1UKAA

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
total genus 101
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ukaA00
1SOMA 2DHCA 1WOMA 5JZ9A 4X95A 5ALIA 1QTIA 3PI6A 2OCGA 2ZYIA 1TKRA 1G5FA 5ALSA 1QO7A 1CUYA 1UWCA 1QGED 2XUOA 1QIDA 3C6XA 2B9VA 3IURA 4FFWA 4GDMA 3WQHA 3DL4A 5JZBA 1N1MA 3WK5A 1BEEA 5FRDA 5CH5A 2C5GA 4X92A 3RK4A 4N5HX 3M3DA 1DINA 4X93A 2WFLB 4J03A 1NU8A 1P0MA 2OGTA 1XRRA 4GLBA 3HXKA 1CUDA 3W9UA 1LPPA 1YS2X 2GBGA 2ONCA 4G4IA 2QXUA 1WM1A 3W06A 4X00A 4WDQA 4MYSA 1LNSA 3C8DA 1SFRA 4BVJA 1XRQA 5ALJA 2JEYA 2ORYA 4ZV7A 2WFLA 5CT4A 2PL5A 4ETWA 3DOHA 1ZICA 4N8SA 1AUOA 4OYYA 1A8QA 1G66A 4X6XA 5JIBA 3OOSA 4LYDA 3FYUC 3ZI7A 1UKCA 2DQYA 6YASA 4A16A 1C7JA 2OCIA 2ZSHA 1EVEA 2PSDA 5IKXA 5AKHA 5JD6A 4ARBA 4I4CA 3WIBA 4CCYB 3FYTA 3EQ8A 1CUZA 2XUFA 4E11A 5BWCA 3R41A 4NS4A 5A7GA 5ALNA 1FFBA 3DKKA 4ITVA 1K5PA 1QIGA 3STUA 1USWA 4W9RA 4QE3A 5FLKA 1B41A 1FFEA 1JT2A 5EHZA 3FOBA 3F96A 1DTEA 5K5EA 1VA5A 1E89A 2E3JA 3G0DA 4G4JA 5ALTA 1DX6A 3EBLA 2HA3A 4QZVA 4Q1VA 4BDSA 1Q84A 4BCDA 1ODCA 3FNBA 5HKAA 4FLMA 4H7JA 3VKFA 4ZV9A 1CUUA 2I3DA 2QT9A 4BE9A 2YXPX 3O95A 3OC0A 1IZ8A 4I3FA 5E4YA 4GXNA 1ZI9A 2RGUA 1E66A 1GZ7A 4KE8A 5K3EA 2HFJA 5AICA 2V98A 1UK6A 1S8OA 1QE3A 4BCCA 1IZ7A 3SC2A 3DYIA 1QIFA 2RAUA 1VJ5A 1YASA 4Y2YA 3BE8A 5C8XA 3LCRA 3M81A 3VVMA 2WG1A 4J0KA 4KAFA 4LXGA 5JALA 3IVMA 3TJMA 1CR6A 4LXIA 2WIKA 3D0KA 3WKCA 3C5WP 1LPSA 4H7DA 4AXBA 4BVLA 2XMSA 4RE5A 5AM5A 5SYNA 1GXSA 4UBOA 1EDEA 2XUQA 1YS1X 1EK1A 2H7CA 3LIPA 1CUHA 1XRPA 3LLCA 1QTRA 2DQZA 4H18A 5AM4A 5EGNA 1MJ5A 2HRQA 2DHEA 1GGVA 4UBKA 4P9NA 2QR5A 2JEZA 3WK4A 4FWBA 1LPNA 4G8DA 2RONA 3IB3A 1EDDA 1XLUA 1MT3A 1RYYA 4CG3A 5HF6A 4Q05A 1VE7A 5I8PA 4GI1A 5CBKA 4F5ZA 4CCWA 3FLAA 4KAAA 4IHAA 3ZPXA 2WJ6A 3PICA 4DTCA 3A70A 2GZRA 5ALUA 4X7BA 4MWTA 2VJDA 3QMMA 3H1AA 3QPCA 5LZ7A 1BN7A 3O9MA 1DT5A 5ALZA 4EY6A 1UK8A 3DEAA 5CW2A 2RHWA 4J7AA 5DTJA 2OQIA 2PSEA 3W2TA 1ODTC 3AIOA 1BS9A 4XIIA 4PSDA 2G5TA 4U2CA 3WZMA 4AMYA 5H3HA 3F9CA 3HYSA 4X91A 1QLWA 5BOVA 1ODSA 4G8BA 1DWQA 1OXMA 3R3WA 1L7AA 3H19A 1QIEA 3ANTA 1U65A 1UKAA 4DYHA 2W22A 2PU5A 4Y2XA 3I28A 1N5RA 2RI6A 2O7RA 5AJHA 2JGJA 1MX1A 5CT8A 3ESCA 4RNCA 3TEJA 5CXUA 3L1HA 4QWMA 1O6GA 3H1BA 5K3FB 1CQWA 1CUJA 2AJLI 1EVQA 3C45A 3HACA 4RPCA 5ALPA 2DCMA 1ZGCA 4FTWA 2OXEA 3K2IA 5LZ2A 1K6EA 1AURA 2OLEA 3VDXA 3G0CA 3O4HA 1JJIA 1ZD3A 2HU8A 1THGA 5ALOA 1VZ2A 1TAHA 1EDBA 4RE6A 4BAZA 2OCLA 4KE6A 4F21A 2ZYSA 2Q0XA 2H7XA 5HQ3A 2WIDA 3IIIA 1XZBA 1WB6A 1D07A 1XRMA 4WJLA 1JMYA 1SCIA 3ICVA 3HLKA 2K2QB 5BV7A 5ALLA 3WKEA 3WMRA 1GPNA 5EHXA 4OU5A 2WFMA 3QPAA 3PFBA 2WIGA 4EA6A 3YASA 2BAGA 2PU7A 2XUIA 2VQ6A 4MQMA 5C7YA 3AUKA 2HA6A 4ROTA 5AOCA 1XZHA 2G5PA 4KR0A 5ALKA 3KSRA 5HF5A 3WK6A 4BAGA 3HZOA 1W52X 4FLEA 4H35A 2BGRA 2JIDA 2W6CX 5FUMA 2WLSA 3D2CA 4AO7A 3C43A 1EXWA 4Y2TA 5AM2A 1FFCA 4WFIA 2WUDA 3FCXA 5CURA 4C01A 2H9YA 4FFVA 3MUOA 5IVIA 1ZI8A 1DT3A 2ES4A 1W75A 3D2BA 1QFMA 3A6ZA 5FV4A 1RP1A 4JNCA 4G1FA 4CIAA 4B82A 1GQSA 1EA5A 4QLAA 4EHBA 3Q8WA 3CN9A 3G9UA 3STTA 3I2KA 3V9AA 5HF8A 4J0HA 3G02A 3C70A 2C7BA 5FPQA 4IQ4A 4H7IA 2Z3WA 4LKOA 1ACJA 1ORVA 1W1IA 4UHFA 4YPVA 4H7EA 4LIPD 5AIBA 3BIWA 1XZLA 2R11A 3ILSA 4DMHA 1LPBB 1EINA 1BRTA 4C87A 3PFCA 1BCRA 3G0BA 3OPMA 3HABA 4L0CA 4BTLA 3W04A 4BE4A 4BRSA 1R4ZA 1F8UA 3DDUA 5LKRA 4BRZA 1VKHA 4UFNA 5F4ZA 1ZD2P 1J06A 4P08A 1QIHA 3CN7A 3QMWA 1E8NA 2J4CA 4GBGA 2X8BA 1MNAA 4B6GA 3WJ1A 5AP9A 5AH0A 4J0IA 1Z68A 4S0XA 2WJ3A 2UZ0A 1J1IA 1VXRA 4G9GA 4HZGA 4PSCA 2FJPA 3IUQA 5AM3A 1BCSA 2GBFA 2VJCA 2J3DA 1A7UA 3JYHA 3A2MA 4E15A 1E8MA 3IDAA 5CH3A 4AB1A 3ESBA 4BTVA 1JI3A 1CEXA 2GBCA 4Q82A 3C6BA 2QJRA 4H7KA 4K6HA 1WPRA 4OPMA 3R3VA 1E5TA 4OB7A 1XZIA 5AKEA 4E14A 1AQLA 1L7RA 5LZ8A 5ALWA 2QXTA 3IUJA 5C8ZA 3QZUA 3H2HA 1F0NA 1UKBA 4KACA 4M0EA 5LZ5A 3KWFA 2JGMA 4QNNA 3L1IA 4PQEA 3WK9A 5JASA 3W05A 5CH8A 1N5MA 1BROA 1YA4A 2C5FA 5AKJA 4Y2PA 2CB9A 1FFAA 3O9VA 5AM0A 4QLOA 4K5QA 2VT7A 2JGKA 2BFNA 2PPLA 3ZLUA 1WB4A 1IUPA 1UOOA 4IH4A 3D7RA 1CPYA 3UUEA 2VAVA 2Y6VA 5AI6A 2NW6A 4Y2JA 5EHNA 1F0PA 1LZKA 3Q0TA 4DNFA 2HM7A 5ALMA 1C7IA 4AZ0A 2Y6UA 5HFNA 4DNPA 2PSFA 3TGLA 1OILA 4DIUA 1PFQA 2QRUA 3FBWA 4K2AA 1LGYA 1XQYA 3FSGD 1CUAA 1Y7HA 5JATA 2ECFA 4BVKA 3AJAA 2CMFA 2OGZA 3MVEA 3V1NA 3PDCA 5D7BA 2QZPA 3OG9A 4X71A 1W4LA 2PBLA 1ZJ4A 4W1PA 3B3QA 1Q0ZA 1QIIA 4FBLA 5ALVA 5KWJA 3DKRA 4LHEA 3GUUA 3GELA 4FLFA 2XQKA 3QYJA 5EIAA 5DYTA 4ZWNA 2V9ZA 1XZFA 2J4FA 3WK7A 4DMKA 2VA9A 4ZI5A 3U0VA 4CCYA 4BP8A 1WHSA 2XB6A 3O4JA 2XMRA 1IMJA 3VVLA 3WA7A 3T52A 1MX9A 4X97A 5CXXA 3F98A 3H0CA 2VTVA 5DNWA 3V1KA 1HLGA 3BIXA 1TRHA 4G9EA 4KRYA 5JAUA 1VXOA 2XE4A 4MJ3A 5DLPA 1ZIXA 3STVA 1X70A 3PF9A 1MNQA 3BDVA 1QOZA 4CFSA 3STXA 2WUGA 1J2EA 2VF2A 1JU4A 4C4ZA 4Y9SA 2G4LA 4G4GA 4N8EA 5CRIA 5ALGA 4YASA 1EI9A 3G9ZA 1P0IA 3IUNA 3JWEA 3S8YA 1KEZA 5K3DA 4OB6A 1YAHA 1JFRA 3D5EA 2ZJ6A 3G9XA 4W1RA 1WPXA 2FUKA 4L72A 1CV2A 1AX9A 4WFJA 4JUIA 1C4XA 3GBSA 5EFZA 2OGSA 3NGMA 4MQLA 2Z5GA 2WHPB 3O4IA 5JAOA 2QUAA 3VXKA 3BJMA 3WWOA 5AKGA 3X3HA 4HS9A 1JKMA 1VE6A 1JJFA 4BYMA 1T2NA 4DNOA 4DMCA 4ARAA 5DWDA 2Y2VA 2VSQA 3OURA 3S2ZA 1EX9A 4BB0A 3LS2A 1UOPA 3BWXA 3GA7A 4PV7A 5D3KA 5AKZA 4WFKA 5T4EA 4BAUA 3QM1A 5HZGA 4DNQA 1HBJA 2QKYA 2HA0A 3KWJA 1TK3A 4FBMA 2O2GA 4K6KA 3I6YA 4FHZA 5JARA 3CCCA 1P0PA 2D5LA 2PSHA 1Q83A 4LXHA 2XUJA 2WM2A 3G7NA 2QUBA 3R0VA 1PJAA 3FCYA 5T4FA 3WKBA 2ZJ7A 1CUFA 3FVRA 2WKWA 5HK8A 1ORWA 4EY5A 3DYVA 2GZSA 4AX4A 3IA2A 4HXGA 3R3UA 4L9AA 4EY7A 2WIFA 1SC9A 3H04A 2DSNA 3ESAA 3IULA 5AI0A 5DYYA 4X6UA 2AJDA 4B84A 2PKYX 5EIHA 1BU8A 3MUNA 2WG2A 3WA6A 2J3QA 4EUSA 3E3AA 5ALDA 4BBZA 3R3YA 3HRHA 4B80A 3D4LA 5IH7A 3FYUA 3G0GA 1AGYA 3DOIA 4MEBA 2CKMA 1FJ2A 1MO2A 4U2GA 2HRRA 1F6WA 3N0TA 5AOBA 5A62A 5AKXA 5ALYA 3B12A 3OTQA 1XLWA 3DLTA 1XQVA 3AINA 1KU0A 4FMPA 3U1TA 4UFPA 1QJ4A 5J3JA 4DMFA 1DQYA 2X5XA 2OPHA 2HA7A 2G63A 3H2KA 2BCEA 2OCKA 1QONA 1R9NA 4ZRDA 4UHCA 4U2FA 4Q3KA 2ZVDA 4F0JA 1H22A 1MN6A 4AN0A 4Y2SA 1GKLA 1YCDA 3PF8A 2PUHA 3LIIA 1U4NA 4K6GA 2ACKA 4HVTA 2B61A 1CQZA 4W1QA 4QA9A 3QH4A 4BDTA 1CUCA 1XZDA 1DU4A 1X2BA 5YASA 1UFOA 1HQDA 4WY8A 5HCUA 1TCCA 4X6YA 2HA2A 2O7VA 4M0FA 2XLBA 4U2BA 1CIJA 5A6VA 1R1DA 1AC5A 3GFFA 5CT6A 1AKNA 3W9BA 5AI8A 4UBJA 2HU5A 3AFIA 1H2WA 3T4UA 3QVMA 5KBYA 4JEIA 3ED1A 4UBMA 2C0QA 2JGFA 2Y1KA 2OAEA 4HAIA 4I19A 4DGQA 1UOQA 4D9JA 3BDIA 3PUHA 2XQJA 4ZXFA 3D2AA 4RGYA 1I6WA 4B83A 5AIAA 2JGLA 4JYMA 3DQZA 2I03A 1QIKA 4CIBA 2QM0A 2XMBA 5HFAA 3R40A 3V1MA 1UXOA 3C87A 3AZQA 3DS8A 5K3BA 1P0QA 3I6ZA 5E4TA 3ZV7A 2H7YA 5BWBA 3AZPA 1UZAA 1CUGA 2YYSA 2WG0A 1FSSA 2WU3A 1IUOA 5K3AA 5JAHA 2WU4A 1LBSA 2GYWA 3NWOA 2HU7A 2BUCA 3EIOA 5AKIA 4DM7A 4YK7A 2I78A 4Y2RA 2YH2A 3IBTA 3HI4A 4M0MA 4Y2UA 1ETHA 5EHQA 2ZYHA 1K4YA 5AK3A 4QEKA 4AQDA 3P2MA 2QVBA 1QIJA 4Y7DA 4OSEA 2WUFA 4C88A 1RWQA 1K63A 1ZJ5A 4BP9A 3G8YA 5ALHA 2BUAA 5AI9A 2GYUA 1MX5A 3DL7A 1ACLA 1TCAA 3E1GA 4TPKA 4BC0A 1IVYA 4JH0A 1JJBA 5A7HA 3KD2A 3EQ9A 4UBLA 2JF0A 1R88A 4A23A 4B7ZA 1XRLA 2VJAA 3WWPA 3FSGA 2RIPA 3ZLTA 3LP5A 3GZJA 4LYEA 5T4HA 3I2JA 4FKBA 3E0XA 4UBNA 3V48A 5DNVA 4BATA 1M33A 2I3ZA 2WQZA 1CLEA 1DWOA 2VJBA 1CUVA 1THTA 4YX9A 5HQ3B 4NZZA 2H1IA 4H7HA 4B9AA 5E2IA 3VISA 4E46A 4CG2A 7YASA 1CRLA 3NOXA 4BZWA 5A2GA 3WWDA 4C6HA 2PX6A 1L7QA 4U2DA 4CI9A 3AILA 4NVRA 5CT9A 4MEAA 4N5IX 2RHTA 5LLSA 2C58A 4C89A 4IH1A 1R9MA 3G9TA 3WL6A 3RARA 1H2ZA 4TGLA 1DWPA 4BZZA 3I2IA 2WFZA 5JADA 2WTNA 3WYDA 2B20A 4HRXA 4EB0A 3C5VA 3WL5A 3RKSA 4UPDA 1N8SA 3N2ZB 3DD5A 4Y2VA 1BN6A 2JBWA 3BL8A 1GPKA 1E3QA 2XQGA 3I1IA 1KU6A 3QBJA 4XX1A 2B4KA 3H2JA 1H2YA 5C8VA 4OYLA 2BJHA 1EB8A 3HEAA 2HA5A 4HRYA 1ZD5A 3WJ2A 5EIEA 4PSUA 3H18A 4P92A 1T4MA 3AIMA 2WHQA 4QDXA 1XKTA 4FOLA 4UHDA 1XZEA 1MU0A 4J0DA 1Q0RA 4UHBA 1VA4A 1XRNA 3BJRA 4WY5A 3EQ7A 4QDUA 4UBIA 3R3ZA 1J07A 4XVCA 4C4YA 1CUWA 3ESDA 4JYPA 1EK2A 3FVTA 4V2IA 2QS9A 4BC1A 2WHPA 2PM8A 1LPAB 4B0PA 2PUJA 4INZA 3I2FA 4XWGA 3VJLA 1XZGA 1XZJA 3DNMA 2HA4A 3I2HA 4J0GA 1JMKC 4G8CA 4DSZA 1DQZA 3H2GA 4C4XA 2CUTA 1A8SA 3C6ZA 4AO6A 3WYNA 1AMNA 1ZI6A 3C6YA 4H0CA 4AMZA 1A8UA 4HXFB 2DFPA 4EY4A 5D6OA 2VAXA 1XZCA 2HADA 4Q3LA 4O08A 4QDTA 5A7FA 3E4DA 3WK8A 4GECA 3I2GA 2BGNA 2IX9A 5SYMA 3K6KA 1U2EA 3FAKA 1XQXA 3STWA 5AI5A 1JU3A 5E4JA 5ESRA 5I9IA 4B0OA 5LKAA 2OQVA 3SWWA 5FPPA 1WHTA 2V97A 3A2LA 4KRXA 3WLAA 3WI7A 4B9EA 3ZWQA 2XLCA 2CBGA 2Y2UA 3FLBA 5JYCA 4KE7A 5FXMA 2WJ4A 3M83A 1CFJA 5ALQA 1TQHA 1XZAA 2XDWA 3ICWA 5FDFA 5C81A 2HDWA 4X3CA 1UK9A 2WUEA 3WWCA 2XUGA 5T4BA 3BXPA 2WIJA 2XI4A 1YR2A 5JD4A 1K8QA 1AZWA 2ACEA 2QOEA 3HC7A 4X94A 5LIPA 3I1YA 1U8EA 5ALXA 1X2EA 2LIPA 2FJ0A 3H17A 3H2IA 3CCBA 2OG1A 2PSJA 4W1SA 2HHAA 1CUBA 1W6RA 5ALFA 1CVLA 1HL7A 4IO0A 2VT6A 3UMJA 3DCNA 5KREA 2ROQA 5AKLA 4OD0A 1YSCA 2HFKA 5AI4A 2AXEA 2Z8ZA 1FFDA 2JGIA 1OCEA 2WILA 4Z49A 3UUFA 1LPMA 5K3FA 3AIKA 4UUQA 1LZLA 2O2IA 4KAJA 3STYA 2Z8XA 3BF8A 1MAHA 2XUHA 3OM8A 3O4GA 1TIBA 4Q3OA 1HDEA 1H23A 2CJPA 3WZLA 4ZREA 4H7FA 4FDMA 5DNUA 3WWEA 4WDRA 1ZOIA 1ISPA 5JAPA 1A88A 5ALEA 3EF3A 4A5SA 3O0DA 2QMQA 4F60A 1PV1A 5IVHA 3F97A 3FWHA 4AO8A 4OUKX 3WL8A 3QPDA 1XZMA 2XUAA 5HF9A 3AZOA 3SX4A 2XMZA 5DTIA 2ZJFA 2XQFA 2AJCA 1UT6A 1YA8A 4MYDA 4CG1A 2HL6A 3PUIA 4AN1A 1LBTA 4EBBA 3BF7A 2R8BA 1VLQA 1NX9A 5LZ4A 2OAGA 1SCQA 3WKAA 1VZ3A 3HSSA 1XROA 4J0CA 3NUZA 3JW8A 3QMVA 5AK5A 4KJXA 1ZD4A 1EHYA 2EDCA 1EH5A 3D3NA 2GYVA 1YB7A 4B85A 1MTZA 2XT0A 3ZLVA 4QWWA 3D59A 4B81A 1NU6A 4WCVA 5AKYA 2VEOA 2CZQA 2YASA 1YAJA 3WL7A 4UHHA 2AJ8A 4N8DA 3RLIA 1CUEA 2D0DA 1UK7A 5AM1A 1QO9A 4J0JA 2PVSA 2EDAA 2BKLA 4KE9A 3FYUB 4BCBA 1TCBA 1WCYA 2BUBA 1YB6A 4L3WA 1XLVA 5FP0A 5CMLA 1QIMA 4KEAA 1G4HA 4J3JA 2XMDA 2QTBA 5FKJA 4PO3X 3ANSA 4Q34A 4HXEB 2IIVA 5FOQA 4IH9A 1W76A 3L1JA 3GROA 5JD5A 1QFSA 2ZSIA 3A2NA 5JANA 2WSLA 1R50A 1E8DA 4H77A 1Y7IA 1QZ3A 1MPXA 1LPOA 3VJMA 1B6GA 1BE0A 4QDZA 4EZIA 3SK0A 5AK4A 5CT5A 2WTMA 4U2EA 2EEPA 2XUKA 3F8SA 4OCZA 5DYWA 4G5XA 3V1LA 1H2XA 2HIHA 2Z3ZA 1CUSA 2FX5A 4PNZA 5AK6A 1ZGBA 4GHWA 3R3XA 5HK9A 4Y2QA 1XZKA 3KXPA 1XKLA 3RM3A 2V96A 5A71A 4GWLA 3TRDA 1GPLA 5AKKA 4MWSA 4PF1A 4FNMA 3QITA 1HPLA 2WHRA 1IUNA 1Y37A 3KOOA 2JGEA 5JZSA 5LZ9A 3DJYA 1XQWA 3F67A 1EB9A 3M82A 1GT6A 1O6FA 5HKBA 2DHDA 1CUIA 5EI5A 5K3CA 2X76A 3K9BA 1BEZA 2IITA 4HTAA 4FNGA 1WB5A 4UHEA 4OU4A 3WIOA 1LLFA 2XMQA 2VATA 4ZGBA 2CEKA 4EY8A 5CTAA 5I7UA 2XMCA 2AJBA 2C4HA 5LP1A 1VOTA 4DSAA 4GW3A 1G42A 4MXDA 4TVKA 1HKHA 3WKDA 3CXUA 5ALRA 3KDAA 2XUDA 4OB8A 5KWIA 5DJ5A 3FLEA 5IVKA 3I6MA 3PE6A 2QJWA 1CUXA 4XJVA 1ZIYA 5AO9A 5IVDA 5D3ZA 5AHXA 2C0PA 3MGAA 4AZ3A 2XMGA 5AOAA 4UFOA 5ISMA 2XQIA 1MAAA 1R3DA 2ZYRA 4PW0A 2P8SA 1XFDA 2O2HA 1GQRA 3C8HA 4KYVA 4QDOA 3IUMA 4W63A 1SCKA 4X85A 4DLNA 2GBIA 3B5EA 2DR0A 3VJKA 3HJUA 4GEGA 3G0IA 1GKKA 4NMWA 4X90A 5LYYA 1DX4A 2XUPA 4P93A
chains in the Genus database with same CATH superfamily
5DCUA 1SOMA 3HKDA 4EENA 3WGIA 1PEAA 4ZJUA 3O75A 3UANA 2YBEA 4B48A 4OQDA 3K0FB 2GCGA 1QU2A 3VTAA 1JDTA 1TKAA 4X1KA 1MMFB 1IBRA 2GETA 2YNMD 4X95A 2ISQA 5JZ9A 5ALIA 1UBSB 2NSJA 4Y9DA 2X13A 4G36A 1OBCA 3IESA 1NV9A 1QTNA 1G6Q1 2VIIA 3A1TA 3PI6A 3QVXA 3INYA 1NRIA 3KFLA 4CUJA 1E2DA 3HDHA 1WV0A 3FCCA 2FWNA 4YJGA 1G5FA 3HVKA 3QNUA 1CYEA 5JPCA 1K08A 4G41A 1DELA 1OLXB 1CUYA 2QZSA 3FZYA 2Q27A 3NC4A 4V02A 1M6HA 5C8XA 4FYIA 2PGOA 4DDWA 2H1LA 3C6XA 3IURA 2CL5A 1ENZA 4OOEA 3UJCA 3IP5A 1H66A 3S8EA 1AQUA 1XB2A 4YS6A 4RZ2A 1EBFA 3ZQJA 3N7AA 1YACA 2OZKA 3MJEA 1Z2AA 2PUDA 1I94B 4CQLB 3DL4A 5JZBA 4DV0B 4AQ7A 3NH6A 4OO3A 1Z4LA 4YONB 3VC3A 2YKGA 4AKGA 2CLFB 5LQDA 1N1MA 3LT4A 1Y3FE 3WK5A 4K9NA 5FRDA 5DTRA 5IBRA 5KZMB 4X92A 1RPNA 5IAKA 4CKZA 1TT5B 5TMDA 1S02A 3LQYA 4DT1A 1PT6A 4OK6A 2JAOA 4KODA 1JDZA 4J7XA 2PPVA 2BHSA 2WFLB 3ZTYA 2IOFK 2XYRA 1DMSA 4ENPA 2X1VA 2OGTA 1UMDA 1AQ6A 1MXHA 3IBYA 4W8OA 1BX3A 1B2LA 1PK8A 1WSWA 2ZAMA 1APBA 1NXPA 1CNEA 1L6IA 2BH9A 3L8FA 2B7CA 4G2NA 4UTXA 3LLSA 1CUDA 2OM2A 3IAS6 4KR6A 2FE4A 1YS2X 3CZQA 3L0YA 2OE2A 2RB4A 4OHUA 2QXUA 1K7YA 1ECFA 4B87A 1QRTA 1G8GA 2C7OA 2GK7A 4TKMA 5B4TA 2AS0A 5G1OA 4O8CA 5MHTA 1Y7LA 1ZXXA 2ZSBA 2RAFA 1IZ9A 4MQFA 1HTWA 2NO5A 2Z1MA 2ZSKA 3DTTA 1Y1RA 3SMVA 1AKRA 2G09A 1J25A 4I50B 4UMDA 2O7QA 2W70A 2PH1A 2H63A 3CUYA 1GGJA 4MKGA 5ETJA 2BHNA 2PR2A 2WY2D 1GFWA 3RTEA 4N8SA 4DGSA 4GZ3A 1TF2A 2XT9A 3K31A 2N47A 2YQZA 1C81A 4OYYA 1ZUHA 3CW2A 5HX7A 1A8QA 1G66A 1HSOA 3HCPA 4EATA 4MUJA 2F8TA 1IMOA 4M6WB 1JHRA 5CDYA 2GEBA 1N5IA 4R3NA 3BMOB 4JQCA 4LXUA 2YINC 3FLMA 4RBNA 4HWTA 1H85A 3VBCA 3CH5A 4LZNA 4RV9A 4XIGS 4KWTA 4E2FA 3UA3A 4U7HA 1J8QA 1RIIA 4XVUA 2F00A 1OLOA 1RXSA 1DJOA 2B4TO 1NMXA 4JVMA 4Y1RB 3IVCA 2V03A 3A6HA 3HO8A 3OEYA 4OHXA 1BDBA 5AKHA 5U1PA 5IKXA 5H8WA 3ESRA 1Q7TA 2GOYA 1UEIA 3DVAA 3SXUA 5DP2A 3ZWNA 3P9QA 4TL6A 5CJ2A 3WIBA 2W2QA 1RAFA 4QM7A 4BN0A 1OQAA 3M6UA 3W7BA 4KJZA 4F72A 3EQ8A 2XUFA 4ZQHA 2KM1A 3RS4A 2Y4NA 4AZSA 2V54A 4EI2A 3PXDA 3R41A 1T9GS 2BFCB 2IHTA 4DLBA 2ON6A 2IYEA 3CPSA 2H9AA 3ES9A 5G41A 3ND7A 2H16A 1X87A 3SIPA 1VSBA 4LRSB 2XOKD 1M3SA 5BNWA 3E7DA 5F5LA 5DMXA 3ET4A 3GCGA 3AV0B 3STUA 3DH0A 1EFPA 2PGDA 4QE3A 4UUPA 1R0ZA 2GAOA 4L5YA 1JNXX 3C3DA 3ZVRA 1WB9A 1XP8A 3CLRD 3Q1KA 1DTEA 1VA5A 5LJLA 4UNNA 3WHPA 4MCJA 5BSMA 4PYOA 1JGTA 5DW3A 4UOQA 4DOMA 1QRDA 2OXCA 1IXYA 3PXGA 1E99A 2F7SA 2HA3A 2IXAA 2F43B 3TW0A 2NV2B 1MH1A 1Q22A 4YN3A 3KTAB 3PRYA 4YO8A 3NHRA 1ODCA 1KDZA 3FNBA 4CPDA 4Z9YA 2JFUA 3LC1O 3RSZA 2G1AA 3OJEA 1RKVA 3B13B 4KQMA 3UHAA 3KJZA 1GNQA 5EVCA 1P4HA 1OXVA 1SO8A 1WU7A 4ECEA 1QOQB 2PLFA 3LVFO 4II7A 5HNKA 1WU8A 3G2HA 3RSCA 3NTRA 3OHSX 3PFWO 3RU7A 4CLRA 3EYAA 4RDXA 2CXOA 1DC7A 2E4UA 2NP7A 1T1JA 1LRJA 2FG7C 2H2AA 1EE2A 2TMKA 3O95A 2M6KA 4REOA 1IZ8A 5E4YA 5IC6A 1V8FA 3K96A 3ZDRA 5I4IA 3ZU6A 1ZI9A 4RHUA 5JMOA 4EYGA 1XNHA 2RHHA 3SICE 5I7RA 4QG7A 4LBZA 4TN5A 3B20A 1D2NA 1E60A 3BSWA 4XQCA 2NU8B 3TQFA 5C8YB 1B6SA 3O2JA 5KU7A 3E5NA 4XM0A 1OIVA 4LGCA 1TTQB 3UJAA 5K3EA 3TZLA 5U4XA 1CJSA 1L7DA 4MRRA 2VN8A 2DHQA 1AN0A 4IX1A 3U4DA 1KMCA 2Z4TA 4ANFA 4HSGA 2VPZA 5FBQB 3SOPA 5KNBD 2HK6A 2C2GA 1T6XA 4OH1A 1H5QA 1A8IA 5G1PA 1PK7A 1VJ5A 2RAUA 3R6LA 3T1VA 3NTLA 3AFMA 3VVMA 3M81A 4M9UA 2O5EA 2ID8A 4G1VA 5JXHA 5LP6F 4FXPA 4J0KA 5CB8A 1W29A 3PQ2A 1YZFA 3OO1A 5AHKA 5DYGA 2ZANA 3BHNA 1NAIA 1VG1A 1XDGA 2FW1A 4LZOA 3UB2A 2PQ6A 2QRPA 4CMEA 4JLPA 5CEEA 2GNAA 4K0RA 3H5WA 1LDYA 3M1IA 1Z39A 2JFGA 4L4ZA 2H92A 5FOUA 4LXIA 1S4MA 4OJMX 2EHDA 3DZJA 4ND1A 5LQMA 3WKCA 5SY4A 3RAJA 2PV7A 1LPSA 4HTFA 1TGVA 4NU8X 1NRJB 4AXBA 1XMQB 1G4AE 3MILA 4PZ0A 1RPTA 1U0OC 2X5KO 1K86A 2XWJI 3GLHE 3QUTA 1SIBE 1ZITA 2XJ9A 1GXSA 3L0CA 1R0YA 1NTRA 1Y0BA 4L74A 5ED0A 2I87A 1OR8A 5G3ZA 1UINA 4M0CA 2IF0A 4CLDA 2VWQA 3VKUA 3ZH2A 3LTNC 3A6JA 2H7CA 1CUHA 2GYYA 3HCEA 3M5DA 2OV2A 3K9HA 3KUKA 3PZRA 5ENDA 3O8NA 3VDNB 4L4YA 1HZZC 3ZG6A 6ABPA 1ZRHA 1AHNA 3QIVA 4KZPA 1U9YA 5AM4A 4WXPA 5EGNA 4AJIA 5KQRA 3D8RA 4C7VA 1D2CA 5D7NA 3DGEC 4E31A 1GGVA 1M6NA 3TTYA 4RELA 1GGNA 1BNCA 1DUVG 3IUBA 3L7NA 4P9NA 5DXFA 2COUA 2JEZA 1NT4A 2ZREA 2MYUA 3L4SO 2PX5A 3WK4A 3ZIUA 4A2PA 1E1CA 4TM7A 4BFVA 4BNTA 2VH5R 3NV7A 1PFYA 4O3MA 2IY8A 1Q7CA 1AK2A 2F1OA 5ESWA 2C61A 4TXLA 3RYCA 3IB3A 5G40A 4P4UA 2I62A 1Y4SA 5DSZA 2W2XA 4YJHB 4L6AA 5JAZA 1A9RA 1V3QE 4HH1A 4CG3A 2BFDA 2GS9A 4HK4A 1JMVA 3PCTA 5HF6A 3KC2A 4M86A 4Q05A 2PGJA 4EPWA 2NSYA 2QYHA 3GVIA 1G55A 4DM3A 3M2PA 3M6WA 5I8PA 5D3QA 4OX9B 4A6DA 3H0EA 1IM5A 2IYUA 3EXG2 5B1HA 1KC1A 1SC1A 4ALNA 4WWHA 5JD3A 3W2HA 4XASA 4HLDA 3WLHA 5H3LA 4BNYA 1J8VA 3OFNA 3FPAA 3JQ7B 4ZQEA 3TI7A 2EG9A 1N2CB 1P4JA 4R2JA 5JPIA 3ZU2A 3OQOA 121PA 3FLAA 3N0RA 4ZAGA 4DPLA 3L93A 4EZBA 1B42A 4J4HA 1HURA 3L0DA 1AO0A 4B3RB 5KOJA 2O6LA 4ENSA 4PYQA 2XE7A 3GI1A 3U7IA 4EFLA 1CZLA 1C8LA 2I6QA 4IIYA 2H8GA 4JBLA 4K6FA 4KPGA 3GUYA 3P94A 2P1RA 2PIAA 3E8MA 2ZROA 4MVJE 3KKMA 3PNOA 4AJ2A 2HSGA 2GERA 1GUBA 3LL7A 4WBSA 3HY6A 3W6UA 5T41A 2PUTA 3ML1A 4F46A 3I6QA 1Q91A 1TRKA 4MWTA 3QPCA 3G2OA 2JFXA 3QMMA 5DP1A 5CIQA 3EVFA 1YQTA 1ZH0A 2HJRA 1FS5A 3FPFA 1C1HA 1VSTA 3II6X 4NCNA 1E1KA 3R7NA 3IAAA 5FOWA 4ERXA 1Z0FA 3MTBA 1RJFA 3OM9A 4EY6A 2JHAA 5EQJB 3N2IA 1LB1B 1V5FA 1RKQA 4F2DA 1QKKA 3EULA 4OXKA 2J87A 3VPFA 4DKJA 1FU7A 2B34A 5DTJA 1MC1A 4LFCB 2JJ1A 2CCKA 4OGGA 2OQIA 4OSPA 4L28A 3EG9B 2RK4A 4LWPA 1MFZA 4PPNA 1IN8A 2I7XA 4L6IA 1DCKA 2G5TA 2I3BA 1DXOA 4PSDA 3ZE2B 3R8FA 1N0VC 4IKPA 2Z6VA 5IKEA 1UAAA 3C41J 3LXXA 4RFSA 4JJEA 4JBWA 3W78A 3F9CA 3BWEA 1YR6A 3P0HA 3H6KA 2AW3A 4ZCQA 3TIXB 9ABPA 1IBMB 2GFHA 1BDIA 1FYDA 3LGAA 1EVJA 4MS3B 1DRJA 1G1AA 4NZPA 4EG0A 4ZMRA 1QLWA 4ROSA 1LS6A 2KWIA 4XQEA 4JLJA 2QBYA 4A9AA 5KCMA 4G8BA 4BNXA 5K8TA 2R00A 3C7CB 1DWQA 1P6UA 2CXQA 2YZNA 4OXXA 1OXMA 3E22B 4DIFA 2AQHA 4ZIRA 1JX6A 3ANTA 4EB8A 2H59A 1PSWA 3BEOA 1G21A 1GL9B 2Q2VA 3FMGA 3GLTA 3HYCA 1JIXA 2ODQA 4Y2XA 1XHFA 1DZ3A 2HDHA 1BWPA 5EJAA 5AXBA 1N5RA 3GGPA 5AJHA 1JIUA 1EFRD 1Y1QA 4HYYA 4OQLA 3H1FA 3WGJA 1UBUS 2ISCA 1MX1A 2VSOA 5E7QA 1NLZA 2FLKA 1VYHA 3ESCA 1MHTA 4ACBA 3FJOA 1QRRA 3T3IA 4CT5A 1MPTA 2H4WA 3FBTA 1IK6A 4RHCA 5E8JA 2E0IA 3ENQA 3L01A 3S55A 3TEJA 2C9CA 3PFHA 4WCDA 4R98A 2VSYA 4GC5A 2OLJA 2GXAA 2P75A 1T5HX 1E2EA 3IQIX 2H11A 3IOBA 4WOCA 4MWBA 3WAJA 2QPAA 3IV7A 1BDMA 5GGXA 3FMPB 3O6VA 4XDHA 2VZEA 1YRBA 4B6OA 3HRKA 1B26A 2JRLA 5K3FB 1CQWA 3KSAC 3HACA 1EVQA 1SHJA 3C45A 4JUCA 4AI6A 2JGNA 5AHOA 3E48A 3O90A 3BSFA 4G97A 3CRMA 5ALPA 5FWYA 1ZGCA 2AUTA 3KE8A 4C0KA 5JWOA 4BNGA 4WJZA 1MEEA 2QT0A 1FMJA 1V6AA 1QGAA 3T5AA 5FL7A 3OPYA 4NBWA 5DHTA 5ERGB 1R4NB 3KZOA 4IIJB 4B7UA 1ZUIA 3G0CA 4RV4A 5L4SA 1ZGAA 2HU8A 3A1EA 3NHAA 5ALOA 1DMRA 1RWBA 1VZ2A 1W0JD 3LPLA 2XNCA 4IRXA 3KZ1E 5TMEA 3EB9A 1YBVA 3K0KA 1EDBA 1S2OA 4TWJA 2QRGA 3H5OA 2JKZA 4HLNA 4RE6A 1V9SA 1X74A 3D3WB 1XNJA 3R8CA 1M0EA 4BXOB 3MBOA 1PNQA 3NBMA 4FDVA 1T1RA 4UNRA 4F21A 4C2TA 4JEUA 4KIUA 4PHCA 2NO6A 1SBNE 5D51S 3MRVA 5AXAA 5TQ0A 5I48A 5KTYA 2GNPA 4QYSA 1G59A 5HQ3A 1EHCA 1EM8B 3UXMA 5IJ9A 2HHHB 2ZB7A 4TRNA 1Z22A 3E5MA 1GTG1 4TS9A 4WVFA 5TRTA 1RKXA 2IZ5A 1U2GA 2GF9A 1MQAA 4K9OA 3A37A 3N0VA 3RCBA 4F1JA 3AR7A 2K2QB 4Y6OA 5BV7A 5GINE 1L2TA 2EBHX 4YAIA 3WKEA 2X0IA 1QQ7A 1X0VA 3EDRA 3MLEA 3JWIA 2NPFA 4HN9A 5CVVA 1GPNA 3HR4A 5TY0A 5IX8A 5KNBH 1NQTA 1Q5PA 3OICA 3UAVA 2WFMA 4W7IA 3BICA 3ZTTA 4ZI3A 1YR9A 3H4IA 2Z43A 2FX3A 1X19A 4BLUA 2QYOA 2IDMA 4TTJA 1V1RA 2PU7A 2XUIA 3KKQA 4NZNA 4M0UA 4NMLA 3O91A 3MYYA 4B43A 1FP6A 3O83A 2ZUVA 3U5TA 2VQ6A 3SOZA 1NFRA 4YRNA 2R5WA 4UEWA 2W93A 1RLIA 1L9XA 5HILA 4YWJA 1D7AA 1XZHA 4UAGA 2WP0A 3GF4A 3SZRA 1PGPA 5HIKA 2G5PA 5LLTA 4EYQA 1K7CA 3S1AB 3EGEA 1PWXA 3IYLW 4MOWA 1JJVA 4OP2A 5ALKA 4WHMA 3WK6A 4BAGA 3PA8A 4XJSA 4PAWA 1DL5A 2AFHA 2QV7A 3SDSA 3TFQA 1D1TA 2I4LA 4H35A 5IBPA 1Z25A 1XOIA 1UM8A 2QP3A 4JB8A 4M1EA 5BP7A 4IDGA 3RF7A 4W6QA 4BLSA 5FUMA 1IZZA 8OHMA 3A0RB 3BCHA 2C3PA 1PKEA 4HH3C 2JIMA 3OHMA 1O97C 4W7HA 5DNDA 5C51B 3OZRA 1QQ5A 4OLAA 1Y7PA 3B89A 5A0TA 4URXR 1Q0QA 2GWRA 3L6EA 3RIMA 2DLDA 1TEVA 2O7NA 3EVCA 7REQB 1HYEA 3ZGZA 2X42A 4H17A 2C83A 1CRZA 1K5GA 4RGQA 1ABFA 4YCMA 5CFNA 4OOFA 1AB5A 1NL3A 1EZZA 4C0BA 2HMUA 4V1CA 1ZI8A 2WWTA 2X8JB 1PDOA 3WLQA 5C4IA 2R6DA 1NDQA 3ELUA 4L75A 1GGEA 3S8MA 3NXSA 5HCNA 1NUAA 1FA9A 1GNTA 3B1WA 1N8NA 3UMSA 3VJRA 2OKGA 3ESQA 3V42A 2YJGA 1TD9A 1QHFA 3BFKA 4P32A 3A6ZA 1KRHA 3BK7A 1YB5A 5FV4A 1BC5A 2IY7A 2C9OA 5DSXA 1JPVA 2D7DA 3H9UA 4KN6A 1OB2A 4HGYA 1B0PA 4CKCB 4DMGA 4FNOA 3PFFA 2F55A 3AP1A 2H4YA 1GQSA 4H1UA 4PPYA 3UYKA 5AT1A 3TNJA 5KHLB 4YRIA 4LF6B 3FJYA 2EQ5A 2V5VA 3ZK8A 2HEGA 2O9JA 2CNWA 2IZOA 3STTA 2AXQA 2QQ5A 2IOHA 1ZCBA 3NBXX 3RFFA 5IF3A 1X7XA 1PJ3A 2PO7A 4R0NA 5DHRA 1DX9A 3FKQA 4Q9JA 3MJVA 1NN0A 1UC8A 5JY1A 3C70A 4PRZA 1WUKS 4UUOA 1GAQA 3L0SA 5LB2A 1JHXA 2PS1A 1XELA 4H7IA 2Z3WA 3RS3A 4B3XA 1ACJA 4BNFA 4IEEA 1SIWA 2C5HA 5JSZA 4JI2B 1ORVA 1JR3E 1W1IA 3T6KA 2ERXA 4MMZB 3UW1A 2DXIA 5FUXA 4KO2S 5I7FA 1N57A 2NAFA 2XXJA 2J3EA 3ORQA 2IYAA 4H7EA 1I3MA 3CZCA 3E61A 4MV7A 1B1AA 3GLFB 3OZIA 4XRRA 3TRJA 3VTFA 2CB0A 4IVPA 4CLOB 3NNNA 3LHFA 1EM6A 1CY1A 3FIJA 2MCFA 5JMWA 3PLAE 2LKDA 4LVUA 4XUGB 1EINA 3LBYA 2N3ZA 3MAJA 3TIFA 2UUCB 5EZYF 3UGQA 4BRUA 4C87A 2D2FA 4DLRA 1FTYA 2J3HA 3PFCA 3S27A 4LDQA 1Y8RB 1P9RA 1J9GA 2RGWA 3HABA 1XU9A 3MXOA 1XF1A 3OPMA 2GFIA 3PLRA 4L0CA 3DWFA 4W9NC 4IV8A 4AF8A 3DO5A 2P9YA 1Q7RA 2JI4A 3PVZA 3A26A 4KXMA 1G2IA 3TLBA 4M2LA 2AFIA 2DWQA 1ZOOA 1GAJA 4QUEA 3Q41A 1DIOB 1FDRA 4QUIA 2ZXUA 5F9HA 1NLMA 4YUXA 4AVYA 4COOA 4G67A 4OXRA 2VQSA 1R5BA 2R85A 3D0QA 4ZAVA 2XOKA 4XJTA 1DPGA 3ILVA 2PZ8A 3G2JA 1T4CA 3ASUA 4AZWA 4B4DA 1NQ5A 5LYJB 1JVBA 5HWSA 3GYGA 3ZW7A 1ECBA 3OETA 4NNOA 2WD9A 3GPLA 2X8BA 4A36A 4MB6A 3DE6X 1TEZA 1ADGA 3N2LA 4IIXA 4X20A 3EN0A 1YL7A 2R8EA 2J9FB 1WEKA 2DC1A 4NHOA 1T3GA 2W2MA 2B37A 1LFAA 1T0HB 1QAQA 1L7XA 4EKNB 1DAPA 4MDFA 1WS6A 2UZ0A 1VXRA 1SKYB 3P4YA 1CNFA 4FHCA 4G9GA 3VO2A 3WV4A 4MUBA 4FFSA 1SOVA 2V4MA 2W98A 3IUQA 3QEAZ 1PR3A 3HU5A 1TDJA 3KKPA 4MNTA 2JEOA 5K4HA 3ORSA 1MC8A 1COZA 1ZINA 3BL6A 3PI7A 2GHRA 3CZAA 2J3DA 3A9RA 2BMWA 1SOAA 3K8QA 4FGWA 1X1SA 2AFRA 4X7PA 3SQWA 3BWMA 3JYHA 3RK0A 5GJBA 3FRIA 1WKCA 2FFAA 2FSUA 1NFQA 2VJKA 3ESXA 4ZQGA 4E15A 5INTA 2GBLA 3QEMA 2B94A 1GPMA 3GEPA 4G26A 3SIXA 4HQFA 4V03A 1B8OA 1YMUA 5FV7A 4BTVA 4WKCA 3ZNOA 1GCAA 2F3UA 5J4YA 1NW9B 1FU4A 5JT1A 3P97A 1U2SA 4K6HA 1BHJA 3HP7A 2OWEA 1ZL0A 1VPVA 4PG7A 1C8BA 1J8MF 1ZUWA 4DQ0A 1W25A 4OB7A 1A5AB 4OUDB 3ONDA 4GRAA 4MI9A 2W8ZA 1U2DA 2D0PB 2QVZX 4Q9DA 3RS7A 4E14A 5JG7A 2PZAA 3H1TA 1WSAA 4JR0A 4BLQA 2IOYA 3VYTB 3O3OB 1A7KA 2BD0A 2FMIA 2HX1A 3N58A 1W36B 1QNLA 1IM8A 3Q7SA 4V24A 5GZ6A 4IDFA 5JSKA 1KZ9A 2QX7A 4MR9A 1F0NA 2IUEA 4C05A 5DM0A 4IFTA 1TPZA 4D82A 1JWAB 1DJLA 2CL7X 3HXLA 3W5IA 3U3ZA 4U0KA 2CDRA 3E9YA 1HYGA 2CUZA 5JJIA 3L1IA 2FEWB 3DLPX 1N2OA 4LOLA 3KOWA 2I76A 5I6DA 1EFPB 1E94E 4KQFA 4DDKA 1JWBB 5C7OO 4XA8A 1Z2EA 1I4LD 4A4DA 5CCBA 1NXTA 3H1PA 3X1KA 5AW8A 5AKJA 4TMFA 3GRFA 1SUPA 3QTBA 1FFAA 5DX0A 4JJ7A 4EKDA 1Y4AE 5H4HA 5AM0A 2W6ID 1DADA 4ZQBA 1C9KA 2MSCB 3WHIA 5KMGB 1Z75A 2OCPA 3NOQA 1W94A 2PLWA 2QVXX 1A1SA 2FQXA 3EH2A 5FI1B 1W5EA 3LUHA 3EMVA 3O8QB 3VUFA 1A1VA 2VRWA 4MMYB 1K8ZB 3VV3A 1UOOA 2KLHA 5CLQA 3T5CA 4ZI7B 1P2UA 1ZGJA 2CMDA 2MJLA 3OFND 5JNRA 5LQUA 4UASA 4Y2JA 3OTWA 5AUQA 3L0IB 2BFWA 3AUTA 4MB0A 4O8ZA 1ZR4A 1F0PA 4W5JA 1GZ4A 1UBLS 3IXLA 5BWMA 1HDYA 3VR6H 3FR8A 3GRCA 2JJYA 3IUEA 4TXMA 5FL7D 3MYRA 4DNFA 3HU1A 3DAGA 4JVLA 1GZ6A 4V0SA 4B34A 1Z13A 3SDZA 3C3BA 1KI2A 2RH4A 1C7IA 3GJTA 4E5DA 2EF0A 5KTRA 4HGNA 4NOMA 4B3SB 1U7DA 1X8LA 5AK0A 1HRKA 5HM8A 3MJSA 3TGLA 4TYWA 1PFQA 1IN7A 1KI6A 2KB0A 3M8KA 4R9UC 3ZQ6A 3I45A 1KQNA 5JRJA 2D1SA 4BBJA 5IYZA 1KH1A 1YCHA 1IWBB 5TT0A 5IJ9B 1LXCA 4IP0A 3ER8A 3LBAA 4JASB 3FSGD 3A1WA 5EUCA 1Z0JA 1CUAA 4Q3BA 4WFQA 3ZGNA 1WP9A 3ZW9A 1L7PA 2FZLA 2ECFA 1GA1A 2Q5CA 3QFFA 5JJLA 4FMDF 2DH6A 1WOYA 5CNMA 4ZVRA 4IUBS 3UICA 3OG9A 3OLXA 2ZI7A 1XTVA 1WMFA 4E1AA 1WV1A 4POAA 1W4LA 1Z2NX 3KD3A 5CBPB 4DLWA 1SXPA 3Q3CA 3U3MA 3WJ7A 4K6MA 2X8AA 2NZXA 2VNHA 4IXNA 2RG1A 5ICFA 2HV9A 2OFPA 3A9SA 3ZV3A 3FB4A 2XA9A 2R84A 4LHEA 4AWXA 4GKKB 1ISMA 1QO0A 1UBEA 3DWGA 3AL3A 3FMOB 3GELA 3O2SB 2WWXA 4R1SA 4RZQA 5TF0A 1JJ7A 2GQ0A 3QYJA 1W2GA 4PZPA 1LWNA 4D3SA 3TSWA 4ZWNA 4D9BA 3TN7A 2J3LA 3KG2A 4FDUA 3NFYA 4YV1A 3ADOA 4AJKA 3OWHA 5KSYA 5IC4A 4KFSA 1XDZA 2P77A 3U0VA 3A6LA 2JKVA 5JQWA 2D06A 3LH5A 1WHSA 3EEBA 4IS2A 3IQHX 2KMLA 3O4JA 2W90A 3HBMA 1SK8A 1WKVA 1R0BA 5KTMA 4I9UA 1IMJA 3LFTA 1D4FA 2AC4A 1FSGA 4M1YA 4P81A 3WA7A 2XRYA 4F3CA 4X97A 4H7PA 5CXXA 1GQYA 1XSEA 2FAXA 4LDPA 1WR8A 2QL7A 1NVBA 4BQFA 1UPXA 2V7TA 3VR5A 4FS3A 4DBLC 1WZNA 2VTVA 2YMPA 3IBGA 2IS6A 1HLGA 1N0HA 1E0AA 2A35A 4HF7A 2OMKA 1NASA 2PLAA 4IGFA 1IATA 4QUDA 2GR9A 3A6DA 2ZT5A 3KOYA 4G9EA 4C5CA 5DH9A 4F9EA 1CQPA 4KPYA 4AULA 3O38A 2QRNA 1Z7BA 1YVUA 2QRQA 4GKAA 1ZIXA 4K9RA 1K3UB 2D8AA 2R7KA 1PNOA 3O3NB 3IUPA 3OEED 4YUZA 1IL0A 2G6BA 1FEZA 2YHBA 3PF9A 1MNQA 3BDVA 3EEFA 1QOZA 3Q72A 2RGBA 4ZU1X 2AIRA 1FFXB 3BXEA 4AXXA 4K86A 3DQQA 3QF4B 4D4KA 4LFBB 1KYTA 1CJBA 4RORA 4ZO6A 5FWAA 1REQB 2OORA 3CNEA 1C14A 1CR1A 2XIQA 5E7MA 3VC2A 4B17A 4QTYA 2VF2A 4LOJA 4J76A 3C1TA 2I6TA 4BO8A 5J5AA 3LFHA 4C4ZA 3CUVA 4O2AF 2ZTLA 4BZQA 2G4LA 1N5JA 5TGZA 1DPFA 5ALGA 3VZRA 3A4MA 1RKUA 3G9ZA 3OSZA 4N9WA 2WU1A 3K0CC 3AEYA 5EVJA 4JKIA 5K3SA 2ZCJA 1C3VA 1Y5IA 3WFZA 1KEZA 5AMXA 3P26A 1QS0A 2Q3LA 2DUUA 5FBRB 5K3DA 4C4PA 1JFRA 5IS2A 2NT3A 3LZCA 4HPJB 3KALA 3I42A 2IUUA 3USCS 3WS7A 3K70C 4UTNA 5GP1A 5EWMA 4EA9A 3TTXA 3PC6A 1TM7E 3T3PB 2EFYA 3F0TA 2O8DB 5KJCA 3TF5A 5JH7F 4WFJA 2N75A 5IAJA 1N34B 3PNSA 1DTWB 3REQB 4JUIA 2PMEA 4YJKA 3I04A 2CVPA 2JGAA 4IOLA 4UU0A 2OGSA 1MQSA 2BISA 4ZC8A 5IUKC 3RKUA 2YN2A 4MQLA 2Z5GA 3HY4A 5FO1A 2EZUA 3QBTA 3LW7A 5SY9A 4CKEB 3JRNA 4E13A 3SM9A 3BRSA 1IG0A 1Y8AA 1QVZA 1U7UA 2CUKA 2QM7A 1RCTE 2QUAA 4JY7A 4UREA 5K0SA 3VR2A 5KWVA 3TSYA 1J49A 2VZ9A 3JD2A 3O03A 3TQHA 1M7GA 4O4IA 2VYQA 2J7PD 4BWVA 1YMQA 1RJ9B 2L82A 4ZT2A 1MC5A 1AJEA 1K6IA 5AKGA 1YVDA 4HS9A 1JKMA 3WIUA 3X3HA 1DDIA 1RTKA 1TM1E 2XSZA 3QIAA 2HQOA 4QHTA 4FB5A 4LMBA 1SM4A 1I32A 1UXKA 1AKWA 3GJQA 1WUTA 3MMNA 5K2MA 1TUEA 1P9OA 1NA5A 1VL5A 1Z0SA 4GS5A 4YJ2F 1TQ6A 3BUSA 2HUNA 4M98A 3AF6A 3E35A 5K05A 2AOUB 2JASA 3CR3C 4LY0A 1EX9A 2P5TB 1JIIA 1UOPA 4GX5A 5LPNA 1XMOB 3PVCA 1TMYA 2SECE 3QVSA 3O93A 4HZIA 5D3KA 1GRCA 2OHOA 4QUKA 5AKZA 2LVBA 5G0VA 3ZKWB 5T4EA 4GE0A 4BAUA 4DXAA 4HDOB 3ZJVA 3R74A 1XJWA 2ZUDA 1TMGE 1NVEA 5B3JA 5ILGA 4BFWA 4BVEA 2XCTB 3DB1A 4I5IA 1WMBA 2D7CA 1QH0A 2EFGA 4KYIB 4FBMA 2Z9BA 2D4HA 3A9VA 3B1VA 3LC7O 1DG3A 1NLFA 2ZBFA 1IM2A 3L8EA 3WNDA 2B35A 2YIMA 3TTWA 2Z2XA 1XQ1A 1U98A 1P0PA 2LW7A 3PC3A 3DO6A 2WM2A 3QQPA 1CW2B 2WPNA 4RSRA 4PSKA 1HT0A 2P4EA 2QUBA 3R0VA 4HDSA 1JEJA 2NM0A 3GAZA 1KA9H 2YMQA 3IT0A 4QXOA 4XUCA 4E5YA 1I7SB 1WQ3A 3EPLA 2X9NA 5EZ6B 2CVZA 3FCYA 3KT3A 4CV1A 4QUBA 4TS1A 3QWBA 4HGOA 4P3XA 3AJRA 3BE6A 3SQOA 3WKBA 2EKDA 1WSDA 5JNSA 3COJA 1IAVA 4K03A 4YH1A 5HK8A 5BPFA 1Z45A 1ZHFA 5JSQA 3PCXA 1KZ1A 1QYCA 1KEPA 2C8JA 3PUVA 3CE6A 3TM5A 3ABSB 1A9PA 1Q0LA 3M2TA 1E0SA 1XJ0A 4X8LA 2JA1A 2QUHA 4B73A 4HXGA 2OXFA 1G8HA 1LDBA 1KO8A 2Y3IA 1FP7A 2RJNA 2B1RA 5AFSA 4EECA 1PJCA 1RYBA 2WIFA 4ZQCB 5GAJA 4EIWA 2D00A 5BVGB 3IAM1 3RC3A 3V7UA 4QEDA 5NULA 1U31A 3GLQA 3VU1A 4DRXA 5L40A 4Y1FA 4JOSA 5I47A 1XCBA 1JFFB 3R24A 5DYYA 4X6UA 4Z1OA 3NX4A 4B84A 1LX7A 2XY4A 4KLAA 1BU8A 4Y6RA 5TPZD 1E3WA 2B8NA 2O48X 3G82C 2OEPA 4LE1A 4RHXA 2QN9A 1PQYA 3BHMA 4EPXA 5FH9A 2XMPA 3B1YA 4BX0A 3AKZA 3RIEA 3WA6A 1RWMA 4INJA 5FTNA 5KNLA 3FI9A 4ECAA 2RH8A 4MAMA 3MS7A 2GAJA 3KZNA 4PYNA 4L78A 4YFYA 3LCVB 4GPD1 2VHEA 3K9GA 1L5LA 3WHKA 2FEAA 3CX3A 4RTRA 5F1YA 4B80A 3EF0A 4ZO7A 4JOCA 2WKSA 4EG3A 4XCVA 4W7SA 4TKZA 3ZLJA 4JFAA 5IH7A 3JTEA 2XZDA 3G0GA 4DCSA 1XVTA 3K4PA 1AGYA 3NFRA 5BMOA 1B00A 5ELMA 3F5FA 3HA5A 1EUQA 4MEBA 4LA4A 3MTQA 5U9CA 2BBOA 4RJTA 2JCSA 5HGJA 2ISSD 2C4KA 4FT2A 3DXXA 3OUZA 5CNKA 2FX2A 1PE0A 3IAHA 3NRBA 4EHJA 2FVXA 1H8HD 1F6WA 1HM5A 1VB5A 2QTTA 1CX9B 1GNVA 2PCLA 3OFSA 4MR7B 2C03A 2O7SA 1N2GA 4O33A 1S8AA 4EG4A 1QRUA 3MSXA 1COWD 1K27A 2VJNA 4ALIA 3PD0A 1YRYE 2X8WA 2XAUA 2ZFUA 3G1UA 1FXWF 1QCCA 2G8LA 2R4QA 4PGFA 4JVOA 1XLWA 3RYIB 1C4KA 4FGJA 3MMZA 1XQVA 3AINA 2QA5A 3DOFA 4QOGA 3VFDA 4RVGA 4LNUA 5JBNA 3NUGA 4GD3Q 4M8SA 1EDOA 3CUWA 4PLFA 3U1TA 1CZKA 2FN9A 3JQRA 5J3JA 1QGUA 4W5NA 4DMFA 2TRSB 3D6HA 2F8LA 2HA7A 1O96A 3HU3A 1JHOA 1UAGA 1UJ2A 2OCKA 1L4KA 2XV1A 3EBOA 3QOWA 1V41E 3T5BA 3RVPA 1S3SA 4PLTA 4M1WA 2P41A 4YJ3A 2R7AA 4U2FA 3RUAA 1R6TA 3OMXA 1JTEA 2P5SA 4F0JA 3RSFA 3PIIA 1H22A 2XDAA 1LRLA 5H70A 1C50A 2JB9A 3QKIA 2QK4A 3IKLA 2HJVA 3BKXA 1NVGA 4NHEA 1A95A 2FXVA 3SF8B 2ACKA 4HQNA 3H83A 2Z57A 3IPCA 4HVTA 2NMVA 2WINI 4LF4B 3AB3A 3JWPA 2H5JA 4K46A 5L4NA 2W5UA 1DTSA 1K7XB 3AHEA 1Y3DE 2VPTA 2XODA 1DU4A 5FBVB 4FR5A 2Q5HA 2Q1UA 4DKXA 2VQDA 3NT2A 2OFFA 1VLJA 2JD2A 2RK6A 2VR1A 3LZDA 3OQ1A 3P9XA 2J0SA 2G04A 4WD3A 3AFGA 5KU1A 1NW3A 1ZA1A 2Z9DA 4XD7A 2H1WA 3H5VA 4B3GA 1JSRA 5B7QA 4FCCA 4OJKA 3SZUA 1SVUA 1BOFA 2X14A 4X6YA 3OZBA 1A98A 4NG5A 4WH0A 2NXEA 2O7VA 1YU9A 4QOHA 4M0FA 3R6GA 2CBZA 4UE3S 5JSZB 1AC5A 5EFOA 2M9MA 4RVSA 4C7OB 3FTQA 1B8NA 1UFVA 2GASA 4R1TA 3W9BA 1NBIA 4FYHA 2IHYA 4DQDA 4UBJA 3O73A 1JG7A 1LFDB 3KEMA 1KR5A 2MMCA 2VF7A 2XF2A 4D56A 1Q1NA 2R2AA 3THRA 5JDIC 2O8FB 4NBUA 2FR8C 3GGDA 5EJ8A 5KBYA 4DCJA 3ED1A 4JT8A 4UBMA 4B32A 1NOIA 3VYVA 2GX6A 5ITZB 1A2KC 3ABIA 2BP7B 1SCJA 2DCUA 5G1NA 1DIBA 2EX1A 2QD2A 4URYR 4B09A 2O1SA 1EXVA 4YPFA 4KVFA 4RGYA 2OBYA 3CH7A 1V3TA 2E5WA 5B37A 3U60B 5AIAA 1NATA 2F4NA 4EVQA 4EO4A 3WBBA 3CVJA 4AJJA 3S6JA 1JILA 3ZDYB 1QIKA 3MXTA 1V1JA 3ZCTA 2QM0A 1W87A 2VK2A 2XMBA 2YV1A 4FNAA 4ZAXA 4RS3A 2X8JA 2H48A 4JA2A 4XAQA 5LYJA 1JG1A 4B71A 5HHTA 1CQXA 1R7RA 5I5EA 1UXOA 1R8YA 3ETDA 3AZQA 3BMNB 3TNDA 4NDNE 1M8KA 1GOTA 5K3BA 4GMDA 4C3UA 5TJ9A 1M8GA 3IC5A 2Z04A 1XO1A 3Q7QA 2GRUA 1EVYA 4JA0A 3MWJA 4J94A 2ZSAA 4AS3A 3UMYA 4PPQA 2H7YA 2X22A 5JXIA 4U9UA 2A9VA 4B79A 2HXGA 3DMTC 3T4PA 2A9RA 3B8EA 4PZLA 5BWBA 3OE4A 4YDRA 3WGVA 4OHFA 2XD9A 1CUGA 1RE1A 3SG0A 3M5CA 3QE0A 3T7CA 4V0ME 2NV0A 2O8BA 3VSBA 5FTLA 1EGQA 2QW1A 4OKNA 2WU3A 3TTSA 4Z7QB 2WU4A 2JLSA 2GYWA 3SVTA 3PJEA 2GK3A 3A9CA 2ORED 3GPBA 2HJWA 4YK7A 4Y3UA 5EAIA 1F8YA 1KR2A 2EFJA 5KDDA 1R6DA 2JK1A 3CUUA 3LQ4A 3OCJA 2XTJA 4I08A 5DI9A 4LHVA 1EMDA 2VJMB 4M0MA 1ADJA 2EJVA 4IEIA 4MWDA 2PS0A 3K1AA 4NYMQ 4EI7A 1JJAA 2O0MA 3OIUA 3TZBA 1K4YA 3QFTA 4JOBA 4TQ9A 3QX9A 5KYKA 1SXJD 3IQWA 4HY3A 4OHBA 1TYEB 2QVBA 1LSSA 4TYMA 2EX4A 4OQYA 1QIJA 1T8YA 4D79A 3AVTA 1KYVA 2IC5A 5EJ4A 4R1PA 3AEQB 2JI7A 5DI3A 3VU0A 1KJQA 3UG7A 4AJLA 1JEQA 3SS9X 1L4NA 1YDHA 4IY1A 4JWTA 1XMSA 4IIBA 4Z5XA 4ZMSA 1L5ZA 1T5DX 4ZOQI 4IJUA 3TFOA 1IXSB 3ZWWA 1L6RA 1L0BA 4GKBA 5ALHA 4X7RA 1P1FA 2UYOA 3V55A 3VHXA 3JQBA 3ZWPA 4BP9A 2XADA 4GDFA 1MG0A 1QV7A 5K51A 5ITWA 2IUTA 2GYUA 3Q3VA 4ZFNA 4C7KA 3VKVA 3EQ2A 3PQ4A 4MHOA 5FNVA 1F0KA 1WW2A 2CDBA 4X1IA 3U80A 2WTXA 3GLIE 2XYQA 5KOYA 1ACLA 1SC6A 4HDMB 3S2SA 2YV2A 3PNBA 5B30A 5C1DA 1OV4A 4N3NA 4A6XA 1M2VB 4BC0A 3ZIDA 2D0OB 2ZR8A 2ORWA 1A0OA 1YE8A 3EXHB 4JH0A 3S44A 3ZLBA 3I4FA 4CR6A 3MT8A 5DGIA 2BFOA 4QDKA 4DLVA 1KXZA 1NC3A 2CLEB 3H8WA 2VYVA 3KD2A 3KEFA 3T7TA 4EGQA 1ZM3A 4UD6A 1GG9A 2YZMA 4CIXA 3OEHA 2R7MA 5TQVA 4BNZA 1YRWA 2R48A 2GEJA 5JQGF 2Y93A 4A23A 5LD2B 2VJAA 1L4YA 1MV5A 4TL8A 3RK1A 3BWYA 2DEUA 2HMAA 4D0NA 1Y3HA 3LP5A 5JO0A 5G0WA 2JCXA 1QP0A 3GZJA 1CEEA 3GLHA 5AVYA 2DJ5A 3SP1A 2O2CA 3I2JA 1U2RA 1JBKA 4MZDA 4FX2A 3SJBA 3G68A 4HNRA 2D8MA 5CFPA 1NVMB 4Q19A 1QYIA 2K6GA 1T2EA 3SKXA 3QA3E 1AUXA 1SG6A 2DLNA 3OZVA 4ON9A 2ODEA 1CS0B 2ZIFA 3F2IA 3F5DA 1NE2A 3BILA 4XLLA 5JYDA 2WC1A 1V4VA 3A1UA 4N5DA 3AKCA 2IS4A 3BEDA 4Q5IA 4RTQA 1PBNA 3KDSE 4BMYA 3EE6A 2AMVA 4OLJA 5IJXA 1Y4DE 2O8NA 3A7EA 5KYGA 1TW3A 3H05A 4F7WA 1SUCA 4QU8A 4KC0A 4E4RA 2VJBA 1OHHA 3Q2KA 2ZB2A 1DC8A 1NVVQ 4M21A 3I4CA 4RZIA 5JOQA 2UVPA 1XI2A 1NLUA 3NHSA 5T57A 5JMPA 1I7LA 4FEAA 3WYAA 2Y1FA 4NZZA 4TTPA 1O03A 1R15A 3LGXA 4LECA 4EYKA 2H1IA 1YQXA 2P9TA 4YMVA 3B8HA 4G81A 1BMFA 1XF9A 4IUDS 3UPUA 1XD2B 1T4GA 4GLOA 2BZ1A 1MZVA 3D1LA 4MHSA 4DA9A 3GEMA 4I6JA 4E46A 4MVJD 4QSMA 4FYJA 4ZEMA 1VDMA 4CG2A 4GOKA 4OV6B 1E9BA 2H1HA 4CHGA 3SC2B 5F64A 1CRLA 3WFIA 3NOXA 3HKCB 1KMHA 2ECQA 3CUKA 3PL5A 3Q7PA 4IDBA 4BB5A 5A2GA 1GTRA 2VDRB 4CGZA 2W43A 4ICIA 3BH7A 2IYRA 1WLSA 1L7QA 4C07A 4F5YA 3HKBA 1TK2A 2I99A 4U2DA 3AYXB 4CI9A 4DMMA 1QPZA 3AILA 2IBSA 4NVRA 4ACAA 1O3YA 4KVGA 2D5IA 4HC4A 4JJKA 3L04A 1WXGA 3DLBA 3FFBA 1ZU5A 4IX9A 4WV3A 2CJYA 2PEYA 1PD0A 4IH1A 3A2KA 4WAUA 1USGA 6REQB 3PHJA 4P4SA 4CM4B 3GHHA 5IKMA 1TW2A 3RYHA 5G3YA 3UAOA 1R0SA 1UBGA 4JOQA 3TLMA 4R9SA 2PKEA 3QFSA 1JDBC 3SN6A 4B8YA 1VP3A 1DWPA 3G3EA 3JWHA 3L8GA 2WE7A 1H0HA 1YZKA 1DB3A 4TZ6A 3ZJ5A 4WSOA 1KHHA 4O1IA 4CKBB 4Q9LA 5C1BA 2HN9A 1PYGA 4IEFB 4FPXA 3ICQB 1E2BA 1NVKA 3W7VA 1F0YA 4JX8A 4OJYA 4BUCA 4X3OA 2JAQA 2B6NA 1OMOA 4GYJA 2BEWB 3LUDA 2NQ2C 5CNIA 5BVHB 1D0VA 3N2ZB 1Q7BA 4TLLB 4LRQA 5EJ2A 2IH5A 1C4OA 3RUIA 1TECE 2XVYA 1P4SA 4GI2A 3TVTA 1S2IA 4RJIA 4X44A 1WUJS 1GQOA 1GPKA 4MGKR 1E3QA 2XQGA 3DONA 1E1YA 2DE0X 4IXDA 3NHUA 2Z58A 1YQGA 3C3KA 1N33B 1U3FA 3I1IA 3JU3A 3JVUA 4GT1A 2V6FA 2QTCA 1KU6A 1KPIA 1UH5A 2YWHA 1BKYA 2NZVG 3KSUA 3DBLA 3RVQA 2V7QD 4F3YA 5BN3B 1DAKA 1DWUA 1LU9A 2H2GA 3KTDA 1AKMA 1V4NA 4EJ6A 3RHFA 3CVOA 4XB2A 5C8VA 1ULBA 2CJWB 3WSTA 4XYGA 5TE9A 4M6WA 3C7KA 3MTAA 3NJ4A 2JFBA 3ZZ1A 5GMOA 1JQAA 1P9NA 2ZWOA 3NHZA 3T1QA 3B2QA 4ENRA 3EEOA 4PTZA 2O3SA 2Y67A 1ZD5A 3U44B 4BWFB 1A76A 4CTKA 1KDTA 4JR1A 5EIEA 1BWQA 3CA8A 2HLDA 3M1AA 2CEAA 4P4SB 1J2UA 1JR4A 1B93A 1WXWA 2WNSA 4P92A 3T95A 4X20B 2VYCA 1F8FA 1PZNA 1H6CA 1OXTA 2QG6A 5EYPB 4E07A 3QP9A 4FOLA 4UHDA 4M4SA 2C8VA 4MKXA 3MINA 4ND8B 3QUAA 4LQLA 4S1WA 1MU0A 4FFBB 5C0OE 3VNBA 1HLPA 1U0NA 3QOXA 2Q3HA 3HMQA 2Q0QA 2W4IA 4UHBA 4ZODA 3RU9A 2R8RA 4Q93A 3ZHQA 3A32A 4KCGA 2GZDA 1RXCA 4MV1A 2ZE5A 2PWYA 1WMSA 1XN1A 5EZSA 2V6MA 2IEZA 2C2OA 2NTEA 2H08A 2OO3A 1U4SA 2G5GX 4WZBA 5I9BA 4DIMA 3DULA 5F4BA 3R9KA 3VA7A 4FHEA 2CYBA 1XVIA 2FQWA 1DC4A 1JG2A 3IAUA 3GZNA 3JZMA 2O3TA 2KBFA 2P5YA 2RBGA 3M7IA 4OIFA 1EK2A 3RRBA 2F9MA 2O59A 3SQLA 2A9KA 1ABEA 3COZA 1A5BB 1PF7E 3AETB 3K35A 3SC6A 2CXXA 1XYVA 1UJNA 2HAEA 3D6TB 4B76A 3U6KA 3RWMB 2PM8A 1SELA 4HB4A 1A27A 4JENA 1RJDA 4LAFA 4N7BA 1JKXA 4QNRA 4JP2A 2ATCA 4RPLA 4RY8A 1GYQA 4ARUA 4EJMA 3O7WA 3UOWA 3VDRA 3BRCA 1FSFA 4INZA 2GXSA 2QTWB 4RIIA 5D01A 2BGGA 4CN8A 1VJGA 2NSLA 3EMBA 4QO7A 3R9XB 3I2FA 4HWSA 5LA6B 1MQ8B 3DDSA 3THSA 3KU4A 4F96A 4CODB 1QANA 2VHQA 4CU5A 5LM3A 1XZJA 4WCFB 1ISIA 3DNMA 2HA4A 2IXBA 1CZOA 3I2HA 4EMBA 4HBZA 2J08A 3LDFA 3BFVA 4A8HA 1WIWA 1GUZA 3CT4A 1E1LA 3IDSA 2A59A 3LX5A 1IN1A 1HF3A 3W5JA 1D04A 1KEVA 1XQ6A 3HDVA 2A5JA 5DBIA 2CUTA 4QRDA 2WTAA 3C6ZA 1P29A 1AMNA 1DFIA 4ER5A 4ZTZB 4MX8A 2NO0A 3GB9A 4PO1A 1A8UA 4AMZA 2II6A 2CFCA 5HKOA 4HDSB 2QF7A 1Z28A 4GQAA 1VSVA 3RYIA 1JSLA 2DFPA 5BUQA 4Z4IA 2RHMA 1EAYA 3CNQS 3HE3A 1WUIS 4ZCTA 5KTKA 5KYXA 2FJUA 1E5DA 3RVDA 3QF4A 3LOUA 4EO7A 1QKJA 2VRCA 2GA8A 1MB9A 1OW3B 2NXWA 4Q3LA 5BRJA 1D0IA 1AH2A 3SD7A 4QDTA 3CB2A 3ANLA 3LJKA 1OASA 1V0JA 1LQUA 2AFIE 1G291 3D8BA 1PEKE 3DBHB 4XR4A 2LUOA 3X1WA 5KHOC 4MW5A 3ZXYA 3X1MA 5A4DA 1M1NA 3MQ2A 3I2GA 1QX4A 1YI0A 4DV5B 1VIMA 3GG9A 2FE1A 1D9XA 4MRAA 5SYMA 2QAJA 3RBZA 3FAKA 5ELLA 2C4VA 2PRSA 1LQ2A 5FO0A 3TK1A 2FSVC 2LP4Y 2WNIA 1E9AA 3X1DA 1LTKA 4P3NA 1Z0ZA 3ZCPA 1YJBA 3O3CA 3UCFA 16PKA 4M38A 1AY0A 4R2KA 1ZM2A 3QUBA 1RR6A 2IYOA 1K8XB 4XIYA 3RUPA 3RGWS 3S1LA 3AL0C 2DFKB 5CGQB 4B0OA 5I9IA 3QE9Y 2VDWA 2F9LA 3IAS1 4CYMA 5CIYA 2I2BA 4X1OA 4R7TA 3JY6A 5FPPA 3DVAB 2PD4A 1O0SA 2JFFA 2QTMA 2NO9A 3ZGLA 2XLCA 4Q3EA 3VZPA 5DRTA 3F4BA 1E3DA 4KE7A 4CM6A 3WRVA 4UNIA 4HWRA 5HXAA 1DIRA 1EWTA 1TIPA 1N2SA 1Y63A 2WJ4A 1VE5A 2X0RA 1M6VA 3QVTA 2GF2A 3EZ7A 5JVDB 1CFJA 3EMDA 5ALQA 1C9MA 1DIAA 5IKOA 3EDYA 4BNLA 2XYGA 2ZJ1A 1MFPA 3TD2A 3AUUA 3JARA 4Z0NA 4GR4A 2XYPA 1A9SA 2XDWA 4MPJA 2XOEA 2IGTA 4LC9A 3NWBA 4UOEA 2CF5A 3ICWA 2WKRA 3WE7A 1U0LA 13PKA 5EP1A 1N3YA 2Q1SA 5GJWC 1MD9A 4Q01A 2ZWMA 1ISFA 3A4YA 4A6EA 1IUKA 2FEOA 2BJWA 3M3HA 1CY4A 4E6EA 1ZZGA 4F56A 1I7QB 3EUWA 1E9CA 1KRXA 4KQ2A 1W9MA 1JDNA 3CINA 1E7WA 1LK7A 1NF9A 1KVRA 3VV2A 2QRZA 3AUJB 1N7IA 2BJVA 2JH3A 3CZPA 1XJQA 3E0QA 3JALB 2Q3MA 1ESZA 4DG5A 1E3TA 1YR2A 3GMTA 4P38A 4BQQA 4ZYVA 3UMGA 4MVJI 5KWSA 3IV6A 5EWJA 1N78A 1T1GA 4S2UA 3S5JA 2REXB 1YQEA 2ZDHA 4TMKA 2CBXA 4Z9AA 4M1TA 2ZBVA 4CHTA 1XDDA 4DCNA 1F6BA 3BZBA 4NKRA 3TMKA 3OZSA 3HADA 2Q6KA 1ZONA 3IO5A 3GUVA 4ESVA 1WBBA 3HU2A 2WTBA 5DW0A 5L95A 1I4EB 1F12A 1FQWA 2BFBB 5I9SA 4JXZA 1MAWA 1TU3A 3FCSB 1T3SA 2FK7A 5ILQA 2AK3A 3DEJA 1CUBA 3KKOA 4RLQA 1Q20A 5ALFA 2FWBA 5BQOA 2J6HA 4Z3DA 1CVLA 1G20A 1YKGA 4RY0A 2IL1A 4GX0A 3UMJA 1X7ZA 1DKQA 1K9VF 3D5TA 1BA3A 2ROQA 4HPXB 5BQ5A 2QN8A 3UH1A 5SV2A 4HEA6 4JYAB 3IAM6 3PPIA 1T9KA 1YSCA 2F3TA 5AI4A 1J99A 5IXYA 3T3GA 3BGVA 5CLFA 3NM4A 4WX2B 5D2CA 2E5LB 4U39A 1RC0A 4H9GA 1Y7TA 3E58A 1P5HA 2IW1A 3OOEA 4HFMA 2Z8ZA 3GJ3A 3IP3A 3V34A 3P9KA 4E5NA 5IJ0B 3MD0A 4GBED 3ENVA 4KG7A 2VWHA 4UM7A 2RGAA 2W2LA 3UUFA 3W1WA 4Z49A 5LWHA 2QQEA 1GRVA 2YIVX 2YR0A 4HXYA 1UL1X 3IDFA 4OF4A 4ZIRB 3DV0A 2LPMA 3H4TA 3JCZA 3VR6D 2QVCA 1OLUB 1G6HA 3A14A 4C4TA 5BNZA 3LAWA 3R9XA 3CJTA 1KF0A 5LA6A 1GN8A 2ZBPA 1KI1A 4HVCA 2Y1CA 5DHAA 2ZJ4A 1VJTA 4RF5A 2UYGA 4RTPA 3W3AA 2XUHA 1E69A 2FF7A 2G7ZA 4DWVA 1UIRA 1V48A 4PC7A 4FB4A 2FPGB 1TUIA 3O4GA 5IHXA 1TIBA 1EM8A 2WZBA 1YGYA 4ZT3A 2FFQA 1NULA 5T3UA 1H23A 4IJMA 1EPUA 1EWRA 1ML4A 3LO8A 2INGX 1NJ2A 2AOTB 4KGDA 3WZLA 4ARZB 4W5QA 3EZXA 4FDMA 1HE1C 1XN4A 1QYVA 5DNUA 5P21A 1OOEA 2IPMA 1HGXA 4MQBA 3K09A 4OBBA 4OQMA 1SXQA 1D2HA 1C8VB 1A88A 1J2TA 3K73O 1KBQA 4RUKA 1YRQA 2VDKB 3QFHA 2W6PA 4MP6A 3ZE0B 1FZTA 5DV9A 4H1VA 3OKFA 1EUCB 3AR6A 4ZK2A 5FQNA 4B2LA 4F1WA 1PZGA 5AW7A 2RH5A 4HQKA 5AQ1A 5I9LA 2DFLA 2QMQA 1UKZA 4TWRA 4ER0A 1QYDA 4A0GA 4X8MA 5IVHA 3EOZA 4DJ5X 3DUFB 3HYRA 3I6IA 2X2FA 4M1KA 4PX9A 3UMBA 1PSZA 3WL8A 5FNVF 3SQMA 1AKYA 1XZMA 1YZLA 2DKNA 2GKSA 2NZ2A 5BSRA 3ZIAD 1A9ZA 4YFVA 3EZGA 3KB8A 3O94A 4GMFA 1E96A 1US8B 1YUMA 1BXZA 2J3KA 5EESA 1O8CA 1XTUA 2CFRA 1PJ4A 5EXDA 3MRTA 3SZMA 1KVTA 2UUBB 4D8VA 3OTIA 1JTVA 2XQFA 4D9FA 2GVDC 2YV3A 1QFZA 1E9DA 1QGUB 3WQBA 5BMVA 4PR0A 5KC8A 2A0XA 1ZCZA 3HVJA 1UT6A 3HXQA 4MYDA 3RKRA 2HL6A 3JYQA 3EEQA 3IDQA 2IYPA 1BX0A 2WJJA 3INNA 3NC0C 2ZUEA 1P4AA 1EFCA 2L0XA 4XOIA 4NBTA 3V8EA 1M1UA 1Q74A 3SXJA 3BXZA 1NUHA 3UA4A 4LF8B 1VIVA 4L6CA 1PFVA 2Q1XA 2O8VA 3IKTA 4MR7A 2G72A 5DDIP 3OOYA 2W7TA 2P65A 3V8PA 1D2EA 3OIWA 1LLQA 4DCTA 3OPQA 5AR1A 3KCNA 2UYCA 2MDTA 3KFVA 4MW7A 1SCUA 4Z7NB 3HCOA 4AX8A 1SRQA 1EHYA 4G0ZA 4MW4A 4CM8B 4EUHA 5DHUA 4XYLA 3MJHA 2GYVA 1S5PA 1KMIY 1MTZA 1YB7A 1Z4IA 2HBQA 2J5XA 2PA3A 3AUFA 3BSYA 3DYBA 3IKMB 4PTLA 4QWWA 2AD5A 4R54A 5J5VA 2X6QA 3DJFA 1BWSA 4FHGA 1M66A 4LI0A 5H68A 1Z0DA 4B81A 4F8YA 5AKYA 3I8SA 3OT5A 2CZQA 3Q6MA 5KNDH 3LP6A 1MOPA 2HU2A 4Y7CA 1IJBA 5MFPA 1E2IA 4LGMA 4P4NA 4M89A 2BFMA 1YAJA 1I1QB 1RFLA 1K6MA 4S1TA 1FJHA 1U1IA 3DB2A 1ILWA 4LCEA 4PX2A 1C3OA 1M5UA 3RLIA 2I2DA 3IEPA 4L8YA 5EXTA 4LVNA 1JSCA 1UK7A 1LF5A 1ZO8A 4TKUA 1R4MA 5EMMA 1NDHA 1UBNA 4FSXA 1QO9A 3GT7A 3UT5B 1GFZA 1KJJA 3DL0A 2PVSA 3N86A 2ZTMA 1I8TA 1S01A 5IZCA 2AG1A 2HZBA 2EDAA 3ANXA 3HNOA 3QJGA 4RZUA 1CJMA 1F51E 5A6SB 4AT1A 3GLGE 2PE5A 1JLLB 4WLUA 1WLYA 4JWKA 2G80A 4OLBA 1CRPA 4I7EA 1QQBA 3DZFA 3ISVA 2Q4EA 1N6OA 4U63A 1WCYA 3OA0A 1OWPA 1RYDA 3N8KA 4L3WA 1BXGA 1XLVA 4X1KB 3ZGYA 4TYQA 1B8VA 1LI7A 1XG5A 1QBKC 1N9KA 2UYQA 4B3DA 4DCVA 1JEQB 1TM2A 2MSNA 3LCCA 3VYUB 3WICA 3OT1B 4KEAA 1A9OA 5EMLA 4QHYA 2XMDA 4BIMA 3MNFA 4PXYA 3OM1A 2E6KA 1CQJA 3ANSA 2GD1O 5IMBA 4LBWA 3Q7IA 2IIVA 5A5GA 4O2BB 2R86A 4KXNA 2NZWA 4BWGA 2PX3A 4RGBA 1PTJC 3L1JA 3GROA 4Q7MB 4CDGA 5IBQA 3DNPA 2O3UA 4II3A 3VC7A 4DAEA 4BX3A 2EBWA 4Z8YA 5DRYA 4KU4A 4AMUA 1GUYA 2CVQA 2IEYA 3K2EA 2ZJYA 3T4XA 1DKMA 5F2NA 1JB1A 1FTGA 1QZ3A 4JYBA 3VJMA 3QX7A 4EQZA 3VSDA 1U0SY 3W5UA 1B6RA 4L7QA 1YDEA 4CM3A 1AZSC 1HH4A 2FW7A 4HX5A 4PM4A 4YTEA 5KAMA 2F1RA 4YALA 1XT6A 1R6XA 1UAYA 3LK7A 3Q5DA 3UKDA 5JEDA 3F8SA 2EARA 4OCZA 4B3HA 2GDZA 5K3OA 1U80A 4RC9A 1NDUA 3EFHA 3LHSA 1FTSA 4KUEA 1YZQA 1QTQA 2ODAA 1VI5A 3PTZA 5FUVA 1GSAA 2JL1A 3K8OE 3OQBA 1BJRE 2GK4A 1TO6A 4GHWA 2IX3A 3R3XA 5F78A 3FBGA 5HR5A 2FMHA 4TSRA 2I66A 4ZVNA 2ZUBA 2R1ZA 3A1DA 3LPAA 3QLTA 3ZKAA 3ZCVA 3VKGA 5IMSA 4RENA 1C9YA 2YVUA 3EXAA 1H3FA 4K1LA 1QV9A 3R3HA 2I6FA 1SEPA 4GVXA 4U9HS 4BNIA 1F1JA 1SKBA 4DR1B 5BV2P 1NXXA 2VZ8A 1E6CA 4FUTA 3ROTA 4JP1A 1PRYA 3N0WA 4G5OA 4RGVA 5A71A 2FG6C 1AF7A 1W88B 4IGKA 1GTJ1 3X1YA 1R6AA 1T1SA 4CLRB 2JBHA 4NJEB 3V2IA 1GPLA 4GPIB 1OC4A 3ZOKA 5HJ5A 5HOEA 4ZCMA 4NRDA 2QRJA 3IXMA 1CULC 3ICOA 1R9GA 4OMCA 4DLAA 1GNLA 1KZYC 1QK5A 5EN4A 2PX4A 3QLVC 1P1RA 1D0SA 2WHRA 3H84A 1I6MA 3Q9LA 3O9ZA 4O2RA 2BMEA 1EHIA 3EY9A 3NNDA 2OGWA 5DLEA 5JZSA 5LZ9A 3NU1A 3SLRA 5KKNB 4UDYX 2E82A 4TV8A 3R7LA 1Q92A 4D0SA 3L4KA 2HLDD 2MT9A 5LL6P 2RKWA 3TCKA 3RRMA 4PC3A 4M9RA 5J2UB 3K05A 4IINA 3LVQE 1IVNA 3U4AA 2BFEA 1II9A 2AE2A 1YR3A 2GDJA 1LC3A 5EXPA 1BEZA 5FI3A 5IEBA 4RKEA 4WNYA 3W1EA 1FFSA 2Q5QA 3T9AA 4AU1A 2HH9A 1A5SB 4AZTA 4N0DA 4FUQA 4LVOA 3RBXA 1TVKB 4ASUD 5AUOB 4DB4A 4KNYA 2OLKA 4OU4A 1COWA 3AM1A 2JZCA 2DJIA 3EGCA 4PHHA 1TO2E 1O0BA 3DOUA 1JH9A 2GF0A 2CNLA 2HJGA 3MJ4A 3WIOA 5L3QB 5A0FA 5CYGA 1U3TA 2ACVA 1P9LA 4MGZR 2QI9C 3AOEC 4PLZA 1G7RA 3FSJX 3DHWC 4FOSA 3D6JA 3DMRA 2ONJA 4PS0A 1OGJA 3LTEA 5I7UA 2AJBA 4DLYA 5KYYA 5HZHA 1BKSB 4AKSA 1G0NA 4W5RA 4NECA 5C5DA 4GW3A 3R77A 4J1TA 2J31A 4O59O 4MV5A 2HIAA 1O89A 3E2PA 1AIPA 3WLJA 1JDSA 4MXDA 1DBIA 4NJOA 1XD9A 3E9NA 5KINB 4LBYA 4NYIR 1A7AA 2ZS8A 3CXUA 3NPAA 3CTMA 3GLGB 4MPRA 1QWSA 3A1VA 1YUNA 1WABA 5EL0A 3UB3A 4L5BA 2Q8QA 3KDAA 4EJSB 1DC5A 4F4HA 1R6BX 3K2BA 2Y0CA 3AKYA 3NAQA 3TO5A 4BQIA 3LHIA 3ILXA 3R44A 1H69A