3H6KA

Crystal structure of human 11-beta-hydroxysteroid-dehydrogenase bound to an ortho-chlro-sulfonyl-piperazine inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
260
structure length
260
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Efficacious 11beta-hydroxysteroid dehydrogenase type I inhibitors in the diet-induced obesity mouse model.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 100
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h6kA00
3ORFA 4OJNA 2C29D 2ILTA 4U6SA 3TWOA 1PL7A 4YAGA 1KY4A 3PPIA 4HY3A 1PWXA 3H65A 4KUGA 3U4DA 4L75A 1YDWA 3D3WB 1G6KA 3NRCA 4P8RA 1JKIA 4YACA 4J1NA 4RF4A 4R51A 3WSVA 4YR9A 4NU6A 4D3FA 4CV1A 1NR7A 1G0OA 4W82A 4TVBA 2AEMA 3JQEA 3WOHA 3UN1A 3WGIA 4NZ9A 1YOVA 2FHSA 3R3SA 1NNUA 1O0SA 1LDMA 4XB1A 3GGOA 2GF2A 3GVXA 4Y6SA 2HMUA 4NH4A 1MX3A 3KSZO 1DRVA 3ONEA 3V5NA 2ZB3A 1I5RA 3MJ4A 2QRLA 2VYNA 2E37A 3SVTA 4UUOA 4AJ1A 5CEJA 5KOIA 3WGOA 1H2HA 1P77A 3KV3O 2ZQZA 5EJ2A 3KYDB 4J1QA 3JV7A 2AQIA 1CERA 5MGBA 5DP1A 1H6BA 3ENNA 1PS0A 4N5LA 4GMGA 1GYQA 4OSOA 3GVIA 1LSSA 3HQ4O 2VZ9A 1BXGA 4B4UA 3PHGA 5CG1A 4CM4A 1PS9A 1HWYA 2GSDA 1P0CA 3I52A 2D5AA 3V1YA 1BVUA 5KNLA 1GUFA 2G5CA 2BFMA 1ZXBA 3UH1A 1U4OA 3VPXA 1A4UA 1ISFA 4QUKA 4J90A 2OMEA 1I36A 1O89A 5CDTA 5BNTA 4INAA 4A10A 1NFQA 3KTDA 2JFGA 5F1KA 1ZFNA 4BKRA 3NTQA 1GU7A 5AXDA 2WD7A 4AICA 1LSOA 1CYDA 4F3YA 5BNIA 3RC7A 2OZPA 4P38A 4BNHA 4BKPA 1V9LA 1IUKA 3GVCA 3GZ4A 4ROSA 4HFMA 4I5EA 2CFCA 5DOVA 1LI4A 1SB9A 3GHYA 3GHHA 1RM4A 1KEPA 1TB4A 4NBVA 4CQMB 3BMNA 3FR8A 1WXDA 3OF2A 1XDWA 2YFQA 3MTGA 4MVJF 4YQZA 1YB1A 3IP3A 1QYVA 3HFGA 3ANLA 1EUZA 2FRDA 2J3KA 3K73O 1VRWA 4MKXA 5I7SA 4XZ3A 2PD3A 2RCYA 3AWDA 3DOJA 3SBOA 4RO0A 4LRTB 4UVHA 5L45A 1DOHA 1QYDA 1ZMTA 2C54A 2VHYA 2PKQP 2HMSA 4C7JA 1SNYA 3DZIA 4UEOA 4B4OA 4CMIB 4Q3NA 2X0JA 4AJKA 1YJ8A 5B37A 2TMDA 1EVZA 3W6UA 3DMYA 3RWBA 3JSAA 3RBVA 2YJZA 3D3WA 4RVFA 4ALMA 1EBFA 1ZNQO 4MVJP 4DLLA 4JN6B 3OHSX 1U8FO 2TMGA 1WNTA 4AJIA 3HADA 2V6BA 3GUYA 3DMTA 2DLDA 1HZZA 1U7HA 3HFSA 4GKBA 4E4YA 1TT5B 1E3EA 5C7LO 3C7CB 4U8GA 4GLLA 1GCUA 3I23A 4IINA 1DIRA 4QQRA 4P22A 3TSCA 1I30A 3DTYA 3LC1O 1U5CA 1Y9AA 3Q6IA 4PG5A 4RQTA 2Q1SA 4NQZA 2VTDA 1EMDA 3DXFA 1M6WA 3QY9A 1RYDA 4M49A 1ADFA 1NPTO 4RV9A 3Q9NA 2NVUB 4YJDA 1OZAA 3FD8A 1V8BA 4DC0A 2NUAA 1GUYA 3DTTA 3OEYA 1DRWA 3KYDA 4BNIA 4H3VA 2NWQA 3WWZA 4XRRA 1AE1A 3AOEC 4Z3DA 1QYWA 1GD1O 3FBGA 4BNTA 3CXRA 1JW9B 2EHDA 3ZWYA 1UXKA 5BQFA 2ET6A 3I5MA 2GCGA 2I65A 3ASVA 3Q9UA 4C7KA 3SXPA 3FWNA 1ISGA 3WQSB 1XSEA 4KUHA 3JD4A 3OJ0A 5DCYA 1WZEA 1IZ0A 3PWSA 1F17A 1NYTA 4HNGA 4MP6A 2ZJ0A 1NPYA 3JQBC 5JYDA 3HJAA 1D7OA 4YT8A 1MG0A 1DLIA 3RU9A 1U4SA 1EDOA 3FNFA 1PWZA 1LRJA 4U5QA 4WK6A 1U7TA 4KWHA 5A3VA 1UP7A 3VZSA 5B4VA 3U62A 3ICCA 3H9EO 5CP8A 3EMKA 4J1SA 4QT0A 4PFJA 1DC6A 5FFFA 4BQPA 2P2SA 3E03A 2B83A 4DQXA 5F5LA 5U1PA 3WIDA 2VHXA 1QMGA 1J49A 2Q1UA 1NM5A 1T1RA 2W2LD 4ALLA 2FPPA 3RC9A 1NP3A 4YXFA 4HFRA 1XKQA 1R6DA 4JIGA 4XQCA 3UCEA 1GZ6A 3AUTA 4HX5A 5CDGA 2VHVA 3IS3A 5THKA 1EFKA 2WMDA 1OAAA 1MXFA 3OIFA 3NEPX 4RPHA 4XX0A 3TN7A 1HKUA 5ICSA 3L4BC 1Q0QA 3PIDA 4MVJE 4BGVA 1T24A 2I3GA 1HE3A 3G49A 3BTUA 1LTHR 3LLSA 1M66A 2FN7A 2OFPA 3ANMA 1Y8RB 1TVEA 3WQRA 3VH2A 2IDZA 1UP4A 4AJEA 4JQCA 1HETA 4ID9A 2Q49A 4TQGA 1UXGA 3LK7A 1TT5A 1CEQA 1R4NB 2BFOA 3DAGA 1DIBA 3I3OA 1N1GA 3K96A 2VWPA 4JCOA 5TRTA 4E5YA 1YRLA 1E3IA 1ENPA 1CETA 2LDBA 5GY7A 2EG9A 3RU7A 1KC1A 3P2OA 3B70A 5CPFA 1KVRA 3DBHA 1C0IA 2I5PO 3ETGA 2OXIA 3F9IA 1LDYA 3EVNA 1LRLA 4QTZA 4OKIA 1U3VA 3BYZA 4WCFB 4BB6A 3F4BA 3FRJA 5A5EA 3IAHA 3PFFA 3BIOA 3V1TC 1MB4A 4DBVO 1L7EA 3LYLA 1U2GA 1P45A 3E9NA 5TIIA 2AW5A 4L8VA 1GZ4A 3A1NA 5AXBA 3ULKA 4GWKA 1LDEA 3ANNA 3SLKA 2BI8A 4NPCA 2FY8A 1UP6A 2HQ1A 1XQ1A 4QO7A 1IB6A 4DLAA 4RVUA 3PP8A 2OBNA 3H5AA 4K6FA 3G0OA 1R12A 1YL6A 3ZN2A 3I4CA 4E2ZA 5KKCA 3G79A 3M2PA 1XCBA 4KDFA 7ADHA 1DPGA 4XR4A 4FQ8A 1ARZA 4LMRA 3KEQA 2W2KA 3ZWBA 5JC1A 4WUVA 3GA0A 3PJGA 3PHIA 2HKIA 3K6JA 3QWAA 4XYMA 4CJXA 2VCYA 3KUXA 4MO2A 4BMNA 1YL5A 4EI2A 4CMKA 5A06A 1C0LA 2GZ2A 3RIHA 4W9NA 3WBFA 4PLFA 1K6JA 4WNIA 2YV2A 3OJOA 2AMFA 2DQ4A 1NVTA 3OQ1A 1VE9A 3WX0A 3WJAA 4PZDA 5HM8A 2VHWA 4XR9A 2DPHA 1EUDA 2UV8A 1F0YA 2P4QA 3JCZA 4FOSA 4D42A 1A5ZA 5G0VA 3DZGA 3KZVA 1HDGO 5CG2A 2G17A 3ZWWA 5G4LA 5T5QA 3WGQA 1Y8RA 1U3TA 2OP0A 1JKFA 3GDGA 5DT9A 3HHPA 5L7WA 5EL0A 4ONEA 3ZV4A 3SX2A 4BL5A 4TRJA 3GN2A 4XJSA 3L4SO 1UAGA 2ZK7A 3FR7A 5ITVA 1B16A 1FDTA 1N7HA 5C7OO 4GVLA 2C5AA 5ITWA 2YV3A 1EEHA 4BNXA 4A03A 1GQQA 2EERA 4EZBA 4TZTA 1I24A 1OBFO 2C59A 4BO2A 2Y1FA 1RM3A 4HXYA 4CMEA 4XA8A 3INTA 1X7GA 3IL2A 2OOSA 4D44A 1K6IA 4WCFA 1ADBA 4M1QA 4MPDA 3BA1A 2NQ8A 4B8ZA 2QQ5A 2VUUA 3GRKA 4J7XA 5KWEA 1XYGA 3IKVA 1OC4A 1X1EA 3EW7A 3K5PA 3DHNA 4PG7A 5I9LA 3MJTA 4H15A 3B1FA 3ITKA 4UUPA 4D46A 4O5OA 4LSMA 2RAFA 4IDGA 1WWKA 4EDFA 3JD0A 3UUWA 4PZEA 5BSFA 3TZQA 1QLJA 4E32A 5I9NA 4HBGA 2NV6A 1BHSA 1QXSA 1GEEA 1B8VA 2B36A 1HL3A 3FWZA 3GG9A 3W8EA 4BVAA 3ZHBA 4BO9A 1DO8A 2Y1GA 1A4IA 5U4QA 3VKVA 2ZTLA 1IHXA 4EUFA 1PJ2A 4PCVA 1EZ4A 1LA2A 2WD8A 4KUEA 5CHEA 5DCWA 3X2FA 4L73A 4E21A 5LCXA 2HMWA 3U09A 1ZW1A 3SC6A 2DKNA 3FI9A 2YHUA 2QX7A 4Q39A 2YQ4A 4GPD1 2FZWA 5IF3A 5T8KA 3PDJA 3BMCB 3CPSA 3VZRA 5HTOA 4O1MA 1P1IA 3P19A 4TRRA 1LEHA 3H5NA 3DBRB 2NACA 4IJWA 2EJVA 3OECA 1NAHA 3VC7A 1XEAA 1LDBA 3H9QA 4BV8A 3FPCA 3G1TA 1O5IA 5HS6A 3KOUA 4PLWA 1SZJG 4AJLA 1PJCA 2G1UA 3GFGA 1IULA 2DUUA 2A9FA 2VZ0A 2GZ3A 3B1JA 4OGWA 1SOVA 1U2DA 3C1OA 3JYLA 2IZ0A 1Z45A 3EC7A 3GG2A 1JKJA 3GDOA 5T6BA 3GFBA 2VWHA 4GGPA 4Z3KA 1TA4A 2VNSA 4B3IA 1CWUA 4BB5A 5L4NA 3WYBA 3SC4A 1AHIA 1LQUA 2QG4A 3IIEA 3GF4A 3O38A 3ZWXA 4W99A 3FCOA 2D3TA 2Q99A 3ROQA 3RUDA 4HWKA 4R1SA 1P44A 4BIIA 2X23A 1H94A 3U4IA 3JQ9C 1YO6A 1SBYA 3OSUA 4DIFA 4R9RA 3EVTA 2X0RA 3EYWA 1F14A 1JVSA 3BTSA 1T1SA 3U0BA 3VTFA 2P5YA 3PEFA 1LSJA 1PZFA 2OL4A 1YB4A 4NFHA 3ONDA 2PD6A 4I5DA 3RAJA 4CMBA 4Z6KA 4CV0A 4H16A 5F1OA 3OICA 4ZRMA 5IDXA 1P3DA 4BNLA 5G0TA 5G2OA 3I9NA 4NJOA 5TLSA 3NTRA 1NWHA 3TDKA 1CQIA 3LSYA 4FS3A 2CNBA 4NIMA 1PZGA 2DVMA 4IJVA 3A9WA 5DBIA 2DBQA 3PRJA 2WYUA 4XYLA 2C20A 4DWVA 3DR3A 4IJUA 4TKLA 3IKTA 3F1LA 3FNGA 4Y98A 1XR3A 4XQGA 1MXHA 1SAYA 3FHLA 1GAEO 4UULA 2NNLD 4C4OA 5IXYA 3CTMA 5JXWA 5K6AA 2R2GA 3E82A 4CM3A 5A04A 4FJ0A 2GR9A 2VUTA 5DDIP 1X0XA 3U49A 4BKOA 1I3KA 2CF5A 2Y99A 3ZNNA 4FGWA 4YRDA 1EUCA 3FNHA 4MIYA 3VOSA 1ZUD1 3R3JA 4J2HA 5KJEA 5ENDA 2BF7A 4EJ0A 4IIVA 1HZJA 1HF3A 1MGOA 3H7AA 3O8QB 4QFDA 4FCCA 4JJIA 4Y6PA 1YOVB 2DUWA 2QZZA 4GSKA 4I9NA 4JROA 3BTVA 1WMBA 4IGEA 4CQMD 1N9GB 3EY4A 2AEJA 2RHRA 1H6DA 4L4SA 5IDYA 3BMCA 3L6EA 4YAEA 4R1NA 3D64A 5ER6A 4MP3A 3DBRA 2YUTA 3R6DA 1LQTA 3IC5A 4BNWA 4M87A 3RASA 5IZ4A 2B4QA 4I1IA 4D43A 1XG5A 1O8CA 1LNQA 3GNQA 3MZ0A 1Y5MA 5GZ6A 2P68A 3T7EA 3GGPA 1HDCA 1WDLA 4I5FA 4BMVA 2VWGA 3C8MA 1RM0A 3PI7A 2HMVA 2IXBA 5K9ZA 2H5LA 3GK3A 3VZQA 5EIOA 2Q2WA 2Y93A 3NTOA 3VHRA 5BSHA 4NMHA 3RD5A 1XLTA 3RJ9A 4ND4A 5JCJD 1YJQA 1JVBA 1BXGB 1DAOA 2WM3A 3BHMA 3ROKA 4E0BA 3NGXA 3DHEA 1Y6JA 2O7SA 3BMQB 2HMTA 1LUAA 2FPGA 1FF9A 1ORRA 1UXHA 2EKPA 3H3FA 5JNLA 1F06A 4B7XA 2FMUA 4IIUA 1HYGA 1DHTA 1PJTA 4N5MA 4BGUA 2DTDA 2QRKA 4CV3A 5BSEA 3L9XA 4MVJI 3I9LA 4XEHA 4RVGA 3VAZA 3CUKA 4YYZA 1R15A 3ZGYA 1E0DA 1JLLA 1I2CA 1DC4A 2JFFA 2WJPA 3AU8A 1DRUA 2QZ9A 4J0FA 3VH3A 4A2CA 3FF4A 3I1JA 2CZCA 1ZSYA 2HK7A 4NDNE 4FJ1A 4ILKA 2Q46A 4RPKA 4S3MA 3S2EA 5JSFA 3WJ7A 2O4CA 3E18A 4MKZA 3D1LA 1QYCA 4DREA 2B37A 5I9MA 4NFYA 1HE2A 4RCVA 3PWKA 3DZHA 1GY8A 1QLHA 4Q3AA 3PJDA 5A05A 2OO5A 4J43A 3NGLA 3DAFA 4H7PA 3TRIA 4DBZA 1A9ZA 4K1LA 4PLTA 4UEJA 4WCFC 5FI5A 3QV1A 2Q3EA 3ETEA 4B7UA 2ZCUA 4R54A 4EITA 4MVJM 1PZHA 4YCAA 7MDHA 3QHAA 1ZSVA 4RPJA 4J49A 3AW9A 4IDFA 1TI7A 3DZKA 1IHYA 1RKXA 5IFLA 4YJFB 1A7AA 1ML3A 4YWJA 5HRUA 1UZLA 1TXGA 4TKMA 1PGNA 1B3RA 3KVOA 3O8QA 4P4NA 5C7IO 4BNZA 1IPEA 4A0SA 4PLHA 4R41A 1UJMA 2VWQA 2Y66A 3F46A 3JQAB 3OA0A 3R0IA 3RSHA 1N9GA 1JWAB 3JQDA 1HDRA 4J7UA 2EV9A 1NPDA 3GRPA 3WS7A 3WYEA 4G5HA 4YRAA 3RC2A 5JS6A 3ZHYA 1GZ3A 1X13A 3PWZA 4AJJA 2EWMA 4WGGA 1FDSA 1U8XX 1VM6A 4YQYA 3RUFA 1HLPA 1V3TA 3GEDA 1DFIA 3PDUA 3PJEA 5ENVA 4AJHA 5LC1A 1GPDG 3RKRA 2PA3A 2AXQA 3DO5A 1R66A 4ZU3A 4IDEA 5JE8A 1Y7TA 1E7RA 4YDRA 2FZEA 2O3JA 1D1TA 1UDCA 4PVDA 4BGEA 3V8BA 2ZYAA 3BMQA 1DEHA 4NK5A 1BDBA 2JAHA 5JDCA 2ZTVA 1P1RA 4BNKA 3PYXA 1B26A 4NK4A 1G0NA 1WLYA 5FI3A 4RF5A 1T25A 4LISA 4NBTA 3N74A 4WLUA 4P4LA 4UEKA 4Z9YA 5TF4A 5CEFA 4WE3A 5EMHA 3O9ZA 1R16A 3E9QA 1SPXA 1XWFA 1YQGA 3AY3A 4G2NA 3JD1A 4UAGA 4HP8A 5C37A 2GN8A 3MWEB 1E7QA 4E5NA 4A73A 2PWZA 1MFZA 2P9EA 2ZYDA 3NT4A 4IY1A 4LW8A 3H8VA 3N7UA 4PGFA 5TNXA 1ZMOA 5F3RA 3DDNA 2FPIA 5FWNA 2I66A 2I76A 1DC5A 1ONNA 1Z74A 2X1HA 4IMPA 2CVQA 2NQTA 4E13A 1WPQA 2DBRA 1PJLA 1QRRA 1QP8A 2ZKLA 1UDBA 3JQ7B 2Q2VA 4S1VA 4FIZA 3EHEA 1UXJA 4K6CA 4UUMA 4J4BA 2DM6A 2EW2A 3L9WA 4MP8A 2O50A 1BDMA 1T2EA 4IZIA 1MG5A 2P5UA 3PGJA 4YJFA 5JDIA 3Q2KA 3AFNA 4ZJUA 1DIHA 5K6AC 3QSGA 1LJ8A 4OAQA 1R4MB 3O4RA 5KJ1A 4WECA 4O63O 4WNCA 1QORA 3W4IA 2QYTA 1LXCA 5KJCA 2JCVA 3LF2A 3H4VA 1Y8QA 4MKRA 4R1UA 3JQAA 2HJRA 2WE8A 4LGVA 3ZU3A 2EIHA 1FK8A 3DHYA 5U9CA 2AG8A 3BHJA 2C2XA 3CSDA 3DBHB 1UZNA 2ZJ1A 1J6UA 3DFZA 4ITUA 5DOZA 4CM8A 5TC4A 1S6YA 3LDHA 3CH6A 4IDDA 4CLXA 1JQBA 5JY1A 3HDJA 1WP4A 2D4AA 5DP2A 2DAPA 5HA5A 1YL7A 2BFPA 2AE1A 4EW6A 2WTBA 2NVBA 3NX4A 4OYRA 3TZHA 4GLOA 2HJSA 1NFFA 3I9MA 4B3HA 4ZVVA 4DA9A 1JTVA 3IJRA 1LSUA 1CF2O 3GDFA 4ZICA 6ADHA 1K0UA 3S2GA 2BKAA 4WJZA 2VRCA 5ES3A 4YAJA 1FDUA 4CMAA 2GDZA 4URFA 2EJWA 1NFRA 2UDPA 4DYVA 1LC3A 1P74A 2DBVO 5I7FA 2W2KB 3PK0A 3UGKA 2VOEA 5GMOA 4WLEA 1GYRA 1PGOA 3PFWO 5JY6A 3GR6A 2DC1A 4RLHA 4R16A 1V0JA 1W0CA 2DFDA 5L40A 3LLVA 3ZI0A 1EQ2A 1GFSA 2YV1A 5EERA 3HDHA 4B3JA 1SEVA 4PLGA 4R1TA 2EP5A 5BR7A 5FEUA 4OXKA 3SEFA 4PN3A 4P4GA 1HDOA 4B79A 4A27A 3TF5A 5DBFA 3I4FA 1I8TA 3MJEA 4MVJA 2YHIB 3ON5A 4IBOA 3JQ7A 2F00A 4R01A 2NU8A 3OJEA 1HXHA 4NBRA 2R00C 2XXBA 3TFOA 4PZCA 1PGPA 4GX5A 4BO7A 4RPLA 1A7KA 5CAEA 5T57A 1T2CA 1NTOA 4RQUA 1OMOA 3W1VA 4U7WA 4DUPA 3PZBA 4CLOB 1R4MA 4CLRA 4FFMA 5JMWA 1WVGA 2B5VA 3ZWOA 4JJFA 4IS2A 5BNFA 3G1UA 1IL0A 4IPTA 4DPMA 1H93A 1ZK4A 1GV0A 1YB5A 3DL2A 1W73A 3Q0EA 3V2HA 4U0JA 3AUSA 2VYVA 2C2YA 3MOIA 3QVWA 4Z0PA 5KTKA 3U5TA 4AVYA 2YDYA 1MLDA 4XJTA 4IMRA 3ST7A 2W4QA 2V6FA 2Y1EA 2E48A 4FD3A 3R1IA 5DBGA 3V1UA 4BUCA 3ZWCA 3RUAA 2JKVA 3M2TA 3X2EA 5L7YA 4R68A 1C14A 4OSPA 1B8PA 2EW8A 3IJPA 4JK3A 3WFIA 3GAZA 4LMPA 1JU9A 1PIWA 2PV7A 3N58A 3E1KA 1BWSA 5FF9A 3WFJA 2DU8A 3E5RA 4WKGA 3AM3A 4CR8A 1UZMA 3LT1A 2Q2QA 4O59O 3AFMA 4L76A 2B4RO 2CY0A 1IYZA 1E92A 4M89A 4CUJA 2Z5LA 5DCUA 4HV4A 3CKYA 2VNAA 1S7CA 3HUDA 3RVDA 1ONOA 4A5OA 4M8SA 2PTGA 1NASA 1MV8A 2NVWA 3CZMA 4LK3A 2WDZA 3KYCA 4DMMA 4L74A 4EJ6A 2C82A 5L4LA 2PZKA 2ZIZA 1SOWA 2I6TA 4GX2A 5ER9A 2YFHA 3UKOA 2PFGA 1ZZEA 1V3VA 1PU2A 3QRWA 2CDAA 1H9BA 3PHLA 1RYEA 3HWRA 2WWRA 1KYQA 3S2FA 5F5NA 4E33A 2GUGA 3GMSA 4D0RA 3QWIA 1LDNA 1HEUA 5JAQA 1UH5A 5JMPA 2YHIA 3WICA 3DBVO 4FPXA 1ZK3A 4CMCA 4W7IA 2BD0A 2IEBA 3GNSA 4JP2A 4LSWA 1F8FA 1Q0HA 2LDXA 3FTNA 3LT2A 3PGXA 3OETA 4ZD6A 4D7AA 4RF2A 5BT9A 2I99A 2X5JO 3OBBA 4IGFA 2CUKA 2X0NA 3K92A 5KVVA 1PJQA 4E30A 4CLOA 1SEPA 3PQEA 4WEQA 1BVRA 1U1IA 1I33A 1B0AA 3NT2A 4QEDA 5AYVA 4F6LA 1CIVA 1R0SA 1QSGA 2HO5A 1DFGA 3K31A 3LC7O 5F21A 3ZWNA 4BNNA 5IZCA 1KBZA 4NJMA 4OH1A 3E6AA 4II3A 4QFCA 4TRNA 1YS4A 1BGVA 2X6TA 3UW3A 3PHHA 1L1FA 3DMTC 1I0ZA 2VYND 4WLNA 4GKVA 2WE7A 3JQGA 3DOOA 4BQRA 2WYWA 3M1AA 1O94A 4FSHA 4XQ9A 4ZQHA 1BTOA 3ZWMA 1M2WA 4E31A 4MDHA 4RDHA 1RJWA 1KVSA 4BNFA 1AXEA 4U0KA 4E2YA 2Y0CA 5T64A 5L9AA 4MINA 1XA0A 1ZK1A 1RM5A 1NHWA 1C0PA 4YVFA 4ZN6A 4I9UA 3NV9A 4Z9FA 1YQDA 5IN5A 2DFVA 1PQUA 2NLOA 2O3UA 1P9LA 3GZNB 1XGKA 1V35A 2UAGA 3TFQA 2UUOA 1PL8A 5B4UA 2NM0A 3RFXA 4IDBA 5DULA 3ZW8A 1YONA 2EEZA 4N7RA 2C7GA 2GPTA 1DBVO 3ROMA 2G82A 4TROA 1ISJA 1UAYA 2IODA 4KDEA 4I9HA 1H9AA 2WEKA 5L3ZA 1K89A 4XDZA 1QKIA 1HTBA 4N5NA 1AUPA 1N8KA 1Y1PA 2IZZA 3INGA 4CV2A 4ZGWA 1K3TA 4R3NA 3TJRA 3U4HA 1F8GA 2VQ3A 3I6QA 5CDUA 2I9PA 4YJGA 4G81A 3JQ8B 1LRKA 5TSDA 2BFAA 4IDAA 2FSSA 1PEDA 3K2EA 1B3BA 3T4XA 4EJMA 2ZTMA 3H5RA 4ZHSA 1I3NA 1KOLA 2J5KA 2J8ZA 2Y0DA 4CQLB 4CMJA 2FOIA 1Z75A 2V7PA 3KB6A 3ZU4A 4ESOA 3L77A 1A27A 1EQUA 4IQ8A 1Q7BA 1ZSNA 3RKUA 2RH8A 3MWDB 2JHGA 9LDTA 3GEGA 4IUYA 3ICPA 3VZPA 1NVMB 1T26A 3Q11A 3LC2O 4G65A 4RPGA 3K8ZA 4BOYA 2P91A 1M6HA 4UVIA 2BELA 4B8WA 3SJUA 3QIVA 3WR5A 2UVDA 3D5QA 3CEAA 3DONA 2BMAA 1KS9A 4XYBA 3H3JA 2GZ1A 3UF0A 4E2XA 5IN4A 3HZZA 1D1SA 4DXHA 1I2ZA 1O9BA 4EEXA 3ITDA 2VN8A 4LCEA 5I8WA 3QWHA 1Z7EA 4ZQBA 3RCBA 3JQAD 3RUCA 3EZLA 3Q2IA 1H2BA 4D79A 2WSBA 1YQXA 1C0KA 3PYMA 4TWRA 5C3MA 4NR0A 3UXYA 5IJZA 2Y1CA 2D5CA 3AY6A 3VVCA 4PRKA 5ICMA 1QG6A 2HLPA 2P9GA 4M55A 3F1KA 3MOGA 4Q9NA 4CM6A 3DOCA 5AOVA 1DB3A 3L6DA 3ZCXA 3WB9A 1HDYA 4MJLA 4OO3A 2Y05A 3Q1LA 4YB8A 4F6CA 3RBZA 3L0DA 2NU9A 1H6CA 3JYNA 3AU9A 4FFPA 5JAZA 4E12A 4WOKA 1YKFA 1Y5RA 4GWGA 2PZJA 1FDVA 3BHIA 3AI2A 3F5SA 1AGNA 1QV7A 3HB5X 3ZV5A 1X14A 2JAPA 3EDMA 4AG3A 1NQOA 4WOJA 1NX6A 3DB2A 3OP4A 4XGKA 1Z82A 1DXYA 1TLTA 4XIYA 3UICA 4BO1A 3FN4A 4IQGA 4BO5A 1T4DA 1NQAO 2XF8A 3NKLA 4E5PA 3GZNA 2O2SA 4CPDA 2QHXA 3H9JA 1ZK2A 4BMSA 4CLEA 1DDOA 4CODB 2JL1A 3RBXA 1E77A 1SMKA 2VUSA 2X86A 5ILOA 5HWSA 4GBJA 1KVQA 5TX7A 4PVCA 1WDKA 4Z9XA 4CUZA 4XRGA 1DC3A 3G17A 4YT5A 2X58A 2W2LA 4FDAA 4M86A 2PH3A 1UXIA 3JTMA 2V65A 1GQYA 3JQ8A 5A5FA 2EGGA 2NTJA 2POQX 4YT4A 3DFUA 1GADO 5A1TA 2EGHA 4NBWA 4K9DA 1GTMA 4KWIA 4OKNA 4CQLA 3ZWPA 1I3MA 1EVJA 4MVJD 2DPGA 1K2WA 1PSDA 2H1SA 1CQJA 2Q50A 3C7DB 3I6IA 5JCXA 3KSUA 2EKLA 1LBEA 3RFVA 3NT5A 4GH5A 1E7MA 2CSUA 3ZH2A 4E5KA 4W9NC 2H6EA 1G1AA 3TQHA 1I10A 3QVTA 4A7PA 3F3SA 4CLHA 4OIMA 2PLAA 3T7CA 3IMFA 4I5GA 3A4VA 1GL3A 1PL6A 3K2BA 2HAEA 3F47A 4AL4A 4K28A 8ADHA 4FW8A 2CMDA 2Z95A 3I83A 3EZYA 5COAA 4Q3DA 3KLMX 2O3TA 1PJ3A 3AOEA 1PQPA 4PLVA 1T2AA 1X0VA 4IZHA 3JQFA 4YJHA 1VPDA 3CZRA 3VH4A 1WDMA 5B4TA 2E6UX 2PD4A 3OM9A 1SC6A 1MUUA 5IAAA 3WNVA 1ZBQA 3WGTA 4BO6A 3ASUA 5LDHA 1GV1A 3WGZA 3WWYA 2Y0EA 3JQBA 1V3UA 1JDJA 4MOWA 1ID1A 1XQ6A 2A35A 3QLJA 4R3WA 1PJBA 4HADA 5A02A 1YBMA 4E6PA 3TZ6A 2DTXA 1BXZA 4DLBA 4EUEA 3AY7A 3NDJA 4ZQFA 4GMFA 2NSDA 1Q0LA 3RI3A 4YAIA 2E49A 3BZUA 2DT5A 5L4SA 4CMEC 1D3AA 3WGGA 1VL6A 2ZB4A 1DFHA 1EE2A 2JHFA 4CM7A 1FJHA 4R69A 3H2SA 1ADGA 4PRLA 3UAGA 3W8DA 3QVSA 1R37A 2NTNA 1ISMA 1HSOA 1P31A 2BGLA 4F45A 3PHJA 3MJCA 2YW9A 4O0LA 3TOZA 4CL8A 3L4BA 1N2SA 3KRTA 4FC6A 4D45A 3ZWAA 1HT0A 3PQDA 4BHTA 2B5WA 3UCXA 1ZJYA 3OMLA 3WBBA 4Q3EA 5I7EA 4HFJA 1PS8A 1RWBA 1WAMA 2IEDA 1Y8QB 4Q3CA 5G4KB 4UUNA 1U9JA 1E1LA 4KQWA 2R6JA 2HRZA 1H6AA 3CMCO 3GMDA 4PIVA 3SJ7A 1KEVA 4LVCA 1I01A 1VJTA 4FN4A 3HDYA 3QQPA 2GN9A 1P1FA 2EXXA 1W8DA 4CM8B 4PLYA 2D1YA 4J4HA 1X15A 5T8KC 4EBFA 1N7GA 3D3EA 4JJGA 1AHHA 4YRBA 2IYPA 1ZEJA 3RUEA 3VVBA 3WMWA 1YDEA 3KHUA 1ZKMA 2F1KA 3U9LA 4D41A 1Y81A 3OQBA 4RGBA 3FTPA 1LX6A 3WDSA 1HDXA 3LQFA 1J4AA 1PTJA 1VI2A 5G0UA 1OC2A 1PGJA 4J6FA 3WMXA 1PX0A 2PKQO 3NUGA 1BXKA 4J9VA 5KIAA 1YWGO 1ULSA 2Y68A 2GYYA 3LT0A 4Z0TA 2CVOA 4OM8A 5DN9A 1GQ2A 4JP3A 4GSLA 1E6EA 2G76A 2AQKA 1ZXLA 2A4KA 5EESA 5C5IA 1AXGA 1EDZA 4NU5A 4ZQGA 3WXBA 2Q1TA 2O7QA 3OIDA 3DEYX 4U6QA 5THQA 2YY7A 3AM5A 4YEDA 5EPOA 3WYCA 5MDHA 1JA9A 5IDWA 5A9RA 4XIJA 3K9QO 4RF3A 4PG4A 5A9SB 3WTBA 1KEWA 2XOXA 1LLQA 1XIVA 4L9RA 5JPIA 2ZATA 3GNTA 1PJ4A 3H2ZA 1I32A 3LF1A 1JAXA 1PZEA 4GL4A 1NHGA 2BRUA 2HUNA 4KQXA 1B14A 4BNVA 1ONPA 1U28A 2RBEA 3B6ZA 4HKTA 4TMFA 5BSGA 4OL9A 4KTTE 5KVQA 5A9TA 4J91A 3DBLB 4RVSA 3TZKA 4DYDA 3KYBA 4XKJA 1GDHA 2D8AA 4YBZA 5TT0A 3HB4X 1P0FA 2HCTA 4J2OA 3ZZNA 4BNYA 1M75A 1ZK0A 4N54A 1GEGA 3KEOA 2J3JA 2J3IA 2V6MA 4GVXA 2V6GA 3JD3A 3TL3A 2ZB7A 4J7CA 2O4UX 4M54A 4XD2A 3L6OO 3GC6A 5JYEA 4XQEA 3VPSA 3OIGA 5TJHA 3LVFO 3TZCA 1C1XB 3INRA 4TRMA 1U3WA 5JO9A 1P1KA 5TS3A 1P33A 4CLRB 4ND2A 4RVHA 3GEMA 3C3XA 1E5QA 4ND3A 1H0KA 4OXNA 3NDRA 4J4TA 3KSDO 1ISIA 3AUUA 2OBYA 5G4KA 2C07A 3PYLA 1R0LA 2JD1A 1QV6A 3MJVA 1LC0A 2OGUA 1N92A 1JAYA 5AQ1A 4YAKA 2XAAA 1EBUA 2ZTUA 4DQUA 3IP1A 4JLWA 5T67A 2PNFA 4J3FA 1EK6A 1XU9A 2VRBA 5CDSA 2JCXA 4EUHA 4CM1A 4OOEA 1O95A 2O23A 2PR2A 3IDSA 4ZRNA 1WMAA 2HK8A 2DTEA 3IUSA 1A72A 2G0TA 4OOFA 5JFOA 3ETDA 2GLXA 1HSZA 3GAFA 2XXJA 4YTEA 1VJ1A 4L4RA 1E5LA 4OMUA 5KKAA 5TJ9A 3HN7A 2D0IA 2D59A 2BH9A 2IE0A 4DL9A 2FR0A 4FJ2A 3H9UA 5L51A 3ADOA 5JO0A 3VPFA 4NBUA 2X9VA 4F46A 3DZJA 4LVUA 1WW8A 1E6WA 3BTOA 3EUWA 3JQFC 3JD2A 1OOEA 5I7VA 2DBZA 2I67A 5DZSA 3ZU2A 4GGOA 1GR0A 3ZWVA 3KYCB 3ZU5A 1VL8A 4N18A 1HLDA 1Q7CA 2X9NA 3ADPA 5A9SA 1TT7A 2Z1NA 5H83A 5TGDA 1Q7GA 1LDGA 2ZB8A 5DNAA 3DAPA 2JD2A 1BMDA 1E1MA 4J0EA 8LDHA 4RJTA 3PLNA 3QP9A 3QVXA 3WGHA 1K6XA 1LU9A 2P4HX 3PQFA 3W6ZA 5EINA 1X1TA 5G0SA 1F12A 4FC7A 3DBLA 1T2DA 3OJFA 4NNJA 3WTCA 1RPNA 5COQA 4XB2A 3S1LA 4E5MA 2PH5A 4PLCA 3PTZA 1PQWA 2NU7A 1Y9EA 1YGYA 5FYDA 4TZKA 1B8UA 4KP7A 4XYGA 2BHLA 4OHUA 3QWBA 4I8XA 3T4EA 4CQMA 3B20A 2A92A 3GLQA 5CEEA 4NI5A 4IXTA 2IYOA 1UUFA 5IG2A 5H81A 3STHA 2WYVA 3U4CA 1C1XA 4UREA 3E9MA 3OEWA 5CPBA 5A3JA 4Z0HO 2IZ1A 2Z1MA 4KOAA 4PG6A 2ZQYA 1M67A 4NJMB 4MIEA 5B12A 2H63A 4CMIA 5L95A 3CE6A 1X7HA 4CM9A 3NJ8A 3F5QA 4GAEA 2SCUA 2B69A 3KBOA 4CM5A 4W4TA 1D4FA 4MVJG 4EEZA 3JQGB 3WG9A 3VTZA 1EFLA 1PGQA 2AA3A 1EK5A 4O6VA 5JCJA 1E1KA 2Q45A 4X54A 5H82A 1TEHA 4IXWA 4JBGA 5EQFA 1E3JA 3COSA 3JQ9A 2PGJA 3JYQA 3EK2A 2OUIA 3DWFA 4YA6A 5EQDA 5GZ3A 2BGKA 1ZEMA 3FBTA 1P1HA 3PZRA 1HE4A 4LN1A 1YH3A 3O26A 1SO8A 3JYPA 3RROA 1CRWG 4FR5A 4B4VA 1X7DA 4L4XA 3ZHXA 1FMCA 2HU2A 3ONFA 3TOXA 4JXKA 3A14A 2NVUA 1FXSA 1T2FA 4HUJA 1PR3A 4B4WA 2I3AA 4QX6A 3LU1A 3CMMA 5EN4A 4RORA 4BO4A 4B7CA 3I9OA 1KVUA 2PK3A 1E6UA 5HBRA 4IDCA 5JDCC 2VHZA 5L53A 3I9JA 2RHCA 3UHAA 4YJGB 2XPCA 4Q3BA 3D5TA 4NFSA 2CDCA 3E8XA 3M1LA 5TT1A 4RZIA 2BI7A 4QXMA 3WSWA 1O6ZA 2E82A 2O3QA 2YZ7A 2VOJA 2GASA 1C1DB 4DMLA 1NBOA 2NADA 3E5MA 2QRJA 1ZO8A 1M76A 4D3SA 3ABIA 2Q4BA 5ILGA 2QW8A 4DRYA 1CJCA 2OP1A 2X4GA 4BS9A 2O48X 5DF1A 3AM4A 4MVJH 1SB8A 1KY5A 1MP0A 3L07A 2FWMX 4RVDA 4IQ0A 2YDXA 1XU7A 5JBIA 1HYHA 5IXSA 4XYEA 5F1PA 1IY8A 4NHEA 4DPLA 4DPKA 1Z73A 3MCVA 4ND5A 1E3LA 2CVZA 2EKQA 2AQ8A 3HE3A 4AJ4A 1ENOA 4BKQA 4DGSA 4Y6RA 3E48A 4BO0A 5GZ1A 1NAIA 5JDIC 2HRBA 3AK4A 4ALKA 1QR6A 2P9CA 5JW6A 3TL2A 3AI3A 3P2YA 2Y1DA 3S2IA 2GN6A 4YT2A 3D7LA 4FFOA 2J6IA 2ZCVA 1HYEA 1P1JA 5JAIA 1MC4A 1L7DA 1A71A 2UYYA 3RFTA 5B1YA 3BMOB 1MFPA 5JLAA 1B15A 1U5AA 1IPFA 2H9IA 3AOGA 2B4TO 5KJ6A 1BW9B 3KETA 3CIFA 1E7YA 3C1AA 4XDYA 1DIAA 5JAMA 4GI2A 4AJ2A 1YVEI 1R4NA 3LZ6A 4J9UE 3M6IA 4LCJA 3AI1A 1GYPA 4RZHA 2HSDA 2X8LA 3A06A 2X5KO 3KXDA 3OFSA 4UVDA 4ZQEA 2C0CA 2EP7A 2PGLA 4RL6A 4BV9A 4KMSA 5G0WA 5HS4A 4NG5A 4TVOA 3ZDFA 4BNMA 1NVGA 3W4JA 4BNJA 4DQVA 3PIIA 1Q2XA 5TQVA 3CINA 4E2WA 2HDHA 3UOGA 4DC1A 1W6UA 3HG7A 3KO8A 3NDIA 3JQ6A 1WZIA 1E3WB 2PKRA 3NAQA 4MIOA 4WCDA 2J5QA 3P7MA 3DQPA 3WIEA 2O2YA 3C24A 3QVOA 1NQ5A 4WASA 3GOHA 5A4DA 4FFNA 1D8AA 3MTJA 2X5OA 1EE9A 1VKNA 1ZJZA 4J1TA 4WLFA 4QSMA 3RC1A 3OA2A 1JWBB 4FB5A 1DAPA 5J23A 1HDZA 1UDAA 1ENZA 1VC2A 3WLEA 3ZV3A 2O3SA 2AE2A 4JBIA 4OQYA 4CL3A 1DIGA 1NQTA 5I8ZA 4XGNA 3VPGA 3GQVA 1ENYA 4II2A 1C1DA 1DJQA 3K30A 3PXXA 5AXCA 3GN1A 3HSKA 2JCYA 2RIRA 4D0SA 1UR5A 4GX1A 1QYXA 5KCZA 1I2BA 1U3UA 2NTVA 3C1TA 4RDIA 4ALNA 4XGIA 2W98A 1BG6A 1R0KA 4KTVE 2J5RA 2GD1O 3ROPA 3S8MA 3IQDB 1YBAA 3ZNPA 5AXAA 3HNPA 3GGGA 3UFXA 3BAZA 2D2IA 4ALJA 1HRDA 2OORA 3GH3A 2EF1A 3BXXA 1Z6ZA 3RJ5A 1XELA 4QO8A 1BSVA 1VLLA 3MEQA 4R9SA 1KERA 4OQZA 3EAGA 1ZCJA 2VZ8A 2GNAA 1T4BA 3FPLA 2PY6A 3QWFA 1B2LA 2Y1OA 4YJHB 2O3RA 1KC3A 3C7AA 4UVEA 1N5DA 4ZA2A 3MJSA 2HK9A 2A94A 1E3SA 1OFGA 2PZLA 4FGSA 1FDWA 2OHXA 3ZV6A 3PVZA 2YQ5A 3OJLA 4E3ZA 1VSVA 2CD9A 5IDQA 1PJSA 2NU6A 5LDGA 3BMOA 2C7VA 1E7WA 1VSUA 4FOOA 1BW9A 2VT3A 2UUPA 4BKUA 4D3DA 1GCOA 4R4JA 2GRAA 3ENKA 2W8ZA 2FSVA 3QW2A 1IOLA 4KZPA 4R5MA 1IZ9A 2PZMA 3D4NA 3P5SA 4QECA 4WEOA 3W8FA 4FFLA 4FFRA 3GPIA 3C85A 2AHRA 3F4LA 2VRCD 3PLRA 3F6YA 3V2GA 4AFNA 4PLPA 2Q1WA 2FP4A 1NXQA 3D4OA 1MC5A 1J0XO 1NWCA 2GO1A 3TNLA 2AG5A 4DIOA 3GT0A 4AJPA 4CMHA 1VKOA 3GVHA 5JC8A 2AEFA 3LT4A 3WGYA 3A28A 3AUAA 4UVGA 4DTIA 3DZFA 1C3VA 1E3WA 2GGSA 1IE3A 3ZNOA 4R5HA 4OXYA 4AJOA 1DLJA 1V6AA 2X9GA 3RQSA 3G3EA 3GPDG 3WQQA 1W4ZA 5COBA 3TPCA 4JBHA 5KVCA 4DVJA 3RUIA 4A26A 3ZNQA 4IJKA 1A9YA 4ALIA 2YYYA 1J5PA 4FBGA 2C5EA 4DIBA 4BGIA 1KEUA 2GN4A 1H5QA 2IXAA 2VT2A 1YXMA 3H6KA 3JQCA 3GVPA 2X22A 3PJFA 4WLOA 2X7HA 4GQAA 1HE5A 2BGMA 1OI7A 1SCUA 2FR1A 4RLSA 3WLFA 2RH4A 4Y8VA 2PGDA 4PG8A 1ZVMA 4AJNA 4J16A 1Z7BA 4HNHA 3S55A 2GERA 2QIOA 1ZH8A 1LLCA 1ISHA 2JFHA 3GY0A 3ZHZA 2J3HA 3RUHA 6LDHA 3VPHA 3UCFA 4IM7A 4ND1A 1DHRA 5L7TA 4BO8A 1DJNA 1CDOA 2JJYA 3V2UA 5CDYA 3JYOA 2W90A 3U3XA 3VKUA 2CF6A 3GUCA 3O03A 1VL0A 3B1KA 4I08A 3OH8A 2ZYGA 3H9GA 3QE3A 4CM9D 5A03A 3SLGA 3I9KA 3KLPX 1AN9A 1Q1NA 1KIFA 2X0IA 3KM0A 2B35A 3EGOA 2VYVD 1ADCA 4W6ZA 4CLDA 3D4PA 3UVEA 1JN0A 1I3LA 1PR9A 1LLUA 3Q3CA 1DSSG 2AQHA 4BNGA 4CM4B 9LDBA 5IZCC 1MA0A 5CFZA 3HDQA 2Q4EA 1LLDA 2CDBA 4JX8A 1EVIA 4JGBA 2E4AA 3AJRA 4CMGA 4L0QA 4GX0A 3QJ5A 1YE3A 4BO3A 1BRMA 3QA9A 1GUZA 4WPGA 3DZBA 4PLZA 2WD7B 4W7HA 5AVOA 4IS3A 4K26A 5KVSA 1K5HA 1B7GO 3ZW9A 3W4KA 1ZIDA 3VDRA 4Y67A 2BLLA 4JNKA 4CR7A 3FNEA 3NYWA 2IRWA 2QYSA 4BNUA 1E7SA 3FSRA 3HN2A 3IOYA 3WNQA 2VTEA 3IUPA 4XWYA 2FR8A 4HFNA 3BMNB 4CUKA 5ADHA 3VH1A 4EYEA 2R00A 2Y67A 1ULUA 1E1NA 1N1EA 5K0ZA 5KJFA 1KVTA 1VJ0A 4YPOA 4TSKA 3DC2A 1XHLA 1KETA 4LRSB 4EGFA 4Y9DA 1YBVA 2JD0A 4XCVA 2B0JA 3NJ4A 4WLVA 3VDQA 1GPJA 4CR6A 3OQ6A 1NR1A 1EVYA 3D0OA
chains in the Genus database with same CATH superfamily
1SD5A 2JKZA 4OJNA 4U6SA 2P90A 1JIXA 4DB2A 3VO1A 1KMMA 5CJPA 1PWXA 3H65A 1R6BX 2OOKA 4L75A 4MW7A 1KAHA 4KLZA 1JB9A 4ZJYA 3ZHTA 3ACCA 3CURA 3OTOB 2FQQA 1WSWA 4W5TA 1PVDA 3OQNA 4UHBA 5TQ0B 1NR7A 1WLSA 1F9EA 4IHKA 1IBSA 5JS1A 4TVBA 3V80A 4OJTA 4NU0A 3WOHA 3UN1A 1X7YA 3EIHA 1R5BA 1I1HA 2FKAA 3R0QA 5C2JB 3DEZA 6ABPA 5LMZA 1NNUA 1LDMA 1D9XA 1NATA 4EK9A 4QHTA 1FY2A 2KS6A 1YBFA 1EVEA 3NP9A 4H31A 4B74A 1Y0BA 2OUKA 3KSZO 1DRVA 3VOAA 1FNBA 3IKLA 2LCFA 2ZB3A 3MJ4A 2PYIA 3O82A 2E37A 4JODA 3TTVA 2V7QD 5A4IS 4UUOA 5D2CA 3K70C 2PUHA 1FPQA 3VNQA 5CMLA 1IHPA 1QCCA 5KOIA 2YH2A 5TS2A 5EJ2A 3KYDB 1A9XB 2K7ZA 4WN9A 3SM9A 4L4UA 1YIDA 3NHPA 3I05A 1CERA 3O2SB 3OEHD 5LQSA 5DP1A 1NG1A 1H2ZA 1NLYA 4KJZA 4ATNA 1PS0A 3OE4A 3O8BA 4GMGA 5CB8A 1Z5PA 3NPAA 1D6JA 1Z0JA 2HGSA 1O94D 4ZO9A 5AM2A 3L7AA 5DJ5A 5DFAA 4BRSA 1GQOA 2VZ9A 3MQ2A 4WK2B 4OHMA 4ER3A 5D84A 1BXGA 4B4UA 3PHGA 4WNAB 1PS9A 3I52A 1P0CA 5I5GA 5I4CA 3EMDA 2G5CA 2BFMA 4BV2A 4EF4A 5DMHA 1VFPA 5EWLA 2H4ZA 2GXUA 2JIMA 4PHHA 4XWTA 2ZPAA 3RAGA 2ZJ3A 2HU8A 3RRYA 2YWCA 2IUTA 2WP8J 4ZU6X 4EKYA 3KTDA 2FU5C 1F2TA 1V1RB 2ZIVB 3DMNA 3THRA 4BKRA 1GU7A 1NP7A 4M6WB 4M98A 3HLKA 2OFOA 5BNIA 2RDMA 2IPNA 1LWOA 2HJGA 3MRVA 1RI5A 2OZPA 4BNHA 3GFRA 2Q28A 2WZDA 1UK6A 3U80A 5I7WA 2DWQA 3PNSA 5DOVA 3OZTA 4W9MC 5EIWA 1Y1LA 5CM2Z 4ZEOA 2FW0A 3PR1A 1PAUA 2O06A 3AVVA 5I3ZA 4D9CA 3RYIB 3Q3HA 2J9ZB 1CDZA 4D8WA 2BP7A 1RWMA 1TF2A 2WVJA 4C4AA 3IEVA 4Q7KA 1XDWA 4NMXB 4MVJF 4BUJA 4CE6A 1ZUHA 3HFGA 2FRDA 2J3KA 13PKA 1VRWA 4BFZA 4UTRA 4XZ3A 4EQ6A 4KREA 1BJTA 1TJ5A 2FZLA 2IYYA 3QXCA 1Z13A 2YC4C 1L3BA 2CCGA 3MMPA 1DOHA 2QAGB 1V9CA 3AP3A 5I4BA 3FCAA 4JSTA 1XNJA 2GZSA 2OWEA 4G89A 4F96A 4OU4A 3U4MA 1SNYA 4BVBA 4CMIB 1XVTA 3QBDA 2PAFA 3PF9A 2NG1A 4PFQA 5B37A 5EQTA 2TMDA 2AZ4A 1W5SA 2SCUB 1Y6GA 1GT91 2WICA 3I39X 3W6UA 3PXCX 3RWBA 4DMHA 2YWEA 3RBVA 4O8ZA 1ST2A 4ALMA 3ER6A 4MVJP 2PRZA 1H3FA 1RQGA 3PA8A 3SQOA 1U8FO 3GUZA 1WNTA 4Q16A 3QNUA 5BWLA 3FCUB 5LVAA 2HQRA 2QP4A 3NYRA 4KQIA 4X7RA 5TQ0A 1DINA 4FXOA 5IKEA 2DLDA 3CVUA 4GKBA 1KAGA 3DFFA 3HB9A 1ZM9A 3V2IA 4E4YA 2E21A 1E3EA 3K70D 5HKBA 4GLLA 2VNIA 1HFKA 3HCPA 1DIRA 4QQRA 4Q1DA 3S4YA 3ERCA 2H1CA 3R41A 3N0VA 1O57A 1ULTA 1X70A 3LC1O 4LZZA 4BEWA 4MUYA 3A31A 5HZGA 1L8AA 1USVA 4JP8A 4PHGA 4YYEA 3CF4A 1IN6A 2HCRA 5TQ2A 4ACBA 1ISRA 2XQFA 1NXXA 3D6AA 4C7VA 1AG9A 1RI2A 1U0HC 2NVUB 1OZAA 3UANA 3FD8A 3AXTA 3E3LA 3KYJB 1PEAA 4EHNA 2ZULA 3F5FA 3KYDA 1J0CA 4BNIA 2QLLA 4TTQA 5UKDA 4XRRA 1M2GA 3WMFA 1AE1A 1KQOA 2Y77A 3WWZA 4AZVA 2XTMA 4HTFB 4B1FA 4EJSC 4DXAA 4X6LA 3FBGA 4A6PA 1QGUB 1V45E 1WJGA 1MJNA 2QLJA 3BERA 2GPYA 2YJ3A 3CHYA 3LA8A 3MIZA 3RS5A 2EHDA 3TNJA 3HU5A 4MVXA 3ZWYA 2PWBA 3MTAA 1E61A 2E87A 4WNAA 3TG8A 2I65A 1ODLA 2DFLA 2JLSA 2MTBA 4AMGA 4F11A 3AEUB 2KB0A 4PC1A 1ISGA 4PO9A 3LY8A 1XSEA 2Q9BA 2H7VA 2HHJA 1EXVA 2ID7A 2R0QC 4P93A 2XGJA 1UK9A 4M4SA 5KWJA 2HF2A 5BRAA 3L4JA 4MP6A 4I5IA 3KT8A 1NPYA 3WGUA 5JYDA 1KDPA 1D7OA 2WWIA 3NVDA 1V1RA 1W4CA 5JD4A 1DLIA 2ZUDA 4EG1A 2C1EA 3HXMA 1EDOA 1LRJA 1EHYA 3RVBA 5JR3A 2XOKA 1DU4A 4FILA 3EQZA 4D3ZA 3M8KA 2WSYB 1P1CA 5B4VA 3OOJA 2F62A 4R9NA 4HXEB 4BWFB 2ASEA 3OAAD 4LS3A 3H99A 4FHFA 4KNYA 5FLYA 1RR6A 4PFJA 5FFFA 2ST1A 1BFDA 3W6PA 1YB7A 3E03A 4OYLA 4RKWA 3RK1A 3BXHA 4L5IA 1XJCA 1Z6QA 2QTZA 2P2GA 3AF3A 3O0DA 4ZCSA 5U1PA 3T7DA 3V97A 1D6SA 3H2HA 3WIDA 4CN8A 1J49A 2Q1UA 3GGDA 1GAXA 2FX3A 2Q3JA 2HOQA 4TTSA 4UBOA 2AB0A 5H4GA 4ALLA 4L2IB 3PR2B 4LGMA 4C87A 4HFRA 4MSUA 1GZ6A 4HX5A 1DRKA 1H4TA 1EFKA 2SNIE 2QAGA 2R6AA 2Y1LA 1GVNB 1Q0QA 1Z4IA 2DLNA 2O5VA 2VG8A 2HNBA 1EUQA 1P4HA 3M5PA 4UBMA 3SYMA 4F9EA 3AJDA 4HDCA 4QRIA 2QKYA 1E5TA 1M66A 1C7RA 1QO0A 2OFPA 3NLLA 4JHXA 1XJ5A 3UY4A 4X64B 3CR7A 1P2UA 1Y8RB 5C1DA 2PMBA 2V0CA 3WLOA 4IIJF 3WYGA 1WRBA 3AINA 3AP1A 3D7MA 5K5EA 5K3BA 4AMUA 3O21A 4EM6A 4ZYLA 4TQGA 2CKMA 1D6MA 3KJGA 4F12A 3DE1X 5M04A 1CEQA 2FMXA 4D82A 5BN3B 2XUGA 3DAGA 4P08A 1A77A 3K96A 4E5YA 3NHSA 4BZXA 5GY7A 1E1YA 1VCOA 1EH5A 1KC1A 1UFRA 2A9RA 1QTQA 4FMCB 2B6NA 1SM4A 4D8VA 2P7HA 1QFZA 4C89A 2PX6A 2I5PO 2J9RA 3ETGA 4L50A 1T5HX 2FOXA 2M32A 2D2EA 1LRLA 1XCMA 1FIUA 4UTXA 3HU3A 2ORYA 1U3VA 1U8UA 4OKIA 4XXHA 4DUYB 2NO4A 4R2XA 4OHYA 4I4NA 1CK4A 3PC6A 1D2CA 1L7EA 5AJZA 5DWVA 4HTFA 1RYMA 3DTVB 1YCFA 3LYLA 2O8NA 4ZQIA 2R97A 4AP6A 4HXGA 5EIXA 5ALZA 1PR0A 1C7EA 3PF8A 1QGUA 1GZ4A 3EXAA 5FJJA 3QNWA 4NLLA 1KNXA 3D8UA 1L5LA 2FY8A 2WIKA 4BE7B 2HQ1A 4DE5A 3BWXA 1Z07A 5FLXA 3E4CA 4DLAA 3BULA 2WKRA 2JLRA 3E0XA 1XMJA 3QLUA 4FCTA 3H5AA 3OCVA 2MHCA 3ZN2A 1VHWA 3THXA 4E2ZA 3WHPA 2ZT6A 4Q24A 4L5BA 1YS9A 4DZRA 3H5IA 3G79A 3SSMA 7MHTA 1RKBA 3LLCA 5A0TA 1E69A 3MUFA 1JFLA 1GPKA 4X0EA 1IZ7A 4BVJA 4N40A 5I7HA 3U16A 1CHNA 1ZH2A 2YN2A 4Y2HA 5AJYA 1KKUA 1QG4A 2W2KA 4LMRA 3VI3B 3E8MA 5JC1A 1II0A 1BGXT 3GA0A 3O93A 3PJGA 3PHIA 2CFTA 1U28C 4XYMA 4ND7A 1Z5WA 4UMEA 5CCDA 3T1YB 3BXGA 3GLRA 2F9LA 3R24A 4MO2A 3V4VB 2CWDA 3FHCB 3ZCVA 3ZD7A 3QPBA 5KSPA 1G8FA 3UK0A 1UBCA 2GZ2A 2R5FA 4K6HA 3ZY6A 1DG9A 4FHGA 1CUCA 2A9KA 3FPHA 3P8ZA 4H27A 1M2HA 5F78A 5H9VA 4L2IA 2DQ4A 5HPYB 2XZDA 4ILEA 5AK3A 3NKFA 4ZV7A 2PUFA 2XE8A 5CH8A 1VE9A 4NPHA 1GTJ1 2ZUWA 4BQNA 3UTDA 4HVAA 5DI3B 3THWA 3BL5A 4PR0A 3TPFA 1RZRA 3RRMA 5HM8A 2C58A 2QAIA 4XR9A 2DPHA 5BUCA 2VHJA 1ES9A 1W88A 3JCZA 4FOSA 1GL7A 2ZW9A 1IEVA 4FGJA 4L9AA 4QRHA 3IVRA 4MDYA 4CFZA 1TTQB 1QHSA 3SOZA 2C3MA 3N5KA 3ZWWA 4PFKA 4FU0A 1Y8RA 1F8XA 4IMJB 5C5EA 1QFMA 3UMCA 4I1RA 2BE7A 3EASA 4FSXA 2OC9A 3K1AB 1L1QA 5DT9A 3STXA 4C06A 3S68A 3NAZA 3A6JA 3NI2A 3R7NA 3SX2A 3KOYA 3WV5A 3JVEA 3FYHA 1OV6A 4OCZA 4K87A 4TRJA 5KOJA 4V0SA 1P0MA 1G41A 1C7FA 3L4SO 3KQLA 1TUEA 5BN3A 1U1CA 5ISMA 2Q5IA 2O14A 3FR7A 5KNCD 2IE8A 1UKAA 5ITVA 3ZDAA 1E4EB 1B16A 1FDTA 1PKXA 1IQ0A 3FTDA 3VHQA 1UDWA 3EIXA 1EEHA 4PQYA 1O95C 3IUJA 1PWHA 2JGJA 4A03A 1P4JA 4AG6A 1GQQA 2FP4B 2WF7A 5F12A 1YMUA 2OHVA 5AESA 3QBEA 2Z9CA 4EZBA 5BPFA 4MV1A 3I5YA 1E9FA 1B6RA 3PQ5A 4WOPA 1UMDA 2P3OA 2EATA 3SYRA 3PTAA 4CMEA 4XA8A 3INTA 1X7GA 1KMIY 4FKBA 2JAXA 2CB9A 7REQA 4B3DA 1ADBA 4M1QA 2CHVA 3PQ4A 2NQ8A 2QQ5A 4K8OA 1VPLA 3FFBA 2VUUA 3IAS6 4M8IA 2GCIA 1DQZA 3O9VA 3LK6A 4QBHA 1COZA 1F3OA 1OC4A 1LPPA 3VR3D 4L22A 1X1EA 4YCDA 1YCDA 1ZIYA 1GPWB 3DHNA 5E2BA 1NVVQ 2H7XA 4K9RA 4OV6B 3RS9A 1RXCA 2CZGA 3ITKA 4LSMA 2RAFA 1SVOA 2FDXA 2OO3A 4EDFA 4L95C 4FN5A 3BZWA 1QLJA 3DPIA 2W6NA 3P9QA 2CFSA 4JELA 4BMDA 4B3MB 1NBIA 1L7MA 2ARKA 2NV6A 1O6CA 2FLVA 4JOBA 5HZMA 4V0ME 3GRVA 1GEEA 1FP1D 3FWZA 1QKKA 2C5FA 3EBPA 3GG9A 3LG2A 4YASA 4MWEA 3ZHBA 2GPNA 4BO9A 2CKDA 2V6IA 2YJ6A 3LQYA 3RNLA 3EAFA 2FMIA 3CLUC 4EF6A 3IQEA 4ISCA 2BKEA 3VKVA 3RS8A 3WI7A 1T1EA 1VHDA 4PCVA 1LA2A 2WD8A 3MUOA 5CHEA 5DCWA 3X2FA 4CKWB 1XKXA 4HMPA 2ZIUB 1TK9A 4INZA 3O1JC 4TUYB 2R47A 5FLKA 2QX7A 4M0LA 5JADA 5DHAA 1WB5A 4PAWA 3TB6A 2WU1A 4GPD1 2FZWA 4UPDA 5FOXA 5IF3A 4AURA 5A7GA 5A3RA 4RY0A 1CUSA 3VZRA 1N57A 1QB7A 5HTOA 3SDBA 1IK6A 4NZPA 5H80A 4M1KA 1K7EB 4TRRA 3H5NA 1PFKA 3DBRB 4MK4A 2NACA 3TQOA 2TS1A 3ILYA 5HXAA 5LZ4A 1L8OA 1NAHA 2C83A 2BMWA 4C07A 2G67A 2ZRQA 3CVYA 2D2XA 4RSHA 1L7QA 1XCJA 1HI9A 2RJNA 4KTVE 5HS6A 4MVCA 3SY8A 1SZJG 5MFZA 2UYHA 2I2DA 5DI3A 1G5TA 1PJCA 4O25A 4B3RB 2OYSA 1I7PA 4H7FA 1E0KA 2DUUA 2VZ0A 4AP9A 2FNAA 4P4UA 2F48A 2ODBA 4G36A 5ESDA 2Z08A 4OGWA 1LV7A 2PXAA 3L7OA 1U2DA 3NMUF 2WA2A 1Z0ZA 2IGBA 4H0CA 1VIVA 4I0WB 1ZH0A 1QZ3A 2XW6A 3QKTA 1R64A 2H2DA 2B8TA 3EGIA 3EMVA 2E6KA 3FMGA 1O95D 2QX9A 3K1AA 3K6KA 4MAMA 2GTPA 5L4NA 1Z4QA 3SC4A 3I2KA 1AHIA 2QG4A 3TD2A 3NC0C 3HCOA 1HURA 2FVYA 4A82A 3VDMA 1NSFA 3O38A 3Q15C 4L02A 4X24A 4YO8A 4ZVRA 3ROQA 4HWKA 2DPMA 2ADOA 1CDDA 3ESZA 3SKVA 4E5UA 2PUGA 3OSUA 1SBYA 2B9EA 3ZQJA 1PBTA 4EB0A 3EVTA 2X0RA 3V33A 2CBZA 1JLLB 4L78A 4X6UA 4K46A 4MUFA 1JVSA 2ES4A 4NFHA 1SHTX 3JZMA 1SVLA 3A9CA 4NAUA 1D5CA 3LQ4A 3ONDA 4G5XA 1VA5A 4I1SA 4EHLA 5C4IA 1FCJA 3DDOA 4GNRA 5KTNA 5BO5A 5CB4B 1N1DA 3U4QB 3MBOA 2FN9A 2XT6A 1JLMA 2ACVA 2OGSA 3I6YA 4P58A 1J0DA 4NJOA 5TQJA 3TIXB 4GOND 3VV3A 2FWRA 3UEOA 1NWHA 5FR2A 4FYJA 1G5QA 3B7GA 3IOCA 4QXAA 1CQIA 2JH9A 4FS3A 1WB9A 5JI2E 1KQ3A 1QK4A 2PT6A 1FS6A 1HA3A 2DBQA 2WUGA 2XUOA 3CLUD 3IKMB 4FGLA 4KVFA 2NZYA 2WP0A 2JIDA 1PYOA 3DR3A 2OV1A 1U65A 3JU3A 5D3KA 2EOAA 1J0EA 3HBAA 4Y98A 2Z6AA 4D92A 4ARIA 3BRCA 4U5XA 1VRVA 1THGA 4XQ0A 3E82A 3PDIB 4AMZA 1OFUX 2GR9A 1MQSA 3D6UA 1PUXA 4LHEA 3B2NA 4YRDA 3TCXB 2VCHA 4D9IA 4MIYA 2RGEA 3R3JA 5AK4A 5KJEA 5T4FA 3T9AA 2PWAA 2BF7A 5ENDA 4EJ0A 4IIVA 5KNDD 4QC2A 5CNMA 1Z3CA 5AO9A 4CKWA 2FFHA 4FCCA 4LYDA 2OXCA 1ZRSA 1XWWA 4TUYA 1A97A 3QX8A 2LV8A 1QGAA 3HO6A 2XCTB 1OA1A 1YOVB 1WMSA 4GSKA 1JLHA 2BFFA 2FFQA 3KKNA 2RGNA 1SCAA 2F9MA 2XCIA 4Y0NA 5DHTA 4YI3A 1W0JD 3UC9A 4CQMD 4EBFA 2AEJA 1IPHA 1VLQA 5EHNA 4ZKEA 3R7LA 1R74A 3KKEA 3IIKA 2B1QA 3MBIA 3OIWA 4LPKA 3FMIA 4YRKA 2IY7A 2KE5A 3CW9A 2RB4A 3DBRA 4XE5A 5IX8A 1KNQA 1W1UA 5EXPA 1DUSA 5H59A 1ECJA 4OLHA 4BNWA 3P0HA 3L7BA 4FYWA 1U7OA 5JLJA 4CF6A 1XG5A 1LNQA 2EBFX 3KSBC 4L5YA 1Y5MA 5GZ6A 2P68A 5LN1A 5CT9A 3ZZMA 4BMVA 3C8MA 1YASA 1RM0A 1DMRA 2Z30A 3IEIA 3N59A 1HYQA 4XOUA 5AFSA 5K9ZA 1EFCA 3GK3A 4FFVA 4I50F 2Q2WA 4NMHA 3RD5A 1VA4A 2P75A 3RG8A 1MAHA 1HDIA 3PWTA 4ND4A 2WM3A 1DAOA 2RKBA 2YWDA 4W8OA 1BH6A 1KJNA 2P77A 1E2MA 3C6KA 4H17A 4LJ4A 4X94A 3NGXA 5DTQA 4E0BA 5GADl 1JX6A 2GAAA 1ZVQA 3OWXA 1G21E 1UXHA 4OGGA 3TR5A 4B7XA 4E15A 5EGSA 2FMUA 3NG1A 4ZV9A 3N6RA 4I6EA 3OX2A 2AI2A 4IF6A 4PO1A 4C1NA 4N5MA 3OTIA 2GM4A 1Z6TA 5TDHA 4QYWA 2EJUA 3VAZA 4RVGA 3CUKA 3LAWA 1R15A 3ZGYA 2C8KA 3KKZA 4MZXA 3STYA 2OAGA 1JLKA 3TQQA 5IAKA 1JLLA 3BM5A 1FNNA 3DE5X 4G0WA 1DRUA 2H4WA 5BW5A 4A2CA 1WTCA 3FF4A 3KVYA 1IXKA 3OQMA 1N5KA 1XA3A 1P5RA 4PX5A 3KFLA 5H02A 5JSFA 1NKSA 5DM70 4UMFA 3E18A 5F1YA 3UA3A 2GHRA 2EHJA 5JSQA 3COJA 1NRIA 1JHDA 2B37A 3G82C 4KVGA 4XD7A 4XSGA 3ND7A 2EG5A 3WWPA 2OAQ1 4RWEA 3EEYA 1G38A 4FHZA 4H6WA 5LM3A 4EGCB 5ERGB 5EY5B 5LMNB 4B17A 1QLHA 4Q3AA 4YJ2B 4J43A 3NGLA 1U8AA 2ZUVA 3NW9A 4ZVQA 1R6AA 2P2ZA 4FOTA 4A8TA 1BMFA 2EZ9A 3DCIA 4UEJA 5AQEA 1E4YA 2JLBA 3G2PA 3E9CA 4B7UA 3T3EA 1FEZA 2WHYA 1P2GA 4URHA 5L3RA 4QE3A 3MWGA 3SSOA 1GDDA 1CUIA 2GK4A 4J49A 1MDFA 3PDIA 1S5PA 4FZ3A 4IDFA 3T9DA 3X2SA 3DZKA 4Q03A 1IHYA 1RKXA 3USCS 4FLFA 4CU5A 5FBWB 1YVDA 1A7AA 1S2DA 4LYFA 1ML3A 3MLEA 4GE0A 2KMLA 1R50A 3UXEA 1FNSA 1TQ2A 3KVOA 2XUJA 3LBHA 3MCZA 4Q4HB 3IT3A 2ZJ7A 4JC8A 1JHPA 3EZ6A 2C7PA 4QUJA 2PKXA 1QANA 1YNSA 4RK0A 4BNZA 1JZQA 2C9OA 1CP2A 4HLUA 1NBWB 2VDPB 3MJRA 3MFQA 4TN5A 1F20A 1YJAA 4Z7OB 2D7CA 2YQZA 2O54A 1DT5A 3KQTA 1SULA 2UZ4A 1JWAB 2H4JA 2G08A 4KAAA 2EV9A 4A23A 3BQ9A 1CUVA 4GRAA 2WF8A 3GX1A 3G2LA 2Y1WA 4QELA 3GRPA 3WWDA 4EYQA 5JZMA 4LJYA 2V5AA 3T9FA 1ORIA 4L8LA 2A1IA 2AXNA 3PA6A 3OZVA 1QVAA 2ZWIA 3KV1A 2F4NA 4G4GA 4AJJA 1EPUA 3THYB 4TOIA 4WGGA 1EI9A 1WUTA 3IP7A 8AT1A 4M37A 1W34A 5ENVA 2NUAB 3BH6A 4P7BA 1M34B 5LC1A 4MV8A 2OBXA 1SUAA 221PA 1A2BA 2PA3A 2XECA 2XKJE 3SZMA 1EM8B 1R66A 4LDRA 3DGEC 3SR4A 3KHTA 5JE8A 3I6BA 2AUTA 3IB3A 3ADDA 4FNMA 1E7RA 3GNLA 5EWMB 4DQLA 1UPAA 3BIFA 3PQ3A 1OBHA 2IOFK 4EP1A 1D1TA 2OY0A 3NOXA 2JB9A 1OI4A 1J9ZA 3B1YA 1O03A 3U61B 5CLHA 3L1KA 3O4IA 3C8DA 2ODTX 3V8BA 2ODWA 1L4MA 2HRCA 2Q5LA 2YZ2A 3O4FA 5JDCA 2VTBB 5G53C 3UAWA 3FCXA 2ZRNA 4MJ3A 4DR1B 4JDUA 1P2VA 2JG3A 4MQEB 5DX0A 4IKEA 3H8WA 3L46A 3OO0A 1UBFA 4QXPA 3PPWA 3F7TA 3LKBA 1CDEA 4YV7A 2Y1XA 1XD9A 5IK2D 1RQRA 4WLUA 3RBAA 3CZQA 3GLIB 4UEKA 3V4ZA 5HZHA 5ELMA 3KTOA 5F3DA 5EMHA 5JSUA 3O9ZA 1NQUA 1OVGA 1R16A 1XWFA 3E9QA 1EDEA 4ENTA 1RDFA 4ZC1A 3SVLA 1NULA 1YS1X 2FSVC 2EQ5A 4HP8A 3MGKA 5ESXA 5C37A 3EG9B 3MWEB 1NVXQ 4E5NA 4A73A 1UWKA 4IY1A 3CC8A 1L7AA 3O4HA 3N70A 4K9MA 4PYRA 1ZMOA 5AW8A 1U0GA 3DDNA 2PX3A 3MAGA 1TQHA 2W6JA 2FPIA 3K4HA 4IUDS 4LRUA 5FBKA 4E1VA 5FWNA 1W4RA 2CNKA 1NUTA 1DC5A 2I76A 1X2EA 2BMFA 5EZ5A 2NQTA 5JNTA 4YJ2A 4F1KA 5ECDA 3LIPA 3FCCA 5KYKA 4A0HA 2DB3A 1V1MA 1R1DA 4Q1BA 1OYOA 2H07A 3EHEA 2YVQA 3MBKA 2RE8A 1E5DA 2QYOA 3VPDA 2ZXEA 2DM6A 3A0RB 4KQ9A 3L9WA 1IDN1 5F2NA 3AVPA 2IYSA 5KPJA 1OHHD 2JHCA 1GNLA 1M8KA 3PGJA 1ZUIA 1RWXA 2JRCA 2R96A 5JDIA 1S3GA 5IF9A 5JPDA 1UM9B 2PUCA 4ZJUA 4ARCA 3HVKA 2V7EA 1SG6A 3MCUA 4Q4HA 3ZKWB 2EBWA 4MCAA 1AGYA 5FTMA 4BE9A 1R4MB 3GCXA 4WECA 1FMFA 1KPGA 2I7CA 5K8CA 3LF2A 5KVAA 3I2FA 4DA0A 4MKRA 5B7QA 1I3OA 1K4MA 1Z06A 5C35A 5IUKC 5G41A 1HG0A 4ETMA 2AG8A 3BHJA 3GOQA 3R3UA 3CSDA 2OQVA 4LSZA 1T0HB 1UZNA 1NURA 4X93A 4ITUA 2DHRA 5TC4A 1FQKA 3U3ZA 5JJIA 2XNJA 1YOBA 5EXSA 5D01A 3G5TA 5CJ2A 4FFWA 2GD0A 1C3OB 3CH6A 3JWJA 4BAGA 4CLXA 4DIKA 1CUAA 1X1RA 4IVNA 1CY8A 3L6UA 4IX1A 4N9QA 1Y9JA 4B34A 1M34A 1WP4A 2D4AA 1KSHA 2EFCB 1G17A 1YL7A 1IMOA 1X74A 2AE1A 1EM8A 1ODTC 3MT0A 1NBAA 1IY9A 2WTBA 3ZGZA 3G2OA 3NX4A 1NA5A 5AOBA 4C30A 3FOEC 2IS4A 2X9LA 2GKGA 4OP1A 3VU8A 1UINA 1GCGA 1I2AA 3I9MA 4B3HA 4YX9A 1WBDA 1VCHA 3VBCA 1DXHA 3QX3A 2QL6A 3HJRA 3SR3A 1NMSA 2D54A 2ODAA 3OT1B 6ADHA 1K0UA 4G1VA 3S2GA 1CCWA 1G7RA 4DA6A 3LVQE 2ZVQX 4JA2A 2PL5A 2VTBA 4I6JA 1MX5A 3VYRB 3PJRA 2OT3B 2YIDA 3GJ8A 3P1JA 3QXGA 4CMAA 3QEKA 2Z6UA 1G20E 3PNQA 2A5YB 3CXUA 3NYIA 4MGZR 4HN4B 4URFA 5K3AA 4HNUA 3EVZA 4EUSA 3USES 2IL1A 1EXMA 3EPPA 1YVUA 4JWTA 4PGMA 2R8ZA 2LRHA 3GLIA 4RQBA 2L19A 4DYVA 5FBRB 4MJXA 1NDQA 3LBAA 5T3YA 3W5HA 7GPBA 3NBXX 2H2WA 3KG2A 1Y6RA 4LFBB 1VFNA 1XA4A 2AW3A 4X3OA 4A36A 1D2GA 1QWOA 3GT3A 1CEEA 3TSAA 3EG9A 3MWEA 3MJHA 2HO4A 1E2HA 5BQ5A 3M3DA 4S05A 1JYEA 3WQHA 4HAZA 4DJFC 5L45A 2GZMA 3GFPA 1F9AA 1NDHA 2Y1KA 4BV3A 1SEVA 2AHOA 4PLGA 2RFLA 3JPYA 4R1TA 1KBOA 2I22A 2JFOA 3ISTA 3KR2A 3O3NB 4N0EA 4R2IA 4D3XA 3CCBA 2I62A 3N07A 3BDIA 2QJWA 4P4GA 3M5DA 4QLOA 3DLBA 1ZR2A 3TF5A 2O8DB 1UOQA 1X3SA 2YHIB 3ON5A 4R31A 3ZK9A 2ZUBA 2NU8A 1SU4A 2IHVA 4RIIA 3TW8A 1OLOA 3OJEA 4MW5A 1Q6YA 5ECYA 1OPRA 4M9SA 4IV8A 3ACBA 1LGYA 3TQCA 2O8FB 2EX1A 3ZHVA 3TFOA 4JMPA 4FR0A 3LY5A 3V6LA 1A7KA 5CAEA 4QJIA 1KDTA 2VSFA 5T57A 3VM6A 3WNDA 1T2CA 2UKDA 1NTOA 3WC4A 1AIPA 1UM9A 1EFVB 1YR8A 2JJ1A 3FW1A 3PICA 4JU9A 5EKUA 8ATCA 4DUPA 1O9GA 3MTBA 5FV4A 1R4MA 3T7SA 1AS3A 1BMTA 4CLRA 2BM1A 1KOJA 3EPHA 3ZWOA 1T8PA 2MYPA 2EJBA 4IV5A 4JJFA 4IS2A 2CDNA 4LXUA 5BNFA 3C5CA 5E4TA 1O3YA 1KQNA 3CX4A 4DN6A 5LXTF 5EA2A 1VDMA 1OXMA 1YB5A 3PPVA 1W73A 3ICWA 4F2PA 3Q0EA 4DV4B 1YZNA 2Q6IA 4ZVKA 3AUSA 3MOIA 3VR5D 4D4LA 4KR2A 2YDYA 4XJTA 2VYQA 3Q0TA 4M38A 3QLVC 2W4QA 3V1UA 1WHTA 3R1IA 4ZI5A 4NICA 1SVSA 1C3OA 4Q4DA 2G07A 1SH7A 3ELBA 3GZTB 1HDEA 4YDQA 2JKVA 3BMXA 2QQGA 1Z4OA 3DCJA 4UE2A 4C4XA 2VJCA 1VPVA 4EY4A 3NNNA 4C4TA 1B8PA 1WXWA 3KZMA 1XTIA 3GAZA 2AR9A 3OE5A 4YRCA 1W7AA 3OZIA 1Y7PA 2JBWA 3BJRA 4NESA 4RC9A 4TL7A 3DAHA 3E1KA 3LBYA 2G1JA 2BZSA 4JKIA 4QYTA 4X7PA 2J3QA 5FF9A 3WFJA 2XNSA 4CR8A 4ZMSA 2ERCA 1UZMA 1DAMA 1XJQA 2MR5A 2UZ1B 4KSYA 1JDNA 1FUIA 1WUKS 3GFFA 3TIGA 4M7RA 3V48A 2BHTA 5TEVA 4ARVA 4JVOA 4PZYA 1UF9A 4UMDA 5KYYB 1JF8A 2Z5VA 3I4LA 1XAGA 2ZFUA 4L08A 5DCUA 4JI2B 4TLMB 1CIJA 3IILA 3KZNA 2AC4A 3GLHA 2DQZA 3A7DA 3RVDA 2YS6A 4A5OA 5J58A 3AFHA 1ZAKA 1MV8A 2X9QA 3WK8A 1ZI9A 3KKMA 4RSRA 1LFDB 1SXPA 2XTJA 3GLHE 2H0AA 2X40A 4J0CA 5CX1B 5EZQA 3E84A 1XRNA 4R0VA 5CLGA 4LXTA 4QZVA 4L74A 1N7IA 1TZ2A 3EGWA 1T9BA 4ZYXA 5L4LA 5EWJB 3MVEA 2ZIZA 5MF6A 2EQAA 2QPTA 2UYOA 4MA4A 3TGLA 1YFJA 1QH9A 3C3MA 4BX2A 1H9BA 3BB1A 3H0EA 1RYEA 4POAA 2WWRA 3I8SA 5B1SA 5E3HA 3PVCA 4YCCA 2BKXA 5JNVA 4LYAA 1UEXC 1KY3A 1E0SA 2J48A 1JLRA 2FWAA 2ZG6A 2CN1A 3GO4A 1D0VA 2QT1A 2VBCA 5K4GA 1EGMB 1G5FA 2GMWA 1C41A 1K8ZB 2Q9UA 4G8CA 1HEUA 2F2TA 4LOAA 1SZDA 1VG8A 1SFRA 3CUSA 2XX3A 1RADA 2O8DA 3LXRA 5JMPA 3T0GA 1XDSA 3VZDA 2YHIA 1M8JA 2G5TA 3F8TA 4FPXA 4ML3A 5BYJA 5EJ8A 1FX1A 2BD0A 3GNSA 2NO6A 4NZZA 4TKVB 2WTUA 1J24A 3TKAA 1USIA 1F8FA 4UEWA 4JLVA 2O8FA 3MTQA 3W9UA 2FSIA 3DCNA 5F35A 1NDUA 4ZCIA 3AZOA 4K9KA 1UDXA 1SG0A 3M5CA 4RF2A 4Z4EA 2E4ZA 5JQGB 4W5HA 1MPTA 1M8PA 4F5YA 1DP4A 3SVZA 1DG3A 3MWJA 4TKZA 2OFXA 3KVVA 1PJQA 2W11A 3VU9A 3PQEA 3P0FA 1K3FA 2DHEA 1I33A 4KMOA 1B0AA 4KIFA 4QEDA 3H17A 3Q6NA 5F21A 1MQ9A 1CUHA 1SVNA 1TQ6A 3SQLA 4BNNA 4KO3S 4BWYA 5IZCA 5JUWA 2D0DA 1VKRA 2MJLA 3E6AA 4QFCA 2WPDD 1LNZA 1OZHA 4UHHA 3MGCA 1V2HE 1ORHA 1SCJA 1HZZC 2IV2X 4RXTA 4BFVA 1QRTA 1CUDA 1QO7A 4GRDA 4WDRA 2E89A 2AZDA 2WYWA 2FPLA 4CTKA 3WXMA 4ZQHA 3ZWMA 4Q1FA 3Q7RA 2VCEA 2CNWA 3FNRA 4FDLA 3QG1A 5JISA 4EHKA 1I1QB 3B9PA 3CB2A 1W5TA 1Q95A 3C7TA 2K87A 4EUNA 1TM5E 2WABA 2AWOA 3EY9A 4L6AA 1KVSA 4QJ5A 2PPLA 2H4HA 4BNFA 2WAAA 2DKFA 1XZDA 4L6CA 4U0KA 3TCKA 1Z4MA 1XA0A 2YICA 4YVFA 4RJKA 2H08A 2CL5A 2OM2A 3C7KA 4JQOA 4OF4A 4MLPA 5IJAA 3WRYA 4DSUA 5IN5A 2DFVA 2NLOA 3GJSA 4FYVA 4LBYA 5BR4A 2UXCB 1PHRA 3GZNB 3GLFA 3PQ6A 2UAGA 1OAKA 2UZ1A 2QDKA 2UUOA 1WIWA 1PL8A 3DKVA 4TWJA 1DO2A 3OX1A 3WLRA 1L5WA 2PGOA 4IDBA 2JZOA 4KACA 3ZLTA 4C6SA 5KYYA 1RBZA 4KWCA 3FA2A 4PSVA 4O2AB 4ZAGA 4N7RA 4RJLA 2QTWB 3GDHA 3ROMA 1DBVO 2H2IA 3L1HA 4TROA 4KFRA 4HL6A 5HF9A 4PQFA 3QU7A 1Q44A 3SBDA 5ABPA 5L3ZA 1K89A 1UT5A 2JI6A 3V8RA 3TNDA 2WNSA 4G0VA 1HTBA 4KWTA 4O4JA 1N8KA 5B1YA 3INGA 3S1SA 3OFJA 3S2YA 4R3NA 3B85A 5BSUA 4W5QA 1F8GA 3I6QA 1XTSA 1T6YA 2VXCA 3P9XA 4QOGA 3OG9A 5EWJA 2I9PA 5IC6A 1ND6A 3GLVA 4X1IA 3L7KA 1LRKA 1G7TA 3TL6A 3L7MA 3P26A 2FSSA 3ML1A 1B3BA 3QLTA 1CZLA 1XEFA 3FZNA 3S3TA 1BKSB 4F91B 1I3NA 1VMEA 2J8ZA 4XIIA 3TVDA 4PIPA 2F1JA 4BATA 4DNFA 3JZAA 1YZ3A 4DMKA 1WCV1 1PW7A 2D1SA 3TQTA 1Z75A 1HQCA 1NIJA 2BBTA 3UPUA 2Z3ZA 3E7FA 2HA2A 1Y6FA 1IN7A 4KMMA 2PUEA 4E5DA 2PZEA 2F1IA 3GRZA 3WZ2A 4LJ6A 3HP1A 3LFHA 5JT1A 2PGIA 3H5TA 1AB6A 4RZXA 3RVJA 1KQFA 4MULA 1ST3A 4KQHA 3GEGA 3MB8A 1NM5C 5KTOA 4AI6A 3TBHA 3VZPA 3A6DA 3C8UA 1NVMB 1ZOOA 3K09A 2C42A 3IT1A 4TKVA 3ZDCA 2NZXA 1NVWQ 4HG2A 1Q19A 3AUYA 3IV6A 2P91A 3GUVA 4GPAA 2WOOA 2BELA 3JZFA 2IEAA 3AH8A 3CKMA 3KUUA 3K9HA 1YB6A 4UVIA 4XM1A 3SJUA 4W5OA 2IHNA 4QUBA 3A1SA 3DONA 3HS3A 5CLQA 1M1NB 5D6NA 2GZ1A 4E2XA 5JQGA 4MHSA 1E1RA 2FGKA 1I2ZA 2AT1A 3AR5A 4LXXA 3ITDA 1T6ZA 1WB6A 4LCEA 2JASA 4QXQA 2G3YA 4ZQBA 1FFHA 3ZIAA 1JMKC 3RCBA 2QMYA 1CQPA 1J1ZA 1HFEL 5C1IA 1FMLA 1P17A 2XCUA 1H2BA 5K3SA 1YQXA 2ISCA 3Q3EA 4TWRA 5C3MA 2WJGA 5IJZA 4KRXA 4KKXB 3A1EA 3EGCA 4D8XA 1CZRA 1JNXX 1RWVA 3VVCA 3DUWA 4PRKA 1RWPA 3RK0A 3E1GA 4A2WA 4ZI3A 1LS6A 2PKCA 4M55A 2WOJA 4GPIB 3FUWA 5GINE 2DR2A 1VBFA 4CM6A 3DOCA 5AOVA 1E98A 3FOZA 3I04M 3O4GA 1OI2A 3QHPA 5IJWA 4D3YA 1IY2A 1JQKA 3B8EA 4L57A 4ZYWA 1RPZA 1FFYA 1HDYA 4OO3A 3O92A 2AC2A 4YB8A 4F6CA 2GAJA 5FOVA 2ACWA 5C8VA 3HXQA 4MPJA 1H6CA 3DT6A 3JYNA 4X1OA 1OFTA 1Y5RA 5L3VA 2FSPA 1MIHA 3Q87B 1GSHA 2AR0A 3F5SA 3FCYA 1DKMA 3ZV5A 2W2OA 1X14A 2Z04A 3EDMA 3BDVA 4TQ9A 1A2OA 4UFPA 2YASA 3QUCA 4WOJA 1P3JA 4EVSA 1DTEA 2B61A 2GILA 5IXJA 5CNIA 2QD2A 1A5TA 1T4DA 1NQAO 2QM3A 1KJIA 2GLTA 1B8NA 2XF8A 3ITEA 5B55A 4JYAB 5BQPA 2O0JA 3GZNA 3UAYA 2V59A 2O2SA 2ZRHA 2B94A 4OSEA 3L0BA 4EPYA 3QVGA 2W0SA 3L6RA 3ZI4A 2X2OA 4KO1S 4LOLA 2AZMA 4CODB 5AVRA 3K32A 4MW0A 1VE7A 3A36A 3DBIA 2JL1A 3A7EA 1E77A 3EXEB 4LPSA 4O2AA 5DIFA 5EQJB 4EHBA 1M5RA 2W2NA 2XE4A 4FS8A 3R7SA 3ZW7A 2F64A 3CN9A 1OJLA 4TLCA 1A1VA 3AF2A 1FTNA 1KSJA 3TQRA 2FDRA 1NY5A 4L7VA 2Q6OA 3CX6A 3EIUA 2H1VA 4JKOA 4PNHA 1MJGA 2ZANA 1DC3A 1J0AA 3G17A 4HWSA 4GE3A 4QOJA 2R48A 4ZTUB 3NHZA 4EX7A 1IH8A 1XTVA 2W2LA 1TUGA 4IZ6A 4KVAA 1UXIA 3OQPA 2V65A 3D0QA 5A5FA 3KBBA 2BZ0A 2D7JA 1WVIA 1AKNA 2OHJA 3ESXA 1AQJA 4F5DA 4K9DA 2C2BA 1QH1A 3ZLJA 4KYTA 4YUXA 4JI3B 5BN4A 5BXQC 3GFSA 4C0BA 2XSZD 4LYGA 5E3IA 1RAHA 4KB5A 4MVJD 2XIQA 4ZDWA 4QQNA 3TEMA 2H2AA 5JCXA 4RV5A 2F3TA 2I1WA 3DEAA 4UZSA 3KSUA 2Z0MA 1LBEA 5DHQA 3NT5A 1E7MA 2CSUA 2PYZA 2NUTB 4W9NC 3QELB