4TKZA

Crystal structure of phosphotransferase system component eiia from streptococcus agalactiae
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
130
structure length
130
Chain Sequence
MIKIIIVAHGNFPDGILSSLELIAGHQEYVVGINFIAGMSSNDVRVALQREVIDFKEILVLTDLLGGTPFNVSSALSVEYTDKKIKVLSGLNLSMLMEAVLSRTMFEHVDDLVDKVITSSHEGIVDFSTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein gbs1890
publication title Crystal structure of phosphotransferase system component EIIA from Streptococcus agalactiae
rcsb
source organism Streptococcus agalactiae nem316
molecule tags Transferase
total genus 45
structure length 130
sequence length 130
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.69: Transferred entry: 2.7.1.191, 2.7.1.192, 2.7.1.193, 2.7.1.194, 2.7.1.195,
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 4tkzA00
4TKZA 1PDOA 5IM4F 3IPRA 5T3UA 3GDWA 1VRCA 3BEDA 3CT6A 3CR3C 3GX1A 2JZOA 3MTQA 2JZNA 3LFHA 1VSQA 3B48A
chains in the Genus database with same CATH superfamily
3C8DA 2KS6A 4X91A 2VBFA 2EJVA 4I9FA 2X5NA 3K92A 1IZ9A 2X41A 3LW8A 4ZI7F 1T3GA 2R4UA 1MQAA 4AK9A 4F7DA 5EWLA 4BVFA 1RT9A 1T2CA 3DMGA 1ODFA 4F91B 1NF8A 3AVVA 2I78A 4YJ2F 2OCBA 4HEA1 3FFWA 1KI6B 5ALOA 1H6AA 1J23A 2AZ4A 2NU7B 1JJVA 3LH5A 4Q01A 4TYMA 4D0LB 5AVSA 4OSOA 5JARA 5KYXB 3INYA 3IDFA 3PE4A 2OXEA 1F6BA 4P4UA 3GU3A 2JH9A 4IJUA 1Z17A 4JDPA 1Z18A 2Q1YA 2ZRQA 3EBOA 2GF0A 3KALA 4H3KB 4M83A 1EM6A 4FEGA 3GGPA 1C0EA 3ASUA 4R4JA 4DJTA 5CVTA 4CEIA 4B2LA 2V3VA 4NJOA 1XD2A 2W43A 5TE9A 4RC9A 5IAAA 1TA0A 4JODA 3CRQA 4PYQA 3R75A 1PEYA 1E7SA 4F2PA 2GF2A 4BZXA 4FB5A 3L0YA 2QU7A 3JYHA 3UMRA 2E0IA 4GG1A 4R2IA 3MWYW 1SKMA 2G83A 1X13A 4NEHB 3ZH9B 2ZI3A 3QKSA 4BJ5A 3U3KA 4MV6A 1V5IA 2Q7DA 2B1GA 3TCXB 1EXWA 3WV5A 3M3HA 4J49A 3I0MA 1PHRA 3I01A 2A5FA 3CBGA 3CUWA 3W5JA 2R8PA 1I8TA 4X1OA 5HQ3B 1CJSA 1VPWA 3HVKA 1P0MA 4NNPA 4D3XA 2Z2XA 3KQUA 3CONA 1E94E 1XZNA 2FPRA 2WF6A 4A6EA 2AGVA 1YRBA 2PYDA 3I6BA 4ZQIA 5CGZA 3COPA 2QPAA 1JSRA 3U4MA 1DIAA 2B83A 2X77A 3WK7A 2HCFA 2XSZD 4RTQA 2C31A 3GFGA 1J7KA 3PUXA 2CHEA 2P5TB 3TMYA 3HE3A 3PC7A 4XKJA 3ZX4A 1ONBA 4JJ6A 3UVEA 2V58A 1Q6ZA 4HGYA 4QSHA 4AKEA 4HPXB 3LUFA 4Q1EA 3ETLA 2HK9A 1NVMB 4L4RA 1NWCA 4MA4A 1TF5A 5TT1A 4I4TF 1A8HA 4CEHA 3GGDA 3G85A 2Y68A 3I09A 1RWBA 2GETA 2WWIA 1IHPA 1NJ6A 2G77B 3JR7A 4W8HA 3O8QA 3V2IA 4NENB 5C37A 4LZNA 4XDGA 1XDZA 3EGEA 1L4LA 1NRWA 2ZANA 4KXYA 1U1CA 2Z30A 1ESZA 1KGDA 2ID9A 4ER3A 1JDJA 4R8RA 3VHLB 4HPWA 5EZ5A 2CXSA 5IF3A 1UMKA 1MAVA 1WW2A 3R5SA 2H17A 3H1AA 4JU9A 5C8VA 2H65A 1KC3A 2VPWA 3DAOA 3H2BA 4M88A 5I9MA 4TKLA 3W34A 1EE1A 5ILGA 4ARSA 3Q7QA 4RHXA 2OL4A 3CIFA 2RIRA 4XYBA 4BQOA 4HVLA 5CD9A 5IJZA 1M34E 3A2LA 1JPVA 3QVGB 4AZ0B 2IVFA 1TCAA 3QVLA 3TXAA 4FGWA 5HCUA 4Q4DA 3KQPA 1PN3A 4KWIA 4C87A 2H2AA 3VTKA 3ZGVA 2YHAA 4JA2A 2BLLA 2O3SA 3MS7A 1X9IA 2O2IA 3QYAA 4ZARA 1U28A 4MWDA 3LUAA 2ODQA 4XZ3A 1P60A 4YP0A 3FHJA 3KKZA 4TPKA 4ZA2A 4WT7A 2GCIA 3O47A 5B4UA 4X84A 3R3XA 2ORWA 2DH6A 3CPEA 5ELMA 5FBVB 1R6XA 3DEHA 1QUEA 1E2EA 2PM8A 2KE5A 1J8VA 1PFKA 2ZT8A 1G5RA 2QLMA 3K96A 3Q88A 3W8NA 4EUEA 3EFBA 1VB5A 4D4GA 2D06A 2YBEA 4LYYA 2FF7A 3G2OA 2JI9A 3DLIA 2FMFA 3WICA 4CV2A 3ZK9A 2ES4A 1U6JA 4OQMA 5IASA 1Q3TA 1A9PA 1HZZC 5E6UB 3FVTA 5HGJA 4LF7B 2PMWB 1IYZA 4MPPA 1HA3A 3C8HA 2C78A 4KMMA 3B51X 4KYVA 1G7SA 3LUJA 1H2FA 1KJNA 1N0VC 3LHIA 4EGFA 3QEBZ 1J8YF 1H9AA 2R44A 1QFXA 1IY1A 1F6WA 1UJNA 4P3PA 5KPDA 3K70C 3U44B 5E2IA 4HGQA 4TWZA 5KJEA 3R9XA 1LDMA 2PH7A 4EO7A 3E3MA 2XYRA 3GO4A 5LDHA 1HE1C 1ZW6A 1N8SA 2PH1A 2XEXA 2VEDA 5GONB 3I9JA 4EG3A 4F04A 1VCHA 4JKYA 3VO8A 1SOMA 3DDWA 2RKBA 4MDHA 1A2QA 1AF4A 1W6RA 4INJA 3ZY6A 1E62A 2HA2A 4DV4B 1CCWA 4ZMSA 3R24A 1GA6A 4WD3A 4XDHA 5AT1A 4X1KA 4B17A 4FM9A 4K7JA 4WSOA 5ITVA 2DHEA 3E2PA 1UT6A 2Q46A 4TMKA 3FWYA 4G1VA 1JV2B 2VNIA 3B5EA 3SC6A 2IOQA 2FOIA 4LBWA 1HSOA 2VKQA 4AIRA 4QRHA 2ZIZA 2QTCA 3EK2A 1RTTA 4MVYA 1JEQB 4QHYA 3U3RA 5DRYA 1HH4A 1E3EA 3N8NA 4TLDA 2C5AA 3RU9A 4UDXX 5JD4A 1UP7A 2O8EA 5GAJA 4Y6GB 1FMFA 2OG1A 1P75A 5KHLB 2IP2A 4QTTB 2WKQA 1ZJ5A 3KQMA 1OU4A 1GL9B 3BMNA 3OJWA 1P4SA 4IQGA 3SXJA 3VOAA 4BNYA 1TUBA 3TPZA 4YMTA 1QGED 1QH9A 5IJAA 1PEDA 4BV8A 4N1AA 1DELA 3HJUA 5EWMA 1R7RA 4DAEA 2NIPA 2WZCA 1DC7A 1YVEI 3KHUA 5HOQA 1KP9A 1EIWA 1SC1A 2Q07A 2ZJYA 2XIQA 1G21A 1SIBE 1YU6A 5H81A 5C1PA 4AP6A 5F12A 1SXJC 3WDSA 1IDN1 2EL9A 3TZEA 2PGXA 2J4DA 1IOVA 4OJTA 2E4WA 4HQNA 4BE9A 5KNCH 4Z3DA 3IUMA 4HSGA 2IWHA 4W8GA 1F12A 1ILWA 3ASYA 4HDMB 2WU8A 3PHHA 3OQOA 1YDGA 3CWQA 3MCUA 1SOUA 2YMQA 1L4HA 3KZNA 3JQAD 4IDGA 4OF4A 4Y2PA 4MKXA 3S8YA 3SQXA 1NLUA 4KI0A 1OKKA 1FLNA 3EH1A 4NOKA 4KV7A 3W2IA 4D8TA 2Q4DA 1GXSB 2GZMA 3Q98A 5DX8A 4BXOB 1R6TA 1MRSA 1BDMA 1CYEA 3KKEA 2H06A 3K31A 2C07A 3OIDA 4YRIA 1H4VB 3GNLA 4JT9A 4A1OA 2IH4A 1ISHA 2VUTA 2WSBA 3CMCO 3NBQA 2MSCB 2FWRA 4L4UA 721PA 3NDJA 3RS9A 3AEZA 2O2ZA 4MVJD 4GZ6A 1RI5A 1BQ3A 1L5NA 1Y9ZA 1E2UA 5ALDA 4ZEXA 1CJCA 3CF0A 4JI5B 4D4KA 3UK2A 4U7DA 2X9LA 4J07A 4RQTA 1ULTA 4OI2A 3ETHA 4OK3A 3TNFA 1TGYA 2A78A 2YXLA 4BWYA 3R9WA 3S81A 4HB2A 4FHEA 4L02A 1MO6A 1TNDA 4IYJA 4YRTA 5GADl 2FR1A 1GYRA 4A0FA 4QTZA 4C6RA 1J8MF 1GDDA 4G1MB 5BN3B 1KORA 4WXMA 4TRRA 3AFNA 2FJUA 4UE6A 1JA1A 1HLPA 1XKXA 2DGDA 1DMSA 2W6NA 3SJAA 1MB0A 1NUSA 3CLHA 4FDLA 5EIHA 4IHAA 4A7PA 1A4IA 2PGNA 4K81B 1ZM2A 5KDOA 1HURA 4G4SO 4ZVKA 3JQCA 2G25A 1TUEA 5IK2A 1SKAA 2XDAA 1GL7A 1QHHA 3A3NA 1SD2A 3LC7O 3U7QB 1N7HA 3TB6A 1NUAA 3I6MA 2GN0A 4RK0A 1K9SA 1NLFA 1NJSA 3VU8A 1QHYA 4OYYA 5JRJA 1G21E 1NW6A 3AIKA 3D8HA 2O8NA 1VL2A 4FCWA 1CY6A 1DCMA 1CZHA 1R8XA 1K5DA 1HV8A 2HIGA 2RCYA 4REQB 2W71A 4ETNA 1J9EA 1AUOA 5ALJA 3WHLA 5KYYA 1WVIA 2ZJBA 1KDRA 1XZGA 4S35A 4OQDA 3TSYA 3WB9A 4Z1MD 3IP6A 1KIFA 3I73A 2GBIA 3KFLA 3KXLA 1MXHA 4X45A 2O05A 4JDUA 2BFDA 2BCJQ 2VF5X 3EZGA 5F2EA 2YFYA 1X1SA 5GM1A 4JUDX 2JBAB 3T52A 1QFSA 3MJHA 1BEZA 3LC2O 3VXKA 3WNQA 3QVOA 2CJWB 2DVMA 5TQJA 1L5OA 3ZE9A 2I2CA 3W5AA 2VPYA 1WDKA 1H8ED 4EI7A 1JJFA 1LLQA 5IFKA 2ECKA 1FFXB 3LQRA 1HKUA 5BOSB 4JT4A 4HLCA 4ZDWA 3OQBA 1CS0B 3PR1A 5G4LA 3HL0A 2GLTA 3P0IA 5HKKA 1NNUA 2PMCA 2FU5C 4IDDA 4MCAA 5F3RA 1NQTA 1QGZA 2HK6A 2H4FA 5LQCA 1G55A 3QIVA 1Z0AA 2E4UA 5ER9A 1RYDA 2V7UA 4LAFA 4NG5A 3JCZA 3PT9A 3SF8A 5LQJA 1CY2A 3IRUA 4HTFB 3PUZA 1K92A 2QUBA 4OGLA 3F7OA 4WCFB 4HDOB 4D6YA 4CLOA 4WX2B 1T3ZA 3CWCA 2G5PA 3F7MA 1KO1A 2G4VA 2H4YA 2Q5EA 2KW5A 3KC2A 5HRAA 4NG4A 1HQYE 2B0JA 3I9LA 3LRXA 5FWYA 2AS0A 1L7DA 4HZUB 3FX2A 1ETUA 2G1UA 2TMGA 2GLXA 4RVGA 4DIUA 2FPPA 2RGDA 1B0UA 4TLEA 1T9AA 4X71A 2ACKA 3ZLUA 2HV8A 4DB4A 2O8CB 4MYTA 3HXTA 2PSJA 1ZL0A 4Z99A 2B4TO 2BI7A 2DLNA 4I46A 4ZAZA 1M75A 3P9XA 1OAAA 4KH1A 4N5LA 2A1UA 2VJLA 3ZXIA 3QU2A 1Y98A 3GLFE 4XVRA 4Q3NA 4PVDA 5C1OA 3CT6A 3VAZA 1YOBA 4LJ9A 1V26A 2INGX 2COKA 2J0UB 2YRWA 5BQOA 4CR6A 1G6KA 4ZCQA 4AJKA 2OZVA 3ADBA 4UDYX 5IX8A 3L1VA 3RH0A 5E1BA 2J9FA 2ASEA 5AOCA 4K6GA 3LOPA 1TD1A 4K40A 5JH7B 4ARZB 3SVLA 3OWOA 4RVDA 2Y9MB 3K2BA 1SEVA 5D5QA 5BVHA 3U7RA 2XOEA 4IX9A 4KVZA 1F6DA 3RQSA 4UJ3A 2VDRB 2PJUA 3UMCA 2VSNA 2PRSA 2QLFA 4QWWA 4WECA 1JLLA 3OJCA 5KVQA 3HTXA 1TLTA 1T15A 2A9JA 1UBTS 2UVPB 4RXMA 5C7LO 3OFJA 2JGEA 1M8FA 1U9ZA 3JQ6A 2VOEA 1RACA 3DTTA 5CT5A 4KQHA 5K9ZA 2PKWA 1G17A 4HBGA 1O5IA 1P2TA 3UA3A 2CXPA 4KEAA 2ANCA 1BXKA 1IJEA 2PQ2A 2Q5HA 3VJMA 1RYNA 4JVLA 2GT1A 1GL3A 1Z5NA 2VDJA 1W85A 3IBSA 2UZ1B 2AOTB 4E51A 2P6RA 1IJFA 4IDBA 2Y92A 2OCKA 3K2QA 1QTNA 5D1NA 4IJ6A 1Q7GA 1ULHA 3WMGA 4MLCA 3TINA 5HS4A 2BL4A 4I14A 1KFBB 2IEBA 4EUFA 1A5BB 4EI2A 1YO6A 1D6JA 2XQVA 5LOVB 2F2TA 3GJ0A 1XAIA 2O8BB 3VMFA 3H9QA 1Z5VA 1QFJA 1NN1A 2FXVA 3PSHA 1KI9A 1KZ6A 4FOOA 2ONYA 2XR1A 3AFMA 3OC6A 3L04A 1PQUA 4NCNA 2ZTUA 1NP6A 3AESB 2D5BA 5A4KA 2COUA 5KWVA 3TR5A 2PO5A 3JPWA 1VLZA 1XRNA 3EIWA 1UBLS 4BGDA 3DB2A 1AVTA 1CR0A 2ODTX 2RB4A 4TQ9A 3N58A 4Q9LA 4E5DA 1RAFA 3P0EA 1B6RA 4HGRA 1L4NA 1EDOA 1QORA 2FZCA 2VA8A 3AI2A 4NQRA 5ICSA 3IMKA 1PS8A 4OQEA 2VAWA 3NYQA 4JWTA 5J9FA 1W4ZA 4X90A 4KLNA 5G40A 4F96A 4ZFNA 3CZQA 1M2OA 2NPIA 3V4RA 5LUBA 2AMFA 4XIGS 2B1IA 4DV6B 1TQ4A 3F5MA 2YCLA 5HNKA 4IIJA 2AJTA 1W4LA 4MI3A 5KX5A 3CNOA 5KWSA 4A2WA 4DIBA 4FX2A 1E5LA 3GCXA 4MRRA 3UFXA 3NFYA 5IKMA 4NJMB 4O29A 1ZD3A 3KLOA 1S7CA 5TJHA 1RCFA 3K1AA 4KMRA 2VF2A 4KZPA 1QPBA 2D2EA 1QONA 2VRNA 3H1FA 3KOUA 4YRPA 3DVQX 2JJQA 4RVNA 3VKWA 5K05A 1KKMA 2VHEA 1H2HA 3IBYA 3P71T 1B2LA 2C84A 2ZITA 4H6VA 1JNXX 3MUFA 2YS6A 2PMBA 4IRXA 5K51A 1Z4KA 4ENTA 1KIAA 1REQA 1DGQA 4MUEA 3HXQA 3N7TA 3BOSA 2J3EA 3H7AA 1JU9A 2XXBA 4P81A 2QW8A 3WWDA 3IC5A 1Z45A 3UG7A 3UWMA 1FFYA 4PPGA 5BW8A 3L6EA 3PZBA 1JEOA 5DP1A 1KETA 3VDMA 5K3AA 4XQEA 4YV7A 2G1PA 1JHZA 1GKKA 4GI3A 1Q7EA 4LMBA 4OLFA 2CXQA 4X97A 2JZCA 5CAEB 1DDOA 1UQTA 4YPOA 3AJAA 1ZXXA 1EUZA 1IPEA 2YIMA 5JQGA 1BFUA 3PXDA 3PKJA 1TJNA 5DX1A 5I4KA 5JYEA 3IRVA 3EXIA 3OM9A 1BDJA 4C0QC 3QI2A 1KOGA 4CQLB 3AUTA 4D42A 3BXEA 1FNNA 4HS9A 1NVAA 3SHVA 4DSNA 2D8AA 4KXQA 3K9GA 3LLSA 1MAUA 1W581 4DYVA 3WNVA 3IPAA 4JBGA 3GDHA 2YDYA 3AB7A 1Z37A 2X8WA 2PX5A 1LDYA 2XMZA 4Z51A 1ZOLA 3HABA 2NVOA 4Z4CA 1UZLA 4XUCA 3WI7A 1OJ7A 4GKJB 1J06A 3IDSA 2NUAB 3QG5A 3TUJC 5DP2A 3JQRA 3QBJA 2BFOA 4HX5A 4OYRA 4HYEA 3ZJTA 5JTTA 4QBKA 5AKZA 1WNFA 2J3IA 2VDMB 1T25A 4JQZA 3A04A 2JFBA 5ILQA 2F4VB 2HU8A 4S0XA 4WK2B 1SG0A 5JJ5A 4N49A 1OMOA 5COAA 4TS4A 4ZOAA 5JALA 3DMTA 4ITUA 2C96A 3DUWA 4L9RA 1J4AA 4WASA 3AB3A 2W2VA 2YVUA 3LLUA 4ZDJA 2CV0A 2JD2A 2CGEA 3PNPA 3QA3E 5DHUA 1EA7A 1OILA 1QIIA 2Q49A 1UFQA 3GG2A 1W0JA 2CWWA 2OBYA 2ZZKA 4OBEA 3AKZA 1NRXA 3QLTA 4LOIA 3ZDAA 5CYPA 3Q6IA 1AE1A 1KY5A 3UWDA 4G6ZA 5H70A 2J7KA 5U1PA 4LF6B 3DFKA 5FOTA 4G24A 4K03A 3AR2A 4GGMX 4U39A 5TX7A 3ECSA 4E07A 4WOPA 2B5VA 2W7TA 4WCDA 3TTTA 2H85A 2ZKLA 2XUIA 3BHJA 3I5UA 3ZJYA 5I9LA 1CW2B 3EAFA 3UQYS 5DLPA 2AHOA 5IVPA 1VGRA 3KUCA 1E79A 4QU0A 4HUTA 2E55A 4QLBA 2WNSA 4TLLB 3D4NA 4BEVA 1SXHA 1YB6A 2ZU6A 3FTCA 2HI0A 3OTWA 3VBCA 3IQHX 2H2IA 3IBGA 1E8DA 4E2FA 2RH8A 2AN9A 4GBJA 3F3KA 2ZYTX 4RQBA 1AKRA 3B7PA 5J5AA 5BV8A 3JRXA 2IYWA 3MWJA 2IHJA 2XOKD 3BN3A 3G8CA 4S1OA 4UMEA 4ZPXA 4MKHA 4D57A 5JS7A 5FBKA 4MJ3A 3SQOA 3TGPA 4JOCA 5EIBC 4Z0TA 4CM8B 3DV0A 2R11A 10MHA 2PAFA 3D3KA 3HI6A 4PFKA 1FJ2A 3W1WA 5AHWA 4B6FA 3TFOA 1JMYA 1ZKMA 3H9UA 2J6CA 4HY3A 1WZCA 1NI5A 4YO8A 3AR9A 3T0IA 3WGUA 1H2WA 4WMLA 1SULA 4X7BA 1W93A 4LFAB 1PQWA 2WAAA 5ALLA 1O08A 5FQNA 1ABFA 3FJYA 1HZJA 1K8RA 4G5XA 3SKVA 2C4VA 4C3ZA 4YI5A 4DCJA 3WRVA 3IEMA 1Z4PX 3A36A 1TZCA 3EIOA 4KE7A 4XIIA 5IXJA 1LCIA 1Z3CA 3CNQS 2XBMA 4Q6BA 1J2RA 3RANA 3LBIA 2ODNA 3QFRA 4NE9A 2HQBA 3KFXA 1H69A 1UJ4A 3NWEA 3VSEA 5ICEA 3KG2A 1IPHA 1KJZA 2OZPA 1SVOA 4R2LA 1CEYA 3NALA 4I50B 2Z3WA 3MINB 1YZUA 1OQAA 3OAAA 1U7PA 3S99A 1YBFA 4RAOA 1HDRA 5T4BA 1XKLA 1MBZA 1TT7A 2WTXA 4RPGA 1EFVB 1FXSA 2AX3A 2VQDA 3NT2A 5EAIA 4BO9A 5LM3A 2I29A 3SFVA 2XF8A 5H3LA 5LQUA 3GIWA 4JJZA 1A9OA 2HR1A 1XSEA 4UMDA 4MP8A 4TTQA 3L9XA 2LCIA 5KU7A 2IDJA 4B2YA 1ZUD1 3HVHA 2WF9A 3BX1A 4PXYA 3RF7A 5DT9A 4C5BA 3AR4A 5HFAA 1VBNA 5GM2A 1DRUA 4RHFA 1K89A 1GNRA 4V0LA 3A3OA 1C8KA 2DU8A 1UKYA 2OBMA 2ZUTA 3MT9A 5KSWB 1WCIB 2XMQA 5JDIA 1TM3E 1UKAA 1ZH6A 2GCOB 1MX5A 1GTMA 2RHHA 2VPIA 3NBFA 1ISFA 3ORYA 3AUSA 1L4KA 2QYSA 2VK8A 2PJDA 4O2LA 1Z4OA 1MB4A 4EJ2A 4BBAA 4DBVO 2GM4A 1KJQA 2BGKA 4RTPA 1YIDA 2QZSA 1BWQA 3HACA 3V8MA 3GLRA 4RO0A 5JSYA 1D8TA 3HZOA 3PQCA 3RREA 4O4HF 4YPVA 2CK3D 4KKXB 2WLTA 4L0QA 2XHZA 5DM4A 3L02A 1NVFA 3HP7A 4PRLA 1GEEA 5DW0A 2IIBA 1E8NA 4IY1A 4EDFA 2XNDD 4NEQA 4KDRA 3DNMA 3ULKA 4FNAA 4UE2A 3AERA 5LNK6 1A77A 5E1MA 3V9PA 1DJOA 1UXJA 2WFLA 1JKJA 4BFXA 5K3FB 1M7HA 4U0KA 3ANMA 1Y1KE 3WE7A 2ZW9A 3O8LA 1ZHOA 1NHWA 3R9IA 2EARA 3TQCA 5ELXA 5TEWA 1QQ7A 3I9V6 1IB0A 4KREA 2FRVA 3I53A 4ZVOA 3TG8A 2XWQA 2J6IA 4Z2YA 1GVHA 1XDDA 3CZ9A 2QKYA 3HSSA 2FEAA 1CUFA 4OMFG 3TTUA 3DTVB 3VH1A 3G5MA 2ONJA 4LNAA 1DC8A 2WF7A 3B2NA 2PX0A 3ZD7A 2OPBA 4FCCA 1G8GA 3A9SA 3CV3A 5GP1A 4G4SP 2IK8A 1AZTA 2PPVA 2QVZX 2ZJ2A 3IMCA 3L8FA 3QFHA 4DNXA 1PK7A 4CMHA 3PZRA 3H13A 3IIEA 4R1QA 4JXXA 1K6MA 3RKSA 3PR2B 1WSDA 2GEJA 3G82C 4KACA 3U3OA 3QBDA 2J4CA 5EP2A 4RY0A 3ZWMA 4B6JA 3MA0A 3P9SA 4NZPA 4U3JA 4GI7A 4BASA 3GEEA 4E09A 1FMTA 1YT5A 1LQUA 2A14A 5DBIA 1BCSA 1PIWA 5J4YA 1LVGA 2IHNA 3TH5A 4FEEA 1EUDA 5TMDA 2YDXA 3R09A 1CHDA 3QJ5A 1KFEB 2V6FA 1G42A 4XR4A 7AT1A 1DBVO 3IQZA 3G1UA 1XZFA 4XWYA 3W5VA 2Q3FA 2C4MA 1KP3A 2CDNA 1VE3A 1ZN9A 2Q0XA 1R6AA 1P5FA 5HX7A 1IN6A 1I3OA 5BPFA 4ENRA 5EMKA 1N0WA 4IVPA 3VU0A 3W06A 1A9TA 4OGGA 4FLEA 4D9FA 1GNVA 3L79A 2X2FA 1SKBA 4JWKA 4AYWA 4EY3A 3T3PB 3TLEA 3AVXA 1L4EA 2Z04A 3MWDB 4Q21A 3PVSA 1GTSA 1Q0ZA 1UC8A 3L0ZA 1U3WA 3G9UA 4HDRA 4KQXA 2BAGA 3DXZA 1TW2A 2IHTA 2X22A 1Q2UA 3D3WA 4PLFA 2R65A 4M7OA 2W2KB 1KVQA 4LYJA 2W70A 1FFEA 1XVUA 3MC1A 1Z7EA 1I1QB 1U2EA 3A4NA 4KVGA 1UBMS 2W5UA 4P80A 1Q11A 4RS3A 4TYQA 5J59A 1LS6A 4QXAA 2FWAA 1U98A 3QXCA 4D25A 3RR2A 2EL7A 3HYNA 4LJ7A 4AG6A 1FYVA 4UCXA 1FFWA 2ZZMA 1GVNB 1GYQA 1HTBA 1M6WA 3KTAB 2RC6A 4RMHA 1L5KA 3MJDA 3ILVA 4HLNA 1AKVA 2ETVA 3CLKA 1JIIA 2VYFA 3S1AB 4AUMA 2A0WA 4R01A 4E1VA 1XMQB 2C82A 3GYBA 1DQSA 1VKRA 4NPHA 3BVPA 3DL0A 3O7WA 1EA5A 1IN7A 1JEAA 4JJKA 4LTMA 4UU1A 5ENZA 2EDAA 3AV3A 3ETJA 3DBLA 3NBZC 1HT0A 3SXPA 4FMCF 2QX8A 5AVWA 1QB8A 5BP7A 2X4GA 2XMDA 5BMVF 1C7EA 4Y2JA 3L8YA 2NGRA 4OXNA 5DRTA 1CRLA 5A62A 2KM1A 1ZD1A 3SQWA 4L2IB 2CC2A 1B8UA 4O2BB 2G28A 4UHKA 4FFLA 4KQFA 3ISJA 5KTMA 1AO0A 1WXXA 1YJXA 4B3XA 4KAJA 4G0YA 4C5CA 3G13A 3A1NA 1HQDA 4RFSB 1P0PA 4N9WA 1JBEA 3Q6NA 2HU7A 4BMSA 1DQYA 4OKSA 4P3NA 3OOWA 1O3YA 2B2XA 2PNFA 3GFTA 2GEVA 3FFXA 3WGIA 5CT6A 1WSAA 4BUJA 4CM7A 4W6ZA 2XA2A 3DDNA 1TZJA 2JHFA 4ZQCB 3PHJA 2BW0A 4MOWA 4K9MA 2C2WA 1EB8A 1CE8B 1LFDB 1QO9A 1CUWA 2A88A 2CZCA 4M8NE 4E2YA 3QXXA 4IIJF 1U7ZA 1KO7A 2OHVA 3RS0A 3IA2A 1B6TA 5I4IA 4Z9BA 2VJNA 5THKA 5KX5F 2NAFA 4DJFC 3TLYA 4J3NA 1GP2A 1UK6A 4OP2A 1C7FA 2NTYC 1FP4B 4O63O 5CB0A 5C31A 4YRLA 5JPIA 3BHNA 3LO5A 3X1MA 2A2ZA 3HVUA 5BN5A 2I87A 5F5NA 1D2NA 4U0JA 4KAXA 1KERA 2W6OA 1RWQA 1R15A 2R6ZA 2WUGA 3P2KA 1M2KA 2WZDA 2VYQA 1T3LA 1XNJA 2WU0A 3QHQA 4K8RB 3RABA 3CZMA 4HUQA 4EEXA 2BLNA 4UHJA 1KK1A 1UBGA 1ZEJA 1LBIA 2IEGA 2RHOA 1T5OA 4QJBA 3GT0A 1EZ4A 3KCNA 1OC4A 3MK31 5FLEX 4CLRB 1IZ0A 5BSEA 5GINE 4CKBA 1CVLA 2GX6A 3EOBI 1BU8A 3U9TA 2AFIE 3PQ2A 1DUSA 2PMEA 1M6VB 4INOA 4RD2A 1E1QD 2BT4A 1E20A 2XKJE 3TEFA 5IKXA 6GPBA 2A5GA 1K7FB 2QD1A 3OLZA 3EF3A 3LC0A 3SC4A 1JIJA 1FTWA 1Q0UA 2IJGX 3BBPA 3QVJA 1C81A 4TXLA 3L7OA 2GNPA 2IFTA 2I8CA 2Y0PA 3I4FA 4QGBA 3RUEA 5I6DA 4RH3A 4WLOA 4D8WA 5JFTA 4GKBA 3QU5A 1NN5A 4OI1A 4PY2A 4NZ9A 1X39A 1CG6A 1P3DA 3AVUA 3U3DA 1UWCA 1BFKA 3HMQA 1G66A 3K0CC 3NG1A 4IV8A 5CVCA 3UO8B 4HEJA 4Q39A 1D6SA 1UBJS 4TTRA 2BCGY 2CVFA 2HAEA 2HDWA 2XMGA 1GGMA 2WIKA 1GSIA 4E1BA 2C2OA 1C29B 3GJ3A 3IO5A 1ZOOA 4WXHA 4UCFA 2Z5GA 2OGUA 5AXDA 2HN9A 2JJ1D 3QX8A 4AN0A 3WP0A 3GLGB 5FFFA 4IIBA 4MVCA 2IYFA 3RYHB 2XE4A 3FB4A 1JPUA 4YONB 4LE0A 6ADHA 1SUEA 4IMIB 3H8VA 3CRZA 3ZU6A 3A1FA 2D1QA 2OB2A 1I9GA 2X76A 4RY9A 1OX6A 5EYPA 1LBEA 3DD5A 1X8KA 4U1RA 1HYEA 2Y4NA 4ABTA 2IYPA 3L84A 1F7VA 4HB3A 1AUVA 4TT3D 1ZP6A 2EF0A 4M9UA 3NRJA 1DXHA 5EUMA 5EZYB 2JCSA 3D4PA 1P1JA 5CM8B 3ELWA 2BEKA 2O23A 2PBFA 3JQGA 1IWBB 4NY1A 4AY6A 5FLYA 4U7HA 1DV2A 3OA0A 4ASUA 4Q3BA 4UFNA 4I1OA 4N6GA 2HCTA 3BKXA 2HZBA 4QUJA 3C1TA 5L7WA 1IFXA 3MQ2A 4C1BA 5A04A 3G88A 1OTXA 3H05A 3KEFA 2ZB2A 1CNEA 3KVNA 2B21A 3GZJA 4DR3B 1MV8A 1NYLA 1Z88A 2R6GA 2CFTA 4G0ZA 2YIDA 4I5GA 1CRWG 4MH0R 4ALIA 3OT5A 2QD2A 3MTIA 4EP1A 4OHFA 3DAYA 3EPLA 1XPOA 4EY5A 1T4CB 1O0CA 2WPDA 1XCGB 3WWOA 2DPLA 4E2WA 4EEZA 1EBBA 2H6EA 2IY9A 3HCRA 2JGDB 2GN2A 4DRYA 4BAGA 1NOKA 1Z13A 5TGZA 4EHNA 2PL3A 4DMCA 1EP3B 2X0KA 4EYGA 2WQ7A 4NFSA 3EXFB 2HUNA 2EDCA 3C3BA 4P35A 2OK8A 4PZEA 1PP4A 3VR4A 4B79A 5KNBA 5KYWB 3KSUA 1F2TA 4WZBA 3L8DA 3M89A 4K0RA 4XEHA 2YHSA 2EJCA 2Q6KA 3G59A 4J1TA 3E8SA 2WKWA 2BKEA 3QJYA 3OZIA 1KAHA 5G0UA 1W25A 3ZNQA 4DA9A 3TAUA 2HADA 3U7HB 2HMTA 2W58A 4R0NA 1EFRA 4UBNA 4AKSA 4JLDA 1KZ1A 2I3ZA 4HPJB 2VS1A 1L5YA 3OQIB 2J1LA 1XZPA 4CGYA 1Y5LA 4UQLA 2HNAA 5CLIA 3SEQA 4OQPA 4U7TB 4NS1A 2D2VA 5EXPA 3GEMA 5DWDA 1PKXA 4G65A 5F9HA 3QLUC 5T6BA 1FDTA 4NZOA 4BZZA 1Z6PA 5EHIA 3HJTA 1UP6A 3D5EA 3UQZA 5FOVA 4Q4JB 4F4FA 4XVCA 3H99A 4WH0A 3L40A 2ZYHA 3T7SA 2KB0A 5ED0A 4ZO4A 4R0VA 1NIJA 2QQFA 2WWTA 4L08A 3K9WA 2DUMA 1YKFA 3UGQA 2RCNA 2Q8NA 4C03A 4MPTA 4DIDA 4YP5A 5I5EA 2V7QD 1AO3A 1M2NA 4AFNA 5EIOA 2O57A 1KI6A 3R7SA 4DUGA 1Z6QA 2QM0A 3OX4A 4RZ3A 3EZYA 3REOA 2QL9A 2P90A 4EI8A 5KYXA 5AVRA 2G09A 2YV5A 4K6CA 3FNFA 1VHJA 4IIXA 1T8SA 2VQFB 1ZXLA 3IAHA 3T38A 4D43A 1DBWA 1FF9A 4C0XA 2Z2IA 4AF7A 1O57A 4U7GA 3ZE2B 3BC1A 1SXQA 3OY7A 5AKEA 1KDOA 4Q16A 3PE3A 1XQ9A 3F73A 2HQOA 2R7MA 2ERXA 3WQHA 1QVWA 1PX2A 3DMHA 1UXKA 3U3JA 1EGMB 3CF2A 2JL1A 3AXTA 3IXMA 3JSAA 1YR2A 2AK2A 3OICA 3X0DA 1XL1A 3MLAA 2OT3B 5ALRA 5THXA 3EVNA 4HQKA 2II6A 3BA1A 4HRXA 3UGTA 1E9CA 4Y1FA 2EP8A 2Y1WA 1UADA 1GITA 5BSMA 4X20B 1LVUA 4WA8A 1ONSA 5H3CA 3GVCA 1E6UA 4MLZA 4NU5A 4JB8A 3C98A 3WV4A 4WZBE 4FFSA 3NYRA 1EE2A 1G5QA 3JV7A 2D3WA 2ZSDA 2XT6A 4G2NA 4ZQBA 4PFQA 1B43A 1B6SA 1IQ0A 1OI3A 4WXEA 1NV9A 1DEAA 1DNPA 4F97A 1FW6A 2F3TA 4JGBA 1LK7A 4JI0B 3BXXA 1L2TA 1HTTA 3COWA 4NYMR 3FVRA 5A5DA 3AJ8A 5I7OA 4HWKA 1GT91 2PKXA 3WWYA 3MMZA 2OCGA 3D5QA 3QUCA 2CNOA 4ZU6X 4ACAA 2GPBA 3K6KA 3I05A 4LZJA 2KPOA 2QTHA 4O0LA 4XB6B 5B6PA 4QFBA 1LRKA 1E32A 3ANXA 4GAEA 3EQZA 4ER0A 4F8JA 3JYQA 1NF2A 1S02A 3LLMA 2OPHA 5K8JB 5KNDA 3NFRA 2CBGA 1E6CA 4GI2A 2P78A 2BSQA 1N2EA 1IQUA 3AIIA 2V8BA 2FSFA 3WYBA 5CD1A 3I72A 2BFPA 5J1TB 4D02A 2B4YA 3OZWA 2WI8A 1L4MA 1CIJA 2ZP1A 2PD3A 4DXAA 1DC5A 2IUYA 2IW1A 2F1OA 2C5LA 3GJ5A 3MJTA 1XZJA 3DAFA 4NENA 4NYMQ 1N33B 4C7BA 1JNYA 1EJBA 4BCCA 3A6DA 3KB8A 3T5AA 3EUAA 2WSSA 4NYJQ 3E81A 1OH8A 4F3RA 3WNDA 4J3JA 3BSYA 1WEKA 4YYEA 2IRWA 4CW7A 3D02A 4OJKA 3E9ZA 3LCJA 3TLZA 1NPYA 1R4ZA 1U1IA 3SYTA 3RDPA 3E18A 1Q0HA 3FMGA 4RX1A 3R44A 4CM1A 4R8MA 2I4RA 5KKCA 4L5CA 3QVGA 4AZ0A 5D6OA 1PJZA 3VNQA 3HGMA 3B89A 3IAM1 4ZZ3A 4BJHB 5AM1A 1F5SA 4JT8A 2OGWA 1UT8A 1EHCA 2OVFA 4IFTA 4MQEB 5CBPB 5KVSA 2P9YA 3HBAA 2LUOA 2CDBA 3GJRA 4OU4A 2KBEA 3UXMA 1N7JA 2SKDA 3GJQA 1ZJWA 1GQQA 1KPHA 4MJLA 3H4TA 4S05A 2GXUA 3EFOA 3EPRA 4XVUA 4UARA 1PJAA 1T6ZA 2I65A 1AG9A 1HYGA 4IH4A 2G40A 8ADHA 2BBSA 1Q95A 2FZKA 7MDHA 1NT4A 1MAAA 1CUBA 1E2PA 2KX7A 2V9ZA 5JMPA 1X14A 1NBEA 5DDIP 1UPAA 1PNOA 3DZHA 4JC4A 2YUTA 4AAYA 4C0LA 1CF4A 1XTVA 1Z4LA 2VAMA 2W2LD 4GPAA 1U0BB 3MJSA 5IHPA 2HJHA 5E6UA 3RVJA 3U4CA 4KWCA 4LHWA 1BQEA 2ISSD 4JZYA 1PWXA 3VVCA 2H08A 3AGQA 4G4IA 2LKCA 2QR3A 3AV0B 4G56A 5IS2A 3ZPXA 2YIJA 3P4XA 4EGAA 4LJAA 3QOYA 4YMUA 3U44A 1QIKA 1JHVA 5E6SB 5B1SA 3EW9A 3ZDDA 1RWVA 4B3BA 4C7VA 1C30B 5G41A 2AKYA 5IPFA 3HLKA 3IAXA 4BQIA 3KXDA 1VYTA 5GONA 5K0CA 4ARCA 3N0XA 4V0SA 3WK8A 5CYGA 2CCJA 4QDXA 5F52A 1OV4A 2J41A 3F97A 3N7UA 5F4BA 1WR8A 3PPXA 5KEIA 2FN3A 1QB7A 2ZYUX 3GFQA 3THYB 3BJZA 3I2KA 3KJFA 2ZVJA 3BQ9A 3S2ZA 1T6YA 1F2DA 1U5CA 2G71A 4JL5A 4RENA 1IHXA 1SUIA 5H80A 3MGAA 4WQMA 2DQ4A 2NO5A 2QTLA 2LXNA 3MCVA 4ZOEA 4LJ5A 3GLQA 4Q47A 1M54A 4H1UA 1LPSA 4QVKA 4EUKA 2DHCA 3PFCA 1JEQA 2Q3HA 1GA4A 4ZREA 2K87A 2G8LA 4PM4A 3U19A 2B92A 1QWOA 4ARAA 3CRVA 3IKLA 4U7FA 2BMEA 1GUFA 4GKAA 5D7BA 2OK7A 4DHEA 5B53A 5HZMA 1J90A 4DMRA 2Q1UA 1AMNA 1N2JA 1SQ5A 2XYPA 3MJFA 2YWJA 2UUBB 1WDWB 3FGNA 4OXKA 2QRQA 3QVKA 1DI0A 1GU7A 1P18A 4NCXA 4S1TA 1CSEE 1EK6A 1KYTA 3K0SA 3KNZA 2AZTA 4J7CA 1XCMA 4LI0A 2ZUCA 4PGFA 2C3UA 1UKEA 4DR2B 1CP3A 1X87A 4X6UA 1OWLA 2CLSA 2AHRA 4JN6B 3FCEA 4PXAA 4B34A 3V46A 1Z8NA 1RE0A 1SIOA 3RYCB 1OROA 4KXNA 4C4PA 3TQQA 2H5LA 1P1IA 5B3AA 5TY0A 1DG9A 1X8XA 4TVKA 2BKUA 3O0DA 4IZOA 1PLKA 3P97A 4Q82A 3C3JA 1XYYA 2H1IA 2KYRA 3LBFA 3PUHA 3N28A 4FB4A 1JB9A 2JFOA 5K4AA 4PYNA 5HR5A 4BATA 4W9MC 3AZPA 2AXNA 1NF9A 4OBWA 1GQRA 4M6WB 3PXUA 1FE8A 2FWBA 1AHPA 1ZNXA 1Z07A 1G7RA 4O1MA 3L1HA 4D74A 4DMFA 4DVGA 1ULUA 2RGGA 4EB6B 4UXJA 3IILA 4M99A 3BE5A 2NPFA 4J2TA 2QMUA 2CVZA 1GXSA 4K9PA 4BXOA 4MW1A 4LTNA 4NRDA 3NTVA 4Q4AB 1RYBA 2XNJA 3EGXB 2V0CA 1WUYA 3O0TA 3CA8A 3Q7EA 2UXDB 4QBHA 4DR4B 4DDTA 1ZS9A 2V65A 3NHSA 4HB0A 4NZNA 4NMLA 4RFLA 3SYRA 4N3BA 5JS2A 4EF6A 5FA5A 3BMQA 5J4VA 3BYZA 4FJ0A 3U4HA 2XCQA 2H1HA 1U94A 3NAMA 4F1KA 4E5KA 2VUHB 1UBOS 3KUXA 1X80B 3QVMA 1YK0A 1R2QA 5FKJA 3TKAA 3VH4A 4GL4A 3OH8A 1B00A 1OXBB 1AU9A 2WE8A 1WZ2A 1X9HA 5BSUA 4C30A 4YAIA 3KKPA 4GPZA 3GH1A 3U80A 4RDXA 1CQIB 2QM7A 4OX9Y 1N5OX 2X8AA 3H4MA 5BN3A 1XEWX 1EX9A 3T54A 1MZVA 4KVAA 1ETHA 3VR5A 4BP9A 3UPTA 1XRMA 3CVWA 4YO7A 1Z63A 1WDLA 1FRVA 1Z0ZA 3KQWA 1XTRA 3T6KA 4RTKA 3AWIA 4F86A 3B5JA 1NJ1A 3FMOB 2YN4A 4KRFA 1NF3A 3MRSA 4OU5A 4O5OA 1E2MA 1FYEA 2R97A 2WNIA 2IE0A 5KNCD 5K0FA 4R2JA 4YQEA 1KEUA 4LE1A 1E1RD 3CE9A 1O95A 2AOWA 3WG9A 1RLUA 1ECBA 1A2OA 5C4MA 5JSHA 3CEMA 1DCTA 1A96A 3NCTA 5K3EA 3LP5A 1Z4JA 3PB3A 3I45A 1JG2A 1WM1A 4REQA 1G8AA 3O1IC 4WJKB 4QHSA 4AWAA 3IJEB 1WMAA 4YV0A 1E4VA 1VXRA 5CK4A 3SEZA 4EL5A 3SQDA 1F60A 1HLDA 4P7BA 5KINB 2TYSB 1WXWA 3NRCA 3NP9A 5J2UB 5TB5A 2XRZA 1U90A 1ZBDA 3UATA 1DOHA 3Q3CA 1PJSA 1SU8A 2QN6A 5E0OA 5A3VA 4R7GA 2DBYA 2W90A 3HADA 3P9RA 4MHOA 2GK4A 4NBTA 4RQAA 5MHTA 1DBPA 2D0PB 4N0QA 4PSAA 4EK9A 1XI2A 2XPCA 4WZZA 5CLLA 5AW0A 2JBAA 1U2SA 3OEHD 4P33A 4RD0A 1CBUA 1UBFA 2YWGA 1ADJA 4DE5A 2CJWA 1GGFA 3BF8A 5LCXA 1SG6A 2C2XA 3HUFA 1FFXA 2CNWA 2EVWX 5FOQA 4YR9A 1EVZA 2ZM5A 1QIFA 1CFZA 2BDEA 3Q9UA 3PHBE 1ZN2A 5BOSA 3C6BA 1CS0A 5DPMA 3VPGA 1THGA 2GS9A 3L06A 1N1MA 4M49A 2OKCA 3SC2B 4A23A 2VTBA 1ZGCA 2EZ8A 4PBSA 4RV5A 4TKVB 2NNWB 4D79A 2W6MA 4RXUA 1UXGA 3D6AA 3CLUD 3TDKA 3WXBA 1PZGA 3DO5A 1F9AA 5B55A 4HTFA 1SD5A 2C1EA 4RVSA 3W2TA 4FBGA 4WESB 1TKCA 1HWYA 2ODAA 4WCFA 4WWHA 3PCTA 2E1RA 2FI1A 1EWTA 4ZIRB 3FIUA 4EPRA 4HN9A 1O8BA 3BXOA 2FDRA 2J87A 4XOIA 1KS9A 4UCQA 2E4AA 4FZRA 4IJWA 3A31A 1XF9A 2GJ4A 2YY5A 3AI1A 1M6NA 4K6MA 3U4GA 5ICCA 4HZUA 2O8FB 2JDIA 4EELA 1H1DA 4MCIA 2XZDA 2HQRA 4CM9A 1GM5A 3OU2A 3STHA 1QHIA 3ESYA 3VX4A 1J0AA 1TE2A 2RHJA 1DFIA 5K8LA 5ALFA 4F5DA 1L7EA 3DVSX 1K27A 4RUKA 4NULA 3T7JA 1NMQA 3U7JA 3RIXA 3T9EA 2NP6A 2LPMA 4DBLC 1RJ9B 3V9AA 1P2GA 4E3ZA 4AUEA 4RMGA 4NECA 1O58A 2C9OA 3KQNA 2FG6C 3A6JA 2OORA 5D6NA 2O2HA 3K5HA 2KJQA 4C4OA 2CL5A 2LDBA 2J0UA 4L5BA 5FUWA 1OH6A 4ZVLA 2D7DA 4NBNA 1TOAA 4C88A 4RZXA 3T12A 5IDQA 1ZMXA 3CKLA 3E3LA 2WWGA 3M34A 2P4SA 3FFAA 1U0EA 1WUKS 2JCVA 2QUKA 3O82A 4B75A 1CJVC 1G8HA 4IDHA 2FEOA 3K7EA 4ARZA 4XM1A 3F46A 3JZDA 4H31A 3UMGA 4OHCA 4BMVA 3PIIA 4JBIA 1K5PA 2IKQA 3PDWA 4XWGA 3RUFA 5JS6A 1ZG3A 1T26A 2IGBA 3H4IA 4J3FA 2XYVA 4N8SA 2BJVA 4RE5A 5TR9A 3AG5A 1UZUA 2GUWA 3WLFA 3QTTA 3UJ3X 3KTDA 4E21A 3IPRA 3UOWA 5DCUA 1YFLA 1V37A 3TPCA 3KYDB 3SG0A 2UVPA 3ZD6A 2VRWA 1F8UA 1FDOA 3QA9A 3OQHA 1XV5A 1A88A 1YHYA 3HDVA 2OV4A 4MRVA 2NU9B 1JG1A 4QA9A 4L0MA 1BKSB 1USUA 1MG0A 4LHSA 4R7ZA 3TCKA 2E4YA 1WXQA 2C4NA 3OA2A 2FMIA 1B3RA 2WDZA 2QZZA 5G4KB 1BWRA 2NSHA 3E9RA 4AF8A 2UZ1A 2AOTA 3D2CA 4QUKA 5CHEA 1YE3A 4YJHA 4BKMA 2N1MA 3L41A 5E7JA 1L1FA 2VYND 2J9GA 2P27A 4B87A 1IXSB 2AR7A 3ILYA 1NRJB 5CBKA 1KC1A 4MUNA 3OG9A 3GH3A 3EW7A 3OMWA 1XA0A 5K6TA 3PYXA 1P81A 4GICA 4L15A 3EISA 3RUAA 3UIEA 2DBVO 3RVLA 3QE9Y 3W4IA 4KG7A 3EAQA 4ZAYA 3QKIA 5C8YA 3B1ZA 1L1QA 4KB5A 3OCUA 2IHYA 4J7XA 3N86A 3EGIA 2ID4A 5EZSA 1VZ2A 1ZVKA 3AESA 3CX7A 3UHFA 4JNKA 1XN4A 4YWHA 3I6IA 1G291 4RORA 2YVQA 3JZIA 1JJ7A 1T5DX 4ZTZB 1RM5A 4I3FA 3FG9A 2I6FA 5C46F 1OREA 5B3JA 4D9GA 1ZZGA 5DEOA 1J0XO 2XQKA 4G0MA 3DYVA 3WHKA 3WGTA 4P38A 3TLMA 2N75A 2VC2B 3KEQA 3W05A 4OFWA 2J9RA 2QL6A 3RFXA 1XMJA 2AT1A 1LWNA 3IV7A 1RJEA 3HP4A 4XQCA 2LZ0A 1A2BA 1T4GA 4EAQA 3KU4A 2AKEA 4CIXA 2UUAB 4FZJA 1V8DA 2EF1A 2B5OA 4U2DA 2QJRA 5DHSA 3JASB 2N42A 3BRWD 5IBPA 3GHHA 4MQFB 1MJNA 5AHXA 3GFPA 2OWDA 1Z29A 4BNNA 4OH7A 5DW3A 5ECDA 3T7EA 3RKRA 3RS5A 3LFHA 3WRXC 1OTYA 1IE3A 3D9QX 3NBAA 4QASA 3RC1A 2H59A 2JJ2A 2NXWA 1S2GA 2PS1A 2WYVA 1R9NA 2PTHA 3OE7D 5A9SA 3DC7A 2QNIA 3QOXA 4W9RA 3T06B 5LMCA 4ZDKA 2DECA 2YWRA 1XWWA 3QE3A 4IILA 4L27A 4DW8A 1PWEA 2MDTA 3GJ6A 1DP4A 4I6JA 4EZIA 1E1NA 3E8XA 2NYUA 2IIPA 1YGYA 3KWLA 3Q9LA 2P79A 3RSLA 4ALMA 4QM7A 2GJSA 4EKEA 2F1IA 4PAQA 5GIOE 2DLDA 2WWXA 1ADYA 2OBBA 3HU3A 1E63A 4CCYA 4CKXA 4U2GA 2GCNA 2NO1A 2YJGA 3LDFA 2VL7A 2XLBA 3P5SA 4FYPA 1J70A 2NX2A 2Y3IA 3KQOA 1FNSA 3P4YA 4NMXB 4XD7A 1L5LA 4ZXFA 1QAOA 2NVBA 1INLA 2OXCA 3WYAA 2F3SA 4R31A 4C04A 1SA0B 2GAAA 2JFUA 4XGIA 4DN6A 1A9QA 2HD4A 2LIVA 2VZ0A 4KR2A 3AHDA 5A3QA 2YOGA 2RAUA 4WL0A 3LUDA 2E4VA 4DCOA 4HNAB 2HO4A 1AXRA 4CQLA 3VU9B 2APJA 5ER6A 1TRKA 3JTEA 1WE2A 1YB4A 1TT5A 2HA4A 4MWTA 1Q5PA 2VK2A 1MUUA 1E18A 2X42A 3PI7A 3PUWA 4QELA 5GONF 5HILA 3MIIA 5BPHA 5DTJA 2B7CA 4MULA 2JI8A 1U8XX 2O7QA 3HSKA 5FTJA 2XZLA 3WMEA 3IEUA 2SICE 5LP6C 2I34A 2VUIB 1ZZEA 5F2NA 5IUNC 4QX6A 5LXTB 4L74A 1PR3A 2NUAA 4Z7JA 5LJLA 5AKGA 4JJAA 1EE9A 1T9GR 1KO5A 1G0NA 2YJZA 3KFVA 1PTJC 1BE1A 1DIBA 2PS0A 2PT7A 5CT9A 1VKJA 2Q29A 3M9XA 5E2AA 1GDTA 2FZLA 1DAFA 3DAPA 4FR2A 4IMRA 5B3LA 3MPOA 5CDYA 3FDJA 3FF4A 5EJ7A 1ODCA 4JI3B 2YYAA 3HU5A 4U7JA 1GGKA 1ZSYA 5FPTA 3JVDA 2EW8A 4EX7A 1VKNA 4J9UE 3UANA 4B3IA 4Q15A 1E92A 2C9YA 1V7CA 1F3OA 1NR1A 3OPVA 1AX9A 1E58A 3T5CA 3I32A 1II0A 2EKQA 4GYKA 1NVKA 4PZDA 2Z6VA 5C4GB 1TEVA 4Z49A 1J00A 1GJRA 4EW1A 4DLAA 5B2ZA 4NAHA 1UMBB 2FXIA 3ZE1B 1XTPA 3JS5A 3NIBA 2BMDA 1X15A 4OXYA 1N5IA 2OHXA 4PX2A 3V3KA 1M0EA 3OQVA 3HY4A 2QZPA 2W2TA 4ETIA 4C08A 5J23A 2A5JA 2BISA 4MMYB 2OV3A 2PRZA 2XQFA 4JLSA 3S5UA 4MV3A 3FPGA 1X1TA 1N78A 1P1BA 4G0WA 4PNHA 1BOOA 2O1SA 3FYCA 1I24A 1Q91A 3HDQA 4AXBA 4MQ6A 4B6OA 1U3TA 4OQXA 3TAHA 2XTAA 1IXRC 1ZNQO 2JGLA 3GNSA 1RRVA 2P11A 5FPYA 3V8BA 4OB8A 3D8RA 4IIDA 1MVNA 1NLZA 3ND7A 2WABA 5CYOA 2LR0A 3Q7SA 1JILA 2RGCA 3K1ZA 3KPVA 3KAJA 4RCVA 4CM8A 4H3VA 4F9GA 1V3UA 2AJBA 4TZKA 2NSYA 1QKIA 2Q0HA 2GB4A 2SKCA 3D6MA 4PEVA 4WBSA 3W4KA 1YJQA 5PNTA 1B0ZA 2FJPA 2Y6VA 1IOZA 4WA7A 1EBFA 4EECA 3UT5A 5DT2A 2H1WA 5AWFC 3P2IA 1RXIA 3EC1A 1Y1LA 2O20A 3FPFA 4IYRA 1EXNA 3L5OA 4RSGA 1JE0A 2VHJA 4UJ5A 5EHGA 1S8OA 1NTRA 3DVLA 4AW9A 3F6RA 3DE3X 4GMDA 2NAPA 4GVXA 3JWPA 1GRNA 4RIHA 4DAOA 1X8LA 3W5BA 1N2SA 2QBYB 1SAYA 2H5EA 3OMLA 1QV7A 2IH2A 2V3WA 1KGSA 4FYVA 4MWCA 2XX3A 1NJGA 3D8TA 3NXKA 4RACA 4YLEA 3ZHVA 3R5KA 4ZJUA 2CLDX 4R98A 1JFLA 1RPJA 2WHYA 4QJ4A 3Q0EA 1ZK2A 4I50A 3LT5A 4OQQA 2WMOB 3MINA 3D0KA 4PC6A 1I4DD 4EYEA 3NC4A 3UJ8A 5FNZA 1OXUA 1YUMA 4OO3A 5DNCA 3QJGA 2QSZA 5F7XA 1EFVA 1AK2A 1NXOA 3OCYA 3SI7A 4JBNA 5G1OA 5IT0A 2AEMA 1GPAA 2XJ4A 2E18A 5TGDA 4UUOA 3BH6A 1CR1A 3L8ZA 4KZKA 5DTMA 3C7CB 4BJ3A 3U0VA 4M0FA 5B64A 1NMEA 2MYTA 5H68A 1AGYA 13PKA 3WWPA 4QLOA 3BUSA 2QDKA 2YMMA 2ZR8A 3OJEA 1HTWA 2BBOA 3LT0A 4HRVA 1CC1S 3I1YA 4TLMB 3F1LA 4P22A 1WO8A 3BRCA 4YCNA 4IRMA 1TMGE 2I6SA 2JLSA 1WCIA 1Z6AA 2CLCX 4LRUA 1O96A 5HUQA 3X44A 4B73A 4NXMB 1IN1A 2L69A 4OOFA 2A94A 4PZUA 5DSXA 4ZC1A 3SS9X 2CE2X 4R9VA 1K6EA 3SS7X 1IHDA 1PJLA 3MGBA 2WSYB 4F11A 4GC5A 4EWLA 5CXUA 3NVMB 3PFNA 4TXMA 2KI5A 2IYVA 4EZBA 3EVGA 3WKCA 2QV0A 3RVRA 4R6WA 4GYJA 3IAS6 3IQXA 1HDEA 4IZHA 1QGYA 3KTFA 5EGSA 5ENDA 3RIGA 4DV1B 1NNSA 3ILSA 3H1BA 3NOOA 2Q3CA 5CVUA 4ZCLA 2HF8A 5BRNA 3NVDA 1O9GA 4J91A 1E4YA 2A57A 3L6BA 2NACA 2G0NA 4DEVA 4YRKA 3FUCA 3A4YA 2V4MA 5BYAA 4HF7A 1NC1A 1T9KA 1J25A 1ZA1A 2GAJA 5CXQA 3J81k 3T4EA 4JNCA 3NX4A 4N40A 2R8YA 1PD0A 2BFAA 4ZANA 3LYUA 1XGKA 1XHFA 4HTAA 1ULSA 2L17A 2IPLA 3OKCA 1HETA 1E7YA 1DIOB 3CPSA 3I9OA 3VYSB 5KCZA 3E7PA 4KPEC 3BIFA 3LLVA 1IG0A 4X95A 3O9MA 2MSWA 5TEVA 3OPXA 4BFVA 4DDWA 5C32A 1ZI6A 1A8IA 3I6YA 2LP4Y 3EIFA 3JYOA 4XLTA 3A0UA 2ZJOA 3C48A 3EMVA 2FEWB 1Z0KA 3FNEA 3MUOA 1I36A 3FAKA 4MDYA 3RBAA 3RS3A 2IPAB 3W9BA 2HL6A 4ZRNA 1JB1A 1DDGA 1OXTA 4CLHA 2M1ZA 1WULS 3J80A 1E0SA 1WZUA 2DFNA 5DGCA 5B5SA 1YASA 4E46A 1RPTA 2CUZA 3KQQA 3PEVA 4J2HA 5B7QA 5L4SA 1N6OA 4QUBA 5KSYA 3FWPA 3KRTA 3NV7A 3EDQA 2ZJ7A 2IGTA 3ETEA 4ZVTA 3AUFA 3R6TA 3RG2A 4TLAA 5FWXB 1M76A 5JSZB 4YBRA 2C0CA 3KSDO 3OKPA 2YXDA 3CLTD 1TMYA 1PGQA 4N6NA 5K45A 3MTEA 2PHZA 4B4UA 3QLJA 5E4YA 1SCDA 4CUKA 1OWMA 1XDBA 3QXJA 1LF5A 3QBEA 4KAAA 1Q3HA 5CYFA 2WIAA 3CN7A 1ZN7A 4YMGA 3CWZA 3B2QA 3OD5A 4D6XA 3MERA 1M0SA 4QYSA 2JVJA 3H6GA 2IPNA 3FBGA 5E4TA 4Q4CA 3EHEA 5JW6A 4JJGA 4TYYA 1QHSA 5DWVA 2O1XA 1DEXA 3QVUA 2FE4A 3MWDA 1JSCA 1DV1A 2OHHA 5CG1A 2FG7C 1W1WA 3MUEA 1JA0A 4RW0A 2ZRBA 2XUPA 1Y8QB 4PHCA 2QRZA 1TYCA 3RM3A 2WC1A 3ZGOA 2IF0A 2WFAA 4ISBA 1Y5IA 2JBHA 1L4YA 3BMOB 3LIIA 1VJGA 3Q0IA 2DKFA 1H8HD 3O90A 4QD3A 1SXPA 4FI3F 4BTVA 3PFBA 1KAOA 4EMTA 4GWLA 2W6QA 2FGJA 4DWWA 1ZVVA 2M6RA 1GCAA 1R12A 5KYKA 4QBFA 1U0SY 5LIPA 1B1CA 1SCBA 4DCUA 2MR5A 3KTAA 2VXOA 2Y2UA 4FC6A 5AKYA 4A91A 3NHRA 1AH2A 1JHUA 1QGUA 3U0BA 4DCMA 5KOYA 4QBGB 5E1OA 1DIRA 3S1AA 4KDCA 2XY4A 4HZIA 4ZYUA 5J58A 3QENA 1EX7A 3PGKA 1KHHA 1T2EA 1Z5OA 5FULA 5IAKA 4ESVA 2HRDA 2RGRA 2OA0A 4CKWB 4ITVA 5D87A 4AKIA 2IEAA 3FTNA 2EOAA 1UP4A 3DCIA 2G0TA 3KZOA 3TB4A 2H4ZA 3R7LA 4E32A 3R7WB 1PJ2A 3IX7A 2IHUA 1Z7BA 4HEA6 4QUIA 1G6Q1 1PJ3A 1RAGA 1Y34E 3U4DA 2X1VA 2CVHA 2H7CA 3BE6A 3PFFA 4HNQA 4UEKA 1I0LA 4XB2A 5IAEA 2O2SA 4C0HA 2R66A 2A1TR 2QLTA 2VP6A 4Y2VA 5T3UA 4H08A 4L2IA 4LJ4A 4LRXA 1JX6A 3F6SA 2HFKA 4O2BA 4UUBA 4BCDA 9MHTA 1YI1A 2WJ6A 2WT8A 2M6KA 4D3ZA 5KNLA 1Y8RB 3DEKA 4RFSA 2JASA 3HA7A 4O33A 3ZYCA 5A5FA 4KPFC 2MIIA 2Q5FA 1QOQB 4KJZA 4UDNA 5ALUA 1V8PA 3DCYA 2LDXA 4UC0A 5HQJA 1C7JA 4HFNA 4UFOA 1O97D 1Y3FE 4BLRA 5JSFA 4QXOA 3UCFA 1Y6FA 3G2PA 1E2BA 2HV9A 1OFHA 2P8SA 2D4HA 1PTKA 1CE8A 1XT6A 1O6BA 4D44A 3AY6A 1KVRA 3AILA 1K66A 1D7OA 5K0GA 3WISA 3EXAA 3DT8A 1TMOA 3ZV6A 4EUHA 4JLJA 4CZ2A 3KHKA 3CVOA 1T0IA 4LW8A 1ECCA 4PSKA 3GELA 1FP4A 1CKEA 3HXLA 4IV5A 2Z9DA 4LXTA 4ZCSA 1QGAA 2ZCUA 3KUDA 5KNBH 5KYUB 3VR4H 4W7SA 4KX3A 3M33A 1FRNA 1IRIA 1SUPA 1W4CA 1TA4A 2C59A 2JFHA 2P9QA 2R5WA 2OUIA 4L5AA 4OA5A 5T6MA 2YINC 4LHEA 5F64A 2O19A 1X77A 5C0OE 1MFPA 3OOSA 3DE7X 4FINA 1YKGA 2P77A 3KQHA 3VDNB 3AHCA 4O4LB 2GZ2A 4E14A 1NJ5A 4WFQA 4XFJA 3H11B 4V0QA 1WOMA 4CLRA 1XA3A 9LDBA 1X3LA 4EMUA 5EJMA 2RH4A 3A1WA 1CRQA 1ZD5A 5TPZD 4ETMA 2VDOB 4Y98A 4MJXA 3CR8A 5I8ZA 1M6VA 1SVNA 2ALJA 1G8FA 3NTOA 5JDCC 1C1HA 4OXRA 3KU1A 1RKXA 3ZK7A 1ZQ9A 2Y1OA 2JAPA 2QZ9A 3FYUC 3LL7A 1EVEA 1M0WA 1XBTA 2E21A 4OP1A 2A92A 1WTCA 1N0IA 1XNGA 1YR6A 2DSNA 1JKMA 3G89A 4JGIA 1IZ7A 1KIMA 4LDZA 4CMJA 2R7KA 1W36D 1YE8A 1T2NA 5D7NA 3KQSA 3H5WA 4N3CA 1U65A 1MB2A 1QF7A 5F76A 4OHZA 3R7DA 1UPBA 4I1PA 5BUSA 4ITRC 3W5IA 1LUAA 4DLWA 2CF6A 2C54A 1WXHA 2ZYSA 2DHQA 1ACMA 1EFPB 1GUBA 1P77A 4D97A 3C4JA 3NGMA 5DTEA 3A70A 5AP9A 3RB8A 4DMGA 2HA6A 2NZJA 3A6PC 4ZI7B 4N9QA 5C7IO 2Y76A 3ODGA 3TLAA 5UKDA 1H2EA 3TZLA 3EPKA 3GLGA 1CETA 3UHPA 3RYHA 2CXRA 4RA6B 2EBHX 4HAXA 2Q5IA 3TDMA 2GH1A 1ECLA 2DWOA 1J9ZA 3NEYA 4YJ2B 5FLKA 3W3AA 1RI3A 2UXCB 2Y0BA 3GJZA 2QAGB 1VSVA 2ZJ1A 1KRXA 3EXG1 3KL2A 2W37A 3KOZA 4JFAA 3RW9A 2AC4A 1LTKA 4IZ6A 4WNAB 5B6JA 5JJBA 3LI2A 2I3GA 1OE0A 5EZYA 3A4VA 3LE8A 3KV3O 4HDSB 4QAJA 4DRXB 1DAHA 2IZZA 2BEUB 2Y0CA 5BYBA 3OQ6A 1ZXBA 1LBQA 1RYYA 2AG1A 4JQOA 1Y8ZA 2DETA 2WFMA 3UK1A 1LC0A 2A35A 3K15A 4LY9A 4PHGA 3HHEA 1WKCA 4I99A 4TWRA 5A9TA 3PJDA 3R7FA 2D7JA 3QPBA 5DGIA 1ULBA 4BFUA 1Q16A 2ZBRA 5GIPE 1EQAA 1FTSA 2CB9A 1LSJA 3FLMA 4CV3A 1SZPA 4UU7A 3TRHA 5BQXA 3E3OA 2QUZA 2RHLA 3DULA 3L7KA 1O03A 4Q3EA 1HM5A 3ZDRA 1K6IA 1THTA 4D9KA 3AC0A 1EFTA 1T4CA 1TM5E 4NU6A 4DREA 3OZXA 1V43A 2R8ZA 2ZFUA 1RAAA 3LZ6A 2XMCA 5C4IA 3UYLA 1JWBB 4D0SA 4WJZA 2IELA 4AYTA 2PV0A 2P5UA 2JGDA 1LS1A 3R8CA 3KWJA 2Q5CA 4V0RA 5KNDH 2VJQA 4PS1A 1M1YB 4BFYA 1ZNZA 4EHDA 3O9ZA 2H5IA 3GLIB 4NJEB 3BGDA 2VJDA 1E99A 1ZH8A 1WW8A 3EXFA 4HN4B 1CUSA 1TC2A 4GIBA 4PR0A 5KYWA 1UINA 3EQ2A 2VT6A 1TEHA 2OO7A 3QSGA 4BC0A 2PH3A 1X1RA 5E6RB 3FLAA 3O31A 4E1AA 1CY4A 2G9QA 2JJYA 2N9UA 4V2IA 2ZBEA 4XE5A 1I3NA 4HX9A 3TTXA 3DO6A 1T34A 2MOKA 4IZIA 1KP2A 1C9MA 1E3QA 1SVSA 1FK8A 5A02A 2HMUA 3H97A 3IIMA 3G8DA 3OQIA 4MVJM 1USGA 1YMQA 1T0PA 2NZ8A 1N2XA 2ORYA 4ARIA 3RBVA 4LBYA 1CS4C 2OZLB 3DGFC 4RSMA 1F4PA 1QQ6A 2DPHA 4I4TB 1L6RA 2FE1A 3TL3A 3GLGE 1ST3A 2UVDA 3COVA 3F98A 3M4NA 2C5EA 4MAMA 2QQEA 4LMRA 3MT8A 4FVTA 2PLWA 4Q4JA 4Z0NA 2OZEA 1BH2A 2PWBA 1EHYA 4UDOA 2GBLC 1X1DA 2VIIA 4KQKA 3FCCA 1LPMA 4J0FA 4KXVA 4UD2A 1JU4A 2BMWA 4FC7A 3SR0A 3TTYA 4B8WA 3F7NA 4DNPA 2BR4A 1Z7WA 2YV4A 1LZLA 3FSJX 3E1KA 3KKOA 3Q5DA 3RRMA 4B40A 2Y1LA 2FSGA 1C0KA 3TZBA 1BDIA 4I50F 3FWKA 3RRXA 4BRWA 1U4SA 1CB7A 3O8NA 4OYLA 4ZZIA 2HWYA 1GU0A 4HAOA 4JLWA 1F3LA 2MT9A 1B26A 3UXYA 1ECFA 4WEOA 3WIUA 4YUZA 3CJQA 1LDNA 2CDCA 1HYBA 3AIOA 1RCUA 3LJKA 3MWKA 1MO2A 5IKOA 5KDDA 1G9XA 1WMFA 3ZNPA 5JXJA 4CQNA 2HF9A 3K9HA 4MGHA 5AVZA 3PC2A 4L95C 1WPGA 1KMCA 4CN8A 1YULA 2CHVA 4ME6A 1A4UA 1B14A 3ZJ5A 4HQ0A 2ZR9A 5C53B 3PCXA 4Q19A 1R4MB 1SY7A 2R8EA 3D2BA 4JBWA 3BFJA 3WZMA 4FHDA 4M0EA 5HP4A 4ZT3A 4R2WA 3A1CA 3N0TA 3O95A 4HXEB 5K0SA 3W5HA 3UCXA 3WTCA 1J5EB 4TXHA 1ZCJA 1Q15A 2DX7A 3K8OE 2CV1A 1BG6A 2R8XA 3G0DA 4GX1A 1T6NA 2YICA 1U0TA 1VP9A 2R7LA 3AR8A 3KT3A 3L7YA 4AZTA 3FVVA 4CQMB 2JS7A 4JR1A 4PIVA 1MX1A 2QXYA 2FR0A 4GW3A 4HOYA 3WTBA 1W59A 2XWJI 3MN1A 2HHAA 4BECA 2FPMA 5SY6A 4J0EA 1WOYA 2A9QA 3T7KA 5BO5A 2XGSA 4HH3C 3H2JA 4FXOA 3HCWA 3S1LA 2V96A 3ORRA 3L6UA 4RJLA 5SZJA 3ZCSA 3CLUC 3C3PA 4LA4A 5T41A 3G17A 3IVMA 4F4DA 4QE3A 2R96A 3OECA 3B3JA 4EFKA 3NB0A 1UFVA 4TM7A 2HRBA 3WMXA 2CEAA 3FTFA 4IICA 2FRXA 2OCXA 3K1YA 3VYRB 2XUDA 4TVOA 5ICGA 4FFRA 2FZWA 4LRSB 3I39X 4JYPA 1Y48E 2F7SA 3AMVA 3FDXA 3PYMA 1W30A 5J2TB 1KEZA 5IC5A 2PN1A 4WXRA 3INRA 3L6RA 4ZO9A 2I7CA 5CMLA 5CCXA 4F2DA 1YB7A 5IHXA 4LHYA 1LK0A 1OFGA 5FNVA 2C8KA 5JAPA 1CLUA 5AM2A 4BKOA 3G2MA 2K7FA 1VI2A 4QQFA 4LY0A 4NCHA 2HU2A 2R68A 4Y9RA 4HDNB 3KYJB 4BX3A 5GTDA 2PAAA 2H52A 2HIAA 3ZDEA 3G68A 3E9NA 3I52A 4FS3A 1KBZA 3R20A 4HAVA 2WSIA 3HVRA 1KVTA 3GP5A 4OM7A 1QOPB 3GXOA 2ONZA 5H59A 3KSAC 1SUWA 1T9GS 3LVRE 4DGQA 2V7WA 4MQEA 2REXB 2R6DA 4U9IS 2GARA 2KWIA 4JCOA 1O6GA 1QX4A 4OFZA 5K1ZA 1GNSA 1K4MA 1GD1O 2GZ1A 3H18A 2H2DA 4P86A 5BUCA 3HJGA 4UCWA 4FMPA 4B4WA 3WQQA 1FTNA 2OENG 4M0PA 3HH8A 4K9KA 3FFTA 1SCJA 1YACA 3X43A 4EHJA 1GTZA 3A1EA 3DP7A 4UKDA 4MIKA 4HP8A 4N3GA 2F6RA 1D9XA 1L8XA 4WV3A 3ITNA 4B85A 3G0IA 1LGYA 4UFPA 1DAKA 4AYXA 1U7DA 1SC6A 2GFIA 5KTTA 1ISGA 5LQAA 4KXMA 3GNTA 2ZJ4A 3S70A 3AXSA 2PVSA 3A6FA 3NHLA 1NNEA 2DUUA 3CO0S 3NO4A 5AJZA 3PTAA 2PIDA 2ZQ5A 1ST2A 3RS2A 1CRPA 4QKQA 5E6SA 1OX5A 1NR5A 1W47A 3CF4A 2OC9A 4E6EA 4MRNA 1C30A 1CWUA 2BM1A 3M2PA 1DBRA 1GZ3A 2AW5A 5KTNA 2O2EA 3LF2A 3O7MA 2EC5A 4MW6A 3VR5H 4AY2A 2ORIA 4AJHA 3GAZA 4OTZA 3EMKA 1QHXA 1M2GA 1ZMRA 2JD1A 2P0YA 3THYA 1NIPA 4Z6KA 3U56A 1N32B 1U2DA 2G8NA 5DBFA 1KZHA 1F20A 2PYIA 5G02A 3SIRA 3ZDYB 2HHLA 5LDGA 1US8B 1SVMA 1ZGJA 3OZDA 3R2JA 1UM9B 2DFTA 3LUBA 2FEKA 1FFBA 3IURA 3LX5A 2GUGA 3ZK8A 1STOA 2VTDA 3S27A 2GPYA 3FZYA 1IJBA 4RZSA 1K08A 4LI3X 5BW4A 1OKKD 2OCPA 3GWZA 3N0WA 1OSNA 5EMHA 1L7VC 5E4FA 2IOHA 4DFDA 3A3KA 5ALIA 2Y1KA 1VKHA 2X9NA 4GBED 4O2BF 1C7ZA 1T1GA 5ALWA 4LYAA 1H9BA 3W7VA 1R0XA 1MOQA 2R00C 1GR0A 1HDZA 3M3PA 1EP2B 4PW0A 3BDVA 5BN1A 5AOAA 4YWJA 3DOUA 3L7BA 2X1MA 3VDQA 1JIKA 2HDHA 3DF7A 2PV7A 3R6DA 4XX0B 1OZ0A 1R6DA 1T8PA 2X7XA 3KKMA 3OKFA 5C1DA 3F4BA 5FTKA 4BNLA 4TRNA 5BOVA 3RYCA 2H4HA 2HQSA 5FPPA 1T5IA 3EF1A 4Q9DA 3HU2A 3AGPA 1A9RA 3U62A 4EO9A 1A5TA 1NV8A 3H2IA 1UZMA 1PJQA 1L3BA 3I9MA 3IUPA 4LYFA 4PZCA 4QPCA 2O3JA 2DF8A 1HNNA 1TF2A 2HMVA 1Z2OX 2P5YA 5K99A 3QYJA 1WTAA 2W93A 4PFSA 1VGQA 3HRHA 3L05A 1Q0TA 5FUBA 2YNMA 4G9GA 2QMOA 5E3HA 4ZYVA 5DNDA 4X44A 4AROA 4MYDA 2A58A 4M7WA 3KOOA 1II9A 1KAMA 4LYDA 5LKRA 1HSZA 4H6XA 3O4IA 5DYWA 4GXRA 3M1IA 2G4CA 4OSEA 4Q4AA 4E12A 3EGXA 5EIWA 1D2MA 4FGZA 4QYWA 2RHWA 5JZVA 1H3FA 4X93A 1BEUB 3T35A 3HI4A 3FUUA 4GOOD 1U9JA 4YV1A 1PFQA 1IQPA 2ZI6A 4X1IB 1ATIA 2JJ8A 4I1RA 2OXRA 4R9NA 1T0UA 3FDZA 1W1IA 3R0QA 4XIFA 5EVCA 2EHJA 1PRYA 3E15A 3VVBA 3UJDA 1X80A 3G2HA 2XXAA 4YHHB 4MUHA 5EN4A 1GG2A 1XK6A 4MCHA 1E1CA 2IBMA 5LR6A 2O7RA 3KCQA 4DCVA 3DOIA 4JYZA 4AN1A 4JFRA 4P6VF 3HYRA 3OOEA 1C0LA 3SP1A 1M8JA 1JQ5A 1CQZA 1T5BA 5KTOA 4QIHA 3T1TA 4BTEA 2AE2A 3M4YA 4BLQA 5A06A 3FHTA 5J43A 1C1DB 1ADCA 1ZH2A 4ZKEA 4WE3A 3TQIA 3ZGXA 2WM9B 1E7QA 1WB6A 2JIDA 3G8AA 3PX2A 2P2LA 1CT9A 4NDNE 1QWSA 3L82B 4KN6A 3UMMA 2F8MA 2ZSJA 3EIXA 1VLLA 3L2OB 4POAA 4L9SA 4C76A 4L73A 4QAQA 1U31A 2WFZA 1BNCA 2VDPB 4UNPA 1U0NA 1K3FA 3L0DA 3OFKA 3UJCA 1NUQA 2ZT5A 1JUDA 1OY1A 3LHDA 5BR4A 4ZCTA 4HADA 4IX1A 5HKKD 4A92A 5EJEA 2YJ4A 1E9RA 2Q4EA 1E6WA 1XELA 2Y27A 3C16C 4NNOA 5ALTA 1V8OA 1XE3A 2GTPA 2YHUA 3E9EA 5EE5B 1ZOSA 3MXTA 1DX9A 2IKSA 1DEKA 2ZQZA 3LOUA 1S9HA 5T64A 1GGHA 5AI4A 3TRDA 4Z4FA 5EZYF 4AO6A 2AC2A 2DYKA 3QFFA 4B35A 4DSTA 2H2HA 2YH2A 3DKRA 1RWXA 2QD4A 2WJYA 2IUFA 3LQFA 1XCJA 1KBQA 2JGNA 3PDIA 4L8LA 1GCIA 4H4DA 4BMDA 4IDCA 2ZSFA 5J2UA 3WIVA 4BQNA 5I4BA 3QEKA 3ZIAA 3WGOA 3PA6A 4LVOA 4PONA 4EJMA 1BJTA 2QP4A 1YZYA 4PFJA 2VDVE 1UWKA 5A3JA 1JTVA 1VPLA 2GJAA 2CKMA 2YASA 4JIMA 4LV8B 3PUVA 1BGVA 1UKBA 4NFHA 1KYXA 3I0ZA 3HYLA 2ZUUA 4K9QA 1CUJA 4BWFB 1C4KA 3TGWA 2WMYA 1RQRA 1R1DA 4PG4A 1N8KA 3BGIA 3SS8A 3T3IA 4A8HA 2VDUE 1H2BA 1J6UA 3FCOA 3QFCA 2PKCA 5E95A 4L5IA 2Q99A 4LGYA 4JH0A 3LUKA 4HS4A 4TKVA 1I13A 4YASA 3FBTA 5M3BA 1RYFA 4WNIA 4N5MA 1UPXA 2AJ8A 2DFPA 3EUWA 4MW0A 4EYSA 4DV7B 3D4OA 3DFFA 2FAXA 3CZPA 3VPHA 3OFNA 2O0HA 2ZRJA 4WESA 4ANFA 1ZGZA 2WVAA 1E1YA 4FSHA 2AVNA 2ZDQA 3DM5A 3EVAA 5E9JA 1N6PA 3HBLA 5KVVA 3OZCA 4FWIB 3TSCA 2BMFA 3GV0A 3PITA 1V9SA 2BUCA 2VEOA 3R7NA 1KKLA 5F98A 2O8FA 4RH1A 5ALGA 1XJ0A 3JQ8A 3B3FA 1DTWA 1WXEA 4G3XA 4GT1A 1F0KA 2I54A 1VA5A 1EFLA 5KBYA 3KLPX 1NDUA 2H1RA 3DMDA 2KLHA 4JL8A 4JD5A 1AQYA 1KMNA 4IF4A 1TLFA 4K2AA 4UBJA 3UH0A 3IDOA 3SBOA 5CVDA 2F48A 4DADA 1QYVA 3LO8A 3VTZA 1P2UA 4YAWA 4C7MA 1M2VB 3IHTA 2NZWA 1MO4A 4FLFA 3JQFA 4MQLA 4A8JB 4LHXA 1RHQA 4YALA 5SV2A 3T9CA 3HKDB 4TYPA 5DM1A 2QMQA 1QE5A 3AEUB 4KH0A 4L3OA 2ZDGA 2WYWA 4DIOA 4JV5B 4PGHA 1N75A 1AUPA 3AG6A 3HB4X 5DNEA 3SNKA 3EVFA 4UZFA 5BSGA 1EGAA 1SUDA 3B8EA 1OB5A 4I1UA 3OE4A 1L6IA 4ZJYA 1GG5A 4OFXA 1Q7CA 3CX3A 3ZW8A 4CMAA 1FVFA 1D4ZA 3I34X 4GH5A 3C1AA 4BMOB 4R05A 2I1LA 3QUTA 5LD2B 4M54A 5M04A 3C6KA 4MDFA 4B6RA 4MUAA 4RA9B 4W8OA 3Q6MA 2FF5A 3S2UA 5TVKA 3WLQA 3FI9A 5JAHA 2NTVA 2G1KA 3D2AA 3EMDA 4H7FA 4YYZA 3B36A 4ROTA 5FPQA 3BCRA 3BD9A 2TMKA 4BOYA 2R4QA 1JDZA 2QVCA 3KEMA 3KYDA 3RVNA 1Z2NX 2NU9A 5EJGA 2LTAA 1WW3A 4H59A 4AWBA 2YFKA 2FN7A 4HMQA 1E0JA 3KZCA 3QBTA 1KY2A 4E6PA 5ILOA 2VAXA 5T4HA 5I7VA 1BKYA 2AE1A 3F6YA 3DA8A 5AW5A 5G4KA 2GZRA 4CMKA 2C2YA 3SE0A 1N9GB 4AM8A 4L0CA 1RP7A 2JEZA 3LKVA 3ER6A 5KWIA 3WMRA 1R18A 1JIQA 4R9SA 5EPOA 2O5VA 2QK4A 3AR7A 3NGLA 1XXLA 4EY8A 1YAHA 2HM7A 3U16A 3K9FC 1QP7A 4TT8A 2WD7B 2Y77A 3H84A 1QZUA 4ZWNA 2H1OA 1PZHA 4IWXA 5EINA 1RYMA 5FPKA 4KYIB 1Z38A 2E89A 1LVHA 3NTLA 1GT6A 1FRQA 4UM7A 1VJDA 2ZE5A 1P1HA 3EEYA 3ELBA 3I23A 4W1RA 3S8EA 1U8FO 4QPZA 3IS3A 2FX2A 1DC6A 2CV2A 5ADUS 4X1YB 3HUUA 5A03A 1P29A 4Q7LA 4WY2A 4YMHA 3H5AA 3BERA 3W4JA 4UNRA 1Z4NA 4DMMA 5BWLA 1X7DA 2ZRPA 5EJ6A 4N3NA 2X5OA 1U2GA 3RTDA 4S0ZA 5TF0A 1R00A 5LB4A 2IYQA 4L8GA 2AD5A 3LPNA 1LX7A 3HS3A 1KU6A 2RB5A 4QPDA 1GQFA 2ZDHA 3BEOA 4ZMBA 4G8BA 4MQFA 1JEYB 3VPBA 3B1KA 4GRIA 2HOQA 1LNZA 4JYCA 5IEBA 4KNWA 1DFHA 5LB2A 1XCOA 5E7QA 4M8SA 1Z6YA 1KEWA 3CLTC 4G5GA 1FP7A 2L2QA 3QKWA 4BDTA 2Q6IA 4MP6A 1IUOA 1W4AA 2P0EA 5E9AA 2W2PA 3FFBA 3SPXA 5D1HA 3VGPA 4BMCA 3AI7A 3HEMA 1TW3A 2B20A 2DPXA 5AVKA 5CHYA 1PBNA 1KXJA 2QIPA 4X66B 1U9IC 1SOAA 2PL9A 4TTTS 3QTBA 1CR6A 1UT5A 4BP8A 1QNLA 4QGFA 3U09A 2FW7A 4OHOA 2I3AA 3HVJA 5BMVB 2C5HA 5MGNA 2WWVD 2FPIB 5A1TA 1ECPA 4UE3S 5EC8A 5CFLA 3BJEA 4PQEA 2WWWA 1KO4A 3V1TC 3HDYA 3M9WA 5FTMA 6REQB 3PJGA 3OCZA 5JCJA 5I48A 3MGKA 4M9SA 2XDQB 4RVHA 1S89A 2YVKA 2D0IA 4A26A 1A4XA 4EYQA 2WWHA 1Q1EA 3O4GA 4ZZ2A 1TA9A 3DOCA 2WVGA 3AZQA 2VK4A 4XJSA 5CT4A 5B1HA 4P0PB 3C3MA 3ZXUB 4C4RA 4DLTA 4C0WA 1G3MA 1SA0A 3KVRA 1F17A 4ENQA 3LS2A 3A2MA 2PUAA 1EQ2A 2V6JA 3NNNA 2OLKA 1C50A 4BNJA 1Z0UA 3B5IA 1FLAA 1NM5A 4HNAA 3SQMA 4M3NA 5FL7D 1YB1A 2IDMA 3VU9A 4RTMA 5HCNA 1N5DA 2GZHA 3FLBA 3FUXA 4TKZA 5TQVA 3RHZA 4BIIA 1MQ9A 4ZTUB 3V3TA 2BGIA 4KIJA 1GZDA 1C4XA 3BORA 4NYIQ 1N77A 1ZAYA 4O4JB 2AL7A 3OCWA 4D0NA 2AB0A 1ZD4A 2Q2QA 2A9RA 2ZI9A 1CNFA 1GAQA 1PSWA 3TECE 2BE9A 4RAQA 5LXTA 2J8ZA 3FYHA 3KQVA 4GSKA 3WRYC 2BOVA 1CUVA 3ZZTA 5EIEA 2HSJA 1YHNA 1SHZA 2R8RA 3LWDA 3UMSA 1Y7LA 3OLWA 3WLHA 1EKXA 3CX4A 1WXFA 3E3NA 3GVHA 2B6HA 3ICPA 1KYYA 3QE4A 1W48A 4AVYA 1QSGA 4FOSA 2DH5A 4MUIA 4YQZA 3A9TA 3N39C 2IS1A 1JXOA 2ZBQA 1FTQA 4NP6A 1HLGA 4EJSC 1PL8A 1S1MA 5DYYA 4PSUA 4LZPA 4IQ4A 1AZWA 4BVGA 1FDUA 2O2YA 1ECGA 1XRJA 2MSKA 2REOA 4KL8S 1NFFA 5KYGA 3UGJA 4TSKA 4F5YA 1JQLB 1O97C 1IUNA 1PQPA 3GD5A 1G38A 3P0JA 4DVJA 2OE2A 3W5SA 2QNRA 3OBIA 1SKYB 1ZVQA 2GDJA 3DDCA 4GMHA 2PKYX 3HWRA 1Q0QA 2WHRA 4MK4A 3REFA 2V1UA 4KPYA 1UMBA 1LSSA 1FMCA 1YU9A 2FPOA 2HLNA 4ABYA 2PSHA 3B6EA 3VI4B 4EPXA 3NCHA 1LKZA 2WMDA 1MQSA 5KYYB 3RBZA 4ZICA 2VPXA 2ZWPA 3ESCA 1NXSA 4RSHA 4FFMA 1WPRA 1ZCFA 1CQJB 4C9BA 4F9FA 1Y80A 1SK9A 3FCYA 3TQSA 2FWPA 4MR7B 3V2UA 3WGZA 3GOHA 2ZROA 3CB4A 2Z8XA 3VDRA 1QRRA 2OO5C 2OKGA 1J20A 3NS7A 4YRJA 3OQPA 3ZE7A 3CZRA 2RHGB 1C2YA 1CY8A 3CUTA 3OAAD 1KBOA 5CIWA 3RGWS 1U8EA 5BSHA 3ER8A 4C2UA 4AKGA 3ITEA 3CVUA 2PANA 1HDIA 4TWJA 3UV6A 2H63A 2ERYA 3JQPA 3LXXA 4JSTA 3SMVA 1VI5A 4C7JA 1HEYA 1Y1TA 4ECAA 2IYAA 2LCFA 2I62A 7REQB 3EOZA 3ESQA 4IEEA 3A11A 1SR8A 1QK5A 2WUWE 1XMOB 3LD9A 1F5NA 1T91A 4UM9D 5CNJA 3RVQA 1MX3A 5BWCA 5I3ZA 2XUHA 4YH1A 4D0RA 4KV9A 1Y9AA 2F9FA 4HFJA 5K6AC 4AXXA 1AS2A 4GOND 3KX2A 4AJPA 3S2SA 4AJ1A 3RSCA 1E9SA