1UKAA

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
total genus 101
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ukaA00
2RHWA 1RYYA 3F9CA 2WG1A 1ZD4A 1HPLA 1XRRA 1NU6A 5JD6A 2ACEA 1BN7A 2K2QB 1JKMA 2QS9A 5E2IA 4OPMA 2XMDA 2WUFA 3JYHA 3WIOA 2O7RA 4BZZA 5JD5A 4ARAA 1BROA 1E89A 2HADA 1WM1A 4LYEA 3BWXA 3DEAA 2JEZA 2Z8XA 3SC2A 3WKDA 4J3JA 4BAUA 1R88A 4A16A 1DX4A 3BF7A 4MJ3A 5IVKA 1O6GA 4Q05A 4FHZA 4KR0A 4BE4A 4OCZA 3FYUA 3ESDA 5EGNA 2WTMA 3WZLA 1VE7A 3WWPA 2WU3A 4M0EA 1W52X 1C7IA 3W05A 7YASA 5KWIA 5ALSA 5DNWA 2C4HA 4FNMA 1KU0A 1OXMA 3QH4A 3LCRA 3LIIA 2HM7A 3EF3A 4DMKA 4W9RA 5FPQA 2HA4A 3NUZA 1XZAA 4EHBA 5ALEA 1GPLA 4WFKA 1CRLA 1AX9A 3VDXA 2Z5GA 3HC7A 4K2AA 1QIIA 4G9GA 4INZA 2B61A 3V1NA 2H7CA 2CEKA 4UBMA 2XQKA 3W2TA 5AM0A 4WJLA 5FPPA 4DTCA 1BRTA 2DR0A 2WILA 2JEYA 2HFJA 5AK6A 4AXBA 5I9IA 4BE9A 5HF8A 2DQYA 1XZEA 5ALXA 3AZQA 4W1PA 3OG9A 4BCCA 2ZSIA 2VT6A 4IH4A 1QIDA 1CUWA 5YASA 5J3JA 1XRNA 4CCYB 4BRZA 3C6YA 4KE7A 4BP9A 2ORYA 2WIFA 4H18A 3KXPA 5C8ZA 2O2IA 3WK8A 2XB6A 1ZJ4A 4A5SA 4BVKA 1DINA 1EVQA 2EEPA 3WK5A 3WZMA 4AO8A 2VEOA 2OG1A 3KD2A 2PU5A 2HA7A 2CJPA 3WJ2A 3IIIA 2OQIA 2H7XA 4G4IA 4UHCA 4EUSA 1WOMA 1QO9A 4HXEB 5AK4A 2HDWA 1ZJ5A 1J1IA 5ALRA 4H35A 3LLCA 4X7BA 1JU3A 1R50A 4WY5A 3VJLA 4HRYA 5ALTA 5JYCA 3L1IA 5D3ZA 2ZYIA 4H7EA 3PF8A 2J3DA 3I2KA 1XZKA 4FMPA 2OCLA 5K3FA 2WFZA 1KU6A 1CUUA 5IVHA 1JI3A 4IQ4A 5H3HA 2OCKA 4RE5A 5E4YA 4J0HA 1MAAA 4PSDA 1K63A 3KWFA 3UMJA 1LZLA 2BGRA 5IH7A 4EY7A 1LBTA 3C6BA 4AQDA 4AO7A 3IUNA 4KE8A 2WUEA 1CUIA 5EHQA 3ZLUA 2ZYHA 3S2ZA 4X93A 1DTEA 1J2EA 5K3DA 3TGLA 3STWA 1XROA 2C58A 4MEBA 5AHXA 1W75A 1X70A 2QJWA 5ALKA 3O4HA 2G4LA 4H77A 2O7VA 1CUCA 1QE3A 3CXUA 1ORVA 3C5WP 3WWCA 4DSAA 2V97A 4J03A 2Y2VA 1ZGCA 3WK6A 3ESCA 3H18A 1CUEA 4RPCA 2C0PA 4BC0A 4IO0A 1QIFA 2CBGA 2OGSA 4AN0A 3ZV7A 5LZ5A 5IVDA 5HQ3A 1UOOA 5AKYA 1UOPA 4BDSA 2VA9A 3H04A 3IUMA 2GYUA 2WIDA 2RGUA 2OCGA 4CG3A 4B85A 1UFOA 3P2MA 4A23A 3R3YA 3O0DA 3F96A 1GT6A 4MYDA 1SFRA 1AC5A 1TRHA 2HFKA 1MNAA 1ODSA 3I2IA 2JGKA 1I6WA 3I2FA 1XZLA 3T52A 4Y2RA 1WPRA 4KEAA 1CUDA 5AH0A 1VXOA 2G5TA 1UK7A 1JFRA 4FLEA 4D9JA 3HJUA 1LZKA 4UBIA 3WKEA 5DYTA 3D2AA 1AKNA 1QONA 5CH5A 2WFMA 1DQZA 3EQ8A 4L72A 3RLIA 5LKRA 1W76A 4OD0A 2OXEA 4H7DA 4AN1A 1EK2A 2AJCA 4GEGA 3QPCA 3MUOA 4KAFA 3NOXA 1XQYA 1Y7IA 2HIHA 1G4HA 3BJMA 2WSLA 3F97A 1CQZA 5EI5A 4EBBA 3G9ZA 5AKGA 4N8DA 1UT6A 4YPVA 3PUHA 2Y2UA 3AZOA 4CCWA 5DYWA 3C45A 3HI4A 5T4HA 3D5EA 1Q0ZA 2BAGA 4OYYA 1VXRA 3BJRA 4IHAA 1IMJA 3ANSA 5JASA 4UBJA 3CN9A 5K3EA 4CG1A 4X92A 2DSNA 3E1GA 1FJ2A 3DD5A 3GUUA 4G4GA 3H19A 2PPLA 2XMBA 2WQZA 4FOLA 3I28A 1LPSA 5HKAA 1QIEA 1C7JA 4X71A 3M83A 3I6MA 3E3AA 4OYLA 5I7UA 5K3CA 5ALYA 3WK9A 1HDEA 3FLAA 4M0MA 4B83A 3VJMA 3R41A 3WQHA 1WCYA 3WL8A 1YCDA 4Q82A 5KBYA 4RGYA 2XUJA 1MT3A 3G9TA 3WK4A 2DQZA 3QITA 1K4YA 3DS8A 2V9ZA 4CI9A 1IUNA 1UKAA 6YASA 3C8HA 2WHPA 2HU7A 2HU8A 4NMWA 4OB8A 4N8EA 3AJAA 2CZQA 4H7FA 4TGLA 4X94A 4J7AA 4GHWA 3K2IA 1B41A 1QTRA 3G0IA 1PFQA 3D59A 4GDMA 2XUPA 5E4TA 3ZI7A 5HKBA 1SCIA 1W1IA 2ZJ6A 3ZWQA 5CURA 1WHTA 1XZDA 1G42A 1ORWA 1RWQA 5JAUA 3FYUB 3IBTA 1E8MA 3G0GA 3LS2A 1EXWA 1ZI9A 2XUIA 1TCBA 5FP0A 4FLFA 4UFNA 2WHRA 4NS4A 1R9MA 3FVRA 3VVLA 1YB6A 1CUAA 1YAHA 3BL8A 2JF0A 3BXPA 5AKKA 4FLMA 3WKBA 4GW3A 4V2IA 4L3WA 2CB9A 2OPHA 5T4BA 2HA5A 2Z3WA 2GBFA 3H2GA 5ALDA 1XQWA 1CUYA 4BB0A 3BE8A 3NGMA 4DIUA 2PUHA 1CLEA 4DLNA 4BRSA 3C8DA 4XIIA 3K6KA 4JYMA 5I8PA 1YS1X 3FYTA 5AI0A 4YX9A 2XLBA 4UBLA 3WKAA 1E5TA 3WYDA 2WG2A 5ALMA 4C4XA 1LBSA 3FSGD 3M81A 2WFLB 1ZD3A 4LXIA 5JAOA 5AKEA 2X8BA 4LIPD 3C43A 5EHNA 1TCCA 4PSCA 4QWMA 1IUPA 5AIBA 5AKXA 3STXA 3W06A 4Y7DA 4K6KA 3GELA 2NW6A 4QDUA 4OUKX 2H7YA 4QNNA 3DCNA 4Y2VA 3OTQA 4Y2UA 3QYJA 4LXGA 4QLAA 2PM8A 1L7QA 3JW8A 3W9BA 5FRDA 4PO3X 1H2ZA 4BZWA 3H2IA 4PSUA 3OPMA 1BN6A 3T4UA 5JALA 2VAVA 3R3UA 4JEIA 1XLWA 1OCEA 1YASA 3GROA 2RIPA 3WYNA 3ED1A 3STVA 1THTA 3PFBA 4Y2PA 4OB7A 3HLKA 2PX6A 2WG0A 2XMGA 2Y1KA 5CT6A 5ALIA 4UFPA 3BDIA 4X85A 2I3ZA 4WCVA 5JADA 4DMFA 1GPNA 4JYPA 1JJIA 3KOOA 3BIWA 1CV2A 3FVTA 4ZXFA 5ALWA 3FBWA 1BCRA 2XI4A 4QEKA 1U2EA 1HQDA 3E0XA 1UZAA 4KE9A 4F21A 3FYUC 1LPBB 5AI6A 4B0OA 1EA5A 3MGAA 3ZLTA 1WB5A 2IX9A 1N8SA 1ZIXA 2QRUA 1UWCA 3H17A 4UHHA 5ESRA 3FAKA 4X95A 2PSEA 1TCAA 3NWOA 3I1YA 4DNPA 4DM7A 1N5MA 2WTNA 4P08A 3JWEA 1JT2A 2JGLA 4I4CA 1FFCA 5IVIA 3BIXA 5HF5A 1CVLA 4X90A 5JD4A 5FOQA 4X6UA 1MO2A 4DMHA 4PW0A 3QM1A 4QZVA 1E66A 3VXKA 1X2BA 1A8UA 1E3QA 3U0VA 2E3JA 2RHTA 3ICWA 1ZIYA 4U2CA 5D7BA 1SC9A 4B0PA 3SX4A 1R4ZA 3I2GA 5ALVA 3STUA 2B20A 4G4JA 4QE3A 4W1QA 4WDQA 3QBJA 3I6YA 3OM8A 4BYMA 2BCEA 3LP5A 5A71A 1H22A 4QWWA 2PL5A 1VA5A 5LZ4A 4ZGBA 3C6ZA 1CPYA 2YH2A 2JIDA 1YA8A 3A2MA 4RNCA 4FBLA 2ZYSA 3QMMA 2BUCA 1AZWA 3FLBA 2DCMA 4UHFA 2QZPA 5K3AA 5HFAA 1MX5A 4C4YA 3B5EA 1MU0A 2XUFA 3V9AA 1JMKC 4B81A 1LPOA 1QLWA 1P0MA 5FKJA 4AO6A 1ZI6A 1GKKA 1XQVA 4UHDA 4BP8A 2WLSA 2XQFA 4X00A 2HA3A 1QO7A 5JAHA 2JGIA 4BCBA 5SYNA 3C87A 4MQMA 4KRXA 4HVTA 4FKBA 1NU8A 2OGZA 4L0CA 1TIBA 3PICA 4X6YA 4OB6A 4NZZA 5AJHA 4C6HA 5AKHA 4TPKA 3A70A 3HZOA 2QUBA 3WWEA 1QGED 3KDAA 1Q84A 3CN7A 4C4ZA 1WB4A 2HHAA 2QUAA 5CXUA 2HRQA 3TRDA 1FSSA 2VJCA 1U65A 5D6OA 5AKLA 3OOSA 4B6GA 2QJRA 3V1KA 1XRPA 4C89A 3WA7A 1QJ4A 1N1MA 1P0PA 1GQSA 1WB6A 4AB1A 5D3KA 4CIBA 4J0CA 1MNQA 1QZ3A 1EK1A 4Y2SA 2LIPA 5JZSA 3MVEA 4L9AA 1SCKA 1K5PA 1ZI8A 2VQ6A 3IUQA 1M33A 3TEJA 2C0QA 2ZYRA 4UBNA 5AI9A 3DQZA 3HABA 3O4IA 2BUAA 3H0CA 1XZFA 4WFJA 2BGNA 3WL7A 4FBMA 1QTIA 4G8DA 3O4GA 3Q0TA 2ZSHA 4N5HX 1EDEA 4QDOA 2PVSA 1UKCA 5EHZA 4FTWA 2ZJ7A 3GA7A 5AM2A 5AM1A 3D2CA 4B7ZA 5ALQA 4N5IX 1R9NA 4BAZA 1HLGA 2XUAA 3A6ZA 2XMZA 1D07A 5FV4A 5EIHA 4KACA 1AQLA 1CUZA 2AXEA 5HFNA 4C01A 2CMFA 5BWBA 3PI6A 4OSEA 1F0PA 4U2DA 5LZ2A 1N5RA 1T2NA 1YR2A 2H1IA 5A2GA 1EI9A 5KREA 4J0KA 1OILA 2XMSA 2WU4A 3X3HA 4XJVA 4BVJA 1CFJA 2JGEA 4PQEA 3WL6A 3F67A 5A7GA 5LLSA 1IZ7A 1CUFA 4BDTA 5FXMA 5ALJA 1L7AA 5AKIA 5K3FB 3ESBA 3FCYA 1A88A 5AI5A 2DHDA 2Z8ZA 1ACJA 1UXOA 4MWTA 2ES4A 3H1AA 1GPKA 2VF2A 4GXNA 1J07A 2FJPA 3QMWA 1E8DA 2VT7A 1UOQA 4U2BA 5EFZA 2JGMA 3QZUA 3GZJA 2WFLA 3AUKA 1ZD5A 5HF9A 4G5XA 1VKHA 4HXGA 2QKYA 4BVLA 2PSDA 2DFPA 4DGQA 4GBGA 4JH0A 3DJYA 3FWHA 2YXPX 2D5LA 1AMNA 3STYA 4ZREA 3G0DA 3C70A 4DMCA 5CRIA 2DHEA 3STTA 5DYYA 3DL4A 4G9EA 5HF6A 4W1RA 5JATA 2QOEA 2B9VA 2WHQA 4NVRA 3GBSA 2J4FA 4ETWA 5K3BA 3QPDA 1XKLA 1XRMA 1GXSA 1GGVA 1YSCA 1FFEA 4C87A 3H2KA 2CUTA 2FX5A 1YB7A 5K5EA 3FOBA 4W1SA 1USWA 1HBJA 4UPDA 5HQ3B 3AIMA 5CT9A 3O9MA 1EHYA 4X97A 2UZ0A 5JZ9A 2WKWA 3PUIA 4H7JA 4LXHA 5AI4A 4B9AA 1SOMA 2H9YA 4EZIA 1GZ7A 4XWGA 1XQXA 2RONA 4CIAA 3AZPA 2V98A 3UUFA 1ACLA 1UKBA 1LLFA 5CW2A 1XZIA 5CT4A 4H7HA 1H23A 1R1DA 5ALPA 1VLQA 3PDCA 1JU4A 5LP1A 1TKRA 1FFAA 2RI6A 2QTBA 3A2LA 3EBLA 2PSJA 1SCQA 2DHCA 4F60A 5LZ9A 5AP9A 4X6XA 4CG2A 3H1BA 2BUBA 1MN6A 3SK0A 1DT3A 4UHBA 3HACA 4F5ZA 1WHSA 5HK9A 5JAPA 1XZGA 5DTIA 3DNMA 2J4CA 4U2EA 2AJBA 4EY8A 5CTAA 3E4DA 1DWPA 2ACKA 2WM2A 3ANTA 4DNQA 1S8OA 5ALOA 1ZICA 2OLEA 3ZLVA 4BAGA 5T4EA 1CUGA 3ICVA 1VOTA 2VSQA 1EINA 1U4NA 3QPAA 5C7YA 1ODTC 4WY8A 4GWLA 4LHEA 5LIPA 5ISMA 1H2XA 5LZ7A 5AK5A 3DYIA 1MPXA 4WDRA 1CUHA 3H2HA 5AOCA 2X5XA 3CCCA 2VJAA 4AMYA 4E11A 2QT9A 2XUKA 2GZRA 2IITA 2WJ4A 5CXXA 3DYVA 3F8SA 4Q34A 2XQJA 5A6VA 1TAHA 3BF8A 4P9NA 3TJMA 4Y9SA 3I2JA 2XQIA 2HA2A 4O08A 4B9EA 1ODCA 5AKJA 3N2ZB 3VKFA 4RE6A 5LYYA 4B84A 4OU4A 2C5FA 1VE6A 5A7HA 4U2GA 2Q0XA 4XX1A 3VVMA 1NX9A 2AJDA 4AZ0A 5KWJA 1XRQA 3WJ1A 2W22A 5F4ZA 1Q83A 4HXFB 4FFWA 4J0IA 2WUDA 2PU7A 1QIMA 2D0DA 5CT5A 5CMLA 2XUOA 5HZGA 4ROTA 4KRYA 5ALHA 1VZ3A 5DLPA 4FNGA 1DU4A 3I1IA 4EY4A 1LPAB 3M82A 1A8SA 2Z3ZA 3ILSA 4PV7A 3B12A 3R3XA 1UK6A 1K8QA 1EDBA 3L1JA 1EDDA 3AILA 2HU5A 1H2WA 4Y2XA 3R3VA 2PSHA 4HAIA 4IH1A 2GYVA 1U8EA 3L1HA 1B6GA 1DQYA 2X76A 4B82A 4DSZA 4MWSA 4UBKA 3N0TA 2YASA 1QIHA 5EIAA 4Y2QA 1EVEA 2XUDA 3WK7A 1KEZA 5CBKA 2XE4A 4CCYA 3WL5A 4GECA 1MTZA 2PSFA 3DKKA 4AZ3A 5BWCA 4MXDA 4FFVA 2ZVDA 3R3ZA 4DNFA 4PF1A 1RP1A 4ZI5A 4KJXA 3F98A 4F0JA 1IUOA 1P0IA 4ZWNA 2OAEA 3PF9A 1K6EA 1W6RA 2JGFA 1AUOA 4KAJA 3V1LA 3O95A 5LKAA 5LZ8A 2HL6A 1CIJA 4AMZA 4BATA 1X2EA 1FFBA 4K6HA 4MYSA 3R3WA 3G02A 1GQRA 4HRXA 2WIJA 3WKCA 3PE6A 3R0VA 4JUIA 1JJBA 1YS2X 5ALLA 2QR5A 2QM0A 3W9UA 4K5QA 1DWQA 4BC1A 2V96A 2VJDA 3LIPA 3IVMA 4E14A 1CUVA 1XRLA 3YASA 2IIVA 1BS9A 3HEAA 2QXTA 5FLKA 2EDAA 4J0JA 4G1FA 4S0XA 2ONCA 3SWWA 1CR6A 2OAGA 1XZHA 2JBWA 2XQGA 2XT0A 1VA4A 3A2NA 4Z49A 4GI1A 2BKLA 2VAXA 3AIKA 2OQVA 3G7NA 5T4FA 3WI7A 5FUMA 1O6FA 3I6ZA 3IURA 1BU8A 4TVKA 3RM3A 3RKSA 3FSGA 1TK3A 5AOBA 4LYDA 4EY6A 2QVBA 3HRHA 3CCBA 2G5PA 4KYVA 4UUQA 2XDWA 4FWBA 3WWOA 5C8VA 3IB3A 1P0QA 3G8YA 3B3QA 3K9BA 4P92A 3VISA 5ALNA 2O2GA 2GZSA 1CUBA 2ECFA 2I78A 5C81A 1LPNA 2C7BA 1CUJA 1MJ5A 2VATA 4U2FA 5CH3A 1C4XA 3G9UA 2I03A 2VTVA 4JNCA 4X3CA 1Z68A 1ZOIA 4J0DA 1EH5A 3HSSA 4X91A 1LGYA 3IA2A 4I3FA 1MAHA 1F6WA 4MEAA 3WIBA 5DJ5A 3HXKA 5A7FA 1QOZA 2PUJA 5ALFA 1LNSA 4C88A 4Y2YA 5BOVA 2R11A 4Q1VA 2HA0A 1WPXA 1F8UA 5AM3A 5DWDA 3V48A 2YYSA 5EHXA 5DNUA 3D4LA 4H7IA 1XLUA 5HCUA 1THGA 1XZMA 4M0FA 5AM4A 2BJHA 1W4LA 2RAUA 4H0CA 1E8NA 1H2YA 3UUEA 1LPMA 1F0NA 3Q8WA 1CQWA 4ZV9A 4G8CA 2PBLA 2XMQA 2I3DA 2G63A 2WIGA 5ALGA 3WLAA 1EX9A 3DL7A 3ZPXA 4HS9A 3GFFA 2WUGA 4ZRDA 1ISPA 1DWOA 2GBCA 4Q3OA 3HYSA 3KSRA 5AICA 1A7UA 2XLCA 4UHEA 2XMRA 1A8QA 3G9XA 2QMQA 1XLVA 1JMYA 4B80A 4K6GA 4ARBA 4FDMA 3V1MA 1HL7A 3D7RA 1BEEA 4HTAA 4Q3KA 2P8SA 1PV1A 1ZGBA 4YK7A 5DTJA 5DNVA 1QIJA 2CKMA 3DLTA 4QDTA 3IULA 1ZD2P 3M3DA 2C5GA 2XUHA 4QLOA 3I2HA 5FDFA 5JZBA 1XFDA 4UBOA 4W63A 4CFSA 3G0BA 4BBZA 2J3QA 4BTVA 1GKLA 3RARA 3OC0A 4IH9A 2EDCA 4EY5A 1YAJA 3IDAA 1DT5A 3DDUA 3QMVA 1MX9A 4LKOA 4DYHA 2XMCA 2ZJFA 3OURA 2O2HA 4EA6A 4N8SA 1FFDA 1ETHA 3WA6A 1CUXA 4G8BA 1BCSA 3FLEA 2JGJA 4GLBA 4KAAA 3QVMA 1QFSA 2BFNA 1CEXA 1XZBA 2WHPB 1Y7HA 4E15A 2Y6UA 3WMRA 5AOAA 3C6XA 3AFIA 4ZV7A 4PNZA 2XUGA 1Q0RA 4I19A 3RK4A 3AIOA 5BV7A 2QXUA 2ROQA 1VJ5A 4DNOA 2R8BA 5SYMA 1QFMA 2VJBA 1EB8A 1UK8A 1AURA 4QDZA 3D2BA 1IVYA 3DOHA 1XZCA 3D3NA 3DOIA 5CT8A 5HK8A 3EIOA 3G0CA 5ALZA 4E46A 4HZGA 1DX6A 4Y2JA 4XVCA 5E4JA 4BCDA 1EB9A 2OGTA 2WJ3A 1AGYA 5C8XA 3C5VA 3R40A 3H2JA 5IKXA 1YA4A 4P93A 2OCIA 1UK9A 3BDVA 4AX4A 4WFIA 1R3DA 4QA9A 4UFOA 1L7RA 1JJFA 5AK3A 5JANA 3DKRA 2FJ0A 4QDXA 1T4MA 1VZ2A 1XZJA 4J0GA 2XUQA 3AINA 4MQLA 2AJLI 5A62A 2WIKA 3O4JA 1BE0A 4OU5A 4KE6A 1QIKA 5AKZA 3ESAA 5JARA 2FUKA 1TQHA 3PFCA 3VJKA 2GBIA 3FNBA 2HA6A 1J06A 2PKYX 2Y6VA 4ITVA 2W6CX 1IZ8A 5AI8A 3FCXA 3KWJA 2B4KA 5EIEA 5CH8A 4Y2TA 4YASA 5ALUA 2GBGA 3D0KA 1CUSA 1G5FA 1XKTA 4H7KA 5AM5A 1PJAA 1MX1A 5AO9A 1HKHA 3W04A 2GYWA 3MUNA 3U1TA 3IUJA 1Y37A 5AIAA 3EQ7A 3O9VA 3WWDA 3EQ9A 5JIBA 2HRRA 4EB0A 1LPPA 3S8YA 4Q3LA 2AJ8A 1BEZA 4BTLA 2WJ6A 1QIGA 1G66A
chains in the Genus database with same CATH superfamily
2RHWA 5FFFA 5FTJA 1JR3D 2GPJA 2QR3A 1G8FA 1YOBA 4INJA 3S0JA 1DBPA 3EW7A 1RYYA 2IPLA 1UBMS 4P7JA 3M49A 3AJEA 4C0HA 4Z99A 5GMOA 3ZU2A 1JWLA 1NKTA 3ZDBA 2ATIA 3NAQA 5BSMA 3TBHA 1KPGA 3K0AB 5AVWA 4RTMA 4A2CA 4DRXB 3BH6A 1XRRA 4NH0A 2Z08A 2ZUVA 1GV1A 1G20A 4ZU1X 3GO4A 1YC2A 3F0TA 1CYEA 3TB6A 4CJXA 2AYYA 3PL1A 3V5NA 2O0KA 3PEEA 1L7NA 3D4IA 4L5YA 5CIYA 1CNEA 1SBZA 3PDJA 1Y48E 3RLFA 2VWPA 4PYKA 2ZETA 2QTVA 4OPMA 3ESXA 3GJ8A 3NAGA 3OWOA 4Q3AA 3VNSA 4TVSA 2XMDA 1H6DA 2WUFA 5CPFA 4IIUA 1U28A 2O7RA 4O4IB 5CHEA 1Z4QA 1T4BA 3TPCA 3QSYA 5FWXA 2V7EA 1PNVA 4RSMA 1RE0A 2L17A 3EZNA 4PGHA 1JXAA 4DUYB 1QDUA 3HI6A 1FDWA 3O5AA 4FDLA 5F2OA 5C18A 3TIVA 2UKDA 2M32A 5HOEA 5B6PA 4BNKA 4DBLE 4DR2B 5HBRA 5B3KA 2JEZA 4B8WA 1KF0A 3TGPA 3SC2A 1ODKA 4HHEA 4OM8A 2H0AA 3FTCA 5FBRB 1USKA 2ICAA 1DOHA 5A1JA 1GU1A 3CH5A 4CTMA 4MCAA 4QOIA 5AJWA 2A0YA 2A4KA 1G7TA 2OAP1 4F3RA 2GQ0A 1Y5MA 2HRDA 2Q1WA 3HCBA 1N9GA 3UJ3X 1XAGA 2PR2A 4RLFA 1QO0A 2Q7OE 3P2JA 2OXCA 1PQ4A 5H68A 1HTTA 3CF2A 1WW3A 3C8UA 4KBGA 4MWBA 5DNEA 2I8AA 2PRYA 3IUPA 4KR0A 5KJFA 1UMCA 2N1MA 1DBSA 1XQ9A 1AM4D 3FYUA 3R8CA 4P4UA 2QTHA 4BY9E 3ZKWB 2YUIA 4TLEA 1QH8A 4US0R 2YJ5A 5KNCD 1IL0A 1P17A 2A3RA 1B73A 4J9UE 4W8GA 4K0KB 1DIRA 3TIGA 3V7WA 4K1XA 2BMEA 1C1XB 5JHGB 1BXZA 1N2XA 3T7RA 2YN2A 4C5BA 1PGOA 4GBJA 3OKPA 4HOYA 4M0EA 1C7IA 3AUAA 3KKKA 7YASA 4RLQA 4YREA 3BE4A 4NAVA 3PDUA 4B44A 5DX1A 1THMA 2AHOA 4DDMA 1YRAA 2X2OA 2HM7A 5MF6A 3OLCX 3C3EA 4DMKA 2IXDA 1HKUA 2YYAA 1NYRA 3MBIA 1U6KA 1XNGA 1ZXLA 3ONNA 5KJ1A 3M5DA 2ZJ5A 1LLCA 3OO0A 4IS2A 5TPZA 1YT5A 1YDHA 3GCDA 3UUWA 2CZGA 1GPLA 2W71A 3GDOA 1CY4A 2QIOA 1YDWA 1HI9A 3I1FA 4PXAA 1T2FA 3H4MA 1PW5A 1ZC4A 1EK0A 2Q2NA 3L8FA 2ZJAA 2Q07A 3HC7A 3K15A 4I46A 1IE3A 1U7HA 1X7DA 3L0IB 2CLMB 1QIIA 1P72A 2ODAA 2R7MA 4E5KA 1ZUNB 4ZT6A 4EJSC 4NCNA 1YRQA 2EYQA 2NVBA 3OLYA 4A8JA 2FFJA 4AI6A 4R81A 2XYQA 5CVVA 3OEEA 2FEMA 2JLSA 2XQKA 4TL9A 5EESA 3RWMB 3ORQA 4PFSA 4UEOA 3A3OA 1E32A 1FS6A 3QKUA 1UDCA 2HY7A 2WHEA 2WILA 2Z2ZA 2CLFB 4P83A 3ZZUA 4RZ3A 2TRSB 1TI7A 2OBNA 2X0JA 1JN0A 3C7DB 5EPUA 2GZDA 3LTNC 3CNHA 5DWVA 3QEAZ 4TWIA 2E48A 5K0TA 1T9GR 4GFDA 5LBTA 4MCJA 3DVAB 2WVAA 1DIBA 2FLVA 5CB8A 4WN9B 2X5OA 5BV8A 4CW7A 9MHTA 4DLSA 3AERB 4M36A 1LI5A 1VHDA 1CUWA 4NEGA 3H05A 4YIKA 4Y6RA 1XRNA 1I4LD 2BGKA 2QYOA 2Q8PA 3U44B 4PYNA 3C1AA 1AKEA 3NTXA 4KE7A 4QVIA 1GTL1 4FKMA 3ZE9A 1RAAA 4JJ4A 1WZUA 4NWIA 3MFQA 1Z5NA 1X8LA 1K3UB 3FTDA 4PLHA 4ZC8A 4E31A 1K5HA 2PX5A 3DAHA 1WA5A 4JC0A 1PJ4A 2O2IA 2AC2A 3AM1A 1B0UA 2YBDA 3FIUA 1EFLA 3IQWA 1O97C 3GJQA 3EFBA 3EVAA 5B1HA 3TE7A 3W5UA 2AFIE 1NF9A 2QZJA 3NV9A 2IY7A 2A0FA 3JV7A 5C37A 5LDDC 2OG1A 2OCXA 2HA7A 2PHZA 2X9NA 3ZQJA 1L4HA 1YXMA 3PB3A 5JC8A 1NQUA 1F1BA 3QLUA 4ARIA 4P58A 4MUNA 4TKZA 5FOSA 3O2SB 4MIOA 4E30A 3QBEA 1VQ1A 2PSSA 4V0KA 1ORDA 2VPQA 3JRWA 1SUWA 3IIIA 4WHMA 2AMFA 1C9KA 2OQIA 2JFVA 4NBSA 3ET4A 4CV1A 1ZUNA 4JLJA 3DA8A 4QQFA 9LDTA 2BFMA 2Q0SA 5LNK6 2HLDD 3MBKA 2PS3A 3ZYCA 1XTQA 2FGKA 3IIEA 3S27A 3TD6A 5ALRA 2Q5HA 2MYNA 2P78A 3LLCA 4X7BA 5JDIA 2L0XA 2ZPTX 2NNLD 3JTEA 4BMCA 3ADBA 4IGAA 4KNWA 3K5WA 2XW6A 5DLDA 2WA2A 1ISMA 3TLAA 4RTQA 2X58A 4F92B 3NNDA 1QK3A 1Y8ZA 5H81A 3L1IA 3RC8A 4ZCIA 4DN6A 2GK3A 4PE5B 1NXPA 1LBIA 3WV5A 4OBWA 1V4NA 4CKBB 4R1TA 4EVSA 3DWEX 1EFVA 3VU1A 4FB4A 3OQOA 1XZKA 1YMUA 2WFZA 3N1UA 3EXEA 2WKQA 1KU6A 4BQFA 3B2EA 1S4QA 2XCOA 1O08A 1MV5A 3AIIA 3G49A 5H3HA 4ZI3A 5K8JB 3DXZA 1ZHHA 1L5GB 1T10A 4AX8A 1MAAA 1UQRA 2ZBPA 5TT1A 2WINI 5IDXA 2QTNA 4O4LB 4N82A 3KWFA 1LWNA 2G9RA 4TUYA 2V6BA 3EWNA 5EXDA 1YQXA 2O4UX 4GLOA 2BGRA 2IDJA 1ZBDA 5CLQA 2AXQA 5K7SA 4UVIA 4RL4A 2B36A 1O96B 4QHTA 5JYEA 5HIJA 1HLDA 4A0RA 3A9UA 4NJOA 4DCVA 4M6WA 1EIWA 5HS6A 5B36A 4M1YA 4V02A 4BQPA 1LDYA 4WOCA 1WX1A 3DNFA 3PDWA 4PCLA 4CMCA 4CF5A 3A1CA 1YKGA 4DV3B 4ENWA 3OE5A 4FDAA 3EEBA 4JP5A 4X93A 5COAA 1L4KA 3RABA 2D8AA 3KD3A 4YLGA 3E15A 1RKUA 3UAGA 1M5RA 4F2HA 2O8DA 3CZCA 3TGLA 4G0OA 4YV0A 3STWA 3VZCA 1NW8A 1OAOA 4RPGA 3ZUPA 3L0DA 1UZNA 1G8MA 1XROA 2C58A 5D86A 4QBGB 3MWKA 3WWZA 4GGMX 4IINA 1Q20A 4DUGD 4WH0A 4OJMX 4CLXA 1ESNA 3WIEA 3V1UA 4RDHA 4EFDA 4RKEA 2ZRQA 4A91A 3ZHTA 4GI5A 4MV8A 3RUCA 4UXIA 2G3YA 1IY0A 1CUCA 4WLFA 2V7PA 2NV0A 4MQFB 1AN0A 3IYLW 1ORVA 3RVPA 1KIFA 3OMXA 3PQDA 5CGQB 3L93A 5BSUA 5KZMB 4EYOA 2Q0HA 1JZTA 4AK9A 4A15A 4J03A 4MCIA 3IAS6 2GBLA 3ZDZB 2HWXA 1TM4E 4MIKA 2HXGA 2C0PA 3A9TA 4FFPA 3NHMA 3L4KA 3D8RA 3N3BC 4IO0A 1N78A 3IERA 4YALA 4C7OB 3SXUB 2H2DA 5K6AC 1YRLA 2G6BA 3W5SA 2OCYC 4G1CA 4YP0A 4O4HA 2MSNA 1JHPA 3BREA 2H08A 3EZ7A 4RACA 1KFJB 1B8PA 3HDYA 4MMXB 2NXJA 3ETDA 4UU0A 2Z1DA 3Q5EA 2O8FA 1XA4A 2ZIUB 2GHRA 1A7KA 4FDTA 4HDQB 3ZVRA 1ICIA 3N2EA 4XQEA 1SU6A 1UFOA 3IL2A 2Q5IA 2R6HA 2DH5A 4GMHA 4A23A 3FHLA 1R0SA 2R6GA 2XADA 1C0KA 3BZBA 1VDMA 4P4SA 2N47A 4NPHA 3EDOA 3F96A 1P4GA 2ZJOA 5CHYA 4LY9A 4ZQEA 2C5AA 3IP1A 3T06B 5BVHB 1F51E 1CC1S 4XB6B 4DSUA 3EDQA 3ABZA 3ST7A 3V8NA 1L4FA 1XG5A 4PPYA 1KDTA 1SFRA 1IYZA 3BICA 1UWVA 2IYYA 3L6DA 3S7TA 2OFPA 3NM6B 4NRDA 3U17A 1Y9ZA 4DQDA 3ZY5A 2IHBA 1N9KA 3L04A 3NASA 5TGTA 2SKEA 1MNAA 1EFAA 3R5XA 2H2IA 4FEEA 3KP1A 3ZHSA 3JZAA 3IA7A 4NJMB 4JIMA 4B3TB 2JGKA 3DBHA 1VJ1A 1I6WA 3P71T 3OIVA 2OYCA 4L85A 4RD1A 3RBVA 2ZIVB 3NO4A 4E88A 2MSWA 3UV7A 1N6PA 4L27A 1YZQA 1BO6A 1KK3A 1PYGA 1XCPA 2DJ5A 3DOEA 3L92A 2O8EB 2VF8A 3OOEA 3UENA 3TZCA 5DCUA 2PT9A 4B1FA 4XRGA 5BQPA 4RKQA 2DU8A 2LBPA 2NZVG 4C5AA 1TC1A 2DPLA 2FI1A 1G3MA 3D2LA 4YJHA 2IEZA 1KI7A 4MQ5A 4ZVLA 4ZVPA 1AU9A 1G8SA 1OFHA 1P44A 1JFRA 3E8SA 4TTTS 2YMMA 5GJCA 4CL8A 5K0EA 4FLEA 1GQQA 2XYHA 1W36B 2FPKA 4NE2A 3OCUA 4R1SA 2J0EA 2AB0A 4DMUB 3HJUA 2F9MA 1AD2A 1UDAA 1DAEA 3PGKA 4CFZA 3FPKA 4DLYA 5I5EA 5L40A 3UW3A 2Q2OA 1LEHA 3MJVA 3WKEA 2P5UA 1AKNA 1QONA 3MJFA 3PP8A 2YQ5A 1RWOA 4L72A 4I8XA 3UK1A 4RDXA 2IXEA 5GONB 4R2JA 4ZCRA 3A1TA 1BW9B 4WCFC 4N7JA 3H9GA 1ULBA 2OXEA 5JY1A 1EWTA 2CHVA 3E9ZA 4H7DA 1A5ZA 5E1DA 3L9WA 3L18A 3HCCA 5DSTA 3VZSA 5MN5A 4UM9D 1L1QA 1AE1A 1QQTA 3R7AA 4CQMD 3I01M 4U7GA 3RT1A 3ISTA 3G5MA 3FGZA 1BYUA 4GLFA 1J8YF 1QG6A 3U5TA 3KQKA 3U7QB 2TMDA 4NULA 1JDVA 1ENOA 4QGSA 1DTWA 1XQYA 2REQA 4L0MA 1KP9A 3OQPA 3UMRA 3BJMA 4FK8A 3GCGA 2HI0A 2P9BA 2WMNB 1CQZA 5AXAA 5HIMA 3C15C 3A1FA 2VPXA 1MC1A 2PJDA 2B5VA 3Q7QA 4CMEC 4U4AA 3O84A 1S89A 5AKGA 2GNOA 4L50A 1KFBB 1PDOA 4RGVA 1YACA 4GSKA 2QLJA 3N2LA 5L3ZA 1UM8A 4Z7QB 3PUHA 5IAEA 2Y2UA 2DULA 1Q0PA 4FFSA 1G1MA 4AJEA 4D6PA 3AZOA 1V45E 4CCWA 7GPBA 3GRYA 1GUAA 2FKAA 3IEXA 1G38A 1FB5A 3ITEA 5J4LA 3AR9A 2X6RA 2DLDA 1ATZA 3ESYA 3TS1A 1GUZA 4M0DA 2E4XA 1KWKA 4WKOA 1NVFA 1P1RA 1P5HA 2HPZA 2ZTLA 3GJ7A 2W11A 4V0SA 5K2OA 5A0TA 4IHAA 4QC2A 4EG6A 2A1UB 1IMJA 1EX7A 2HF8A 3ANSA 5JASA 3IKLA 4HGRA 2A8YA 5JSZA 3HA3A 1BXRA 4R8MA 5KTMA 2G6TA 4HJRA 4FCCA 4G26A 2Q9BA 1ORIA 3AW8A 4HXYA 4LVNA 3E1GA 4JBYA 5CM2Z 1U0RA 3ORRA 4P7FA 3ETLA 1RM0A 2J7PD 4KPUB 3BVPA 1NKSA 3DM5A 4O4JA 1Z5WA 2JAOA 1DKUA 1QCCA 3GJSA 3GUUA 3G79A 1PS0A 2WWXA 1M2HA 2PPLA 3O8QB 4JYCA 2AEJA 2G67A 2OUIA 2RGAA 3HB1A 4TWZA 5F7JA 4A6DA 2JVIA 1E3IA 4B2YA 4EG4A 5JYBA 1QF7A 2MIIA 2AC7A 3I92A 3NH6A 4FOLA 5G41A 1LPSA 4DIOA 1I4WA 1HORA 5TNXA 3UT5A 4KQJA 1XQ1A 2AE2A 4LV5B 4X71A 3GL9A 4GGPA 5EYPB 4M89A 1MUUA 2OWEA 3W6OA 5ETJA 3D4NA 2N1BA 4OYLA 5I7UA 1COZA 1M73E 5LXTA 2H52A 3GHYA 2I9PA 1HDEA 1L2TA 2FWBA 3FLAA 4B83A 5TXGA 4BZPA 3R41A 5HUHA 2H4JA 4DB4A 3AY0A 2DWOA 3DD1A 4AZTA 2Z43A 4D74A 2I4TA 2ZZKA 1T6NA 4Q82A 4RGYA 2XUJA 2C4VA 4TMFA 5JWHA 1SIOA 4P0PB 4WUTA 5TMDA 3S2GA 1PVOA 1JDJA 4OYHA 3D3QA 4GSYA 4C2TA 2QRGA 1NAIA 3QITA 1ADJA 1W0JA 2BFPA 3DS8A 2I7DA 2V9ZA 3OFND 5BUZA 4AKHA 1UXIA 4KH1A 3OU7A 4EJ0A 5B3JA 3RIXA 3H97A 3TB4A 4B6SA 4B71A 2XNSA 4QRHA 3C8HA 2WHPA 3THOA 2HU7A 2HU8A 2W4MA 4N8EA 3M6AA 4S1PA 4CMJA 4OOFA 3HXTA 3T3EA 1TU0A 1DJPA 2QUZA 3GY0A 3QKRB 4IEEA 2WAOA 1CFZA 4LDPA 4TV8B 5ARBA 2UYQA 3BFKA 3RUPA 1K1EA 3V33A 4BB6A 3VYRB 4RADA 5CNJA 1F17A 1PFQA 3OY2A 3USCS 3BJIC 3IRUA 4PLCA 1RKXA 2VUSA 2QLMA 2F48A 2ZP1A 2ZU6A 2A5GA 5HKBA 1M1YB 3QGMA 1NLFA 1D0VA 1KDOA 1QF9A 3WNVA 3G17A 1E7WA 2CMKA 5CURA 2I7CA 5F52A 3KXDA 1E5DA 4HDKA 2J9RA 4WECA 2YDXA 4YJ3A 1I2AA 2O9JA 1G42A 2OBXA 4G2TA 3HKDA 5KQRA 4LHXA 2RGGA 1NX6A 3PQCA 5ITWA 3OUUA 1OBOA 3OX3A 1EXWA 4F3CA 3GN2A 3PSAA 1E2NA 2AA3A 4FZVA 1KK0A 4DBVO 2P3SA 1SD1A 2R7LA 4E3WA 4LJKA 3WDLA 2FUG6 2QSJA 4G8JA 4RY0A 5KC8A 1V6CA 1XMOB 3VPSA 1YA6A 2FDCA 1QQ6A 3E27A 1R9MA 2DKOA 2F3SA 2HSEA 5FNVB 3WLTA 2NZXA 4URVR 1CUAA 5EWJB 1NN1A 3BL8A 1V1RB 5DFAA 5IBQA 1CJUC 3AFMA 4GVLA 3U6KA 3A1NA 5B4VA 2IWHA 1TU4A 5FUVA 3BXPA 4EHAA 1XFAA 2OSBA 3NLLA 3ESZA 4U02A 4PLTA 2OM2A 3DE3X 2Z2IA 3PIIA 4MPRA 3N8DA 3G0OA 3GFGA 4L3WA 5DVZA 3EGEA 1MGPA 4MYTA 1IBSA 1NOKA 2FU5C 3NBUA 4W5TA 2B4TO 2AFVA 2DTEA 5BWNA 4P81A 2NSLA 1UWLA 1ZKDA 3B78A 3RRNA 4CLRB 5GINE 2YVUA 4Q4JA 3CRQA 1CJVC 3DF7A 3IT3A 4K9PA 1U02A 2PGNA 1OLXB 3AERA 5IH3A 4DC1A 2ETXA 3ITNA 5EEHA 5HWSA 5IF3A 1XQWA 2XEDA 1CUYA 2AN5A 3BE8A 3QXCA 4FMDF 1VLLA 2PMDA 4RA6A 4TTQA 5EL0A 4Q12A 4FJ1A 3U49A 5I7VA 4MV7A 1MO4A 2YXLA 5B7PA 3VKVA 3I3OA 1Z56C 4F93B 1G6OA 3LPNA 1F0KA 3C8DA 1F2VA 1YJQA 3UT5B 3PNBA 4ZARA 2AI3A 5ECDA 6REQB 3NM4A 4BNNA 2GD6A 3WAKA 4I6JA 4ZAZA 3A2KA 1R0LA 3LYUA 4RKYA 4HB3A 1HDGO 2P2NA 2J9FB 2QJTA 1SKUA 1M2VB 2EIXA 4PX5A 5LXTB 4K88A 5I8PA 1YS1X 4I4IA 2FFBA 4I81A 1M8GA 4YX9A 1W9HA 5A06A 2NQ8A 1T3GA 2O8FB 4R83A 3ZWXA 1E5TA 2BZGA 4FOPA 4A3SA 5DP2A 5TVKA 2IPOA 2ATVA 4RC9A 3T5MA 3SYTA 4HDAA 2HJ9A 1G41A 3FSGD 4XWYA 2WFLB 2YV3A 4LXIA 8ATCA 3G7SA 1E9RA 2PUVA 2ZYUX 3N0XA 4LIPD 4NFYA 5HIIA 3TDKA 3KAQA 4EPWA 1JHAA 2R5NA 1V16B 1TCCA 2BSAA 1N8TA 2R1UA 2DG2A 4PSCA 3TPFA 1MCZA 4D4IA 2AK3A 1IUPA 1JAHA 1XDBA 1B8UA 2AD5A 1IY8A 2WB4A 5AKXA 3STXA 3R4VA 4DR1B 1N6RA 1GL3A 3F5QA 5L3QB 3FZEA 3W06A 4Y7DA 3VSDA 3MJEA 1TUIA 2JAUA 1TVKB 3PUYA 4E03A 3LUBA 2XOXA 4OUKX 1TTTA 2I6XA 1NG1A 2H85A 4QNNA 3CW8X 1OWPA 1NLUA 3L7YA 1O94D 2CC2A 3DCNA 4LRWA 4XFJA 1MQSA 1R9JA 4Y2UA 1QF6A 2PUGA 4HWTA 3WTCA 1MZPA 1XZNA 4HFRA 4L8GA 3Q7SA 3MRTA 4MDFA 1DCMA 1A96A 4B3BA 3QIAA 2QHXA 3UFXB 2Q9AA 3ZX4A 2PM8A 3W9BA 5FRDA 3UCEA 3LQRA 2GSDA 4PO3X 4DEXA 1EPUA 2OBMA 3L7AA 2QDXA 2ZBDA 4Z8YA 5EGSA 2VPZA 2YHAA 4LJ5A 3RS0A 3KB2A 2O8BA 4PSUA 4FYWA 2BZ0A 2PANA 4X8LA 2BELA 2ZXUA 4GMFA 2VAVA 4AL4A 4WKNA 4LJ9A 3C3PA 4HAZA 4US1R 4FOOA 2BFAA 3NYRA 4RJIA 2DLCX 2G4VA 3TUZC 1Y1TA 3HU2A 3KO8A 4KN6A 3VC3A 3A9WA 3WGKA 1JPJA 1ORRA 4FE7A 3UB2A 3ZCRA 4C0BA 4B5LA 3ED1A 4KVFA 3MW8A 4MI1A 1THTA 4WINA 5JFGA 2PT6A 2L2QA 3KHSA 4R1NA 4OB7A 4IPTA 1DAHA 2I4NA 2HDNB 3UH1A 3OZSA 2QTTA 3WGHA 2WG0A 2XMGA 5CT6A 2Q1TA 1DELA 1R4NA 2JAXA 4W7IA 4HUJA 4UFPA 2HCRA 3NRJA 3M70A 4GKBA 5DGTA 1XXHA 4Q7KA 3GLHE 4HAOA 2B4RO 4L51A 1KZHA 3DXFA 3CUWA 3EYWA 4CPDA 2G25A 3S2IA 4D9HA 4DLPA 1UFVA 4WCVA 2V7WA 3SN6A 3X1JA 2G5CA 4GE3A 3ZE0B 1GPNA 4HGOA 4D42A 3R9IA 1ADYA 2FSGA 4O4IA 3S68A 3GLGA 3KOOA 3PS9A 1Z28A 4CMHA 3KDSE 1JXOA 4IXTA 4CM4A 2ILTA 1JPVA 1UBEA 3FBWA 4IRMA 4RORA 1EVYA 1J2TA 2QV7A 5J4YA 1T25A 1LTKA 2CXOA 3TNDA 1HQDA 1Y89A 2VC2B 5JH7A 1YONA 2JGDA 4FHDA 4ER6A 3R6WA 1GCIA 2BM1A 2QRNA 4M9SA 1UZAA 1WDTA 4F21A 4E07A 2PNFA 4OHFA 5AI6A 2GHTA 4QTUB 2C82A 4B0OA 1R6XA 2QGNA 2JI4A 3MGAA 3HCNA 1KOJA 4DDVA 5IFKA 3AESA 3PQEA 4DCGA 1SPXA 1T29A 2X42A 2YQ4A 3BTUA 1DCFA 3E35A 3JD2A 1G2QA 1DAPA 3KAJA 1O7JA 3PUWA 1NUHA 3HA5A 4WJKB 4MPJA 3ZIUA 4YXFA 4NZPA 3X44A 4JENA 2IH4A 5EE5B 4CLOB 2CNDA 1P29A 1ZIXA 2QRUA 3TQHA 5FO1A 4Y2GA 3VMMA 3Q9SA 4UHHA 4DM3A 3NHWA 2PUFA 2OGUA 4X95A 4DR7B 3OTIA 4I5EA 1OYWA 3ZTTA 5LD2C 4M9UA 2QLNA 1IUKA 2EBWA 4AJLA 4LOLA 4BNLA 5CFQA 4HG2A 1TCAA 3NWOA 1E9AA 2UVQA 4YCBA 4EENA 4DM7A 1N2OA 1N5MA 1TA0A 4FQ7A 4DQ0A 3AYZB 2AVNA 5BUQA 5L8VA 1UJ2A 4TV9B 4DFDA 1JT2A 2JGLA 4AZSA 4LYAA 3NHAA 3PTZA 5TF4A 3SX0A 1CEEA 3WSVA 4MVJA 1IXSB 4YJDA 5HF5A 1YUNA 2NU6A 1QAOA 2Q4EA 1XTZA 2Z3VA 4JYBA 2CGEA 4MVJD 4DIFA 1CQXA 1X1TA 1XE3A 5IAOA 1QU2A 1E0JA 1E2MA 4QBIA 3CNEA 4R3UC 4URZR 1WWKA 2Q6IA 1F8FA 4OK6A 4X6UA 3MT9A 1G9XA 1N0WA 3IAHA 1KJ9A 2OORC 3HYRA 1L8XA 4PW0A 5DZSA 1ZN7A 8GPBA 3U7HB 2AKAB 1HTWA 4EB8A 1Z6PA 3OZTA 3RJZA 5CNKA 1X2BA 1XELA 4Y9DA 5LJLA 3D6FA 3GFRA 4KFUA 4WN3A 3UZUA 1CY7A 1E3QA 4B43A 4FWIB 5P21A 4PWYA 2O1SA 4L0QA 1HDCA 4FW8A 4FGZA 2O2CA 3ICWA 2QY9A 5BNWA 1T5SA 3WB2A 3KU1A 1I3LA 3SJAA 3EFEA 2P4SA 4IX9A 2JB9A 2V7UA 4G0QA 2OCAA 5D5HA 5DEOA 5JVDF 2CL0X 4TLLB 3AVQA 4U6QA 1TYEB 2B20A 2I6GA 3HBJA 1YI8A 4QKQA 3R7WA 1WXWA 1O58A 2YC2C 3HWRA 3HL4A 3LPCA 3U4HA 2BCEA 3GJ3A 1QYWA 3PE4A 4YQFA 3HP1A 1G98A 2AQHA 1HE1C 2JFOA 5A5FA 5AUOB 2PL5A 1H5UA 1JHRA 1Y4DE 1VA5A 3JPYA 4GPBA 5EC8A 2P9HA 2HMUA 3E7DA 3VMFA 1EWQA 2FHSA 1O8CA 1E0DA 3E82A 1X1QA 4LV8B 3M2TA 4R2MA 3TNLA 3JXEA 4M1WA 2H9IA 1NBMD 3FTQA 1MQ8B 1USGA 4RNCA 1ILEA 1NE7A 4P5EA 1HV8A 3F4LA 1Z26A 4OAPA 4XSGA 3CNQS 1DZ3A 4NU6A 2DKFA 5TMBA 4AUEA 3L84A 4AY3A 1ZJZA 2C61A 2VPTA 2YJ4A 1RXSA 3RQIA 3U19A 1U1GA 2JK1A 3EXEB 1Z2EA 2QZPA 3HHEA 4M38A 4G6ZA 4UHFA 5K3AA 4GKKB 1EVJA 3EZ2A 4YUVA 5J5CA 2B8NA 3U3MA 4JIGA 4LGCA 2ZRMA 4PG7A 4XM1A 2HNBA 1OV6A 3ENWA 2XUFA 2C2OA 1JMKC 4B81A 1LLQA 1PBTA 4AJ1A 4BNIA 5MN6A 4M0CA 1JHYA 1EAMA 1K2WA 2QTVB 3TVDA 1FFHA 3MILA 1DJOA 4G09A 2R5WA 4AO6A 3RF6A 1RXVA 1Z39A 1FRQA 2WE8A 1W8DA 2HPAA 1HL3A 3K53A 3SLRA 1GKKA 1JR4A 1M1XB 4P2GA 3UJDA 3WHKA 4BP8A 5B53A 2X1MA 3V2GA 1W0KD 3BXGA 2PYIA 4QECA 3COZA 2Z6VA 2JH3A 4PHHA 1CZUA 4QUBA 2XA2A 3QY9A 3GGCA 4TQGA 2XGGA 3JWPA 4BJ3A 1QO7A 4ZVQA 1RWKA 4B76A 1ZVMA 3LGXA 4OP1A 4AG6A 2ZZNA 1P18A 3IPAA 5EP1A 1E5XA 3L6CA 2CW5A 4IDQA 3UKJA 3AXTA 2CVPA 3C87A 3T7SA 4ZQGA 3U0BA 5IKOA 5C1OA 1HWYA 2EP7A 4MQMA 9GPBA 4WK2B 4FR2A 4HVTA 1VE1A 1ZH6A 5CVTA 4M46A 3JSAA 4R2WA 5I7FA 2FMKA 5BN5B 1G6KA 1URPA 5JECA 3HXOA 1YS9A 1NU8A 4QUKA 4I7EA 2HO5A 2UVPA 2E87A 2G7MC 3R9XB 1Y5NA 1TIBA 3L6OO 1ISRA 3IUBA 1CE8A 1XTBA 3MMXA 1EWVA 2K7ZA 1NQ5A 4EKEA 4DCOA 2OZVA 5LJIA 3SHWA 2FMUA 4LC1A 4LRQA 1FQWA 1OT5A 3D02A 2W8ZA 4TPKA 3D8HA 2GRUA 5B1EA 2M1XA 2ZBUA 1RYEA 2QUBA 1TYZA 2VCHA 3HADA 1M10A 4U1RA 2G0TA 4DDTA 2H6EA 3WNDA 1RXEA 1FF9A 1MG0A 5K9ZA 2ZJ0A 1EUZA 3KDAA 3NH9A 5REQB 3GRUA 4L6IA 2BKEA 2HT6A 2XNDD 4A0GA 3AHEA 5IJAA 1ZMXA 2BDEA 3OH8A 4N6NA 5FTNA 5HYVA 1KRHA 1XK6A 1YR7A 1Z17A 4ZAFA 3UJHA 3BH0A 5DTRA 5A4MS 2AYXA 1SD5A 1T9GS 3AKCA 3TRDA 2AFRA 4JASB 4IFTA 5T67A 1WVMA 3IXMA 3ZWBA 5D6OA 4O2LA 2RD2A 5TPWB 4CZ2A 1L9KA 2NWQA 4YMIA 2QJRA 2CCGA 2X0FA 1EDZA 5HCIA 4C89A 4C3VA 3OZAA 3E9NA 1NUTA 3CE9A 1LK0A 1V3UA 4PX2A 3VV2A 3T99A 2YV2A 4D9NA 1I32A 5AR1A 1G8JA 3GFBA 1A9YA 4H3HB 2IKSA 4L28A 3ZV6A 1T5TA 2NADA 2VHUA 4GUDA 3IVAA 4PGAA 2DUUA 3PZBA 4YMWA 1P1BA 1SCKA 3KQSA 2ZTMA 1ZI8A 1CE8B 3E5MA 3OUZA 3K2QA 3EGXB 4KDRA 3FNEA 2VNJA 1U1EA 2VQ6A 3ZK7A 3IX7A 3L1VA 2ARKA 3PQ5A 4C04A 1D1PA 1W93A 3PA8A 4I4NA 4ACAA 5KJCA 3Q8KA 1U90A 3VR5A 4IOJA 1FTQA 3N2KA 3O8QA 1YRBA 2IZOA 1RKBA 4F86A 2XA1A 2C0QA 1F4LA 5LB4A 4UBNA 5LP6A 1N2CE 5ERXA 3BHNA 1RAEA 2NTJA 1CHNA 3FWKA 1Z15A 3IIJA 2FSPA 3O4IA 5CCEA 3U4QB 3HCDA 1CRZA 3L05A 1U94A 1VC2A 1Z22A 3DE5X 5KKCA 5J2UF 1KEVA 2VN8A 2WY2D 1RZ3A 1VHQA 1L5ZA 5B55A 2CYAA 2PAAA 3H1EA 3O4GA 5CBPB 1Y8RA 4QBHA 3LOPA 6ADHA 5A3JA 1XWWA 1QPGA 3K09C 5JH7B 3QWAA 2EKBA 1FP7A 3RS4A 4BMVA 1YJ8A 1LD3A 3FG9A 3TPZA 2CVZA 3IQIX 3H86A 1ZITA 3F6BX 5H83A 2FWMX 4LXYA 5JU6A 2NTYC 4CEIB 4N5NA 2IHUA 3N59A 4RYLA 7REQA 3VR2D 2FN9A 4FTWA 2FPRA 3TAXA 5IW8A 1NBEA 1DAOA 1HYBA 1VIAA 3B52X 4I1IA 1ZMBA 1YBMA 1U80A 1B23P 4WD3A 4I5FA 1KDYA 4OG2A 4F56A 4IIBA 3T9AA 4BNMA 2ZRFA 3LXUX 3IAEA 1R9NA 3KKPA 4BAZA 4QDKA 4ND5A 1HZZA 2XUAA 2ZI5A 2J0QA 3AQIA 5EKSA 4U00A 4DMGA 5KUTA 4OOEA 4CUKA 4IHJF 3SVZA 2FX2A 4IG9A 4MJ7A 4X1OA 2DSTA 4YYZA 3DVQX 3T3DA 4CKZA 4IJVA 1T1JA 3OIFA 4KVAA 1D07A 4P84A 4JOQA 3S99A 5LP6B 2DBRA 1NIPA 1L5QA 2Z9DA 3AR8A 4A92A 4QFDA 1K4MA 4LYJA 4Q7JB 3OWXA 1O9HA 1CUZA 4FPXA 2AXEA 3N8HA 2XHZA 2I34A 4X1IB 2FEAA 5HDQA 1JLLA 3SM9A 2WKSA 3AP2A 2HWWA 3I52A 4OSEA 5BUCA 1TO2E 1T2NA 2GN1A 4IDDA 3E3MA 2XY4A 5AWFC 5KYUA 3TBKA 1GTSA 5A2GA 5KREA 2J07A 2X15A 3FYSA 5KCMA 3C85A 5JDCA 1NR5A 1HFKA 2V6MA 3KOXA 2ZCJA 3TTSA 1YDGA 2WU4A 4DG9A 4XJVA 1UPFA 3ECAA 3P96A 3WL6A 1RXUA 4LNHA 1ICEA 3AVVA 2X0IA 4CM7A 1FW6A 1IZ7A 1AKMA 1E2FA 2PFKA 2O14A 3DOUA 1E0SA 3L7NA 4I66A 1X7HA 3ROTA 3PFIA 4QSHA 1L5HB 1YR8A 2D13A 5CX4A 2F90A 2MHCA 5BUSA 3FCYA 3NTRA 2EGGA 1GZDA 1A88A 2XD9A 3GEMA 3PIDA 3G6WA 4BMNA 2O8EA 2GCIA 4Y67A 5SZKB 3GXOA 4EW6A 2GCEA 3KJGA 2ZG6A 4D0SA 3VNVA 4DRXA 2JARA 1R12A 2VNKA 4AY2A 2IXFA 3GWZA 1SVUA 2NO7A 1K7FB 1QH9A 2E82A 4XYBA 2F2TA 1UPCA 4MWTA 3KYDB 3VH1A 3WIUA 4BNHA 4R8LA 4QQKA 3H1AA 2OA0A 3DKPA 3RVMA 3WLQA 1S7CA 4OJTA 1NT4A 1QHHA 1Y9EA 5AJZA 1NNSA 3GRKA 5BV1A 2QQGA 4HI0E 4Z7OB 2OCPA 3EFOB 1EGQA 3FPCA 1UM9A 2WNHA 1RFLA 3MIIA 1X6VA 4U2BA 3T0GA 5AFSA 4EYKA 1FPMA 2JGMA 4FYMA 1XEAA 1QUFA 5EZ6B 3TR6A 4G85A 2A92A 3B70A 4HEA1 5HF9A 6CHYA 1D2GA 1GLNA 2JRLA 4G5XA 3ZU4A 1DMRA 1NAHA 4HF7A 4LOJA 4JB0A 2FMXA 2CNWD 2HLNA 2OT3B 4KITB 3FUVA 1BX3A 5DWQA 2PSDA 4O4HF 2XE8A 5D87A 4BVHA 4X84A 3VAAA 3FSRA 4GBGA 4F97A 4R9UC 1ESCA 1N8KA 2W6JA 3CV3A 3FWHA 5A05A 3IUYA 2ISQA 2OFFA 3T3OA 1UMDB 2IHVA 2Q6LA 1BEUB 3I3SR 3SEZA 2D5LA 4ECEA 5LSAA 3KELA 4Y98A 3STYA 5DYGA 2QRPA 4ENUA 3BYZA 1GCOA 1XIVA 3C70A 2X6QA 1LS6A 3P32A 1GDDA 3STTA 4Q4HB 3A4IA 3ZV5A 3QA3E 1GDTA 1W5BA 2NACA 4G9EA 5HF6A 3OM1A 3B9RA 3C3AA 3E7PA 2NUAB 6Q21A 5JEEA 2O0LA 1IH8A 2R1VA 1N6HA 4CKCB 3D5QA 2V03A 4XX0B 2X86A 5ECYA 3SVTA 1QLJA 2BBTA 4L15A 2NV6A 2B9VA 2BGGA 2EWMA 5EPOA 3LBAA 2W93A 4G5QA 2ADOA 5CFRA 4YP5A 4XEHA 3QPDA 3P9PA 1SKYB 1MTOA 3QG1A 2CFOA 3NIWA 4CM5A 2XTZA 5JZOA 3VU3A 1GGVA 2UVPB 2PMFA 4KPYA 1YZYA 4G0WA 2CUTA 2FX5A 4MK4A 4REOA 4GZ5A 5LM3A 2O8DB 4L4RA 4W1SA 3PDIB 5I9TA 2EQBA 1AV6A 3B9QA 1WZCA 2QD1A 1JIVA 1ZY2A 3QNWA 3T7EA 5HQTA 5CT9A 1N2SA 1T8TA 3L8ZA 1JG4A 3O9MA 2PFSA 4XQ0A 1PL6A 2AG8A 3HDJA 1X94A 4L5IA 2FPGB 4TKUA 4XFKA 4AS1A 1FX0B 1Z82A 2UZ0A 2VRWA 3LGAA 4MAAA 5EJ2A 2HSWA 2OYSA 2VQDA 5JZ9A 2QTRA 2WKWA 5KPDA 4IFEA 4TWJA 2DBZA 2JGNA 3MWFA 4EZIA 8AT1A 1GZ7A 2ZJ1A 1UBUS 1KSFX 1ZRHA 1MVLA 2PZJA 4WZAB 2E2WA 5AW1A 3G3EA 1DVRA 3AZPA 4P4GA 3VVCA 5FNVF 2V98A 4ZRMA 2OZPA 1X9GA 3S8MA 1ACLA 4XIYA 4G1UC 2FWRA 2Q3BA 4ZZ3A 2ZIEA 2QY6A 5G0UA 1TZ2A 1LLFA 3MT8A 4P3KA 3IPYA 3MOGA 2G5GX 4ZN6A 2GO1A 2OXRA 4G25A 2ZUSA 5BVGB 4B3MB 1G4AE 2A6PA 2W00A 1N7HA 2QRQA 1ZL2A 4MYRA 3U7FB 2PE5A 2P9JA 4NNJA 3QPVA 5AW2A 1P31A 2HEGA 3SJZA 4PXSA 3DUFB 4TWBA 3L82B 3PDCA 1TCUA 4ERNA 1U0HC 2VDWB 1XZ8A 1RI4A 3ODGA 4C6RA 2FSVC 4DQUA 4DLAA 4X65B 2YC4C 3PK0A 1B76A 2QLBA 2XIQA 1XVTA 4J0EA 2ZT8A 2JPDA 1NJGA 2VDLB 3G2LA 1O95C 5C8YF 2WM9B 2X2PA 3HXLA 4ZYUA 1SRRA 1C7QA 1SCQA 2AH5A 3A4YA 4JC4A 5I7SA 1J9ZA 1RCUA 1U3VA 2GERA 4WE3A 3TRIA 4QIHA 5AP9A 2C84A 1QCZA 5FORA 5REQA 4YO8A 1JG1A 1E7YA 3D54D 3N2KB 3RIYA 4CG2A 4D9GA 4PPNA 3I53A 2BUBA 5EZYA 4EKNB 1CR4A 2H48A 3I5UA 1ENYA 4P6VF 4B3HA 4AAYA 4ZO7A 1MN6A 1J70A 2AIRA 3GG2A 3IOCA 3SNHA 1PGQA 4OAQA 3TTYA 3NU1A 2PCLA 3LOQA 4BLTA 1Z5GA 2LNDA 2HUNA 2VHZA 4MV9A 4L9WA 1B42A 2JA2A 2YOHA 3ICPA 4MINA 5GVRA 3RVQA 2AT1A 2ZS8A 4UHJA 4ASUA 4DJFC 4C05A 2R7KA 2DFVA 3FMFA 1A4IA 4ASUD 4MW6A 4LXXA 2AN3A 1YK0A 3GJXC 4ZZ2A 4AMVA 4C08A 1G3QA 3G2MA 2WM2A 4URUR 1Y6RA 5FCDA 1YF3A 5F4BA 1S8OA 1V4BA 1P4AA 1ZICA 2IFTA 1K2VN 4BAGA 4KPEC 3B48A 4V0RA 3NIBA 4KBYA 4M37A 4RQTA 1HFEL 1U3DA 1AS0A 1YE5A 2GPWA 3ML1A 3P26A 1BD4A 3ICVA 3QUCA 5CJJA 5DGDA 1K06A 2VSQA 4BMSA 1R8SA 1U4NA 2Q3LA 2XSZA 4MHSA 3NDIA 1ULHA 1CYDA 3IKTA 1ODTC 3V8EA 2BKAA 3R0QA 5EWMB 4BQRA 1S1CA 4Q6WA 4YECA 4B47A 2X3YA 2ONKA 4C4RA 2Y0EA 3WIDA 2PZBA 4HNVA 5BSHA 1C8VB 1ZK0A 5A9SA 1U2RA 2VPPA 4JLAA 3HCEA 3OI7A 5JQGB 4JJFA 1K3FA 5G4KA 5LZ7A 821PA 1XTVA 1PFYA 1MPXA 4WIAA 4Q02A 3UYKA 2ORVA 3DGEC 5ESXA 1LSSA 4LXQA 5AQEA 3TQRA 1XD2A 3CH7A 4MA4A 2Y0DA 4WLEA 5KTPA 2JAPA 1CRPA 3M6VA 1W9MA 4KODA 3EVFA 1LQUA 4RHEA 1QYDA 4YGXB 2VJAA 1PR5A 5EQDA 3RIEA 3T3PB 3GGPA 1B14A 4AMYA 1V1RA 1EXNA 1NVMB 221PA 2D59A 2ZI9A 4GMDA 4BQOA 4WKGA 2Y1XA 3A4LA 4A8HA 4HQKA 4OI1A 3KDPA 4DDKA 2Q7XA 3IXQA 3OIUA 2IBSA 2D00A 2X8LA 2VAMA 2GZRA 1GTRA 1WUTA 2IITA 2WJ4A 3O1HB 1GT91 4KSCA 1W5AA 2C9BA 13PKA 4C03A 4R1UA 5AW9A 5H3CA 2F3TA 5D01A 2GNAA 1ULTA 3KVNA 2HA2A 4KCGA 4NYMR 4YRRA 1UZMA 2I67A 2XRFA 4KDCA 2JFFA 5EPEA 1U0LA 1SUAA 5IS2A 4LSWA 3DE4X 3HKCA 2HQBA 2OWDA 4KLNA 5AKJA 5LQCA 1M7BA 3D4PA 1F3LA 3BHIA 4YJGA 1H6BA 1BKYA 2B98A 4L95C 3HDTA 3Q7PA 4ZD6A 5HEKA 3V80A 4Q4DA 3JX9A 3OLXA 5ER9A 1SUFA 1W4ZA 5JJLA 2P65A 4L1KA 4MVJG 4GEKA 1YGPA 2CL7X 1VHTA 4XX1A 5C7OO 3ZGNA 5I4BA 2VKTA 2IA5A 1KBOA 2V45A 4H27A 1SXQA 3MSCA 4ADSG 3X1DA 3A6GA 1XRQA 3EIUA 1R6TA 1NSYA 1JEYA 3NC4A 4EVQA 1K75A 5F4ZA 4CKXA 1RC1A 2D0OB 4HQFA 4S2UA 4UNSA 2FOLA 2H5LA 4J0IA 2WUDA 4KVZA 1E98A 1WSDA 4HQNA 1YQEA 5ILQA 3X1WA 4RZ2A 2D0DA 1PDVA 1QZUA 5TQ0B 2W37A 2XBLA 4KO8A 1JWBB 2PBFA 5CT5A 3TKLA 2AFHA 3OIGA 4C7MA 4MS1A 5CMLA 2MMCA 4YCDA 2NTVA 2V7QA 5G4LA 1OIWA 4GX0A 2WAXA 2QSYA 4E0BA 1FLVA 4GPIB 3RB8A 1W5FA 1Y82A 4F2PA 1KAHA 3QU4A 3L7CA 2B8WA 3H16A 1VHWA 4F1JA 1DU4A 4MPTA 1KVSA 1LPAB 2FRDC 4HNHA 4DMLA 3R6DA 1L1FA 3BJZA 4IOMA 3ZHVA 4HTFB 3CYFA 3ONWA 4I9GA 5FQOA 2C4TA 4GX5A 4E5PA 1KJYA 2YVQA 3ILSA 1UJBA 2EJVA 1NM5C 2OMEA 3QF4B 2YN0A 3CO5A 3EY4A 1W73A 2E4WA 3ZWMA 3OO1A 2ONZA 1EDDA 3VJRA 2AOUA 5FOUA 5A4AA 5H16A 1WBBA 2ZE5A 5F1OA 3GFSA 1H5QA 4QUIA 1Z34A 3F46A 3E9DA 5FPHA 1PSDA 3GGDA 1PWHA 1NDUA 2UXCB 2DKNA 2PSHA 4PLVA 1PJ3A 4NZMA 2Q9CA 1KMHA 3C3DA 4A8JC 4PYRA 2BKVA 4FD2A 5BNFA 2VUHB 1TJYA 3C3BA 1QGOA 2NM0A 1I6LA 1B6GA 1MKYA 4NYJQ 1R74A 3SSOA 1A76A 2MSCB 4IDPA 3UHJA 5DP1A 2V6FA 3E6AA 3BCRA 2WJWA 3AESB 3IRVA 2YASA 1P33A 1RXYA 1KAGA 5EIAA 3CB2A 1EVEA 2XUDA 3F74A 1EE1A 4R1QA 1C7EA 2X9QA 4EHDA 2ASEA 3BIOA 3ZTYA 3TBFA 1CQIB 1WUKS 3HU5A 3I5MA 4I1UA 4BQEA 4OSOA 1MXHA 3K05A 3O8LA 4OHPA 2NUTA 1DQPA 3UT0A 3KB1A 3EC1A 1B3BA 1P8AA 2JAQA 4AZ3A 2VBCA 2R7NA 1BGXT 3FCEA 3VTKA 3MTEA 4C7BA 3QXXA 1N8NA 5IZCC 2JJ1A 3DFUA 4LF7B 2XUZA 2R47A 5EMLA 2P1RA 1X3LA 4AJJA 1Z73A 1XVLA 2ZVDA 4QAJA 2I7XA 1T26A 3X2SA 1UMDA 1QORA 4PF1A 1SK9A 4X1YA 2E4AA 4ZAVA 3RUEA 4CKEB 4ZI5A 3DR3A 4KJXA 3QFSA 4C1NA 1ZVVA 5HIKA 1NRXA 1B6TA 2QX8A 1DXHA 4GS5A 4QYMA 1QANA 2XKAA 1P0IA 2VSXA 3IPXA 1UP4A 2KX7A 4IGFA 1YL6A 4JJEA 2CK3A 4N3CA 4ZWNA 5I7HA 3DXYA 1K6EA 4AMGA 1W6RA 3LBHA 3VZDA 3ZCXA 4XVUA 3QE3A 4L8YA 4KAJA 1SIBE 3V1LA 3V1TC 2PX3A 1FMLA 1N6LA 1REQA 1V11A 3O95A 5KYVA 2HL6A 5I7WA 1X1AA 1Z5UA 2ZR8A 5ARDA 3LK6A 3OJCA 1EAYA 4AMZA 4ZFNA 3B1VA 5FQNA 1GGHA 1X2EA 2HJWA 4J9VA 5EWLA 3ZVMA 1ZZGA 2IYAA 2XA9A 3H3JA 4IIGA 4YGYA 1SBTA 3QI2A 3GCWA 4KNYA 1GM5A 5LQUA 3R3WA 4MUFA 1OWOA 3E8XA 5K8CA 1DJNA 3WYEA 2NP6A 2W8BB 1OX4A 3WRYC 3PTLA 1GQRA 4HRXA 3KVRA 4Q9DA 1AK9A 1JHDA 2A7QA 4HLDA 1O8BA 3PE6A 3H9EO 1H1DA 4JUIA 4MA5A 1JJBA 1YS2X 2YHIB 2YRXA 2QR5A 3CMMA 4QPCA 5TJHA 1J4AA 4EMTA 1WR8A 2GPNA 4MB2A 3M8KA 1DWQA 4Q24A 4WVFA 3Q3JB 3QEKA 2IXTA 4Q7MB 1D6SA 4UOEA 4H4CA 3M6MD 1R66A 3MJCA 2EL7A 1XEWY 2ZQ5A 1W87A 4JL8A 4B2LA 3KT0A 3PEUA 1YU6A 3RE1A 4E14A 2C2BA 3CLRD 1R4AA 4V0NA 1X15A 5J4HA 2ZU0C 1HQYE 1SOUA 2BMWA 2IDZA 2DE0X 1OUMA 1HH4A 2FKNA 3MN1A 4FZ3A 4ZOLA 1BS9A 4QOGA 4AKEA 2H63A 4Q01A 3UWPA 1QSGA 1R00A 3FHTA 3UWOA 3CWQA 4U7FA 3ZDDA 5KOHB 2BEWB 1PYDA 4S0XA 2ONCA 4REQB 4L8VA 5C1PA 4O1HA 5A6SB 3GI1A 4DT1A 1S2IA 3NBAA 3T7IA 1QBGA 2IEBA 4A9AA 2VP6A 1VA4A 4TMWA 4CKBA 1KXZA 4ZT5A 1N2BA 5CDGA 5BSEA 1BMFA 1P2FA 4GI1A 2O8CA 1B2RA 2YMLA 2WT9A 3MWJA 3P0HA 2QAGA 3NTVA 4YRMA 4G3XA 3E48A 3T0FA 3I8XA 3KJIA 3VO1A 3UV3A 3NKVA 4X1KA 3FR8A 3ACDA 4C7VA 5CFMA 1O6FA 1ZNZA 3I6ZA 3IURA 3JQ8B 4TVKA 5TB5A 5A9RA 2PYDA 3ILHA 1KS9A 2W98A 4KIUA 4Q1DA 5DV9A 1DQNA 2WIBA 4PLFA 4PLYA 5HTKA 4W5QA 2JD2A 2K6GA 1TK3A 1A95A 3FSGA 4GP6A 5AYVA 4HVAA 1J2UA 3EGWA 1GGFA 3C8ZA 3IMFA 4KV9A 3AETA 4FJ0A 4LYDA 4EJMA 4XE5A 3T6KA 3VR5D 3HYCA 3ZR4B 1MXFA 3C5EA 3CCBA 1J7KA 1U0TA 2G5PA 4KYVA 2P9TA 1DOAA 1GA1A 5DSZA 2FMIA 4NATA 1CY0A 4FS8A 5JJIA 1C3JA 5TR9A 5C8VA 2KSQA 3JQ7B 1ORHA 4E33A 4KR9A 2I76A 3CVVA 3C4QA 3KFVA 4I1SA 1KJZA 1JKJB 1ECFA 4WRRA 5B6JA 3WAJA 1FYFA 3B3QA 3IQFA 4WPGA 4P92A 4CQLA 1WMAA 4LJAA 5J40A 4EI7A 1WNFA 1IEQA 4KYTA 4NICA 1PZNA 2P9ZA 2XYVA 3HKEB 4BKRA 5KQSA 2XXAB 3DBRB 5ELMA 1VLHA 4IKOA 5H0IA 3THYB 2YFQA 2Z4RA 4Z3KA 1WDKA 3X1MA 4CI0B 2GZSA 1TVKA 2CDNA 1R0CA 2GN0A 4A10A 1GAJA 3ZY6A 1IN8A 3LHDA 4N3NA 4NL4H 1MA0A 2QT1A 2F1IA 2B3DA 1U3GA 3ENKA 3GPCA 1GNQA 4IXMA 1DAIA 4H59A 5TEWA 1EE9A 1DAFA 4L4UA 3AU9A 2QVCA 1M5TA 2DOKA 4F7DA 1NW4A 1V1MA 4LCBA 1ADGA 3CSSA 3KALA 3HYNA 1EH5A 1FDIA 4FQ5A 4ZALA 3LTEA 2JRCA 1HZJA 3NWEA 4J8PA 5CM9C 3HSSA 2BOVA 3RHZA 4BX8A 4I9UA 2XZTA 8ADHA 3OEED 4ZCPA 1H1LA 2AOXA 3WGNA 4E1BA 4I3FA 1NOIA 1YL7A 2HQSA 4A36A 4MVJE 4PCVA 5L4SA 1OX6A 2C9CA 4JELA 2O1XA 4RM3A 5SZHB 4BFVA 5K6AA 1FP2A 5DJ5A 4YONB 2FLWA 3ZIAD 5M04A 2AR7A 3KKOA 1ZM3A 3LPMA 4BN4A 1QP7A 3OQIA 1BKDR 2E9SA 1QOZA 1MJNA 2PUJA 3M89A 4M8NE 5ALFA 4BPRA 4BUZA 2BFBB 1ZISA 2Z1MA 2UUCB 1SELA 1R6VA 5AJTA 1FDVA 2D4AA 5DM70 2G06A 1SKMA 3JZIA 4YRGA 1Q1BA 1I36A 2BHRA 1ZN8A 3FMVA 4IXDA 2UU9B 1ZEJA 4MHTA 1CQJA 3IR6A 3PC2A 3OQ6A 5AM3A 2COKA 2DGDA 1GDHA 1KQ3A 2QJOA 1A2BA 2IGBA 4UDNA 3IH5A 1C3LA 2YYSA 2BHTA 1RWPA 4B31A 5EHXA 1O5IA 3D4LA 1T2DA 1A8IA 3EDRA 2D0IA 2XYGA 2RGNA 2ZTSA 2MU1A 3RU3A 4CF3A 3I01A 1S0UA 4TYMA 3TTWA 5LQAA 3UJAA 4NCKA 5HCUA 5JWRA 1JHOA 9LDBA 5EKDA 1PJQA 2ODEA 1T8PA 2OOSA 4M0FA 1XMQB 2EJUA 1M2OA 2BJHA 2FK7A 4AP5A 2OZLB 4PGGA 4MKHA 1H2YA 5EKTA 3O94A 3UUEA 4OX9Y 3ROKA 1RAIA 5K8LA 3B3AA 1LK5A 5LA6B 3L5KA 4TOIA 2JI9A 3CLTD 3EN0A 4GVPA 4UDXX 2PBLA 3RTGA 4CVNA 1WCIA 2XMQA 3GGOA 3F7TA 5KX5B 1A9SA 1WXFA 3LZCA 2PFGA 5M3BA 5CFPA 4IM7A 2H17A 5EVCA 2OOKA 1JDBB 3RD5A 1MB4A 1GSHA 2XF8A 1KZGB 1UBFA 5ALGA 1H1TA 4J2OA 2TYSB 5A3RA 3WLAA 5LLTA 2J1LA 2OLKA 1JEQB 1UFRA 1N9ZA 3ZY4A 4XPIA 4W5NA 1T0UA 3PQ2A 2JLXA 3GCXA 1ML3A 1RJ9B 3RSZA 5JYDA 2Q8QA 4F2WA 2HLDA 3A8TA 3FZYA 4BYGA 4GMKA 1A7UA 2GPBA 3FWNA 1VG9B 1QWOA 1XCMA 4LOAA 5EJIA 3RU7A 4EEXA 1ONBA 4JP2A 5BMVF 1A8QA 3LW7A 5J58A 3DHWC 3MCVA 3VYWA 1PV4A 1W46A 2MDTA 2FMHA 3IT2A 1VL5A 4ZPJA 2I7TA 3PYXA 1LW6E 1ZIDA 1XYYA 1BGWA 3N3AC 1AF4A 4GYKA 5GY7A 4AECA 1NSFA 4P32A 4IMJB 4MKXA 4PHFA 1GZ5A 1CWUA 4PZPA 2ZQZA 2KI5A 3LFHA 1KK2A 1EGVB 4QEDA 1O57A 4B40A 1SMKA 1UC4B 2E6KA 4F2DA 4QPJC 5C8DA 4YJ3B 5HOQA 4BLVA 2IDMA 3QWHA 1Y9DA 5A4FS 2P2LA 4N40A 4RHTA 5ESDA 1MX3A 5IPFA 2PX0A 4E5SA 5FF9A 2KLBA 3B60A 5CNMA 4ZQIA 2E5LB 1CJTC 1Z0JA 3DAPA 2VTBA 3MXOA 3HJRA 4WOJA 1UL1X 1ENZA 2PJRA 3ZVNA 4ITRC 4EWLA 1ZGBA 4RS4A 2F1OA 2KBEA 3H6HA 5DNVA 1QIJA 2CKMA 3LFTA 4CMEA 4EGQA 4ETMA 5M34A 2GEJA 3IULA 2DPMA 3X2EA 1X9IA 1FXSA 2KB0A 3LT4A 1RVDA 3N0WA 4IS3A 3M3DA 3EAGA 1QHEA 4NXNB 2XUHA 3CO0S 3AEKA 1PUJA 4NEQA 4AFNA 2Z6UA 1UJMA 1J00A 1AUXA 3G1WA 2I2FA 1T5HX 3UANA 4XSVA 2I6SA 1J8FA 3LKZA 5AW5A 4YP9A 1A2KC 2ZWPA 4FYKA 3W3AH 2G1PA 2O06A 1KY2A 1H2RS 3G0BA 5EWMA 4BBZA 4BIMA 5JJCA 2GGSA 521PA 1QCYA 2JK0A 4KIJA 2F55A 3CSUA 4XCXA 3D8UA 2PX4A 1TTQB 5CIQA 3COWA 2P6MA 4O33A 2ZXEA 2JZOA 3GD7A 3FTPA 4QTTB 1X7XB 3W77A 2PIAA 3RARA 4F3NA 3OC0A 4ZI7B 1AO3A 2J32A 3C7CB 4IH9A 5GOTA 3ABRB 2W4IA 2H1OA 2I3GA 1WEHA 3PYMA 5FJIA 4JP3A 1IAVA 2NT3A 1DT5A 3PHCA 4HSEA 4OXKA 3SHOA 1HEYA 3FPHA 3I58A 2XKKA 2F9FA 3NTQA 4MQEA 4YCAA 4WT7A 3ZHYA 1PDWA 1C1HA 5EYPA 4Z8XA 1GUDA 2H07A 5FADA 4FNAA 4PCAA 3PKJA 4K05A 1TEXA 3RWBA 2PX8A 3ZY2A 5KINB 3D8TA 2BBWA 1B1AA 1W4RA 1EEHA 3SI7A 4ZHQF 2O2HA 1SVNA 3KR0A 2UZ1A 3SIRA 2IX3A 4EA6A 2EJBA 4N8SA 2J6CA 3KG2A 3OLVA 5E9QA 4B3DA 1H4QA 3SYLA 4ARUA 3H5AA 3OCWA 3HA7A 3RIHA 1R5BA 2P40A 2REBA 3BMQB 1TEHA 3K5HA 3LA8A 5DH9A 2QU7A 3EYAA 1GPH1 1RJDA 2OBYA 3G89A 4H0FA 4MRRA 3BGIA 5F51A 5B1IA 3S44A 1FLAA 3K35A 4B33A 1QS0A 4I50B 2WJIA 1Z7EA 1ZH2A 4RESA 4YRBA 4YJ2F 1L4EA 1M1NB 5DBOA 3LMKA 4EK9A 1S01A 3RS5A 3KQHA 1L3IA 3NBXX 3QVMA 4R1PA 3QLVA 4G81A 4RJTA 2VHXA 2N42A 2I2BA 1F8YA 1QGAA 1NGSA 4BNDB 3DMGA 1RM3A 1Y7HA 4TT3A 1W29A 2Y6UA 4OXNA 4YEDA 4E15A 3WMRA 1W36D 4RDIA 4YI3A 2PEZA 4JBNA 5KOHA 3DZGA 2NO6A 1BWQA 2GAOA 1I2DA 1EJ0A 3C6XA 4K6CA 3Q0EA 4PICA 4TSFD 3TEFA 4I9NA 5H4HA 3ROFA 4CTJA 4BNTA 3BBPA 4PNZA 2FG7C 2CNOA 1PV2A 1KO7A 3NR2A 1N2CA 2ODWA 2EFEB 4P8RA 1KYVA 1ZD8A 3TF5A 3ORSA 1E4EB 1P6QA 4G0NA 5TLSA 2C7VA 2QPLA 2WP8J 5AW0A 3QU9A 3H2SA 1F9EA 3UXMA 1QM5A 3TLGB 2ROQA 1X42A 1VJ5A 3B1JA 1NWCA 4PRYA 4R3NA 4TMYA 4WSOA 5DT9A 4DAOA 3OMWA 1LRLA 3I5XA 3OZXA 1YBHA 4X63A 3VGPA 3H4TA 3P2EA 4QDZA 1V5WA 1JLKA 3H7IA 1F3OA 3MCAA 1ZXXA 2KM1A 4RD0A 5FR2A 5GQSA 3RF7A 2B37A 1S9DA 3DOHA 4L78A 2HDHA 1WAMA 1YK1A 1Z0KA 3B3FA 4I55B 4N3AA 1SAYA 4X1KB 4LJLA 2EW2A 4RENA 3RUDA 5CT8A 2LCQA 4M87A 3EIOA 1COWA 3H75A 3WGGA 5ALZA 4LF4B 1FU8A 2QAGB 2CFSA 2QRKA 3AM5A 4CNBA 4DPLA 1UJCA 2J87A 4GIBA 5E6RA 2NOAA 4Y2JA 1N25A 4XVCA 4OFWA 4BHTA 2RE8A 4FM9A 3C6MA 2EERA 1N5KA 3KLBA 3N2GA 2J9XB 4C0WA 1PG2A 4OX9B 2AG6A 3FHOA 2O57A 2XZLA 2IIPA 2GPAA 2RAVA 1R10A 3KOWA 1YA4A 3EXAA 4C06A 4PLZA 4P93A 1Q0SA 1G55A 3BDVA 1BMQA 4PG6A 3V97A 1JEYB 4BNYA 3GDGA 1R3DA 3FUCA 1G16A 2W5UA 4BNDA 4GOMD 4UFOA 1L7RA 1CY1A 1XZQA 3HN2A 1ORTA 3PSHA 3RUFA 1G19A 1PWYE 2O2YA 1X7ZA 5CX1A 4URFA 3T9EA 5AK3A 3D1LA 3SBEA 1L1RA 1JR3E 1T4MA 2WJJA 2ZS7A 2H5EA 4JR2A 4M7WA 1IY1A 1FMTA 4TN1A 3PUVA 1M34A 1JECA 5AUNB 4BMDA 1HETA 3PC8A 4S0ZA 3D7NA 5HKLA 2FJUA 3UKOA 5IP5A 1N3YA 1SUPA 1IWPB 1BJTA 3ANYB 4UDYX 3R77A 3BCSA 1XAHA 2QT0A 4O2AA 3A7DA 1G1AA 5CDFE 2C5EA 1D2EA 1WQ1R 1DL5A 1QVZA 2HLPA 2GBIA 3FNBA 5FI0B 2EFYA 3CX4A 1GPUA 2QMZA 5T3UA 3RV4A 3KTDA 1NIJA 2G71A 3KYBA 4OLFA 4Q00A 2Y6VA 3BWMA 1A7JA 1ZA2A 1IZ8A 2ZJ3A 4FILA 4YRCA 1V2HE 5HA5A 4BN5A 3R9WA 4DIMA 1YMVA 4RTOA 5CH8A 3VBCA 3BWVA 3O3CA 4OHKA 2ZFUA 4H4DA 1B0AA 1NVAA 1TCVA 4OJKA 3NC1C 1PGJA 2QJFA 4Y3UA 1M2NA 2P4HX 3M4XA 3A6EA 1UH5A 1QHNA 3D0KA 3D3WA 3AL2A 5C46F 3I5YA 1P1KA 1X7YA 2ZS9A 4RGQA 1NNEA 3AQ4A 4MDEA 1C29B 4EVRA 2EIHA 3HHPA 1N33B 5AM5A 4JFAA 4L5BA 5DN9A 1PJAA 3RS3A 1MX1A 2WLTA 3PQ7A 1HTBA 1NZDA 5AO9A 3PNPA 1SN7A 4D02A 3W04A 4G89A 4PR0A 4FOSA 2GYWA 5ADUS 5EHGA 3SBDA 4RY2A 1PKEA