4PQGA

Crystal structure of the pneumococcal o-glcnac transferase gtfa in complex with udp and glcnac
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
506
structure length
506
Chain Sequence
HHHMTIYNINLGIGWASSGVEYAQAYRAGVFRKLNLSSKFIFTDMILADNIQHLTANIGFDDNQVIWLYNHFTDIKIAPTSVTVDDVLAYFGGEESHREKNGKVLRVFFFDQDKFVTCYLVDENKDLVQHAEYVFKGNLIRKDYFSYTRYCSEYFAPKDNVAVLYQRTFYNEDGTPVYDILMNQGKEEVYHFKDKIFYGKQAFVRAFMKSLNLNKSDLVILDRETGIGQVVFEEAQTAHLAVVVHAEHYSENATNEDYILWNNYYDYQFTNADKVDFFIVSTDRQNEVLQEQFAKYTQHQPKIVTIPVGSIDSLTDSSQGRKPFSLITASRLAKEKHIDWLVKAVIEAHKELPELTFDIYGSGGEDSLLREIIANHQAEDYIQLKGHAELSQIYSQYEVYLTASTSEGFGLTLMEAIGSGLPLIGFDVPYGNQTFIEDGQNGYLIPSSSDHVEDQIKQAYAAKICQLYQENRLEAMRAYSYQIAEGFLTKEILEKWKKTVEEVLHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycosyltransferase Gtf1
publication title Structure of a Novel O-Linked N-Acetyl-d-glucosamine (O-GlcNAc) Transferase, GtfA, Reveals Insights into the Glycosylation of Pneumococcal Serine-rich Repeat Adhesins.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 187
structure length 506
sequence length 506
chains with identical sequence B
ec nomenclature ec 2.4.1.-:
pdb deposition date 2014-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4pqgA03
2R66A 3MTBA 3L7DA 3CUTA 3S2UA 1PYGA 3T3HA 4X7PA 1FTWA 3L7CA 3VDMA 2F3PA 5IKOA 4HWGA 1FTQA 1P4HA 3WAGA 4M60A 4MHSA 2IV3A 1Z6QA 7GPBA 3L7BA 4GZ3A 3G2JA 1Z8DA 2QN7A 4WACA 3IA7A 1NZDA 3TOVA 3OTHA 2QN1A 1GG8A 1XOIA 5DLDA 3UYKA 8GPBA 4KQ2A 2H1FA 1FU8A 3SYRA 2IUYA 2IEIA 2QZSA 4CDRA 4F9FA 3T3GA 3Q3HA 1KTIA 3T5TA 6GPBA 1GFZA 2PYIA 5GPBA 1GZ5A 3IAAA 1L6IA 2R4TA 3BCSA 3HBMA 4L22A 3WC4A 1IIRA 2IEGA 1J39A 3DZCA 1BX3A 4M83A 5JTTA 2GJ4A 2H1HA 3MBOA 4RBNA 1ABBA 3RSCA 3D0RA 2ACWA 4RIIA 2G9VA 2FETA 3HBJA 4MHOA 1PNVA 2XGSA 2X0DA 2AW3A 2XA9A 1NVKA 3T3DA 2X0EA 1WUYA 2PYDA 1XL0A 1GPYA 1WV0A 4BFCA 2F9FA 2ZB2A 3BCUA 5TVGA 3G2HA 1F6DA 2GM9A 4RELA 3DD1A 3BEOA 2QN8A 2AZDA 1NOJA 4WHMA 3OKAA 3PE3A 2XA2A 2ECPA 1JIXA 1FA9A 2QLMA 1P29A 2FF5A 2F3QA 2C9ZA 4AMBA 4G2TA 1B4DA 2X6RA 3BCRA 3CEHA 4KQ1A 4XI9A 2GPNA 4YI3A 3DDSA 3OTGA 5LQDA 1RZVA 4X7MA 3MT8A 3MTDA 3HBFA 1RZUA 5DU2A 3FROA 4NC9A 3NCHA 1WW2A 2VSNA 3RSZA 2O6LA 4N3CA 1JG6A 2R4UA 1P2DA 3ZCTA 3CX4A 2ASVA 2C4MA 9GPBA 2HY7A 4MI9A 1O6CA 3ZCRA 2IW1A 2PRIA 4CTNA 3TSAA 1Z62A 3CEMA 2KS6A 1L5QA 3S27A 2BGUA 3GPBA 2C1XA 1L5VA 1C3JA 2AMVA 1XKXA 3UYLA 4YUAA 4F96A 4MICA 2PQ6A 4M7PA 2QRHA 1K08A 1EXVA 1L5WA 3C48A 3OTIA 1PN3A 2ACVA 2BFWA 3L7AA 1HLFA 3EBPA 1JIUA 2BGTA 1NZFA 2IYAA 3PE4A 1Y8ZA 3CUWA 4KQMA 1SXQA 1JEJA 2JZCA 3MRVA 3NAZA 3T3EA 3MT9A 1LWNA 3ZCUA 1NOIA 2QRPA 1XV5A 4EKYA 2F3SA 2QN3A 4X7RA 3L01A 1P4GA 1K06A 4FZRA 4GYWA 2QRQA 1FTYA 2G9QA 2GEKA 3D1JA 1GPAA 3HBNA 3CUUA 3GUHA 1H5UA 3C4VA 4AY6A 2XGOA 4NESA 1UQUA 4GZ5A 3BDAA 4X6LA 4AY5A 2VSYA 5IKPA 2PRJA 2GEJA 4PQGA 4W6QA 3G2LA 4N3AA 1L5SA 5TMBA 4QLBA 1C50A 3T7DA 3MRTA 2F3UA 4GPBA 4RIGA 4CTOA 3AMVA 3VUFA 1NOKA 2G9RA 3G2IA 3WADA 1XL1A 2P6PA 2GT1A 3OY2A 3CUVA 1L7XA 5JTUA 1AHPA 2QN2A 1P2BA 1F0KA 3ZCQA 5D01A 3G2KA 4GZ6A 1Y6GA 3S29A 2QLNA 4EKEA 1L5RA 3OT5A 4XIFA 2QLLA 4MRAA 1RRVA 3CV3A 3Q3EA 3MQFA 3MRXA 4LDPA 4N9WA 3MS7A 2VG8A 3CUYA 4EL5A 2JJMA 1WUTA 3MS4A 4EL0A 2C1ZA 3H4TA 1LWOA 1EM6A 3E3NA 2SKEA 4F97A 3RT1A 2X6QA 2R68A 1C8KA 3Q3IA 4AN4A 1XC7A 2AV6A 2QRGA 4HLNA 4CTMA 5TMEA 4MI6A 3OKCA 1V4VA 3DDWA 3G2NA 2QN9A 1SXPA 3EBOA 1QM5A 2ATIA 1Y6FA 3QHPA 2X0FA 3CEJA 2OFFA 5D00A 5TMDA 1GPBA 4RIFA 1M5RA 5I45A 1AXRA 1WV1A 4MI3A 1QKJA 1E1YA 5DXFA 3OKPA 1C8LA 4Z5XA 2FFRA 1YGPA 2IYFA 1UZUA 2WTXA 5HXAA 4RIHA 3H4IA 3MS2A 3NB0A 1IXYA 1Z6PA 3O3CA 3C4QA 4NEQA 3OY7A 1P2GA 3S0JA 4GYYA 1NLMA 2BISA 2XCUA 1GGNA 3VDNB 3BD8A 3TAXA 4BQFA 5C1DA 3L79A 3SYMA 2Q6VA 2SKCA 3E3LA 1WW3A 3NP7A 4BQEA 3COPA 5BNWA 2VCHA 4RIEA 4FKZA 3D0QA 3S28A 2QRMA 1FS4A 3ZCPA 2XCIA 4N39A 2VCEA 1JG7A 1FU4A 2QNBA 1E4OA 1FC0A 2R60A 2IV7A 3BD6A 3E3OA 1PSWA 3ZCVA 2JLBA 3NP9A 3RHZA 1YA6A 3T3IA 1P4JA 2G9UA 1UQTA 4REMA 3MTAA 1JIVA 4WADA 2GPAA 4AMGA 3MT7A 3QKWA 4LEIA 2SKDA 4BQIA 3NPAA 2XA1A 3ZCSA 3NC4A 3BD7A 3MSCA 2XMPA 4N3BA 4RENA 5ENZA 1VGVA 2GPBA 1FU7A 4EJ2A 3VUEA 2XGMA 2YJNA 4YI5A 1A8IA
chains in the Genus database with same CATH superfamily
2C97A 4PGFA 3DCJA 3IVRA 4IG4A 1Z0KA 3EQ9A 3MTBA 4ZKEA 2A5LA 5IP5A 2GJ8A 3DHVA 1GO2A 4X3OA 4DQ0A 1PEDA 2AF3C 3L6BA 4HB4A 3REQB 4IDOA 5BR1A 3R20A 3RYCA 5B4VA 3K96A 4A23A 4CDMA 5KTYA 3OZSA 1U4SA 3L7NA 1CG6A 3BG5A 4J2TA 5DMHA 4GH5A 4L9AA 4D1YA 2I2AA 2IV2X 1BKYA 1OC2A 1V4NA 4M60A 3RRYA 3AVWA 4L28A 1W5AA 2DPLA 4GKJB 5AJHA 1W4LA 4GBED 4YEDA 4F3RA 4U9IS 4MW6A 4C14A 4M76B 2DBQA 4MRMB 2GDJA 1U28C 3G2JA 4UM5A 2VRCA 5EQTA 4YDHB 4BEJA 2UYYA 3IAEA 4NP6A 4B2PA 4B31A 4G01B 5T8KC 2XUKA 3P1JA 1YZ3A 2A6PA 2A9VA 2VHUA 3IUSA 4MWDA 4XASA 4JKIA 1L7EA 1AK2A 1XHEA 1ZHFA 3F74A 3T1NA 1K3FA 4GOMD 1QHIA 1JTEA 3TZLA 4BVKA 2BMDA 4B74A 4N48A 1YASA 3ZWBA 1Q0SA 3HNOA 2YRWA 3FFXA 4C3VA 2WFLA 4S35A 4K88A 1ENPA 2PGLA 2HH9A 3IAS1 3RADC 1MNQA 2X2PA 4XWGA 1E6CA 2AJDA 2QW8A 2RI6A 3FHTA 4WCFC 5T4EA 3WNZA 3DKVA 5ILOA 3FPKA 3VU8A 4CU5A 4Z4GA 1NBWB 2Q1UA 4L7QA 5ILGA 4E07A 4AU1A 1OH6A 2YASA 1IOWA 1L9XA 3SK0A 4Q00A 2GLTA 5IPFA 4OJMX 4N0QA 4J9UE 2E6KA 2XOEA 2DT8A 2C5SA 2XEXA 4R05A 4UUNA 1UL1X 1RAIA 1W1IA 5DZSA 2VSOA 4UJ5A 4QVGA 1KAQA 2CV0A 4DEYA 2PX3A 1C9DB 1WDMA 5HEKA 3FIJA 4N0DA 3WJ7A 4HQNA 2OTCA 2OXEA 4LOLA 1XCJA 1T13A 2B9EA 5AMXA 4BAUA 1KRXA 3ZJTA 1NMQA 2G06A 2WA2A 1KXJA 2L42A 4OAPA 4M83A 1L7BA 1EVYA 1RCTE 4R1QA 1JJVA 5JOQA 2XUGA 4ARUA 5L9AA 3E7XA 3HNPA 4FGSA 4P53A 3ZLBA 4O4HB 5FWYA 4CV0A 4JHLA 3KX2A 1X1RA 4FDTA 2FETA 2QN6A 4OKIA 4QPZA 2CXNA 3PZRA 3OIYA 1UM9B 4Z0NA 1PK7A 1ZI6A 2QTNA 4C0QC 3TTVA 3MXOA 3W4JA 2BGRA 2GZ3A 1B42A 4XGQA 3B9PA 4QTXA 4HTAA 4CM3A 3PQCA 4W5OA 1EEHA 1WUYA 3IV7A 3O9MA 5C7IO 3ZH2A 4LSMA 4R2JA 2AOTB 1QIMA 3KYBA 4WQMA 3T0IA 2FMFA 1A4UA 4Z51A 4JVMA 1X7YB 4AJ9A 1JHVA 1OFHA 2XNJA 4F4JA 3ZTYA 4RKEA 3GQBB 2PBZA 1FLNA 3HLYA 2CJYA 3FDFA 1U9YA 1VCOA 3SEFA 4GWGA 2WOOA 1GV0A 2QD4A 1XD2B 1F9AA 1JEQB 3GJ3A 3HCBA 1RXIA 2O54A 5ALSA 1GZ6A 2AZDA 1EI9A 1K89A 1POWA 1B0PA 1XAJA 3I2KA 2VYQA 4XM1A 4LI0A 3UUEA 1O6FA 3O91A 2QX8A 3FNEA 3FGOA 4XEHA 3FOCA 3I76A 4DNPA 4JITA 4RCYA 1U5BA 3LGXA 4KLAA 4RVCA 5MFPA 2A7XA 1P1RA 2Q99A 2BRUA 3QPUA 4HNAA 4NBLA 1ZHHA 5E9AA 3BXOA 3TQHA 3VHQA 3I9JA 1HE5A 3KSAC 3A6PC 1KSJA 1OF1A 2WVGA 4Y1RA 2VQDA 2B1JA 1OFIA 1SBQA 3TBHA 1KQGA 3BREA 3C6KA 4CT4B 4I5FA 1M1NA 4HAIA 1GARA 5LXTF 1BCRB 4G8CA 3ONDA 4DIOA 2WYHA 1J2TA 5ESXA 1M2VB 1U6IA 2FPLA 3TSOA 3V1LA 4F5ZA 4J2HA 2NZVG 3JQ8B 2AOUB 2I78A 4GMDA 4M38A 4QBKA 3TOSA 2VTVA 1VPDA 4TWRA 2VAPA 3O83A 1LCIA 3PB3A 3UAVA 1G9XA 1KYVA 4RVUA 1P80A 1FFDA 3QEKA 1U3VA 1WG8A 2JLYA 3B51X 5EZ6B 1MOZA 3UMBA 5J4HA 2Z1DA 3EGOA 3DHNA 3EHEA 3F7TA 4DAOA 5CA1F 3LL7A 1QCCA 5IWAB 5HZKA 1LW6E 1ST3A 4LDJA 1EP3B 2BR3A 2I6TA 2NIPA 3EZ2A 5LQMA 2O6LA 1NP6A 5IFKA 3SJUA 4KXXA 2EJBA 1U0TA 3CS3A 3GEDA 4JNKA 2ZB3A 1ST2A 4ZYUA 2H2AA 3IO3A 4O63O 5AUQA 2VUHB 3ECAA 5CA1A 4KV9A 4F45A 4PZUA 2UYOA 3AVQA 3DL0A 3RJTA 2JS7A 5HKKD 1BHJA 2UDPA 2H9AA 4JLJA 4S04A 3JQAD 1RJ9A 4MROA 4JUBA 4RD4A 2XJ9A 3BRSA 4MYCA 1S2NA 2I3BA 1O6CA 3LQ2A 4IJQA 4L4XA 1HQCA 3TJRA 1SQSA 2IOQA 2OKCA 4D82A 3DEZA 3O84A 1ODKA 1UIRA 4MCIA 4U3JB 3VHRA 1Z62A 1NF9A 2JEZA 3FWZA 2ILVA 1E9CA 1NJFA 1W94A 4ZZIA 1TZCA 3NHKA 3OCYA 1XTPA 4CDGA 2SICE 3BVPA 5DNEA 3GPBA 5E2BA 3OI7A 4OLFA 1GU7A 4H7FA 1BA2A 3FTNA 5L8VA 2BJVA 2HU2A 4N8SA 5FRDA 3OQ1A 1P0MA 2HXGA 1EUCB 3VPXA 3IBGA 1YR8A 5LQCA 4F84A 3M33A 1S3SA 3INTA 3M81A 3NJRA 2VQFB 1E1NA 1LI7A 1JV2B 3M83A 4PNHA 1Y0BA 4MJ7A 3PTZA 5COQA 4H31A 3M5CA 2NN3C 4HBGA 1HI9A 3C48A 4PYRA 2W8BB 1P0PA 5BYAA 4W1PA 2BFPA 3PPVA 2JGKA 2J9YB 3G8YA 3KT0A 4I9FA 3UH1A 2JANA 1P0QA 4KSYA 2GD1O 2H1WA 4P54A 4DJJA 2JAXA 2VK8A 3TI7A 1W0JA 3R9KA 2RGDA 3ER6A 1H8HD 1M54A 1WABA 1QGYA 4CGYA 4I1IA 4F7WA 3B8EA 2O4CA 1N3BA 2VI5A 2Z3WA 5JCPA 3ERCA 2B98A 4DLUA 4A26A 1I36A 1E1RD 4M0EA 4EUHA 1G5FA 5JD4A 4B3TB 2AC7A 1OA0A 1TQ6A 1QCYA 3L7IA 2IY7A 3BXZA 5LQJA 3DBIA 3WNBA 4CGZA 1FUYB 3O8OA 3P4YA 4K05A 2P77A 1KPIA 1G60A 1OJLA 1QFMA 2W2KA 3MPUA 3K05A 4KKXB 4TSKA 3T1OA 4X7RA 5A5VA 3WGIA 3USCS 1W88A 3IH5A 1GG9A 1UAGA 1UBHS 3KTAB 4EJMA 1HYHA 1NUHA 2V03A 4YMIA 4EM6A 3LYHA 3I73A 2GEKA 1X2EA 4M8LA 4Y7DA 3F96A 3CUUA 1TEVA 2YJ4A 2BM1A 1H5UA 3F7OA 3G7SA 1FLVA 2KE5A 4MS1A 2IS6A 1GYPA 2AI2A 4H9GA 4ICIA 4FLEA 4M0PA 4LWQA 2D8MA 5D2CA 5D85A 1U02A 3LW8A 1JYSA 3RRJA 3LCUA 4V2IA 1KMQA 1W8IA 3P2EA 3VTKA 3FNGA 4D9FA 1DBWA 4HGOA 2QX7A 3NX4A 4DKXA 4DWWA 4OJTA 2WNIA 1ZR2A 3OWHA 2NU6B 2WWFA 2B8NA 2H1RA 3OPVA 3P0HA 1EE2A 3L92A 4W7IA 5CGZA 3TTYA 2IPLA 2QENA 4EAAA 4ZDKA 2GN2A 4YCNA 2BKVA 1JQ5A 5HK8A 3SF8B 4PYLA 4DY4A 1U0HC 1K6JA 1EDDA 1Z0FA 1E7MA 1EXWA 5JJKA 1PWEA 4EQ6B 2W98A 5EHXA 4QHSA 3B5JA 3DPIA 3ANMA 5AW9A 5BUQA 1JGTA 5LMZA 3JAWA 3PQEA 2HT6A 4WZBA 2AG8A 2V58A 2J6IA 4BP1A 3W5AA 1MX5A 2V74B 4AICA 1P2BA 4K40A 1QVAA 1QB7A 1EG7A 1Y6GA 1SD1A 3DDUA 1R6AA 1E5TA 2GAFA 1ADYA 1P17A 2B1RA 3N6XA 4X5OA 2DY1A 5K51A 2IYSA 5CLHA 3VR3A 1BXGB 4NFHA 2VZ9A 1V6SA 1CP3A 2PKCA 1R9MA 1Y8CA 2JFYA 4Q4HB 5FFFA 3LUPA 5LA6B 3VH4A 2D7DA 3SEAA 2B6HA 3HZZA 1IOLA 3RSGA 1P33A 3HM2A 4AMVA 3B1XA 3CR7A 3KPUA 3R0IA 5F52A 3QW4B 1GA4A 4I66A 1V11A 3BB3A 3ILVA 1TCCA 1Q1ZA 3WGGA 4NBTA 2Q1TA 2G6TA 4MQUA 1FYXA 2H3HA 3CZRA 5AK0A 2PMBA 4MUHA 2ZIUB 3K9BA 3D8TA 1IZYA 3JSAA 1CLEA 1K0FA 1NN1A 3E3NA 3GEBA 4ZTUB 4XCXA 3RCBA 1MMFB 5I8ZA 3IIJA 3G68A 1DXOA 3OJWA 5CG1A 3B3AA 5DSTA 4EG6A 4PZYA 1FLAA 2YC2C 4YAEA 1H1LB 3LJKA 5ITVA 1XWFA 4LJ8A 5ALQA 2HMUA 1XCOA 2Y9MB 3EQ6A 4L5AA 4WWHA 2CBZA 3P5SA 2NTVA 4XH9B 4RANA 1KRHA 1OX6A 4TTSA 2HI0A 2RGNC 1PE0A 3INYA 3EULA 1IM5A 2VHEA 3F49S 3LUHA 4JKOA 2OWDA 1MIOA 4WXEA 4C9BA 4NU5A 1VE9A 3F97A 2O8FA 4TKUB 4NVRA 4DBVO 1V25A 4TWJA 4NDAA 5FNVF 1CRZA 4D0GA 3RTEA 1LBIA 1RPJA 4MOWA 1WIWA 4TLBA 3QVXA 4L6IA 1U0NA 5L53A 5HUHA 3AHFA 2VWHA 3M6VA 4FT2A 2QRJA 4J3FA 3CURA 2JHAA 2OFFA 4FE4A 2G88A 4MVJM 1T3HA 2QU8A 1MD9A 1MGPA 3DEJA 1DKUA 4G9EA 4TYMA 2RSLA 4Y6PA 1R0LA 2C00A 3F67A 4GZLA 2HWKA 4Q16A 4ZP1A 1AXRA 4QGSA 4YMUA 1PS8A 1VL5A 2UYCA 3GIDA 1E1YA 3KZOA 4OJKA 1HKHA 1LNZA 1HE4A 2FSPA 4H0FA 3RRXA 1AKTA 1AO0A 3W0LB 2GWRA 3H4MA 1BVYF 4WKCA 5G4KB 2VBIA 3IP7A 2Q6OA 3LHIA 5L7WA 1Q92A 2BFFA 2VAVA 5FO1A 3IMKA 1NSTA 1YS6A 4KN5A 4YROA 1NXVA 2POCA 2NU9B 4MZDA 1O95C 1XLWA 3EDOA 1FYDA 1LVGA 4B75A 3FDXA 1WDLA 4I8DA 3PQ2A 3G23A 2PNJA 1ULAA 1WR8A 1D1QA 1IQUA 2IY9A 3L7KA 4JVLA 4RD1A 4E5YA 3F3MA 3V55A 3ZY3A 5HTKA 2VO1A 4WKPA 5CB4F 1DWPA 3DNPA 3SHWA 5LXTA 2HJRA 3CRQA 4D6PA 4JP1A 2DBZA 1DAIA 4I55F 1T43A 3JV7A 2XVZA 3HZRA 4NEQA 3FHLA 1C2YA 1N77A 2I5PO 4ZCPA 1GITA 1P5ZB 4G0NA 3QIVA 3Q7EA 1FNNA 1A8HA 2Z0MA 1TYAE 4HS4A 5AICA 4HX2A 4UQPA 1ECBA 1V1RA 1RBYA 2WZBA 3EXIB 3K5PA 3OZBA 4UTZA 5HS6A 2XZLA 2CXOA 3QA3E 3FHOA 4XSGA 1VHJA 1ZC3A 2HJVA 1WOMA 2YFHA 2PVSA 3F6BX 3TAXA 3R0JA 4N49A 3V7WA 1T8YA 2IYEA 3DBOB 4OU4A 4BNGA 5BXQC 5JZMA 2C2OA 4ZQIA 1TOAA 1SXJA 4KSBA 3AM1A 1B6TA 1AKEA 3LI2A 2FZEA 2ZUTA 1J7JA 3DV0A 1VKNA 2GKGA 3L6RA 1QBGA 2ISQA 3HVUA 2UYQA 4P7JA 4R2WA 2PX0A 4UARA 4DMMA 3MZ0A 3P2MA 3PQ7A 3JRNA 4N0PA 1H85A 3B9RA 3KLMX 1VL0A 1BJKA 1Z74A 1SZJG 3MJVA 1CUFA 5E2AA 2QJWA 2E7ZA 4I3HA 2QR2A 3RNLA 3CUKA 1LF0A 3D6NB 4KAAA 1GZ3A 1QIEA 3G8CA 2O2EA 2JLRA 1BAPA 2YVKA 2Z83A 3LXMA 1K75A 3QE2A 1MF7A 3Q85A 4HPXB 4LSZA 1Y3IA 2QZJA 3IBFA 4UDYX 1C29B 2HO5A 2YWXA 3A4VA 3DXYA 3H11A 3H7AA 1PNQA 1A8UA 3K5HA 4UBIA 1CQJA 3PR1A 1TU0A 4B6FA 3E8SA 3TVTA 1W5EA 1QGOA 1VPEA 4KWTA 3BL6A 4I1UA 1H0KA 1KHTA 3TB6A 3HL4A 2NUPB 4MUNA 1WPGA 1HA3A 3Q9UA 3QEJA 2G8NA 1I1OA 4ZOLA 1RRKA 4BQQA 3IOYA 2GN4A 3DOJA 5ARCA 2PUVA 1KMHA 3UWSA 4CWAA 2VF5X 2VRWA 3A9CA 3GLHE 3AUJB 4KR2A 3KLNA 5EIAA 2H63A 2OCXA 3DR5A 3HHPA 4DMKA 3BHJA 3NKFA 3NFRA 2B94A 2GJ9A 4WESB 1NDHA 1E3QA 1ZIDA 4U0KA 5K8LA 1U5AA 2O57A 4OHFA 5AKYA 3ASVA 2JFPA 3MUNA 5DGCA 1IULA 4Y6QA 3ZDBA 4CF7A 1PYGA 3ZZNA 4HRYA 5TGDA 1N1MA 2GK7A 3FUCA 4MW7A 1QV9A 4ENRA 3BK2A 1LNQA 1YZHA 4OEHA 1U2DC 3W1VA 4JI0B 3C3EA 4HP8A 3GOHA 2EKPA 3B78A 1FVFA 4NV1A 2PBLA 4I6EA 3SZOA 1O9HA 4ZVRA 2VDQB 4PW0A 5TPWB 4EZBA 4V02A 4I4TF 4RNDB 4F4IA 5DW3A 3ZHUA 2HLDD 4LBYA 2ZRBA 2WJVA 3FCCA 1RWKA 3F3KA 4FYWA 3I5XA 1K63A 2V59A 5FOUA 4OX9Y 5GM2A 1KVRA 2BFCA 5BVGB 1GNRA 1YE5A 3MMPA 2WNSA 4HYYA 3UV7A 3PC3A 2QN7A 2PR2A 4XRRA 3BORA 3M9LA 3ZJ5A 5FO0A 2X1LA 1YQXA 2JH8A 3IKMB 4C0HA 4TZ0A 2MINA 1KO7A 3TOVA 5BY2A 3RKUA 4OU5A 3TZHA 1GEGA 2C4HA 1NR1A 5AW6A 5HJ5A 4PFKA 3KJEA 4RJTA 3T9EA 1ONNA 3I52A 1H1TA 1GPJA 2XDYA 2YHUA 1IU9A 5AK6A 4A3SA 1TLTA 4Z0HO 4DARA 2YWJA 2QAGC 4B44A 3C3AA 3E0XA 1DX4A 1U7TA 2XNCA 2Z58A 5IUKC 1JLLA 1B41A 4FD2A 3T61A 5K0ZA 4JIGA 2A3NA 3DOEA 3QVJA 2H5JA 4X1IB 4ALMA 1Y7IA 4OUKX 4RACA 8GPBA 3RYHA 1UDCA 4KQ2A 4X45A 4NKRA 4OGWA 3ZHCA 2BJWA 3P2KA 4NHEA 2VR1A 4NYMR 3R3HA 3FSGA 3KYIB 1CQWA 4G86A 3DH0A 2WD7A 3WWZA 5C8DA 1YJ5A 5M7EA 1RLOA 2DUMA 3AJDA 3A6HA 5DSZA 5KOJA 2HU7A 3UPTA 1XU4A 3URMA 2R1TB 3PGVA 4ZYLA 3FN4A 2YXEA 1X7XA 5EHGA 3J81k 2R4TA 3PVSA 2BHLA 4RE6A 3KZ1E 2XNDD 3ND6A 3GT3A 2IEGA 4R54A 1UKEA 2CHGA 3NRCA 3Q7RA 4RD6A 1EJ0A 3AEQB 4AUKA 1MLDA 3DXXA 3R0ZA 4PAMA 3OJLA 1D9XA 3I5UA 1CY2A 4G0YA 1YDGA 4N5NA 3EZ9A 3EEFA 3FTPA 4P3NA 3VYSB 3OOHA 2ADMA 4DLNA 5T4BA 1PX2A 1MKYA 3K6SA 2IH2A 1YVUA 3W06A 2Y0CA 4FR0A 3VM6A 4KTTE 4RY9A 3K0AB 4TXHA 2X4GA 4KQEA 1UKYA 4TMWA 4WW0A 3VOBA 2ECOA 2YX1A 2VDRB 1JP7A 3BZBA 3EAGA 5FUBA 4ZEMA 4QU5A 5B58C 3R5XA 2Y1FA 2Z3VA 4LQDA 3N7UA 4MUJA 3HB7A 4WZZA 2J46A 3LPNA 1V3VA 2Z6VA 1SEVA 4PF1A 2H2DA 4UU1A 2PKEA 2PD6A 4ZAFA 1COWA 4HWTA 3TCNA 1KEZA 2PGXA 3U81A 2VHZA 1YR2A 4YACA 4R2LA 3EXHC 2CD9A 2FJPA 3OJOA 2GD0A 3ENWA 4Z8YA 2F9FA 2HF9A 1M2KA 4DRXB 3DD5A 3JVDA 3NV7A 5CX4A 1XVIA 4K0RA 3I9V6 2C7PA 5A4MS 4IUDS 1YA8A 3ZVRA 2QN8A 1Z63A 4NOMA 3TD2A 1TIKA 2QTCA 4GSKA 1NPTO 4MVCA 4N6NA 4OYRA 1Z6AA 1K8XB 2FFHA 1RXCA 2ZYWX 3O8QB 5JLAA 4B7CA 4AQ7A 1LLUA 2OSBA 3TO5A 2XA2A 2YDXA 2GZSA 2WNHA 3AR9A 3FNHA 1SZPA 2RHCA 3H7IA 3JD1A 3OUUA 3WQSB 3EZGA 3LSTA 1ZM9A 4G0VA 2XT6A 2MHCA 1N5MA 2FF5A 3LSYA 2C9BA 1ID1A 1KDTA 2WF8A 1FLDA 3AEUA 3IP1A 4QXPA 1U0LA 3GLUA 2LE0A 2JATA 3WLQA 5IUJC 1CY4A 1M5UA 3N2NA 4BC0A 1ZOLA 5C32A 2VN8A 5HQ3A 3E9RA 3K70B 3FE2A 1L5MA 4XVHA 3PZBA 3ED5A 3AONB 3H2YA 3R1IA 1N6OA 3ZQUA 3JAMA 2G71A 3PU6A 3CLUC 1OMOA 4EKNB 1MO5A 3DDSA 1VJ0A 4ND6A 4QGFA 1VBNA 4NU0A 3BFVA 3K4PA 4XVQA 5JQWA 1JEYB 3GMTA 1YI1A 5HPYB 4REOA 5FOTA 2GR9A 2NUAA 2A0UA 4HLUA 4INAA 4KRGA 4NZPA 2QM8A 4GWKA 1O77A 2Q0XA 2JJ1A 5BOSB 1DKNA 3MF4A 4LCEA 1Q1AA 4N3NA 1E5DA 4I46A 1OREA 2ZSKA 1RCFA 2OA0A 5EIEA 5JJCA 3ABSB 1N5OX 4JOCA 1T5IA 2VSNA 3UMCA 2WU3A 4N3CA 1JG6A 4PFJA 3KAQA 2V4ZA 3SCZA 4BV3A 4O2AF 3K71B 3KTDA 1Z38A 3BFKA 3UJBA 1Y63A 4C3OB 3ZJUA 3N8HA 3QFSA 4BYGA 4PRKA 3WYEA 5CAEA 3UJ7A 4LMRA 1WPRA 4OP1A 4C7JA 4D9BA 1JIKA 2VNAA 1E5LA 3A6DA 1W8DA 2D7CA 3UB2A 2C3OA 3A05A 4ZA2A 3UQYS 4ETNA 3CHYA 1GKLA 1I4TD 1XQ6A 2XTZA 3PICA 2NO9A 4TN5A 1L7AA 1JFRA 1FFCA 1OCEA 4HUJA 2FEAA 3SNKA 3QBTA 4AYXA 1TEZA 2HTFA 3DMFA 2IWRA 4KIUA 3S68A 3A3YA 1DIOB 2QTWB 1KO5A 3E7WA 1VE3A 1W49A 1YV9A 1G3MA 2ZSUA 4RZXA 1EUDA 3JARA 1US8B 2ZI9A 1X14A 1NKVA 5IH7A 2GLXA 2CW5A 2EDAA 2HWUA 3FVTA 4YMWA 3Q7QA 2QV0A 3AHDA 3GFGA 1XN4A 1QANA 4WECA 3IBSA 3K8ZA 5H70A 3EQ7A 3RSLA 5JW6A 5KVCA 1BXKA 2BPOA 1SUIA 1ZA2A 5T4FA 4WNYA 1RWWA 2FW6A 5H83A 1JQKA 3ETJA 5FBZA 5GP1A 1S5PA 3INNA 4ZYZA 3DBHA 2RH9B 2OE2A 2FPIA 4U02A 1JQJC 4F9GA 1GLNA 1ISHA 1VL1A 1MJFA 4EX6A 4WVLA 2RCNA 3I9KA 3U49A 5K0JA 3ZIAD 4TXMA 3F6RA 1KFEB 1Q0QA 1XDSA 1TJ5A 2DFTA 4PLVA 5BWOA 3CF6R 2DUUA 3I04A 2ZSDA 1X80A 3SQDA 3B38A 4AZ3B 1U8YA 1C14A 4PZAA 4KIGA 1ULUA 1HWYA 2DG2A 3NIGB 3O9VA 4YRGA 1Y8AA 3OZEA 4EMUA 1Y8ZA 2V6BA 3PPYA 4PO9A 1CFZA 4RETA 5CNMA 1YZLA 4B43A 3NAZA 5EPUA 5BV1A 5TV2A 1W5FA 2VHTA 3KUCA 5GZ6A 4YIHA 3BGOS 4W8HA 4M1KA 3OX2A 2J7KA 3ZHZA 3ZV6A 4M37A 2F3SA 3ZI0A 2H1VA 2I99A 2H07A 1AHHA 3L01A 2QW0X 3QMWA 1LSJA 2YWFA 5EXPA 2ZVDA 5EUQB 3X3HA 4UTNA 4GYWA 5CVJA 3ADDA 4C0BA 2CHVA 4E7PA 2BFNA 2BJHA 3F3YA 3MM4A 1M75A 3QKUA 4QPCA 4XDHA 4ZI7A 2E4UA 5A04A 3WLSA 4MCAA 1H4SA 1WZUA 4J0IA 2JFQA 3CH4B 3KEGA 1NYQA 4M1TA 3N59A 1IUOA 1KI1A 4NZOA 1ZMTA 1CNFA 1RYMA 1Z5WA 3OM1A 4G8JA 4ND8A 1BKDR 2R6AA 1MXFA 1UQUA 3FI0A 5ESWA 5ES3A 2R1ZA 3VHXB 3BWXA 3BDAA 3PGKA 4MR7B 5K0FA 4LYJA 2QDKA 3HFRA 5IKPA 5JARA 2IU4A 2TS1A 3WL7A 10MHA 4G4SP 3IAFA 2Y77A 2WG0A 1FJ2A 3B8HA 1PO7A 2VJOA 3ABRB 3MWLA 4DQDA 1ICEA 1Y6ZA 2L18A 1P0IA 4LIPD 4L3WA 2FK8A 4Q7JB 3GUVA 4TMKA 4G0MA 3NKLA 1CIVA 4QU0A 3T7DA 5C53B 3UJPA 1BVHA 3UUFA 1N2HA 4ED9A 2J0EA 2DQKA 3B1JA 1CS0A 3KE9A 3FCEA 1E61A 4RIGA 3UC5A 3BXHA 3COJA 4K9DA 4FFBB 2WZDA 2JAOA 5DXAA 1SWVA 3A4MA 4EY5A 2QLFA 3GZJA 4J0DA 4IJKA 5JMOA 3NXKA 1W75A 3OUZA 4V1CB 1XTQA 5TJHA 2WSLA 4DV3B 3RAFC 4FIZA 1V9CA 4RLHA 1HQYE 3T1VA 3OPYB 4AJEA 3C3MA 3RC9A 5D01A 2A92A 1K4KA 3IOBA 5KCMA 3DVAB 4F5WA 2ZWPA 4NZZA 5HZGA 4AG5A 4C2AA 1ES9A 3X1ZA 2V55B 3ENNA 3ZU6A 4DUGD 3Q5GA 1XLTA 3FRIA 1JFVA 3RK1A 3T5DA 2ZXUA 4ZK2A 2VH2A 3OTQA 1Y3CE 4C3UA 5JXIA 1V8FA 4QUKA 5FYQA 1H94A 4I36A 5D5HA 1IBCA 2QD3A 1LFDB 3IDOA 1E2BA 3Q98A 3SR4A 3ZE9A 5H9WA 1X1DA 1ZZGA 1T26A 3ACBA 3UFBA 3TXXA 2HZ7A 4JBNA 4L74A 4I7EA 3FLAA 4LYAA 4KQKA 1Y80A 2BTQB 4YCDA 3NNSA 1U2PA 4YJFA 5HZHA 3AGQA 1KDRA 3UFXA 4CMKA 4MVJI 4DYVA 2EFCB 1MQSA 1Q0ZA 4KQXA 1DC8A 1GQOA 2FRVA 2O4UX 2Z9DA 3C45A 3GYBA 1C3XA 3HJNA 3PX2A 5EG5A 3L2OB 1RWPA 1Z0IA 4BB6A 4BFYA 1YRWA 3WRXC 3ZXXA 3SXJA 3FTFA 1RPTA 1FVOA 1SCIA 2X6QA 2WM2A 1A9TA 3R5SA 4RFLA 3RT1A 1JMVA 3ZD6A 2YNMA 3L0CA 1Z82A 1PJ4A 2R68A 2QYOA 1R37A 5EVCA 1L7OA 4D6YA 2IIBA 1E3WA 2E4WA 3BMXA 3RF6A 4UXJA 4MUAA 4DJAA 2ODEA 2Q4BA 4RMNA 4U2FA 2H7XA 3IO5A 5DM60 5KTOA 1T6YA 3U4IA 4QYIA 2HBQA 2WKPA 2I91A 3B12A 1JAHA 2C31A 2ZAOA 4QO8A 2J3EA 3DFFA 3IBYA 2OK7A 1A5SB 1QR6A 2W37A 2Z1NA 3MHPA 4QEDA 2DOKA 3TF5A 3RS4A 2YV2A 4BB0A 2HREA 5PGMA 2AG6A 2B5VA 4X71A 4X1KB 1GL3A 3OMLA 5KJ1A 3UN1A 2I62A 3KVVA 1LXCA 3TZEA 1LX6A 1HV8A 5CIWA 4MIYA 1ORHA 1T1EA 2PT5A 2WFZA 2ZIAA 3AB8A 4MGIR 1M2WA 4AJ2A 2N75A 1XD8A 2OGSA 5AUOB 1NTOA 1N3IA 4KQJA 3BT7A 4DCUA 5ARBA 3UIEA 2OBFA 2ZE6A 5BXYA 4J0KA 4CLHA 2JARA 2XTAA 3GN1A 1EZ1A 4DDHA 4RTSA 4HWOA 2FEMA 3HCAA 1VLVA 3QVTA 5F2KA 5F4ZA 2DMRA 2GZ2A 4ZFNA 4CEIA 5CXXA 1O96A 1KZ9A 2Q45A 4M0FA 2L82A 5DLPA 1YI0A 2XB2A 1UH5A 2PGDA 5HMLA 4FLFA 1OB2A 3QU5A 1UMCB 4BV9A 5EP3A 4CF5A 5KNLA 3RSSA 2PZMA 3THWB 2H59A 4RIHA 4UZSA 5TXGA 3AEXA 1NA5A 1ZK2A 4J1NA 2WIJA 5BQPA 4E21A 2P9CA 5IAAA 5A0FA 2O2ZA 3KT3A 2OORC 1Z2AA 2QQEA 1RPAA 2OO5C 3H2JA 1E1CA 5DJ5A 4IJMA 3SS8A 5DT9A 4E70A 1MC4A 3D3JA 3OPQA 2WQ6A 3FNIA 4H1HA 3HXOA 1GZSA 4DEXA 1U3GA 3N8DA 1C9YA 1MB3A 4KNWA 3RJMA 2IXTA 2B7BA 3L4BC 2JIMA 1PG5A 4CQMB 3FCSB 1KI3A 1DIBA 3ZQ6A 4HSEA 1MBZA 2CJWA 4MTCA 1PL0A 5E6RB 4MUGA 3EWAA 2FXIA 4ND3A 2F55A 4PV7A 5LZ7A 2WY2D 4ZYYA 4DR5B 4WD3A 1W5TA 1PQPA 2G5TA 1BX1A 1SKMA 4MAMA 2O0HA 5AW1A 5KX5B 2D59A 4HLCA 4ESEA 5KKCA 3K70D 4Z4FA 2REBA 1AHIA 3AUAA 2I9KA 4RHTA 1P7CA 1YA4A 3A58B 2ZRJA 4H3VA 4XRGA 2WHPB 5ADWA 4X84A 4QTZA 4BEBA 5CA0B 4LHXA 3J80A 4H16A 1RMTA 2IHNA 3H6KA 1T15A 4FUQA 1A9XA 4YWHA 5AI8A 4L8FA 3OT1B 3S28A 3NU1A 3K1AA 4DT1A 3AL3A 4KMSA 3K31A 3QMPA 2AN9A 1L8XA 3UZUA 1L1EA 2ZRIA 1JBKA 4QL3A 3E9DA 2IBSA 2PUDA 5AI6A 1E32A 4LVOA 4TTPA 1L3IA 1JPUA 1RLJA 2RK3A 2ZR7A 3C8DA 5GMOA 1WNTA 1NXSA 3B36A 3EGIA 3Q1LA 1EJBA 2JCXA 4E1BA 4HDKA 1XVVA 2XSZA 1YA6A 1V48A 4KGVA 4KZKA 1NUPA 2YVUA 1T2UA 3DBLA 5A6SA 3E48A 2G9UA 4IRMA 4A0SA 5A5FA 2DGDA 4TLLB 4G2NA 3A1TA 3GLGB 4P4NA 1QQ7A 2PPLA 2VZLA 6PFKA 4UE3S 5ALLA 5IZCC 1E2KA 3MRSA 2ZRMA 1IB0A 1P18A 2ORWA 3ZHXA 1TCAA 1DFHA 1P1BA 1A2BA 3RLFA 4CMIB 4QM7A 1AB5A 1SC9A 4RENA 3I0MA 3KL4A 2G40A 4KQGA 5IG2A 1L4BA 3NTUA 1P2VA 2OXTA 4L75A 4M99A 4MUMA 1KL7A 3SSAA 5CG2A 4X66B 1LBTA 1VIVA 2P90A 3QI7A 1AV6A 4KI7A 2ZRCA 4TLAA 3AKZA 1FTNA 1PKEA 3JYHA 5EYPA 4YJHA 1F48A 3EFEA 3CUTA 5CJ2A 3KEOA 4EDHA 4R1UA 4A2QA 1Y5NA 2O52A 1BCSA 2QRKA 1J1IA 2HRRA 4MO9A 4E33A 2GHQA 5ECDA 3KLOA 1RVDA 2Z2KA 1QORA 2PMWB 1P4HA 1OLSB 1P7ZA 4FNGA 1UBKS 5K99A 2AKYA 1Z0JA 2COKA 4R01A 3UATA 3OQIA 2DZDA 2YJ5A 2W2QA 4JYBA 1XNGA 1FTSA 2FPOA 4NXNB 3WDMA 4O59O 4GZ3A 1SUCA 3ETDA 3Q5DA 3I37X 4QNMA 1NASA 1N9GB 4H1WA 4P86A 2ZTLA 1KH2A 3IV9A 3TQRA 1ECFA 1KC1A 3AETB 1YS9A 1ZFNA 1Y9JA 2JFBA 3BMOA 2R87A 5JCOC 2IZ7A 1QGZA 5LD2C 2N1BA 1HE8B 2PTGA 5C8VA 1T9AA 3B6KA 4CLEA 4M9UA 1YQQA 3R24A 4BX2A 4CT5A 2BEWA 2NAFA 1C9MA 1XLUA 1OXMA 4GXRA 4TM8A 2XVYA 3U9TA 1HY3A 2J85A 2J1LA 1PLLA 1ZICA 2FI1A 4HVCA 3H2KA 2CWWA 2YHIA 3BIFA 1JMKC 4JOBA 2OBMA 3HI6A 3JCZA 1Y4ZA 1KZ1A 2EP8A 2JLWA 1QDUA 2DP4E 3HY4A 4BASA 4NAUA 4UEWA 1IWOA 3DZKA 1N3YA 2NTEA 3NBFA 5KS2A 5LJIA 621PA 4Y0AA 3EFHA 2H1FA 4PLGA 4CLOA 5EHZA 3IL2A 4IDGA 5BT9A 3NM5A 5EJIA 1RAEA 4BNXA 1CR1A 3MJ4A 1Q95A 3Q3HA 1W4CA 5DISB 2AC4A 1CY0A 4IIJF 1QGAA 4LA4A 3K20A 3C7AA 3BMQA 3EA5A 1MDBA 3BOSA 4W5JA 1D9ZA 2W4MA 4V2UA 3AUYA 2P30A 4KUHA 1SC1A 4E2WA 4LF9B 1T4CA 1T0HB 3H86A 1GD1O 1VLJA 4LYEA 5FBWB 1DKQA 2C3YA 2ZBEA 4Y6SA 2I8LA 3LGSA 4OYHA 4I3FA 4YB8A 3D6TB 2AE1A 3HKCB 2PUAA 5AVQA 4RMHA 3Q3GE 4NCKA 4QO7A 2QTLA 2Q2NA 4MB0A 1BGWA 4KITB 3S8EA 3UK6A 5G40A 3V2UA 4MHOA 2QXYA 3NIWA 3KKPA 4CMGA 4DQXA 4ES6A 5JDIC 4CQLB 1O97D 5FJIA 5F3RA 2C9YA 1UJNA 1Y81A 3KXKA 1L4MA 1N57A 5KWEA 5FFNA 2VJYA 1TECE 3JQFA 4ZQHA 1E7RA 1Z4JA 2NV2B 1UCFA 2X0EA 1E1MA 1A4IA 1NUAA 2QQ5A 3RFVA 1YOVB 3HL0A 4HDRB 5AUPB 2W6ZA 3SVTA 3SHVA 4UDOA 5KB3A 1KS2A 2HWWA 5KINB 4W5NA 1NATA 3EVDA 1FSPA 4F86A 2O8DA 4I4CA 3BCUA 5LYJB 2XE8A 1IEQA 2B61A 3C3KA 3OMXA 3R6GA 1Z4LA 4OBXA 4IHQA 1O54A 3AOGA 1QX3A 2W6IA 1WKVA 5A03A 2EHDA 1CZUA 3MGGA 2BEKA 3QENA 2JGDA 2CXPA 2X9QA 3KR9A 1H2XA 3QG1A 2Q3BA 4TPKA 5A1JA 3JU3A 2H06A 3NVAA 5B4TA 4RUKA 1NV8A 3E7FA 4HNTA 1X39A 3T99A 2RHDA 4K03A 5C4IA 2HF8A 5DOZA 5EWLB 3S2YA 1J22A 1ENOA 1M2JA 1TTHA 3FWHA 1FA9A 4QTTB 4GE0A 1SQ0A 3BGIA 3W5BA 3LLMA 4CCYB 2O2SA 2I65A 1OZGA 3OIWA 4K6MA 5LCXA 2EZUA 16PKA 2OEPA 3KU4A 4PVCA 1TT5B 4Y9RA 1NW9B 5H82A 5JPIA 4OI2A 3KYJB 3PSAA 3P52A 4K81B 4KR9A 3WYAA 5KDOA 5FIUA 3G8AA 3A06A 3KHUA 4E30A 3EZ6A 2REQB 4KQ1A 3MERA 4W1QA 2WUGA 2HPVA 2XUQA 2XKBA 4TRJA 4C3ZA 2QLBA 1AUOA 2J5RA 2XUOA 1W59A 2X4IA 2FWBA 2CJXA 2WAMA 3KFXA 5I8WA 1YKFA 4CG3A 4OXIA 2RJOA 5EA2A 1N8TA 3EH2A 4KWCA 5ESDA 1BOOA 4DDTA 2J4DA 5C8YA 1KOLA 1E79D 5CBPA 1U7OA 3KLBA 2BDTA 1QGUB 1UFRA 4TT3D 5KQSA 5L45A 2HMVA 1ODSA 1SH7A 4HXFB 2WLSA 1UZMA 4GR9A 5CDSA 4PONA 1RC8A 3S1LA 3EXAA 1AGNA 2E49A 3I9V1 2GM3A 1QHSA 2OFOA 2P8SA 1RKVA 1UFVA 2YWBA 3AR5A 2N46A 3FHCB 4GICA 4KHZA 2CLEB 4MCHA 5AW2A 2C92A 3FVQA 3DAPA 4MA5A 5THKA 2RK4A 1P3JA 3D7LA 3EIUA 3L8DA 4FJ1A 4L5IA 2ZWOA 1I4WA 4H0CA 1A3CA 3H5LA 2Q27A 5DIFA 1XTSA 2CK3D 2XCOA 3K94A 1ZOOA 4L02A 4IIXA 5FI5A 4HDOB 2CMFA 4CF6A 2CY0A 5ALEA 3TSAA 1OTYA 1UQRA 3AM4A 5J5AA 4LW8A 5KYGA 3FZQA 5AO9A 1FFBA 2H4FA 1SU4A 5D84A 4DR4B 4WKOA 2HJ9A 1CUXA 4IDQA 3SC4A 3QWHA 2C5EA 4GX0A 2O3JA 1GGEA 1ZH6A 5DN9A 1OWOA 2XH8A 4HWRA 5H5JA 4EHFA 5CU7A 4FC6A 1MRNA 5GADl 4X44A 1DBVO 3EVCA 1Q1NA 4NWIA 4BBJA 4TXNA 3PFHA 1WLYA 2ZANA 3TRDA 9ABPA 2IQ5A 4TGLA 3MGKA 4GRAA 4UAVA 4DG8A 2PT9A 4EB8A 3HUEA 2GJKA 3E9ZA 5H4HA 5L3QA 2YWDA 1F2UB 2IF0A 5EMNA 4CQMD 2B37A 5G53C 3RYFB 2M6SA 4FHCA 1KFJB 1W581 2JBAA 3LUFA 2UVQA 3SXUB 4BLQA 1XPUA 2VSQA 4B6JA 1ADBA 2BSXA 2XRYA 3KR0A 5JD5A 5DTEA 2JFWA 1QPGA 3L7AA 3CZ9A 2AWOA 1LTKA 3S44A 3TNJA 4AYWA 1XJWA 2DFPA 1DTEA 1N8NA 2J0VA 4LFBB 3KKZA 5FWAA 4LXIA 2G82A 5AVTA 4A0FA 5LSAA 1DUIA 3PGXA 2X4LA 4P3KA 5LP6C 2O8EA 2C78A 4MPJA 1U1DA 1PZFA 1W85A 4PIPA 2GZRA 2O07A 1NC1A 4C0LA 2WU8A 3AUKA 4EKYA 4EZEA 1RM3A 3KQSA 1DKLA 3UMYA 1WF6A 4BVEA 4FW8A 1AGXA 4MRSA 4IF6A 4QE3A 3EIHA 3OUTA 3UJ8A 4GOND 2KSQA 4Z9XA 3CRRA 3U1BA 2NO7A 5G0WA 4CQNA 3EPJA 4EFLA 2G9QA 4XIYA 3D1JA 3CNEA 4ZQGA 5KU7A 2GFHA 3HBNA 2BBWA 2V9PA 2ZU6A 4QODA 3MT0A 3ICVA 5D7BA 2XJ4A 2FEOA 3WL4A 2BKUA 5DB4A 1T3LA 3AHEA 3V1TC 5U4QA 4JJFA 1NULA 4O08A 4NG5A 1GTZA 2WF6A 5FTMA 4Q3OA 1YC5A 5C1BA 1CE8B 3L8CA 2QRVA 1AS3A 1BMDA 2B20A 2FMIA 3H9JA 5EIHA 3TKYA 4DS3A 3G82C 5JVDF 1XP8A 2XADA 2IKSA 2XLCA 1NW6A 3LW7A 3LQRA 4BFLA 4JZYA 2CNBA 3OEHA 3ETCA 1ZK0A 4W6QA 2XV1A 1WXHA 5A0VA 2H2FA 3BWVA 3K0BA 2YKGA 4CEHB 1FRNA 4NENA 2V4UA 1XCMA 1A9RA 4NR0A 1JLHA 1JLSA 4IIGA 4I1OA 5SZJA 3DFZA 2OOSA 4F8YA 5JNWA 2IXDA 1INLA 2GVDC 3AMVA 4RORA 5CK4A 1OH7A 2B4TO 4QYWA 2NUTB 5ECYA 2QTTA 3LD9A 5ARDA 3T7JA 1MZVA 2FTKE 4IIBA 1AHPA 5HQJA 2P78A 2QN2A 4OX9B 1BMFD 2F62A 4ABTA 1ZI9A 2H1SA 5FJJA 3OF3A 4D45A 4EPRA 5FWXB 1Z37A 4EHAA 1NM5C 1X3SA 3HJRA 3PTLA 4KR0A 1SBCA 5DM1A 3BH7A 5K9ZA 1H22A 2P9ZA 2QSYA 1L6RA 2VAXA 4MP3A 4K6FA 4I5GA 3FMGA 1M1UA 4Q3LA 1RTKA 4QHYA 1DAEA 2H5IA 3BJIC 3GT0A 1IHPA 3B3GA 1C30B 2KJQA 3ZWXA 1RM4A 1ZUD1 1NUTA 3LL4A 2ZRLA 3GZTB 1LBEA 4F56A 1DQYA 1LQUA 2DR0A 4TM7A 4F8EA 3EBLA 2TMDA 4OBBA 4D9JA 2WWYA 1Z0AA 5IT9A 1PT7A 2WRZA 3QQPA 4OB8A 2ZIXB 4M6WB 2JIRA 2VG8A 5ALMA 2P7HA 1MCZA 4LWZA 4Q19A 5L3SA 1I7SB 3HPQA 2PWZA 5DTJA 1JYEA 3H5NA 4K9LA 3AU8A 3T5PA 3GK3A 4YN3A 5JZSA 4TTRA 2SCUB 1SUEA 1PFGA 3AEYA 4ZGWA 1L4NA 3O8RA 5EE5B 1TM5E 4LRSB 4I5DA 2SKEA 4MQ6A 1DARA 3I8OA 4LXQA 5B12A 3PX7A 3LUBA 3AW9A 4RK0A 3HO8A 3VYWA 1ITZA 3CC8A 3W5IA 3EFOB 2PV7A 1YGYA 4WNAB 3WSVA 2V6GA 1JEEA 1SCUB 3LX5A 4A2WA 3VSEA 1UFQA 2QT9A 5A4FS 1MA0A 1Q6ZA 2X13A 1X7HA 1P5HA 5GVSA 1ZJ5A 1BEZA 3TN7A 3IODA 5IDXA 5CCEA 3JQBC 4UTVA 1F8GA 3G2NA 2OV8A 3IDQA 3R23A 4MJXA 3YASA 3IKLA 3QU7A 2QN9A 4Z1MD 3T7CA 1BMTA 1OXKB 3G2QA 4M7WA 5LB2A 4Z54A 5BN4A 1IVSA 1OI4A 1R4ZA 4MEBA 3WQRA 3GUCA 4EHHA 3H5TA 2BHTA 1RHUA 3MB8A 3SU8A 3QHPA 3E8XA 4PSUA 5JSHA 4JEHA 5ER9A 3SR3A 2QG9A 2I29A 3O4IA 2AEFA 4N8DA 5H81A 3WK9A 1ORWA 4KRFA 1GDDA 4LG1A 2G1AA 1TYDE 2H54A 3O2QB 2ONYA 2A58A 1RVV1 3BXFA 4M98A 3USES 3TCKA 1N0WA 3RNOA 1M5RA 3TQCA 4G0WA 1RRGA 2PU5A 5SYNA 2JZOA 3RBXA 1XZFA 5I4KA 4F93B 4MHTA 1JXQA 3HFGA 2JVKA 3ABOB 1HM5A 3Q3CA 1XZBA 1ZU5A 3QI2A 5JHHB 1H3EA 4B46A 5E6UA 3UC9A 4TS9A 3DAYA 4A9AA 2OHIA 2VXCA 1P2UA 1YULA 3GCGA 3P0IA 5E3HA 3T34A 2XITA 4JHXA 4UBNA 1T6XA 3TLMA 4DCPA 4WPGA 4W5TA 5F21A 3NEAA 1DHRA 4IDNA 4BJ6A 4G1EB 4BO5A 4IHKA 4HPJB 2JLUA 2VEDA 1ZSYA 2YZ2A 3BXXA 1XK7A 3NB0A 5TT0A 4X90A 4BVFA 5JDCA 3ST7A 2AZMA 3A4LA 2XODA 3CMCO 4K1LA 3SDZA 5CFRA 4A16A 1Z5UA 5TS2A 5CNIA 2FSVA 3VZQA 1WBJB 2F9MA 3W1WA 2Z43A 3HCEA 4BU1A 1M6VA 2VJAA 4IW3B 3P9PA 1V8DA 1ZN8A 1QYVA 1J00A 1K92A 1M0TA 2PZEA 4TS1A 3TRHA 3EVBA 4B4DA 4RU1A 2C4NA 4OA8A 4GRIA 2A1UB 1EVKA 2XCUA 3DL4A 4OCZA 2DWCA 4R81A 3VAZA 2GBPA 2JVIA 4YDRA 4WCFB 3O1HB 4QYTA 2YWGA 2D3TA 3S2EA 4TKVB 2RGBA 1VECA 1Z22A 2IODA 2A0YA 2RE8A 3THSA 4MVJP 1JLKA 1L4UA 2O7QA 3H0EA 3KUDA 4WJKB 1QP7A 5EXTA 1EDBA 3OT4A 1JDZA 2YOFA 3LY9A 5A4KA 1QV7A 5EWMA 3ZJYA 5KYYB 3DMPA 3Q87B 1Y37A 4FEGA 4D57A 3ZCPA 3C8ZA 2RHGB 3RVRA 2C2ZA 2PIAA 4MUKA 4A6XA 1I0LA 1JB1A 2YYYA 1ZR4A 2PWYA 5FEMA 3G0DA 5LR6A 5CX1A 2P6OA 3U3DA 2WKQA 4XB6B 2EKDA 4Z4EA 3E82A 4NZ9A 2XHZA 4XVRA 5AHXA 5GONA 1MO6A 3NOQA 1B3BA 3M6WA 1ADCA 3PXXA 1B6SA 4REMA 5ERYA 5B4UA 2WDZA 2P2SA 2V7XA 1LC3A 1VHDA 1E3EA 1W2WB 3EIEA 4OH1A 3TLGA 2H2WA 4EEKA 3KDSE 5BN1A 3DXZA 2PMEA 5JNRA 5GWXA 3CSUA 3Q8MA 1E9BA 1JG4A 2VQ6A 3OJEA 1WZEA 1PRYA 3F2VA 3LFTA 1JA0A 1UOQA 3DWGA 3QPCA 2ZR0A 1RRFA 3FB4A 4IOJA 2IDJA 3NC4A 3B6ZA 2A5JA 4K3VA 3VISA 3K6RA 4ZO9A 5CYGA 5GGXA 4KBYA 4MR8A 2EJWA 3JWJA 3L6DA 4U0JA 5I9IA 1L5NA 4U5XA 5JZBA 2OFXA 4J03A 1ZESA 1ULSA 1LDMA 1XEXB 2WJAA 1N6IA 1OX4B 2HA7A 3VAYA 1QDLB 3HA3A 1DQSA 4C6TA 4DDUA 3TLEA 1NQVA 4O33A 3TNYA 521PA 2OPBA 1I6MA 2JBHA 2XXJA 2XUHA 1XD9A 5E9WA 1HPLA 1UKBA 5FXMA 3WLJA 1EX7A 1SCDA 3GLRA 4W5QA 1FUUA 1PHRA 2IZZA 5CM8B 1PS9A 4B3SB 2P41A 4QSHA 3AP1A 3M4YA 1XTTA 3WOVA 3DZFA 3GFPA 1G5QA 5CCXA 3HZOA 3UT5A 1CQIA 1UJ6A 3U7QA 3HKDA 1E9EA 2GGSA 1EVEA 4Q3DA 1ZGZA 1L4GA 2IZ5A 4M9SA 4UNNA 4HAOA 3TTXA 4OGGA 3SQLA 1NL3A 3H5VA 2WJ4A 4DBLE 1IN1A 2OC4A 4KYIB 4UNPA 1PQ4A 3F4BA 3ZNQA 4JODA 4PZCA 3IA7A 4IFEA 1ESMA 1YSCA 2YQ4A 3QSYA 3RC1A 3DMDA 3PKJA 1CK4A 1IB6A 4CIYA 2NO4A 4YGXB 5JMPA 1LJUA 4A0GA 3E0QA 3FETA 4UDXX 1VE5A 4QDXA 4NFYA 421PA 5KWJA 4M1OA 1SWWA 3AC0A 4XPZA 5GIOE 1KO4A 1J0AA 3DBVO 3MINA 5HP4A 1T1IA 3QVKA 2Y67A 3TQFA 4CVNA 4B4OA 5AM5A 2GMWA 4A0QA 3IYLW 4FJ0A 4OUDA 3ZKWB 2B82A 2CWDA 1GCOA 1L7DA 4B79A 4BVGA 1KZGB 1QFZA 1W1WA 4MLZA 3HWWA 4CM4B 2R6R1 3LXUX 4NATA 1Z4PX 3ZXIA 4AF7A 2X23A 1NI5A 5LU9A 5LKRA 2JEYA 3V80A 4ABYA 2D74A 4M9ZA 4D7AA 4PNZA 4UJ3A 2J67A 2PANA 1VJRA 3IQZA 1XTRA 2VQEB 3DEIA 3OTWA 1H2BA 2EFJA 4D3ZA 2BI4A 1DG3A 2NMVA 4MGHA 4QUAA 5JLJA 3FYUA 4H27A 1VE6A 2BKEA 5JNSA 3A1WA 1C3OB 2CYAA 2J09A 1JXAA 3GJYA 8ATCA 5IAGA 3E6AA 3L8GA 3D7SA 3HADA 2H1HA 3LM8A 5K0GA 3U4GA 3D0RA 4Q15A 4GM0A 4H1VA 2EZTA 5F73A 4DMLA 3SFVA 2UVPA 1CJUC 3IBCA 4IIDA 4CF4A 1PYOA 3SVZA 1P3DA 2X0DA 1VSQA 2HADA 4TLDA 2FPRA 1CIJA 4PC6A 4REQA 4YRSA 1NE7A 2IHYA 1C9KA 3GLHA 3I4FA 1AKUA 3QYAA 4HGYA 4D9CA 5JJBA 4DR6B 2Y4OA 4QBIA 2H5EA 4MK4A 1Z08A 4YRBA 3L6UA 3CRVA 4MV6A 5DHFA 2V6FA 5EWJB 5LJLA 2AZ4A 3BRQA 1QVZA 4RKYA 2F43A 4RJKA 3SBEA 4DCCA 4DZRA 1BGXT 5KPJA 1CC1S 1J42A 2C0PA 5HKKA 2PUGA 4ZOEA 1TCUA 1O6ZA 2W2VA 3JQAA 4LDRA 5HCNA 1YAJA 5EFOA 1KVSA 3ONVA 1B23P 3DE3X 4QM6A 3U6BA 3JYOA 4BDSA 2EERA 1U3UA 1NAHA 2R7LA 4WLUA 4UFNA 3V7UA 3GJQA 3N6VA 5JVDB 2XYQA 1SBYA 5CIQA 5FNZA 4BO7A 4UNSA 4X97A 5AXDA 1Z7WA 3REOA 1J09A 1JPNA 4PLHA 4OI0A 1W44A 4GLOA 1REQA 3T3OA 4HO1X 1I2CA 2J32A 1RQ7A 3DOIA 4HRAA 4I50B 2WT9A 3ZE8A 3WGKA 4BBPA 5F5XA 4QBHA 4DZTA 1T2VA 1ZPDA 3OZTA 3UANA 4RA9A 1PG2A 3AK4A 1R8JA 5ICFA 1I7DA 2D1SA 3BCRA 3CEHA 2VTBA 3H2HA 1E1QD 1V1MB 1JBEA 3UHFA 2C2WA 4S1OA 4LPKA 1F14A 1UFKA 1R0SA 1CDOA 1E3TA 1MENA 3GJSA 1QUEA 4J0CA 5EJAA 4O2BA 5PNTA 2ODBA 2R47A 2DJ5A 3MT8A 1RM0A 1XZKA 1H8HA 2P69A 2C59A 2M9MA 5TQ2B 4AS3A 2UZ4A 3NIDB 1WS6A 1P8AA 1TW3A 2VTKA 2JRLA 1UZLA 3H6HA 4POAA 3PUVA 2WFLB 1MX3A 2VH1A 3HPRA 2NO0A 3GLVA 3QH4A 1A9SA 1E1RA 1L9KA 1P7YA 4LX8A 3WQHA 1ZUNA 2FOLA 4DDKA 2HFJA 4GKVA 3RSZA 1ZD2P 2MYTA 3D8HA 4JLWA 2AUMA 4YVFA 3K8QA 4TMZA 3AZQA 2BI7A 3W9UA 2NVWA 3NBKA 1M9NA 1CV2A 4GMFA 3OMWA 2CCJA 5FBHA 2DH6A 2O8VA 1IBKB 2IXBA 3CLRD 3AY6A 3HBAA 4U6QA 5H59A 2ISCA 3UJ6A 4NPAA 3PPXA 4MI9A 4COOA 4NCIA 4B48A 1JIIA 4BX0A 5K0EA 5JY6A 3LKBA 5LIRA 1RQXA 1QU3A 2A86A 1M0WA 3HDGA 4QFCA 2MSWA 2XMSA 3C3PA 3HVRA 3FVWA 1QS0A 1USWA 4JN6B 4EY8A 1EUYA 1CRPA 2BEVA 5LZ5A 1USKA 2XZPA 3PDCA 3STHA 1PZHA 1SC3A 3OQPA 3K16A 4QX6A 5CD1A 2BSQA 2ZI6A 1PK9A 2A5YB 2YVAA 1BGVA 2QE6A 3D6JA 3F9RA 1ZD4A 2BFDA 3DE2X 3OD1A 4MTLA 1JFFB 4YJ3B 3F3SA 3LS2A 4UULA 4MICA 3RTGA 3EHDA 4NBRA 2OFWA 2VHWA 1TQ8A 1NW7A 2CN1A 3AILA 2QRHA 1OV4A 3KE8A 4R0NA 2ZSJA 1RJEA 3ESBA 3AVTA 3MCVA 1T9GR 1H05A 2NM0A 5HDBB 2EC5A 1V8PA 4IV0A 2NYUA 4R69A 4ESVA 1YUBA 3BAFA 4ZI2A 4MQ4A 1E2PA 2OXIA 2XMQA 2R6HA 3PEFA 5HE8A 4CV1A 1DIGA 4JX8A 2HJSA 3MD0A 5KVAA 3KPWA 2HN9A 1ZK1A 3RUPA 4BNLA 4HJXA 4E4RA 1XTBA 1EQ2A 3REQA 2YZGA 1ZEJA 5G4LA 1YS2X 5B2ZA 3LQKA 3U60B 4F1KA 2V8OA 4B4VA 1P91A 3WVNA 2XB8A 1IOVA 1D1PA 1Q0RA 2Y1KA 1YZGA 3KJNA 4LHWA 4H6XA 1TI7A 5TEVA 1VYHA 5EI5A 1AQUA 4MWTA 2BFMA 3TE7A 3P4UA 1M34B 5B5SA 3A6LA 3ZCUA 1J0CA 1T3GA 4N7MA 4X6YA 2OCYC 1Z36A 3JWPA 2LIPA 3K32A 3R5KA 4GLBA 4MRMA 5FL3A 1I7QB 1V4BA 3HB4X 3VNUA 1I6WA 2DLCX 4G0UA 4BGEA 1YKSA 5CYPA 5AH0A 3SMQA 1FTYA 3DAGA 5EXSA 1GPAA 1XG5A 3IXLA 1MN6A 4Y1RB 3VPFA 3FM9A 1G3RA 1SD2A 5ALZA 1M2EA 1ZC4A 4L4ZA 4CRWB 3UPDA 3WYGA 4NESA 1OC4A 2QTMA 3A04A 5AXCA 2HRCA 1GR1A 3U13A 3OICA 2X5JO 4LTNA 5FBVB 1EXNA 8MHTA 4M1WA 4R1MA 2VP0A 4N5DA 2N9UA 2BKLA 2PLRA 4YRTA 3OCXA 2JGLA 2VP4A 5EJ2A 3QKRB 3DFUA 3DZ8A 2QTVB 4P3XA 3OLWA 4TTQA 1D4OA 2A0WA 4KFTA 3VYUB 3RT7A 3JQDA 3N76A 3RIGA 4DV1B 4UKDA 4D9HA 5CDYA 5CFOA 3PEEA 4GPTA 5IJ0B 3AJ8A 4G63A 5BSTA 1YE3A 3ZYCA 1X7WB 2DAPA 2PWBA 3K9HA 2ZJ1A 4YONB 1LS6A 2QUZA 1KDOA 2XAAA 3KOYA 4Y2RA 2VHJA 4M55A 1N6KA 1EGQA 3RRZA 2ZWVA 221PA 1DIHA 3H1BA 1WMDA 4QG7A 4C30A 1PNTA 3KOXA 1P75A 2A88A 2QA5A 4PRYA 3IVMA 3IJPA 1GDHA 4M9QA 1RJ9B 2DTXA 4RGYA 4YK7A 2XE7A 2BZGA 1SCKA 5EKXA 4QJIA 4RXMA 1GYRA 5E9QA 3VGJA 2ISSD 3VKUA 4O4HA 4DREA 3UAGA 4MRAA 3SZMA 2R2GA 4JGBA 1C7FA 1R88A 4KO4S 2PLAA 1UM9A 3I5MA 3G2OA 4Q37A 4QLAA 4LJAA 5CYFA 3L1IA 2GEFA 3GH1A 2AD1A 3OG9A 2RFLA 4AJHA 3RC8A 1W73A 3DOOA 4RPJA 3RFUA 2ZSIA 3TX2A 4RHUA 3SVLA 3OP4A 5HG0A 1XP5A 1OVGA 4L4UA 2AOTA 1KEEB 3CFYA 1L4HA 3M6FA 1X7YA 1K0UA 4HFRA 5DCWA 1TTQB 2RH4A 3GQBA 4LWPA 1Y82A 4UUBA 1G3UA 2EU8A 4H77A 1ZRNA 2FZLA 2Z30A 3GAFA 4Z9AA 2CLMB 2I4MA 4B7ZA 4NV3A 1XD2A 1Y7PA 3IUEA 2P9HA 1JEQA 4XLTA 1ZA1A 4FX5A 3QW2A 2EEPA 5JISA 1T9DA 2XWSA 1RI2A 2FN8A 2JNWA 4NIMA 3U7EB 2ZM6B 1U0FA 3QVOA 3Q3IA 1YRQA 5KQMA 3KQHA 4JCCA 3ZX5A 2P2LA 2XF2A 1KY3A 2VXOA 4I99A 5SZHB 1FUKA 5G0TA 4BB5A 3CEPB 2G3YA 3DDWA 3HR8A 3PNOA 4EGSA 1ZEMA 1XB2A 5SYMA 1IY0A 3FUXA 3KB1A 3L0PA 3L82B 3WMFA 4ZQBA 1QQ6A 3WNQA 3O8OB 3ZBPA 1Z2NX 1EM8B 1J2JA 2X5KO 4BNZA 1YACA 1E4EB 4GL2A 2J3MA 2C20A 3JWEA 3P0RA 2GCOB 1BCRA 3ASUA 4HEJA 2ZATA 4A8JA 4NRDA 1M2VA 3CEJA 1UBJS 1L2TA 3JQ8A 3MCWA 2AOUA 3SKVA 4Y7CA 4B17A 2ZYTX 1ZM2A 2JCYA 4GYJA 1ZVJA 1UXOA 4GBMA 4LMAA 3AUFA 1LQTA 1GGMA 1QG0A 4P58A 3P5BA 1LTQA 5GOZA 4PYKA 2GEUA 4KLZA 4Q24A 5FPHA 3OESA 1BH6A 4JXJA 2I34A 4UU8A 3O74A 2FVYA 5SICE 3SS9X 3AJRA 3CN9A 3WP0A 4M1YA 3NUQA 4FI3C 5EP1A 3QWIA 4EYKA 3K2IA 3HEAA 4NQZA 1T1JA 2V7VA 2HK8A 4BRZA 4EJSC 2RONA 1XTVA 4Y2SA 3IAM6 3PGMA 3F8TA 3QVGB 1CD5A 2WYIA 3QFCA 2IYFA 4PANA 4TTVA 3RYTC 4F4CA 2AUNA 5JYCA 3R2JA 3AZOA 2VUTA 3A9WA 4BTVA 4QFDA 3WRWA 5A4IS 3U6KA 2H18A 3KYCB 5AM3A 3A0RB 3CLVA 1PD1A 4OQMA 1H6CA 3OX1A 5MFZA 5CFLA 2CYBA 3HEBA 4AJKA 1Q7GA 4CKZA 2XOKD 2G04A 4U3JA 4BS9A 2IH4A 1GFWA 1Y3BE 2BKXA 5BV7A 3T0FA 3FZEA 4DIMA 2ZGVA 3EE6A 2MIIA 2ERYA 1KSHA 2B8EA 1VB3A 4FOLA 4GYYA 1DUVG 4LYGA 1IATA 4UCQA 1ISSA 4AMUA 5KTPA 2F1KA 2UU9B 5JFGA 2ZYDA 4BWGA 4K6HA 5HOEA 2NU7B 1SCNE 2QAGB 3PQFA 1S4QA 1ZCBA 3GDGA 4KWEA 4C7XA 4EPVA 3A4YA 1EB9A 2JI7A 2RHBA 1AA9A 4GI2A 1EUCA 3BD8A 1D1TA 2K87A 4UZFA 5JQGF 2V6IA 3KCQA 2OUIA 2Y3IA 5JAMA 4LOHA 3CLKA 3W5SA 5A4DA 1W48A 2W6QA 4J7AA 2QX4A 4A73A 2AT1A 4V0NA 2W8BA 3E35A 3HN2A 3Q4GA 5GJCA 4HDSB 5T57A 2Z6QA 3MAAC 3R6DA 2BSAA 2HLDA 3EIOA 3FR8A 4QOJA 2ZJ4A 3UG6A 1FFGA 3VTAA 4B6RA 3KKNA 4MYSA 4PCAA 4BVJA 5ESRA 3NGMA 4CLRB 1GLGA 1U0OC 3FDIA 1Z13A 4C2UA 4UE6A 1U4OA 3AFNA 4QYMA 2D13A 1OROA 4YALA 2ZRKA 4ZV7A 3VZBA 1FC0A 4DA9A 4RHCA 2R8EA 1MEJA 1ZGAA 2EFGA 3ZCVA 1JHUA 5KQLA 3V5NA 5GZ3A 3TEJA 3VVMA 4PHHA 1S4MA 4KB5A 3IBTA 3JR3A 4AX4A 1H2AS 3NVDA 4IRXA 4Q3EA 1IWBB 2NXJA 1UXJA 3KTAA 1CUAA 3MB5A 1E98A 3HEMA 1SN7A 3PJGA 4BJHB 3ITKA 4BBZA 4IP0A 1SURA 2RBKA 3K92A 2H29A 4C07A 3T9BA 3THRA 1MR3F 4EECA 5DGDA 5IKXA 3IHTA 5JFOA 5BR4A 4LXTA 4LTDA 4YPVA 5DU2A 2GCEA 2QUBA 1T4DA 5BNTA 3EXHB 3Q7TA 1ZDMA 2XWPA 1G5PA 4FZJA 4MB6A 3VUEA 2P2DA 4EFNA 5ALNA 3GGDA 2IEYA 4N5HX 1RJFA 5JE8A 3C4JA 3SX2A 1UBCA 1N2OA 1BXZA 4R83A 4F92B 2XNSA 5KOYA 1ND6A 2HMSA 1E8NA 5T6BA 3T3PB 3EPKA 5B57C 2NU6A 3NBZC 1A8SA 5TARA 3U4DA 3RHFA 2PZJA 2XNDA 2ZJFA 2QMHA 3PEUA 1Z4QA 3UAWA 1XZ8A 3VPSA 2D5BA 2PLNA 2G0NA 2QGZA 2AG1A 3CM0A 4QQKA 3SF8A 3V00A 2P6MA 3AR6A 4CG1A 4RFSB 4DLAA 1LH0A 5IKOA 4CLXA 3H9QA 1HO3A 2HA4A 3CCCA 1X74A 4EQ6A 2FGJA 4QT4A 3TNDA 1APBA 5ELLA 1KOJA 3CNBA 3RODA 2GZAA 2ASEA 3V1NA 2V4MA 4E6EA 2NZUG 4K26A 2GVNA 4LRXA 4XYMA 3R3UA 1JG3A 1JG2A 3G6WA 4L72A 1DJPA 1T9GS 4UU0A 5J63A 1AF7A 3IFSA 3MHTA 5F12A 1G1AA 4DXAA 1ZWLA 3VDXA 3FJYA 4ZO6A 5JBNA 4FXPA 3CT4A 5KMGB 2IRWA 4YMLA 5FPSA 1XNQB 3A0UA 1BXGA 3EQ8A 1MGOA 5DBGA 3MTQA 4N65A 4G56A 2FZKA 1MEEA 4I5IA 3M7IA 4Q4HA 1NJ8A 4UUAA 5SY4A 5LA6A 4BLPA 3IUYA 1PGJA 1IY9A 2OZKA 4NI5A 3D0KA 4FGZA 4JS0A 1HEUA 1XA0A 2JIQA 2X58A 3I30X 3A6ZA 2F8LA 4O5AA 5BYBA 1CHNA 3R7WB 3SLGA 5BPFA 2VF8A 2WWTA 3JSXA 4HI0E 3FDZB 4Q39A 1Z75A 3TQQA 2WA1A 3EY9A 5F7OA 4H35A 2FW7A 4P4GA 1DEHA 1GQRA 1YDWA 3EARA 3KB8A 4KH1A 1GFZA 1IQ0A 1W29A 1TCVA 2FPGB 1XAHA 4G8DA 1YWGO 4IEIA 3L7LA 1YRHA 4QRHA 4R6WA 5F5LA 5GVRA 5HFJA 2B4QA 4MV1A 1ECJA 2B35A 1G9TA 2VPQA 3QXGA 2A57A 4DABA 1H1LA 5A1TA 1M1ZA 1MH9A 1DX6A 3L0YA 2LTAA 3OM0A 3U5TA 4TLCA 4OHXA 3W04A 1WY5A 1O95D 2XR1A 1AS2A 3GUUA 1YMVA 3Q3VA 3NI2A 1SBNE 4IXNA 4IQ4A 3RSCA 4MV3A 1WLSA 5KTSA 4RS3A 4YUXA 3KUKA 4LZOA 4TKUA 5JZOA 2C03A 2B36A 2ZQ5A 1PJ2A 3PFCA 3ZWNA 4ZAVA 3ORYA 1TMKA 4IVRA 1UPFA 2GO1A 2QDXA 3QHAA 2A0FA 2E1RA 3IPLA 1V5EA 3UMSA 2XGSA 4C4OA 3UICA 4YRMA 2A9KA 4HEA1 4K9KA 5FD8A 1KYWA 1LLDA 1F12A 4MQBA 5HJ2A 4QPJC 2EYQA 3AI3A 4EHDA 1FMCA 1JDNA 1Z2EA 1SXHA 2DLNA 5DRTA 1GPKA 4LDQA 1A8QA 3E3MA 4D4LA 2HDOA 3DE4X 3EDYA 5KNBD 2JK0A 3KC2A 4OP2A 2AGVA 1WV0A 1GNSA 1XALA 4AF8A 1IY1A 3S5UA 5SYAA 3I01A 4JYCA 3PXEA 1B6GA 1PR4A 1ZVMA 3LUJA 3N7TA 1Q14A 1U1CA 5M2QA 2D5IA 3KVNA 4JOQA 2QX6A 4LRQA 4QHTA 3CH5A 2IKQA 1V8ZA 3AX6A 4GG1A 5G4KA 3NATA 3RABA 3FNRA 5KVSA 4LDAA 1Z06A 1F6BA 3T6KA 1KZ6A 2CUTA 1QQ5A 5CFNA 5I7RA 3K0CC 4YCLA 2J3QA 2WIAA 2W9XA 1J2EA 4M86A 4AO7A 2NSYA 2ZYVX 3GQVA 5J47A 3PJEA 3NWBA 4PR0A 1FRFS 4ZDWA 3OZAA 2M98A 3D7KA 1PZMA 3AY7A 4G0XA 2HF2A 2R44A 4TKLA 1P60A 3TK1A 4AMBA 3CY6A 1NSYA 2IU6A 3DE0X 4OGKA 1D6NA 5FLEX 4HEQA 5KI6A 4HUTA 3T7EA 4CF3A 4X24A 1JR3D 3DWIA 2IIVA 1ZIOA 1V96A 2JFHA 4DYHA 5FBLB 4DM4A 4F3KA 3CB4A 4R2IA 4EHJA 5DNWA 3A28A 1OU0A 1UBTS 3EXIA 3ZIAA 5AVWA 4S1PA 3RIMA 2X8AA 4IJUA 1ADJA 5LLDA 4DV6B 2DQZA 2VBGA 4IJWA 2ZBVA 1SG6A 3WDSA 1P9LA 4J1SA 1XFAA 4C76A 5J1SB 1TA9A 5IWCA 1FTGA 3DVRX 3IDAA 5H80A 1DKRA 2Y0BA 4B3CA 4LVNA 1M6WA 2DPHA 2RI1A 4M1QA 1E5XA 1P5FA 4KE9A 3NCHA 1PEAA 2VZ0A 1X1CA 3TMYA 4BLSA 2R00C 2X8JB 5ES4B 1NBIA 3Q72A 1V3TA 2C96A 3TLBA 4ZCQA 2DPXA 4ZEXA 3ZWWA 4P81A 1VTKA 3BWBA 2WD7B 5TX7A 1JJ7A 5K0SA 5AHRA 4EVQA 2C4MA 3WWDA 2Y93A 3U16A 4CKXA 4YUYA 2GZMA 5KOJB 3SM3A 4B09A 4YPOA 4D3FA 3G9TA 4HAXA 3DTYA 4H6WA 3R8XA 5DN6D 1Z33A 5JC1A 3LKDA 3EC2A 2R751 3LVRE 2VUIB 2HJWA 4OXNA 3KHSA 2IITA 1B8UA 1W36C 1Z0DA 3A9RA 4UMFA 1XZHA 1L7MA 4X8LA 4RPHA 5AKJA 4CZ2A 2DT5A 5IANA 3KS9A 1QRUA 3ZNPA 3UXMA 2ENWA 2OCAA 4AT1A 1V1JA 2QPOA 2Y6VA 2BGUA 2OXCA 3AF1A 3IE2A 4GQIA 2NUPA 1R6UA 4G4JA 4PHTA 4D3DA 1PQWA 5J9FA 4X64B 2ZYGA 4FGUA 1A9PA 1ZI8A 3NWJA 4JROA 4MKFA 5BWLA 3K0SA 3BKXA 5T67A 3X1YA 1F0NA 2J45A 3AHCA 4AZTA 3V4VB 4LZJA 1IM8A 2R5NA 5T5QA 4BNUA 4MIEA 3L3BA 1RKBA 2CNDA 4WESA 5FT9A 1AQLA 4H3KB 4EGFA 2EZ9A 1YDMA 2MR6A 2PXAA 3NHSA 4OHPA 3WK5A 1NMEA 1NR5A 1Q0HA 4FZ5A 4LZWA 1DTWB 5JWOA 1YHNA 2ONZA 1HG1A 1PGQA 1S2IA 2PBRA 2FN3A 3VPGA 5CT6A 4DMCA 1ZCZA 2ZJAA 3EJ6A 4L4SA 4JOSA 1SCAA 4GOKA 3CF4G 2QJTA 5B1SA 1HEIA 4FOPA 4LUCA 5TPWA 4DUGA 2AXQA 3VO2A 1UK7A 3WAJA 2VNKA 3G0BA 2O3RA 1PG0A 2D2EA 2PGOA 4CODB 2D54A 2FSGA 4OPMA 5BVGA 2QN3A 4HFJA 5IAKA 4K1XA 5AXAA 5DEIA 3GPIA 1K06A 2G4VA 4FHFA 5KNBH 1RYFA 2YWEA 3WXMA 2ID7A 1JAXA 2VLBA 1NJ5A 2AJCA 3EF3A 3FF1A 3G1TA 5HF8A 3G59A 1HDCA 4J6FA 1J07A 1R1DA 4IICA 2IPNA 4CMCA 3LOUA 3VJLA 2J3KA 3O3MB 1CY1A 1DT3A 2WWVD 3MJEA 1LK0A 4EG4A 5B3JC 3B1FA 1J9EA 3L06A 2G28A 3KR1A 3OIGA 3BWCA 3Q9LA 1F6WA 5DM2A 1G63A 2TMGA 1VIMA 5AW4A 2Y9PB 5E0OA 4EELA 2J3DA 2ZYIA 3DC2A 2VSYA 2JAUA 4BMPB 1PWZA 5LP6F 4RD2A 4RF3A 4X1IA 1IIBA 4YO7A 3VPHA 1P45A 1K6MA 3LK7A 4P92A 4OM7A 3TD6A 4HATA 4WEOA 1ISGA 2BZ1A 1BDJA 1T2DA 1SB9A 4WN3A 5LM3A 4D26A 4RDHA 1BO6A 4AG6A 9LDTA 2QUAA 3DFKA 3MRTA 5HSGA 1W9HA 1WQ3A 3A1NA 3ZY6A 1D2CA 2HWXA 3ND8A 4GPBA 3ZW7A 1AUQA 1KQ3A 1Q7CA 3BGDA 3H1FA 1MJHA 4OHMA 1L7VC 2IHJA 2YIDA 3KCNA 4KK4A 3KWJA 2R1TA 5AVOA 4F3YA 1Y3DE 1TD1A 3B9BA 2XCSB 3E1KA 1L7XA 4KI0A 1W4AA 3DB1A 4IEFB 1TIBA 1P7WA 2PZLA 1IL0A 3H97A 2I6GA 1Z0ZA 2ALJA 2VK2A 3AEQA 5I5GA 3MBKA 3A14A 1Y3FE 3L9XA 1HXHA 2BKAA 3UV6A 1J8VA 3TWOA 2CLIB 2PY6A 2NNWB 1ACMA 4O6VA 5E4JA 4NEGA 3K0AA 1YCDA 2QKYA 4AZWA 4JBXA 2PT7A 4EJ6A 2GBLA 2X76A 1XKLA 3WKEA 1QZZA 4P83A 1CJSA 1UM8A 1Y9ZA 3PHBE 3U44B 1Z45A 5B6PA 1FMFA 1EX6A 3CF0A 1Z5GA 3CLUD 4JD5A 2ZAMA 2A1IA 1CZLA 5FHRA 1Z8FA 2O50A 2O9JA 3OE4A 3G3EA 4L76A 4QDUA 3UGQA 3HV0A 2PFGA 4G5RA 4MGZR 2GBGA 3PA8A 4XIIA 3U39A 3BZUA 3VPCA 4DRXA 1WUTA 2BE9A 4A91A 1AGYA 1FFXA 1HDXA 2RBEA 3A6EA 3GHHA 3H4TA 1JVSA 1NQWA 1ESNA 4MYHA 3NRBA 4ZODA 5DEOA 2N47A 1GA6A 2M6LA 4BN0A 3I3SR 1F4LA 4BMZA 4HXGA 4D3YA 4OFBA 1UPTA 3CWZA 2A8YA 3WHKA 4R98A 1XT6A 3K1YA 1HDIA 2P4EA 5BV8A 1ZNWA 3KJIA 3VR5D 1TZJA 3U40A 1K86A 2FQXA 3VMFA 4ALKA 3JQQA 1PNOA 4ER0A 5LQKA 1M34E 4A5SA 3VKHA 1VSTA 4Y8VA 2FR8A 4YFYA 3AF2A 3KRTA 4WK4B 4WNIA 5FBRB 2QG6A 4UHCA 3ADCA 4LFAB 3A1CA 4TYYA 3UOAB 2PE5A 1H9AA 4J75A 4W82A 1JNXX 3G5MA 1F8FA 1Z5NA 3N2GA 3W2EA 4X62B 5FPQA 1GKIA 2QXTA 1XN1A 2VBCA 4FT4A 3GROA 4DDMA 3JATA 4MSUA 5I4BA 2OENG 1KRWA 3STTA 4P6VF 4UMEA 5LNK6 3WOHA 2IVFA 3GD5A 1LX7A 4QOIA 3NTXA 1X9IA 4M0LA 4FU0A 1LZLA 3KBOA 4O02B 3R0XA 3V4RA 1JEYA 1FP7A 2D3WA 2R6DA 3NHZA 4JJIA 5AI4A 1DJQA 4L0CA 3U3JA 3OE1A 4DRYA 2JHPA 3E9NA 3B7WA 1G8YA 4NYJR 1D2EA 3GGPA 4ND8B 3KOOA 3BQMB 4BTEA 5BOSA 3ZXSA 1QKJA 1GRCA 5DW0A 3ZNOA 5CHYA 3FY4A 2CVPA 2YV3A 3G0IA 3IDSA 3P71T 4PLTA 1NLFA 2Z98A 2HHHB 1OILA 2M6RA 4W1RA 1PJQA 3HFSA 2Z57A 3GR6A 5D3ZA 1ZJ6A 2YNMC 1I1QB 1TX4B 3K9NA 4UHHA 4BCBA 2XWJI 3GLFE 3WMEA 4DB2A 2C95A 1GADO 3OZUA 3WKBA 2RB4A 3H8SA 1IZ7A 3SSNA 3ODGA 1QLJA 2KBFA 4FDAA 1I32A 3FW1A 1NXOA 1VLHA 1CX9B 3DMTC 4CHGA 5KNCD 3U7GA 2VH5R 1CZKA 2RHWA 4G0PA 5FUWA 3SC3A 1CP2A 1VHQA 2ODQA 2WJGA 3QUAA 1KMMA 1EWYA 3C1AA 1VL6A 2HDHA 4HR7A 4J16C 3AVOA 3EIQA 3GJZA 5TDHA 1MP0A 2RIRA 4INJA 3GEEA 3RVDA 3G1WA 3WSTA 4I9GA 4KXNA 1H2HA 1Y4DE 3B6IA 4L4YA 1NLMA 1ZH0A 2BZSA 4K6GA 4A27A 4OP3A 1US8A 4J0FA 4QC2A 4TMXA 1G0NA 4Y0NA 4CL0A 4GC5A 3ODPA 2CZCA 2BMJA 2VHXA 4PIVA 3BDIA 3LV8A 2OV6A 3D54D 3FMIA 4DN6A 4DMHA 4ENPA 3RGWS 3S40A 4C87A 3RFFA 3O3OB 1P9OA 3ABZA 3K1TA 5JSZB 1JR6A 3HJAA 4LSWA 2A5FA 3ZZUA 3X1JA 5FKJA 1E4VA 3ROPA 3W7BA 1VRCA 5BQXA 3TPCA 4A1OA 1UFOA 1FQOA 1V2HE 3R75A 4C0AC 3KQUA 5C5IA 2Z04A 4QPNA 3DDZX 3EB9A 1SQ5A 2HBRA 1HK7A 2DECA 4AZ3A 4ZI5A 2QT1A 4RLQA 1I8TA 2E37A 1C9JA 3D5QA 1BFDA 2GBIA 1XDZA 3QE9Y 1JR3E 5JALA 3VSCA 3L0BA 1IC6A 1VYVA 4ZCRA 1Y33E 1RU3A 1C0PA 5K5EA 2GXSA 4P3PA 1EK2A 1WUJS 2H3EA 4B84A 4XVCA 1Z0UA 3BF8A 3VC7A