1UKAA

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
total genus 101
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ukaA00
2HA5A 1AC5A 2OGZA 3QMMA 4BCCA 3QPAA 1W75A 1HKHA 4X95A 3NUZA 2V96A 3ZWQA 4P9NA 5DNUA 5EHNA 5LYYA 3V1MA 1R50A 1P0MA 3FNBA 4X71A 2GYWA 5CMLA 1ACLA 2CKMA 3K9BA 3QITA 3I2HA 5T4FA 4RGYA 3C43A 4E46A 3DOHA 3G0IA 5K3FA 1QIKA 4BTLA 3FSGA 3W9UA 3LIIA 5C7YA 1TCBA 2H7CA 4ARBA 4X93A 2ROQA 1VJ5A 4UBIA 2DSNA 2I3ZA 5AM3A 4K6HA 2FJPA 1AURA 1XFDA 4Q3LA 4BYMA 2XMBA 3C45A 1BU8A 2J4CA 4AB1A 4FKBA 5J3JA 1LBTA 3TRDA 5ALUA 5FV4A 2PSJA 2G63A 3WJ2A 5ALXA 2IX9A 2Y1KA 1MT3A 3G9TA 3KDAA 4LIPD 1Y37A 4BVLA 2RGUA 3C6ZA 1F8UA 1ZIXA 1B41A 1VA5A 5CT8A 3ICWA 4HRXA 6YASA 3WK7A 4PSUA 5A62A 1H2XA 1E89A 1QE3A 3BF8A 4RE6A 3IURA 4Q3KA 4H0CA 5T4EA 2HRQA 3D3NA 3EQ9A 5HCUA 1JMKC 1LZLA 3DYIA 4BB0A 4UFOA 1H2WA 1EI9A 3V48A 1LPPA 4BAGA 4M0FA 2DHCA 3KXPA 1SC9A 1MX1A 4MQLA 4Y2UA 4H7EA 5A71A 1WM1A 1BRTA 1XZGA 3ED1A 5K3AA 1QFSA 5LKAA 4UHHA 3A6ZA 1CPYA 2WU4A 5JADA 1C7IA 3QBJA 5ALYA 3DCNA 1DU4A 1BEZA 4QDOA 2RONA 4V2IA 1MAAA 2OXEA 1CUVA 3H17A 3QMWA 3I1YA 5JANA 5AH0A 2WFMA 2E3JA 1T2NA 2QUBA 4F5ZA 3WL5A 2HL6A 3AILA 4DNPA 3FBWA 2JEYA 4ZI5A 1UZAA 3C6BA 1ACJA 4HXEB 5CH8A 5AM5A 3Q0TA 1ZI6A 5EIEA 4KE9A 3PF9A 4HVTA 1THGA 1QIGA 3STTA 3CCCA 2O7RA 2XQFA 1DX6A 1LPOA 4LKOA 3AZQA 2HDWA 3RKSA 5JAUA 1Z68A 2ONCA 3BJRA 1JT2A 2C7BA 2XQIA 4FWBA 4GLBA 5DWDA 5DYWA 3D5EA 1JFRA 3PICA 5AIBA 3B12A 1TRHA 4ZV7A 2XB6A 2WFLB 4OYLA 5AIAA 5K3CA 4PSCA 4G5XA 5ALNA 4QDXA 4EY8A 5JD5A 3E1GA 2QVBA 4WFKA 4FHZA 5CXUA 3HEAA 2JGKA 1E66A 1VE7A 2GZRA 4CIAA 4FFWA 1AGYA 2XI4A 5HQ3A 5ALZA 2QR5A 3HABA 4OPMA 5LLSA 1L7AA 2CJPA 2XQGA 1SCQA 2JF0A 4W1SA 4P92A 5DJ5A 5JIBA 4YASA 3VJLA 3YASA 1FFEA 4DGQA 3STVA 3A70A 4WCVA 3B3QA 5ALLA 1GPNA 2O2HA 3C87A 4M0EA 3FOBA 1FJ2A 4HZGA 5FLKA 4LXGA 5AOBA 3UUFA 5AKJA 2DQZA 2HA4A 5DTJA 3BDIA 4KAAA 4FTWA 2XMCA 5ALJA 2Z8XA 2WJ6A 1QTIA 1XZEA 4OUKX 2D5LA 4Y2VA 2BCEA 1R3DA 2PSDA 1U4NA 3IB3A 4GBGA 4CI9A 3R3YA 1DWPA 2WFLA 1XZFA 4FBLA 1HQDA 2QXUA 3H2JA 3WKAA 1K63A 2B61A 3A2MA 4LYEA 1EXWA 5F4ZA 1KU0A 2QJWA 4AN1A 1GT6A 3DLTA 2QXTA 3G02A 2Q0XA 2G5TA 2X5XA 3IULA 4UBOA 2J3QA 1EX9A 1SOMA 1XZAA 4IHAA 2B4KA 1E3QA 1UFOA 3AIOA 2PU5A 2VAXA 2BJHA 1D07A 4QDTA 4CCYB 3L1HA 3MVEA 1R1DA 3WWDA 2QM0A 1N1MA 1B6GA 5ALGA 4B0PA 4ITVA 3QYJA 1OCEA 2I78A 4BRZA 4I4CA 4KE7A 3UUEA 1EK2A 5C8ZA 2JBWA 4OU4A 4Y2RA 3PF8A 4Q05A 2XQKA 2HA3A 1MX5A 3WA6A 1ETHA 4KAJA 4QZVA 4B83A 1XRRA 1AX9A 2YYSA 3MUOA 4CCWA 4DLNA 1DT5A 1OXMA 2H7XA 2H9YA 1DQZA 2DHEA 4OB7A 3VJKA 4L0CA 3D0KA 2ZSHA 4GI1A 1ORWA 1CUUA 3D2CA 4MXDA 5A7HA 1CUIA 1R9MA 4LHEA 5E2IA 4UBMA 4C01A 2PU7A 4FDMA 5FPQA 5CW2A 3SC2A 1MTZA 1H23A 2H1IA 3SX4A 4G4GA 1L7QA 3ZLUA 3EIOA 4Z49A 4BC1A 4AO8A 3G0CA 3H2IA 1A7UA 4A23A 1W1IA 4GDMA 2JIDA 5AKGA 1W6RA 5HFAA 2ZSIA 3V1NA 5KWJA 1Q0RA 4FBMA 4IH1A 3I1IA 2XUOA 2HU7A 3EQ7A 4F0JA 4QWMA 2QTBA 1X70A 4DMHA 1XRNA 2XUIA 4HRYA 4BZWA 2QT9A 1PJAA 3PUIA 1LPAB 1EHYA 5E4JA 3TEJA 1UXOA 3WMRA 1VZ2A 1BCSA 3STUA 3TJMA 1H2YA 1NX9A 2Z5GA 2HA2A 1UWCA 1UOOA 3GROA 4E15A 4B85A 4BAZA 4C4ZA 3W2TA 4QDZA 5C81A 1A8QA 4KE8A 1JJBA 3GZJA 4BE9A 2O2IA 3D2AA 1USWA 5HF5A 1H22A 2CMFA 2VATA 5D3KA 1R88A 4OU5A 3EF3A 2WKWA 5CH3A 4E11A 2BUAA 4NVRA 4XIIA 1ODCA 1GPLA 4X85A 5SYMA 4LYDA 4QWWA 3L1JA 4DMFA 3WKCA 4ZGBA 1GQSA 5T4BA 5AKIA 3OC0A 4BDTA 3STYA 3G0BA 5ALPA 2VT7A 3O4HA 4L72A 1A8UA 4J7AA 1NU8A 1WB5A 2C58A 3OURA 4A16A 2Z3ZA 4U2BA 3WWCA 2WFZA 2WHQA 1ISPA 4IQ4A 4IH9A 4INZA 3FLBA 2ZVDA 4UBNA 3VISA 5BOVA 2WILA 1U2EA 1BS9A 4AQDA 3WK4A 3JW8A 4YPVA 1VXOA 3M82A 5JYCA 1GXSA 1ZJ4A 4K6GA 2CB9A 2V97A 1Q83A 1XZHA 3F8SA 2W22A 3DJYA 2OCLA 5JALA 2HADA 3OTQA 1CEXA 7YASA 3H19A 4PV7A 1TK3A 1CIJA 3M83A 5AK6A 1OILA 1CUGA 4Y2XA 4DNFA 3N2ZB 3KWFA 3FLEA 5A7GA 1QGED 5AKYA 5IVIA 2WIKA 2XMGA 3EBLA 5D7BA 2WQZA 2WU3A 5I8PA 1HDEA 2BKLA 1PV1A 1ODTC 3C8HA 2IIVA 3WI7A 3H18A 3RLIA 2DFPA 5JZBA 4EZIA 5JARA 3DS8A 5AKHA 2ZYIA 2FJ0A 4W9RA 2PSHA 3I2IA 2VJCA 2AJBA 1EDBA 3A2NA 3R3ZA 3WK5A 3IA2A 5AKXA 5K3DA 2QJRA 3Q8WA 3WKEA 1ZD3A 2ZJ7A 1O6FA 5ALFA 3O95A 4H18A 4AN0A 3ESAA 1UOPA 3PFCA 3DYVA 3PI6A 3STXA 3DQZA 3DDUA 5SYNA 3H04A 1IZ8A 1LZKA 1GGVA 1QZ3A 1BROA 2XUGA 5A2GA 3SK0A 3G7NA 1TIBA 1GKKA 4X92A 1IUPA 2OCGA 1U8EA 1IZ7A 4DNOA 4ETWA 4X00A 1R4ZA 5IVDA 3KWJA 1CFJA 4OB8A 1CUWA 5CT9A 1EH5A 2PKYX 3JYHA 4KJXA 3I28A 3QVMA 5DNWA 4HS9A 1GPKA 1K8QA 2RIPA 4UBJA 2BUCA 4FLEA 1W4LA 3IBTA 3WQHA 4AX4A 2PBLA 4EY7A 3ESBA 1DT3A 3IDAA 4Q34A 1F0NA 1FFCA 2OCIA 1FSSA 2B20A 2OAEA 3GELA 1CQWA 4MWSA 4Q1VA 1BN7A 3HJUA 2PUHA 3R3VA 4NZZA 3W9BA 2XLCA 4C89A 4X6YA 3F97A 1YA4A 3ZLVA 3V1LA 1YR2A 3BL8A 4U2FA 1EB8A 2OGTA 5JD4A 4W1RA 2XUJA 1QO7A 1WPRA 4HXGA 3FYUB 5ALVA 3NGMA 4B84A 4G1FA 3MGAA 4MJ3A 4X97A 5AK3A 1HLGA 2JGLA 3AUKA 2W6CX 1W76A 4UHFA 4CIBA 1NU6A 2OCKA 4XX1A 2JGJA 4WY5A 4CG3A 1DTEA 3QPCA 5ALRA 3HRHA 3HACA 1ORVA 1WCYA 5LZ8A 5HFNA 2HHAA 3O4GA 4EUSA 1CUAA 1LPBB 4PO3X 3WYNA 2QZPA 4PNZA 4DIUA 1Q84A 2WG2A 3FYTA 2XMZA 3U0VA 2FX5A 1J1IA 2WUFA 1MNQA 2VF2A 4KRYA 5AP9A 4FOLA 1E5TA 4L9AA 2EDCA 5AK5A 2HIHA 2VA9A 1CVLA 2BAGA 4U2DA 5DLPA 2RHWA 1G66A 4KE6A 5HF6A 1FFAA 4BZZA 3LS2A 2ACKA 1JU3A 1GKLA 4H7KA 3GUUA 3WK9A 4ZV9A 4G4JA 2XE4A 1KEZA 1QIEA 1CV2A 5AM2A 3ZPXA 1MN6A 2QRUA 3BIWA 1PFQA 4QE3A 3FYUA 2VTVA 4ZXFA 2GZSA 2HRRA 4OYYA 5BV7A 1F6WA 2BFNA 1P0QA 5I9IA 2OQIA 2WIFA 1GQRA 2ZYRA 4ZWNA 1RWQA 3FVRA 3BIXA 4XJVA 3FSGD 4RPCA 4BBZA 3JWEA 3WIOA 3FAKA 1J2EA 2HM7A 2JGIA 4KYVA 4HTAA 4U2EA 1YAJA 2RI6A 4IH4A 1CUCA 4G4IA 4PW0A 2XUFA 1XKTA 2ZYSA 1BCRA 4JUIA 3F98A 4H35A 4O08A 5BWBA 3FCYA 3GFFA 5AI8A 3HZOA 3G0DA 3FWHA 1GZ7A 3MUNA 3VDXA 3R3XA 2JGFA 2XMRA 1QIHA 1WB4A 4KEAA 1K5PA 4X90A 3R3UA 1XRPA 2OAGA 1CUJA 1EDDA 5EHQA 1XZMA 1UK6A 1QIFA 3QM1A 2C0QA 2EDAA 1CUDA 5AM4A 4B80A 5FP0A 2O2GA 4B81A 2XUDA 2FUKA 4C87A 4MYDA 2WIJA 3LLCA 4X6UA 2ZJFA 4A5SA 3WL6A 1N8SA 2PX6A 3LP5A 2QOEA 2O7VA 3ESCA 2PUJA 5JD6A 4UHCA 5EHXA 3WWPA 5H3HA 5DYTA 1AZWA 1MU0A 5JAHA 3W06A 4N5HX 1XZCA 5CH5A 2WIGA 5AOCA 2VAVA 3T4UA 1CRLA 3RK4A 2JGMA 1BN6A 2XUKA 4J0IA 4DNQA 4F21A 4UHBA 4W1PA 2VJDA 5EIHA 3WKDA 1SCIA 1YSCA 5HK8A 1WPXA 3O9MA 4WFIA 2Y6VA 1YB7A 4UBLA 5T4HA 2DQYA 4DTCA 4BVJA 2QMQA 2AJDA 5LZ5A 4IO0A 5A6VA 1VE6A 2Y6UA 1YS1X 3NWOA 1W52X 5EHZA 4J0DA 3H2HA 3C6YA 4J0HA 1G42A 3R3WA 1YA8A 5ALTA 3AZOA 5D3ZA 4BCDA 5K3EA 5CTAA 3R41A 2QKYA 2UZ0A 1LLFA 1LGYA 4UUQA 3DKRA 3FYUC 5ALWA 1Q0ZA 5AI5A 3HC7A 3VJMA 2XUAA 1BE0A 2XT0A 4JH0A 1UOQA 2VQ6A 1J07A 5CT4A 1XQWA 1XZLA 2P8SA 4ZRDA 4J0KA 5ALDA 4X91A 2PM8A 3I6MA 4B9AA 3ESDA 5K5EA 1EVQA 3I2FA 5DYYA 1C4XA 1VOTA 3F9CA 4BRSA 1THTA 3LCRA 1CUZA 3HLKA 4HAIA 3BE8A 1QTRA 5AKZA 5AO9A 1QOZA 1E8DA 5BWCA 3AZPA 4JYPA 2XMDA 2PPLA 4GECA 1WHSA 4H7HA 2AJLI 3FVTA 3G8YA 3H1AA 2WHPA 3U1TA 5IH7A 5IVHA 5EFZA 4BP9A 5HKBA 3O4IA 3O9VA 3ANSA 5JASA 1ZOIA 3BWXA 3F67A 3QMVA 4X6XA 1LPMA 2WUDA 3D7RA 5AI9A 3HYSA 4UHDA 4TGLA 5ALMA 3QH4A 4WFJA 2Z3WA 3A2LA 4UBKA 3IUMA 3B5EA 1CUYA 4CG1A 1RP1A 1TCCA 2PSFA 4C6HA 2X76A 4RNCA 1QLWA 5LZ2A 4Y9SA 3E3AA 5K3FB 5JZ9A 2ACEA 3RARA 2XQJA 4BCBA 1IVYA 3GA7A 4W1QA 3ZV7A 2BGNA 1FFBA 4OCZA 1CUEA 1XROA 2C4HA 3LIPA 4GXNA 4N8DA 4UFPA 3DKKA 2I3DA 1QO9A 4DMKA 2WTNA 3OG9A 2R8BA 4WY8A 3X3HA 1G4HA 2WIDA 1XLVA 4WDRA 1WB6A 1SFRA 3BXPA 1HBJA 3KOOA 5I7UA 2HA7A 2XUPA 4FNMA 1A8SA 1A88A 5AICA 1UT6A 4EHBA 1QJ4A 4D9JA 4DSZA 5DTIA 5EGNA 2PSEA 3UMJA 4G8CA 1DX4A 1CR6A 1QIMA 2C5FA 1KU6A 5AKKA 3WWEA 2OQVA 4NMWA 2VJBA 2HA0A 2YXPX 5FKJA 1TCAA 4KAFA 4XVCA 5ISMA 2XDWA 2NW6A 5ALQA 3WWOA 3HI4A 5ALHA 4JYMA 1AUOA 3RM3A 1ZI9A 3C8DA 4QLAA 3ZLTA 1JKMA 3PFBA 4G9EA 3DL7A 5YASA 1E8MA 1JU4A 4YX9A 5ALSA 3AJAA 3DEAA 1I6WA 4DM7A 2QUAA 5AKLA 5LIPA 1XZBA 5AJHA 1N5MA 1UKAA 4Y2JA 3H1BA 2V9ZA 3WYDA 4TVKA 4AZ0A 4MQMA 1AQLA 3C5WP 5CT6A 1XQYA 2CUTA 2XLBA 3C5VA 4RE5A 5A7FA 5JATA 4K2AA 1CUHA 2GBCA 3PDCA 4NS4A 2GBFA 4GWLA 1S8OA 5KWIA 4FLMA 1U65A 1TQHA 3IUNA 2ZJ6A 4DSAA 5FOQA 1EK1A 5CXXA 1ZGBA 2ZYHA 1M33A 1LPNA 4EY4A 1E8NA 1XZKA 3FLAA 1QONA 5LZ4A 3G0GA 3AFIA 3AIKA 4H77A 4Q3OA 2IITA 1R9NA 4WDQA 1CUSA 4AMZA 3QPDA 4N8EA 1XZDA 4H7DA 4PSDA 4F60A 3FCXA 2B9VA 1T4MA 4OB6A 3SWWA 1BEEA 4OD0A 1DWOA 4JEIA 2G5PA 5FDFA 2QS9A 3ICVA 5HF9A 5LP1A 4ROTA 1ZD5A 3CN7A 4UFNA 2WHPB 4KACA 4QLOA 4EBBA 2XUQA 1ZI8A 2BGRA 2WG1A 3G9UA 4E14A 3T52A 3V9AA 2XMSA 3N0TA 2WJ4A 3BJMA 3I2JA 5KBYA 5HQ3B 5LZ7A 1L7RA 2HA6A 5DNVA 1YB6A 3TGLA 5FRDA 5ALOA 3KD2A 3WK6A 4EY6A 3I2GA 5HK9A 1UKCA 3WK8A 5AI4A 3BDVA 4X3CA 3G9XA 1XRLA 2XUHA 5AOAA 4I19A 2YASA 4J0GA 4UHEA 4J0CA 3KSRA 4JNCA 1ZGCA 2EEPA 4EA6A 2YH2A 5E4TA 2WUEA 1C7JA 2ES4A 4AXBA 5ALEA 5FUMA 1ZICA 2OG1A 1XQVA 1QFMA 3EQ8A 5FPPA 5C8VA 3CXUA 5ALKA 3D2BA 1YAHA 3IVMA 2V98A 4LXIA 4BAUA 2WLSA 4B0OA 4B7ZA 4BP8A 4AZ3A 3V1KA 2J3DA 1LPSA 2OGSA 4PQEA 4J0JA 1DINA 1XLUA 1X2BA 4Y2PA 3WJ1A 1EB9A 3BF7A 4DMCA 1ZD2P 4Y7DA 1UK8A 3K6KA 3H0CA 1XLWA 4H7IA 2WUGA 2PVSA 4N8SA 3D4LA 1QIJA 1SCKA 1DWQA 2Z8ZA 4B9EA 4OSEA 4W63A 1MO2A 4P08A 3K2IA 2BUBA 4CFSA 1O6GA 2J4FA 2OPHA 4K5QA 1TAHA 4BATA 5CRIA 4CCYA 1X2EA 1N5RA 4FFVA 2AJCA 4MYSA 1CUFA 1AKNA 5HF8A 3VKFA 5AI6A 1MJ5A 4BC0A 1HPLA 1H2ZA 1XRQA 5LKRA 3I6YA 4M0MA 4BTVA 5EI5A 3S8YA 4UPDA 2D0DA 4C88A 3WLAA 1YASA 1XZJA 4I3FA 4C4XA 1VZ3A 1XQXA 2HFKA 5JZSA 4MWTA 3I6ZA 4MEBA 3W05A 2R11A 5E4YA 2H7YA 4K6KA 4GEGA 1F0PA 1UKBA 1TKRA 1CQZA 1Y7IA 4CG2A 4Y2YA 3WZMA 2DR0A 3E4DA 3GBSA 3G9ZA 2HU8A 5JAPA 1Y7HA 1ZIYA 3W04A 2VEOA 1CUBA 1G5FA 3IIIA 4FNGA 2GBIA 3AINA 3S2ZA 4PF1A 3H2KA 4KR0A 5AM0A 2VJAA 4G9GA 4QNNA 2CZQA 1J06A 2GYUA 2HFJA 1JJIA 2LIPA 3P2MA 4P93A 4Y2QA 1EDEA 3WL8A 2OLEA 3HSSA 3DOIA 1P0PA 1LNSA 3CN9A 3VVLA 1MPXA 3IUJA 2VSQA 2AJ8A 1CLEA 5HKAA 4G8BA 1DQYA 2WSLA 4J03A 5K3BA 3C6XA 4Q82A 4Y2SA 3M81A 1RYYA 1P0IA 1AMNA 1MAHA 1VKHA 2DHDA 2K2QB 4BE4A 4XWGA 3H2GA 5EIAA 4G8DA 2WHRA 2G4LA 2WTMA 3WZLA 3VVMA 5IVKA 2GBGA 5AI0A 1JI3A 3R0VA 2ECFA 3PE6A 4WJLA 1ZD4A 4J3JA 4Y2TA 1FFDA 3AIMA 1HL7A 2PL5A 4U2GA 5LZ9A 4X7BA 1XKLA 4BDSA 1K4YA 4LXHA 5ALIA 4BVKA 4N5IX 3VXKA 4AO7A 4L3WA 3WA7A 2Y2VA 4ZREA 1QIDA 1IUNA 1ODSA 4H7JA 2DCMA 3PUHA 1JMYA 2RHTA 4KRXA 2VT6A 5KREA 4MEAA 3QZUA 2CEKA 5CBKA 5HZGA 4AMYA 4B6GA 1VA4A 2RAUA 4H7FA 1YCDA 5AKEA 1JJFA 2I03A 3IUQA 1VLQA 1CUXA 5C8XA 2JGEA 4TPKA 4S0XA 3DL4A 3F96A 1YS2X 4B82A 1XZIA 4DYHA 2CBGA 1ZJ5A 2WG0A 3DD5A 4HXFB 3WIBA 1LBSA 2GYVA 4EB0A 1VXRA 1MX9A 2WJ3A 2C0PA 1K6EA 4GW3A 3OPMA 2JEZA 2C5GA 4YK7A 3WL7A 3NOXA 1EVEA 2Y2UA 1IMJA 1IUOA 3OOSA 2WM2A 5CT5A 1QIIA 4U2CA 1EINA 1UK9A 4ARAA 1MNAA 4AO6A 3L1IA 3CCBA 1WOMA 4X94A 3ANTA 4QDUA 5FXMA 3ZI7A 5AM1A 1UK7A 3STWA 5JAOA 5AK4A 5ESRA 4FMPA 4GHWA 4QA9A 5AHXA 3HXKA 1WHTA 3M3DA 2XMQA 3O0DA 4QEKA 4FLFA 5IKXA 2AXEA 3I2KA 3ILSA 3R40A 2HU5A 3C70A 3O4JA 1XRMA 4C4YA 2X8BA 1EA5A 3DNMA 4EY5A 2ORYA 3E0XA 5D6OA 3OM8A 5CURA 3WKBA 3D59A
chains in the Genus database with same CATH superfamily
4TLLB 4DIBA 2X3FA 4QUEA 4YUVA 3QPAA 2CGEA 1NP6A 3ICQB 1BXRB 4H4EA 2MYUA 2XZTA 5DI3A 5IH3A 1T9CA 3CNLA 3JQAB 5AJXA 1I2AA 5E6RB 2C03A 3V4FA 4P9NA 1PUIA 3LUBA 2ODPA 3V2HA 3NAMA 2W98A 1IC6A 5LYYA 5KYVA 3RJTA 4QOHA 5GV8A 1YRAA 1Z83A 1PR1A 3NANA 1EJ0A 1HM5A 3TQQA 2VLIA 3HKDA 3WLJA 3D3WB 3K0CA 3ENZA 3ADCA 4MVJF 4B3XA 3EQZA 1Y9DA 2QTVB 3CZ4A 2RK3A 2B1QA 4QJ4A 1PO7A 1V9CA 1FLAA 4RGYA 1TVKA 3GRCA 1Y3BE 2BMWA 4I1OA 4IOLA 4JLNA 5C8YB 4XWTA 4NBRA 1DS6A 3DZFA 2WNSA 1T13A 2BMVA 1AXRA 3P4XA 4R1LA 1YTLA 4XWWA 2AXQA 3TTYA 3LIIA 4BQEA 2OUKA 3OO1A 5KNCA 4JLSA 3RJ9A 3LV8A 4FGJA 1GLNA 2MMCA 2ROQA 2NO5A 2D1FA 2L0XA 1VJ5A 1SXJC 4UBIA 3AESB 3OX3A 5LBTA 3U4IA 5CJJA 4MR7A 3UO8B 4XEHA 1PNTA 3OTOB 1AURA 2EBWA 1QU2A 1XFDA 3I6IA 4MQFB 4Q3LA 4PX5A 1RWMA 4TSFA 3NJ8A 4XFJA 1K66A 3PE4A 1IH8A 2X2EA 3BZUA 1JA1A 1TVCA 3JWGA 3OKPA 2EFJA 2IXAA 4ZHSA 4E3WA 1SXPA 1PX2A 2GXQA 5GM1A 1O57A 5EIBD 3WRXC 4D3DA 4QM6A 2LD4A 1XVLA 3W5AA 1GU0A 4Z0TA 1KK0A 1OAAA 2BFBA 2D2EA 1IZYA 1K27A 2HWWA 1JDUA 4L4UA 3THOA 4URVR 2I2CA 5ALUA 4OQPA 2FH5B 5FV4A 2BE9A 2ZBDA 4AIIA 3EDRA 3OZCA 3KEOA 4IIVA 4U3JA 4ENSA 5BUCA 3RIMA 2O4UX 4JIGA 4RFSA 3UB3A 1MEJA 1S2IA 2FLVA 1YRQA 1NIPA 1FXWF 2IDJA 2IX9A 4IDOA 5ALXA 4ZU3A 3WGYA 1QH8A 3F2VA 4OA5A 2WT8A 3PPIA 3KDAA 3WHLA 3E7XA 4I55F 5AVKA 3E58A 3TLKA 4BVLA 1GUYA 5HMLA 3C6ZA 2AN9A 4NYJQ 4N0MA 3SCZA 2RCNA 2C99A 3ICWA 5IEBA 2ZIVB 4XQEA 4ANFA 9MHTA 1KI9A 2GZ3A 1HE3A 1RAIA 4XW2A 1X77A 2KMLA 1QCDA 1BXGA 2OCBA 1QE3A 3ROKA 3D3KA 3IURA 4RE6A 2J9FA 3AQIA 2H4FA 4JBGA 4D1YA 1G9XA 1O87A 3Q8MA 2HRQA 3P2JA 1XJ5A 2XWPA 3H4MA 4FNOA 3T38A 1XCMA 1SXGA 2BR4A 3TEFA 2XCIA 4PYJA 2B1IA 3EQ9A 1XMJA 4CM4A 5KYWB 5JU6A 1JN0A 4FUTA 1JMKC 4KP7A 4EPVA 1OFHA 1NURA 2JIZD 2X8LA 3VR5D 3HBNA 3DYIA 4PSKA 3VNQA 5BURA 3BORA 4JV5B 1RRPA 2HWKA 3C3XA 1VLVA 3HKDB 1SUAA 3HO1A 5KWVA 1DHTA 1PJLA 4OEHA 3A3NA 5D00A 1T2EA 1EI9A 3SIWA 4F85A 2WWIA 3DTVA 2G6BA 4RZQA 1XXHE 2KBFA 4DV6B 4FYXA 3B1FA 3L0SA 4MCIA 4N3BA 2KBEA 2HHJA 3IOMA 3QYFA 3KXPA 1E2JA 1YZFA 4MGYR 5F2NA 1MX1A 5EN4A 4QRDA 2DUNA 4B87A 1WXXA 4YAGA 4MQLA 5EXXA 5I7AA 4B6JA 4HWRA 2BKAA 2YZ2A 2HQBA 5AK0A 3RSGA 3P26A 2AG0A 5K3AA 3S99A 4BRWA 5DW0A 5LKAA 1ULBA 2ZM5A 2ZUFA 1E9AA 3I01M 3JQ8B 3SHVA 4Z9AA 1BHQ1 2IOHA 2YIDA 4GKJB 3U4HA 1QANA 5C5EA 4X65B 2BIFA 3RF6A 5K51A 5JT1A 1P4AA 4QD3A 4EB3A 1GA1A 2AD5A 4IZIA 1C7IA 5JADA 1T2DA 1G6KA 1E2IA 2OSVA 4N8EA 1GQFA 1V1RA 1NVFA 5I7HA 5JFOA 4DMUB 3P19A 4PY2A 1Y63A 1YRBA 3UF0A 3PUZA 3VU1A 1KF0A 4QVIA 1X13A 1EA7A 3M5PA 4HUQB 2GK3A 4MRMA 3VOBA 2OXEA 2ASEA 1CUVA 5CBPB 5JOQA 2Z1MA 4HK4A 1NV8A 3QE4A 1D5WA 5JANA 2JFNA 4BX2A 1SHKA 3MINB 4ADSG 4EJSC 4ZJUA 3NXKA 2A5YB 1L4LA 5FQNA 4ZJPA 3NNDA 4OH7A 1GRQA 4A2PA 1X9HA 2IPMA 3MBKA 4GAEA 2GF0A 4HQRA 4OM7A 1T2NA 2QUBA 3QFTA 2B7CA 4GF5A 4PBTA 3INRA 5JVDB 3SR0A 4F5ZA 1F9EA 3GP3A 2OXTA 1CF9A 1EWYA 2QENA 2VHYA 1W85B 4DLWA 3AILA 2BHNA 1TZKA 3FBWA 4JBWA 4WL0A 4CHTA 5KKNB 2VS1A 2IS4A 2YS7A 1T4DA 4Z2YA 2J87A 1OFVA 2CVHA 2VUUA 1TM7E 3T41A 1D4FA 3A6LA 3UAVA 4C6TB 2BBOA 2C7GA 4B4VA 1HFWA 2K2WA 1NF8A 3Q0TA 1PJZA 1JKIA 1G21B 2AH5A 3MWKA 3ANNA 4MPRA 5EIEA 4K6FA 4HVTA 1I30A 1O4VA 2VQ3A 1XEFA 2A4KA 3CVJA 2F90A 4ZOBA 4JZYA 5KYXA 1KQ3A 5DDIP 2NZ8A 2OTCA 3RIXA 1D6MA 3H5RA 3GT3A 5JAZA 4K9LA 3STTA 2YVUA 5P8WA 3WLIA 1JVBA 1UJ4A 4EKNB 5C46F 3HCEA 1TQ2A 1CDDA 1KO8A 3B7WA 1GUDA 2XQFA 1X3SA 3AV0B 1DX6A 1EAYA 2HBQA 3TE7A 1QV6A 2Y0DA 3AZQA 3EARA 2HDWA 3NOOA 4X61A 3Q12A 3RKSA 4COKA 4EQZA 1UBSB 5IMBA 5JNUA 2X3YA 1ZLXA 2YVAA 2XZDA 2POQX 3GG2A 3H0EA 3U7RA 4YCLA 3PUJA 3EWNA 3PC3A 1JT2A 1R0ZA 3NHBA 4CZ2A 1KZYC 4PLYA 5DWDA 2P3OA 3D5EA 4B4KA 1P4HA 1JFRA 1K8XB 5CITA 4RADA 4BKUA 4LDZA 1NV9A 5HJ5A 1A8IA 1J2UA 1DEHA 4C2TA 1SVOA 3FIJA 1J9GA 1ULSA 1QAQA 1TIPA 2J7PD 1UANA 2JFYA 3GZTB 5FLEX 1TRHA 2PWAA 2Z5LA 1N5OX 4KFRA 2XB6A 1ZCBA 4ZV7A 4GI3A 2WFLB 4TV8F 3GARA 3DONA 1OHHD 1V1JA 5K3CA 3EHEA 5JI2E 1KZGB 1MVOA 3ZBPA 3GGDA 1F14A 1O2DA 4QOGA 2RSLA 3S5UA 3VAYA 1V2GA 4WBNF 1DKPA 1P61B 3U3DA 1T29A 3E1GA 1MG0A 4DT1B 3CLRC 1S1CA 3SQOA 5JD5A 2PTGA 5JXGA 2EIXA 2VDMB 2XWJI 3MOSA 5IT0A 4LNHA 1JWBB 4KR6A 4MQBA 4D4IA 3ICOA 4FHZA 1P72A 5FUWA 2JGKA 1E66A 5DCYA 4CIAA 4X1OA 2GN0A 4ZA2A 4QL3A 3K6RA 4W8GA 4YJGB 4XKJA 1RFGE 4ID3A 3M0EA 2OYRA 1ZNYA 1II8B 2XB4A 5EAIA 5JBNA 5A02A 4B3RB 1SQ5A 4FMCB 4IGAA 5HQ3A 1P2SA 4RHCA 3EIXA 4L7VA 1DV1A 5CVDA 1ZUNA 5ALZA 2Q2OA 3A6JA 4FGKA 2PL3A 1VMAA 2D3TA 2JEOA 3P9YA 3CINA 5JD3A 2SKEA 3V1YA 2V6IA 2SBTA 4JVMA 1YZQA 3U3OA 3LW7A 3L8HA 3T5MA 2HHHB 3SS7X 2E4VA 3QX9A 4QFCA 3LL7A 4WLNA 2FX3A 5JQGA 4KI7A 3CUKA 1YVEI 4DDTA 4LFBB 2UYYA 4CJXA 5JIBA 1Z4LA 4RKRA 3JX9A 2IOFA 3ETHA 4M89A 1UQRA 3IAS1 2A9VA 4NV1A 4WOCA 3GFVA 4N6GA 1K5HA 3GPBA 4EX6A 3DV9A 2CVOA 1DTSA 1O5TA 4MVWA 3UQYS 1FFEA 1ZJYA 3RANA 4CU2A 1VL8A 5IP5A 5JAQA 3STVA 4DGQA 1LD3A 4ZYTA 1G8GA 1U0LA 4FYMA 3C3MA 3DLBA 3C48A 2XWSA 2C7VA 1YRHA 5ALLA 2QL7A 3PFWO 1TEZA 4KRFA 3FOZA 1V9SA 2H5LA 1VL2A 1E5QA 4IUCS 4Q00A 1QF6A 2PKWA 1N5JA 1L5NA 821PA 3ND6A 1S7CA 1SQGA 3MTJA 3UIEA 3TTVA 1E4YA 5AOBA 3K4HA 4KLRA 3PJFA 5DT2A 4G9BA 3E9DA 2CUZA 3T5DA 4EHLA 4D0NA 4D45A 5IABA 2FHPA 5B4VA 3LGXA 1ZBDA 2DQZA 2HA4A 4MUMA 4QXAA 2NUTA 2JLQA 1Z5PA 4IOJA 4QSMA 2PGIA 5KTOA 3Q5GA 5I9LA 2ODAA 5ALJA 1UBEA 4G36A 3ZTTA 3VHRA 3F1KA 4QAQA 3W1VA 3EF1A 1F8YA 3KQVA 4KQWA 4IAOA 4HD8A 3V32A 2ZIWB 3WIDA 3RVOA 4AJ2A 2BCEA 3HA3A 1L5HA 3VNAA 2YIJA 4HFJA 4I5IA 3QWHA 4GBGA 3SXPA 1UJ5A 1Y34E 5FNVB 4DBZA 1V8ZA 2BFBB 2VFAA 1SC6A 3QFHA 5F23A 4WW0A 3DOUA 3A4IA 4C0QC 4ZZ3A 3ZCRA 1CETA 1EFUA 4LA4A 3MSXA 3OLXA 2JHPA 2ZI4A 4CTKA 4DSUA 1Y98A 3PGJA 1JVNA 3CUYA 4HDNB 4JMLA 4DVJA 3COJA 2O1SA 4CEHB 3ZV3A 2LPMA 4JXJA 1HFJA 4V0NA 3U0BA 1K0UA 3F49S 5FI3A 1Y3CE 3WKAA 4BMOB 3LC0A 3A2MA 3KR0A 3SSAA 1LV7A 1WZ2A 1JA0A 5JWRA 1RZRD 2ZS8A 3BXFA 1COWA 3WMFA 5ENDA 4MDFA 3ZW9A 4PC6A 1W29A 4YV1A 2FPSA 4JITA 1KU0A 2J46A 4HTFA 3G1UA 2ZIXB 4LE2A 2QJWA 2WLTA 3OIVA 4IVRA 2JC3A 1UFRA 4O25A 4OGFA 4YROA 2Y0PA 2C54A 1U2GA 2YXDA 3GBPA 4KXUA 4Q7JB 4WLUA 4A15A 4AAYA 1EE9A 1Q1GA 2QXTA 1U0RA 4IOKA 2GJSA 1CJMA 2X5XA 2I29A 3EXG2 1HURA 4CT0A 1EX9A 3A1DA 4TTAA 5HBGA 4KFSA 2JJQA 4XDHA 1UFOA 2DHQA 1HEIA 3S3TA 5BWLA 4QPPA 1UDXA 4GBJA 3MVEA 4CCYB 1WSDA 3ZOZA 2VUTA 1N1MA 1B6GA 4H0NA 5G3ZA 3VPFA 4GKKB 4GKVA 1R9JA 5EIXA 4IIJB 4ITVA 2GETA 3QYJA 1NI3A 1OCEA 5FJJA 3T1NA 2GA8A 2NYRA 1SUIA 3LLSA 1C14A 4I4CA 4Z99A 4BRZA 1EK0A 5JO0A 3UUEA 5C8ZA 3HXMA 2ATXA 3EXIB 4LRXA 1HDRA 1JI0A 3BQ9A 3L92A 1SHJA 4MZDA 2X8JA 4I50A 5BMOA 1L4HA 1OFUX 2ZR7A 4R2HA 1O97D 5MF6A 3PF8A 4DIMA 1SNYA 3SJ7A 4JA0A 4Q05A 2P4EA 3ABSB 1ZD1A 1GZ3A 1KPIA 1LBEA 2YOHA 4LF6B 2L82A 2Z83A 4K9RA 4L6AA 4NESA 5CIQA 2FZKA 2JJ1A 1TC2A 2JLRA 4ZXPA 4B83A 1BFDA 1AX9A 1H8HD 2W58A 2YYSA 3E48A 3MUOA 2H9YA 1GGHA 2H7XA 1DQZA 2XW6A 3HCPA 1DG1G 1GGNA 2GBLC 4TKLA 4H3KB 1BCSB 4L0CA 4FHDA 5H3LA 3LHFA 4IJ6A 1N2OA 2CCGA 1AU9A 2VXBA 2MSDB 4HEA6 1KDTA 5HP4A 5EJEA 1IONA 1G6Q1 5FNVA 4MPDA 4K9MA 4PLGA 3GLHB 2R7KA 1HFKA 3OFSA 4R05A 5B1HA 2QG4A 3BOSA 1Z0FA 3AUXA 4P54A 3L0PA 3JQ9A 1UAYA 1VSVA 1A8PA 3ASZA 3AU9A 3MSCA 4NYMR 1N9ZA 4KHZA 4XR4A 1CY0A 2IGTA 2OL4A 5H3CA 1TZMA 4BNIA 2CXUA 1OOEA 1MTZA 3GCZA 4R0NA 1KO7A 1UKZA 5KC8A 3HB9A 4Q4JB 1T34A 1L7QA 1Z7BA 4OI0A 3V46A 4NSNA 1JQLB 3B5IA 3L7IA 1JXQA 4GO1A 5K0JA 4XVUA 1UBOS 1LK5A 2ZU6A 3CZPA 1ONSA 2UUPA 3L49A 1IHUA 1WEHA 4UDYX 2A88A 3DVAB 3DV2A 4NJEA 3ZS8A 3H2IA 4ZT2A 4HTFB 4MW7A 5K0TA 4KYTA 2WT9A 1ND6A 1SEVA 3BE6A 3I73A 1M2OA 1OTYA 3RAGA 3ZY2A 2Z4TA 5EZYF 2QYHA 4FEYA 1W1IA 4NZYA 1QHIA 1CQXA 4OXYA 4YMVA 1GYPA 3FIUA 5TVGA 4DARA 1NXVA 1AUVA 2AKAB 2AKYA 4HKTA 2O3QA 1W6RA 4EENA 1C80A 1G4AE 1KERA 4G5RA 3V1NA 5KYXB 4FNAA 1KGSA 1Q0RA 1PI3A 3HYNA 4YLEA 1S6YA 3OAAD 3R7BA 4GKAA 4NENB 1BS2A 3DBOB 1B23P 3RYFB 1QHFA 4D79A 5AVVA 1P6QA 3Q10A 4UTPA 3M6AA 4Q3AA 3L8FA 3EG9A 4FQ7A 1T25A 1YV9A 1E9CA 2WWHA 3HN2A 2IUTA 1QK3A 4GRIA 4L4XA 2H57A 4L6CA 4GMGA 4PX3A 2CMDA 3RUFA 4C0HA 4DA8A 5LQMA 3BCRA 5FUBA 1KDRA 4A91A 2XTNA 4HYQA 2QA5A 2DKOA 4AJHA 2DWUA 4QOSA 2XUIA 4HRYA 2PGDA 2I71A 5TQ2B 3V4VB 2AX3A 2PR7A 3T1QA 5IN4A 3EJWA 1TYZA 2VG8A 1ZWKA 3ESRA 1U1IA 3ZU6A 1Z2OX 3TEJA 4OM8A 3IOYA 1Z8HA 4M8LA 4R2XA 3S2YA 2WMNB 5ADUS 1T3HA 2VAWA 1QAMA 3AHCA 2GZMA 4WLFA 2GD6A 2QGZA 3L8YA 1NF3A 2BHSA 2GZHA 1Y4ZA 2KLBA 1NSTA 3OEHD 4FYIA 5FEMA 3HCWA 1QP7A 2FSHA 3DUFA 4OMFG 4HFMA 4PGHA 1IK4A 3DM5A 2QUIA 3TX2A 1H2YA 2GHQA 4BV3A 2Z5GA 5HJEA 2E4AA 5HG0A 3PLAE 1UWCA 1UOOA 3UTCA 2ZSUA 3E7WA 3K71B 4DYDA 2GF9A 1NSFA 4BAZA 1BTOA 1U94A 2F8TA 2ODQA 4DJTA 3QVGA 2IU6A 4G0XA 2I6TA 4QDZA 3MWEB 3SHWA 1XAJA 4MVJP 2Z2JA 1A9PA 1ZHOA 5L4LA 4R2MA 4FFMA 5LOVB 4OOEA 5HF5A 1AK1A 4LGCA 1R0CA 1Z25A 3E3LA 3FKSA 3TIFA 2IHNA 1UZUA 4AJOA 4CR8A 3NOQA 1LQ2A 3FTQA 1R88A 2Q5LA 4MK4A 4OU5A 4AI6A 3NHYA 4D4HA 2VWGA 3KQPA 4RVOA 2PA3A 4C7MA 2XECA 1DP4A 2YV2A 4E11A 4JKYA 4H4CA 5BR8B 3ANMA 4BL5A 4YV7A 4XIIA 5J2TB 3W8RA 2V7QA 4PPFA 2UZIR 4LF7B 1SU7A 2DEUA 4PAQA 5EPUA 2VPWA 1P18A 3QNUA 4KAXA 2GK7A 2RGCA 2EZTA 5B7QA 1M66A 4RTRA 3AEUA 1NAHA 1GZHB 2O2EA 4QECA 4XYLA 2ZB3A 3S8EA 1V6AA 1ENYA 3SF8A 1ORTA 4MR7B 4OHVA 2Q1XA 1EGHA 4ZGGA 3FD8A 3ICEA 1YKFA 5T4BA 3EGIA 1QVWA 5EE3A 1W8IA 5JV5A 2A6PA 1MH9A 2FEXA 4KWHA 1DAMA 5B6IA 4V0RA 4OJNA 5ALPA 4G89A 2VT7A 4ZZIA 5DFAA 3O8QA 4FOTA 5BN3A 5BWOA 2GAOA 2EATA 3DMGA 1SU6A 2P91A 3JS5A 3KVOA 3ENVA 4J7AA 1TIKA 1YIDA 3INNA 1T5BA 2HMSA 4N5NA 4A16A 1RWBA 2RHRA 3I92A 2GTHA 1Z56C 2ZCUA 3KTOA 3CH6A 1R0KA 2IYZA 2H1CA 3BB4A 1QGDA 3HUDA 3K6JA 4YJ2F 3WWCA 4D9MA 5BMVA 3DC2A 3I30X 4IQ4A 1NRIA 3KUKA 4INZA 3FLBA 2Z30A 1QH8B 4N7MA 1Y80A 4UBNA 4HDQB 1IVSA 1E7YA 2Q0SA 2I2FA 1NLZA 1V8FA 3EIHA 1IQ0A 1DAIA 3EEQA 1X1SA 2DT5A 3I76A 3JTEA 4LV5B 1KPHA 4P5EA 4X1YA 5BOVA 3S2EA 5A9SB 5ITVA 5TGDA 5A3RA 4RSGA 1J25A 1W88B 1Z4NA 1SHTX 2XF2A 1L4EA 4IZHA 3NBKA 4E31A 3JW8A 4O5OA 4Q37A 3PCRB 1MA0A 4NE2A 1PAUA 3RB8A 5GJCA 1GG8A 2R8RA 1O97C 4BUJA 5JYCA 3H9EO 4FSHA 3ETJA 3BYZA 1ZJ4A 4Q1DA 5HZHA 1U3TA 2VRCA 3BBLA 1OZHA 4EYOA 4R1UA 5JJKA 1JZTA 3DFMA 3VSCA 4CWAA 2JFXA 4ARUA 2JJ2A 3GOHA 3EIQA 4D9EA 4RTKA 3GVIA 4DUGA 2G0NA 3KALA 2W22A 3SXJA 5K3OA 2E18A 3DJYA 2WF5A 2NTNA 3KZXA 4ID9A 1GTSA 1C9DB 1E5VA 1XNQB 3DJFA 4Q7QA 1GUZA 4DAOA 3FWPA 4OSPA 5JALA 2JLXA 1UBFA 3HBLA 3OTQA 3QLVA 4YB8A 2BR5A 2JAHA 3CO0S 2BEUA 3U4QA 1OXUA 2IP2A 4KB5A 1WF3A 1KI6A 4YJ3B 2V8BA 2C4UA 2ZKIA 1E1CA 3M83A 3O91A 3WHPA 1YOVA 3T9EA 1B8VA 5CA1A 1R7RA 2CWWA 2VYFA 3OLQA 4KL8S 5ECDA 3AJ9A 3N74A 3UJHA 4BFUA 2EWMA 5ITZB 5L4NA 4F6CA 2W9XA 4OJTA 2JIOA 1RM3A 3ACDA 3KWFA 4IYJA 3NHRA 4P53A 4LQ4A 3FLEA 2VKTA 3GI1A 4RKWA 1H1DA 5CFOA 1QGED 3C8ZA 3GN2A 1RWXA 5AKYA 4IG4A 1V5FA 4JQZA 1EVYA 4UXJA 4MW0A 5IVIA 4IDBA 5BN4B 3CLTD 5A3JA 2D6FA 4MUNA 3KM0A 1BGVA 1R6BX 1GWNA 2J8ZA 4RVHA 1Y1KE 1CZHA 4UQPA 3D6MA 4BNVA 1SVKA 1G8YA 2YFYA 3D7NA 5NLLA 3ZYCA 3GP5A 1U2TA 4Y1EA 4PXYA 1GN8A 1E0KA 2HV8A 4LZPA 5AW2A 5BXYA 2P90A 1WOYA 1ESMA 2HEIA 4UTZA 4N0QA 4TUYF 1E2DA 4QYIB 1BH2A 4BLQA 2WYVA 3C8HA 4JC5A 3PCTA 4YLYA 1MH1A 1ZIOA 2I66A 1ZY2A 2DFDA 3KPWA 5IBCA 2XEDA 2PMFA 5JZBA 2J5BA 3TQFA 2O2DA 4H0FA 4HDMB 4PLZA 4RPHA 4XUGB 3TTSA 1G98A 3ZZUA 4AJJA 1XELA 1YVPA 2A14A 3L43A 2ECKA 4W9RA 4DKXA 3UT0A 3DC7A 4X64B 2PSHA 3I2IA 3OEEA 3WB9A 3ZVKA 4XRRA 1KSGA 4LVUA 4J6EA 3A2NA 1JR3D 1PW5A 2YZGA 4KWTA 5TRTA 4B2YA 2BYTA 1NM5C 4FXOA 4PRKA 3LMKA 4DMMA 1GPJA 1RKUA 1PWEA 4MS1B 3HDYA 1M3SA 3JATB 2PXHA 4S1OA 5HNKA 2J7KA 1T0PA 3CPEA 2G72A 1NVUQ 2QJRA 1UADA 3A25A 5DHQA 5BQOA 3LCUA 4BWVA 4KPFC 2O2YA 1SXJB 5C3MA 3DAYA 4JKOA 3WMXA 5AJWA 3I6BA 1O6FA 3C6QA 4NATA 4N5DA 1PFUA 2C3MA 1F4PA 2ALJA 3O95A 4H18A 2H4XA 1YBMA 3EXEA 3ILVA 4C7BA 2X9VA 3BMNA 3BSYA 3U31A 3PI6A 5ERYA 1R74A 4K8OA 1QLJA 4TL7A 4YIHA 4YT2A 3P27A 9LDBA 4M4SA 4BGVA 2IYOA 3Q7IA 4CHGA 5ERXA 5CPFA 1X7XA 3IOCA 4Y6GB 3ZVMA 3MTDA 4OQMA 3UPTA 1WUYA 3A9WA 3GMDA 3H04A 3NBYC 4OLJA 3SQNA 3BAZA 1IZ8A 3L5OA 5LJLA 1A72A 1XUOA 1QS0B 2D5BA 1M2NA 1GGVA 2XUGA 4QFDA 4ATNA 3CZ5A 4EG0A 5K4GA 1CBUA 1YZYA 3PITA 3KHTA 5A3SA 2OOKA 4CMIA 5A2GA 1FSPA 1GG5A 5F73A 4DCCA 4X92A 3U2QA 3WXBA 2ZTVA 1OV4A 1D7OA 3K9QO 3A9UA 2AFIB 4CEJB 1UMBA 1JB9A 1G1AA 2Q2NA 2OCGA 2WWRA 4HF7A 4OG2A 2QR3A 3SZ3A 4IDCA 5BUQA 2DWPA 5B3LA 1R4ZA 2QTTA 5IVDA 1EG2A 3VPHA 2UZ1B 4OB8A 5EIBC 1DX9A 3VU0A 4DLUA 1CUWA 2YQ5A 3AKDA 5CT9A 3WYCA 3A1SA 4BFLA 4KJXA 2JIMA 1DRUA 4E21A 3I28A 3SX2A 2V6BA 1NR1A 4QGAA 5DNWA 4HEA1 4HS9A 1RQ7A 1KAHA 3DZHA 3O7WA 3KKNA 1FTGA 4QXRA 4JGIA 4JUFA 3UGKA 1SK8A 3SWWA 4FLEA 4BX8A 3B85A 1PT6A 5KDOA 2CBXA 4O4LA 3R76A 4MVJE 3WQHA 4AP6A 1T35A 4ENQA 4PRLA 1Q21A 2FFAA 5EEGA 5F51A 2BGWA 1DT3A 1JIKA 3VKWA 3WQRA 3U7IA 4NMLA 2EKLA 3DEJA 4Q34A 1F0NA 1FFCA 2J3EA 1MO3A 4DLAA 1P17A 5JJIA 4L0QA 4E4RA 4M7RA 2W6NA 1ZSNA 4L8LA 4LNUB 4X84A 2B20A 2P7IA 3BD7A 2OAEA 3W5BA 1PYGA 3ZDRA 1D4OA 2IEDA 2O2JA 3B9PA 4JWTA 3GRKA 5FTMA 1BN7A 1ZVQA 3O83A 4G0MA 4DCMA 6PFKA 1RW4A 4H4DA 3PGA1 4HB0A 1V4NA 4NZZA 3W9BA 4EZEA 1MUUA 3ZE8A 1FFGA 4QJ5A 1ONBA 1Y6JA 4YA6A 3SSOA 3TLBA 1OH8A 3T7KA 3KB1A 4MPTA 4X6YA 5TJHA 3I64A 5D3MB 1YA4A 4KPUA 4QUKA 5LSAA 4PIMA 3X1WA 3ZGYA 1EXVA 1YA6A 4X6LA 3AJ8A 2BHLA 1JV2B 4QHTA 1K7XB 1SD1A 3BL8A 3KOZA 3MRSA 3L0OA 4U2FA 5D5HA 5EP2A 4R41A 2LCFA 1LDYA 2OGTA 4P4TA 5C4MA 2XUJA 3T5BA 5ILOA 2QNRA 2V7GA 5G2OA 4NONA 1QO7A 4NYIR 4KMRA 1Z8DA 2ICAA 3IMKA 4ND8B 2IELA 4S1VA 3Q8KA 1PTJC 5JY6A 1N9GA 1U2QA 2CF5A 3QKSA 5AQEA 3KPVA 3WBFA 1UIRA 1L1QA 3M4ZA 1TKAA 3HSKA 1P74A 3LBAA 3PGLA 3SC4A 3AUYA 3H13A 3MGAA 4PNEA 1Z18A 1Y8ZA 3UA4A 1G7CA 4Y6SA 2NXEA 3AWIA 2IY7A 4X97A 4WKPA 2PS1A 2JGLA 3AUKA 5U4XA 3ZDFA 1W76A 3W4KA 1XX6A 5ARCA 1E3MA 3E9EA 4AJ4A 2WE8A 4CIBA 4A92A 1NU6A 2OCKA 3GXBA 4RZSA 4XX1A 4ZAGA 4EWLA 3S1SA 2Z6UA 4WY5A 2RG1A 3W3AA 3NEJA 4FR2A 3EVEA 1TCVA 3DAPA 2P2ZA 1OFUA 2FE1A 5ALRA 3FSRA 1QHHA 4G8JA 2K7ZA 3KIPA 5H83A 3K4QA 1Y42X 3ONEA 2QMHA 2CE7A 2QQFA 1AHPA 2AEFA 1DV2A 4BJ3A 4MWZA 1YHYA 5IAGA 3RC7A 3ZBUA 1L5YA 1WXEA 2BWJA 2PD3A 1WLYA 2R85A 2QLNA 2PYDA 3GEHA 1ZK3A 4D4LA 2IUUA 2ERXA 3LO5A 2G9RA 1AT1A 3HLYA 4JP5A 1KNQA 4RA6A 3TECE 3U0VA 4AJPA 5LQAA 3WMEA 2F59A 3K1AB 1SUBA 2ZJYA 1VKOA 4KRYA 2P9EA 3KZ1E 4NCIA 1JIQA 2E37A 4P6VF 1U98A 3C7KA 3GUVA 3H8WA 3S44A 3UOWA 2CLOB 2VNKA 1JQJC 3VVBA 2QZZA 5DASA 1ENOA 3DBRB 3NC1C 3IDZA 4TT3A 2HGZA 2BAGA 3ABQB 3PL5A 2PVPA 4MKRA 4Y2QA 2X0FA 2VJMB 4U2DA 5DTEA 2XTAA 2QMOA 4CLHA 3AVWA 5IDWA 5UKDA 4FFRA 3EVCA 1PS0A 1G66A 1MW9X 4IS2A 4QVKA 4EJ0A 4BMXA 2HJSA 2SKCA 3UW1A 3LKZA 5DTRA 4GUAA 2QTRA 2ACKA 4JB2A 2XVYA 1JU3A 3RAJA 1B74A 1OLXA 1AKWA 1G21A 1UZNA 3PTAA 3CC8A 4NZ9A 1I80A 1NQXA 3IAS6 4UEOA 4ZV9A 1JVSA 3FRIA 2QUKA 4DR2B 2ORVA 2IZ1A 4B3IA 1RLMA 4DXHA 4YP9A 1KEZA 1UJNA 1VI6A 2WD7B 2R6AA 3TLGB 2BZSA 4ZT5A 3HXOA 1MC8A 1WSAA 3TQRA 3M9LA 4HGZA 5AM2A 2VNHA 4BNMA 3UENA 3BGOS 2ZTSA 2HIMA 3DTNA 4NBNA 1Z0UA 4KO3S 4BQRA 1H3FA 3AEYA 3BIWA 4L3VA 4KQEA 4P38A 5KQPA 3FBTA 1UF9A 5E4FA 2GNPA 1F7VA 1NNI1 4FFBB 1OXXK 2F17A 2J41A 2CWDA 2XR1A 3EIWA 2R7AA 3FYUA 5FD8A 4OYYA 3LC7O 1F6WA 2QTFA 3B53X 3M89A 1I9GA 1SN7A 2IP4A 4GVLA 4MUJA 3WFIA 3HDGA 4J16A 1XJCA 4KXFB 2OQIA 5L6LB 2ZRJA 4FMCF 1IATA 1P1CA 1P1KA 1VPLA 2Q5HA 1EEXB 3MWDB 1GQRA 2Q62A 5TEWA 2GLUA 4MGIR 4ZWNA 1WG8A 3VTAA 2IK8A 1G18A 1W5TA 2Q0QA 1S01A 1OFGA 1E32A 3ZWXA 1T36A 4RL6A 4RJKA 3ZWBA 4FR0A 1JSRA 1QBGA 3IR6A 5EKDA 1E9VA 1TMYA 1B4DA 3FVRA 2VTDA 4JOQA 1X94A 2O1XA 2QY9A 3FE2A 3LHSA 4XJVA 1XRJA 4LZZA 1AKYA 1E1LA 1SXIA 2CNLA 4RPCA 4BBZA 3PT9A 2HSWA 4L5IA 3UG7A 4NJMA 1NYQA 1P7ZA 3OZSA 1I3NA 1RFLA 4K26A 4KPGA 1Y1QA 1SIOA 4ZYVA 4ZHQF 2B1RA 2VHUA 3Q6IA 1J2EA 4GOOD 2YYAA 2ZB4A 4UMFA 2JGIA 1EGVB 1Z2EA 1V9LA 3LP6A 4KN8A 5KS2A 5FOXA 1ETUA 4G4IA 4FZ5A 3HGTA 1O96B 2YW2A 3TL6A 3K53A 4LJ9A 1IU9A 4MYCA 4KU4A 4W6QA 4C08A 1Z07A 1WDTA 1T9GS 2FW7A 4KQ1A 1UH5A 2ZYSA 2LWIA 1BCRA 4WZZA 8LDHA 3V9PA 1H1LB 2C57A 2FW8A 2ORWA 1HO3A 3HUTA 2D2VA 2VO1A 1NVDA 2BKEA 2W37A 3DCIA 3EVAA 4MMZB 3C3DA 3FGZA 1ZJWA 1WXQA 4YCNA 1WXHA 1ZUNB 1JFLA 4FOSA 3MGKA 1ST3A 4WN3A 1Z6YA 3GFFA 3VR2D 3NMUF 2O48X 1ZRSA 1DKRA 2C59A 3G0DA 2PH5A 4OI2A 4O33A 3N7AA 3C24A 3DFIA 3KT3A 1EFPA 4TV9B 4JBHA 4F12A 3VDXA 4LZLA 5IFKA 1RZRA 4UARA 3GUHA 4M9XA 1DOHA 5DXAA 1JFFA 3K8OE 3OX2A 2H9IA 4ZEWA 1RABA 4CF6A 5EWMB 2DPHA 1PLLA 2WBLC 1I8TA 1HH4A 3JYPA 4S1NA 1T8YA 1BG6A 3M70A 1LQTA 1XZMA 5E8JA 1HNXB 2ZXEA 2A59A 5L3RA 1N4AA 2C0QA 4EG1A 3EEOA 2EDAA 1G59A 1U2DC 3EYAA 5FP0A 3NS7A 2H4YA 3COZA 3PVZA 1VHJA 1JAXA 2GS9A 2XUDA 1AKEA 2NZWA 4A0QA 1BE1A 1PDOA 4I8DA 4D92A 4LJ8A 3OIDA 2WIJA 2OXIA 1NJ8A 1VLZA 3K31A 1T24A 1D2AA 2I1QA 2IHKA 3VX3A 4DJAA 1D0SA 2VP2A 4L5BA 4M0UA 4TQ9A 2FPXA 4JVNA 5KSZA 3BKXA 2IPAB 3GMTA 2ZJFA 3AY0A 3KEQA 4YHBA 4RD1A 2BFMA 3ZR4B 1IHYA 3RGWS 3WL6A 1N8SA 4I9FA 4IKOA 5JH7F 2P9BA 5DU2A 4E5DA 3D8HA 3PWKA 2QOEA 1IE3A 2JG3A 5HR5A 1DRVA 3Q98A 3ZG6A 1RHKA 4BFTA 1CRPA 2PUJA 3WHIA 5JD6A 1DC5A 3B1YA 1Q3TA 3E15A 1P7WA 4P4NA 2EWWA 4FIZA 1TT5A 2BMEA 1L1EA 3DD1A 4JQOA 5EYPB 5K1ZA 3T3HA 3C3YA 4DQ0A 2R4UA 3P96A 1CLUA 5KSWB 3A27A 3AEKA 4QATA 3ROTA 3VSAA 3J7TA 5H3HA 5DYTA 3WWPA 4DMLA 1XD8A 1MIOA 2OCPA 4ZRMA 3V3TA 2XX3A 1RHUA 5F3DA 3EIUA 3T7IA 4I8IA 3TD2A 4DMRA 1DFIA 3NBMA 5JAHA 1KTIA 3RADC 4D9KA 5JXHA 2F8LA 2F1KA 5C8YF 2PMDA 5KSYA 4RZXA 1KBQA 1V5WA 3PNYA 2X5KO 3VHQA 3W7VA 2BP7A 2NQTA 3WG9A 2R1VB 1N25A 1WVIA 3H99A 2NZVG 4MQEB 5CH5A 3ISVA 2AMLA 5AOCA 5A5FA 2GEVA 3QELB 2W93A 3O4VA 4J4HA 4DM3A 1I9CA 3N87A 4OGLA 3NIFB 3RTEA 3W4IA 3DXFA 2VYCA 1BN6A 2EARA 1ESEA 4I46A 1NVVQ 4LC9A 1QTQA 2B4YA 3L0BA 5IN5A 4UTVA 4ZQIA 3MCZA 1DADA 4RFVA 4DDUA 4FOOA 1Q0SA 2FPMA 1Y5IA 5HK8A 2WSMA 1XK6A 4EBFA 4X5OA 5FB3A 2HCRA 4D3YA 1WPXA 3O9MA 4RQAA 3ZDXB 3KE8A 1GLVA 1PUJA 4GVXA 4RK0A 3OP1A 3TSZA 3ZDEA 3SBOA 1LNZA 3TRJA 2DQYA 2HR1A 4HZUB 3TYXA 4DTCA 2JHAA 3D8TA 2DR2A 1IQUA 3DWFA 3GZNA 5CUQA 1LSSA 1EFLA 5LZ5A 5HKKD 1E0AA 3PQ3A 4X63A 1TA0A 3DH0A 1GIAA 3CNQS 1VE6A 3GB9A 5KKAA 3ANXA 1BE6A 4FGZA 3RRXA 5EHZA 1W2HA 2V5AA 3MC1A 3H2HA 1ZQ9A 4I6EA 2G5CA 3BCHA 4Q4HB 1JDVA 1U7DA 4ZZ2A 4E70A 1Q0UA 1KO5A 3WX0A 1L4GA 1FQJA 2I7TA 3NYWA 4QG7A 3SLGA 5ALTA 2AX4A 2QB5A 3HMQA 3HBFA 4QFBA 4RKQA 2N9UA 4J16C 5CTAA 5D3ZA 4BCDA 3OKAA 4K28A 3UHOA 3G1WA 5JPCA 2IXDA 3NT5A 2B34A 3QU4A 5HJ2A 2REOA 1LGYA 1RPAA 2QL9A 1WNFA 2UUAB 1DBIA 1LDMA 1T1EA 3PXEA 1RI2A 2YWRA 3BMOB 2AN3A 1BE0A 1FEZA 1D4AA 3IXMA 4P2GA 2IV3A 3E7DA 1ECLA 2OV8A 2O8VA 3GJQA 1J07A 2QT1A 1PJCA 1P1BA 5AYVA 4DFDA 1ZRHA 4KPYA 1GCAA 4DEXA 1O77A 4J0KA 5LA6B 4FEAA 4TQAA 5I3ZA 2XKKA 1YTUA 2Q4BA 1KOJA 1PR4A 3T95A 4PYRA 2ZIGA 3NYQA 4MX8A 4S12A 2XDQB 2PX3A 3LKDA 5J4KA 2DU8A 2NUPB 3AHHA 3SXUA 1JRLA 2LIVA 4OUDA 5DYYA 3UTDA 3D8SA 4BJ6A 2AOVA 3EOZA 4JJKA 4LWPA 1EP2B 4F92B 2GXUA 2HK7A 2P65A 1Q3HA 1YRWA 3GFRA 4XYMA 2O54A 2WHXA 3TZLA 1CYEA 1J2TA 1THTA 2BBWA 2ZRMA 3VAAA 3MTIA 4UE6A 1FQOA 5B30A 1L4KA 3E9CA 3GGOA 4ZPJA 5FADA 5JNRA 3ITNA 2WD9A 2H3HA 2JA2A 2GN8A 3H1TA 4HY3A 1DUVG 4CN9A 4C04A 1L4UA 2I4MA 3B1VA 1HX7A 2XMDA 1EXMA 1MP0A 3AXTA 4KTVE 4LS3A 2V55B 5F2EA 1XMSA 4PSVA 4W9NA 3ADPA 1J7JA 2CXXA 4OXIA 5HKLA 5K6TA 5KOJB 3G0HA 3FVTA 2OFXA 3H1AA 2X6TA 2ZEJA 4HH0A 4O2RA 4O4IA 3LZ6A 2WHPA 4G26A 5AQ1A 5IH7A 2GN2A 2ZXUA 1M1YA 2BE7A 2RG7A 3V42A 1NMEA 1RYFA 3GNTA 3MWYW 1KYIA 3PV0A 3JD0A 4FFNA 4G0OA 3UHAA 2XJ4A 3I2YX 3B1ZA 3OT4A 3RSCA 4CQLA 2H2WA 4WIAA 1DC3A 3HO6A 4XLLA 3O9VA 2FRVA 5DIZA 3NNNA 5DOVA 2G71A 2ZUTA 4BIMA 5FBVB 1A5ZA 5KHLB 1KC1A 1MLDA 2GZAA 2A0UA 2R5NA 3D02A 1VCHA 3GXOA 5CDFA 2J9XB 1R4NB 4ZCIA 4J2HA 4ZOLB 3S2SA 2VF8A 2JFZA 2R68A 1OUMA 4MMYB 2CLCX 4I4TB 3HB5X 3EGXA 4U9HS 3SJUA 2QRNA 3HBJA 4FDVA 3NRJA 1N0WA 3D7RA 1UMKA 4JUBA 5HQTA 3JQBA 1QVRA 3H75A 3DTVD 1DJNA 3JQGA 3A1UA 3LT4A 1SR8A 2IZ5A 5BSGA 3HYSA 1LWOA 4PRZA 2B1JA 3SYTA 3L1KA 2AQ8A 2JH8A 5H5JA 4RDHA 4D9NA 5C3UA 3FETA 2HSGA 5CR9A 1HLPA 1BVUA 1N32B 3SQLA 5I51A 3UFXB 3HBMA 4HBGA 4TQUS 3M2TA 4WLVA 2FQYA 4RTQA 3A2LA 4UBKA 4B44A 1GGMA 5KUTA 3EGOA 4HWKA 3DDNA 5HHTA 1XALA 4HWTA 3I9V6 4QRHA 2GKGA 2RGNA 3G79A 1G7TA 1THZA 1HF3A 3BZWA 3ZZ0A 3AJRA 3E3AA 4INJA 4WCFC 2QBYA 1EK6A 2R86A 3IDOA 2ACEA 2LVBA 4WA7A 2J32A 3BSSA 1LRLA 2WVHA 3FWNA 4W1QA 5HGXA 3Q1KA 1E7RA 2UZAA 3DPSA 2P2NA 4OCZA 5G1PA 1XROA 4JJ8A 1MQAA 1NLFA 2NXCA 5EERA 2IWRA 4FYWA 2OORA 4IDAA 1YRYE 1XEXA 5MFZA 1L5MA 1IK6A 5EQDA 1JG4A 4NS1A 3KKKA 4G37A 4UFPA 2IRWA 5I4KA 2HMYB 4RVGA 2XB9A 3LLVA 1BCRB 5JBQA 3MJHA 3TTWA 1WUTA 2Y0CA 4HHEA 1ZKMA 1SVSA 3E22B 4BB5A 1C9NA 1W2GA 3OG9A 5AUNB 1RAAA 2J9RA 2BC9A 3EVGA 3Q9NA 4LV8B 3OJOA 4MMXB 4DXAA 2WVGA 4WY8A 3BKWA 3X3HA 5CLJA 4ZTZB 2Y99A 1X7XB 1IBKB 1DAPA 4MW4A 5TARA 4N9QA 4LG1A 2VF5X 1XLVA 1U7OA 1XXLA 2C77A 2RGDA 3M1IA 5DH9A 1YL6A 4MA4A 4PLWA 1QGOA 2C4MA 1ESNA 4CQLB 3DDCA 1A88A 1A8SA 2VVTA 4IFBA 1R0YA 3OCCA 5IC4A 2P9FA 1KI3A 3FWKA 1OVGA 3IOEA 1N5DA 1QJ4A 1LRJA 2WSBA 3KR1A 3TCKA 1I32A 4MUIA 4D9JA 1SWWA 4DSZA 1H6BA 2Q8QA 1F1JA 2VDVE 3CA8A 5DTIA 5EGNA 1PKXA 2NO1A 1PWXA 2XOKA 4EVRA 3EGXB 3FMPB 4QIHA 3TLMA 4I66A 4UNNA 2ZPAA 1HY3A 2ORIA 5DT9A 5TJ9A 5EUCA 3VYRB 1DAFA 2O8CB 3VH2A 1M8GA 3CM0A 3DMYA 1XF9A 3U80A 1DX4A 1O03A 2GAJA 2AOUB 4IIBA 4BLTA 5WRFA 4M8NE 2FEMA 3KKQA 4G4SP 1Q7EA 1Z6TA 5C1OA 4C9BA 3NM4A 3WWEA 1SUWA 1T8PA 4TUYB 4GYKA 4OQLA 3B6JA 2YXPX 4CDNA 3QQPA 2GASA 3R3SA 1M0SA 2CK3A 4U7FA 1K0FA 4FDTA 4V3BA 3O8LA 2HJWA 4W8OA 4LTMA 4Y1RB 5DNDA 1LC0A 4F4CA 2CXNA 3W5CA 1FU8A 1FX1A 4IOMA 2CUKA 1NT2A 4BLOA 4BV2A 5LOVA 4JVLA 1SHUX 4EKGA 2BGKA 4EA7A 1AUOA 3AG6A 4LDJA 2VNIA 1K5GA 1MABA 1TF7A 2GHRA 3FAZA 1ZI9A 3RM3A 4C43A 1L5RA 4QLAA 5SY6A 2AN4A 4ARZB 3ZLTA 4YQFA 4JL8A 4R8LA 1I5RA 2V58A 1U4OA 3PFBA 2OUIA 3TQCA 3GEPA 4GPIB 1ZGHA 4OHRA 3DAGA 3OKFA 2VCEA 2HYDA 5AVZA 4BO1A 8ABPA 4P3XA 4LDPA 3GLIE 5IBPA 4C05A 3VBEA 4KXMA 1XTQA 1XEXB 2IY9A 3PEEA 5CLLA 3W2EA 2QV7A 3TNDA 4BP1A 3TPZA 4EMUA 3ZJVA 3L9XA 2I2XB 3RVLA 5CVJA 3DE4X 3JYNA 4Z6KA 1T3TA 1KH2A 5AVXA 2Q28A 5AJHA 1OQAA 1BVRA 1FVXA 3N7TA 5CVUA 4QQFA 4UU7A 1T9KA 4Y2JA 1KARA 4V1CB 3S55A 1R5BA 3AVTA 1AJEA 1XJQA 4WKBA 3NBFA 2Q3EA 5DE3A 2VSXA 4AUKA 2C7RA 1NZFA 1L7PA 2QTMA 3FDJA 1Z0KA 4WJKB 2W2MA 4UW9A 1N2GA 3N3BC 5DO9A 4BBAA 4MQMA 4ER7A 4I08A 4KR9A 2OORC 4FK8A 1NLUA 4ZKEA 1GDDA 2H4WA 4K8RB 4QQNA 4P33A 5CT6A 4HSEA 2CUTA 1WXWA 3HLTA 3OJFA 3UICA 3DTTA 1USUA 2GO1A 3FI9A 4PE5B 4JYCA 1Y7LA 1BXRA 4L8GA 4D9BA 5DP1A 2PYIA 4JJAA 3UKJA 4LVCA 4RQTA 3ZXUB 4JU9A 5B2FA 1ULZA 3RSFA 3CX3A 3LYAA 4IEEA 3ZBTA 4B43A 2QORA 1FS6A 3RHSA 4IO1A 2X8WA 2GBFA 4LZNA 5L7YA 5KWIA 2YINC 5FH9A 1FYDA 4HT3B 1N6IA 3OP4A 3AY3A 3ZBQA 1JT9A 2OBMA 3IUNA 3LOUA 2H9AA 5FOQA 1FL9A 1RRFA 1ZGBA 3QJ5A 5JECA 4CNQA 5CDFE 3KDSE 4WLEA 4DEYA 2QRVA 4I14A 4LCEA 4RXMA 1A4RA 1JQAA 1I2MA 1YQGA 2R8EA 3B2QA 2PHZA 1XI2A 5DRYA 1EQUA 3GFBA 1E9BA 3NJRA 4HOYA 2YV5A 3GNLA 1TPZA 2QVLA 4G0NA 1KJJA 2YHIB 4MUFA 3B70A 5TPZD 3WAJA 4RANA 3G0GA 8GPBA 2MSWA 1SU4A 4EGJA 3RG2A 4TSFD 4N9WA 1MTOA 4NOKA 2ZSAA 2O5CA 3MGGA 3TRHA 3WRYC 1A3CA 5IJ0B 1F4LA 3AFMA 4AZTA 3A9VA 1CUSA 4QU0A 4WDQA 1JNYA 2C8KA 2YJ5A 3TBHA 3UK1A 4BP3A 2W42A 3LD9A 2R7MA 2ZITA 1TF2A 4H7DA 1UEJA 1JTEA 3VPDA 5J4YA 1U04A 2JGDA 4Z4FA 2B9VA 2FPIA 4GLJA 1C3JA 2ZRPA 2V4ZA 4H08A 1C4WA 4IXNA 1BEEA 4J8PA 5HQJA 5BYKA 1CR1A 1PGPA 3U56A 3UC9A 2H6EA 2VSNA 4YXWA 1TXGA 2J30A 4P36A 1JR6A 2QV0A 3IDQA 1PZFA 2QRHA 3TRIA 5EJ2A 5B6PA 4GPTA 1WHSB 3EISA 2QS9A 5HF9A 2XV1A 2G08A 1AO3A 2VP0A 1UDRA 2E82A 4JC4A 3OQMA 4R31A 2KPOA 3SC3A 4CT4B 1DFGA 4IVNA 1P2VA 4YJHA 1PSWA 4IWXA 4KACA 4QLOA 3A3KA 2I9PA 1IJEA 4QOEA 4WKOA 5ULLA 2NU8B 4J9VA 1H8ED 2VOEA 3IP1A 3SYMA 3MCAA 3V6LA 5TMPA 2PA0A 4KQMA 3W6NA 1ZYUA 2BOVA 2NXWA 2QUHA 3L01A 1R15A 3G9UA 4RK7A 1R00A 3CLSC 3K5PA 3X1XA 2C7QA 4QGFA 1QHXA 4K9NA 1WA5A 1AGXA 2ID7A 1ECGA 1Y81A 4UXIA 1U90A 2XMSA 4YJGA 5BT9A 1J0AA 1DXQA 1H2BA 3AXSA 4GSKA 4X8LA 3I2JA 3MWDA 1M6EX 1UBTS 4P4UA 4G2NA 3VHLB 4JD5A 3FKQA 2ZJ2A 1ZM4A 3ORRA 5FPYA 5TPWB 3AVOA 3CGWA 3L7BA 3NHSA 3UMRA 3ZQKA 1BQEA 2EG9A 2EL7A 1WR8A 2JVKA 4QKQA 2AD1A 3TGLA 5ALOA 3V7NA 4EI2A 4K2HA 3EPPA 1DG3A 2BN4A 3ABRB 3BGVA 4DZRA 3BJEA 1NOIA 2CV2A 3PDWA 2PVCA 6REQB 4YT4A 3AG5A 1QYRA 4X3CA 1JIVA 4QNRA 3HDTA 4D5EA 2XUHA 2H85A 2RJ3A 3HL0A 5I7WA 5IK2D 1PX0A 1VFPA 5TLSA 1QKKA 1RHJA 3IR7A 1WZUA 3PHLA 2DLCX 4CFYA 2ZAGA 5CIWA 2Y3IA 3WOVA 3FNFA 3KQQA 5H8WA 1Y5NA 4KJZA 4RENA 1O0SA 2JB9A 3SDBA 2NP7A 4EEKA 3IP6A 2VT2A 2G04A 4WESA 2ZE8A 3V55A 2GPAA 2OBLA 4OK3A 3SVTA 3OFND 1SIWA 1I36A 1IRIA 1IBSA 1J2RA 2F4NA 3JRXA 1TQ6A 3C39A 4F4FA 5K8JB 2ZT6A 4G23A 4EM6A 2B0JA 1UMDB 1U7ZA 5CP8A 3WV4A 2W2NA 4GQIA 4OQYA 4CMGA 3IC5A 3DZBA 4HADA 5FUMA 1XQVA 5C9ZA 3G5LA 4U4AA 5F1YA 5FPPA 4PFQA 4PU0A 1P7VA 3JQ8A 3H4IA 2DQKA 3A6EA 3AKYA 4ZYXA 1E5LA 4F2WA 2RJNA 5IS2A 3PD7A 5JW6A 3IVMA 3LSTA 5D3QA 3GDHA 2CXOA 5J2UF 3NDIA 1PDWA 1D2CA 4MWCA 1E7WA 3S2FA 3CEJA 2JLWA 1Q1BA 2AJTA 2ZQYA 4P7BA 1UP7A 1ES9A 1ORDA 1GQOA 2FQ1A 2IGBA 2VK2A 5JFGA 4UUNA 4YN3A 5HEKA 3RHTA 421PA 1XHLA 2AMVA 4DBLE 1MHPA 2PWPA 4ZJZA 4GPBA 2I7DA 3TM5A 2IYPA 1HYQA 4KQJA 3DLPX 1LPSA 1CQJA 4MV4A 2XZPA 4J0JA 4KSBA 1PR9A 2RH9B 3WJ1A 1X2BA 1JHDA 3LKVA 3MWLA 4D56A 1HNZB 1EB9A 4OSOA 4RMJA 3BF7A 1OIXA 4U2KA 5E7IA 1R8JA 3HK2A 5C32A 1QQTA 3ACBA 4CEHA 1Z9BA 3LT2A 4QWMA 1E2KA 3BMCA 1YDMA 1W49A 2BI4A 4X1KB 3WLFA 4B1FA 1G6HA 1NUUA 5CCBA 3C5EA 2X8AA 4TWBA 3K9FC 4U00A 1M2EA 2YJ4A 4O63O 3T3MB 4B34A 5A5DA 1B42A 2HB6A 2PVSA 3E5HA 4KBFA 4CLXA 1KMCA 2EHJA 1QIJA 2IUYA 2X1LA 2OM2A 3D4LA 3GDWA 3LZCA 4TWJA 5FYQA 1L5LA 3RV4A 5C18A 3ZDBA 1VG1A 1ULHA 3E9QA 4ND3A 4OSEA 4XUEA 4AJEA 1I94B 1A77A 3O2SB 5LDHA 5FHQA 5IT9A 1CB0A 1WMEA 2FPKA 5AJVB 5DSZA 3ZV6A 2OQRA 2BFCB 3PX3A 1V96A 2QTNA 4EYSA 2IJGX 1RWOA 1CY2A 4E6PA 2Q2VA 5TR9A 4FILA 1PL7A 1Q19A 2FPWA 2OKCA 2BUBA 3HVHA 4UASA 1I3OA 2J4FA 4EG4A 1Y9EA 1JEDA 1PUXA 2BP7B 5DN6D 2RB5A 4IGFA 2OPHA 1VKJA 3R6LA 3A37A 1P33A 3ZWNA 3L8CA 1NXSA 2XZLA 2BI8A 2CXHA 3GHHA 3QXJA 4GMKA 4QGSA 1J8DA 1L8XA 3M1AA 4KXVA 3BA6A 5GIPE 3A10A 2IHBA 1Q0PA 1W34A 2HQOA 2OWEA 2QLBA 1SEPA 2EW2A 4FE7A 4HDSA 4LYJA 5D51S 4M6WA 4IIJA 3TR5A 3D4PA 4QDKA 3LQKA 5BP7A 5IASA 1NVBA 4MYRA 5DBGA 5BVHB 1MJ5A 2AXNA 2CNNA 3ONDA 3ZWWA 4CQNA 1D09A 8MHTA 1C5KA 3PYLA 1GRVA 3PGXA 2GCOB 3P20A 4Q18A 4TXJA 3TI7A 5LKRA 1HQYE 4M0MA 3S8YA 4KNYA 1RAHA 2F3RA 3F90A 2O8DA 2ZU0C 3K5HA 2PKRA 2ZE7A 3WLAA 2ZWAA 1YASA 2WW8A 2Q7DA 6LDHA 1V48A 2X86A 1IN8A 3AHGA 4B48A 1Y5LA 3H1EA 1OWOA 3R5FA 4L0MA 4RTMA 3GLFB 2VHTA 3QJGA 4JSYA 4KDCA 2HFKA 4D6YA 5BYAA 5JZSA 2JCSA 3I6ZA 3DW1X 5IAEA 5GV7A 2DERA 4LYHA 3IBFA 1L4BA 1YBAA 3A4MA 4GEGA 1XNJA 1F0PA 2KWIA 5LPNA 1JIXA 1TKRA 1X86B 3PIDA 5DNCA 4RY2A 4Y2YA 3SM9A 2CDBA 4RHFA 4G41A 1V7ZA 4PLFA 5FCDA 3KUDA 3E4DA 1SU8A 3T99A 1L6RA 1V1MB 1A9YA 5CD9A 1GFSA 2A9PA 3G9ZA 3PNPA 5C5CA 1H4QA 1G9TA 2DP4E 2N46A 4DSNA 2N3ZA 5A6SA 5HOEA 3HDHA 4Z3KA 1I6KA 3W04A 1Z4MA 2QAGA 1TVKB 2AW3A 3JQDA 3QOXA 2VEOA 4DRYA 5CD1A 3TTXA 2P6RA 2H1LA 2OHGA 1G5FA 1GZ6A 1P39A 4FNGA 4PZDA 5DK4A 1DIHA 4ZODA 1W4AA 1B8UA 3BDAA 3KL2A 4KR0A 4AIRA 4JBYA 4TMWA 1EX7A 2OXCA 4WOKA 2OXRA 2VJAA 3KS9A 4N65A 2WF9A 2JVIA 3C3CA 1JEQB 1FP1D 2XDQA 2GUGA 1V5EA 1OXVA 2NPOA 4OL0A 1PT5A 1ZMOA 4OA8A 5DHTA 5FORA 4REOA 5AVSA 1J06A 3U4CA 4D42A 2HFJA 2BGUA 1Y8RB 4P93A 2F8MA 1W96A 4BO4A 1N2ZA 2IYSA 3AO0B 1E1RD 2BZ0A 3MS7A 5LUBA 1Z12A 3LGAA 3U49A 4YV0A 2RGGA 1Z2CA 2O7QA 2PMCA 2PD6A 2VDWA 4XWYA 4A2QA 4EA9A 2XXAB 3V8EA 4P34A 4B8ZA 1XCLA 4HDSB 4HQNA 2C83A 4MJ7A 2LBPA 3RJ5A 2HF7A 4Z4HA 4O2AB 2XAUA 2D7DA 4HXYA 4ENPA 2RHMA 1CLEA 2HUPA 3EE6A 1U28A 3IMFA 1TTQB 3EQ6A 3MJVA 4IUYA 4UCWA 1I7NA 2CLSA 3IAFA 1X0XA 3KVNA 4W5QA 3K0SA 2WSLA 5JCJD 3JWIA 1KJZA 1RVV1 1X1BA 4MIYA 3O74A 1E1QA 5K3BA 1T0JB 5AUPB 1M6VA 2RC6A 3WLKX 1T0HB 2UYGA 3DHYA 4Y2SA 3FGOA 4OYRA 4F9GA 2W0MA 3ZCTA 9GPBA 2P2GA 2CBZA 2D2XA 2GJ9A 2QW8A 2X2FA 4DLVA 3JU3A 4RLQA 5DOZA 2VHXA 1O8BA 2P4UA 1MAHA 5G0UA 3BEOA 4ZYYA 2IW1A 3KOYA 3M4YA 3N0XA 5TC4A 4WGFA 1TTHA 4RA9A 4B2IA 2DBYA 3FMFA 4BE4A 4D6XA 3EX7C 2JRLA 3FNGA 2J9FB 2IYNA 4EFMA 5K7SA 4U6NA 1U9IA 4O0LA 3QRWA 4XM2A 1QWSA 4V0QA 1I4EB 3K8ZA 3KP1A 2WTMA 2PMWB 3ILXA 4AP9A 2C82A 1QYDA 1DBSA 1W1UA 2QAJA 2NU7B 5LYJF 4R51A 2PIAA 2L69A 2ZPUA 2FGJA 4KVZA 5EESA 1X9IA 2ZR9A 3PE6A 5EZYB 3RYHB 3KQMA 1ZD4A 5FR1A 4Y2TA 2LCIA 3WLOA 2FWIA 3ZI4A 4BHTA 3AI7A 4UNRA 1MZPA 3DFKA 5JJLA 4HN4B 1WDKA 4DLPA 5D7NA 1BOFA 4U2GA 1UZLA 4K1LA 1Y8QA 1VFNA 2HC9A 1J4AA 2ZT5A 4BUCA 5KTKA 1T5HX 1Z35A 1NI5A 3P2YA 1CJVC 4WSOA 1XKLA 1PQWA 3ND7A 4PC2A 4AFNA 4QFMA 4JLMA 5LQJA 1BFKA 2RAVA 3HJTA 5EP3A 1JZQA 1OXSC 1Q7RA 1T8UA 3BN3A 4RJ2A 4YJ3F 3ZEIA 4C22A 4CEIA 1JQDA 1ZG3A 2PX0A 5BQPA 4KWCA 3D1JA 3OLYA 4MQEA 4N7JA 1VSBA 2BSXA 3FMGA 4YREA 2EGGA 1QG2A 3F7OA 3BBPA 3T7EA 3VXKA 4CF3A 2CV0A 1TX4B 4ZREA 3TIGA 1Q1EA 1UMCA 3ZU4A 5DHUA 1UBHS 1W19A 2OBNA 2Y9PB 3GRUA 4P7FA 4TRNA 2JDID 3BXEA 1GYRA 3THWA 2PZAA 1XTPA 1JMYA 4DIEA 1IIRA 1LC3A 3OKCA 4OFXA 3NC4A 3A4YA 3UJDA 2OHVA 4JL6A 5LDGA 3NIBA 3A1WA 4AUEA 1RQLA 1WV1A 3ZGVA 1LH0A 2QGFA 4G5GA 3B2NA 5KREA 4XE5A 4TLDA 2DBRA 1C7RA 3PC8A 1XZPA 3HUEA 1TUIA 2W2XA 3KVYA 1CXZA 4R3WA 2WQ6A 3QZUA 2CEKA 2ZRLA 3DNFA 4NYJR 3VR6A 4D9HA 4AMYA 1E9FA 3QW4B 1RE1A 1R37A 1VA4A 4UTXA 4BU0A 1SC4A 4OOFA 1YCDA 4RHTA 5AKEA 3Q3HA 3AR7A 4PYNA 4QASA 1I2CA 5I9SA 3R5XA 3BERA 2I03A 3GIWA 3V8NA 3X43A 4GGMX 4NCNA 5CLHA 1KIAA 1U9CA 3CUSA 2G1PA 5C8XA 2JGEA 3HVIA 5ENVA 2DR3A 1EE2A 1MX3A 1V47A 3FFXA 4RMIA 4TL6A 3TGWA 4BWYA 5HVNA 1YE5A 1XVTA 2UYHA 1WNTA 3EVNA 3EEIA 3T0FA 2YFQA 4HATA 3WLRA 2ZBVA 4HAYA 5KQRA 3KOMA 2JI8A 4NI5A 3KSDO 4RYLA 3OWHA 2ZCVA 1N75A 1YT5A 4GIBA 4FFPA 2FPRA 3E8MA 2CBGA 1ZJ5A 3LF2A 4IFTA 4Q02A 3RT7A 3UMVA 3DD5A 1NW7A 2B8WA 4HXFB 1WBDA 1V4VA 4PCAA 4BNKA 2RB4A 3ZWVA 1LBSA 1PR6A 1NMYA 1D1QA 1VXRA 1E62A 2P4SA 3DWGA 2NU7A 4G5SA 1G20B 3USZA 4UDXX 3RNLA 1F17A 1K6EA 1GHTA 2D7CA 4QDJA 4YGYA 3LZDA 4A1FA 3I5YA 1OZ0A 2C5GA 1G291 3I05A 2IPOA 3N8KA 1R8YA 1TQ4A 2Z2ZA 1W35A 1XAGA 1Z7GA 5C1DA 1VCOA 2VPYA 4YJ3A 4DGSA 1IMJA 1XL0A 3AIIA 3GRAA 5G1NA 3TMYA 1E2LA 4HFRA 1YUNA 4P3NA 4US0R 1TF5A 2NUPA 3NJ4A 3A26A 2IXTA 1QIIA 5J23A 1IN4A 1U8ZA 2J6IA 4Q16A 1KDVA 3FGPA 1UK9A 1V2HE 1L5ZA