3H6KA

Crystal structure of human 11-beta-hydroxysteroid-dehydrogenase bound to an ortho-chlro-sulfonyl-piperazine inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
260
structure length
260
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Efficacious 11beta-hydroxysteroid dehydrogenase type I inhibitors in the diet-induced obesity mouse model.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 100
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h6kA00
1PQUA 4U8GA 1P1FA 1EUDA 1X15A 2RHCA 5U1PA 3TFQA 3NT2A 3WGQA 1E3WA 4YCAA 1T1SA 1TA4A 4P22A 3DQPA 3KEQA 5G0TA 4CLOB 2WTBA 1V9LA 2NQTA 3MOIA 1XQ1A 3GUCA 1Z6ZA 3CEAA 4NI5A 4CV2A 4Y98A 2VYNA 3ASVA 2C7VA 4J4BA 4NFHA 3TZHA 1G6KA 1U3TA 4IZHA 3QWAA 4ZQFA 4IMPA 4BL5A 5JO9A 3ZNPA 3ZHZA 2NU8A 2Y0EA 1WAMA 2V6GA 3NX4A 2VUSA 1UXKA 4FD3A 2DPHA 1E6EA 1N1GA 2DM6A 3CSDA 4U0JA 5IZCC 3JQEA 4WGGA 1E7YA 4IDBA 3WGGA 4WOJA 1NP3A 2BHLA 5B1YA 2EJWA 2JHFA 1R15A 2D1YA 1R0SA 4FIZA 3O8QA 1K2WA 5JW6A 1T4DA 4LVUA 1YJ8A 4FW8A 4NBTA 4EYEA 3UGKA 5BSEA 1F17A 3GEGA 4WLVA 1T26A 1HDYA 4DPLA 4BKUA 1E5LA 1GPJA 3GDFA 4WCDA 1IYZA 2O7SA 5KKCA 4E2ZA 4JBIA 1DFGA 2OZPA 1V3VA 5F1OA 2JCXA 4I08A 1ZSYA 1L1FA 2NV6A 5DCWA 5L4LA 4J16A 4BMSA 4YPOA 3JYQA 3X2EA 3HE3A 4AJNA 4D3DA 4JGBA 4EBFA 3FBTA 3H7AA 3KLPX 5ADHA 5IFLA 2RBEA 2J6IA 1N7GA 3EZYA 1IULA 3GAFA 5COQA 1H5QA 4K6FA 1N5DA 1NQ5A 3K6JA 4RVUA 3FNHA 3HZZA 1GCUA 3DZHA 1X7HA 3NGLA 3HDJA 4R68A 5T8KA 1O5IA 5TT1A 2Y99A 4XJTA 2HQ1A 4DIFA 3DR3A 3HFGA 3Q0EA 4BNNA 4A0SA 3E48A 5F1PA 1X7GA 3DZBA 3I9OA 4BUCA 2VRCA 3I6QA 4P4NA 1NVGA 4MP6A 4J1QA 4IGEA 3AOEC 1NHGA 5CEJA 2WM3A 3MTGA 1P74A 3WQRA 4EITA 2PKQO 4XWYA 3PYLA 1F8GA 3G3EA 4WLEA 3ZWVA 5I9NA 1BG6A 7MDHA 3MZ0A 2GO1A 5G0WA 4ND3A 1ORRA 3PQEA 1QSGA 1GEEA 4PZDA 3TDKA 5IDXA 3RFVA 3DBLA 5AXAA 2X0IA 4CM4A 4KTTE 2X5KO 4WK6A 4A03A 4YT5A 4CQMD 3N58A 4FB5A 2EIHA 3KM0A 3NJ4A 2O3TA 2Q99A 3AW9A 3UKOA 3VH4A 1ENOA 3E6AA 1C0LA 2G76A 3LDHA 1I2CA 4J4TA 5BSFA 4P38A 4QSMA 1P3DA 2DU8A 4R9RA 2OO5A 1Z7BA 1A4UA 4J9VA 2P4QA 1RM4A 4B79A 4CM1A 3DB2A 1PGNA 2YYYA 4IDEA 4YRBA 4E0BA 1BVUA 2E48A 4EI2A 4WEQA 2EKQA 1X0VA 2PY6A 2GRAA 4IQ0A 3GRKA 2PKRA 3IP3A 1MP0A 2XF8A 5L3ZA 1PL8A 3VPHA 4BNVA 3JQAD 2QYSA 5LDHA 3WYEA 1EVJA 3HDHA 2CF6A 1UAGA 1FDSA 2Y0CA 1H0KA 4FFOA 2BH9A 1YOVB 1YQXA 4BO3A 1TT7A 4NBWA 2FMUA 4RV9A 5DT9A 1QYCA 4RPLA 5EN4A 1ONOA 2AQKA 5G4KA 3BMNA 3ZWNA 1ONPA 1LDEA 2J5RA 2PK3A 2EV9A 2RCYA 5IDYA 1YXMA 3EK2A 3FPCA 1BDMA 2Q49A 3RJ9A 4YYZA 3RUIA 3UUWA 1BHSA 4B3JA 2JHGA 3JQAB 4P4GA 2B4TO 3AJRA 1YBAA 1P31A 1NFRA 3HSKA 3I4FA 3IOYA 4QECA 5IN5A 2X0NA 3UH1A 1E3IA 3PK0A 3PEFA 1HE3A 3K31A 3LQFA 4F6LA 1NFFA 3ZU2A 1C0KA 5AXCA 3RKUA 3TWOA 3JYLA 3F1KA 3KZVA 3H6KA 1IB6A 2B35A 2HU2A 4HNGA 1LRLA 1ZSVA 1PQPA 4OO3A 5JXWA 1KVRA 3SJ7A 4L4SA 3QWFA 3H2ZA 3NT4A 3U4HA 4DQVA 1DJNA 4IDCA 3IKVA 4H15A 5CDYA 3FF4A 3G17A 4AVYA 4JQCA 4GKVA 3CMMA 1Y8QB 3QVSA 3RBVA 2R6JA 1AGNA 4D43A 1LSOA 1TB4A 4EUFA 5I7SA 1UZMA 4MKZA 1K6IA 1YE3A 1XCBA 3AI2A 3FN4A 1VSUA 4DLLA 1B0AA 3LSYA 1PJSA 2HMUA 4TKMA 2WDZA 1KC1A 3ZHBA 2RHRA 4XR4A 4BNWA 3I3OA 4BNUA 1HYEA 5TX7A 4CR8A 1B15A 2HUNA 3GVXA 4ALJA 2D4AA 2IEBA 5C7IO 1U3UA 3TZQA 4OSOA 2UV8A 1YJQA 3WNQA 3L9XA 2PD4A 5JE8A 3M1LA 2EGHA 5AXDA 2B0JA 4BO4A 1JVBA 3SJUA 2DPGA 4K26A 5J23A 3LVFO 3QA9A 2P4HX 2Y66A 1DRWA 3UW3A 4G81A 5DDIP 1DXYA 1OAAA 5ICSA 3EC7A 4TSKA 4EDFA 1VC2A 2Q2WA 3DMYA 1I3MA 4MVJA 4OOEA 3HQ4O 3EYWA 1AXEA 3KBOA 4BGEA 5TS3A 3EUWA 3RSHA 4DC0A 3D3WB 2E82A 1ARZA 1RPNA 4YT4A 2X6TA 4G65A 2Y67A 1NFQA 2UUPA 3WGOA 5KJCA 4B8WA 3IJRA 4GL4A 2CMDA 1W73A 4EJMA 3FHLA 1PWZA 2B36A 1J49A 1AN9A 1BW9B 4GBJA 4F45A 1UDBA 2P9GA 1CWUA 1YB4A 4O63O 4OQYA 3VTFA 4MKRA 1MC4A 2AEFA 4R9SA 4UEOA 3DBHA 1ZUD1 5KKAA 4BNGA 3KYBA 1ZVMA 3JQ9A 3JQAA 2HDHA 4PVDA 2D0IA 3PPIA 4MP8A 1LC3A 4GH5A 4B4WA 1MV8A 4L8VA 1R66A 1LNQA 4TVBA 4PRKA 5JMPA 3WTBA 2IZ0A 3FNGA 4YA6A 2QRLA 1LRJA 1GQYA 3QIVA 4E5MA 5IG2A 2ZTUA 3GVHA 2UUOA 2HO5A 1E6UA 3ITKA 3WB9A 1R4MB 3DC2A 5DOZA 2A4KA 5DULA 3KYCA 1H94A 1V3TA 2BD0A 3NTQA 1GZ4A 5G0VA 3NTRA 3CKYA 1HYHA 3ZV3A 1IHXA 1H6BA 4INAA 3E18A 4KTVE 2XOXA 1NR7A 4KZPA 1E3LA 1JDJA 1KS9A 1LRKA 1YL7A 1Z82A 1W0CA 3AM3A 4BO6A 5TJHA 3EDMA 3G1UA 4OKNA 3IC5A 4J7UA 4YQYA 5FFFA 4KUEA 3HDYA 3KB6A 4N5NA 4CJXA 4AFNA 4R54A 4DYDA 2V65A 4CM7A 3E5MA 5EQDA 1PS9A 1T1RA 1XEAA 3PTZA 2Y0DA 2HCTA 1NASA 3PWSA 1EE9A 2JCYA 2ZYGA 4PLFA 1SC6A 3UICA 3BTOA 3C24A 2Y93A 3AY3A 3ZDFA 4YT2A 1VJ1A 3WJAA 4L4RA 3OECA 1VL0A 3IQDB 1EVIA 1H2BA 4FGWA 1U8FO 2H1SA 5AQ1A 4AJOA 1E5QA 1H9AA 4BO5A 2HSDA 1PGPA 4JCOA 4Z0HO 4Q3EA 1JVSA 2YFQA 5JAMA 2QHXA 5JY1A 1XQ6A 3F47A 1U4SA 4LCEA 4AJKA 3I9JA 2WJPA 4FC7A 1XKQA 2EWMA 4PLHA 1B3RA 4N7RA 1FMCA 2VRCD 3QVXA 3AOEA 4DWVA 2J8ZA 3R1IA 1PZGA 5IN4A 4BVAA 3B20A 5TGDA 3VDRA 1M75A 2A9FA 3OJ0A 1X13A 4CUKA 4XYLA 7ADHA 3JYNA 2BFPA 3DTTA 3OFSA 4A7PA 1NTOA 1Z74A 1H6CA 2PD6A 3D3WA 3S55A 5KIAA 1RKXA 2DTDA 2CZCA 3GG9A 4LSWA 1R0KA 4TRRA 2YHIA 4GVLA 4EJ6A 1U4OA 1OC2A 1GV0A 1KERA 4D44A 3QJ5A 1FK8A 4J2OA 5HWSA 4GX5A 4CMJA 5JBIA 4I5DA 2O7QA 1U9JA 5DN9A 2DLDA 1T2DA 4HWKA 5AYVA 2B69A 4J1NA 4DREA 1SB9A 5GMOA 5GY7A 1UZLA 3BMCA 2VRBA 5GZ6A 2HAEA 1A4IA 3KRTA 1DIGA 1M76A 3L9WA 1DIBA 4QFDA 5EINA 2CF5A 5EESA 2GASA 5BNTA 4CLXA 2WD8A 3C7AA 3ZWYA 1BRMA 3GGPA 2R00A 4R3WA 3UAGA 3IUPA 2BGLA 1HE4A 3WGZA 1CF2O 3MJCA 1ZXLA 3LT0A 1HLPA 4WCFA 2ZB7A 1X0XA 1QV7A 5JC1A 2I3AA 4I9UA 3OIDA 1YS4A 4OJNA 2GDZA 3PJEA 5L7TA 3PJFA 1X14A 4B3IA 1UDAA 3GMSA 1D7OA 1NVMB 4R5MA 2HK8A 3RUFA 4BNFA 3DTYA 1A72A 1JQBA 1QKIA 4TMFA 4ZN6A 3IUSA 2HK7A 2IZZA 3GZ4A 3L4SO 2VT3A 3ROMA 3PYMA 3H3FA 4RGBA 2PGJA 2EKPA 5L40A 1NAHA 3O4RA 1SOVA 2IODA 3FTNA 1PJ4A 1ONNA 1R37A 2C82A 3F5SA 2X8LA 5KWEA 4ZU3A 4XGKA 2Q2VA 3ADPA 3ANNA 5L4NA 4EUHA 3AU8A 5IJZA 4LGVA 3GY0A 1P0FA 4PVCA 2AQ8A 2D59A 5EL0A 3GR6A 2GZ3A 4A5OA 5COBA 1UAYA 2Y1DA 3JQ8B 1ZBQA 4ZHSA 4XQCA 1IPFA 4N5MA 3RD5A 3D4NA 4NG5A 3H9JA 2WYWA 2C5EA 4GWKA 1NVTA 4RPHA 1LXCA 4CM3A 3JQ7A 4BKOA 1M66A 4E4YA 3I6IA 3RUHA 2HJRA 3PZBA 1I2ZA 2X0JA 4MPDA 4D0RA 4EGFA 5L45A 4CQLA 5A9SA 4BQRA 3PLRA 4R1TA 4YDRA 2EW2A 3I1JA 4Z9YA 4YAGA 2BELA 5B12A 2GN8A 1K6JA 3FD8A 3RVDA 1XWFA 4K28A 1E0DA 1ZKMA 1EK5A 1HSOA 4NBRA 4RPGA 4HBGA 2EERA 4XA8A 4ZJUA 2O2YA 1B8VA 2G1UA 2VHXA 4FQ8A 3PI7A 4MVJI 4DQUA 2ZB4A 5H83A 1SEVA 1DHRA 2G0TA 3C85A 3H8VA 1X1EA 2NADA 4MVJH 2H6EA 1LBEA 3KLMX 4GSLA 4IGFA 4RF2A 4WLUA 4WLFA 1OZAA 5A02A 3VZPA 4Q3DA 3HDQA 1GY8A 1JA9A 1QXSA 4NJOA 2PTGA 4BB5A 1Y9AA 2B37A 4ZQEA 3WFJA 4IM7A 4HUJA 1JWAB 2PH5A 2EG9A 2ZTLA 3JQ9C 4ITUA 4L74A 1V6AA 1VI2A 2FY8A 2ZTVA 4A26A 1NWCA 1NPTO 3DBHB 1YL5A 1I24A 2J3IA 4E5YA 1Q0HA 1EZ4A 1D1SA 2NVWA 5G4LA 4MIEA 1F0YA 1QLJA 4NZ9A 3H9UA 4HV4A 1GYRA 1K5HA 4TROA 1Y9EA 3IJPA 3DZIA 4Z3DA 3V8BA 4W99A 2VWHA 4J0EA 3OA2A 3W8DA 4ALIA 1ZK2A 5A3JA 1KETA 2EJVA 4YRDA 4ZVVA 1G1AA 3VZRA 4Y6RA 2HMSA 5EPOA 1KVSA 4RQUA 3UVEA 1E6WA 3GRPA 4HX5A 4XGIA 4WNCA 4PG6A 3OICA 5CPBA 1E7SA 1DC5A 4GGPA 1MC5A 3OMLA 3ZWAA 4A73A 3H65A 1QG6A 1K0UA 3I23A 1P44A 4LMRA 4QO7A 4YRAA 1HDZA 2C54A 1KC3A 1YBMA 3COSA 3E1KA 5ER6A 2YHUA 3BMCB 3DFUA 2ZK7A 4FR5A 2OOSA 3F4LA 1U2DA 3F3SA 3GFBA 4OSPA 5KTKA 4QO8A 1ZMTA 1SAYA 2P2SA 3MJVA 4HXYA 3PHGA 4CM8A 2CDCA 1Z7EA 3ULKA 3LK7A 3U4IA 3L4BA 1E7RA 3UXYA 2EF1A 3OJFA 1GZ3A 3ROPA 4CL8A 1Y6JA 1BVRA 4CR6A 4BNKA 3IMFA 4FPXA 4ALMA 4BV8A 3G0OA 3VDQA 1E1KA 1DHTA 4JJFA 4LSMA 1TXGA 1UXHA 1NQTA 3AU9A 3PHLA 5FWNA 4PG7A 3P5SA 3GMDA 1XGKA 4KP7A 4PLTA 2Y68A 1EFKA 3VOSA 1LEHA 1AHIA 2WWRA 4MVJM 4WLNA 3WTCA 1P0CA 5T5QA 4PG8A 1PGJA 3SBOA 1OC4A 4GSKA 4HFRA 2EHDA 2ZQYA 4CUJA 5JYEA 4XB1A 3HB4X 2EKLA 2P9EA 1H6AA 3CXRA 1UP4A 3JD1A 3R0IA 4PFJA 2B4QA 1GUZA 2X9NA 2P9CA 2O50A 1BTOA 3WWYA 4HKTA 2FSVA 3V1UA 1DFHA 2JAPA 4KDFA 4TZKA 5IF3A 1U8XX 4BKQA 2PFGA 4XQEA 1YRLA 2P5YA 2YV3A 1Z75A 1ID1A 2VHVA 2NVBA 4PLYA 1P1JA 2I67A 1WVGA 2Q4BA 2I3GA 1DPGA 1K3TA 3HNPA 3DMTA 5DCYA 3ZU4A 1VLLA 1GUYA 4CM8B 3Q9UA 5T57A 4W9NC 1CQIA 4ZD6A 4MP3A 3KVOA 1TEHA 3FCOA 3GDOA 3AUSA 3DFZA 3RFXA 1G0OA 5FF9A 3VVBA 2NQ8A 3F9IA 2PR2A 4XCVA 5G0SA 4BNXA 2AE1A 1NQAO 4UVGA 3BTUA 3PJGA 1W4ZA 3D4OA 5F5LA 2WEKA 3OJEA 3K30A 3QRWA 3PJDA 5DBFA 3U49A 5CDSA 4PLGA 1JTVA 2FPPA 5TC4A 1EE2A 3DHNA 1EMDA 2IRWA 1ZJYA 3HJAA 3W4IA 5GZ3A 1S6YA 8LDHA 2B83A 3LU1A 4S3MA 5KOIA 2P5UA 1GL3A 1EUZA 1FXSA 4O59O 3TJRA 3K2BA 1U3WA 2O4CA 2Q45A 5JC8A 3GGGA 5THQA 1LC0A 1PIWA 2PGDA 1ZMOA 3ZNQA 1X7DA 4GX1A 1Q7BA 4PLPA 4CV0A 1CJCA 3Q6IA 1A7KA 4J9UE 2C29D 4RQTA 2JD2A 2IXBA 4I9NA 4U6QA 4CODB 4DTIA 1I10A 4OL9A 4CLDA 5EQFA 2O23A 3PLNA 4GGOA 1NHWA 2JFGA 2Z1MA 4Z0TA 1BDBA 3QE3A 1E77A 5ILOA 5DP2A 1GD1O 4B7UA 4B4VA 1YDEA 1EQ2A 4TWRA 5EERA 3ZZNA 2BGKA 3WYBA 3UCEA 1O6ZA 3LZ6A 1PEDA 3Q2KA 1YOVA 4GMGA 4W4TA 4WCFC 1HEUA 2B4RO 4JN6B 2EEZA 4KWIA 1TVEA 3F4BA 2FZEA 3ZWXA 2C2XA 3A14A 3IL2A 1SZJG 3DO5A 1P1KA 2X86A 3BHMA 1XIVA 4BNMA 1R12A 4CLHA 2YDYA 4RZHA 4E31A 4TQGA 5LCXA 1ADBA 4RPKA 6ADHA 1SCUA 4NFSA 2CD9A 1DJQA 4M1QA 4OHUA 5KJEA 2ILTA 2ZQZA 3ZWOA 1TI7A 1DB3A 2NTNA 2J3KA 5BT9A 4RVFA 4XDZA 1AE1A 1IHYA 3NTOA 4NNJA 5TF4A 4DYVA 1QYVA 1AXGA 3E03A 4CLEA 3P19A 2D5CA 3N74A 4R1NA 1YL6A 2IE0A 4Q3CA 4UREA 4TVOA 2Q3EA 2FPGA 1WZEA 3BMQA 3GUYA 3JQBA 3KV3O 4YJFB 2AQHA 3TZCA 2OGUA 3G79A 1KVUA 1R16A 3OHSX 1N2SA 1HSZA 5L4SA 3DOJA 2I99A 3U5TA 5B4UA 1YB1A 5A4DA 1T2AA 4NQZA 1B2LA 5JCJA 2IZ1A 3D5QA 2VQ3A 3PDJA 4IS3A 4RF4A 4UUOA 1HRDA 5HRUA 2XPCA 4CM5A 3S8MA 3WDSA 5TQVA 4DGSA 3B1JA 1VKNA 1ENPA 1DC3A 1N1EA 5I7EA 1GR0A 3BIOA 2OFPA 3W8FA 3K8ZA 4BO8A 1I3NA 1ZK3A 1RM3A 4WLOA 1GPDG 3NGXA 5JSFA 2VHYA 4ZGWA 4GAEA 1F8FA 4L73A 3DBRA 3BAZA 4IJUA 1PGOA 1UUFA 3ONEA 5CPFA 4YB8A 3RUDA 3K9QO 1HDOA 1TT5B 4PCVA 4DBVO 3KOUA 3ASUA 4CLRA 3H9GA 1A5ZA 1EDOA 1ZK1A 3BXXA 1I2BA 4ND5A 3RFTA 1EQUA 1KEVA 1PGQA 2DFVA 3SXPA 3U62A 5AXBA 5IZCA 4RF5A 5JDCC 3RUCA 2BMAA 2D2IA 3AY6A 3AI3A 3I5MA 4D42A 2AHRA 3Q3CA 2GYYA 5I9MA 3JQDA 3GFGA 1Q7CA 3M2TA 3CMCO 3QVOA 4OXNA 3LLVA 4U7WA 3PXXA 1HE2A 5BNFA 5L51A 4WOKA 2WE7A 2X9GA 1ZSNA 3GGOA 4B8ZA 5ILGA 5MGBA 4IDAA 3KO8A 1P1RA 1JLLA 1PZFA 3ANMA 4IS2A 5L53A 5JAZA 1F14A 2ZATA 3NJ8A 3EVTA 4HFNA 2BFMA 4XYEA 4B3HA 3LF1A 2FRDA 4D79A 2ZTMA 3GHYA 3JQFC 4IJWA 4MDHA 3GVIA 3KXDA 4O0LA 1ADCA 3TRIA 1GDHA 1Y81A 3L77A 4W7HA 4O1MA 4WJZA 3PFFA 2VHWA 1BW9A 3PIDA 4P4LA 4RL6A 6LDHA 3VAZA 4YR9A 1B7GO 2FOIA 2QIOA 1B26A 2Y1EA 1DO8A 1WMBA 3NAQA 2I66A 4IDDA 2ZB3A 3DBVO 2OORA 3U9LA 4LMPA 3GF4A 2GD1O 5JDIA 5KJ1A 2W2KA 3V1TC 1JKIA 3VHRA 2QZZA 1V3UA 3DMTC 1PS8A 2OBNA 4DPKA 5BNIA 2VT2A 2NU9A 1QR6A 4GPD1 4ONEA 3IDSA 4CMAA 4M89A 5C7LO 2AA3A 3INRA 1Q0QA 1MXHA 3RASA 1WXDA 2HLPA 1EUCA 2YV1A 1C1DA 3IIEA 5TSDA 3NT5A 4LISA 2W8ZA 2R2GA 1CDOA 4FFMA 2GZ2A 3KUXA 4YVFA 4BNIA 4CMGA 4E30A 5C3MA 4OH1A 3GLQA 4FFLA 4RDHA 4BGVA 3HG7A 3E8XA 3HHPA 4I8XA 3NUGA 2XAAA 4EZBA 4CQMB 2EP5A 2ET6A 4J4HA 4XIJA 4XQGA 4TKLA 4XRRA 5DBGA 4RPJA 1DLIA 1E1MA 5JLAA 4Z3KA 1LA2A 5EIOA 1DAPA 5JAIA 5F21A 4R41A 2P91A 1DEHA 3FNEA 1BWSA 4U0KA 1XR3A 4ZRMA 3OM9A 4BO7A 4LCJA 3WOHA 2W98A 2NWQA 3I9NA 4Y67A 1LDYA 4NU5A 2QRKA 3C8MA 3RQSA 3WX0A 1DIAA 1XELA 4II2A 5T6BA 5JCXA 3JYOA 3GEDA 1U3VA 2VZ9A 4PZCA 4ROSA 3CZMA 3F5QA 2DAPA 4XYGA 4RLSA 5DF1A 2Z95A 3TF5A 4GLLA 5L9AA 1PR3A 1XU9A 3AWDA 3RU7A 1CERA 1HDXA 4I9HA 3DDNA 3ZU3A 1MLDA 3AM4A 5K6AC 3VTZA 1JAYA 4WE3A 1HDCA 5F1KA 1T2EA 2G17A 4GX2A 4AJIA 4FFPA 1HYGA 3PIIA 1LDBA 2O3SA 1PL6A 3KYDA 3PQDA 3MJEA 5G2OA 1NPDA 3AUAA 5F3RA 5K6AA 2V6MA 4E5NA 4EEXA 2GR9A 5C37A 3DONA 5L95A 1DC6A 4NDNE 5DCUA 2NVUB 3GZNA 4CMEA 1HKUA 2OMEA 1CYDA 2DBZA 2FSSA 4GKBA 4JP2A 3WBFA 3C7DB 4NMHA 3IKTA 4OOFA 4M8SA 2NACA 4FFRA 4NK5A 3KYCB 5CG1A 2CVQA 1HTBA 4YTEA 2Q50A 1WLYA 4CMIB 1P1IA 2CNBA 3VC7A 4ND1A 2D8AA 1OBFO 3ZI0A 4H7PA 5JCJD 1PQWA 5IXSA 5I7VA 1ADGA 1I33A 1SPXA 4GLOA 4A27A 1NPYA 4GI2A 3BMOA 1PZEA 4E12A 4I5GA 4KQXA 4D41A 1E1LA 1UDCA 2DBVO 2IYPA 1LDMA 1ISJA 3PQFA 2E6UX 4EUEA 3M1AA 2J3HA 1NQOA 4OKIA 4CMIA 5U9CA 2WMDA 3RC1A 5G0UA 3ST7A 4BMNA 3KTDA 3MCVA 3PWKA 3KSUA 3ZGYA 2UVDA 2G5CA 1DRVA 3NYWA 5TJ9A 5TRTA 1CEQA 2E4AA 3LT4A 3MJTA 5H81A 5GZ1A 3RBXA 5CHEA 4PZEA 3NDJA 3SX2A 1IY8A 4HNHA 4XYMA 5ITVA 1P77A 1U5AA 3B1FA 5C5IA 2WYVA 3GHHA 4N18A 2OHXA 1O9BA 3E9MA 4HADA 3GPDG 2NVUA 3S2IA 3OA0A 3TL2A 3HN2A 2EP7A 4OMUA 2OUIA 4ZRNA 3RUEA 3QP9A 3EVNA 3GNSA 3QWIA 5CDUA 5DBIA 4IDGA 2WD7A 2PZLA 4XX0A 3F46A 2ZCVA 3WGTA 5ITWA 1M6HA 3Q2IA 5K9ZA 1EVYA 1TT5A 4IQ8A 3SC6A 1Y8QA 2Q1UA 1ZFNA 5ICMA 3WMXA 1DBVO 1HT0A 1YO6A 1IZ0A 1PL7A 4K6CA 3S2FA 1C0IA 2B5WA 2HJSA 4J7CA 3ZCXA 5FEUA 3TL3A 4KQWA 4MINA 4IZIA 4EW6A 1M6WA 4O6VA 4OAQA 4Q39A 3ETGA 3HN7A 2WSBA 3AOGA 5JFOA 1MA0A 2GN4A 3OP4A 1UXIA 3TNLA 5I9LA 2ZJ0A 3ONDA 5BSGA 4HFJA 3OEYA 1ENYA 3L07A 4M55A 3S1LA 2JD1A 4KUHA 2Q46A 1LUAA 1ULUA 3KYDB 4FN4A 1VKOA 4ALKA 4RVSA 2D3TA 4FBGA 3PHJA 3TQHA 1PJBA 5TIIA 3KEOA 2IEDA 4DL9A 2QW8A 1O95A 3L0DA 4IUYA 2PZKA 2R00C 1JU9A 4L4XA 4CR7A 4RDIA 4BO9A 3DWFA 2VWQA 2YV2A 3ICPA 3OIGA 2X58A 3WIEA 4J49A 3SC4A 2RH8A 3BMNB 3UCFA 3ZNOA 3ETDA 4BMVA 3INGA 4JK3A 1H2HA 2C2YA 1A7AA 1H6DA 3EMKA 4J1SA 3LLSA 2OBYA 4YACA 2AEJA 1LLQA 3CINA 5B37A 4GX0A 1VPDA 1ZH8A 4Y9DA 3OBBA 1Y5RA 3GA0A 4E2XA 4D3FA 4CMEC 4J0FA 2YJZA 3W4JA 5IDWA 2DUUA 1R4MA 2HRZA 3WICA 1JKJA 1WPQA 4M49A 2HMWA 4NU6A 1IL0A 5BQFA 4I5EA 5JNLA 3VH2A 2HRBA 3FR7A 2W2LA 1KYQA 1BXKA 5EJ2A 2A94A 3GN1A 3WLEA 4E3ZA 4LVCA 5IZ4A 4NJMB 1PU2A 1UR5A 4TRJA 2DKNA 1EFLA 1A71A 3JQBC 1GTMA 2YFHA 4NPCA 2F1KA 3D4PA 1NBOA 4K1LA 3I83A 3GQVA 3WQSB 3FTPA 1GQQA 5HBRA 1JKFA 2BGMA 5BR7A 1HDRA 4IXWA 4UVDA 1LDNA 4Q9NA 1A27A 4U6SA 2TMDA 3DL2A 5LC1A 1VSVA 3UN1A 3A9WA 1DOHA 1HZJA 1R6DA 4KMSA 2WD7B 1R4NB 3C1OA 1T2CA 4FS3A 3RC2A 1GCOA 1KVTA 4HY3A 4URFA 4BKRA 4CV1A 4AJEA 5H82A 3ZWMA 4YAIA 1ML3A 3DZGA 1KEWA 5ES3A 4IXTA 3X2FA 5F5NA 2FZWA 3GT0A 2PA3A 4F46A 1JAXA 3JTMA 2Y05A 5KVQA 2FWMX 1HF3A 3O26A 4RF3A 1E3EA 3DEYX 1A9YA 1J5PA 2J5QA 1N92A 4OXYA 1YBVA 2BI7A 4IQGA 5FI5A 1C1DB 1ZW1A 1O89A 1PZHA 2VWGA 3SLKA 4RJTA 3Q9NA 3DZKA 1ZIDA 5KCZA 3GPIA 5ER9A 3HADA 4RCVA 1E3SA 4NJMA 2POQX 1GU7A 2BLLA 4RVHA 4DMMA 3AI1A 1FDUA 3EAGA 3VPSA 5ENVA 2PNFA 4DLAA 4CLOA 1RWBA 2G82A 2X23A 2Q1SA 4Y6SA 4PG4A 4YAKA 1E7MA 3JD0A 3WXBA 3VKUA 1CIVA 4JXKA 2FHSA 2NNLD 3E82A 3P7MA 4J43A 3KHUA 1P33A 4R3NA 3AFNA 1YDWA 3CTMA 4K9DA 1IE3A 2LDBA 1PX0A 2YQ5A 1KY5A 1E92A 1NR1A 1WW8A 2I76A 2CUKA 2VWPA 1P45A 3QW2A 3NDIA 1ISFA 3JD4A 1SO8A 3ZV6A 4U5QA 3UF0A 1I5RA 1KBZA 1O8CA 1ISMA 5TT0A 3L6EA 1FJHA 1GFSA 5A9SB 5G4KB 4QTZA 2GN6A 4GMFA 3VH3A 2QZ9A 2X22A 3STHA 2O4UX 2P68A 1PJQA 3EGOA 3N7UA 3VPFA 5CAEA 1I8TA 3GN2A 2BI8A 4E21A 4UULA 2DQ4A 3RU9A 3DZFA 2NTVA 3GH3A 2Y1OA 1KEUA 4RLHA 2GCGA 2E37A 1D8AA 2W90A 3V2GA 3UFXA 1XYGA 3E5RA 3SVTA 1I3LA 3U0BA 2VNAA 1B8PA 1Y8RA 1BXGB 5CG2A 5HS4A 1VRWA 2BFAA 4WCFB 1KOLA 3C1AA 2UAGA 4F6CA 4DQXA 2C5AA 1I3KA 4J7XA 3ZV4A 4IINA 1IUKA 5THKA 4QUKA 5I8ZA 1T24A 3Q11A 4I1IA 5DP1A 5T64A 3PGJA 4D0SA 3A4VA 2CFCA 3T7CA 4R69A 5I7FA 5TLSA 5A3VA 5FYDA 3OSUA 3AFMA 2O3JA 3C7CB 3JQ7B 4QFCA 1AHHA 3EHEA 2YHIB 2QQ5A 1YH3A 2PLAA 1QRRA 1PJTA 2D5AA 2NU6A 5HTOA 1ZO8A 2GSDA 3D7LA 4FC6A 1KY4A 2O3QA 2HMVA 2FP4A 2AW5A 3GDGA 4BIIA 3LC7O 1QP8A 3MJ4A 2QG4A 4PG5A 3AUTA 2NLOA 3QVTA 5T8KC 4PLVA 1Z73A 3S2EA 1V8BA 4E32A 2AEMA 3LT2A 1WZIA 4CM4B 2X0RA 2A35A 2H5LA 3EW7A 4QQRA 2HK9A 4J90A 3WGYA 4BO1A 4BO2A 9LDTA 3PFWO 1M67A 1FDVA 3D3EA 4OYRA 4WEOA 4DBZA 3G49A 4J91A 4NBUA 1QLHA 1R0LA 1SMKA 4E6PA 3GVPA 1ISGA 1ZZEA 3ZW9A 4DRYA 4ALLA 1H93A 3DAGA 1WMAA 2GUGA 1J0XO 3PGXA 2GF2A 3VZSA 4M87A 4L76A 3W6ZA 3AK4A 3WYCA 4P8RA 3PYXA 4ND4A 3UCXA 4IJVA 4DC1A 2VCYA 5U4QA 3ZN2A 1DRUA 3CUKA 1ZEMA 4J2HA 4TRNA 4XQ9A 1UP6A 1MB4A 4XRGA 3QLJA 2DFDA 2OXIA 3BA1A 3PZRA 3WQQA 4MJLA 3WIDA 2VNSA 4DPMA 5I8WA 4BV9A 4J3FA 2Q1TA 1E1NA 1V0JA 2GZ1A 3GZNB 5KVCA 2AQIA 3PVZA 2NTJA 2YY7A 1C0PA 1MG5A 1Q0LA 1WDKA 3ZWWA 4IPTA 1EDZA 4L75A 3AY7A 4UVIA 3VZQA 3OJLA 1D4FA 2DBRA 3ZU5A 5KNLA 3CZRA 4AJLA 4A2CA 2H63A 2VHZA 2AG5A 3ANLA 1NAIA 4ZQGA 1D1TA 3OQ1A 4B4UA 3DZJA 1Y1PA 2AG8A 3JQ8A 1XG5A 1GAEO 1O0SA 3PHHA 4BNLA 1B8UA 3OEWA 5DNAA 2VOJA 4ZQBA 4O5OA 4YXFA 3FWNA 3HWRA 4CL3A 3WFIA 1O94A 3QV1A 1PTJA 2AE2A 3U4CA 1SB8A 3R3SA 4BHTA 2ZYDA 4JP3A 4RO0A 4JBGA 3WS7A 1YVEI 4MIOA 2RAFA 1LU9A 4RVDA 3RC9A 4XJSA 1V35A 4OQZA 1GV1A 4ILKA 1I0ZA 5CEFA 4ALNA 4N54A 4XZ3A 4WNIA 3SEFA 4GWGA 4MVJP 1U2GA 4G2NA 4MOWA 3ZHYA 4D46A 1UXJA 3QVWA 4OXKA 4YAEA 5CDGA 2E49A 2CSUA 2OP0A 2VTDA 3F1LA 1GYPA 4C4OA 3TZKA 1N9GA 1SOWA 2GNAA 3VKVA 3GEMA 1QYDA 3PRJA 1CQJA 1MG0A 3O03A 2QX7A 4NFYA 3WLFA 1KIFA 3RAJA 1NX6A 1T4BA 4ND2A 4RVGA 1I32A 4Y6PA 1BXGA 1YONA 2Y1CA 3K92A 3D0OA 2Z1NA 2JL1A 4IIUA 4MVJG 1ISIA 1E3JA 3B1KA 3LC1O 4B7XA 5IDQA 2O48X 2QRJA 2PV7A 5KJFA 5KJ6A 3BZUA 1F12A 4Z0PA 4WECA 1LDGA 1W6UA 4DMLA 3DHYA 4YJDA 5JPIA 4CM9A 3DHEA 4I5FA 3VPXA 2LDXA 2VZ0A 2YDXA 4GQAA 4UUNA 4CM6A 1L7DA 1D3AA 4AJPA 4UUPA 3TOZA 2NU7A 4PLWA 3W8EA 1Q7GA 3FRJA 3MWDB 1DSSG 1U28A 3DOCA 3FSRA 1DC4A 1VM6A 3WSVA 2BRUA 4UEJA 3T4XA 5B4VA 4IMRA 1UXGA 1C1XA 4CMHA 3M2PA 4PN3A 4XYBA 3WGIA 4F3YA 1HL3A 3BHIA 2VYND 4YJHB 2AXQA 4BNYA 1ULSA 2DC1A 4E2YA 4QX6A 4UUMA 4KUGA 5TNXA 5A04A 2Y1GA 1KEPA 4LN1A 3CIFA 1XDWA 1MXFA 5CEEA 3QWHA 3ZW8A 4ZQHA 3BTVA 1IPEA 2NSDA 3MOGA 4S1VA 4R01A 4YBZA 2DTEA 4ESOA 3WBBA 2J3JA 4YAJA 4FOSA 4XIYA 1B16A 1VL8A 3D64A 1LQTA 3L6DA 4XB2A 5COAA 1Z45A 3FPLA 4DIOA 5HM8A 2WYUA 1ZK4A 3P2OA 3G1TA 1XHLA 5LDGA 3IS3A 1IOLA 3AM5A 3LC2O 3NEPX 2V7PA 1PJ3A 1NWHA 3NKLA 3AUUA 4PIVA 4NIMA 1FDWA 4L9RA 4YJGA 2X5JO 4H16A 3B70A 1YWGO 1JWBB 5JDIC 3JD3A 2EW8A 4IY1A 2GGSA 1E3WB 1FF9A 3C1TA 1MFPA 4MKXA 4YT8A 3CE6A 1ISHA 5EMHA 3HUDA 3BYZA 3QY9A 1LLUA 5KVSA 1EVZA 1VJ0A 3GVCA 3K73O 3ON5A 1WDLA 2PZMA 4II3A 1MFZA 3JSAA 4AJ2A 1EBUA 1K89A 2DBQA 2XXBA 2BFOA 1LX6A 3ZHXA 1QYWA 4XEHA 4FSHA 1RM0A 2CDBA 2Z5LA 4MVJD 3PP8A 1NNUA 4J1TA 2HMTA 4BNHA 3H3JA 3PHIA 1HE5A 5CFZA 4BGUA 2PWZA 3IP1A 2X4GA 5L7WA 5DZSA 4DVJA 5A05A 4R1SA 4W9NA 3O8QB 4E33A 8ADHA 2O3RA 3Q1LA 1C3VA 3RUAA 1RYEA 5A1TA 3RIHA 4AJJA 2GLXA 2GERA 2X1HA 3JV7A 2I5PO 3H9QA 1UZNA 3H4VA 3CPSA 1LLCA 4ID9A 4LRTB 3GK3A 4G5HA 4E5KA 1Y8RB 5C7OO 4E5PA 3JCZA 5JDCA 3JQGB 4MIYA 4YEDA 4BB6A 2EXXA 3QWBA 5JY6A 3QSGA 3A06A 2Q4EA 5CDTA 3FI9A 3WGHA 1CRWG 4H3VA 1GUFA 1CETA 1XSEA 3BMQB 4YJFA 3W4KA 3BHJA 4D3SA 1PSDA 3RCBA 3ZNNA 1B14A 1LSUA 4BS9A 3QHAA 4WKGA 1U1IA 2AMFA 5AOVA 3VH1A 3ADOA 5B4TA 2FR0A 3ZV5A 3FWZA 2RH4A 4OGWA 4Y8VA 3B6ZA 2DUWA 4BO0A 3KSDO 3ORFA 3TZ6A 1GYQA 5A5EA 4YQZA 4TZTA 2VUUA 4BNZA 3R6DA 3KSZO 3OIFA 1HLDA 1Y7TA 1EK6A 1HWYA 3RROA 9LDBA 1F06A 3FBGA 1PJLA 1WWKA 4EJ0A 1Y5MA 3TSCA 1U7HA 1GQ2A 1QV6A 4AL4A 4KOAA 1DLJA 5A9RA 3VPGA 2JAHA 1P1HA 2ZB8A 1MGOA 3GNQA 1GADO 3FR8A 1XA0A 4D7AA 1UJMA 4OM8A 3F6YA 5K0ZA 1X1TA 2QYTA 1SEPA 4MO2A 3HB5X 3H9EO 4Z6KA 4HFMA 3CH6A 4W6ZA 1I01A 4B7CA 3H5NA 1PR9A 3W1VA 4NR0A 3TOXA 5IXYA 3RC7A 2PD3A 4BGIA 1J6UA 1LSJA 4PLZA 3JQGA 3BTSA 3S2GA 1MX3A 3K5PA 4D45A 4NK4A 3EY4A 2V6FA 5L7YA 4XKJA 3LF2A 4JJGA 4UVEA 4DIBA 2EGGA 1PS0A 4M86A 1PJCA 4FDAA 1QORA 3TFOA 1WP4A 1ZCJA 1ZNQO 4IIVA 4DXHA 1GZ6A 3TPCA 1N9GB 3A1NA 1C14A 2F00A 1YB5A 1BSVA 1E7WA 4IBOA 1QYXA 5DOVA 5A9TA 4PRLA 4BKPA 3ABIA 3W6UA 1IZ9A 1UP7A 2PZJA 2PGLA 2I6TA 3QQPA 4IDFA 1NYTA 2JD0A 3KETA 1ZK0A 3DOOA 3ETEA 3A28A 4DLBA 4TRMA 3V1YA 1DIHA 4KDEA 1SNYA 4R16A 3RKRA 5JS6A 1GEGA 4CMKA 1RM5A 1C1XB 2O2SA 3U09A 3FNFA 4DUPA 2VOEA 3INTA 4XD2A 2C59A 4XDYA 3SLGA 4QEDA 1LQUA 2HKIA 3ITDA 2GPTA 3GNTA 3RJ5A 1RYDA 2DTXA 1PJ2A 2PKQP 5T67A 3RWBA 2GN9A 5A03A 1OFGA 3UOGA 2WE8A 2ZCUA 4CQMA 1A9ZA 2PH3A 5JMWA 3MEQA 2SCUA 4C7KA 4JROA 3T4EA 1OOEA 1FDTA 3WG9A 2FN7A 2RIRA 5JYDA 5JAQA 4M54A 5CP8A 3ZWBA 4NH4A 4IJKA 4BQPA 1WNTA 4FJ2A 3TN7A 4FFNA 3I9KA 1NXQA 3D1LA 3PWZA 4FGSA 4AJHA 2ZIZA 2DVMA 4YJHA 4PGFA 1B3BA 1ZJZA 4WUVA 5KVVA 3ZWCA 1LSSA 3I9MA 4X54A 1T25A 3EZLA 4YJGB 2JFFA 3MWEB 2C07A 2H9IA 4UAGA 2YW9A 1HXHA 1N7HA 1EBFA 1G0NA 4BOYA 3NDRA 3V2UA 3H5AA 3NV9A 2JJYA 2FPIA 3GAZA 3MTJA 4ZA2A 1H9BA 3RBZA 2O3UA 4JIGA 4ZICA 3DAPA 2NUAA 1HETA 1Q1NA 2ZJ1A 3I52A 4W82A 3ICCA 2I65A 1HDGO 3U3XA 4BNTA 2IXAA 2X7HA 1DAOA 2ZKLA 1BMDA 3OF2A 1ZEJA 1E7QA 3ROQA 2BKAA 3RI3A 1I30A 2C7GA 2IDZA 2VZ8A 1VJTA 1MUUA 2NM0A 4CMCA 3V5NA 3ONFA 4L0QA 3E9QA 1T2FA 4AICA 2TMGA 4R4JA 4EEZA 1XU7A 2YUTA 3ENKA 1YGYA 3K96A 4Q3AA 5AVOA 4J6FA 3OQ6A 4CV3A 3JQ6A 3V2HA 5MDHA 1K6XA 1J4AA 2YZ7A 3OETA 3WWZA 4QXMA 1LI4A 3JYPA 1YQDA 3WSWA 4B4OA 1OMOA 2C0CA 4KWHA 1YQGA 1VE9A 2XXJA 4JJIA 3L4BC 1Q2XA 4CUZA 3ENNA 4LK3A 4E2WA 2IYOA 2W2KB 5HA5A 3WMWA 1U5CA 3JD2A 2W4QA 4MVJF 3H2SA 3WR5A 4LW8A 3WNVA 3VVCA 1L7EA 4FOOA 4CM9D 4QT0A 1ENZA 2OL4A 2W2LD 4JLWA 2UYYA 5A5FA 3DAFA 1DIRA 1P9LA 2X9VA 4AG3A 1BXZA 2J5KA 3GG2A 5A06A 1UH5A 4AJ1A 4W7IA 4WPGA 2VYVA 3DXFA 4R5HA 3T7EA 5HS6A 1DDOA 3E9NA 3MJSA 1U7TA 2CDAA 2V6BA 4GVXA 4NHEA 2FR1A 1LJ8A 4A10A 4HP8A 4RZIA 1JN0A 4AJ4A 2VTEA 1M2WA 1YKFA 2VUTA 1VL6A 4Z9FA 4CMBA 4Q3NA 4CQLB 4UVHA 2C20A 3OQBA 3H5RA 3K2EA 4JX8A 2BF7A 4JNKA 3HFSA 4R1UA 1PWXA 3C3XA 2FR8A 4MVJE 2JFHA 3GOHA 3R3JA 5JO0A 1RJWA 2ZYAA 4E13A 2A92A 3U4DA 2VYVD 2Q2QA 3IAHA 1JW9B 1AUPA 4XR9A 1NM5A 4WASA 3ZH2A 4N5LA 2B5VA 3DBLB 4OIMA 3PDUA 3I9LA 3I4CA 4DA9A 2CY0A 1KVQA 2JKVA 1DFIA 4YWJA 1EEHA 2CVZA 3DBRB 5ENDA 4XGNA 3BMOB 3JQCA 4FJ1A 4C7JA 2CVOA 4FJ0A 4CLRB 1XLTA 2Y1FA 3UHAA 4JBHA 1TLTA 1ZXBA 4R51A 4Z9XA 1ADFA 4CPDA 3LT1A 4RORA 2Q1WA 1W8DA 3ROKA 4Q3BA 1HZZA 5BSHA 1QMGA 3O9ZA 4LRSB 3L6OO 2JCVA 4PLCA 1BGVA 3NRCA 2UDPA 1SBYA 3LYLA 1N8KA 3OH8A 3GC6A 5FI3A 1LLDA 4BNJA 2DT5A 2X5OA 1I36A 5IAAA 3P2YA 1R4NA 3M6IA 2VN8A 3WJ7A 4NBVA 4UEKA 1S7CA 2I9PA 3D5TA 3O38A 1OI7A 3JQFA 4FCCA 2YQ4A 3ZWPA 1WDMA 3OJOA 2OP1A 1LTHR
chains in the Genus database with same CATH superfamily
2D5LA 2XX3A 3NALA 1ISRA 1PQUA 1P1FA 1M3SA 1WS6A 3DXXA 4RD1A 4LSGA 3SWWA 5KYYB 1GT6A 3WGQA 3K5HA 1TA4A 5G0TA 2EBWA 3IRUA 1RMTA 5BSVA 1JKJB 1P17A 3PA8A 2NQTA 3MOIA 2AT1A 4ARCA 1TPZA 13PKA 1Y1TA 2B2NA 2H4YA 3GUCA 2CV0A 1YHYA 3NUZA 3H11B 4AXBA 4Y98A 2VYNA 2C2MA 2C7VA 4NFHA 1U3GA 5C3UA 3CLRC 1L5RA 2WU0A 3VPDA 4D9NA 2D6FA 5DGDA 3ZK8A 1WSAA 1O5OA 2FX2A 2I6UA 3QEJA 1T43A 1WXXA 1P61B 2Y0EA 4GM1A 2WTUA 2V6GA 3G0HA 2E4XA 2YCLA 3S2SA 3THXB 2DM6A 1I4OA 3GX1A 1CFJA 4K3UA 5IZCC 1N0WA 3JQEA 4BP8A 1XTBA 4QEKA 2X0FA 5B6IA 1IBRA 2O8BA 4WOJA 3DV0B 2ONKA 4PINA 3DTNA 3RS2A 2EJWA 4MVWA 2QDXA 2D1YA 1QRUA 1IIRA 3EEBA 4FIZA 4D9GA 4GOMD 4INPA 3H87A 4KAAA 4E4RA 1T4DA 1QAQA 2F3UA 2ZAIA 4PIMA 1L2TA 2F6RA 2ON6A 1ZICA 4WLVA 3GEGA 1T26A 4C4YA 3P9KA 1MAAA 4DPLA 2OD2A 4R83A 1E5LA 1NUSA 1GPJA 3UOAB 5FTLA 4FDUA 2JFPA 3OQOA 1V7PC 4DLXA 5MN4A 3ONVA 1JNYA 1XCJA 2F90A 2HHJA 1GXSB 1ST3A 2OZPA 4GPAA 5JI2E 1KYYA 3B3QA 1L9XA 1OXMA 2NXNA 2WZCA 4PAWA 3HKEA 2C5LA 4X85A 5F1OA 3VU3A 1DKUA 5KQMA 1MDFA 1ZA1A 3HY4A 1P9NA 1U9IC 2ZIAA 3HABA 2X2FA 1L5OA 2PXCA 4O4HA 5DCWA 3SCZA 3VU0A 2CZGA 3SU8A 3E2IA 3VO2A 3X2EA 4YPOA 1QRTA 1VPWA 2M6KA 5C34B 3MMXA 4EBFA 2LR0A 5ADHA 1QO7A 1ZHHA 1N7GA 1E9CA 1M34B 2MR5A 3KKLA 1HFEL 4K6FA 1IM2A 1QTNA 2ZIXB 4LXIA 1HPLA 3D2AA 2PSHA 2Y4NA 1DKQA 3T5GA 4RVUA 3ZX5A 4BX0A 1RZRD 1TYCA 4A3SA 1EWVA 1MVNA 1O5IA 1D2AA 4M46A 1N0VC 4DIFA 3A6GA 4PZAA 5T4FA 4IKEA 3E48A 2VJKA 5F1PA 3VJKA 3BWMA 5B1SA 4B81A 4KR0A 4HN4B 3I9OA 2WPDD 2WAYA 1JXAA 3QH4A 3OZDA 3I6QA 2PWPA 1BQ3A 1CRZA 4J1QA 4P08A 2XZTA 5GM1A 1NHGA 4RU1A 2WM3A 3L5OA 4KV9A 5B1DA 3OLYA 1AKNA 1N6NA 3KAJA 3DVQX 4XWYA 3TDMA 3PYLA 5FRDA 4DR4B 1TJNA 2AOXA 4ZO8A 4NENA 2RONA 1F8GA 1VHWA 4Z1MD 1NV8A 1RPAA 3NKFA 1BG6A 5KOHA 1TCAA 1SUIA 3UBMA 2GO1A 4RGYA 5E8JA 5B1HA 4PZDA 1QO0A 1KI6A 4U9HS 3O2NA 1TMKA 4RMIA 4X3OA 1UBGA 1UMKA 2X5KO 1MJFA 3DO8A 4QPCA 1AIPA 2XW6A 4ND8B 4URUR 3GLIE 4DMUB 4MHOA 3WAGA 4M1EA 1XZQA 4MUBA 4JYCA 4JS0A 1O95C 2Q99A 2XQIA 1ORWA 3PU6A 1BX1A 3W5CA 1R9MA 3E6AA 1L4YA 4OG2A 5AUPB 3QFFA 1L4NA 2QN1A 4Q19A 5CRIA 5C31A 2QYHA 4MS1A 4DDKA 2IKQA 4R9RA 5K6TA 1UBFA 1VMAA 4B6OA 1MW8X 4N40A 1FMFA 2P4QA 1W4AA 4B79A 1QHSA 4G8JA 3DB2A 4J07A 4CM1A 1PGNA 1Q7EA 3OZUA 1E2LA 2DWOA 4JJ7A 4JNCA 1PFGA 2WSSD 1BVUA 2E48A 2F3RA 3COYA 4HWTA 2WNSA 4RETA 4WEQA 4AY5A 3ADCA 1X0VA 2PY6A 4TXNA 2VF4X 3BGIA 4MW1A 1XTQA 1P0IA 1MP0A 2XF8A 4HB4A 4KO4S 3ZKAA 4BNVA 1V39A 3B9BA 5LB2A 5MN6A 4C6SA 2QYSA 5HNKA 3B1YA 3WYEA 4TYWA 1S2DA 5KSPA 2CF6A 4BLRA 1N8TA 5LU8A 2R1VB 2CMKA 3TTWA 1QBGA 4YRZA 4YRQA 2Y0CA 2W2XA 4FFOA 2BH9A 4KKVA 1ZGJA 4I6EA 1KH1A 2CFSA 2PKEA 3BE5A 3EXFA 1ORTA 4RPLA 1ONOA 3OQIA 2CLHB 3BMNA 4DLRA 1JL3A 3SHFA 2Z4SA 1ONPA 2J5RA 3UWKA 3TRKA 1S2OA 3WHKA 4AJ4A 1BE1A 1DV1A 1KSHA 4HH1A 1YXMA 3LG2A 4OPMA 1Z5OA 2Q49A 4X1KA 4OP3A 3ESYA 2K7FA 4IP0A 1XNQB 4OBEA 1PFUA 4FYVA 4B3JA 4V03A 1XZBA 4P4GA 1R8YA 1C3OB 1FQOA 3BH6A 3NM4A 4DKXA 3AIKA 3AFGA 3LAWA 4IXDA 2H5JA 3IRVA 3PK0A 2CNKA 1YVDA 3Q3IA 3PEFA 5J63A 4ZVTA 1XZKA 3LD9A 4F6LA 4DC9A 1OBOA 3LX5A 4I1VA 8GPBA 2ZYHA 2FZKA 3EJ6A 3RRXA 1I3CA 3JVDA 3H6KA 1OU0A 3CR8A 3H1FA 5H7XA 2A0YA 3CU5A 5BN3B 1LRLA 1KHTA 3P9CA 1ZSVA 1PQPA 2EQBA 4MVCA 4ZO4A 1JMVA 1XWIA 1NVDA 4F9FA 2UXDB 2X3YA 2I3BA 1X7YB 3LT5A 1XN4A 3FKJA 4RXTA 3QWFA 4LKRA 4AJ9A 3J7AC 1SBIA 2BI4A 2Z5FA 2Q6VA 3B5JA 3VGPA 1MJHA 4IFBA 1OWLA 4H15A 4LAFA 4OCZA 2ECPA 4MWSA 2XZDA 4JQCA 5F12A 5ED4A 3K8YA 1IZZA 3LYAA 2XCLA 4ZT4A 1XKTA 2WJYA 2FGJA 4CIBA 1UZMA 4MKZA 3IV7A 2A1TR 1AK9A 1YRWA 1H2XA 2BM1A 1VSUA 3IVGA 2NNWB 2OYCA 3KYIB 3DVAA 4AWXA 4BZWA 4RYDA 1CR1A 1NBIA 2FHPA 2E6KA 5FUMA 2AN4A 1E9DA 2VDJA 4JV5B 2XR1A 5DHAA 1Q50A 2Q0QA 4UCXA 3NQ41 4XR4A 1NJ5A 2GEBA 5LP6B 1WXFA 3B38A 1RP1A 1ZZGA 2FAXA 2WU4A 3MBIA 2ZWOA 1YASA 4HMQA 3GVXA 4KQEA 4LYEA 4ZEOA 2OCXA 3D4BA 2ZBRA 2R5WA 5EIHA 3KVYA 3TZQA 1FVOA 1PQ4A 3NYIA 1YJQA 1A8HA 4OSOA 3AVOA 3AHGA 4FBMA 4ZVNA 3ZE6A 2UXCB 1HKHA 2Z83A 4RKFA 1L6RA 3ILSA 5KAPA 3FPAA 1RHMA 5FNVB 4BO4A 4CU5A 4Y6QA 3GW8A 3KL2A 1MB9A 2AEEA 4RQAA 1COWA 2ANCA 2C8JA 5BQPA 3SIRA 2YKGA 2XUFA 5FWAA 1K98A 4X6XA 1T6BY 2C4WA 3UW3A 3T1NA 4MQEB 5EJGA 4V3BA 3V8EA 4WBNA 4H59A 2QT9A 2ANBA 4GU5A 2C0QA 1KFEB 4EDFA 1Z2EA 3HQ4O 3EYWA 4LGMA 4OGGA 3LCUA 3L7DA 3H17A 1Y7HA 2UKDA 2CBXA 2ZAYA 1U0HC 5J9FA 3WWEA 3Q0IA 4BGEA 2CYAA 2PGOA 4QUGA 5BR4A 2QYOA 3F5DA 4PYMA 1GO2A 1CR0A 4NQRA 1XJ5A 1KP3A 3AL3A 4MUNA 2DXIA 2I4MA 2Y67A 2A5LA 1P3JA 3TTSA 1RQRA 4DNFA 4OQ4A 2UUPA 1RXIA 2XYPA 3AR5A 4RFVA 2QNBA 1FYVA 2ZOSA 4OQNA 3I2GA 1W76A 2SKCA 3A70A 5CBKA 1LPOA 4FGLA 1ZUWA 2IPXA 5AW9A 2XNCA 1DBWA 3RLFA 3JALA 1J49A 4CKWB 1JT9A 3G5AA 4GBJA 2VVTA 2W43A 4G5QA 2P9GA 4JD5A 3NAGA 4OQYA 4F4UA 4MKRA 1LK0A 2FPWA 2JFWA 4MUGA 2J7PD 7YASA 4L51A 1AUQA 4B3TB 1XVTA 1ZUD1 1T6XA 5KKAA 3RHSA 1KY3A 3WGKA 3R9XB 2PZ8A 1ZVMA 3TQQA 1P9OA 3HFJA 4FT2A 2D0IA 2FW1A 2VQDA 2C2GA 3OZXA 3RVLA 3F2IA 3FMIA 1UFQA 2CK3A 4M6WA 4R6XA 4DADA 5ECWA 2IZ0A 4YA6A 3DGFC 3GPBA 1FNMA 3DM5A 1LRJA 3X1WA 4KFCA 4E5MA 3T95A 1XZEA 3O95A 1OLXB 3MC1A 2HO5A 3QXSA 4I2VA 5H3LA 3H11A 1IU9A 3C5VA 2WIAA 3ITKA 3M1IA 4QU8A 1R4MB 1Y98A 4FGJA 5D6OA 3AQ4A 3FYUA 2XUGA 2P9QA 2P78A 3Q4GA 4V38A 3UIEA 4ZTUB 1JF8A 1GZ4A 3AVYA 4GKAA 1EGVB 5EHQA 3L0ZA 2Y6VA 4AYWA 2B4KA 3IX7A 1O03A 2YNMC 1H6BA 1BXRB 1A9TA 3ZU6A 1MJNA 1V26A 2TYSB 4KZPA 4AQDA 4LXYA 2KJQA 1KS9A 2JANA 3DEHA 4RDCA 2G71A 5CA1F 3U56A 5TJHA 2JJ2A 3EDMA 3H2JA 4YLEA 4CZ2A 4J7UA 4ZMBA 4Y0AA 3WBJA 1BX0A 2DPXA 3AETA 3GWGA 3HDYA 5D3MA 3KB6A 4DBLC 1SXPA 3A36A 4N5NA 5TQ2B 3Q8KA 1VHDA 1DX4A 4WXPA 1LV7A 2E0IA 3KEGA 5EZYB 5HG0A 4R9VA 3TKLA 2Q9UA 3ZW7A 4N12A 4JT9A 1XL1A 2NN3C 4U2FA 3PWTA 4EY5A 3KKPA 4R84A 1B6TA 3UMJA 2YHBA 4LWZA 1D8TA 1T1RA 2NSHA 3AR2A 4EKEA 2HCTA 3IFSA 2P2DA 3RREA 3QNWA 4DANA 3SR0A 1G7TA 3THWB 1P9RA 1W46A 3UICA 3C24A 1P62B 2Y93A 3GUVA 3RJTA 3ZDFA 4D9FA 5JADA 1EXVA 3TECE 1KOGA 4G8BA 1Z34A 2PZAA 3N6XA 3WL3A 4TSFA 3IBTA 3QLEA 3SZMA 5FH9A 2BGUA 4AROA 1KOFA 1SVMA 2NZUG 1H9AA 1KK3A 1KS2A 4LFAB 2G5GX 3PFKA 4EKYA 1PGPA 4Z0HO 1DTWA 4X6YA 4ES6A 5A6SA 2WUGA 2V54A 2OTCA 3R40A 2EEPA 3DMRA 2QXUA 3PGKA 1SUDA 2J5BA 2HCFA 8MHTA 2YICA 2FFJA 4D81A 1OHHD 5HVNA 3PE4A 2BZSA 2EWMA 3VQTA 1NRXA 4LRQA 3GLTA 1P9WA 3T35A 4Q4CA 3PA6A 2UYHA 3CJRA 4UTNA 1A3CA 2PLFA 4IFTA 1NW4A 3AOEA 4Q34A 4IW3B 3QYFA 3OT1B 2J8ZA 4HO1X 3QNUA 5JS2A 7REQB 2WVGA 3FFTA 3GEBA 4FI3C 4BVAA 3NATA 3B20A 2G1KA 5EWJA 5TGDA 1M75A 2A9FA 3H2BA 5CLQA 1HM5A 1UXOA 4G5OA 3TTVA 1X13A 4HQ0A 4M1KA 1FTYA 4YJKA 4CUKA 1G19A 2BFPA 2LCIA 4A7PA 3V8MA 1G60A 4TTVA 1Z74A 2ZAGA 4KBGA 1H6CA 3D3WA 4KQ2A 1A9RA 1YC5A 2C04A 5E1DA 4UNRA 3B9PA 3AUKA 1ZD3A 1E5TA 2FMIA 1CS4C 5FWDA 3BRWD 2YHIA 4GVLA 4OB6A 4EJ6A 5LP6F 1U4OA 2CCGA 3LRTA 4ZOLA 4LZOA 1G8YA 2QM3A 1MABA 3THOA 2GPSA 3M6MD 5IM4F 1NZJA 3QFRA 2FB9A 4FZRA 4Y9SA 4A8JC 3UHPA 1K8YB 2WOOA 4N7JA 4QBGB 5IAJA 4C89A 2O7QA 3CF0A 3O8DA 5DN9A 4ZV4A 2CLIB 3OFKA 2F43A 1ZPDA 5AYVA 2B69A 3RVSA 1OLSB 4UJ5A 2YUIA 4NJEA 1SB9A 3HC7A 5AMXA 4I46A 4YREA 1E3QA 2F3SA 3BMCA 3QTTA 1BMQA 5DLDA 3MILA 1CK4A 4QYSA 5FBHA 5J40A 1OX6A 3GWZA 4DM4A 2ZUUA 4HLQB 3GT3A 4LDRA 4L78A 4G0ZA 4HRVA 4QFDA 3PGVA 1JU4A 2AUNA 2C4UA 2I2CA 4CLXA 2E5LB 3C7AA 1BRMA 3RUPA 2PH7A 1GG5A 3L0IB 3UAGA 1TQHA 3V8PA 2DQSA 4RZUA 3WGZA 1FFSA 1QKJA 4DLTA 1G8SA 4QU5A 3RDPA 5L3QA 2G07A 2F3QA 3GLHB 5FOWA 1V16B 2IWRA 3C3PA 1VHLA 2DKFA 1C8BA 2PXAA 3FVRA 1ACMA 4TWJA 2HV9A 2IE8A 5K3SA 3KJEA 4WBNF 5C1IA 3IT0A 4HQOA 4FHFA 3T1QA 3ZGLA 1NVMB 3UJ8A 2HK8A 5ALVA 4MJ7A 5ECGC 4JDPA 1QKIA 5EZ6B 1Q20A 3S5UA 3IUSA 3NNSA 4IZ6A 2O8BB 2HK7A 2IZZA 2IIVA 3H5WA 4WN9B 4RGBA 4ARBA 2QTFA 3O4RA 2VSOA 5FPHA 3HPQA 4JB0A 1S8AA 4AO8A 1DC8A 1PJ4A 3T8YA 3U16A 5BSKA 4O3MA 3NO4A 4X44A 4I55B 5KWEA 3ZQKA 2XT6A 3BRCA 4B73A 4BP9A 1WCV1 3M5DA 4OQFA 4QUHA 4EHIA 4FCVA 2HPZA 3AU8A 3O47A 2YX1A 3GY0A 4PTLA 2AQ8A 3AR3A 3LGXA 5EJ7A 1TC2A 3PFHA 3GR6A 1IEWA 5EMKA 3VR6H 5IH3A 5BWOA 1OKKA 1ZBQA 3C43A 3D2LA 1IPFA 4XQCA 3SS7X 3VR3A 3RD5A 2WYWA 1I5OA 3ISTA 2PSSA 4KL8S 1LXCA 1XDUA 1DEKA 3NHUA 1X3SA 4GE3A 4BKOA 1J42A 2QT0A 3MTIA 3W6OA 4X62B 1YB7A 1Q57A 2I7TA 1K4KA 3EVZA 4KDRA 2X0JA 2CYCA 5KOHB 2GM4A 4IAOA 5L45A 3KQVA 4BQRA 3F73A 1LKZA 3O91A 1RVV1 2BMDA 2N1MA 4N0PA 2XVMA 2RIPA 4MARA 4Z9YA 1UBOS 5M04A 1RLMA 5B12A 2GN8A 4RYLA 5IT4A 1YQWA 3KQLA 3ZDEA 1D04A 3ZIAD 3ACBA 5SYMA 3WL7A 3A0UA 4HDQB 5K3AA 1ZKMA 1ZOSA 2BGRA 2EIXA 2H1LA 2DB3A 1O94C 4RPGA 4MW7A 3OUTA 2V7GA 2CFTA 4QYTA 3SQWA 2I4OA 4RA6A 5CJ2A 1NOJA 4ZJUA 2YVAA 1UBTS 1MHPA 3VHXB 3PI7A 1JXQA 3VJMA 1L4BA 4MIKA 1CEEA 3DDCA 5H83A 1CUUA 2G0TA 3OOEA 4AC9A 1ODSA 2G9VA 2HWUA 4P6VF 5K03A 3PTAA 4WLFA 2HPAA 3G9QA 1KTIA 2K5UA 2XH8A 2Z2IA 2JGDB 1ZMXA 4Q3DA 2EFCB 3MSCA 4TKVB 2NUPB 4Y2HA 2F62A 4KXXA 2UZ1B 5JNRA 3V7YA 5JWOA 1Y9JA 5LKAA 3TMYA 5LQAA 1BYUA 3JQ9C 4ITUA 1KAOA 2JCSA 3IEUA 3DEJA 3IXMA 1CY4A 1D2NA 3P4YA 1PR1A 4GHWA 2D13A 3DBHB 4H4DA 4PXYA 4F3TA 2RGWA 1YL5A 1C3LA 4BFCA 5F2OA 3PT9A 1D1SA 1R0YA 4GXTA 4LX8A 5ADUS 1KFJB 1OV6A 4NZ9A 4JLOA 5CH8A 1F8YA 4MV8A 2HHCA 3W6PA 1VMDA 1XDZA 4IIJB 3KQYA 3OC6A 3DZIA 3N2KB 5A4MS 4Z3DA 4TKVA 2QAGA 3V8BA 1HORA 3SAJA 5FJJA 1GQSA 3OLCX 2GRUA 1QRSA 3W8DA 2CLFB 1KZ7B 2EJVA 2SECE 3F78A 1G1AA 1MX5A 3EG9A 2O2ZA 3QA3E 5AJXA 4TGLA 2HMSA 4JHXA 5EPOA 5AM3A 2PSFA 5FDFA 1NG9A 1LPAB 1NVWQ 5KWVA 2DWUA 4XGIA 1U90A 4PFKA 4QUAA 4S1PA 2ZR8A 4PG6A 3OICA 5CPBA 5CVEA 3ZY5A 4CI9A 4D8YA 3GLGA 3OMLA 5ICFA 3RJZA 3CUVA 5DW3A 2C9OA 2ICAA 1QG6A 1K0UA 4HH0A 5DK6A 5FBZA 3AR6A 3I04M 3HYTA 1Z2PX 4FYIA 2C54A 2QTVB 4B8YA 2C2KA 1KC3A 3DCNA 5GJBA 3IPCA 3E53A 5ER6A 2O2CA 4LFBB 4XPIB 2VPQA 2ZK7A 4XWKA 3JAWA 4KKXB 3F3SA 1ULAA 4OSPA 4RA9B 1GKKA 5DYNA 4D8WA 1DQRA 3B52X 4OHYA 1SKQA 4HXYA 2CDCA 1SG6A 1P0MA 2QENA 1T1GA 3DA8A 5A71A 3LK7A 4Q4JB 4Y7DA 1VSBA 4WL0A 3C3YA 2Y0PA 5GONB 1Y6JA 3AFHA 5D51S 2RGGA 5CD1A 1EK2A 3IMFA 1M8GA 4W63A 4ALMA 1YRQA 3OQVA 1E1KA 1JH8A 1HT1E 1NVAA 4MCHA 4X91A 1G21A 4N76A 1NQTA 3AU9A 1AZTA 4IV0A 1EE1A 1WHTB 2OV6A 1OLUA 1QIFA 2G72A 4LJ7A 4N0DA 3FSJX 1V5EA 1MNQA 4PG7A 4UE3S 5CX1B 4Q3KA 3N2EA 5JNUA 1V7QA 3I32A 1QH1A 4PLTA 3CNOA 2G0AA 5FTJA 1LEHA 1AHIA 3U7GA 4IKPA 4ZMSA 1UJ2A 3F71A 2OCGA 4ACBA 5LQUA 1GCGA 3PGA1 4F12A 1OC4A 1SC4A 1ZD2P 3M82A 4K9RA 4GOLD 4X95A 4HFRA 1UK8A 1LS6A 2EDCA 2JFZA 2ZQYA 1CF9A 1S3FA 3QENA 5D7BA 2F8SA 3JTEA 3LHKA 4XB1A 5B64A 1XXLA 1KKUA 2EKLA 2RCNA 4MQ5A 4WVFA 3H5TA 3UHFA 1QQ6A 3CRNA 4IQFA 1EX9A 3BXHA 4YUYA 2IXEA 4GD3Q 3L82B 1K3FA 3DJYA 3H42B 4V2IA 2P9CA 2OEPA 4AULA 1BTOA 3WWYA 1NXOA 3LP5A 1E1QD 3I45A 2FSVA 3AX6A 4HKTA 4TTAA 3E27A 4HTFB 2I7CA 1WMEA 2NUAB 1KO5A 1I13A 2SNIE 5KNDA 5HRAA 1Z68A 3RTGA 1NDUA 4F8JA 2I67A 3G0BA 3OFNA 3T5MA 5EPEA 4EYOA 2OXEA 4EF6A 1H2YA 4FWIB 1ELOA 2MJLA 4LY6A 3EX7C 3DMTA 5DCYA 1KKLA 1OT3A 1SVOA 2IHTA 3MINB 3Q9UA 5T57A 5H8WA 1RYHA 2FSHA 3PGLA 3KVOA 1TE2A 4NZZA 2PYDA 3T99A 2BF4A 1IY1A 3HRHA 3W2EA 2TRSB 3GDOA 1SPBS 5C18A 1FFXA 1TKBA 3RFXA 4RMGA 2KHZA 3UHOA 3VVBA 4DG5A 2JI9A 2NQ8A 5K1ZA 1X74A 1BN6A 5CDHA 4D25A 4WZZA 1NQAO 4UVGA 2XB9A 3BTUA 2UUBB 3OO1A 2WEKA 1VPLA 2YXLA 4A2PA 4C78A 3U4QB 3S99A 4ZOCA 1ZI9A 3OTHA 4OHCA 1KI2A 4P4SB 2XTZA 3GYGA 1T13A 3GA5A 4Z4EA 5I51A 1F6BA 1T0JB 3K72B 1XDBA 1S6YA 3FOEC 2QZPA 2B83A 4K9NA 1GPNA 4W1PA 5IAGA 5HKKD 1QHIA 3GJ0A 2UVPB 3KIPA 5DNYB 3GGGA 5CXXA 1WOMA 5THQA 3RTEA 3WRYA 2PRJA 1LW7A 4EYQA 1FS6A 1XVVA 3N1UA 4GEKA 5CVVA 3ZNQA 4GX1A 2NO6A 4I81A 2AMLA 4IX1A 4LHWA 5HKLA 4KRFA 1NBWB 1CUZA 1NDQA 3BE8A 4KQIA 3RAEC 4J9UE 4ZEVA 1MO3A 4OJKA 4DFDA 3MT8A 2CVPA 1JMYA 2JGRA 2XRYA 1KZ9A 5M29A 4YGYA 4MAAA 4I9NA 1J97A 2CHUA 2H8KA 3DZDA 4JVOA 5CDFA 2QRNA 4CODB 1I10A 3CURA 4FZ5A 3K9CA 4OL9A 4UU1A 5EP1A 2HO4A 4I3GA 4PPNA 2QV7A 1NHWA 2HLNA 2GPBA 4MWEA 5BVGA 3W1WA 3UJ6A 3CH4B 2J0SA 4HNTA 4BWYA 1OXKB 2BMJA 4NDAA 1KYWA 3AZPA 4A6DA 1WMDA 5DP2A 3DUFA 4LNAA 3DTVB 3GUZA 3OM8A 1EQ2A 2ZPUA 4II7A 4M9UA 1ECCA 3F6CA 2QKYA 1RQXA 2IW3A 2LUOA 2VC2B 4DJDC 1OLSA 2VZEA 4KLZA 3UEOA 2AS0A 4JX9A 4JVMA 3DFFA 3UH0A 4C4TA 1I6MA 1TVEA 1JSXA 2FZEA 5FIUA 3R9XA 1SZJG 2NTEA 3DO5A 1VBNA 2X86A 5B1EA 4Q9HA 1R12A 3PFBA 4UNQA 6ADHA 1ADBA 3JZIA 3LCMA 5K05A 4NFSA 3A7EA 4AW9A 1MIOB 4M1QA 1U0TA 1XA4A 2PO5A 4LV8B 4C6TA 1NN1A 1TI7A 4E94A 1ISSA 1DB3A 3R20A 1M8KA 3LCJA 2YFYA 4RVFA 4GR9A 2VPXA 5A0VA 4XASA 5JS6A 1J7JA 2VDWB 5B6JA 2O2EA 2RDMA 3E03A 3KR1A 1A82A 2D5CA 3E7DA 3RQSA 2IE0A 4TT3D 4JOBA 2Q3EA 1WZEA 3BMQA 4YJFB 2QMZA 1LY1A 3G79A 4D74A 1Y5LA 1MIOA 3DOJA 3KKOA 5BWMA 1GTRA 1CUFA 4DRXB 3OQJA 3UA4A 1KI7A 1YB1A 5A4DA 1G8GA 5DHQA 3LUAA 4NS4A 5DLQC 5CFPA 1T2AA 4NQZA 4TTSA 2R8OA 1X1DA 4Q48A 2PDAA 1UL1X 4WGFA 6NULA 1YKGA 4UUOA 3JW8A 3F2VA 4AO6A 2V5VA 4HMOA 5J2UB 4JKOA 2XPCA 4Q9KA 3LUDA 3WDSA 1AMUA 1N6HA 1RE1A 1NF3A 2AR9A 2XMSA 3ND5A 1X92A 3B1JA 3IEKA 4MKGA 4D0GA 3GLFE 1B0ZA 3GLFB 1ENPA 2VDQB 5I7EA 5BNWA 4M0KA 3BIOA 4B74A 5LMZA 4FU0A 1IXYA 4YMSA 2FPSA 2MINB 3PXGA 3DYIA 4LV6A 4Q0MA 2XVZA 3K8ZA 2RJNA 4BO8A 3C14C 3MGKA 3RRBA 1ZGGA 4Q93A 1GPDG 2J9RA 2OAGA 3ICVA 3NGXA 2OCBA 3K16A 3T3EA 2GZMA 3ZPXA 4CTKA 4EEKA 1RLOA 1EHYA 3TAUA 4ZGWA 3Q8LA 1CB0A 1G3MA 2GCOA 4IJUA 1UUFA 1T8SA 3ONEA 4L7VA 4DV0B 1HDOA 3THYA 4DBVO 3ASUA 4JJ8A 3HKEB 2ZXUA 1EDOA 4F38A 1FL9A 3RFTA 5KOYA 1DU4A 1OZGA 1PGQA 3HU2A 3KKZA 3QV2A 2XE4A 1DL5A 1PYOA 3TZLA 2GOYA 1QP4A 5CLIA 3IXQA 5JDCC 3ZV7A 1AV7A 4FYPA 3SVLA 4QREA 4JQZA 2D2IA 4N1AA 3AI3A 3H5VA 1O6BA 3Q9LA 1SXJC 3X2SA 1DCFA 2JJ1D 3QVOA 1OX5A 5GGYA 3OD5A 1CNFA 1QR2A 1AB5A 5BNFA 5L51A 1PUXA 3AF2A 3LQYA 3VDNB 2X9GA 3TLYA 1U94A 2XGJA 1T9CA 4DSTA 5DM1A 2JGDA 4B8ZA 4DN6A 1TJ5A 2C83A 3OHPA 4IDAA 1A1VA 1ND5A 3ANMA 4IS2A 5D3KA 3O3MB 3OX4A 5L53A 4MRNA 5JAZA 2Y1LA 1QK3A 2IQIA 2YC2C 1Z39A 1VPEA 4HR7A 2QUAA 4ND6A 4ZVKA 4D79A 2AZXA 1GRVA 2AFIB 4HNAA 3GHYA 2II6A 4IF6A 4GI3A 2QXTA 4MDHA 3UC9A 3UJAA 3WKEA 1W88A 3TRIA 1Y81A 3O4VA 2PUJA 2X6RA 2FMFA 3HVRA 4W9MC 1WLSA 4YCNA 3PFFA 4MV4A 1J0AA 1NI3A 5AKLA 2JI6A 3I2IA 3ICEA 1A98A 3ZEIA 2D2FA 1UM8A 1EJ2A 5BUZA 1LCIA 1EP9A 4TS1A 1B7GO 3OQNA 4RMNA 3BQMB 4CEIB 2FW9A 3PNKA 5JPCA 1NMYA 1UOQA 3RRNA 1Y4SA 5FWYA 1YK1A 1WMBA 2FFBA 1N5OX 3C8UA 2ORIA 3V32A 3KVRA 3EFEA 4R7GA 2NUTA 3U9LA 4DQDA 4TN1A 2H5EA 4RTMA 2QQEA 2XLBA 4AS3A 1GN8A 4QAQA 4E7PA 2Z2XA 2KI5A 3SM9A 4DTCA 4LMBA 5K3EA 1CQXA 1JKIA 2GK4A 3IALA 3PUYA 1PYDA 4G25A 2OBNA 1C81A 2QMUA 2ZWMA 2VT2A 2DSTA 4QJ4A 3O83A 2J7KA 3HL0A 2IX9A 3JARA 4M89A 1JA0A 2ACKA 1M34E 2XWSA 2QSYA 4M8NE 4Q9JA 4RM2A 5JEDA 2DECA 2NT4A 2ZE7A 2AA3A 4X1KB 3L8FA 1MXHA 3L8ZA 1H2WA 2HLPA 4Y6GB 3KJHA 3H6HA 3ZE2B 1DS6A 2YV1A 4Z4HA 2IH5A 1RC8A 1X3LA 1JECA 2L69A 4KGVA 1AVTA 2W8ZA 1JBKA 2JZNA 4FFMA 4YVFA 5JD6A 3H2KA 3DDZX 2VQSA 4BNIA 3IQFA 2Z6UA 1A4XA 4PTYA 3KS9A 4YV1A 4IYRA 1P2GA 4RDHA 1SXIA 1D7AA 1Z29A 3KJXA 3E8XA 3B13B 3HHPA 3D1VA 3MCAA 4C1BA 3RYHB 2ET6A 4BFZA 2BEUB 4XIJA 5IS2A 2MSNA 4RAOA 4RPJA 1DLIA 1XTIA 2QW1A 3SC2B 1X9HA 4BQQA 5KUTA 1JP7A 1LA2A 5DVZA 3ESZA 4R41A 1QIGA 3EAQA 4FMDB 4DEXA 3EH2A 5LMCA 3RIYA 1TAUA 1XR3A 2PFSA 4EB6A 4LCJA 2W98A 3G2JA 1P2DA 1ODTC 1VYVA 3G9XA 2QRKA 1E69A 3C8MA 4Q7JB 4UBOA 5LA6A 1HOTA 3TZEA 3WX0A 1XELA 1B0PA 5JCXA 4KLRA 1KDYA 2JFQA 3JYOA 3VR2D 4G0UA 4ROSA 3L6CA 3CZMA 2BGGA 2P6RA 2X7JA 2QQFA 4G37A 3TF5A 4LFCB 3O4HA 4EGAA 1GTG1 2WAXA 4GLLA 1JG4A 5C9ZA 1PTKA 2I7XA 3QI7A 3KPYA 3RU7A 1CERA 1WPGA 1YQTA 3EJWA 3Q5EA 4TLMB 1ZR4A 3NANA 3IUNA 3EVAA 3UPTA 5GVRA 4YCSA 1MLDA 2XMGA 3LFTA 3MELA 5H9VA 4EB6B 3ROZA 1ULHA 1LPMA 2CDRA 5F1KA 4IIHA 2G17A 5FPTA 4GX2A 4ECAA 3DF9A 5J4KA 1FRVA 5CNIA 1OUMA 1HYGA 2WPNA 3ND7A 5JZVA 3DE1X 4ZYYA 1R4ZA 2WSMA 1M7GA 3JU3A 4ERXA 4C4RA 1T5BA 3GD5A 2HQBA 3AUAA 3MCUA 4JASB 5C37A 4EEXA 5K6AA 3NZEA 3DONA 1OXSC 3LCRA 3TI7A 4CIVA 2NYUA 4JT4A 3HUTA 4OQEA 1C1YA 2DRIA 2OMEA 4RKWA 3B48A 3TNDA 5KQLA 2WVHA 2FSSA 3WBFA 4JP2A 1TTPB 2J87A 3A32A 1FRFS 3EARA 3IKTA 2Q5HA 4CBVA 4M8SA 3NTVA 2JFOA 1PG2A 3EBLA 4BFTA 3GRYA 1OH8A 5CG1A 1Y89A 4Q9AA 3N59A 5TEVA 2WHYA 4MVYA 3SMQA 2D8AA 4G63A 3HFRA 3W2TA 4BLVA 1L7NA 2ZITA 3KEFA 4WADA 3EOBI 1SCUB 2X0EA 5I7VA 1BMFA 5IXSA 1ADGA 3EF0A 5JVDF 3WAJA 2C7OA 5HFNA 1EFPB 1WB6A 3T7RA 4FCWA 5TXGA 3QELB 3IEPA 1KARA 1RLJA 1N5RA 1GXSA 4LOKA 2P1DA 3S4YA 5G41A 2HYDA 1JHAA 1RRMA 4D41A 1E1LA 4PBSA 3UB4A 2C8KA 1LDMA 1ISJA 1X7WB 1VA4A 2VL7A 3PQFA 1DEXA 2E6UX 4OHFA 4EUEA 5FOQA 3M1AA 2QLMA 1DBPA 2J3HA 2QGNA 4O2AA 4TYQA 3ASZA 4ZU1X 4DB4A 2D7CA 2F17A 4CMIA 2JBWA 1AH2A 4EG4A 1C7FA 2KX7A 3I64A 5BOSB 1CZHA 2AJCA 5A0TA 1PTJC 5G0UA 1K4YA 5AM2A 2GPAA 5H5JA 4I8DA 4L6CA 1BWPA 3MCVA 3PWKA 4MZXA 5IHXA 3LUHA 3NYWA 3GPLA 1FNBA 3R8CA 1EGQA 3KR9A 1CEQA 4W1SA 3O8NA 4D9MA 1KI1A 2GEVA 1JIVA 1GL6A 1X7XA 3CE9A 4IO0A 5CHEA 5EP2A 5KSOA 1B43A 4UBIA 4E14A 2PJDA 1DKNA 1IJEA 3NDJA 3AUJB 4HNHA 4XYMA 2VA9A 3FG9A 5AW1A 2N3ZA 2AJ8A 1YVUA 4GVPA 3TO5A 4A4DA 2R9VA 4KOEC 3TL2A 3HN2A 1W36B 2EFYA 1TM7E 1Z6TA 3F7MA 4JAVC 4RK4A 4U2EA 3RIXA 3SHOA 2I8CA 4MWOA 5G1OA 4C0SA 4NABA 1DKMA 4KHZA 5IM5A 4PR3A 1X8XA 5EIFA 5CDUA 2WD7A 4CIYA 2PZLA 1UIRA 2WJZB 2XMBA 5T41A 4U9UA 4XX0A 4MWCA 3F46A 1CB7A 4JLAA 4IDPA 5ITWA 2VTBA 1R5OA 4UARA 1AQYA 1R8XA 4WN3A 4D8TA 1R7RA 5F4BA 1ZFNA 3OIVA 1E94E 1CZUA 4CFSA 5ICMA 1N2HA 3LOUA 2R5FA 1KRXA 1HT0A 1PL7A 2ATEA 3IPAA 4K6CA 3S2FA 4J7CA 2HJSA 1M72A 1TZMA 1IUNA 2QP4A 3HCCA 2A7XA 3GEHA 4KQWA 5E4FA 4TQ9A 2VBCA 4OAQA 2E4YA 4Q39A 1II8A 1UZUA 3E8MA 1ZKDA 2ZBGA 3HN7A 4DLUA 3E3AA 3K20A 4U00A 2HA5A 2BKEA 1Y33E 3RVMA 3TK1A 4D5GA 5JFOA 1MA0A 2GN4A 4S05A 3OP4A 1AKEA 1R0XA 2FZVA 5I9LA 2PR7A 4UAVA 5CNKA 3KZCA 2ZJ0A 1XD2B 1XXHA 2PKWA 3ONDA 4L85A 4PRZA 3WY9A 2JAQA 4U2GA 3L07A 3O7MA 5JH7B 4M55A 3KAQA 4OQXA 2OWDA 3NWBA 1DI0A 1LUAA 1ULUA 1Z8HA 3BJEA 3L7MA 4FSDA 4QXAA 5DSXA 2QNRA 5IH7A 1C9YA 4EI7A 1JSCA 2W70A 1OBVA 2I33A 3K0FA 3C98A 5TIIA 3NM6B 4XUCA 4ASUD 1K06A 1R9NA 1SIOA 5FOVA 1O95A 4L27A 2VJAA 3Q7QA 2FMXA 1VLMA 2JLZA 4CR7A 3SKXA 2VRWA 1PLKA 2X42A 3HKCA 1BOFA 1QM5A 3DWFA 3CZ5A 2J46A 3OKAA 4X66B 1WUJS 1Y8ZA 2J6BA 4R81A 3REOA 3SC4A 2RH8A 2P2NA 4BMVA 4MUIA 1HBJA 3ZY6A 2NP6A 4MPJA 3EMKA 1J20A 1QRDA 4Q9IA 3ZK7A 2WI8A 2GD6A 2D2VA 2RHMA 3I01M 3N8NA 4YACA 2AEJA 4JXJA 1KO8A 4JBNA 4BE4A 5DIFA 1T5OA 4BN0A 1I4LD 1ZH8A 4KR2A 3OBBA 3W9SA 3GA0A 1MX1A 1SUPA 4D3FA 4CMEC 4ICIA 3AG5A 5IK2D 4M21A 3PIRA 3KSBC 3SX4A 2CB0A 3ZHRA 2HRZA 3WKAA 2IEYA 3M5CA 1WPQA 4DR6B 4M49A 2JF0A 2WOJA 1CUYA 3ABRB 5J59A 3AVUA 5BQFA 2RK4A 3VH2A 3QPDA 2D1RA 3NRJA 1NONA 3FR7A 1D0IA 1CY6A 3MYRA 1IUOA 1KYQA 1BXKA 1NYLA 1YU9A 2WV7A 3D8NA 3BCUA 3EGDB 3PUVA 5DM0A 2PGAA 2RG7A 4LVCA 5KYXB 4P81A 5K0LA 1R5NA 4EVSA 4NPCA 2PKYX 2J6HA 4ZMRA 3ADDA 2I29A 3HGMA 2BUAA 1P4RA 2LTAA 1NBOA 2YBEA 4K1LA 3TD6A 4ZK6A 1ST2A 3RK4A 4ER6A 3BEOA 2QTTA 3PXEA 4MQFA 3PGMA 3IDOA 1A7JA 2BGMA 5LZ8A 5BR7A 3LUFA 5J4VA 1Q0TA 4Z4IA 3MMNA 2IFTA 1GIAA 3VPAA 1LDNA 1XBTA 4IUBS 3AI7A 5FPKA 3MQ2A 1KNXA 4OHMA 1N6IA 3T7SA 3D6NB 4KN8A 1DTEA 1SKBA 1R4NB 1YFKA 2FQQA 2HGSA 1TEXA 2NOAA 3C1OA 3IBSA 2FUG6 3IOEA 1IZYA 1GCOA 1ISPA 1P18A 4WESB 3BD9A 4EMUA 3ETHA 3LGSA 5KMGA 1YB6A 1Z4PX 2Z5GA 9GPBA 4UJ3A 2PAAA 1FP4A 1F2TB 2ZYWX 4G0OA 5H82A 1XJWA 1ML3A 3SYLA 4MV0A 1Y7LA 3AB7A 3UAZA 4PGGA 3X44A 2COKA 4N9WA 1N4AA 4V1CI 2PA3A 3FZEA 3L8HA 4AN4A 3KQOA 2CFRA 4OXXA 2FP4B 4YRGA 16PKA 2H07A 1E3EA 3BKWA 1A9YA 4G36A 2WY2D 1N92A 4UAUA 1SC1A 4G84A 4J7AA 1DUVG 2FUG1 4XWGA 4P84A 1M1YE 4KLNA 1LZKA 1JE0A 1QAMA 4PNHA 3UUFA 3FDZA 4X7PA 1YB2A 3TJZA 1H69A 3A9CA 1BE0A 2RGEA 1D2RA 3VC1A 1Z37A 3CX7A 3IESA 3BSWA 5E0KB 5ER9A 3W78A 3WKDA 4NZYA 4RCVA 1SN7A 3ZQJA 4N41A 3U2QA 2PT6A 4MW6A 5J4YA 3RPEA 1ZLYA 1MVOA 4A0RA 1US8A