1UKAA

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 101
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ukaA00
1QTIA 1QIHA 3CCCA 1DQZA 2QXUA 2VATA 4ETWA 2HA4A 3F98A 5JZSA 3FVRA 5AI5A 1GKLA 4LYDA 2AJLI 1RWQA 4X71A 5H3HA 1ZI8A 4UBLA 4S0XA 3RARA 2HU7A 4HS9A 2C0QA 2FX5A 1JU3A 1XRNA 1LNSA 2HA6A 3WQHA 1DWPA 2ZSIA 3ZV7A 3G9TA 3Q0TA 3DL7A 1LPSA 4BRSA 4IHAA 3C8DA 1LZKA 4H35A 3FAKA 4O08A 2G4LA 1XQYA 4UHDA 4FKBA 5ALDA 3STWA 1XRLA 1BRTA 2PSDA 5IVDA 5AKYA 3C8HA 4X3CA 4H7EA 3BF8A 2HDWA 3MVEA 2WUEA 3C5WP 2XMRA 4J0CA 3I2IA 1DT3A 3C6XA 3V1NA 3I2FA 4HZGA 4Y2SA 3I2HA 3KXPA 3H0CA 1Q83A 3JW8A 1J1IA 4ZV7A 3H2IA 1JU4A 3DQZA 5K3CA 4X7BA 4W9RA 1QFMA 2DFPA 1J07A 1T4MA 1LLFA 5IKXA 3R3YA 1W76A 3C5VA 3WIBA 3WJ1A 4RE5A 4X90A 5AICA 1THGA 3HYSA 5T4FA 1CRLA 2V9ZA 4G8BA 4UFPA 2DQYA 2IIVA 2PX6A 2HA5A 4LHEA 2WIJA 5CBKA 3GUUA 1LPMA 3FNBA 3ESDA 2B61A 5AIAA 5HFAA 1ZI9A 2ZYSA 5D3ZA 5EI5A 1UOPA 3E0XA 2HRRA 1K63A 1GKKA 1W75A 3NWOA 5JALA 4BB0A 3WK8A 5D7BA 2LIPA 4E11A 1TAHA 1A8QA 2VQ6A 4XX1A 2B9VA 2FJPA 1UFOA 1PJAA 3LS2A 3DYIA 2Z3ZA 2ZJFA 3VDXA 3QPCA 3NGMA 2CBGA 2DHDA 3WKEA 2XT0A 5AKIA 5C7YA 1VE7A 2EEPA 1B41A 4Y2XA 3AUKA 5AK4A 3WKDA 4PO3X 3R3ZA 1IUNA 2XUQA 5CT6A 4H0CA 3H1AA 3GZJA 1R88A 5D6OA 3DOIA 2Z3WA 4F0JA 2QKYA 4G8DA 5KWIA 3FWHA 1JMYA 1GXSA 4GXNA 4H7IA 3FYUC 2QM0A 2OGTA 5AKKA 1IZ7A 1H2ZA 2JGLA 2BUCA 2WM2A 2O2HA 4M0EA 5EHNA 1XZMA 1U65A 2I3ZA 5A62A 4CCWA 1QLWA 3B5EA 5ALVA 3WIOA 1JT2A 3BJRA 3MGAA 4G4JA 3LIPA 4K2AA 3G02A 2GBFA 1QIEA 4UBOA 4KE6A 5CT8A 1LBSA 4HRXA 4OU4A 1P0QA 5HF5A 4DSAA 3UUEA 2XMCA 1TKRA 4F60A 2ZJ7A 4P9NA 5IVIA 1CUUA 4QWWA 1HQDA 3H04A 2C4HA 3DOHA 3OC0A 5F4ZA 2P8SA 3AIKA 4AZ0A 5AH0A 4XVCA 5ALZA 1A88A 2PM8A 4FLFA 5DYTA 4D9JA 4Y2TA 3K9BA 4X6UA 1JKMA 1UK9A 2HU5A 3ESAA 3BIWA 2EDCA 3RKSA 3CCBA 2WSLA 4J0DA 5DNWA 5HCUA 3H18A 4GECA 2YXPX 1XRMA 4FNMA 1J2EA 5EIAA 3AILA 4F5ZA 4EY4A 5C8XA 2XUIA 2XUJA 3DDUA 2DR0A 2CEKA 2H7CA 1MJ5A 2WFLA 1MAHA 3ZWQA 5JZBA 4ZRDA 1UT6A 3D0KA 4M0FA 5JD4A 2RHWA 2VAXA 3C45A 5ALTA 5LZ4A 2AJ8A 5AKZA 3F97A 2JGMA 3C43A 1ZICA 3QMVA 3AJAA 4XIIA 3UMJA 4J0HA 4BYMA 2WUDA 4G4GA 4BAUA 5AKEA 3WK9A 5HF9A 1YCDA 2PUHA 4L9AA 3DJYA 5DWDA 2FUKA 3MUNA 1N5RA 3DKRA 4U2FA 1CUJA 3QMMA 4GDMA 5ALHA 5LKAA 1QOZA 4DTCA 1GQRA 3IURA 4P08A 5EHXA 4WFKA 2GBGA 3M83A 1EDBA 3CXUA 4OYYA 3OTQA 1WPXA 5CT4A 5AM1A 3FYUB 3I6ZA 4BCBA 2RIPA 3HJUA 3I2JA 1YASA 4AZ3A 4UHEA 1M33A 5HQ3A 3A2NA 4CG2A 1DQYA 3QPAA 4U2CA 4DGQA 3ESBA 1CUHA 3HC7A 1Y7HA 2XUPA 5D3KA 2WFZA 4JH0A 2YASA 4IH4A 4ZV9A 4WY5A 4B82A 1XLVA 4YX9A 1GPKA 1CUYA 3BF7A 5KBYA 1CPYA 4BE9A 4WY8A 5ALGA 2I3DA 4UHHA 1CUVA 3GBSA 2CKMA 4U2EA 5JD6A 4IO0A 1ORWA 5EIHA 2XLBA 2HA3A 4W63A 3G9UA 5HK8A 5K3DA 2QUBA 3V48A 4OYLA 3PF8A 2GBIA 1YSCA 2VJBA 1P0PA 3BDVA 5JZ9A 5K3EA 2R11A 1IUOA 1H2XA 3IDAA 1EVQA 4GW3A 3DEAA 4N8EA 4Z49A 4BZZA 3DNMA 5JASA 1NU6A 4CCYB 1USWA 2CMFA 1XZJA 2DSNA 1G66A 5T4BA 2WIGA 3FCXA 2VJCA 2CB9A 4X91A 1WPRA 1CUXA 1QJ4A 1K6EA 2WG2A 3AFIA 2DHEA 1DX6A 2B20A 5AO9A 5EHZA 3HEAA 1C4XA 3VXKA 5EHQA 3WZMA 1SFRA 2OAEA 4BZWA 3D7RA 4FNGA 2HRQA 1ACLA 1CUIA 4DSZA 1WB4A 5T4EA 4Q05A 4F21A 3ZI7A 1CUGA 1D07A 4K6KA 3LLCA 3FYTA 3ICWA 5DYYA 2C0PA 5AM0A 4IH1A 2PPLA 1ODSA 4ZGBA 3V9AA 1R3DA 4LIPD 3VISA 1EK1A 4OSEA 2PUJA 2XUKA 1BCRA 4JUIA 1MTZA 3NOXA 3DCNA 3PE6A 4CG3A 1QIIA 1LPAB 3ED1A 1WOMA 5CW2A 1UXOA 3E1GA 4GHWA 3IUJA 4WFJA 5ALLA 3YASA 1MX5A 1MPXA 2PSFA 4X85A 5FV4A 3C87A 1W6RA 2X76A 4C4YA 1CEXA 3KOOA 5LP1A 2OGZA 3IULA 4B84A 3K6KA 2OXEA 2BKLA 2XUDA 4JEIA 5AI6A 1ZI6A 1CUCA 3G0CA 4FFWA 3DKKA 2WILA 3I1IA 1QIJA 4UHCA 5FP0A 4J0IA 5LYYA 2PSEA 3HI4A 1ZD2P 4BTLA 4ITVA 5LIPA 1BEEA 1UWCA 2C7BA 1EVEA 1VE6A 1YAJA 1C7JA 1EA5A 1K5PA 2JF0A 3BJMA 3A6ZA 3VJLA 2ONCA 5AM2A 4PW0A 3QZUA 3HRHA 3EIOA 2VTVA 1F0PA 2JEZA 3ICVA 2XQFA 4G8CA 2RAUA 1ZGBA 3WWDA 2V98A 4WCVA 2QTBA 2BGRA 3BXPA 1YB7A 1R9NA 2RGUA 1XRRA 4DM7A 4FFVA 3N2ZB 3WKBA 3W05A 3I6YA 3D2AA 4ARBA 1IZ8A 1UKBA 4KAAA 1FFEA 3BIXA 4KACA 3S8YA 2XE4A 3C6YA 3GFFA 1BN6A 4A16A 1XLWA 1FFAA 3WA7A 1PV1A 1CLEA 2OQVA 2WHQA 2VF2A 3R0VA 1LBTA 5YASA 2H9YA 4X6XA 2GZSA 4B85A 3WL6A 1DX4A 3FCYA 1ZJ5A 1LZLA 1ZD5A 5AOCA 2Q0XA 1P0MA 3SWWA 2QZPA 3F9CA 4J7AA 2AJBA 1AURA 1QO9A 3HABA 4UHFA 4KRYA 4UBIA 4BVJA 4KE9A 3WMRA 2J4CA 3ZPXA 3G9ZA 2H1IA 1HBJA 1VXOA 1ACJA 1BS9A 3IUMA 3E3AA 4QZVA 1LPNA 1P0IA 4YK7A 3SC2A 3V1LA 5CH8A 1GPNA 3O4JA 3HLKA 4OU5A 1QFSA 5FKJA 4FLMA 2WUGA 2D0DA 1OXMA 4Q3KA 4B9AA 3WI7A 2HHAA 5EIEA 4BBZA 5A6VA 2OCGA 1CUZA 4EHBA 1EB9A 1QIKA 2WG1A 4H7DA 3OPMA 1SCIA 3H2KA 1GGVA 1GZ7A 2W22A 1G4HA 2Y1KA 5DLPA 1U8EA 3WLAA 1LPOA 2VJAA 1DT5A 1YAHA 2WKWA 1EB8A 4BCDA 1UK7A 4AMYA 3IBTA 3O4GA 3STTA 5JATA 1Q84A 4DNPA 2QUAA 3FVTA 3D5EA 1CVLA 4HXFB 4UHBA 2Z8XA 4H18A 5IVKA 1XROA 2XUFA 4CIBA 1FFDA 4DNOA 4Y2UA 4Q3LA 5LZ7A 4C89A 4RGYA 4NMWA 1X70A 3ILSA 2AXEA 4YASA 3HACA 4HXGA 2J4FA 2QVBA 4CG1A 4B9EA 5J3JA 4DMHA 1DTEA 3FLBA 4BDSA 2YH2A 1Q0ZA 4KR0A 4PF1A 1CUFA 2HADA 4DLNA 1WCYA 2ZYIA 1YS2X 4TVKA 4B83A 4C6HA 1MU0A 3GELA 3P2MA 3F96A 5E4TA 4DMKA 2JGIA 4MEBA 4JYPA 3PICA 5AI0A 2OCIA 3HSSA 1X2EA 4C4XA 5A7GA 2E3JA 2BGNA 2ZYHA 1AZWA 4BTVA 5HK9A 2PSHA 2WUFA 5DTIA 1IUPA 2VJDA 4GEGA 4QWMA 1BROA 1WHSA 3DS8A 3QITA 4HVTA 1SCKA 2ACKA 1BN7A 5C81A 5ISMA 4HAIA 1AC5A 2JGKA 5DNUA 1YA8A 4Y2RA 1JMKC 2OQIA 1OCEA 2H7YA 3G0BA 2AJCA 3DYVA 4Y2PA 4MQMA 1TQHA 4FHZA 1EXWA 4MYDA 2O2IA 2DHCA 4B81A 2QOEA 5BOVA 4X97A 4X95A 2XMGA 2QMQA 3H2HA 1QE3A 4EY5A 3BL8A 1QIMA 1E66A 3KDAA 4EY8A 3A2LA 4I19A 1H22A 5HF6A 5ALYA 1NU8A 2XUAA 2OAGA 2XB6A 5ALKA 1LGYA 1W4LA 1QO7A 1H2WA 1ISPA 2K2QB 5FPPA 1XZKA 2PSJA 3I28A 4J0GA 1GPLA 2C5GA 4QDTA 3B3QA 1EH5A 5K3FA 4WDRA 5CT9A 1XKTA 3W06A 2QXTA 5K3BA 4J0KA 1JJIA 5FPQA 4AMZA 1CUAA 4ZI5A 2XUOA 3DL4A 1A8UA 3R40A 4X00A 4H7KA 3A2MA 4QDUA 4BC0A 3CN9A 3STVA 4X93A 7YASA 2WJ6A 4BAGA 2XQGA 1WM1A 4AQDA 4BATA 1XKLA 1DINA 1QIFA 1UKCA 1ZOIA 3R3WA 4AO7A 5ALEA 2BUAA 1MX1A 2YYSA 4FDMA 5HKAA 4JNCA 1Z68A 3QBJA 1SC9A 3H19A 2QS9A 4FOLA 2XLCA 4X6YA 3K2IA 3H17A 1CQWA 2JGEA 1LPPA 4K5QA 4M0MA 4ZWNA 4G1FA 3T52A 5JYCA 3QMWA 1N8SA 4LYEA 4ARAA 4LXHA 4OPMA 5HZGA 2WFLB 5C8ZA 3X3HA 2PU5A 3R3UA 3F8SA 2WJ4A 1R4ZA 4G9EA 1CUDA 5AOAA 2RHTA 1E3QA 4DMFA 3WL8A 2Y2UA 3WK7A 5JAUA 3FLAA 4PSCA 4H7JA 1CR6A 3PFBA 1ZGCA 2CZQA 2BUBA 2WFMA 3IB3A 2QJWA 4KE8A 1F6WA 4J03A 2VAVA 4B0PA 4N8SA 2HFJA 4MEAA 4PV7A 5DNVA 5JAHA 4RNCA 4G9GA 2J3DA 3C6ZA 4N5HX 2HIHA 5CH3A 4BP8A 5AI4A 4OB7A 2G5TA 4I4CA 3TEJA 1XZBA 1HL7A 4EBBA 3I2KA 3A70A 2GYVA 3W9UA 1THTA 5FUMA 4Y2VA 3QPDA 3WK4A 2HL6A 5CXUA 3TJMA 2DCMA 3WWPA 1BU8A 1T2NA 2HU8A 4C88A 1ODCA 2BJHA 4BVLA 2WG0A 2J3QA 2O7RA 2GZRA 3JYHA 3AZPA 3W04A 1QTRA 5DYWA 4Y2QA 2ACEA 3FSGA 4INZA 4EZIA 2OLEA 1VA5A 5HQ3B 4FTWA 1IVYA 5JANA 3RLIA 4A23A 4AO8A 3AIOA 1VKHA 4DIUA 4GWLA 4QNNA 4P93A 4QA9A 3B12A 4KRXA 1ETHA 3F67A 2HA0A 3D4LA 3L1IA 3NUZA 1DWOA 1AQLA 4HTAA 1BCSA 4NVRA 1DU4A 3N0TA 4WFIA 2VT6A 1QONA 5AIBA 3PF9A 4GI1A 3R3XA 3DLTA 1ZIXA 1AX9A 3G9XA 2ES4A 3EQ9A 1E5TA 1TRHA 4MYSA 2VEOA 2XMSA 1O6GA 5AKLA 1XZLA 5LZ2A 1DWQA 5LZ9A 1F8UA 3PFCA 4P92A 3HZOA 4W1SA 5ALMA 3OM8A 5ALJA 3QH4A 2G63A 1CUWA 5CXXA 5ESRA 3G8YA 5JAPA 1ODTC 3WL7A 1HLGA 4UFNA 2JGJA 4B0OA 1MT3A 5AP9A 1L7RA 2HA2A 3G0IA 4H7HA 4FBMA 5AI9A 4DNFA 4UUQA 1GQSA 5JD5A 1KU6A 5IH7A 2G5PA 2XQIA 5ALRA 1GT6A 3VVMA 4KAJA 5BWCA 3EF3A 1XZCA 1VZ3A 4E15A 2WTNA 4A5SA 2XMQA 2RI6A 3WKAA 1RYYA 3LIIA 1S8OA 2C58A 2WIDA 3R41A 4Y2YA 2HFKA 1CUSA 1JI3A 4H7FA 1CUEA 2JBWA 5CTAA 3V1KA 1BEZA 3SK0A 3KSRA 1VOTA 4FWBA 1ORVA 5AKXA 4B80A 2W6CX 1XZGA 3ESCA 2BCEA 4PNZA 1K8QA 2VSQA 1UZAA 4Q82A 4AN1A 5ALNA 2PBLA 1XZEA 3TGLA 4ZXFA 4QLOA 1QIDA 3JWEA 5AKJA 2WIKA 4UPDA 5A7HA 3AIMA 1W1IA 3WZLA 4Q1VA 1XZFA 1EHYA 2HM7A 2QRUA 4QE3A 4N5IX 1AUOA 3KD2A 1TK3A 5ALIA 4FLEA 3Q8WA 3ZLUA 5BWBA 1UOQA 2DQZA 3VJKA 2XDWA 4EB0A 1R9MA 1G5FA 1VA4A 1HPLA 2BFNA 1NX9A 1CQZA 4MQLA 4WDQA 4EY6A 5ALXA 4V2IA 2OCKA 4NS4A 4Y9SA 4QDZA 1U4NA 3C70A 4KJXA 2H7XA 1UOOA 3ANSA 4BRZA 2QR5A 1KEZA 4EUSA 5KREA 1Y37A 3AINA 5AK3A 3T4UA 2Y2VA 5FXMA 4MWTA 4W1PA 3S2ZA 5AI8A 4AXBA 5EFZA 3OG9A 1FFCA 4U2GA 4MXDA 1R1DA 3PUHA 4L3WA 4YPVA 1A7UA 2FJ0A 2XQKA 5ALWA 3VKFA 3H2GA 1HKHA 1CV2A 2XMDA 4QDOA 3G0DA 3WL5A 2WHRA 1HDEA 4BP9A 2ZVDA 5FOQA 3AZQA 4H77A 5ALOA 1JJFA 3FOBA 2GYUA 3I1YA 1XFDA 2BAGA 5AK6A 2OG1A 3L1HA 4C4ZA 2XQJA 4UFOA 2O2GA 3W9BA 1E8NA 1YA4A 1XRQA 3QM1A 5K5EA 3STXA 5T4HA 4BVKA 1ZIYA 4G5XA 2IX9A 5I7UA 3I2GA 4IQ4A 1I6WA 2QJRA 4L0CA 1JJBA 1ZD4A 5EGNA 1YR2A 1XZIA 1YB6A 2HA7A 5FRDA 4GBGA 4U2BA 4LXIA 1TCCA 2C5FA 2QT9A 5AKHA 4PSUA 5AM5A 5E4YA 3OURA 2XMBA 2ZJ6A 5AM3A 1EK2A 3IUNA 4W1QA 5JAOA 5AM4A 2AJDA 4KAFA 4E14A 2UZ0A 1FFBA 1K4YA 4BAZA 1AKNA 1R50A 2OPHA 1ZJ4A 3M82A 2WU4A 1YS1X 4DYHA 2WHPB 1N5MA 3LCRA 4N8DA 3BDIA 4DNQA 1MN6A 2ORYA 1Y7IA 5CRIA 4UBJA 4I3FA 1FJ2A 3STYA 4NZZA 4TPKA 4CFSA 5JADA 3GROA 3TRDA 4WJLA 1CIJA 1MNAA 4BDTA 4OB8A 3WWOA 3FYUA 1F0NA 4C01A 1N1MA 3EQ7A 3U0VA 3V1MA 5IVHA 5LLSA 1G42A 1Q0RA 5LZ5A 2Y6VA 4KEAA 2JIDA 5FLKA 2Y6UA 5LZ8A 3CN7A 5LKRA 4C87A 1A8SA 1L7AA 5DJ5A 2GBCA 2O7VA 3C6BA 3WYNA 3ZLTA 2ZSHA 5ALPA 2VT7A 5CT5A 4EA6A 1SOMA 4AB1A 4BC1A 2ECFA 1EX9A 4L72A 1EDEA 1W52X 3R3VA 4Q34A 2PVSA 3LP5A 1B6GA 3ANTA 3G0GA 5ALQA 5ALUA 5JIBA 5DTJA 2WJ3A 3O4IA 1QGED 4BE4A 1L7QA 1VLQA 4PSDA 4OD0A 3WK5A 5AK5A 3AZOA 3FLEA 5A71A 4DMCA 1X2BA 4IH9A 3WK6A 3M3DA 1LPBB 3OOSA 2PU7A 4B7ZA 1MAAA 4AO6A 1EI9A 4J0JA 2R8BA 1KU0A 4BCCA 5C8VA 1ZD3A 1H23A 1UKAA 1EINA 3MUOA 4J3JA 2OCLA 5CH5A 3W2TA 1E89A 4CI9A 1VJ5A 4CCYA 3BE8A 3FSGD 1FSSA 4K6HA 1AGYA 3DD5A 3O4HA 4FBLA 1E8DA 3PI6A 2X8BA 4PQEA 4HRYA 1TCBA 2IITA 3KWJA 3O95A 3IA2A 1VZ2A 2WLSA 4UBKA 4KYVA 1WB5A 2XUGA 1UK8A 4AX4A 4Q3OA 3PDCA 1IMJA 4XWGA 1MO2A 4OUKX 1U2EA 4ZREA 5E2IA 2ZYRA 5AJHA 3O9MA 3U1TA 3D59A 3WYDA 2XI4A 2NW6A 3D2CA 1XQXA 5ALFA 1O6FA 4W1RA 3WJ2A 5AHXA 3SX4A 4UBNA 2PL5A 5HKBA 1XZHA 1XQWA 2I03A 1JFRA 2XMZA 4GLBA 4RE6A 4B6GA 5AOBA 3WA6A 1QIGA 3RM3A 5CURA 1OILA 1CFJA 4U2DA 3O0DA 4XJVA 1H2YA 6YASA 2D5LA 2WQZA 3QYJA 1XZDA 4ROTA 2CJPA 1RP1A 5K3FB 3KWFA 3ZLVA 2WTMA 1XLUA 3VJMA 3STUA 5A7FA 2WHPA 4MJ3A 3O9VA 3M81A 3QVMA 4LKOA 4MWSA 1BE0A 3D2BA 2ROQA 4RPCA 4X94A 5SYMA 2V96A 3HXKA 1TIBA 3D3NA 3UUFA 3IVMA 4FMPA 5HFNA 4JYMA 4LXGA 4HXEB 2V97A 3VVLA 1SCQA 5E4JA 4TGLA 2EDAA 1TCAA 4X92A 4E46A 5I8PA 2CUTA 2B4KA 4QDXA 2Z5GA 2OGSA 2VA9A 1UK6A 1AMNA 1EDDA 5I9IA 4OB6A 3E4DA 1XQVA 5KWJA 4K6GA 4G4IA 3I6MA 1XRPA 2RONA 2JGFA 4QLAA 1VXRA 3PUIA 1QZ3A 5K3AA 3WWEA 3WWCA 3FBWA 3EQ8A 3G7NA 4KE7A 4UBMA 4Y2JA 4Y7DA 5SYNA 2WU3A 5JARA 3WKCA 1MX9A 5ALSA 3IUQA 5A2GA 3IIIA 3L1JA 3EBLA 5HF8A 1E8MA 3H1BA 2PKYX 1PFQA 4AN0A 2XUHA 5BV7A 5AKGA 4CIAA 5CMLA 1MNQA 2WIFA 1WHTA 4EY7A 2Z8ZA 2X5XA 3GA7A 2JEYA 3RK4A 2GYWA 5FDFA 1J06A 1WB6A 4QEKA 4OCZA 1CUBA 3H2JA 2I78A 1C7IA 1XZAA 3BWXA
chains in the Genus database with same CATH superfamily
1QTIA 1KHHA 4Q21A 4Z0TA 3ZX4A 4CODB 1JHRA 3MGKA 3LQKA 2PT7A 3OCWA 4RZHA 5DK6A 3T7DA 4ENPA 1KBQA 2GI4A 3DF7A 3CLRD 4LOAA 4G41A 4LRYA 4ZVKA 3WGVA 5JVDB 3FD8A 4YUYA 4XCXA 3EGXB 4RESA 5L9AA 1AZTA 1S96A 2C77A 5HTKA 2WSYB 3A1EA 2MR6A 2RHGB 3I45A 4X71A 3ROFA 3LDFA 3OZUA 1KK0A 2XITA 1Q19A 5CLIA 4F4FA 5LQAA 4L74A 4UBLA 4ZMBA 4F56A 2YBDA 5L7WA 2XOKD 2H85A 1NUHA 1WTAA 4LWPA 5I9BA 2QYOA 2XH8A 5LDDC 4BNVA 4Q1BA 4AJNA 5KYUB 4CIYA 4YMHA 1M73E 1OLXB 4O2RA 1XRNA 1LNSA 2HA6A 3NP7A 3WQHA 3ROMA 2DX7A 1F48A 1MTOA 1DWPA 3LTNC 5JSKA 2V54A 4EHAA 4BQOA 2D1FA 3O4RA 3G9TA 3W0LB 5CFPA 2UUBB 3TZ6A 1GZ4A 3DL7A 4QVGA 3GGPA 2ZWVA 5ESDA 2D5BA 3MCAA 4QU9A 2VEDA 4AF7A 4L73A 4N7JA 4ZZ1A 2EAUA 1VDZA 4BRSA 1QMPA 1HDGO 1H4TA 1SA0A 2JD0A 2Q50A 3CZRA 1TQ6A 2QJOA 4Q19A 5KDDA 4G0VA 3C8DA 4YRNA 3P0HA 4EDHA 3SIRA 4URWR 4O63O 4L4UA 4FKBA 4UHDA 1BCSB 2Z04A 2OHHA 4KSCA 4U7JA 2I29A 2QNRA 1BRTA 4HEHA 2JIPA 5CDSA 5DFAA 3ZDZB 1V9SA 2CLLB 1J7JA 3S0JA 3K6SA 3I92A 1ZK1A 3NC4A 1NSTA 5AKYA 5KYWA 5JQWA 4LOHA 4LYJA 2K6GA 3BF8A 4H7EA 2HUNA 2HDWA 2FHSA 3FKJA 2OE2A 4B33A 2WUEA 3TX6A 4J0CA 2XMRA 1PWZA 1TC2A 1DT3A 5HE9A 4EKNB 1FX0B 3TLJA 3TZBA 4A2CA 4PO1A 1CQPA 1G8KA 3I2FA 2RAPA 4HZGA 4HX2A 3U9TA 4XOIA 3AVPA 5DH9A 4MMYB 5L3SA 3HA7A 4UDYX 1QH0A 4AQ7A 3CLRC 4ITRC 1NJ5A 2HRCA 1NF2A 2CLKB 2VWQA 1N8TA 3FBTA 1E58A 2GHIA 1BQ3A 3GA5A 3O91A 4WXPA 5EXDA 3T3EA 4BFCA 4YCSA 3IKVA 4CKCA 1WY5A 1KC3A 2DFPA 1R4NA 1MD9A 3F6RA 1T4MA 1D2MA 3OLCX 4Y9UA 4O2BA 1PFYA 4D6YA 1LLFA 2A9OA 4DAEA 3PUZA 5IKXA 4RVCA 1EE9A 3GX1A 1T8UA 2PV7A 1W76A 2XR1A 2YJ6A 2OXFA 3DBOB 3N6XA 4BGIA 2IKQA 4G3XA 3SQMA 4Z7OB 4G0PA 1E4VA 3TW6A 3OMLA 4D0LB 4HQLA 5A3VA 2EEZA 4QHTA 1TMYA 1ESEA 5AICA 4ZKDA 2JCYA 3H16A 4KMOA 1F9AA 3ENWA 2QTVB 2VP3A 1I5RA 3AU9A 3GJ0A 2ZI9A 4XA8A 1C4KA 1CRLA 2Z09A 3OVMA 2R4TA 4Z0PA 2B4YA 1VJRA 3AF2A 3KB1A 1STOA 4GYJA 3WGJA 4C7BA 4ZT2A 1L5LA 2FP3A 3FB4A 4PBRA 1KIMA 1GZ3A 4R3UC 5LB2A 2EYQA 2ASEA 2PUDA 2PMEA 3KOYA 3A36A 2PXCA 2IIVA 2ZVPX 5BN5A 1AH2A 4WAUA 1NMQA 4LSMA 4CMBA 3C4VA 3U26A 2EWVA 3O94A 4Y6PA 1M8JA 4UOQA 1F60A 3NETA 4A3SA 2V6MA 3SZLA 3D1LA 3JRXA 3F8WA 4RF5A 3NHWA 2FEAA 2ZB2A 4GXQA 5IEJA 1TCVA 4W5OA 1L7DA 4RC9A 1FLVA 5FLYA 2WIJA 2XYHA 2J7KA 2R48A 3GUUA 5IUJC 3FTDA 1UBLS 4YAIA 3HKDA 1H94A 3ESDA 4YRDA 3I01M 1FSFA 1N9GA 4LS3A 4Y3UA 5E2AA 1C0EA 3W1VA 4YMIA 2VNIA 3R77A 5EJFA 5EI5A 3E0XA 1YL7A 2HRRA 3W79A 4DLTA 2ZI6A 1JEDA 2MIIA 4HDCA 3KKMA 1T6YA 2RGGA 3AH8A 3NFYA 3PQ7A 4RD4A 1PS8A 3P0FA 2CLCX 2DZDA 3EN0A 5BMVF 3AP1A 4P84A 1M0TA 2PYDA 3WMXA 4MULA 3SE7A 1K63A 1L5HB 1F1BA 1Q0SA 2YL2A 4F1WA 1GKKA 1HTTA 2JASA 3UZUA 5FL3A 1QV9A 1KSJA 1ABEA 2V9CA 4IGAA 1RBMA 4V1CB 4UEJA 4HAVA 2BFCB 2C5LA 2LIPA 5D7BA 3TNDA 4ZTZB 5JCJD 3V8MA 4ER6A 3CMMA 1A8QA 1ML3A 3V8VA 1W5BA 4UNIA 1XEAA 3KZVA 3RJTA 3DKPA 1WETA 4C0HA 2AE2A 5J2UA 1UFOA 2VRBA 1AUPA 4PN3A 3WAJA 2AQ8A 2ZVJA 1A7JA 5B6JA 1MO4A 3I72A 3VO9A 2VO1A 4CLRA 4XIGS 1PJTA 1R0ZA 1N4AA 3DYIA 2Z3ZA 1HDOA 4Y9RA 3RRFA 4JEUA 1I3OA 4NARA 4B6PA 4RJKA 4E5YA 2F1HA 2QU8A 4DCSA 2CUZA 3I6BA 1CRZA 1F2VA 2PGAA 3U62A 1XDGA 3THWB 1BWRA 4B3SB 3NYQA 1H0SA 4LV6A 1AM4D 1TQ2A 1VE7A 3JZDA 5JJLA 3MUEA 3ANLA 4B5KA 2G0NA 3CPEA 4YP9A 2NADA 2VPYA 3GCZA 3AUKA 4FYJA 1OX5A 5AK4A 1GG8A 1N9ZA 1H42A 4IDAA 1W44A 1QHSA 2IPXA 3H9CA 3NQ41 3UMRA 1SKAA 2J5XA 3AX6A 1JXMA 1G20A 2FZVA 4QTXA 2XUQA 4PFJA 4HYTA 3W8FA 1C9YA 3SXJA 2WWFA 5DZSA 3ORSA 3ID6C 4M1YA 3JQBC 1VPDA 4V3CA 1SUEA 2YNMD 5KTKA 1QR6A 2GNOA 3L02A 2NTVA 2WU8A 4ZD6A 5D6OA 1ZSYA 4BQNA 4I5FA 2Z3WA 3IVCA 4V03A 3TYXA 4F0JA 1YFJA 2QKYA 3EGEA 1ZM7A 4RHEA 5KWIA 3KYDB 1AK1A 1GXSA 3DDCA 4C3OB 1F20A 2ZCVA 3ZX5A 1T2VA 3LUPA 5DKFA 1L2TA 2V1XA 2YXEA 4Q66C 4RPGA 2ZUVA 2QM0A 1FP4B 1MFPA 4B48A 3BD7A 3C5HA 3GFVA 3IFSA 1C1XB 1H2ZA 1Y0BA 1XVIA 1QHGA 4Q1FA 3WZ2A 5ENDA 4OYRA 4CUJA 3CTMA 4AY2A 2JG3A 2G83A 5J4LA 3LX6A 2BI4A 1UDRA 2O2HA 1FRNA 1GIAA 4M83A 3T5GA 4L8WB 2V3VA 2DWPA 4C30A 1MGPA 2O3TA 2PFKA 2W2KB 4PC1A 1YU9A 5B4UA 3BTSA 1U65A 3N2YA 1X7WA 3IT1A 1YI1A 2NSDA 3OEED 1FJXA 3B5EA 1W4ZA 3OEWA 1T1RA 3R4VA 3IESA 1ATIA 1PG0A 3D7MA 5L3RA 2I22A 3HFRA 1KNXA 4UMFA 2F43A 3MGAA 5G2OA 5B3JA 1EIWA 2BM0A 4K2AA 2ST1A 1U2ZA 3SVLA 3LWBA 3I1FA 4ZCPA 3U3XA 2PRJA 4P86A 5P21A 1Y9DA 3SYNA 4QYIA 1JYFA 1EWTA 3DZIA 3LDGA 2ZUTA 3T38A 1YIDA 2NVUB 4IZOA 1X14A 3IPXA 2G8NA 1ZD1A 2QN6A 4PGHA 1LBSA 1KSFX 2RGAA 3JQ8A 2KPOA 5CT8A 4CF7A 4G23A 3AETA 2AKEA 2AEJA 1WNFA 3FA2A 2WJVA 3COPA 1JR3A 1K3UB 4YCJA 5D85A 3FVVA 3IVGA 4N3AA 4YWJA 3U7JA 4MVWA 2P8JA 4FOSA 4F60A 4MIKA 1PGJA 3HR7A 4IFEA 5IVIA 4DRZA 1JQLB 3GR6A 4J0QA 1YF3A 4EW1A 2XKBA 2W7TA 2A67A 2O57A 2HK8A 4ZAYA 2C4HA 4P3YA 3CCFA 1GVNB 1SXHA 2OB1A 2YNMC 3KQTA 3OC0A 2P8SA 3KE9A 3OZVA 1QYWA 1Z4LA 3F4LA 4KDEA 4M1QA 5DTEA 3F4KA 4H1UA 4XVRA 1EM8A 4FQ8A 4IJVA 5CA1F 3QXHA 4DDUA 4I9NA 3SQLA 5AH0A 2B69A 2PAAA 1SXIA 3X1MA 1NW8A 1RPNA 4FLFA 1Y9ZA 3D2LA 4J76A 1N6KA 4Y30A 3GDFA 4L0QA 2OG2A 3N9IA 3K9BA 1IIRA 3C1AA 2ZR7A 2IP1A 3A9CA 3Q98A 3V3TA 1NVGA 1Z0FA 5IDXA 5M2QA 2UZ4A 1BE6A 3O93A 4NU5A 1WG8A 4YTEA 2BFDB 4JBIA 3CCBA 4GGPA 4J0DA 1BHO1 1F1JA 3C3YA 2BRUA 3IAUA 2IYNA 2YXPX 1JQ3A 4O3FA 5HIJA 4DV7B 1Q0LA 1N1DA 3KZCA 4XX0B 1J2EA 1W34A 1IM8A 1A8HA 2H6EA 4U6QA 3VOBA 5C8XA 3MPUA 1OYYA 3HGMA 2VXYA 2DR0A 2H1FA 4MVCA 1DDIA 2O6LA 2H7CA 3VSBA 1H93A 5JZBA 2X1HA 5JMPA 3D0KA 3TR5A 5KI6A 5BR4A 3OLZA 3EYAA 3GJZA 2RSLA 3Q40A 4MPPA 2IHKA 3EF0A 4X1IB 3U4GA 521PA 3OLYA 2H2GA 5JD4A 2X7XA 3GLGA 1SAYA 2VAXA 5DNYB 1SR8A 1IN8A 2NZUG 2JRLA 3AM4A 1FK8A 4UNSA 1DOZA 1PR2A 2HHHB 1XCMA 3CZCA 2NXJA 1M1NA 2PGXA 4TVSA 1UT8A 4TV9F 2AJ8A 4HGYA 1FYWA 3FMPB 4MKHA 1E3SA 3AJ9A 2C7OA 4P4NA 2Q6IA 4JITA 1ZNQO 5DHFA 4XIIA 2C2HA 4HH0A 1FDIA 1GYRA 2IS6A 4CMCA 4BYMA 3VR6H 3R5HA 4YV2A 4G4GA 2NQ2C 5HS4A 1WF6A 2C8JA 5AKEA 5JBIA 1H6CA 1IG0A 2AVDA 3EEBA 3CZAA 1XVLA 4GX5A 5CP8A 2IYTA 2GSWA 1L5ZA 3DBVO 2PUHA 1L8XA 4L9AA 2P3QA 1U3CA 1HZJA 2OK8A 3AI2A 3BD9A 3H11A 4OQMA 5DWDA 4FILA 1TYZA 4HV4A 3MUNA 2IODA 3DKRA 4BIIA 4KKVA 3FUUA 1NKSA 1D2HA 3LNTA 3M6VA 1FNNA 1M66A 1RXEA 2EWMA 2ZJYA 1MVLA 3LAWA 3MT8A 3QMMA 5FO0A 1QOZA 4N5NA 2P4QA 4M0CA 3IXLA 4DTCA 1Q0PA 2JFHA 4TMFA 5BNWA 3AVXA 2DPGA 4YR7A 3DNFA 4XEUA 3NEYA 2PPVA 5CX1A 1NY6A 3K1AA 5DW0A 4AC9A 4FINA 3BT7A 4OJTA 3JQAB 1FDWA 2B0JA 3U7RA 3UKJA 2CLOB 5EHXA 5J4YA 3IPLA 1L9XA 3QFCA 3UJ8A 1UANA 1P1FA 1EDBA 3HS3A 2WJJA 1R5BA 1RDFA 2FPXA 1U6JA 2J87A 2XWPA 1FP6A 2OHXA 2REQB 2TMGA 4DF3A 5LLDA 4U7TB 4GC9A 2JKVA 1JEYA 2Q4EA 5T41A 2KYRA 3VTAA 3QKRA 4TKUB 1KEKA 1PEKE 1PZXA 2PANA 3USCS 3KQYA 4OAOA 5I3ZA 3FAZA 1I94B 3KKZA 4D0SA 5AW7A 3W5BA 4N7BA 4FFSA 4MW4A 3KAQA 4Q1DA 2A0YA 2D54A 3PU6A 2WTBA 2NNLD 1JPNA 1M33A 1S8AA 1IY0A 1V45E 3EEFA 4JCOA 5AOVA 4ZVUA 5HQ3A 2UYHA 5FNZA 3R9KA 2PH5A 5FEUA 5JI2E 1TF5A 2V7XA 3A9UA 3ZN2A 5DLDA 2OBXA 3IJRA 2PX4A 3ND8A 1I33A 4KIUA 4A8TA 5B30A 2WNIA 1J1UA 4MPDA 5F33A 1IEVA 2IEAA 3ANXA 3LQFA 1EK0A 3H7IA 2I7TA 3OPYB 3QPAA 1LBIA 2C4VA 2F64A 3GDOA 4BJ5A 3JXEA 3PRHA 3Q7SA 5B7NA 2JDIA 4LC0A 5BQ5A 4C4AA 1ND6A 1SOVA 4I3HA 4L2IB 3QQ5A 3KEGA 3HRKA 1C2TA 4IRUB 4G0NA 4DGQA 3ZW8A 3ESBA 1FFYA 3HC7A 3FPJA 5J2TF 4MHTA 2XUPA 1V7ZA 2R8EA 3VX4A 3GJXC 1VMIA 1SU6A 2FLVA 3Q9SA 2YASA 5FBVB 1SU8A 2AFVA 3ZHVA 3HM9A 1VP9A 1AZLA 2GCPA 2YC2C 3U39A 2CNKA 4K03A 1WQ3A 4MINA 4YX9A 1GPKA 2G82A 3ZKAA 3BF7A 2VHVA 1MC5A 5FHQA 4QSMA 5BSTA 3UYKA 3WBKA 1US8B 1ZYUA 1VJ1A 4IL5A 4AK9A 1KAQA 4D4HA 3L7DA 5I9TA 1P8AA 1CPYA 3GFPA 4BRUA 3TLYA 5BW6B 4LQ4A 2FEMA 1BKDR 1CUVA 1LFDB 3E48A 5GONF 3OQBA 3VDNB 5KNLA 2A0UA 1C0KA 1E2MA 4C7XA 1XTUA 3PTLA 3LKBA 1D04A 4U2EA 1AZSC 2O4CA 3SFVA 1HNNA 2PG3A 4FS8A 1J2UA 4I4TA 5C5EA 4IO0A 4BEWA 2C88A 1ZJZA 2IC5A 1GNSA 3SYLA 3K92A 1WKBA 1KKMA 4GZMA 3UENA 2XLBA 2HA3A 1V5WA 3G9UA 4LK3A 2C2YA 3MM4A 2QLFA 3MTJA 4UEWA 4NDAA 3ZKWB 5EIXA 3LWNA 4DV5B 2QUBA 3U60B 3V48A 2IW1A 1A95A 2RE8A 2NO0A 3T1OA 1DBRA 2CE2X 2FLKA 3EB9A 4OYLA 2BEJA 5LXTA 4KNYA 1T2DA 3EXFB 1JECA 2QN9A 1M6EX 4LF5B 3N76A 4IXWA 3EIEA 1M0SA 4GM4A 4TRMA 2B7CA 3WGQA 3S70A 1ZH8A 3HZHA 3PHLA 3M2PA 2XZOA 1GV0A 2A9RA 1D4AA 1ESCA 1XSEA 3AOGA 2XB9A 1B16A 4Y9TA 4E88A 4F8EA 4YAJA 1EVQA 3G59A 4JVSB 3HRIA 1GD1O 1U1DA 2ZAGA 2IWHA 3CO5A 1PR9A 2YWBA 1QZUA 4Z49A 5GVSA 2JI6A 3FFAA 3RBVA 1KJZA 3ZDDA 1WEKA 5IKEA 3SF8A 4CCYB 1USWA 3FMVA 3PUKA 2CMFA 3L4JA 2XA2A 2B82A 1QDUA 2AEFA 2F9FA 2ZIGA 1M67A 4I7EA 1SWVA 4ZAWA 1WBDA 1YQWA 1R6BX 3FGOA 4QUGA 2WIGA 3FCXA 2EV9A 5HW0A 3IAM1 1CUXA 2YRWA 3TO5A 1QJ4A 1ZP6A 1DRVA 1K6EA 5GMOA 2ZE8A 2QRQA 5F1PA 3ODPA 3VR5H 3JQ6A 4MB6A 5EHZA 3JRWA 1MG0A 3OFKA 1FFSA 5FWYA 1QP7A 1QB7A 1FUYB 4KXUA 1RHKA 3ENNA 1WZIA 2WF6A 1U0FA 3CNBA 1LTHR 3EIHA 3DULA 3HEAA 5CVVA 1TJPB 1C4XA 1W2HA 3RIHA 5EHQA 3S99A 1M2VA 5H9WA 3I23A 3A4YA 3RV4A 4D57A 3WZMA 1EYZA 3EARA 3PC4A 2FPRA 5IARA 5I7FA 3E8XA 1PL0A 1IU9A 4NENA 1GL7A 2FZKA 4UZFA 3UW3A 3ZE2B 4MQFB 2AI2A 1Y6JA 4MP3A 4FNGA 5HGXA 5DOZA 1WB4A 5T4EA 2WW8A 2FRDC 4GX1A 4R9RA 2PE5A 3R5JA 3LTEA 2YMLA 3ZI7A 4JWTA 4ZQBA 3V1UA 3VSDA 3PGXA 4RCVA 4Y1RB 5AVXA 3LLCA 3NEAA 3B3FA 3U3DA 3COWA 1A1VA 4C07A 3FYCA 4AX8A 5IABA 3EHDA 4D44A 1O87A 3HP4A 1E32A 3OUUA 4FGLA 4F2DA 4HNSA 4TTIA 2HK7A 3LW8A 1IQRA 2YV1A 3B1FA 3G8CA 4CM1A 2IT1A 4KXYA 4FC6A 5TIIA 3SFZA 3MYYA 4X20A 4D0RA 1KHTA 2FETA 2Q8NA 1J5PA 3CUSA 1UDAA 3OPVA 4OFWA 2D2VA 4HLDA 4J75A 3I37X 3WTCA 1WCIA 1L5RA 1S3SA 1K6MA 3GIWA 3HN7A 4PZDA 2GFHA 2QRLA 1RI4A 4PHCA 4XQCA 4PLYA 2PUJA 3BA6A 2FGJA 3D6VA 2ZJ1A 3R7BA 3A4MA 5E9JA 5M29A 1MTZA 3CSUA 4JI7B 3B1ZA 4BKUA 3SBEA 4UVDA 5I3CA 1LPAB 2VH5R 4FS3A 4JROA 2OFXA 1FRQA 4YP6A 3LCJA 1LWNA 4ZDIA 3DCYA 1CZHA 3IUJA 4FX5A 3GH1A 1KK3A 4NEQA 4KXNA 3F5SA 2UYQA 4AG3A 1CR4A 1XFAA 4J16A 2ZJOA 2PSFA 3CONA 4KDFA 3MWFA 4M1OA 2V7GA 3AXTA 3VNSA 5HX7A 1VFPA 4KQ1A 4EMBA 2X76A 3CO0S 1MAUA 2RAFA 3EZ9A 2OC4A 4NY1A 1NBAA 1YIOA 1CEXA 4MQUA 2J0SA 1HETA 1IUKA 3KOOA 2VT2A 4QBIA 5E0OA 3VAZA 2CMKA 4KH0A 3D8HA 3G2KA 1Z0ZA 1Z4OA 2O48X 1N7JA 1OI2A 2AF3C 2OXEA 3TAUA 2RGBA 1W8IA 2XUDA 4TKZA 2WLTA 3M8KA 5B3LA 5CEEA 1JYSA 3KTDA 2ETXA 2GEDA 3WMEA 1QVRA 5BR8B 5JQGB 2HIGA 3KS9A 2X0IA 3W4JA 1CB7A 5B4VA 3X2EA 1P0CA 1ZI6A 2M6KA 3RAJA 5MHTA 1UQRA 3LK6A 3G0CA 4H17A 4CI0B 2E1PA 3SD7A 1VDMA 4FU0A 2P9JA 3Q3IA 3DKKA 2WILA 4FKZA 3I1IA 4HDKB 1QIJA 5DLYA 5HUJA 4JV5B 1G8JA 1MHPA 3DD1A 1FMJA 3KB8A 1TMGE 2I1VB 5COAA 3AFHA 3KIPA 4AKGA 5LYYA 1ZD2P 2Z2JA 4PZZA 1AGNA 1TJ5A 4UZEA 1MG5A 1WW8A 1XQ6A 2WBLC 3QVWA 4MV4A 3N8IA 3F2IA 3WLOA 4DA6A 1VJCA 1BEEA 1LJLA 1YH3A 2BP7B 4UOEA 1RRMA 3I9LA 3ROQA 3K9NA 3QKIA 3TDKA 2R8ZA 2GAIA 4IGIA 1YAJA 3B2NA 3E23A 3QHPA 5TARA 2JA1A 2XNCA 3DOEA 3LY8A 1TB4A 1SBQA 2XJ9A 4WQMA 4YRQA 2GF0A 1KZ1A 4Q5IA 3BJMA 3VJLA 1CS4C 3PZRA 4UTNA 5TVKA 3LU1A 2PJRA 2CXXA 2O3QA 2ONCA 3WIVA 4DCUA 5AM2A 4OX9Y 1P7PA 2WIAA 1CZOA 3ZWOA 2H18A 1GN8A 3IEPA 4JBXA 4PW0A 2KHZA 5AXAA 4BGVA 5BMVB 3QVOA 1IK4A 4GVPA 3ZXSA 1Y1RA 3OX3A 2IIBA 2AR0A 3Q0IA 3RUDA 4CM9A 5KQPA 4ZMSA 3T1QA 3OTIA 1BFKA 5FD8A 2FMKA 4DPMA 3D4NA 2QTBA 3DZJA 4AYWA 3NM6B 5BORA 3BXPA 4G5QA 4CCAA 4IIDA 3DE4X 2G0TA 1Z3CA 3K9GA 3NBYC 1BU5A 1E98A 1XRRA 2RGUA 4Q47A 4X41A 3GOHA 1VSUA 3N2ZB 4A92A 4CTKA 1ZD8A 3IP6A 1TW3A 3HJHA 1IM5A 1DKLA 5ERXA 2ZSBA 3WQSB 1BOFA 4GP7A 1CQJB 4MZXA 1IJKA 2IF0A 5FFNA 3R7FA 1QCYA 5F9HA 1KEVA 2A2ZA 2Q4RA 4MR9A 5FWNA 1K08A 1IXZA 2RKBA 1NAHA 4ARUA 4ARBA 1YZQA 1R0WA 3AL0C 1C8BA 1FFEA 4RMHA 4YRFA 1PYDA 4KQKA 2IEBA 4B71A 4UM5A 1Z47A 2W8ZA 3S8EA 1G8MA 3PGKA 2XIQA 2MMGA 3L7MA 1GL9B 3T1YB 1NE2A 3GP3A 2VA8A 4FGJA 1QAMA 2V6GA 4FW8A 5PGMA 2F6RA 4G0XA 3VZSA 2JIMA 3I1JA 1DDGA 2XQVA 4DARA 1FFAA 4PLPA 3WA7A 3GEEA 1YVRA 1CR2A 1E2BA 2ONKA 2PL1A 1B3RA 2H63A 2ZIXB 3OETA 3EXEA 3GGGA 4W8HA 3R0VA 4BN0A 1LBTA 4CF4A 1I4WA 4HGOA 4MDFA 4GPTA 1OASA 3PNPA 2CFTA 4YRJA 5TE9A 3WL6A 4X9XA 3LVFO 4A0RA 1LZLA 4IUDS 1JPJA 1NR1A 2H0QA 1PHPA 1RMQA 1QYIA 3KCNA 3FWYA 2DR3A 2QM8A 1HDYA 2ODAA 3AF1A 3IDZA 4PZUA 3ZGNA 3UK2A 4LF4B 1P7VA 2AJBA 2QXYA 5K51A 4GT1A 4QGHA 3HBFA 1QO9A 3HABA 4MIOA 4YQZA 4UHFA 3TNYA 5GINE 1Z15A 4KRYA 1J8MF 4CM3A 3ETLA 3HDHA 1AB5A 2JGAA 2WTXA 2J4CA 1Y6ZA 1FNSA 1XVAA 3KZMA 4J4TA 4NV0A 5L3QA 4QJIA 1PEDA 2JBAA 3WTBA 3MOSA 5C8YF 4EGCB 2ZBPA 1WSWA 3P2EA 1BS9A 3IUMA 4QZVA 4PONA 1MC8A 3HP1A 2ZRGA 2CFRA 1N5LA 3H5AA 421PA 4TMWA 2XKAA 1CDOA 4JC5A 5TJ9A 1Z37A 1WBJB 2W4QA 3HLKA 1DC4A 1U4OA 4X61A 1DQPA 1OLUA 1R8YA 2K7ZA 1GZDA 1U3VA 4AFNA 1P44A 4D9NA 1V1MB 3L82B 3MQFA 3PWTA 1I9CA 2JB9A 5AW2A 3BA1A 2D0DA 4QOGA 3MELA 3ZS9A 4DUGA 3ZV5A 4HWGA 2ZETA 1WOYA 4LMPA 4MWEA 4RYDA 4WZZA 2HJHA 5B1IA 4BQSA 2GAFA 2IOQA 1ZM3A 4JCCA 4BNXA 2I9KA 5EIEA 5A6VA 2OCGA 3AB3A 1IN1A 1AS3A 1P2VA 1CUZA 1ODIA 4GBED 4MQEA 4NJEB 4D80A 1EB9A 4EHBA 1JJ7A 4B3FX 2CSXA 4H7DA 5GJVC 1SCIA 1GGVA 2W22A 1G4HA 3EH2A 3SU8A 1WXQA 4GSKA 1IOVA 3CVUA 3H2ZA 4DLZA 3JD1A 4N0PA 4IBOA 1A9QA 5EUQB 1KY2A 2OKCA 4AECA 2PS0A 1ZH6A 3C3AA 1IH8A 3GRUA 1U0BB 3ZJTA 4JJEA 3DH0A 1DT5A 4KXLA 4WK0B 4HJRA 4GICA 2WKWA 1EB8A 1L9KA 3A58B 3EYWA 3VZRA 1P4HA 1WULS 3U4DA 4AMYA 3IOCA 4JUFA 4OQYA 1Z8NA 5J5AA 3MMNA 4F3YA 1BDHA 1QRRA 1U8CB 2HV9A 3C5EA 4P38A 3TJZA 1JFTA 5IXYA 1ESNA 1KO8A 1N0UA 4QYXA 1KI4A 5IN5A 1C3JA 1N57A 2VDKB 1C7ZA 3HTXA 3HWSA 2RHBA 3QE2A 3LNCA 5CB4B 3FWNA 5JTTA 5F5LA 2NYVA 2YW2A 2BGLA 3ZHOA 1DCKA 3NHJA 3C3CA 3RRMA 3TLXA 5B3JC 5BV1A 1UPTA 3W5JA 3RU2A 2DG2A 2HCFA 4RZXA 3BXGA 5LBTA 1TRKA 4DNOA 2CW5A 4L07A 4J7UA 1UODA 3RUFA 1RWWA 1QSGA 3Q11A 5LZ7A 2WY2D 3LHDA 3OKFA 2OXCA 3A3KA 3P2YA 3ZU2A 2AXEA 3ZW7A 4Z6KA 4V1CI 4DEVA 4L7VA 5DCUA 4R8LA 3UM9A 3QEAZ 3H5WA 5DU2A 2XUZA 2XRZA 1EJ6A 2VDOB 4TV9B 2GCNA 1HDXA 5KOJB 2I1QA 1XTJA 4P4TA 3M6AA 5DHQA 1DCFA 1SCUA 4GR4A 5L7YA 4ZAXA 3K2EA 2HADA 4AS3A 4BFZA 1MZPA 2BMDA 3L0BA 4QBFA 1WF3A 1WCYA 2P2ZA 2QTGA 2ZYIA 3E84A 3M4JA 1DMRA 4FT4A 2M98A 4IRXA 4CEJB 2UKDA 3RVJA 4DDKA 3EDRA 5E6SB 3LSTA 2CUKA 2CYBA 3GELA 3NAZA 5G3YA 5G0TA 3GDHA 4C6HA 2VQEB 1ZG3A 3THRA 4E5KA 1YS9A 2X7JA 3FSEA 5C37A 2O50A 2JGIA 1Z62A 1TM4E 2ZRAA 1HOTA 1E0KA 4MEBA 1ZC3A 4JYPA 4LC1A 2RBGA 1P9NA 4RZQA 5L51A 5LU8A 3SI7A 2XA9A 2OC9A 4PX2A 1TEVA 4C4RA 4L5IA 1SBIA 1XMPA 2BDEA 2I76A 4I9UA 3EGVA 5K9ZA 2XF2A 1OX4A 3LBHA 1P7ZA 3OBIA 3RWMB 1ONSA 2OWEA 2FWAA 1IJEA 2EBFX 1KMNA 4TTTS 2H1OA 4UW9A 2UV8A 3GFQA 2RGNA 5H83A 1DXYA 4YT2A 2NP6A 2QQFA 3KYJB 3FPFA 2I7XA 4KMMA 5FWXB 4S1NA 5HNKA 2W0SA 4G8JA 1TJ3A 2HIMA 4PPGA 1NNEA 2YOHA 3E81A 3QLEA 2DF8A 4RIEA 1IUPA 1U98A 4DRXA 2G5GX 4ZO6A 4CFZA 4JYMA 1BROA 3CX7A 3CB2A 3P20A 1NJ6A 4C4OA 2QMOA 2ACKA 2B36A 1PGPA 1F4LA 3DLHA 5C81A 2JGRA 4B31A 3F74A 5I4CA 1T9GR 1AC5A 5AWFC 1GUBA 3O84A 4JBNA 2Z43A 5D5HA 3U4MA 5IC6A 2BHNA 1ZO8A 2QYHA 3V2IA 2HWWA 4EEKA 1JMKC 1Z33A 1L8LA 3DGFC 1OCEA 2H7YA 2QYTA 2ODQA 3G0BA 4TRRA 4YBRA 4YQEA 3ZWVA 3U7QB 3T1VA 1E5LA 2JDID 4MHOA 2HBQA 1VBFA 1RQ7A 3DDWA 4M1KA 1TQHA 3V4ZA 3B7GA 4GL2A 1X19A 3WGYA 2QAGB 1OVGA 1JHZA 3IE2A 4KN9S 4AP5A 2P2CA 2YINC 1PLJA 2QN3A 1KH2A 4HTFB 1IY9A 3QU7A 4YCCA 1KS2A 4B8YA 1L5FA 3HWX1 4OBBA 3AW9A 1IB0A 2YR0A 4LUCA 4MUMA 4N18A 2OHJA 5B36A 1EK6A 3AFOA 3LP6A 1RQ2A 2CJFA 1T91A 2HU2A 2J0UB 4QRIA 4DLXA 4ZZ0A 2F4VB 1PL6A 4TMVA 5HM8A 4HDNB 2HAEA 4RK4A 1O97D 1SD1A 4RVSA 3JWHA 2RGRA 2AHRA 5A4IS 2R62A 3G23A 5BQPA 4DLPA 4EY8A 2AG8A 4I19A 3ROZA 1Q0TA 2MT9A 5F9FA 5HF6A 1KJ8A 821PA 4UPVA 2ID8A 5KYXA 1NU8A 1CJUC 4HYEA 4U9HS 3N8KA 3ITKA 3GNQA 2P6OA 4QXQA 5F52A 1QWSA 3KLBA 3SQOA 3WLFA 5A4MS 4RETA 2QENA 2FDXA 3VNRA 3CV3A 3HB9A 3ONVA 2A58A 2YZ2A 3VPSA 1YDEA 2XB6A 4D96A 1A9PA 1G21B 3AP2A 3FIUA 2BPOA 3M1AA 3MRSA 3TKAA 4IDFA 3NCTA 5IC4A 1D2AA 1B0AA 2L69A 3KHUA 3E3LA 4RABA 1W4LA 4OAPA 3JD3A 4B74A 4DY6A 3BMOB 1VMEA 4FYMA 1R10A 2K2QB 1Z6QA 3LF1A 4MJXA 4OHYA 1A97A 1FP1D 4B34A 2B1IA 4D8YA 3IAM6 3HI6A 3ESYA 2MYPA 3MS7A 3NPAA 4K9SA 4G2TA 4K40A 1T10A 2PZAA 4OFBA 2WF8A 2JARA 3PGA1 3LH5A 1GCUA 3OQHA 4RBNA 2BZSA 5FL7A 3UA3A 3FTQA 3SAJA 1L4GA 2EGUA 2OD2A 3I28A 2VZ0A 3KHTA 1VIDA 2B1JA 2YHSA 3PNQA 2C5GA 2G9ZA 3VNBA 4UD6A 2QN1A 3B3QA 5F7XA 1OXTA 3BREA 4MVYA 5DGIA 9MHTA 2NYAA 1CY2A 1DXHA 2P0EA 3P9YA 4WD3A 1IVSA 5F77A 5CLFA 5K4GA 1R9GA 4JBWA 4RTQA 4KFSA 3VU3A 1TAGA 4NJMA 3A05A 2AOUA 2MR5A 4S35A 3G17A 4AL4A 2IUTA 4OGWA 1W7AA 1NOKA 4A0HA 1Q74A 4J0KA 5FNVB 1ZCFA 3B5IA 4ZQHA 4MVJA 1H6DA 1S3IA 5KHLB 3KXLA 3HKEA 2FGKA 1Y98A 4AMZA 2TECE 5I7VA 2YRFA 4G84A 4YAEA 4KV7A 2QN2A 1ISFA 1SMKA 4CG0A 5CLHA 3SCZA 5LQJA 3C8MA 4YXFA 5IZ4A 2QRPA 1JHPA 4XEHA 3H86A 4G67A 3HN6A 4IF6A 4X00A 3FOEC 4H7KA 5AJUA 4HWTA 4GPZA 2O1XA 3A2MA 3I6QA 1O97C 1X7XB 3LA8A 4GR9A 4O4IA 4IZHA 2YZGA 4Q4LA 3KTOA 5H68A 3GV0A 3STVA 3BQNB 2P9YA 1BXGA 2O3SA 2ZR9A 4ZPXA 4E22A 2XQGA 4KB5A 5MF6A 2FCAA 1RADA 1GGEA 3CZ4A 3NBUA 4CM5A 1ZAKA 3PYMA 1DINA 4BATA 1UKCA 5K0BA 1W36D 4Q00A 4IIJA 1PJQA 3JZMA 2CMGA 3VR5A 2QIPA 1P7CA 1W85B 1HSOA 3CUTA 3EXIA 4YCDA 5KTYA 3CKYA 1QH1B 1MX1A 1XQ1A 3LQQA 4MQ5A 1ZCAA 1X80B 1K98A 4DMMA 5HKAA 1DI0A 2FK8A 3A10A 3AHJA 3BZBA 3GJ7A 4J9UE 4TM7A 1I4LD 1EEHA 2IEGA 4U3JB 3WGLA 5AMXA 1Z6GA 2NXNA 3N0VA 3KUUA 3QBJA 1SC9A 2O2DA 2MSDB 4RKRA 2NYRA 4M9QA 2KS6A 1C3LA 1E9AA 2R66A 1CJCA 1RWKA 3GRVA 3K8QA 2QAJA 4LVCA 3O8OB 1JILA 2QS9A 3JATB 4FOLA 5GY7A 2CT8A 2NZ8A 3IAFA 3I0ZA 1VYTA 4M60A 4UMDA 3TSYA 4B47A 4PTZA 3PP8A 1BH2A 2I8AA 3K2IA 4YT8A 3H17A 1T8RA 3SOPA 1JHVA 1LPPA 4Z9BA 1OFIA 4WGGA 3NIBA 3MB8A 5GV8A 1KEEA 5F5XA 1OBOA 3JALB 3QE9Y 3EASA 4C3UA 1SHJA 4TKVA 1J8YF 5HZGA 3VR4H 2JIRA 4ZVRA 1CJTC 3DOCA 2VPQA 1NDUA 2WFLB 2LVBA 1LX7A 5BSVA 1VPVA 3OFNA 4TYPA 4YRLA 4L5JA 4IYJA 4JVNA 4C6RA 2RGEA 2W83A 2NU8B 2WJPA 3T0GA 5B5SA 1CE8A 2CKDA 1U3WA 2P35A 3BN3A 4WACA 2EF1A 1MUUA 1R4ZA 2ZBUA 3CLUD 2F8TA 4TT8A 3OF3A 3FJ1A 3I09A 4Q3EA 1JHXA 4MS3A 4W99A 2RHTA 1E3QA 5CVCA 5CD1A 2NUTB 2PTHA 5EIFA 4N6GA 3HO8A 5JAUA 4IXNA 3LV8A 4OI4A 1GTRA 1DKUA 1CR6A 4BOYA 2PT9A 2A1TS 2Q07A 2QJTA 2YMPA 3LPMA 3WBBA 1V8PA 4X1KB 1RPTA 2Q27A 4ZGWA 1MXFA 1U1EA 2BUBA 3IB3A 5HILA 4MUXA 3CVWA 1D9ZA 1F6WA 3KEMA 4M9XA 4YI3A 5CGZA 1QQ5A 2VAVA 5EE1A 4B0PA 1XD2B 3DHWC 1SELA 4UDXX 3C7AA 3OPYI 4U39A 1C0LA 5CBPA 1U7TA 1W36C 1MOSA 5HZMA 1VPWA 2ZS9A 4U63A 5K99A 3QU9A 1ISGA 5G1OA 4XGIA 2YC4C 2VZ9A 5KDOA 4OVKA 1Z35A 3EZFA 3PDUA 4MWBA 3MGGA 5ARBA 4US2R 3K35A 1ABFA 2DXIA 3HO1A 3LRXA 1Z4JA 1ZJJA 3QX7A 3TS1A 3JX9A 1YC5A 4BX0A 3C6ZA 3VUFA 4O4JB 1SU7A 2X14A 3PFWO 3A1SA 1GFIA 4BP8A 5KC8A 3TSCA 3HKCA 4M89A 5A0VA 3IX7A 3EISA 3I0NA 4MAAA 3TEJA 4KGZA 5IKPA 2ZGVA 3RH0A 5M04A 4PC2A 2QG9A 2IE8A 3KZ1E 4XWYA 4WUTA 4DKJA 3N07A 3BWVA 3CZQA 1YR9A 3A70A 1X77A 1N2ZA 1G20E 4FMDF 4KC0A 1GDTA 3A6FA 3H97A 3OE4A 5KQLA 3VVCA 1CYDA 3G49A 2ZRFA 2HL6A 3DLPX 5JVDA 4NFSA 3EGXA 1JIKA 1HG1A 4CM9D 3E9EA 2EG9A 4LRSB 3EDCA 3H4VA 3WGIA 3PQ8A 1T2NA 4J16C 4EFDA 1ODCA 3CRNA 1M2EA 3NI2A 4FYWA 1NW6A 2ZRHA 5K0JA 2EXXA 2O7RA 2WV7A 2ZYTX 5EY5B 5IJXA 3CLUC 1H0RA 5DYWA 5TEVA 3W04A 2AR9A 1DP4A 1ISIA 1RRPA 2ACEA 3FSGA 1XCLA 2VIIA 2X15A 1D4OA 4FHEA 4MV1A 3WP0A 4AZ3B 1Z4IA 3FGZA 1VA5A 2NU9B 4QOIA 3PWZA 1IVYA 1YB2A 2ZBVA 1OLXA 2BHSA 1O1YA 3INGA 1VGRA 3AIOA 4D5GA 1CBUA 1VKHA 5ECWA 2PNJA 4DIUA 1BQ4A 1EGMB 1PV2A 5BT8A 3UXHA 5CXQA 4QX6A 5C9ZA 1EESA 4P93A 3CWCA 2ZRBA 4KODA 1YZNA 4RPJA 1J23A 4R41A 3SHWA 3VOSA 3F67A 1COWA 1LBEA 3DFKA 2Q3MA 1GGMA 1JHUA 1UDWA 3FCSB 5E9QA 4BKRA 4ZI7B 2ERXA 2KLHA 4FXPA 2DPMA 1XN4A 1HT1E 1DWOA 1U7WA 4U7DA 1BCSA 4JC8A 1DU4A 2O1SA 3MN1A 2DBQA 1G7CA 1C8VB 2VT6A 2J31A 4MH0R 3RTGA 1AMUA 1XCJA 3OF5A 3ZVRA 1VJTA 4G1EB 4XRRA 4AUKA 1Y8RA 2X22A 3K1JA 4FR2A 3KQQA 1C3XA 1M6VA 3E27A 4WNIA 5DXJA 2G67A 3V4SA 2BH2A 3COZA 4I50B 4ZCSA 1T0PA 4R2LA 3EQ9A 1URPA 1TRHA 3VJRA 1WCXA 4C7OA 4BUCA 1JRLA 1O6GA 4MKFA 3ZCUA 1FX0A 4BWVA 1DWQA 2OCAA 3MWJA 4IICA 4QT0A 2XNDA 4YAUA 1ZN8A 3QENA 4D5EA 5KTSA 5LZ9A 4DV3B 1DUIA 3ICEA 1MOQA 2AN4A 1XMQB 5LMCA 4EVQA 1AQNA 4DV1B 1H1TA 1Z6TA 2WPNA 3UO8B 1U5BB 2DBZA 3RS9A 4G5RA 3OM8A 5H3CA 3TQCA 3VH1A 1SZDA 3BB1A 3WLRA 3ZHSA 3KWLA 1VIYA 2G63A 2VT3A 1JIXA 5U9CA 3QOWA 4DGSA 3QKWA 5ESRA 2D2EA 1RKUA 3H5LA 3DDZX 1EFHA 1EDZA 1HLGA 4CM4B 2HZBA 1Y4UA 4M1ZA 5BUSA 1NP7A 2P3LA 1UP4A 1NQ5A 3FW1A 4LV8B 5EJ8A 2PUCA 5HOEA 4ZIRB 1N2SA 1EWKA 3WYEA 3CS3A 4YDQA 5HCNA 3FPKA 4MI9A 5F4BA 4L5AA 4KQFA 3CH6A 1TMOA 2QZSA 2OZKA 3GCXA 3DE0X 3KFLA 4FBMA 4DLWA 5AI9A 3BHMA 3HN2A 3WOHA 3ILXA 2Z98A 4DNFA 2QTVA 4R8RA 3HBNA 3MCUA 2LCQA 4CMIB 4UUQA 4A2WA 3VKGA 2WABA 4IW3B 4B2YA 1KU6A 5DBEX 3UGKA 5JD5A 2I1LA 4IXTA 3D5TA 1P4SA 1V25A 1KFCB 2FW0A 1ZK3A 4DLKA 4EF5A 1EBUA 2BI8A 2PKRA 3EF3A 3GAZA 3MJEA 4J9VA 4P4GA 3TH5A 5BWCA 1IZYA 3ENKA 4KRFA 3EIFA 1RWMA 3GAAA 4OJNA 4JT9A 4WLUA 3ZWPA 1NVMB 4TKLA 2XMQA 2R1UA 3TG8A 4N01A 2NLOA 2PL9A 3AU8A 3GLGE 3FG9A 3KQPA 2EYUA 8OHMA 2O59A 4F4JA 1GZHB 1WXIA 3CA8A 2IZ6A 1E7YA 2VHCA 2ZYUX 3AV3A 5LDGA 3GT7A 4ABYA 3UAWA 4HEA6 3RGWS 3ORQA 3FRHA 5JWOA 4GMFA 5CA0B 2C58A 2VF4X 2YTZA 3O1JC 2PCJA 2C95A 5B1DA 5C1IA 3RRNA 4CGZA 3HEMA 1LUAA 1K8RA 2ZYWX 3I53A 4E07A 1CUSA 2AA3A 3EAGA 4L6CA 2E5LB 5JNSA 3U4QA 1JI3A 1K89A 4R31A 5DMHA 2VRCD 2AFHE 1KI3A 1CUEA 1ZN7A 4EGJA 1GNVA 1S01A 2PO5A 2GCOB 2Y3IA 1HORA 1GCGA 2DYKA 3STHA 1EFVB 3AHDA 4QTZA 3ZK7A 4YIKA 5CG1A 5C4IA 1HG0A 3ZJVA 3H0KA 1L5HA 4ZAGA 2CF6A 1ZA2A 3MLAA 3QUBA 3FGPA 4R2WA 1T0HB 1G6Q1 1QGZA 1BHQ1 2ZPAA 4GIBA 2AEEA 3TDMA 3ZQ4A 4JI5B 1ORVA 5AKXA 1XAHA 2BFCA 1NWCA 3IAS6 3W7BA 1XMXA 3M9LA 1NQUA 3QTBA 3RTDA 1XZGA 1FMCA 3HJAA 3GCDA 3C3PA 2FPOA 1NSYA 1DG3A 4TWBA 3M7IA 3UPDA 4MPRA 2GD1O 1JIJA 1K8QA 4PNZA 2GJ9A 3GLQA 2Q1YA 2XBUA 5MN5A 3BGSA 4MEJA 1SNYA 3IVAA 1QGDA 4MTCA 5ED0A 5G0VA 1AQYA 1B76A 1M5TA 2H54A 2X9LA 3C24A 3DMDA 3GQBB 4Z9YA 2QGNA 4AJIA 4DDWA 2BFEB 2WU0A 2XSZA 4QRDA 3TFOA 3TGLA 4P4LA 3ER6A 5K3OA 3TRIA 4XQGA 2O8DA 1UBUS 1GZVA 1Y6QA 3C5CA 4G1UC 4IMIB 2FPIA 4ZVVA 1Q95A 4MR7A 1NNLA 2YICA 4QELA 5TEWA 4IDGA 4D0NA 1T1GA 5D5PA 3THWA 1ZUIA 5CDHA 4DVGA 3IP3A 4PZPA 4QAJA 2GEFA 5LVAA 4PYIA 2WT4A 3DONA 2CL6X 1Q6YA 2PMCA 1EHYA 4W9MC 1THMA 4OKNA 2AE1A 2Q5OA 4WJKB 2IU6A 2JLVA 2IHYA 3QBTA 1QXSA 1AB6A 1YRQA 1RYEA 5ALIA 2I6TA 3IEKA 4FLEA 2LD4A 2LTAA 1G55A 3Q8WA 4PCVA 4QC2A 4W7IA 4Z4HA 1UOQA 2AVNA 2HREA 4HATA 4Z9FA 2QPLA 3QWAA 3R7DA 1SK9A 2UU9B 3ET5A 1ZH2A 4JHLA 3NVAA 4XJXA 3SXUB 3PQEA 4DLYA 2W6QA 3TD2A 4U9IS 3KYDA 1D0SA 3O3NB 4EGAA 1C4WA 1FYDA 2MSLA 5BOSA 4IJWA 4IIEA 1A2KC 2MSKA 3OX4A 4RZSA 1AS0A 1JQKA 1X8LA 5UKDA 1OWLA 3L1UA 3TIFA 1QU3A 3GDWA 2ZRMA 5GM1A 1JE0A 3TX2A 1C1XA 1NBWB 2ZBDA 3UXEA 4B75A 1CQZA 1FUEA 2GHQA 3LBFA 3LHSA 4ZAVA 2ZXUA 5TF0A 5JJCA 2VHXA 3ODGA 5DEIA 3WE7A 4A73A 4EY6A 2HRBA 1LY1A 4QSHA 4QFCA 1G8YA 2JFUA 2GASA 1USUA 1JDZA 2GS9A 4Z2AA 3KXDA 4TTJA 5FAKA 2TS1A 3QW2A 1P5RA 4IYRA 2AI3A 2A57A 3EXHB 5GAJA 5HBRA 4QDZA 2A14A 2IIQA 1AUXA 3IVXA 1SQSA 3ANSA 4C0KA 1J4AA 2FN9A 1E3WB 1N9KA 5HWSA 3EX7C 2BE9A 1O95A 5BWMA 3QG1A 3DCJA 1UINA 1ONOA 5AVVA 3DTTA 1HEUA 3RT1A 3QTLA 4QHSA 4ADSG 3ECSA 3BRSA 4H4DA 1XK6A 3TTVA 3GK3A 3AINA 4ZOQI 2Y2VA 2NVUA 5EHIA 2VHZA 4X7PA 1UADA 3SJCA 3GIDA 5AI8A 3WYCA 3A6KA 1L3BA 1RD4A 4FEAA 4QODA 4AXBA 3OG9A 3ETEA 4MXDA 5CM8B 3B3AA 1LI7A 3ACDA 2ZR0A 2HC9A 4CPDA 2IL1A 5KPDA 3QX3A 2FPSA 2OORA 1CV2A 1EM6A 1Q3KA 3LBNA 2PSSA 4WLVA 1DRKA 2ZVDA 4YMLA 5HQTA 1TM2A 1F4PA 1I3NA 2HN9A 2Z1NA 3GT3A 4G0OA 5K0TA 3OQOA 1X1CA 5TV2A 3HPQA 3OX1A 5TT1A 2IUEA 2BAGA 4NYJQ 3EK2A 1E61A 1E0JA 2XQJA 1UCFA 1X1SA 3TNLA 5JU6A 2FVYA 2Y27A 1U2PA 2GD6A 4EIWA 1E8NA 4LJYA 4MUEA 1A4XA 4TWJA 3VKWA 3UPUA 4TT3A 4MRPA 2BFDA 1XRQA 4LZLA 1WQ4A 2CL0X 3RBXA 5KX5A 1P1RA 4I9HA 3W5CA 2RGNC 4PG5A 4U7HA 1U90A 3KL4A 3PKJA 4KDCA 4IFTA 4F86A 2YS6A 3LP8A 4XX0A 4M3NA 4BVKA 4F5YA 5CCXA 1TUGA 1YGYA 5FI1B 3W2IA 1LDBA 5LOVB 1E64A 1WXWA 4QUHA 3ZTTA 1QLHA 1KY4A 4WOCA 2RGCA 3UHAA 3UMVA 3WS7A 4RA9B 2UVQA 2WDPA 4PFSA 4RSHA 3CRZA 3AHFA 1E5VA 1FBNA 3FF4A 5EEHA 4EGSA 1KARA 3LCCA 3T4EA 3SKXA 3V4OA 3AGQA 4HLUA 1R0RE 1UXIA 3LLSA 4FIZA 1ZVMA 4X1IA 3PXAA 3IB6A 5FL7D 5F12A 3EWAA 4DLRA 1ZD4A 1M83A 3E5RA 5TJHA 5EGNA 3QVXA 2HBRA 1W2WB 4D41A 4ZC8A 3BZUA 1P9LA 1YB6A 1O94A 1Z6YA 2HA7A 2EZTA 2IWRA 1JE1A 3MAAC 1EX6A 1I6KA 3P0RA 4U2BA 5TSDA 5EE3A 1KDVA 1TCCA 3QQPA 3EMVA 4IR7A 4MA4A 2C5FA 2NPOA 2QT9A 3TCKA 3KUCA 3UGTA 4C7VA 5HDQA 3ECCA 2XBLA 5KTTA 1KSGA 3G6WA 3MTIA 4AM8A 2EX0A 3D0RA 4YAGA 2FP4A 1XDSA 3PGMA 2H2WA 3PDJA 5C3MA 2VWPA 4AICA 4MVJD 5KNBA 5FX2A 1YMVA 3R09A 1A96A 3OE7A 4W1QA 5AJWA 4EHKA 1SG0A 2J33A 1JBEA 1C1HA 2D06A 2VZ8A 1K7XB 4TVBA 2XGSA 3X1XA 1P74A 4EG8A 2FCRA 5F7JA 5AJTA 5EMMA 4BPBA 1C8KA 3DVSX 2P1DA 1TUEA 2G25A 2IYYA 3QXSA 2WJGA 3Q2OA 3RJZA 1X7DA 4JQYA 4JKIA 4DCGA 3U17A 4R8KA 4NSNA 16PKA 4KSBA 5KTMA 4ZAFA 1YRBA 1ZSVA 2PX5A 3CY6A 1IXKA 4NKRA 1XEFA 3CC8A 2O8CB 3EUAA 5BSHA 1PR3A 1LBHA 2JAUA 2VXOA 4ZI2A 1HT0A 1A72A 3AVVA 4PYKA 3NFRA 2WU4A 3GARA 4BNLA 2FJUA 2ZJZA 3DXZA 5L4SA 1TJ4A 4IV5A 4KPFC 4JSYA 2BJVA 4OHKA 3BDIA 4DNQA 5BWNA 2FW7A 2V1UA 4Q3NA 1Q7BA 4BX3A 1SVMA 1Y7IA 2ORYA 1L6IA 2VPWA 3KZNA 1R4AA 4JR0A 3JQAA 4BZPA 3AYXB 3K4QA 1T4BA 1SVWA 2HMTA 2Q3LA 3HXPA 1PR4A 3STYA 4ESVA 1DS6A 1ECCA 1F06A 3DOJA 1FXUA 2JJMA 3MSXA 2HMWA 2XAUA 3J80A 4K26A 4M53A 2HUPA 3ET4A 3BICA 1OAAA 3GROA 1TM1E 3EXG1 5IDVA 3REQB 4WJLA 2V3WA 3GFBA 2AZTA 3FI9A 4OB8A 4BDTA 1Y9JA 5L8VA 2GLUA 2XB2A 1BGXT 1N1MA 2RJOA 3EQ7A 3OPQA 3C98A 5KKAA 3U0VA 2JAXA 1Y5IA 5BNTA 3A0UA 3C4JA 1TT5B 1XC7A 2ZCUA 3A27A 1QG4A 5D87A 2OZEA 2G1PA 3OZCA 4L1KA 3B9RA 4GNKA 4IJMA 2DQKA 1T8WA 1U7UA 1PT6A 1SRQA 1YQTA 4HMOA 4NBTA 1KI8A 4Z1OA 5LZ8A 2WMYA 2GFQA 1SVKA 3K7EA 3ZV4A 1L4BA 7REQB 2DBVO 3GRPA 1KJQA 4YRTA 3UJ6A 3VC3A 4RTLA 2E2WA 3I4CA 1IATA 3ROXA 3IP1A 3EEOA 1UBJS 4ZARA 3UK1A 4RWEA 5KVQA 4A0QA 1GEGA 1VI6A 1A8SA 2XWJI 4L2IA 1L7AA 3VSEA 4Q9DA 4PG8A 1EPUA 2IPMA 3R20A 5K8IA 2XCSB 1QYRA 2XY4A 1XCOA 2J07A 2R7AA 1D8AA 2CCGA 2JA2A 1UPBA 3G2LA 4WZBB 4EPYA 2JVIA 1LK7A 2KLBA 3WYNA 3VR4A 2EVWX 3ZLTA 4INAA 4OP3A 5ALPA 5LNK6 5KJEA 4LF8B 4RO0A 5B3AA 4EITA 1NAIA 2INGX 2OMKA 2OSBA 3E9CA 1VHDA 4GBJA 3ILHA 3FCOA 4HFMA 4B09A 2H0AA 1GJRA 3ANYB 3TZCA 4RIFA 1EX9A 4MV9A 4FW9A 4F7WA 3R3VA 4AKIA 2BMAA 1LSOA 2ZDGA 5J63A 3QFRA 2GK4A 1FS5A 3BHNA 1H4SA 3L0DA 3OQNA 1EG7A 3UA4A 1KZ6A 5ALUA 1Y8QB 4S1PA 3E9ZA 5CGQB 1HE4A 5CG2A 1ZOLA 1C9JA 1KPHA 1NLYA 3D8UA 3G1WA 2QGZA 3LO8A 4LCJA 1DX9A 4Q93A 1MOPA 1YZ3A 4OD0A 2JPDA 2XNHA 3QHQA 4JUDX 4WECA 3W5IA 4EI7A 5GIOE 4QQNA 1WVGA 2WSIA 3L0PA 3ZKWA 1QF6A 1UMDB 2CL5A 4CLXA 1LW7A 2P7IA 4IEIA 1WNTA 3ZNOA 3M3DA 4BNHA 3RS8A 3E7FA 4CM6A 3P7MA 3PJFA 1J0BA 4RVHA 2B2NA 1N6NA 1TPZA 4M0LA 4TTVA 2HF2A 2HKIA 3JPWA 1JSCA 1VG9B 2R8BA 3DFZA 4GDFA 4KKXB 4FJ0A 3AERA 4GM0A 1FOEB 2CCJA 4IP0A 3TLBA 3BTVA 3L8FA 3PIIA 3H9JA 3BL6A 1H23A 3P9RA 2Y1CA 3C1UA 1M0WA 1UKAA 2H08A 5CCEA 1JFLA 3DE3X 2COEA 3E3OA 4R8VA 5DP2A 1KR5A 2FPKA 4OK5A 4DS3A 1VMDA 4FMDB 2BI7A 2DTDA 2UZAA 2OCLA 4GD3Q 4PU0A 3CIFA 2X0DA 3E22B 2Z9DA 4HRVA 3BMQB 1CRWG 2AMYA 6LDHA 4KNWA 1S2DA 4CI9A 1VJ5A 4CCYA 3K1YA 3FSGD 1W0JA 4NBUA 5LA6A 2Z56A 1FSSA 3ZZNA 1IWPB 1P80A 2AWOA 2Q5EA 1Z34A 4KTTE 2FYTA 3DD5A 4CVNA 4D8VA 3INRA 4PZLA 5EXPA 3V4RA 3HV0A 3IQGX 1E8DA 3AW8A 3E61A 3ZE9A 4ML3A 1RQRA 3HQ4O 4NPHA 3JSAA 1M8PA 1OGJA 2W48A 3FHLA 3CR3C 4A6EA 4EELA 2NP7A 3GLRA 1FVOA 1I13A 4RPLA 2PZKA 2D5CA 4FFMA 4AN4A 1COWD 1U8YA 4JX9A 3P9SA 1KSHA 3FOCA 1K92A 1NZJA 2FPLA 2ZWOA 3C41J 4NTZA 2KB0A 2ZIUB 3T9CA 4UBKA 1EHIA 5DM2A 1WB5A 4M9CA 4ND5A 4Y6QA 2XUGA 5DGHA 1WV1A 4MQFA 4D3DA 3PDCA 2PZFA 1JHQA 5EJMA 1NFFA 3MJCA 4B8WA 1HX7A 4IQ8A 3IHKA 5I4KA 1LRJA 4D82A 3GB9A 1KETA 1MO2A 3ZWNA 2CHVA 4Y1RA 4OUKX 4LVOA 1IWOA 2R3SA 2AFRA 3CF2A 2HXSA 2ZYRA 1J42A 2VH1A 5E9WA 3SC4A 1OA0A 2Q4BA 2GTPA 3O9MA 2VK2A 3OJFA 3MCZA 2R8YA 5ERGB 3MWGA 1IVNA 8AT1A 4Q9HA 1NYLA 3N6RA 3R9WA 1XOIA 2XNDD 3M1YA 4LQCA 3K16A 5K01A 1JIUA 2FEWB 1V1JA 2QTAA 2C1XA 5ALFA 4F72A 4W1RA 2ODEA 3P9XA 3TOZA 4R2IA 5AHXA 4EMUA 4E2ZA 1EUDA 1F51E 3SHOA 3AEXA 1MH9A 1UKZA 1XQWA 4UUBA 3PC3A 1JFRA 4WIAA 4NOMA 4DLSA 2XMZA 3F6EX 1N25A 1NF8A 1JDTA 1S4QA 2AD5A 2YJ4A 1T1EA 4IPTA 4OQQA 2A5JA 4QOJA 2QY9A 1VLVA 1PWYE 2ZYDA 5CJPA 4GAEA 2FFQA 1K8YB 3TQRA 2Q5CA 1ENPA 1G2IA 1IQ0A 1QQ7A 1JDNA 1U0TA 3A6GA 3LWDA 3RJMA 1ZC4A 2ZTVA 5EWJB 2YV3A 3T15A 2QPAA 1LQTA 1TTQB 1YZVA 1Z22A 4RVGA 3OCCA 4HH4A 1E2KA 4BMSA 4U2DA 2R5NA 1Z4MA 1QHHB 3N2KB 3AI7A 3O0DA 2QX9A 3Q88A 3Q72A 5BYBA 4BMVA 6YASA 5JT1A 2FMXA 4D4LA 3AIIA 3HCRA 5BYJA 4BIMA 1NT4A 1HLFA 1XZDA 1YTLA 2R65A 5FQNA 3RBAA 5AVQA 2FEXA 4EG3A 5JROA 4YFYA 1J9ZA 1RP1A 5DBFA 4C4SA 1E2DA 2GXSA 4IX1A 3BBLA 1K27A 3VVBA 1E2GA 1HMPA 3ZLVA 4DBZA 3S68A 5JQGA 1SUDA 1FA9A 3ADKA 3GL9A 4L51A 3PC8A 1W47A 3GU3A 2IYPA 3NRBA 3AF6A 4I55B 3AUUA 4R51A 2WHPA 4LOKA 2B2XA 4MJ3A 3COJA 4UPEA 1M5UA 3ELDA 4O33A 1NR7A 2IOFK 3MCTA 3O9VA 4HDKA 4OMUA 3QVMA 1ZHOA 1T3TA 3RS7A 3VYTB 2ZULA 3GGSA 2IGBA 3BTUA 2ROQA 1GNPA 1MEEA 1BKSB 3DBRB 4I5EA 4OKIA 1IRXA 1H8ED 1R16A 1B6TA 1MO3A 2JAPA 2V96A 3PTZA 3WB0A 1CZKA 1DLIA 4JYBA 5EINA 1N2JA 3FGNA 2BP7A 4J2HA 4OQZA 4X1YB 2DLNA 3BRCA 3C7TA 4JLJA 4R6WA 5TY0A 3UJHA 4IOKA 3PE4A 3OAAD 4UXHA 4Z4GA 4BLRA 3TZHA 5DIZA 2J4DA 5TX7A 4B87A 3IVMA 5HFNA 4RF3A 1H9AA 1SQFA 4LXGA 1G5TA 2V97A 3K31A 4EYQA 1CNFA 1TVEA 5DBIA 3CEHA 1O54A 3HWWA 3VC2A 3NO4A 4RPKA 2W6NA 4UVEA 1GPH1 4QLBA 2QE7A 3NDJA 2GJ4A 5FPHA 5KZMB 3A9RA 3HH8A 1TCAA 3TL6A 1K75A 3ZWQA 4D97A 1BYIA 3PZBA 4JQSA 1DHRA 4CUZA 4NEGA 3WX0A 5I8PA 2R1TB 2Q45A 4U7PB 4W5HA 5CHYA 5KWEA 3UBTA 3VR3A 3IDQA 4RFSB 1UAAA 3ZDAA 3UJ9A 3N5KA 1I1HA 3GGCA 4ZA2A 4MB2A 5IM5A 1OAKA 2DECA 4BNJA 3OQ6A 1CQXA 1KYXA 1WXGA 4HSEA 4RAQA 4L78A 1R37A 2R87A 4N5DA 4DPLA 4QTYA 2J6CA 2Y1OA 4DIFA 3ZH9B 3E4DA 5SY9A 1XQVA 4MCJA 4MB0A 3TBFA 5L4LA 1XN1A 2PBFA 3ZDQA 3WAGA 2DPYA 2QTNA 2E4UA 3E7XA 4QFBA 4B7AA 4O4LB 1SN7A 1S9HA 3B8EA 3EUEA 1XRPA 4NFHA 1E3EA 1VKZA 3SVTA 2IXAA 1ZGJA 4JXXA 3RG2A 1XX6A 5JC8A 3PEFA 2FZCA 4IDNA 3DB2A 4Y6RA 4A6DA 3GJ8A 4C6SA 4DL9A 1XO1A 1NX6A 1QO0D 2UZIR 3EAQA 2G09A 3L4BA 4CNBA 2P65A 1QZ3A 5KNDH 1COZA 3DLIA 2RK3A 5EG5A 5GM2A 2BGGA 2LZ0A 2C78A 5F76A 3WWCA 4DA9A 1W0CA 2N1BA 3HSYA 3G7NA 4BNTA 3I5YA 3ZOKA 4JS0A 5KC9A 1JG6A 2X5OA 4DA8A 5ENZA 2OV8A 1E9FA 3I5MA 3MMXA 2F8MA 1JGTA 5EZYB 5F2OA 3W77A 5AW6A 2WQ7A 3TRJA 1KJ9A 3AEYA 3II6X 4G07A 4UDNA