3H6KA

Crystal structure of human 11-beta-hydroxysteroid-dehydrogenase bound to an ortho-chlro-sulfonyl-piperazine inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
260
structure length
260
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Efficacious 11beta-hydroxysteroid dehydrogenase type I inhibitors in the diet-induced obesity mouse model.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 100
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h6kA00
2J6IA 1WMAA 3RCBA 1SPXA 1UXIA 2P4HX 3KM0A 3WGOA 3V1TC 3ZWWA 3D3WB 5KJCA 1PWXA 2X58A 1WVGA 1D1TA 1WZEA 1QORA 4K26A 4E32A 3IKTA 5GZ6A 4YRBA 3K5PA 4IBOA 4JBGA 4YRDA 4XJSA 2V7PA 4AJIA 1GQ2A 1T1RA 4PG6A 3OBBA 4UVIA 4YJHB 4MP8A 2HK8A 3ZU4A 2Y67A 2Q2QA 2PK3A 2DLDA 4EGFA 1DC3A 4WOJA 3KUXA 4E21A 2EKLA 4DL9A 5JPIA 4FW8A 4NG5A 5DULA 4D3DA 2C20A 4BV9A 2QRKA 3GG2A 4CLHA 4OM8A 1I5RA 3GOHA 1EVZA 4J1TA 1KY5A 2FPIA 4K6FA 1UAGA 4IDCA 3GG9A 4IZHA 3C1TA 5LDHA 2EWMA 1HZJA 2IODA 2NVUB 1JKFA 2G5CA 2OL4A 2EGHA 3MJCA 5L4NA 1HE4A 3IP1A 1DIAA 3RUEA 1E3WA 1Y8RA 1KVUA 1NVTA 3BHJA 1PS9A 4IDFA 1IYZA 3GY0A 5G0WA 4DIBA 3JQDA 2AQ8A 3OA0A 4ITUA 4FC6A 4A5OA 3GPDG 4NZ9A 2GD1O 5JCJA 2DAPA 2GYYA 2GN9A 1CETA 4NFYA 3GLQA 1P1JA 2IEDA 3BA1A 1ONNA 1R6DA 2BI8A 3I3OA 4F45A 4BO2A 4FJ2A 1HRDA 3F5SA 1E0DA 1X14A 1BG6A 4ILKA 1A4IA 4RVDA 2J5QA 4PG8A 4IS2A 3ASVA 3GDOA 4TKMA 1SEVA 1E1NA 5JS6A 3IS3A 1UR5A 3E5RA 1GPDG 4BKQA 4QX6A 5AOVA 2WD7B 3LVFO 1MFZA 3HE3A 4J43A 4BMSA 4L0QA 1LX6A 2H9IA 2QZ9A 3GVHA 1XA0A 2YV2A 2QZZA 3MTGA 4S3MA 3IQDB 2Q1WA 3LK7A 4WCFB 3LC7O 3VH3A 3WOHA 1P1IA 3NT4A 5IDQA 3OIGA 3ZWOA 4HX5A 2AE2A 1VRWA 4KDFA 3GHYA 4NU6A 4M89A 2Z1MA 2V6GA 4OSOA 3V2UA 4PCVA 2PZMA 3U3XA 3QVSA 5KVQA 3GPIA 4J2HA 3JCZA 2P4QA 4NDNE 1OC4A 4XWYA 3QSGA 3RJ5A 3WGZA 4BKUA 2BFPA 3BHMA 4J16A 3VPXA 3JQFA 3PQDA 3KYBA 2XPCA 5F1KA 1Q0LA 2ZCVA 4NNJA 4UVHA 3DFUA 3S8MA 1PJ2A 4I5DA 4E2XA 4NBTA 2QYSA 1HT0A 2O48X 3I9NA 1UUFA 4RF4A 1PZHA 1V3VA 1P31A 4ALKA 4GI2A 1DIBA 4ZQBA 5IXYA 1FDTA 2Y1DA 1MXFA 5B37A 2V65A 5KCZA 1KY4A 5TLSA 3WB9A 4IZIA 4A7PA 1OI7A 2BKAA 1HDOA 3BYZA 4JBIA 3WNVA 3FF4A 2CD9A 1EQUA 4BO5A 4MIOA 1P1RA 2CNBA 3DZJA 3GNSA 3WBFA 4QQRA 3BMOB 4FPXA 4FFOA 2UUPA 4CM6A 1C1XB 1O6ZA 4BB5A 2GSDA 4NK5A 4BO4A 3PZRA 3DTTA 3SEFA 1AGNA 5AXCA 4IJKA 1DSSG 3PIDA 3AU9A 2X23A 2CY0A 3D3WA 1U4SA 3W4JA 4DYVA 1VJ1A 2ZKLA 3AWDA 3V1UA 5THKA 4YAEA 1P1KA 1QP8A 4QECA 1RYDA 1EUDA 1O9BA 1PIWA 4YJHA 4W9NC 2AMFA 4B4VA 1GEEA 1TI7A 3EC7A 3DBVO 1V6AA 2C59A 3GGOA 5ADHA 4TQGA 3QHAA 5I9NA 2VNAA 3LT4A 3WWYA 3SLGA 2JD2A 2NQTA 1UXKA 1CDOA 1YBVA 2VHXA 2X5JO 2B0JA 5DBIA 4YT5A 4EUHA 1DPGA 4OO3A 3OICA 1U5CA 5A06A 3LT0A 5C7IO 1R0LA 3LZ6A 1GUZA 2HUNA 1I32A 4CM8B 1YXMA 4I9UA 1L7EA 5HS4A 1ZSYA 4M49A 2IZ0A 2BELA 3H6KA 3HSKA 1R37A 1C1DB 1VE9A 2D3TA 2GN4A 2W2KB 2NVUA 3L9WA 5TJHA 4ND1A 3WGIA 1P9LA 4YAIA 4BL5A 4BGEA 1LUAA 4MIEA 3QWIA 3R1IA 2BD0A 1SAYA 1YE3A 3UICA 4BB6A 4RVUA 6ADHA 1CJCA 1O94A 3PLRA 4PFJA 4Q3CA 4YJDA 1JAYA 3ITKA 3PDUA 1NAHA 4BNUA 2OHXA 3TSCA 1ZK1A 4JQCA 4MP6A 1PGNA 5I9MA 1UDBA 1ZCJA 5CEJA 2ZQZA 2WE7A 1X1EA 3RC7A 1MP0A 3DBHB 4K9DA 3V2HA 4XR9A 3DO5A 4J4BA 3UCEA 4AJ1A 2PV7A 4QTZA 2GDZA 3JQ6A 4XQGA 1HYHA 3L6DA 3K96A 2RAFA 1B8VA 1EQ2A 1EZ4A 1A72A 1MV8A 3A9WA 3O8QB 3W8EA 5ILOA 2JFFA 2EKQA 4FBGA 2UVDA 3RBZA 1XYGA 3CZMA 4IM7A 1KC3A 4GAEA 5GY7A 5A5FA 4UUPA 1FJHA 2E37A 2VT3A 4LMPA 3TOZA 3WDSA 2GR9A 1U8FO 3HNPA 4WCFA 1DOHA 2Y0DA 4AVYA 4UVEA 1A4UA 1E7WA 3ICCA 3PFWO 1BXGB 5JNLA 2E82A 2EG9A 3C1OA 3C24A 3QIVA 1SBYA 4JBHA 1A7KA 3H5RA 4ALLA 4EEXA 1Q1NA 1KIFA 2NVBA 3K92A 3FWNA 3RVDA 2BGMA 1AXGA 2PWZA 4Z9XA 3TZQA 2BGKA 1H2HA 4M87A 1E1MA 5G4KB 3ZWYA 2FR8A 4DLAA 3RQSA 1U2DA 3ULKA 3NTQA 5CEFA 1RM4A 3I83A 3L6EA 3S2IA 4CR8A 2VRCA 3F1LA 3MJ4A 2RBEA 3D3EA 4CM4B 1PJCA 4CPDA 2HKIA 4TKLA 2G1UA 3K9QO 4A2CA 4BO8A 4JROA 3ZWNA 1D4FA 2EIHA 3H4VA 1Z73A 4M54A 1NQ5A 3RUIA 1NQAO 1BXZA 3VTFA 2TMDA 3WIEA 3PHHA 4IS3A 1GUFA 4RPKA 2B4TO 2Y0EA 3L07A 3BMQA 1RM5A 4QXMA 2D2IA 2O3JA 2Y68A 4AICA 1NFRA 4P4GA 4PLWA 4PZDA 5DN9A 1JQBA 3P5SA 4JGBA 1BW9B 4E0BA 1NR7A 4CUJA 2DVMA 4EYEA 1LLDA 1VL6A 3JQGB 4TRJA 5TGDA 4D0SA 1OFGA 3MCVA 2Q50A 4PG4A 2GZ2A 3DBRB 3PJGA 4XQCA 3BMOA 3E8XA 3H65A 3PJEA 3DR3A 1HE3A 1C1XA 2YW9A 1YKFA 3I5MA 4OXYA 3PI7A 5K6AA 1ONOA 4CLOA 2ZTUA 3AK4A 3A28A 3X2EA 3GEDA 1PQPA 1QG6A 4FC7A 1K89A 4NJMB 2TMGA 4FGWA 1EBUA 1ZJYA 3FSRA 3ANLA 4N54A 2R00A 3SC6A 3R6DA 3ENKA 1K6JA 1OAAA 3I1JA 1GYPA 2WYVA 3WLFA 4XDYA 3GT0A 3IJPA 1U7TA 2W90A 2BFOA 4J4HA 4YACA 5TC4A 2P68A 1HYGA 3U62A 1LQTA 1VC2A 2H1SA 4J9VA 4JJGA 4J4TA 1FF9A 2RHRA 4IGEA 2HLPA 1D3AA 3Q1LA 4IQ8A 1E1KA 1P1FA 1JWBB 4MVJG 3WXBA 1PGPA 4HP8A 4IMPA 2R6JA 2B5WA 4D3SA 3RUHA 2X8LA 3BMCB 3RROA 4WOKA 3H9UA 4IY1A 2UUOA 1PGJA 3QVOA 4B4UA 4HBGA 4E13A 2AEMA 1UAYA 3ANMA 2IXAA 1GU7A 4R1UA 4U7WA 4AJOA 2RHCA 2O4UX 3UKOA 2GGSA 2IYPA 2W2KA 4O59O 2IXBA 5TSDA 3FNHA 4E4YA 2GNAA 3AFNA 3M1LA 4CM9D 1VI2A 2FMUA 3QWBA 1PS8A 3NUGA 5IG2A 5MDHA 1ZEJA 1HDXA 1OMOA 4GKVA 4E5MA 4HFNA 2I3AA 4DQUA 1O8CA 4TROA 4HFJA 4D45A 3IDSA 4R54A 3UXYA 4FGSA 2Y1FA 3KO8A 1LSSA 1Y5RA 1VLLA 3GMDA 1IULA 5DDIP 4F3YA 4Z0PA 2X0IA 4K6CA 2VHYA 3LLSA 4BHTA 4XKJA 1ULUA 3DBHA 3ZWXA 2H6EA 1Y8QB 1PGOA 2JD0A 4B7UA 2Q1TA 1H6BA 2AG8A 1ZEMA 1VKNA 2GRAA 4Q3EA 3PIIA 4Y6SA 3UUWA 4N5MA 3O8QA 1B16A 1XR3A 4JP3A 4D7AA 2HDHA 4I9HA 1VSVA 4MJLA 4MVJM 1XDWA 4FQ8A 2X4GA 1QV7A 1E6EA 1FK8A 1UP4A 2J3IA 3FPCA 1HLDA 2C82A 1ZO8A 3CUKA 3H5NA 3PHGA 3DTYA 1GDHA 4BQPA 4ROSA 3HN2A 3LQFA 1GL3A 2CFCA 4R51A 4KQWA 4E2YA 3ETDA 2PGJA 1BXGA 1TT5B 4ND4A 2GZ3A 2CMDA 3UVEA 5T57A 3W8FA 5KIAA 1EE9A 3OA2A 3HFGA 4MP3A 4WLUA 1O89A 4BNVA 5A9RA 4U6QA 4PG5A 3RAJA 3OH8A 4NBVA 3ZWPA 4FR5A 2E4AA 1PSDA 3JYPA 5G4KA 3EUWA 4XRRA 5L51A 1EUZA 3LC2O 1DIHA 3PJDA 1DXYA 4JNKA 4OQZA 3WYCA 4ALMA 3QW2A 4B4OA 1ISHA 2W2LD 4QT0A 1PZFA 3GVPA 4NQZA 2VYNA 4Z6KA 2XXBA 1XQ6A 1N1GA 3LF1A 2GF2A 2POQX 1U7HA 3E9QA 3D4OA 4HFRA 1X7DA 5JLAA 1C0IA 5JYEA 2ZJ0A 3G3EA 4YJFB 1WPQA 2VYVD 3HG7A 2BLLA 3OHSX 4LK3A 1YOVB 1IE3A 1LXCA 3PEFA 3GGGA 4J90A 4C7KA 5B12A 2NQ8A 4MVJP 4EJMA 5BT9A 4PGFA 4CR6A 2Q2VA 2YDYA 3FNFA 4GVLA 1WDLA 1BW9A 2I76A 1NASA 3WR5A 2ZIZA 5EPOA 3JQGA 3WGGA 1ZUD1 1TT7A 1XEAA 1VL8A 2J3JA 5HA5A 1H9AA 4ZQGA 5BSFA 5DCUA 3JQFC 2CZCA 3KZVA 3QRWA 4Q3NA 4CLDA 3DAGA 2X9NA 5C3MA 4QO8A 5JCXA 2RH8A 1DAPA 1V0JA 3AM5A 1WAMA 3FBTA 4WLOA 4NJMA 4A0SA 4YDRA 3KETA 5COAA 3RUAA 4D41A 4DC0A 4FB5A 5L7WA 3EZLA 1PJLA 5EJ2A 4EEZA 1WDKA 4CMKA 3U4DA 4B79A 4S1VA 4YYZA 1JAXA 4H3VA 4DA9A 2FSVA 4ALIA 3JV7A 2Y05A 1UJMA 3WBBA 3NT2A 2Y0CA 3OJOA 5KVCA 1U2GA 3SX2A 1ZZEA 3GVCA 1YL6A 2NSDA 1ZKMA 4CM3A 3BAZA 1B2LA 3ZV4A 1DC6A 3VPGA 4RLSA 3E48A 3B1FA 2O3SA 2O2YA 2NV6A 4IMRA 4DQVA 4RDHA 2J5KA 2D5CA 4HFMA 3L4SO 1R4NB 2BFAA 2PH3A 1YONA 1DC4A 3RJ9A 3TWOA 4DPKA 4RORA 3OJLA 3HDQA 4FFMA 4B3HA 4URFA 1NPDA 3AI1A 4PLTA 3WNQA 3PRJA 1P0FA 4CODB 3VVBA 3QE3A 5JMPA 4PLYA 4B7XA 3ZNNA 4NPCA 1L1FA 3OP4A 4KUGA 3S2EA 4LVCA 4YAKA 5ES3A 2YFHA 4KQXA 4BNZA 2NNLD 4KWIA 4TVBA 3U4IA 3AOGA 4ZQHA 1I0ZA 4NK4A 2QHXA 4J7XA 4UUNA 3NGXA 5L45A 1B8PA 1XHLA 3JQCA 3I6IA 5KVSA 4QUKA 1IZ9A 4W4TA 4J91A 4OOEA 2ZATA 1N7GA 3SBOA 4E2WA 1QYVA 1U3VA 2VQ3A 3RU9A 3WQSB 3O9ZA 2ZB7A 2VHWA 1NWCA 4ZD6A 4GGPA 5I7FA 3RC9A 1X7HA 1ZNQO 3MZ0A 4GWGA 3KRTA 1PL8A 1ISIA 1IUKA 5EL0A 4J6FA 1EK6A 3U4HA 1XIVA 3EZYA 4J7CA 1GQYA 1AHIA 1NNUA 2YDXA 4E5NA 2Y93A 1P74A 3NT5A 3ADOA 3SXPA 2OP0A 1MLDA 4IDDA 3D5TA 5L95A 1LI4A 4AG3A 3GDGA 2EERA 1HLPA 2YQ5A 4FS3A 3BTSA 1XLTA 4W6ZA 5IDWA 5F5LA 3F9IA 4CMIB 4R1TA 4FJ0A 2FR0A 3WIDA 2XXJA 5JAIA 1X0XA 5ER6A 3ZWMA 3JQAD 4CMCA 4J2OA 3QV1A 1GD1O 2PH5A 2VUSA 2W8ZA 3GK3A 4NI5A 5G2OA 5A02A 4I8XA 2DBVO 4Z0HO 2PD6A 4YA6A 4WCFC 1UXGA 1YOVA 4GX1A 1EBFA 4OKIA 1E3LA 3NX4A 1ISJA 1Q0HA 3EHEA 3L77A 5C7OO 9LDBA 4XIYA 4E33A 2D0IA 1IZ0A 4XD2A 2DT5A 2YFQA 1N92A 4TRMA 3RC2A 3WQQA 2DPGA 1R4MA 3MOGA 2GCGA 3TFQA 4D43A 3GUCA 1QLHA 1JTVA 4L9RA 2YV1A 2IZZA 3PHIA 7MDHA 1YO6A 1C3VA 2ET6A 5JO9A 4E5YA 3NRCA 3T4XA 4FFPA 4UUOA 4RVGA 3GF4A 1H6CA 1Z7BA 3DQPA 4O0LA 4WNIA 4O1MA 1HE2A 3JYLA 1W6UA 3FTNA 1NVGA 1NXQA 4W7IA 4UREA 3EAGA 1GQQA 5FI3A 3V5NA 3WJ7A 4DGSA 1GUYA 5DBFA 2DFVA 1LTHR 1J5PA 1BDMA 4GX5A 3I23A 4CV0A 2ZJ1A 2HSDA 2Q1UA 9LDTA 4DIOA 2PGDA 3INGA 2Q49A 3U49A 1T4BA 4IDAA 3MWDB 3N74A 3ANNA 1O5IA 2CDCA 2JHGA 2WM3A 4ND3A 3BXXA 4PLZA 2O50A 5T8KA 5EERA 5L7YA 2X7HA 5KTKA 1R4NA 4XB1A 2CVZA 3SLKA 4ZICA 3BMNB 3DOJA 1E92A 2F1KA 2P5UA 5K6AC 5IAAA 1Y9AA 3S2GA 1EVJA 3BTUA 3CZRA 3ZU2A 1PJQA 2BH9A 3MJSA 3ONDA 4MKXA 5ENVA 4FIZA 1EK5A 2EHDA 1GZ6A 3OECA 2R00C 3AW9A 1WLYA 3ZWCA 4CQMB 1E3IA 4BKOA 1Y81A 4BS9A 3TZCA 4C4OA 4D44A 5JAQA 3ZNQA 1G1AA 3BIOA 4J0EA 4IQ0A 1ZK4A 1TEHA 3B20A 3DZHA 4GKBA 1XELA 1I30A 3GZ4A 3OMLA 2GN8A 3JD3A 4YTEA 1D1SA 2ZYDA 4MKZA 1CYDA 1HXHA 5DT9A 3P2YA 3ZHYA 1JWAB 3OETA 3DEYX 3QQPA 4MVJD 1QYWA 4YWJA 3OEYA 1H93A 3F47A 4OYRA 3W1VA 2HCTA 3RI3A 1Z75A 2ZYGA 4GSKA 1XKQA 1PGQA 1Z45A 4OIMA 4UULA 2VTEA 3CEAA 4BOYA 1P44A 5A3JA 3PQEA 4MINA 3DWFA 1HL3A 3Q2KA 4E2ZA 3WFJA 3ROQA 2H63A 5JFOA 3WMWA 4ND2A 1P3DA 3W4IA 2QG4A 3UH1A 3T7EA 1PTJA 1T2AA 8ADHA 4HV4A 2QW8A 2C54A 5L40A 5CPFA 3DOOA 2QRLA 1QLJA 3DB2A 2J5RA 4FFLA 3PGXA 4J3FA 3GEMA 5A4DA 3WMXA 2I66A 1Z74A 4XYLA 4O6VA 1ENZA 4IUYA 2BFMA 1M6WA 1T2EA 4WLEA 3H9JA 3H2ZA 4FOOA 3N7UA 4DLBA 4YT2A 3VVCA 7ADHA 2A4KA 1TLTA 4CMIA 3NEPX 3U5TA 5JW6A 2QIOA 5DNAA 4BNLA 4OXKA 4W7HA 3QVXA 3H9GA 4GH5A 1PL6A 2YV3A 3K73O 4AL4A 5CFZA 4PLGA 3QJ5A 3ETEA 4CMEA 4II2A 3PVZA 3E6AA 5GZ1A 4D0RA 4MO2A 3WLEA 5ITWA 4B3JA 4E12A 3DMTA 1EDOA 4RVHA 1C14A 1I3LA 4R3WA 1KERA 4R5MA 1WW8A 1A5ZA 1YH3A 3ETGA 2NADA 1KETA 1FMCA 5AXAA 1FDUA 2DTDA 1PEDA 1NFFA 4MDHA 4KZPA 4AJ2A 1JU9A 4JN6B 3RD5A 1ADBA 4NBRA 2OP1A 1HDZA 1R66A 1TVEA 2X1HA 3U4CA 1B3RA 1EFLA 1QMGA 1R0SA 2FY8A 1IHYA 4CL8A 3RBVA 3M6IA 2Y66A 4YT8A 3PXXA 1FDWA 2EKPA 5CP8A 5CPBA 1YL7A 1UP6A 3G1UA 1E5LA 3ICPA 5A9TA 4O63O 3EDMA 1B0AA 1ORRA 3WICA 3UW3A 1NTOA 3TDKA 1PQWA 4XYEA 1J6UA 3F5QA 1A7AA 1ISMA 2FP4A 4D79A 3LYLA 4RPLA 4MPDA 1I3NA 5I8WA 3CINA 5IN4A 1A27A 2QX7A 1H6DA 3PYXA 2D4AA 3QP9A 4UEOA 1U3WA 2WD7A 1UZLA 4CM5A 2CUKA 2ZK7A 4WASA 2EP5A 3BMNA 2BF7A 1E7QA 3B1KA 3WSVA 3JYQA 2XAAA 5AXBA 4CL3A 5CG2A 4ALJA 3WQRA 5U4QA 5THQA 2OORA 2FWMX 2Q1SA 1W8DA 3GQVA 3UN1A 4IJVA 5B1YA 4CQMA 4QSMA 2Q4BA 2FR1A 4H15A 3TF5A 2DPHA 3K30A 4XDZA 2VZ9A 3T4EA 3HN7A 1NQOA 1I2ZA 2Q3EA 4TSKA 4Q3AA 4BGVA 2R2GA 4KUEA 5I7VA 5AVOA 1DLIA 4LCJA 4FOSA 2UYYA 4EJ6A 5DF1A 3FPLA 1GYQA 4BMNA 1AHHA 3KXDA 2D8AA 2JFHA 4YJGB 3RSHA 4XRGA 4AJPA 3K31A 1DRUA 2UDPA 3HDYA 4YB8A 5C5IA 3WTCA 2GZ1A 1DLJA 1KVSA 3UCXA 3I4FA 1KVQA 3ZU5A 3ZI0A 2E48A 3FD8A 1QKIA 1UH5A 3F4LA 3Q0EA 5IN5A 4NBWA 1H6AA 4XYGA 5JXWA 3GA0A 4YQZA 3L0DA 4MKRA 3VPHA 3G79A 3H9EO 3HFSA 4ZU3A 4D42A 5EESA 3F1KA 3VKUA 4M1QA 1DAOA 3GN1A 3ITDA 3K2EA 2O7SA 4RLHA 5U9CA 2VRBA 3IIEA 4WUVA 1LSUA 2PFGA 1MFPA 1ZK0A 3ZHBA 3HZZA 3TL3A 3FTPA 2H5LA 2UV8A 2Y1CA 3OFSA 2HMUA 5A03A 1EFKA 3TRIA 1YVEI 4RVSA 4XQEA 3S55A 3KYCB 3VTZA 1ZIDA 3KLMX 4BNXA 2DTEA 4PN3A 5L53A 3AI3A 4WGGA 4IGFA 2G0TA 2X0NA 2WTBA 1VL0A 3K2BA 2XOXA 5F21A 3PGJA 2NU9A 4TRNA 4XB2A 4DLLA 1PS0A 4CMBA 4HXYA 1HF3A 3DDNA 4ZGWA 3S1LA 5BQFA 4JLWA 3ROMA 5JDCA 1ZJZA 1M2WA 4BO7A 1J49A 1QRRA 1YBAA 4GL4A 2I9PA 5DZSA 5ICSA 4PVDA 1K0UA 1ZVMA 3L9XA 4ZRNA 4BNHA 4CM1A 4RF3A 1QXSA 3UHAA 4PZEA 4IJUA 1DRVA 4CM8A 2HMTA 1DB3A 3Q6IA 1LEHA 4CM7A 2EGGA 5A5EA 3PPIA 3R3JA 1X13A 3NKLA 3P2OA 3VOSA 4NJOA 4BNIA 1C1DA 4IPTA 3RUCA 3ABIA 4P22A 2IZ1A 4N5NA 3TN7A 4EUEA 5KJ6A 5CEEA 3ZW8A 4DREA 4JX8A 1DC5A 4A03A 1ENPA 5I7EA 4BQRA 3E03A 5JCJD 2EP7A 3B1JA 4DYDA 3WGHA 1YRLA 3GAZA 4YEDA 3I9LA 4YQYA 1DIGA 4XGKA 1MUUA 2EJWA 2HMWA 2WMDA 3G1TA 3AUUA 4DXHA 3LDHA 2AHRA 4GBJA 3AUTA 3C3XA 5G0SA 5EQDA 3ZWVA 4Y6RA 4RJTA 3Q9NA 3TQHA 2VHVA 3DZGA 2WD8A 4BKPA 1R0KA 1NPTO 1X1TA 3JQ8B 1NHGA 3VDRA 2RH4A 4QFCA 1UZMA 3HB4X 4AJLA 3I6QA 2B5VA 2HQ1A 2O3UA 1DFGA 1MC4A 3HDJA 5FFFA 3HQ4O 1BWSA 1I3KA 3IAHA 4PZCA 1F06A 4E5KA 4R4JA 4UVGA 4XR4A 1E1LA 2Z5LA 3H5AA 1ZK2A 2J3HA 4L4XA 4DTIA 5JAZA 4PRKA 2E49A 2P91A 3WJAA 3AY3A 5KJEA 3JD0A 5TRTA 3TZ6A 5IF3A 1IL0A 1Y7TA 3M1AA 4LRTB 4L73A 1NX6A 4TMFA 2PD4A 1DHRA 1SC6A 2VWGA 1F12A 2Y1OA 3MJTA 3ZU3A 2C2YA 5IDYA 2ZTMA 3MWEB 4MVJF 2HJRA 5JE8A 1LU9A 1Y1PA 1DIRA 3LC1O 3O03A 5IZ4A 2AE1A 1LSJA 1NQTA 2Y1EA 5BSEA 4I1IA 4II3A 5A1TA 4GQAA 3KV3O 3GNTA 4L8VA 4RZIA 4LRSB 1BDBA 3DHYA 1MGOA 3KOUA 2BI7A 2BHLA 3LF2A 1BMDA 3DHEA 4GPD1 2DBQA 2IEBA 2O4CA 1GTMA 4JXKA 4AJNA 4C7JA 2Z1NA 3KYDB 1QV6A 1UP7A 3PHJA 4YJGA 4CM4A 4FJ1A 1YL5A 2AG5A 1YWGO 2B35A 4WPGA 4P4LA 2ZB4A 1HYEA 3CPSA 2P2SA 4R41A 5DCYA 4Z9FA 2W4QA 1MA0A 2VWHA 3TJRA 2F00A 2P9CA 1NVMB 3GRPA 3AU8A 3DBLB 1LDEA 2I67A 3HADA 3WSWA 2WYWA 3VZQA 4YCAA 2AQKA 1GV1A 1A9YA 4IDEA 1L7DA 4GWKA 1N9GB 4DPLA 1I2BA 1ENOA 1XQ1A 5DCWA 4H16A 3DBRA 1PX0A 4QFDA 4WE3A 1H5QA 1PJTA 4I9NA 1E7SA 1J0XO 3ZV5A 1C0KA 3DZKA 1LJ8A 2YHUA 3ZNOA 2CDAA 4ZHSA 4RQTA 1XG5A 4Y6PA 2C7VA 2VWQA 3KYCA 1NYTA 1BSVA 4HY3A 2C29D 4UAGA 4D3FA 1SO8A 4B3IA 4LVUA 3GGPA 1SCUA 3C1AA 1Y9EA 3FHLA 3DOCA 1HWYA 1I33A 2J8ZA 3D1LA 3GEGA 4WK6A 1B14A 2X5KO 2HRZA 5KVVA 4JIGA 3R3SA 1DJQA 3L6OO 2QYTA 2O2SA 1EE2A 1Y8RB 4PLHA 4DBVO 1LC3A 1ADGA 1E3JA 1N5DA 3AJRA 2DUUA 3C7DB 3PFFA 4NR0A 4J0FA 4CMGA 4Z9YA 5BNTA 3BMCA 3JD4A 1KEWA 3DHNA 4XEHA 4PLPA 4R16A 4CMJA 2NU8A 1C0LA 2AEFA 4L75A 3TZHA 2VN8A 3H2SA 1TA4A 1ID1A 4KTTE 3A4VA 5A05A 1QYDA 4IDBA 2IYOA 4LGVA 4BO6A 2PKRA 3ZNPA 3HWRA 4OL9A 1KC1A 4BNNA 4NFSA 2PY6A 1EMDA 5CHEA 5F1OA 1KVTA 1NFQA 1PZGA 1BRMA 2OO5A 4NBUA 4BVAA 1R12A 5FYDA 1T26A 1D8AA 3NTOA 1EDZA 1G6KA 1RM3A 4FD3A 3DMYA 4R1SA 1YBMA 5ILGA 1ADFA 4B7CA 2OBYA 1CQJA 1V35A 4MOWA 4W99A 4CMEC 1SB8A 4GMGA 1SNYA 3OIDA 2VOJA 3VKVA 2DTXA 5TNXA 1DHTA 4A10A 1GZ4A 1ONPA 3JQ8A 4PIVA 1Z6ZA 3DMTC 3HHPA 2J3KA 4OOFA 1Y8QA 3QWHA 3VPFA 4OSPA 3VPSA 3FBGA 3DZBA 5COQA 4DC1A 4QO7A 2YYYA 4KP7A 3DAFA 4NU5A 1IPFA 2HMSA 4XGNA 3V1YA 4BGUA 1ZMTA 4OMUA 5BR7A 1NM5A 2GPTA 1VKOA 3N58A 4CR7A 3DZIA 4BMVA 1IHXA 3JQ7B 1VSUA 1XU9A 1XSEA 3GFGA 1YJ8A 1SMKA 3INTA 4G81A 4DMLA 1ML3A 1OOEA 4R1NA 1U1IA 2FZWA 1LDGA 2OMEA 1ARZA 1PR9A 3I9OA 1TT5A 1HSOA 3PJFA 3PK0A 4RPGA 3ST7A 2V6BA 3O4RA 4BO9A 2HK9A 4F6LA 5H83A 1PQUA 1Q7CA 4LISA 3RKRA 2E6UX 5LC1A 1FDSA 5A9SB 3A14A 3ENNA 3FRJA 1SOWA 5L3ZA 4DPMA 2VRCD 1PJ4A 3ROPA 1PJBA 1GEGA 1X0VA 1IB6A 4L4RA 4B4WA 4CLRB 5KOIA 3I52A 1KYQA 1W73A 4Q3DA 1YQXA 2D5AA 2JL1A 4EDFA 3KYDA 4CV1A 2JKVA 1QR6A 3AY6A 4XX0A 3KHUA 5HBRA 2WEKA 5EQFA 5L4SA 4FSHA 4I08A 5IFLA 4R69A 3B6ZA 4LSWA 4RF5A 4YJFA 1ZBQA 1M67A 4E6PA 3O38A 2VZ8A 1F14A 1K6XA 1Z7EA 1T4DA 4UEJA 4G5HA 3OJEA 2D1YA 4NMHA 3ZN2A 4OGWA 1J4AA 2Q45A 1HKUA 1N9GA 4E3ZA 4TZTA 4H7PA 3DONA 3VHRA 3G0OA 4OH1A 5KKCA 3INRA 1IPEA 3SC4A 4JCOA 3H3JA 1JN0A 4BNTA 3PP8A 4J9UE 2VNSA 2DFDA 2HRBA 2YZ7A 4ZQFA 3MTJA 2O3QA 5EN4A 1MB4A 1QYCA 3AOEA 2NUAA 3COSA 1YS4A 4A73A 3L4BA 5B4TA 3GVIA 2PTGA 3JQ9A 4XYMA 3IKVA 3UOGA 4JJFA 3WGYA 1BVRA 3A1NA 4WECA 2PZKA 4R9SA 1GV0A 1KEUA 3OIFA 1MG5A 5IDXA 2A94A 1LSOA 1ZH8A 4OKNA 4RO0A 3W6ZA 4BNFA 3BHIA 2OFPA 3WYBA 3FR8A 2OGUA 1V8BA 3GZNB 2O7QA 1Q7GA 4Q3BA 3OQ6A 1H2BA 3HB5X 1HDCA 5G4LA 4AFNA 5BSHA 2IE0A 1PL7A 4CM9A 5AQ1A 4ZA2A 4TWRA 3T7CA 2BMAA 2JCXA 4RV9A 4XIJA 5TIIA 2HU2A 2JAPA 3H7AA 2P5YA 2OOSA 4UVDA 4UEKA 1N8KA 1OC2A 1E5QA 2PKQP 4WLNA 4CUZA 4U0KA 3C8MA 4DRYA 1I24A 4P4NA 4YVFA 1HE5A 4UUMA 3RFVA 2WSBA 4F46A 1T1SA 4G65A 1XGKA 2FPPA 3S2FA 4BKRA 1YB4A 3SJ7A 2Y99A 1I36A 3AUSA 3EY4A 1RPNA 3D4NA 1LDBA 1LC0A 4FDAA 4J1NA 5TT1A 1HDRA 3KSDO 5TT0A 1TB4A 3FNEA 3FN4A 1BHSA 4IXTA 4TVOA 3QVWA 4ZN6A 4DQXA 4IIUA 4AJHA 1VJ0A 5AXDA 3RC1A 4EW6A 4R3NA 5JDCC 1R16A 3GHHA 1Y5MA 2V6FA 2NTJA 4RDIA 4N18A 1EVYA 4BO0A 3ADPA 1YQGA 4CQLB 3BZUA 4IJWA 5MGBA 3QA9A 5H82A 3CTMA 3VC7A 1RYEA 1DRWA 2EV9A 3AM4A 3ORFA 4KOAA 3UCFA 4BNMA 1LDMA 1T24A 1ZXLA 3FI9A 3VZSA 3E82A 3GH3A 4WJZA 3NDJA 4F6CA 3AI2A 3JQ7A 4Y9DA 2CDBA 3P7MA 4O5OA 1ZXBA 4QEDA 1M76A 4U0JA 2B37A 1HEUA 5JDIA 1ZFNA 2DKNA 1H0KA 2A92A 1Q0QA 3KB6A 5KWEA 3ZCXA 5IZCA 1KBZA 1GY8A 4MVJE 3QY9A 1JKJA 2YHIB 1D7OA 3K6JA 4XA8A 3U09A 4NIMA 2W2LA 2VZ0A 1P45A 1LLCA 1MX3A 1O0SA 1E77A 2OUIA 3CSDA 3KVOA 4J1SA 5CG1A 1DJNA 4BIIA 1B8UA 2P9GA 1RWBA 5A9SA 3JQAB 3BMQB 5DP1A 4YT4A 5JC1A 3NDIA 3JTMA 4KWHA 2HO5A 3VZRA 4BNWA 1W4ZA 5TX7A 5BNFA 2VYVA 3UFXA 4CLRA 1T2CA 3VH2A 3OM9A 4OAQA 4GLOA 2VYND 1NPYA 3QVTA 1KEVA 3D64A 3SVTA 3IUPA 2PGLA 3DC2A 4PLFA 4M86A 2FOIA 1CERA 3D0OA 1JLLA 3RUFA 1LBEA 2GLXA 1N7HA 4MIYA 3ZV3A 3EMKA 3B70A 3ONEA 1P1HA 5T6BA 1LLUA 1G0NA 1WMBA 1T2DA 3OQBA 2C5AA 3D5QA 4CLOB 1A71A 1TXGA 2HK7A 1KOLA 2JFGA 4RL6A 2AXQA 2ZCUA 3LU1A 3RU7A 4KUHA 3OJFA 5CAEA 1A9ZA 1BGVA 3HUDA 3P19A 1JDJA 4GX2A 2X6TA 4KDEA 4RPHA 1VJTA 2EW8A 1F0YA 3GVXA 4M55A 3R0IA 3DXFA 1P0CA 3IP3A 3PWSA 5IXSA 1B3BA 4GMFA 2FN7A 1CWUA 2ZYAA 4CLXA 2X22A 5CDYA 3VH4A 1NHWA 2JCYA 2XF8A 1OBFO 2Q4EA 4NHEA 4HWKA 1LRJA 2Q99A 2PLAA 1T25A 3RBXA 3JD2A 4LSMA 2ZB8A 3NTRA 3ZZNA 4KMSA 4L74A 2LDXA 4I5EA 4HUJA 1UXHA 4PRLA 4J1QA 4YRAA 1E6WA 2DBZA 1DEHA 3F3SA 2HMVA 5LCXA 4AJJA 3HDHA 4CMHA 4XZ3A 2C0CA 2WYUA 4FFNA 3TNLA 1VM6A 2O23A 2X0JA 3JD1A 4R9RA 1YJQA 2B4RO 3LSYA 4W82A 3W8DA 3IMFA 1G0OA 2AW5A 2EW2A 4EI2A 1RM0A 3H8VA 1GFSA 3JQBA 1B26A 3GZNA 3MOIA 3D4PA 2AEJA 3ZHXA 2ZB3A 4PVCA 1YDWA 3E1KA 1PZEA 3OF2A 1RJWA 2AQHA 1WWKA 1HDYA 3UF0A 1E3EA 4YR9A 3DAPA 2LDBA 2A35A 3PWZA 5F5NA 4RPJA 5TF4A 4N5LA 1BXKA 4BUCA 4XJTA 4EZBA 3ZH2A 1GAEO 1DO8A 2FRDA 4YAJA 3LLVA 5T64A 1ULSA 3I9JA 5ICMA 4DIFA 3F6YA 4BNJA 2A9FA 4J49A 1GR0A 1I2CA 1JKIA 1MC5A 1UZNA 3LT2A 4ESOA 1HETA 5C7LO 5CDUA 1KEPA 3OEWA 4LN1A 1KVRA 3V8BA 3WFIA 1K2WA 3W6UA 2X9GA 1B7GO 3LT1A 3PQFA 3W4KA 4E5PA 3VDQA 1I01A 2CF5A 2DBRA 4WCDA 1P77A 3GFBA 2Q46A 5KKAA 2GO1A 4R68A 4CQLA 3ZW9A 4ALNA 1M66A 2B4QA 5CDSA 3IC5A 1K6IA 3NV9A 1FXSA 3KBOA 5EMHA 3CKYA 4U8GA 5FI5A 2CF6A 4E31A 1LQUA 4X54A 3TL2A 3AM3A 4RZHA 5B4UA 5JO0A 5ITVA 5FWNA 3AY7A 3FCOA 2B69A 5JSFA 2ZTVA 4M8SA 2Y1GA 1JVSA 3PZBA 2YY7A 2P9EA 4ZQEA 3I9KA 3MEQA 1V3UA 1C0PA 1Y6JA 3HJAA 1PU2A 2CVQA 3UGKA 4Q39A 3ZDFA 4BGIA 4Y67A 5G0VA 2Z95A 3PWKA 3RFXA 4B8ZA 2NM0A 3C7CB 2YHIA 1B15A 2O3TA 2JD1A 4EITA 3WWZA 4LW8A 4Q9NA 1ISGA 4XCVA 3WG9A 3U9LA 3NDRA 5FF9A 4U5QA 1AE1A 3ZWAA 2VTDA 4N7RA 3F4BA 3JQAA 5I7SA 2EJVA 4ONEA 1YB5A 4RGBA 5IJZA 3PYMA 5KNLA 2NU7A 5K9ZA 3GR6A 2I99A 2DQ4A 4P8RA 5DOVA 1E7YA 4L4SA 3RFTA 5TJ9A 4ZVVA 1CIVA 5BNIA 1MG0A 1DDOA 1JA9A 2NVWA 1MXHA 2D59A 1JW9B 4TZKA 2B36A 2GN6A 2NTVA 5HS6A 4NFHA 3ZHZA 4YXFA 4GGOA 2NU6A 5COBA 3VH1A 4DWVA 1XCBA 2DUWA 1GZ3A 3EK2A 4WLVA 1E7MA 2FHSA 3WGTA 5BSGA 1DFIA 4WEOA 1GCUA 1XWFA 1NAIA 4Z3DA 1R15A 4WNCA 2X0RA 3ZWBA 2AQIA 1I8TA 1P33A 1GADO 1LRLA 5TS3A 1FDVA 1V3TA 3BTVA 1LA2A 2DM6A 1CEQA 2W98A 3FR7A 4OHUA 5A3VA 3TZKA 5HTOA 3OSUA 4Z0TA 4BNKA 5JYDA 3ZGYA 3E9MA 5JY6A 5A04A 4EUFA 2G17A 3JYNA 2G76A 4RCVA 1N1EA 5DBGA 2SCUA 4DBZA 3RUDA 4GVXA 1NR1A 2DC1A 4I5GA 1EEHA 4PLVA 5HWSA 3CH6A 4BNGA 2YJZA 3K8ZA 1LNQA 5AYVA 1WDMA 1ISFA 1U3TA 4RVFA 5L4LA 1E7RA 1U28A 1ZMOA 1I10A 5L7TA 3A06A 2CVOA 4R01A 1M6HA 5K0ZA 2JAHA 1SOVA 3F46A 2C2XA 2JCVA 3NGLA 4DVJA 1V9LA 4NH4A 1I3MA 4ID9A 4AJEA 3Q2IA 1F17A 1ZSVA 2QRJA 4IXWA 4BO3A 3NAQA 1S7CA 5F1PA 1LRKA 4D46A 1HTBA 5CDGA 2G82A 3AOEC 2PKQO 3L4BC 4A26A 3JQ9C 3WTBA 3KSUA 5TQVA 3EYWA 5CDTA 3PYLA 1X7GA 3DL2A 4MVJA 1YQDA 2I6TA 1N2SA 4PG7A 4AJKA 3WGQA 5FEUA 3CXRA 5JC8A 3H3FA 1XU7A 5DP2A 4MVJI 3PTZA 1H94A 4W9NA 5KJFA 1BTOA 1PR3A 3SJUA 2OZPA 3TPCA 4I5FA 2FSSA 2PNFA 2ZTLA 1ENYA 1CF2O 3Q9UA 3ROKA 2VUTA 1PWZA 6LDHA 4P38A 2ZQYA 1CRWG 1U9JA 3CE6A 4AJ4A 5T8KC 1HSZA 4HNHA 3OJ0A 4JJIA 4KTVE 3M2PA 2X9VA 3V2GA 4WEQA 4HADA 1YDEA 3ONFA 1YGYA 3D7LA 3NJ4A 4Y98A 1HZZA 1WXDA 2C7GA 4J7UA 3EVNA 5H81A 2OXIA 3RWBA 4IINA 3TOXA 5GMOA 3IOYA 1PJ3A 3FNGA 4HNGA 4ND5A 1SEPA 4EJ0A 2O3RA 5I9LA 2PZJA 2B83A 1PJSA 3WX0A 5LDGA 1ADCA 4FFRA 3GUYA 4L76A 2FPGA 3KLPX 3Q3CA 3C7AA 3IJRA 5EIOA 3IUSA 3JYOA 2YUTA 3KEOA 2AA3A 2VHZA 3NJ8A 2DU8A 1ZW1A 2HAEA 1QYXA 4IIVA 3KTDA 1WZIA 2WJPA 1M75A 2VOEA 5B4VA 5HRUA 4BO1A 5HM8A 5G0UA 1W0CA 3MJEA 1NWHA 3C85A 3QLJA 4LMRA 2ILTA 8LDHA 5JBIA 4INAA 1DFHA 2RCYA 4JK3A 3GDFA 1K3TA 5J23A 1SB9A 3VZPA 1S6YA 4CLEA 4IDGA 4TRRA 1R4MB 1YB1A 3WS7A 3GN2A 1F8GA 4HKTA 1LLQA 4XYBA 4YPOA 3E9NA 3RKUA 5C37A 2UAGA 3I9MA 2I5PO 5JDIC 4B8WA 1U5AA 2X86A 3KSZO 1AN9A 2JJYA 1E3WB 3KEQA 2EEZA 3MJVA 2NTNA 1Q7BA 1H9BA 5IZCC 3ON5A 3U0BA 1WP4A 2NACA 2PR2A 1E3SA 5KJ1A 2I65A 5EINA 2WDZA 3DZFA 5G0TA 4CV2A 1VPDA 3AFMA 3EGOA 4LCEA 3IL2A 4CMAA 1HDGO 1NBOA 3FWZA 2C5EA 4ZJUA 2PA3A 2IRWA 4DMMA 2BGLA 3PLNA 5JMWA 1LDNA 3O26A 4IQGA 1UDAA 2NWQA 1GCOA 2VT2A 3ZV6A 1BVUA 1U8XX 3E5MA 4K28A 2C07A 3WYEA 4BNYA 4CJXA 1RKXA 4MVJH 1K5HA 4PLCA 1WNTA 3GAFA 3GMSA 3CMCO 3G17A 2JHFA 3OQ1A 4WLFA 1UXJA 1LDYA 1EVIA 2GUGA 1IOLA 2FZEA 1GYRA 1CQIA 4YAGA 4OQYA 2X5OA 1JVBA 1U3UA 5F3RA 5L9AA 4G2NA 1NP3A 4BV8A 4U6SA 3RASA 2OBNA 3PHLA 1GPJA 3I4CA 1X15A 2CSUA 4GSLA 3RIHA 4CUKA 1O95A 1Q2XA 5JAMA 4YBZA 1ZK3A 3EVTA 4OJNA 3DFZA 3UAGA 4EBFA 4OXNA 1QSGA 3STHA 3ASUA 3JSAA 4FN4A 3QWAA 4JP2A 1U4OA 2WE8A 2PD3A 5I8ZA 3NYWA 4CQMD 4GX0A 3VAZA 1EUCA 2BRUA 2VUUA 5T5QA 4WKGA 5DOZA 2Q2WA 2VWPA 1AUPA 1AXEA 4A27A 1T2FA 3G49A 2RIRA 4Z3KA 4Y8VA 2GASA 3AUAA 4E30A 5GZ3A 1Z82A 5JY1A 3GRKA 3Q11A 4RF2A 3JQBC 1SZJG 3H9QA 2GERA 2I3GA 3M2TA 4XGIA 4K1LA 3EW7A 2YQ4A 4FCCA 2IDZA 2NLOA 3PDJA 3TFOA 1ZSNA 3GNQA 2PZLA 3QWFA 4R5HA 3GC6A 4ZRMA 2HJSA 4GLLA 4RQUA 5ER9A 3BTOA 1UDCA 1KS9A 2WWRA 3X2FA 4DUPA 5T67A 2QQ5A 3JQEA 2VCYA 3CIFA 1F8FA 1OZAA 4CV3A 5ENDA 2V6MA 5U1PA 3CMMA 3DBLA 2EXXA 1DBVO 2EF1A 4XQ9A 1IY8A 3E18A 1E6UA
chains in the Genus database with same CATH superfamily
2O0LA 4QGGA 4WZAB 3WLMA 1Z88A 3M5CA 3IODA 1XTSA 4EHKA 4MZXA 8ABPA 1AO0A 2IBTA 4WINA 1DQSA 1G8SA 3COZA 2I78A 3VZCA 5K0JA 4HDNB 3I8OA 3UG6A 5KJCA 5P21A 2VTVA 1D1TA 1SUDA 4LZNA 4E32A 4YRBA 1EFAA 1CNEA 3BS4A 1CLUA 4YRIA 4KQIA 1L9KA 1MX1A 1T4MA 1GQ2A 1ZUNB 4PG6A 1BFDA 3OBBA 1VMAA 1FJ2A 5EUCA 4B35A 1KS2A 3QEMA 2R6AA 2Q2QA 2L82A 3MINB 4B2LA 2LKDA 3E3NA 4EGFA 1DC3A 4WOJA 5K8UA 2VP0A 1VLJA 3WHKA 1EU1A 3QKSA 2OZEA 2Q4TA 1P7VA 3MVEA 3DPIA 3DEHA 4H2DA 3U4GA 5HFNA 2IPNA 5AW5A 2JGDB 1U2QA 3D0QA 3DUFA 1Z56C 5K05A 1AJEA 1KY3A 1I5RA 3GOHA 3QBJA 1E9BA 2OXEA 2MIIA 4FWIB 5FLEX 4HEA6 1OX6A 2LCIA 1JIJA 3EOAI 2QE6A 3PUZA 3FKSA 4X60A 3O8BA 4IDCA 1NMXA 3OF3A 4IZHA 5FLKA 4EABA 1QONA 3G2HA 3B12A 2IODA 3NMUF 3TVDA 1HG0A 3ROGA 4X9XA 2NVUB 3V1MA 3G7UA 3L02A 4FHCA 1ZU4A 4LE2A 4FFBB 1FX0B 1P72A 2Z8ZA 2G5CA 4JVLA 4KVGA 1YZNA 1CRLA 1HE4A 5FX2A 1E3WA 2FGJA 4UBIA 2IY8A 5DWVA 1J5EB 2O54A 3Q8WA 1KQGA 3PXEA 1BKDR 3NFYA 5HZMA 1NNSA 3T1VA 1XZJA 4FNAA 4UHDA 1XTUA 3ZE0B 3Q72A 2GD1O 1K8QA 5JCJA 2IXFA 1ZJ6A 1JHPA 2EL9A 4GT1A 2A1UB 4F4JA 1WD7A 3RTDA 1W4AA 1ONNA 3P9IA 2BI8A 4QUEA 4F45A 3O1LA 3NHLA 3T35A 4L5IA 4N5IX 3KLBA 1ETHA 1YVDA 1A4IA 3KV1A 1B74A 4RVDA 4X8OA 3R5KA 3TM4A 4IUDS 3IP8A 4Y1EA 2DZDA 2IUUA 2OCYC 2ZBPA 2ZPAA 3GDOA 5JEDA 2FG5A 1UBTS 4B3FX 4LC9A 2VAPA 2L18A 3K9GA 1AN0A 1R18A 4CI9A 3AZOA 1UR5A 3IS3A 4ZZ2A 5JS6A 4WDRA 1O6GA 5AOVA 3AR3A 5TS2A 1LF5A 4ZVQA 3C3WA 5FOSA 1YR8A 1CY2A 2J45A 4Z53A 2W0SA 3HE3A 3OCZA 1VB5A 1GILA 2W4IA 1LX6A 2H9IA 3MWJA 1T2VA 1J1ZA 4OHCA 2BVNA 4D8XA 1XA0A 5AW3A 3T5PA 3TR0A 1VYUA 1Z6GA 2Q1WA 3AR6A 3LC7O 2ZS9A 1W52X 3NT4A 2CNDA 5IDQA 4OG2A 1F8YA 4HX5A 4OQDA 3AKCA 1VRWA 2BCGY 3GHYA 3INYA 4KDFA 4MUFA 4O2BB 3FYTA 4OSOA 3NVAA 4P81A 3V2UA 5DTIA 4HMOA 4BBZA 3DMGA 1M10A 3K35A 5DWDA 5TQ2A 3RYTC 3ZZMA 1B8OA 3IELA 5KVQA 1SBQA 4KI7A 4NDNE 2P4QA 1GU0A 1OC4A 1N6PA 4FINA 3RJ5A 1TIPA 1X86B 2BFPA 3K4QA 4J16A 2MSWA 5LXTB 2IHKA 4KE9A 3VPXA 1U3CA 5BQOA 1T9GR 1UEJA 5I47A 1GGJA 3NCTA 4J0HA 5JNUA 1AQUA 3NR2A 4YS6A 3KKOA 2OBXA 5DYTA 1GN9A 1TQHA 5LZ9A 1GXSA 4QYMA 5JAHA 3DFUA 1JA0A 1UMBA 3AIMA 4HTFA 4Q48A 1YIOA 2RB5A 3ABRB 4I5DA 2SKCA 2AOXA 4LQ4A 4NBTA 2QYSA 1MRZA 1WXFA 1HT0A 1NRXA 3EA5A 3GFVA 4TKUA 5JG7A 1SULA 1KYWA 4RF4A 4C2AA 2EZTA 3OCJA 1PZHA 1YU9A 1P31A 4LZOA 4TKVB 3QPUA 1F6DA 1DTWB 4GI2A 3SMVA 2YIVX 3PUVA 1E1DA 3F90A 5TARA 3SQOA 5C1PA 3W5VA 3DEJA 3F0TA 4GYYA 4KE8A 5LZ4A 1GNRA 1Q84A 1JSZA 3L1IA 4OFWA 3ONWA 5E4JA 1N57A 5B37A 4WOBA 2YJ6A 3DS8A 3VR6D 1U28C 1CUDA 2ODWA 4FMDF 1NC3A 1SUWA 1R3DA 1SHUX 2GD2A 2R2AA 3JAKA 2HCJB 4IZIA 4QOFA 4BFVA 4DVGA 1Y48E 2GB4A 2BKAA 2B78A 4O4LB 3BYZA 4BJ6A 1CUEA 2QENA 1N6KA 5KX5A 1EQUA 1SOUA 2DHQA 1IZ7A 3TZLA 3SWWA 1JDSA 1P1RA 2PSHA 1DOAA 1UBHS 2CNBA 4A8PA 1YAJA 1ORVA 3WBFA 3OT4A 2G36A 5JXHA 5JSHA 5FTKA 2UZ0A 3HEAA 3UW1A 5CFRA 2ZRLA 1SXPA 4IFTA 1NBMD 1W94A 2PX8A 3DTTA 4ZT2A 4Z4EA 2W6JD 1BFUA 1AGNA 3FZYA 3AIOA 5AXCA 4HGZA 5HK9A 1GL6A 3NXKA 1YJXA 4ZREA 1TMOA 3FCYA 2J4CA 4MYRA 4BU0A 1JHYA 1OH8A 4PHFA 4UCQA 3W4JA 2ROQA 2QX9A 2WJJA 4FLEA 3CWCA 4B3SB 3TGPA 2PXHA 1GZ5A 3OZVA 1C30A 4BLQA 4QECA 4DIDA 1PR2A 1RYDA 5IF9A 1EUDA 1O9BA 1PIWA 1NV8A 1I2MA 2YY5A 4S12A 2C98A 3W2TA 2H8GA 1XNGA 5IJXA 5LP6F 3I9V1 2AMFA 1RAAA 3TJMA 3EC7A 2DLNA 4HN4B 5ADHA 5AHRA 1ITZA 3RRZA 5PGMA 4CETA 2FKAA 3I04A 3SLGA 2JD2A 2NQTA 3HLTA 1YBVA 3CF6R 2X5JO 3SAJA 3LZDA 4AK9A 2V58A 4OO3A 4KCGA 2HF7A 1CUHA 5C7IO 2NIPA 3MD0A 5KNCD 4ZVOA 1K68A 5H59A 1D9ZA 1EAYA 3CW9A 3EY9A 1D2NA 4YRLA 5HS4A 3E7PA 2IZ0A 2OAEA 3M8KA 3SBEA 2AT1A 4PC7A 3A25A 1JEAA 1VBFA 1VE9A 2WJAA 4RHUA 5BW4A 4NESA 5TJHA 4G0MA 4ND1A 3MBOA 3WL8A 4BLUA 1CE8B 3BICA 4MIEA 4HG2A 1N9KA 3EXHB 3LIIA 3RVMA 4B09A 3T3IA 4BB6A 2WF5A 2DPXA 3R6WA 2WHXA 5J9FA 5GQSA 4FZ3A 3ZLUA 2M98A 4WW0A 4A6DA 2Y2UA 1SPBS 3FWKA 3IULA 3PLRA 4PFJA 4Q3CA 3OZWA 3UMRA 1JSLA 1PLKA 2GH1A 3BF7A 4D9KA 2AD5A 3PDUA 1AQYA 4X1YA 5BVGA 1Q22A 5A5GA 1PJAA 3LH5A 3UENA 1DXOA 4JQCA 1AZTA 4GRIA 2VQEB 2QEQA 3PQ4A 5CEJA 3MMPA 1O9HA 2WE7A 1PFUA 1X1EA 3E35A 5AOAA 3IVCA 3R7LA 1E2QA 3TB4A 3V2HA 1VQ1A 5LQCA 3H6GA 5HMMA 2PKEA 4YRNA 3WGJA 3R9XA 3L7MA 4AI6A 2XBLA 3O8OA 3WYNA 3Q1KA 3PQCA 3O3NB 4Q3OA 1VKRA 3H16A 4MJXA 2GDZA 4WBXC 3DZCA 3JAWB 1HYHA 3NWOA 4OREX 5LVAA 2RAFA 5K3BA 2C31A 2VEOA 4BIMA 4H7HA 2WP8J 1FFHA 3CSSA 5C8VA 3O0DA 4ARBA 3W5DA 1JWLA 4JVOA 3ZVKA 2W0MA 4DYHA 2VT3A 4M1WA 4LMPA 3WDSA 2GR9A 1INLA 3IAS1 4FNOA 5HDBB 4OI4A 3TDMA 3WDLA 5H3LA 4BBAA 4ROTA 4Z54A 4H7FA 4UVEA 4AZTA 2ZE5A 4UM9B 4N6OA 3T7DA 4BDTA 1KMHA 3M6VA 4X1IA 5D00A 1BXGB 4Q1EA 4B71A 2E82A 2C83A 2O57A 2RGBA 3IUMA 5LQNA 2I6FA 3H5RA 1I4WA 1VHJA 1ZD2P 1Q1NA 1KIFA 2NVBA 4F3RA 2DR2A 2YFKA 3IRUA 4ZAGA 3RAPR 1AXGA 4C0QC 3IE1A 2BTQA 4M87A 4HAUA 2A0FA 5CLQA 4ZYZA 3MCAA 1E0JA 2P2LA 4ETMA 2IKSA 3IE0A 3FYCA 4HOYA 5IKMA 4D2IA 1Y37A 2W6NA 3LQYA 5E9JA 3ZWKA 4BWGA 4CR8A 3F5DA 3F1LA 1T1EA 3LX4A 3MJ4A 3L0OA 3O21A 1W0JA 4YQEA 2V6JA 2BP7B 2G9QA 1QH8A 1X7WB 1QCCA 2ZBVA 4JOCA 2OXRA 4KQJA 5A4IS 3ZWNA 1YZTA 2TSYB 4GBMA 1Z73A 4GZ5A 5IKOA 1BXZA 2QAJA 4I3FA 2TMDA 2F3PA 1W7AA 1XCGB 3NTXA 3U1VA 4EKNB 4KYUA 2B4TO 1JAZA 2EP8A 2Y0EA 1L7RA 2JFQA 4Q4AB 3BMQA 4JLUA 4P58A 3E4DA 5IC4A 2D2IA 3HFRA 4XSGA 1KJ8A 2H4JA 4P4GA 1GN8A 3G1WA 4E4TA 4ZI7F 2VDQB 2X13A 1Q17A 1N4AA 2ZREA 1NR7A 2EFYA 4QGBA 2F1HA 4RHCA 2VIIA 1LPAB 2AZDA 1T0JB 3JQGB 4TRJA 4WHMA 3WNCA 1O95C 3WLIA 2F62A 1OFGA 3CRRA 4KH0A 1KL7A 4ZCTA 3O4GA 3S28A 3UJ6A 4OHVA 4JSTA 1RYMA 4KO8A 2NPFA 1IWOA 3BMOA 4BXOA 1YDHA 1T6XA 4H1UA 2YCBA 4QICA 2GK7A 1AA9A 3O8NA 1GSIA 1CUGA 1HE3A 3DR3A 2IW1A 1KKLA 2YOGA 1YKFA 3I5MA 4FR2A 4OXYA 3UKDA 4ECEA 3V8RA 5AVZA 3QLEA 1ONOA 4CLOA 1KH2A 1JJIA 1MJNA 2XLCA 3AK4A 3ONVA 5EQJB 2IHTA 2BGJA 3P0EA 1QG6A 1ZIPA 2I62A 1AKWA 1TF2A 1AGYA 2QL5A 2TMGA 2P90A 3DFMA 4FFWA 4L7QA 3FSRA 3TLAA 3TUIC 1NUAA 2H1IA 2QN8A 1KR5A 3QVLA 4N54A 4W5QA 1PT7A 3R6DA 4ZO6A 4EB3A 4F1KA 5ICGA 1OAAA 5CLGA 5BR1A 4TMKA 2BR5A 3K09C 3M4YA 2A58A 4GPZA 3NNNA 4OHBA 4XDYA 1M2OA 5DGCA 4MYHA 4IP0A 2O0KA 1EK0A 2W90A 4DW8A 3D0KA 1VRCA 4UQPA 2YMPA 2D3WA 3N8DA 1LQTA 2WFLA 2ST1A 4MRRA 4JJGA 4OJKA 4WAUA 4DY4A 4L0DA 5G3ZA 4QYWA 3ECCA 2HA5A 1FF9A 3F5FA 4IGEA 2HLPA 4O2AF 1D3AA 2WJVA 3EH2A 4IQ8A 1ZMXA 4D3XA 1ZR4A 3TNDA 5JI3E 3C6KA 2ICAA 3LD9A 5LOVF 1FUYB 1KFKB 4HP8A 4D3SA 1Y3CE 3R5TA 3RUHA 5HX7A 4EG6A 1UPAA 1FYWA 3PCRB 1IC6A 1RXUA 3B1ZA 3RROA 5AVTA 1YHZA 2MDTA 1YR9A 3RANA 3QVOA 2NU8B 3HLKA 4E13A 4N65A 1OQAA 2BHRA 2ZZNA 1LCIA 3ANMA 3Q85A 1GU7A 4U7WA 3FTEA 1RBZA 1Z4IA 2HV8A 5IRCD 2W2KA 2H5EA 2VHEA 2SKDA 5REQA 1OVMA 3S40A 1CJUC 3FNHA 1C8VB 4I14A 4ZVPA 3W5HA 2NXEA 3M1LA 4A8JA 2JCGA 3KEGA 1LH0A 3LP5A 1JXQA 2FMUA 3QWBA 3GMIA 4HVAA 1JAHA 2NO5A 5EOVA 1FQOA 1SU6A 4GKVA 4HFNA 1KQ3A 2Q8QA 2ZJ6A 3VI3B 5HBGA 4HT3B 4DV5B 2OWDA 2ODAA 3ZZ0A 2Y1FA 3R2JA 5KHOC 3I39X 2BTEA 4L6CA 2PRIA 4LHVA 1HK7A 4UJ5A 3ZD9A 2V9PA 5DDIP 3FWYA 1BMTA 5JS7A 5HF9A 5KC9A 1Y1RA 3G5AA 4XKJA 3ZDYB 4CEHA 1Q0RA 4W8HA 1EGVB 4H6XA 4LF6B 4BFUA 4G2TA 1Y8QB 5J58A 2JLXA 2JD0A 1RQ7A 3FDXA 1WR8A 2YNMC 1H6BA 2ZAGA 4J1TC 5T4EA 4D9EA 2HSZA 1VKNA 4MTLA 2K6GA 1QGUA 3N0VA 3VJKA 5AW0A 4CF7A 1EGAA 4Y6SA 3SSOA 4HF7A 1GRNA 4D9CA 2UXBB 4F5YA 5K3FA 2JDID 2HDHA 3K9WA 3KQMA 1U0SY 4LSZA 5IH7A 2FK7A 3GP3A 3CEJA 4MVJM 3ROEA 4LRYA 1V48A 4ABYA 2V74B 3G2IA 1UP4A 4LRXA 1HLDA 2LR0A 1ZO8A 2FSHA 1GDHA 5JH7A 4M1MA 1AQNA 5B3LA 3IAUA 3GAAA 1GL3A 5JCPA 5L8VA 2H7YA 1OIXA 1L5OA 4KQWA 3DD5A 5C46F 4E2YA 1AGPA 1JNXX 1GA4A 1EFUA 3LRPA 2PGJA 5AWFC 3QBEA 1TT5B 2OGWA 1E60A 2AN1A 3U7FB 4JS0A 4K88A 4HDKB 2HPVA 2V0NA 2ERYA 3SHWA 3ED5A 1EE9A 1XF9A 3OA2A 1S5PA 4MP3A 4WA8A 4WLUA 3PD7A 4GHWA 4U6QA 4GNKA 3OH8A 3PKJA 3UT5B 3ZWPA 1PSDA 4PR0A 3JYPA 2YV5A 2AI2A 2ZRNA 3EUWA 4V39A 4XRRA 3OTWA 5JH7F 2AYXA 3BSFA 2CXNA 4Y0VA 5C0OE 3VVLA 2QTVB 3TTUA 3QQ5A 1E9AA 1R10A 4N5HX 3AONB 3B6EA 2WHQA 3QW2A 5EWLA 3U4AA 4C4YA 3VQTA 4D4JA 1ND6A 2W2LD 4PXYA 5A1JA 5AKLA 5JQWA 3HYNA 4YH1A 3RIEA 4HVTA 5HOEA 2GSWA 2JFPA 4MYUA 1KJIA 5HZKA 1N1GA 3PFBA 1Q1ZA 3ILYA 3E9QA 4TMYA 1SKUA 3SIRA 1FRFS 1GM5A 4NAUA 3PL5A 1ZVQA 1H65A 1YZHA 3NHUA 4O0MA 1TAQA 2WKSA 3HB7A 4NULA 1SQ5A 1LXCA 4J90A 4B84A 2NQ8A 3H1BA 3SF0A 1U2ZA 5BT9A 5AKGA 3KZKA 4LHYA 2VSFA 2AVDA 2ZULA 3X43A 3UPTA 2ZB2A 2CVPA 5EPOA 3IAFA 3EE6A 3IKMB 4Q05A 1TNDA 4P36A 1K0FA 4HBZA 3A9VA 2WIJA 5HA5A 3VDXA 4WBNF 1Y5IA 1H9AA 2EDAA 4G4IA 4MWGA 3RT9A 5AM3A 5AJUA 2WSIA 5WRFA 4UTOA 4E22A 1QHHB 4ZQGA 5BSFA 3T9EA 3MCWA 4EELA 2GXAA 4CIXA 2XY4A 3B53X 3F6RA 4U2FA 4F6RB 4NC9A 1U7ZA 3G13A 2YWEA 4AN0A 1DAPA 3BL5A 1VCIA 1J33A 3VX3A 3AM5A 3FBTA 4WLOA 4NJMA 2H4YA 2VDMB 2JBWA 4Z3OA 1S89A 4EECA 4AKTA 4FB5A 2NUAB 2XMRA 4MS4A 1AU9A 1G18A 1C41A 1W9HA 3DT9A 4EEZA 5IJWA 3ZD6A 1JQ3A 2XE4A 4PC6A 3U4DA 1IDOA 1VFNA 5FBHA 5FOVA 2IH5A 1HRKA 3FYUB 4GG1A 4S1VA 4H3VA 4NE7A 3HXKA 3N75A 4MUXA 3IPCA 3JV7A 2Y05A 3RSLA 2ZUEA 2VJQA 2Y0CA 3C3CA 1YZVA 3NT2A 3AHFA 3OJOA 4HRYA 3PNOA 4DSOA 5KVCA 1AV7A 1HNWB 4QUJA 3LUHA 3BAZA 4CM3A 1XD9A 2ORVA 1QPZA 3FHOA 4X6YA 1DC6A 3VPGA 1PK7A 3UXMA 3WGNA 2SHKA 2H5IA 4OPMA 5BXYA 1U1GA 4IMRA 1T10A 1ODSA 2XYHA 4HFMA 4Z4IA 1VSQA 2MSNA 3BXFA 4JT2A 3RS4A 1KJZA 3UTCA 1NXTA 2H0RA 2GK3A 3O2QB 3OJLA 1FTWA 4RORA 4TVKA 3L0ZA 3QOWA 4B3HA 4URFA 4F4FA 3PHBE 2PCLA 1CQXA 4KKVA 4PLTA 2C4WA 1FZTA 1KAQA 4PHGA 3LWBA 1EWRA 1E9RA 5M04A 1IY0A 3QE3A 4C01A 4JR1A 4PLYA 2OECA 4YONB 2WLTA 4EATA 4DA8A 3NP7A 1M2EA 3C7TA 4ASUD 3KQKA 1N32B 3ZNNA 1ATIA 4UOZA 3MK31 2AR9A 5KB3A 4KXXA 4HSEA 4LVCA 4RK1A 1XTRA 5ES3A 1UINA 5TVGA 5CFQA 2RGYA 4MGHA 5K5EA 3VC2A 1NE2A 1NXOA 4ZQHA 3EVCA 4NFLA 1I0ZA 1HEIA 4NK4A 4JLNA 2QHXA 4J7XA 4EH1A 2VNKA 3VR4A 2FZ5A 3VR5A 3NGXA 4EFLA 3JQCA 3I6IA 3NOQA 3DSRA 1T3SA 3THWA 1SD2A 4TYYA 4KU4A 1Z0KA 2ON6A 3MUFA 4JYAB 3BCUA 4JJ4A 2ZATA 2ZSIA 2YYZA 1OILA 3SBOA 2JHPA 1YA4A 3GX1A 5JTTA 5LYJF 2UYCA 1MVOA 2HI0A 1I4LD 3E7DA 2VQ3A 3RU9A 1DIOB 1N75A 3RT7A 1NWCA 3OQHA 4PFSA 1N8NA 3IBYA 2Y1WA 3L8FA 2KMLA 2YV4A 4GGPA 3GLGB 3RC9A 4GRAA 2P11A 3HCBA 2OPBA 2X8JB 1XZGA 2IS6A 1PKXA 2P3SA 4BRZA 4ESVA 1UOEA 4J6FA 1EK6A 1P9NA 3U4HA 5CDFA 3EZYA 3RSGA 3VPDA 1AHIA 2C2GA 4TXHA 4ZCRA 1QH1A 2ZUWA 2Y92A 2YDXA 4E5NA 2YYSA 1J9GA 1GNPA 2NO1A 1AQJA 3LQ4A 1PEYA 3ROMA 3ZX5A 1FQJA 2Y93A 3L18A 1QHSA 4G5XA 4FK8A 1RKVA 3SXPA 5CCBA 1W49A 2Q28A 3D5TA 5L95A 1BIFA 4AG3A 3UFXB 2YQ5A 4LF9B 3EG9B 4C03A 3AFHA 3BTSA 3A7DA 4IV5A 3ZGVA 5FA8A 4PYIA 1T6NA 5F5LA 2XTAA 5DM70 4CMIB 3CT4A 3FAKA 4R1TA 1SCJA 1WQ3A 2XXJA 4H60A 4DHEA 1KMIY 3F8TA 1W59A 1X0XA 2GILA 4JI6B 4YX9A 1N5KA 1FC0A 1IY2A 4HWPA 5B53A 3QV1A 2PH5A 1UQUA 5A02A 1UANA 1UMCB 2VI5A 4FBLA 5CLFA 1L8OA 3C48A 2HOQA 4I8XA 2IYFA 2IA5A 3EZ6A 4Z0HO 1Y5LA 3HJRA 3OCXA 4YA6A 3W5SA 3EFHA 2WWVD 1EBFA 2XGSA 1E3LA 4P4SB 4CTMA 1P7ZA 3L79A 2R11A 1F7UA 5LP6B 2XITA 1K1EA 4U7PB 2D0IA 4QUBA 4UUBA 1BDIA 4XD2A 5ALIA 1GLNA 1RXYA 1N92A 1EK1A 1JBEA 1QAMA 4YRQA 1JPVA 2GCGA 1R5NA 3GUHA 3LL4A 4HH3C 5AKJA 3BH6A 3ZJUA 4ARIA 3GUCA 3HJFA 3KKEA 4L78A 3LL7A 1N6OA 2FSUA 3EC1A 4X85A 1ZQ9A 1IMOA 2ATCA 2CVFA 1U2DC 2XNKA 2YV1A 2VDVE 2VK1A 3VOAA 4KPYA 3USZA 3Q3HA 5K0EA 3BD6A 2EFGA 2A0YA 1KK0A 4FT2A 3EMDA 1UBOS 1V16A 2ONYA 2AG1A 2RHWA 3OJXA 1YI8A 2TRSB 3NRCA 2AC4A 4FFPA 3HCWA 1S2OA 1H6CA 4L4UA 4YI3A 3DQPA 4DJTA 1X1RA 1HT2E 1HEYA 3EG5A 3DV2A 2AOUB 2I87A 2CWDA 3W1EA 1DINA 2GPYA 2IV3A 4YCJA 3GJ6A 5A0TA 1W6UA 2WVJA 3FPKA 1NXQA 2YR0A 3L5KA 4W7IA 4Y18A 3W7VA 1GQQA 3WJ7A 1OX4A 4S04A 4ZCSA 4EPVA 3DFIA 2DFVA 1OXBB 3NIBA 1O96A 1LTHR 1J5PA 3ACDA 3GRAA 3WYDA 3VR4H 3VR5H 4YGYA 2FAXA 2WKWA 4DLVA 2HSDA 2XEDA 4LFBB 1AK2A 4HS9A 2COUA 3U19A 2PGDA 1G7SA 2Q49A 3U49A 4GKAA 1Z4PX 3VV3A 5LR6A 4XH9B 4M9QA 4WN3A 5DYWA 5LWHA 3ANNA 2E9SA 2CHUA 2CDCA 4G09A 4NHOA 4PLZA 5DNVA 2O50A 1UK9A 3TLBA 4WMLA 2X7HA 1R4NA 1E4VA 1FUKA 3O7MA 1ODCA 2Q0SA 2P65A 4H0FA 2PKYX 1CUBA 4BFZA 2FX2A 1E92A 1T1JA 3RS8A 4EHBA 3RHZA 1Z4KA 4RK5A 1JHQA 2OFXA 2RCNA 3ZU2A 2BH9A 4C4PA 5B2EA 1QBKC 3OFJA 1TTTA 1C4KA 4KQ2A 4FIZA 5ENVA 1NVAA 3OECA 3M5WA 5JBQA 5CFLA 4PQGA 3NGMA 2PQ0A 4RFLA 4CQMB 6AT1A 3G5TA 2Z8YM 5JECA 2FOXA 5JNRA 2Z6UA 1C8LA 2IXDA 3B51X 1XXHB 4LWZA 4RTNA 2WNSA 2C4TA 3C6MA 4G84A 4OGKA 3WL7A 3C8HA 3KVYA 3PXAA 4RH0A 2DXIA 4XX1A 1XMOB 4RIGA 3RYHA 3B20A 5FOTA 3PPVA 2LUOA 4YMVA 1VSTA 4YTEA 5FQOA 4Q00A 5BNZA 4L6IA 1NVDA 5FAKA 3BB1A 5EJFA 2D1RA 3OFKA 3ZHYA 2I9KA 3QQPA 3OETA 4OP1A 2X14A 4MVJD 4OK3A 4YWJA 1H93A 1G2QA 2G6TA 2W58A 4FX2A 5BUQA 3HKBB 1PF7E 4CL0A 4GSKA 4NYIQ 2FEWB 4LY9A 1PGQA 4PX2A 4UU7A 2RONA 2VTEA 2A9KA 3CEAA 3LOPA 3Q3VA 5JNTA 2DWQA 3P9XA 3IIJA 2XXAA 1NVBA 2ZBQA 4MIKA 1CLEA 3FPGA 5HJ5A 1XCOA 1GA1A 3H04A 5CLIA 3ROQA 3EXHC 4L8FA 5CFNA 1O2DA 1OJLA 3KCNA 5P8WA 2Z6AA 5D3MA 1Y98A 3JZMA 3JRXA 2PBRA 1T2AA 4MYSA 2WW8A 2QW8A 3MGGA 4RY0A 5CPFA 1KZHA 5L40A 1YS9A 4NENA 1XLVA 4WZZA 3Q0TA 3L4KA 2QRLA 1YJ5A 1QLJA 1RLMA 1UJCA 2YFYA 1BJRE 5K4AA 3B6JA 4N3CA 4ZI7B 5INTA 2O8FA 1HR0B 1EP2B 1Q74A 4L8LA 4ZALA 2FWJA 3E0XA 3B3AA 5A4DA 3DEKA 2BKXA 4ARZA 1QG0A 4XYLA 3OMXA 4O1IA 4O6VA 3QX7A 1M6WA 3P9CA 4KGDA 1WW2A 4TTSA 1MMFB 3H2ZA 3GXOA 4FOOA 1MBZA 3BGIA 4YJ2A 8GPBA 1Q1QA 2ZJBA 3N8IA 4G1BA 3NYIA 4H0NA 2PWYA 1J56A 4F9EA 5BW8A 1I2DA 2IYLD 3E23A 2WJHA 3GCZA 4HMPA 4K1XA 2OG1A 1SCDA 2Y4NA 4W7HA 2ZWOA 2ZSKA 3O31A 3O84A 1PL6A 1LF0A 3TOVA 1ATZA 5ILQA 3QJ5A 3ETEA 4FE3A 4F85A 1R64A 3BXEA 2OQIA 1OAOC 1F3LA 1OD6A 1WIWA 4XJXA 4C05A 2QSUA 5GZ1A 5J2UF 4QBKA 3LBYA 1DEKA 2C92A 2WUWE 1HTWA 3ZU6A 2BTOA 1CZKA 4YAWA 1JMYA 4KMMA 4EGSA 1DOZA 5I7OA 3WLHA 3FDFA 4JHXA 5JIBA 1HV8A 4NMWA 2QRHA 4ZMRA 1C14A 1KERA 3IPYA 4B76A 3AERA 2PNJA 5I9SA 4UARA 4D8TA 1A5ZA 1H9CA 1MO2A 5BYBA 3OZXA 3DW3X 1WEKA 2H2WA 3SZLA 1ZONA 5LOVB 5C5CA 1FDUA 4EYSA 1WCXA 2JFWA 3GJ3A 1PEDA 4JI7B 5B1SA 2WAXA 4MDHA 4DV6B 1IVNA 5D5HA 1KZ7B 1JU9A 4WZ6A 4D9HA 4NBRA 4QYIA 5IVKA 3AR5A 2AJCA 3VV2A 2XMDA 4FCVA 4TV9F 2D13A 10MHA 4RHTA 4AWXA 4HNQA 1EFLA 2QVLA 4AJJA 4CL8A 2NYRA 1QHGA 3PXXA 3V4RA 3S81A 1YL7A 3HYTA 4Z0NA 3EPLA 4R40A 1E5LA 3ICPA 4YHBA 4QPZA 2PZ8A 3KKMA 3THRA 4KBGA 1E2BA 1P81A 3P4UA 4PQYA 5GJVC 4A1OA 4YV2A 1BYUA 1Z9BA 3UW3A 2QN1A 2Z9CA 1NOJA 3PNBA 2C3MA 1GQOA 5CJPA 1J6UA 1SC1A 5ALUA 1A7AA 3QKTA 4V0LA 4D79A 3LYLA 3PA8A 3FMFA 3G85A 1PG5A 1TC1A 3CB4A 5SYAA 2FQXA 1XAIA 4UATA 5BV2P 2D4AA 2C9ZA 2R97A 3BZWA 3NUZA 3SYRA 2QLMA 1J9EA 4M1ZA 1BE8A 3HC7A 3J7AC 1Z6PA 1OV6A 1E4YA 2ZK7A 4M0MA 2CHGA 2EP5A 3LIPA 3DLBA 1Z34A 1FNSA 1E7QA 2F48A 4CZ2A 2GPSA 3QG5A 1EA7A 2BSXA 2JI7A 1F51E 2XAAA 3JYQA 5AXBA 3NNDA 4ON9A 4CW7A 4ALJA 3WQRA 3AVPA 1VOTA 1IRXA 2W8BB 4LJAA 4RPIA 5KSYA 3A6GA 1U8TA 1W8DA 2HV9A 3ENZA 1YUBA 3MWYW 4FT4A 5IPFA 4I1PA 2EF0A 3F3MA 5B1YA 3GELA 4Y0NA 4RTOA 4D5EA 3U60B 1DVRA 2XB2A 3VNUA 4MI3A 3M70A 4XDZA 5T3UA 3UA4A 1N77A 2P7IA 1Q11A 4XASA 2XUKA 2W2VA 1I2ZA 3AF6A 3HTXA 5AVOA 3CSUA 3LUCA 4GMXA 1U2GC 3W05A 1DLIA 1KZ1A 2Z3ZA 3E8SA 1K27A 1P4SA 3IEXA 1TCVA 3FPLA 1MAAA 4DHWA 2I55A 4B40A 3DJFA 2OCGA 1AHHA 1J70A 1JG3A 3KXDA 3QU2A 4LYFA 4QT4A 5ERGB 3P97A 4PAOA 5KOJB 4QC2A 1B0ZA 4YJGB 2W6PA 4WIAA 3VMFA 1KRWA 2RGXA 5A7GA 3EZXA 2DQYA 4TYWA 1EWTA 1KK3A 1GPWB 2D7CA 3AW8A 5DGHA 3I5XA 1QQBA 3SXUA 4ILEA 4HNAB 2GZ1A 1B43A 3SNHA 2IJGX 2HF2A 1D0VA 1KVSA 4NONA 3UCXA 5I3ZA 3I4FA 5AD1A 3ZU5A 2R6ZA 2O8BB 4G8CA 3FD8A 3EODA 2C7OA 1QKIA 4GYKA 5IN5A 4V0KA 4BUJA 1LWOA 3AV0B 3THSA 2ECQA 5C32A 4S1NA 3UK2A 1YSCA 4BX3A 1PR5A 3JPWA 4MKRA 3DDWA 4JQSA 3H9EO 1BU5A 4OQXA 3PV0A 1QP0A 1JIKA 1Z5NA 3AYXB 1MO5A 4CRWB 2PUCA 1O5TA 3VKUA 1R0BA 2VF5X 1N78A 2DFTA 2VJDA 4A9AA 1PVVA 2O7SA 4E46A 5BQ5A 3S70A 5U9CA 2DT8A 5JXIA 1BE0A 3BRQA 2XZDA 1U1DA 3R09A 3KJGA 1PV4A 3W3AD 1CS0B 4IOLA 3NIGB 4AECA 2H5LA 4C6RA 2IF2A 2PSEA 5AQEA 1L4FA 1ULZA 2PL1A 4Q16A 1PW7A 3UT6A 2BFDB 3OFSA 2P4SA 3THYA 2B20A 5DM1A 3OCWA 1NW5A 4O4HF 3S55A 4UM7A 3KYCB 1ZIDA 3FNIA 4BNXA 2DTEA 3FB4A 4PN3A 1NXPA 1R4AA 2G0TA 4G89A 2DY0A 1C9MA 4OU5A 5LZ7A 3UY4A 3WIOA 3K2BA 3T5CA 2X4DA 5F21A 1DKRA 1P1CA 1ES9A 2HTFA 5L3SB 1PS0A 4CMBA 1IBKB 2GHTA 4HLQB 4HXYA 2VXOA 4JT4A 1HF3A 1M34B 4K46A 4C7XA 3SFZA 2ZYVX 2W2PA 1M2VB 2IFTA 4QKQA 2IL1A 2QF7A 5JDCA 4HZUA 2O2IA 3RSSA 3UFBA 3Q87B 4E5SA 1SQSA 1WXGA 2F4NA 1J49A 3NBKA 4ARAA 5JSZB 1YBAA 5KNDD 2Z6QA 3L7IA 5CB6A 4PVDA 1AB5A 2QJRA 1ZVMA 1QMPA 2M2IA 5HF6A 5FADA 3QELB 3VA7A 1QXSA 3UHAA 4MPTA 4JJ7A 1Q12A 1ZJ5A 1FFSA 1DB3A 1ZZGA 2FV8A 2QP4A 2V4UA 2KX7A 3NKLA 2WFMA 5FO1A 4BNIA 4NJOA 1C1DA 4HX2A 4OJQA 1HDIA 1P2DA 4P22A 3WKBA 4UU8A 5JAUA 2CNLA 3K70C 3WKDA 4DREA 4JX8A 5FD8A 4A03A 4PNEA 4JI5B 1ENPA 4H1WA 1H4VB 2WPNA 1VMEA 4DYDA 1XO1A 4IHJA 4YEDA 3R4CA 1YJCA 1DIGA 1K88A 4ENPA 1P75A 2WMDA 3C3XA 4CKCA 2QL6A 3H11A 4C04A 1E66A 2VHVA 1GG2A 3Q2OA 2B1JA 1KYVA 2QW0X 1NPTO 1X1TA 4DANA 2RH4A 1NA5A 3OM1A 4J6EA 4TPKA 5AVWA 2HQ1A 5IBCA 2ZJ7A 1MC4A 5AJXA 1LD3A 1BEUB 1ZNZA 4P5DA 3IAHA 3HWWA 2RBKA 2EX0A 3BOSA 4DSNA 4F3TA 3X1YA 5TMEA 4CIWA 1NU8A 1Z2DA 2WZCA 4Y3UA 2IS1A 1REQA 1YRQA 1T8YA 2I8CA 4EMUA 1RI5A 3W7BA 2DY1A 2OZLA 5E2IA 3CG4A 1K92A 1Y7TA 5FOXA 5IF3A 5JEEA 2X7JA 3NBMA 4NOLA 2PGNA 2BT4A 2IS2A 3I45A 3WE7A 3ESAA 2VWGA 2CB0A 2XD4A 4O29A 4HC4A 2AKEA 2VKTA 3N59A 3ZU3A 5IDYA 3KPWA 3CVOA 3MWEB 5ECWA 4B81A 2HJRA 5C52B 3PQ5A 4W5TA 3TIGA 3FPJA 5F3WB 3P52A 2JEYA 2FCAA 1P2UA 3QVGB 3O03A 1VJDA 2C84A 4L0MA 4D4HA 3CH7A 2IHVA 1LZKA 1UK8A 1QHYA 2FVXA 4ZIRB 3U16A 4JYZA 3MT8A 4V2IA 3GYBA 4XUDA 1J8FA 4XPIA 3T1YB 1T5SA 2R1VA 3WLKX 3T7JA 4LRSB 4HQKA 2F1RA 1JHMA 3DHYA 4XTCS 4S2UA 3EIOA 1BMDA 3DHEA 1QZTA 4GPD1 2JIRA 3CR8A 4PQEA 1G21A 2GXQA 1Y6QA 2J0QA 4JXKA 4X3CA 3QYAA 1FMTA 2GFHA 3KYIB 4K3VA 1OASA 2CJPA 2CXSA 3KHTA 1JFLA 4MV1A 5DV9A 3WLPA 3PHJA 3M6XA 5GVRA 2D06A 4ND7A 5LNK1 4UCWA 3VSCA 4CCYB 2P2SA 1RYNA 4DA0A 2E87A 3ZDCA 3O8DA 4B73A 1JSRA 2VWHA 1G4AE 1PJ8A 1QE3A 1OREA 3L6UA 4M7PA 2DQKA 2F00A 1NVMB 4N1AA 4B3XA 1RP7A 4MXDA 3R75A 3HACA 2BJHA 2WYWA 3VZQA 2QN3A 3SFTA 3OPYA 1Z0DA 4FYJA 3FLBA 5F23A 1TGYA 2HLHA 2UZ4A 1NW6A 2QUIA 1VI6A 3WNBA 4K86A 4KXLA 3ZHBA 3P9RA 1E1QA 4AN1A 2WKPA 3BZBA 3HJHA 4O4JA 1K08A 9MHTA 1PX0A 1UWLA 3AJAA 4P2GA 4QFDA 1WOMA 3OEHD 3AHDA 4I9NA 5TY0A 2GWRA 3FOAA 1UFVA 1USWA 5D5PA 3HMQA 2XQJA 1LJ8A 2YHUA 4OXIA 1AKNA 1NZFA 3EJ6A 3ML1A 3QX3A 4ZHSA 1V25A 2VLIA 1G2IA 2MSKA 2CUNA 3PRKE 1CDDA 2C7VA 2QTRA 1PT8A 1T8SA 2BBWA 3WMGA 2BUBA 1J2JA 3GJRA 1Z39A 4HY3A 4LZJA 5JZ9A 1RVV1 2HGSA 2JI8A 1SO8A 4KN8A 1NW3A 1WZNA 2IEGA 1MOSA 5CTAA 1KP9A 4MW1A 1QOPB 1SCUA 5B1HA 3UWMA 3V4LA 4JDPA 2BFBB 2EU8A 1LFAA 4NABA 5IBPA 4EAAA 2QRUA 1G60A 3D1LA 2IQ5A 3JVEA 2P3QA 2QDXA 1AF7A 4KR7A 1B14A 1UFKA 2X5KO 2J3QA 2ANBA 3EF1A 3UUFA 5F2NA 1Z07A 5KVVA 1DJQA 1BCRB 3RPEA 2ORIA 4KYIB 4AB1A 5EHGA 1ZP6A 1Y8RB 4DBVO 3IEPA 4B8YA 1LC3A 4RA9A 4FVTA 2XDYA 3PFFA 4CMGA 5IUJC 3LW7A 4EJ2A 5BNTA 4Q6BA 5KI6A 5HCUA 4C89A 3VSEA 1UADA 1C0LA 2G8NA 3JR3A 1TA4A 4KTTE 4QGFA 1TLFA 3GGJA 2P9YA 1RZ3A 3IQWA 2PBZA 4B6JA 3H4TA 2PKRA 4HNVA 4WWHA 3ILSA 3F7TA 4BE4A 4NFSA 3L6BA 2VAVA 5I7VA 1EMDA 5CHEA 1O94D 1KVTA 1FTYA 1PZGA 1BRMA 2OO5A 1YTLA 4NBUA 5CNKA 5FYDA 1VIMA 3NRJA 5C80A 1D8AA 1IWBB 4KIUA 2NG1A 1G6KA 1RM3A 2QRPA 4FD3A 1F0PA 5K3SA 3TS1A 4OUDA 4UDNA 4DCSA 1WABA 4WNAA 1SURA 4JR0A 4ZEWA 2JW5A 3UMMA 2OBYA 1CQJA 4WCVA 3E7FA 1E6LA 4MOWA 4CMEC 5EJGA 4GL2A 3SGLA 5TNXA 4A10A 1U90A 2Z83A 3VU9B 1SC3A 1SQGA 2FXVA 5LP6C 1XX6A 4EB8A 2VF7A 2JEOA 2ZAYA 1UBMS 3HBNA 1SIBE 3HEBA 4RJKA 5B58T 3VR0A 3VPFA 4C0XA 3GLFB 2Z5VA 4HAVA 1OYWA 2J48A 1DQYA 3FBGA 2YZ2A 3TEMA 3UJCA 4OLHA 3VX4A 4E14A 2YYYA 4NU5A 1GAWA 2HMSA 4XGNA 1Y8AA 3V1YA 1L7VC 1M0WA 1ZMTA 2I3ZA 3EOZA 4X84A 4C3ZA 5BR7A 1JDUA 3G6WA 1IIRA 3A7EA 1VKOA 2H1OA 1QIFA