3H6KA

Crystal structure of human 11-beta-hydroxysteroid-dehydrogenase bound to an ortho-chlro-sulfonyl-piperazine inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
260
structure length
260
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTSYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Efficacious 11beta-hydroxysteroid dehydrogenase type I inhibitors in the diet-induced obesity mouse model.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 100
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h6kA00
1XKQA 1RKXA 3LT0A 4AJKA 4PZCA 4YJFA 1Y9AA 1ISHA 4FOOA 4HUJA 4B79A 3OJEA 2VTDA 4UUNA 3PYLA 1IL0A 1NYTA 2NU7A 3FWZA 1OAAA 4GLOA 4BNXA 3PI7A 2Y05A 2NTVA 2WE8A 1XHLA 3VPSA 2ZYGA 3L0DA 1DIBA 4XRRA 1ZUD1 2DTEA 4HWKA 4B8WA 2PKQP 2B4RO 1A4UA 1EUCA 1ENZA 2YW9A 1PJLA 3NKLA 3RAJA 3N7UA 1XQ6A 3RC1A 4A5OA 4OQYA 3LZ6A 4F6LA 2I65A 4FCCA 4WCFB 2ZQYA 3DBHB 4ZD6A 4BMVA 1GEGA 2QRLA 2PNFA 4KUGA 3VPFA 2X22A 4J16A 1DRVA 4BO2A 2AA3A 4FDAA 3WMXA 1I8TA 3FNEA 3PP8A 1KY4A 2PLAA 2Y1CA 2YV3A 3C7CB 3FPCA 4XYEA 1JAXA 3GNQA 4D45A 3ABIA 3VVCA 1YB1A 3GN1A 5I9LA 1JDJA 2I9PA 3W6UA 1PWXA 3LSYA 4DIOA 4PVDA 3C1TA 2ZCVA 4WLFA 2FHSA 1YDEA 1WXDA 1YJQA 2HMWA 3C85A 4IQ8A 2FZEA 4J9VA 3RU9A 1XEAA 3P5SA 3VH4A 1DSSG 2Q2WA 2OORA 3QWFA 1J6UA 4GGOA 4QECA 5A05A 5JAIA 4YEDA 1C1DA 3O4RA 4BNMA 4E5PA 4RVHA 3GOHA 4CUKA 5DT9A 2ZKLA 4TZKA 3IKTA 5K6AC 1E7YA 2I99A 3GVXA 4KQWA 3CMCO 1V3UA 3KV3O 5A5FA 3HSKA 3LC7O 3ADOA 4RJTA 3QIVA 1FDVA 5MDHA 3OJLA 4WCFA 3K2EA 4BNLA 3JQGA 4U7WA 5JAMA 2PGDA 4BNZA 2J5QA 1W4ZA 1YB4A 4BIIA 2ZTMA 4QO7A 3BMQA 3ZGYA 3JQBA 3U4CA 2HRZA 5C5IA 5JXWA 1NAHA 4CR8A 4XGKA 2YY7A 4WK6A 2BF7A 4NBTA 4OHUA 4PRLA 4Y67A 3RKUA 3QVWA 1TVEA 4KUHA 1Y8RB 4ZU3A 4ALMA 4D42A 4XRGA 1KEUA 1W73A 1MB4A 1NQOA 2D2IA 3JYPA 2X23A 2Y68A 3K73O 4IJUA 4QEDA 3NDJA 4BKPA 4BO9A 1VL6A 2PZJA 4MIEA 2PY6A 3ROPA 1RPNA 3NTOA 3UCXA 1ORRA 3U3XA 4YT8A 4R1SA 1HDOA 1YQDA 2Z5LA 4UVDA 1QG6A 4ZRMA 2JFHA 4FFLA 3RIHA 1NVMB 5KVVA 1ZK0A 4QXMA 1X1EA 5EQFA 2QQ5A 2HK8A 2FOIA 4E5MA 4QFDA 1PL8A 4R4JA 1UDBA 3BTSA 4WLUA 2B4QA 2G5CA 2R00A 4YDRA 2X5KO 4CMIB 1MXHA 4M87A 1MG5A 4NFYA 4TWRA 1BXGB 2CZCA 4BO3A 3UFXA 1GDHA 3QE3A 2CDAA 2SCUA 3RBZA 1BDMA 3JQBC 4CLRB 3EMKA 2GZ3A 3I83A 5L9AA 1T4DA 3H8VA 3WNVA 1VI2A 4YA6A 5CFZA 5CDUA 4ITUA 4E32A 4JJFA 4UREA 4BNNA 1GYRA 3TOXA 2GERA 4CMEA 1LDEA 3Q2KA 2Z1MA 3FF4A 4DBVO 2J3IA 4J0FA 5K9ZA 4M49A 1WZEA 1YBVA 2WD7B 4OOFA 3DR3A 3ZHZA 4MKXA 1C0KA 2RHRA 1VLLA 5KCZA 3F47A 5TS3A 1PR3A 3AI1A 3NEPX 3PLRA 5KNLA 2GRAA 2Y93A 4YRBA 4IY1A 1P74A 4FFPA 3PWSA 3GGGA 1S6YA 2X0RA 5T8KC 3ASUA 4JROA 2X9GA 2AQKA 4U0KA 3GK3A 3LF2A 4NR0A 2GLXA 3PK0A 3NUGA 5JCXA 4DBZA 3LT2A 1U4SA 3E9NA 3JQ6A 1B14A 1Z82A 3BYZA 1KYQA 3ULKA 1NQAO 3JQGB 2VQ3A 3E8XA 5I8ZA 4KDEA 4L75A 4XYGA 1P1JA 2Y99A 2H1SA 2OFPA 2V6MA 4JP2A 1YL7A 3ON5A 4K9DA 3C7AA 1SOWA 3BMCA 3DZKA 3M6IA 5A9SA 1ZH8A 2Q50A 3JQAD 4IDCA 1DIGA 3PJGA 3E48A 1HDZA 4M55A 1T25A 2C2YA 2JCYA 2HMVA 3FBGA 1ZZEA 3K9QO 3QWHA 1NNUA 4CLOA 5TJHA 3ITDA 1EVZA 2DC1A 2EEZA 4LCJA 5BNFA 3ZU5A 5DNAA 3W6ZA 4KWIA 3OIGA 1I30A 3EGOA 3EW7A 4XQGA 3FSRA 3OJOA 3ZV3A 3LDHA 1KC1A 4YQZA 2NQTA 2EGGA 1QV6A 1NR1A 1RM5A 2VHYA 3IQDB 3ONDA 2JCVA 4IXTA 1ISMA 4TSKA 3RJ9A 4YT2A 3PWZA 1V9LA 2X8LA 4A03A 1NPYA 2GN4A 4FS3A 3FTPA 3KO8A 1HF3A 3BHMA 5JCJD 1NAIA 4E13A 5FYDA 1ULSA 5B12A 1H5QA 1N7HA 3U9LA 4A73A 4GBJA 3ZWMA 5IFLA 2PTGA 2GASA 1YONA 3GLQA 3FR8A 1R4NA 4R1UA 2YYYA 5EN4A 3HZZA 4XQCA 1Q1NA 2YHUA 1H93A 4FR5A 5HM8A 5IAAA 1R0LA 3I9NA 1IY8A 2C59A 3KETA 1UUFA 1JVBA 1ZK3A 4P38A 2G17A 4IJVA 3JQEA 2OP1A 4KMSA 1UXKA 2G76A 1TT7A 4Z0HO 3ZV6A 3Q6IA 3GF4A 3D3WA 2GPTA 2EP5A 1UXGA 4JCOA 1UH5A 2X9NA 3AUTA 4D0RA 4D3FA 4BV8A 3SXPA 4PIVA 4EBFA 4O5OA 1LU9A 1TEHA 3C1AA 3KSZO 4J43A 5DF1A 3WGQA 4EJMA 3VTZA 5CDSA 1HZJA 1GUFA 4TRJA 2VUSA 4YQYA 5G4LA 3WQSB 4CLEA 2VRCA 1C0LA 3WYBA 4HKTA 4UVIA 4W9NA 1U3TA 4XB1A 4CJXA 3INTA 3HADA 3WBFA 4JQCA 3V1UA 5KJ1A 2JJYA 2I6TA 1E3WB 5AOVA 1UR5A 4K1LA 1ZVMA 4RL6A 1EEHA 3VZQA 3ZDFA 1V35A 1K6IA 1GY8A 3UOGA 3GMDA 4IGEA 1BHSA 3C1OA 5G0SA 5HBRA 2HLPA 2I76A 4GX2A 4ALNA 4CLHA 1O95A 1E7MA 4DL9A 3TDKA 1LLQA 1SB8A 2NUAA 2NVBA 2UV8A 1I33A 1I24A 1R4NB 3P19A 2ZTVA 4I5DA 4WLOA 2IYPA 1R4MA 1VRWA 3FR7A 4BNHA 4IPTA 5C7OO 4ZN6A 3IC5A 5KOIA 4DRYA 3PEFA 5CDYA 2Q4BA 2F1KA 3PTZA 2GN8A 2J3HA 2WMDA 1ISJA 4LVCA 1NFFA 3FNGA 3ZHBA 2JD0A 1ADFA 3NDIA 2NWQA 3ZCXA 4P4GA 2J6IA 2JHGA 4EUEA 4PCVA 4GX0A 1GPJA 5COQA 1WWKA 4BV9A 1T2DA 3D0OA 4UAGA 3UGKA 1U8FO 1Z7EA 4CMGA 5JDIA 2D5CA 1ENOA 2E82A 3RUIA 1I01A 5LCXA 2CF6A 4FGWA 3ZW8A 1LEHA 1MGOA 2JD2A 4HX5A 1EUZA 3D5TA 1B2LA 1HRDA 3V8BA 4RVFA 4DVJA 2PA3A 4OXKA 1HE4A 4YJGA 3PIDA 3DAPA 4ID9A 1ZK2A 3KZVA 4BGEA 1N1GA 2DFDA 1U9JA 2QRJA 3AI2A 3KM0A 3MOIA 5JMWA 1MX3A 3TJRA 1F14A 2VWHA 3RQSA 3IDSA 2PD3A 2I5PO 2NVUA 3DOOA 3HDQA 3PRJA 1QYCA 3EC7A 4GWGA 3M2TA 3PGXA 3GVPA 4YJHB 3HN2A 3F1LA 1LDNA 3ZHXA 4B3IA 2OBNA 1G0NA 3IKVA 2CMDA 2D8AA 4Z9FA 4E31A 1KVQA 4UVHA 4CR6A 2WE7A 4TVOA 3O8QB 5DOVA 4DWVA 3W1VA 1DB3A 3WLFA 3GUYA 4DGSA 3GNTA 3UF0A 3FNHA 4RPLA 4H16A 5DOZA 2FPIA 5TNXA 3W4KA 4BKRA 1E1MA 1DHRA 1U2GA 3O38A 3IUSA 4MOWA 3ZH2A 3R6DA 5L45A 5T8KA 4MP6A 5CEFA 2O3SA 3ZN2A 3DDNA 3QVSA 3R1IA 2QG4A 4K6CA 4IDGA 4Y8VA 4I5EA 3UW3A 1HE2A 2X0NA 4E2WA 4BQPA 5L95A 1XA0A 2JHFA 3PHIA 3KYCB 4DPMA 4ONEA 4NJOA 4LVUA 4RLHA 5AXCA 4MVJH 1EK5A 4AJJA 2NADA 1UZMA 2GDZA 4BO4A 4DTIA 2GNAA 2EJVA 2IZZA 4YPOA 1KVRA 4R51A 2IRWA 2O3JA 3F1KA 4B4WA 2IXBA 3G49A 5KJCA 4WLNA 4XJTA 1OMOA 2J3KA 4DMMA 4CQMB 3KEQA 2FRDA 3OBBA 3AK4A 4Q3NA 2WYUA 3AUSA 3RC9A 5I9NA 1LDYA 2Q46A 2P5UA 1YQXA 3GRPA 1SBYA 1VJ0A 4YRDA 1YXMA 4FOSA 1IPEA 2GR9A 3EZLA 5AXDA 4WECA 3L9XA 2VYND 3DOJA 3INRA 4J2OA 2JFGA 1WMBA 1D8AA 2X4GA 5LDGA 4XD2A 2PGJA 4AVYA 4DYVA 2EXXA 2EKPA 2XAAA 3AY3A 1PGQA 3PGJA 3VZPA 4QQRA 1DLJA 1M2WA 1YB5A 2FR1A 1PL7A 5EERA 1EE2A 1UZLA 4XGIA 1BW9B 2BGKA 1DPGA 2HSDA 1H2HA 1XGKA 3ZNQA 4DA9A 1QLJA 3QLJA 1GQ2A 3FRJA 5TSDA 3ZWYA 1FMCA 4BO5A 2GN9A 5TX7A 1PJQA 6ADHA 1ADBA 3H6KA 3L6EA 5A02A 3RASA 3RI3A 1NHWA 5KVCA 5JSFA 1FDUA 2C2XA 4J3FA 3B6ZA 3WJAA 4DXHA 5HRUA 1SAYA 1XSEA 2X5JO 2DQ4A 1EUDA 1QKIA 4I9NA 2DBVO 1VSVA 5IDWA 2VHWA 5G2OA 1H0KA 3M1AA 3TQHA 3PDUA 4OIMA 5JC1A 4CM5A 1PS8A 1IYZA 1Y8QA 4ROSA 4N18A 1ZXBA 3DONA 3E18A 4W9NC 3DHYA 3FD8A 3LLSA 1PJSA 4RDIA 5IN4A 3ZU2A 1W6UA 3JD4A 2HJRA 4DREA 2FMUA 1ZK4A 2C20A 2O3QA 4J4BA 4A7PA 2GSDA 1R0SA 2RBEA 3UN1A 1E1LA 5IXYA 2XOXA 3WFIA 4CPDA 3VPHA 2BHLA 4TRMA 3AM3A 4N5NA 5L53A 4UUOA 2PKRA 5DP1A 1D3AA 5T67A 1EZ4A 2A92A 4FBGA 4R5MA 3T4EA 3NT4A 1YJ8A 2VTEA 2NTNA 4TKMA 3AWDA 5G0TA 1WDLA 3SEFA 4RVUA 2VOJA 1JKIA 1HDCA 3ZNNA 1HSZA 4CMJA 1E1NA 1JTVA 4RGBA 4C7JA 3SLKA 1VL8A 2HAEA 1A72A 2Q1SA 3CKYA 2FSSA 4J7UA 3VHRA 5IN5A 2G1UA 1PZHA 4II3A 4Y6SA 4NIMA 4CMAA 1J49A 3TL2A 3AM4A 4LGVA 3E9QA 3WBBA 3RUHA 1Q7GA 2BLLA 3HNPA 3H9EO 3DHEA 4KWHA 1DIRA 4MPDA 3DZGA 1RYDA 2CNBA 2P4HX 5CG1A 3QSGA 4QO8A 4CLXA 3B1JA 4Z3KA 5A03A 3E5MA 3OHSX 5IDXA 4AJEA 3NJ8A 1JKFA 2AW5A 2FP4A 4E0BA 4LW8A 1PJBA 4AG3A 1ZMTA 2RAFA 3G1TA 3G79A 4NNJA 4B7XA 3KYDB 4CL3A 1WNTA 1PZEA 1I5RA 2Y1DA 5JDIC 3CINA 3IAHA 1KETA 3BIOA 4TRNA 3S2FA 3DTYA 3BZUA 3F4LA 4AJIA 4RVDA 1I2ZA 4KOAA 3UCEA 3ZV5A 1I0ZA 4RVGA 1EBUA 3NDRA 4Y98A 3OA0A 2CVZA 1NR7A 4GSLA 4KZPA 5IZ4A 2Y66A 4RCVA 4NFHA 2VYVD 4ALIA 3HDJA 4CLRA 5EIOA 3E03A 4JXKA 3JQ9C 1K2WA 1W8DA 1WMAA 1EQ2A 3F4BA 3O26A 3VKVA 1LQTA 2ZJ0A 2P9GA 3CXRA 3A14A 3MJSA 2AE1A 1DRUA 4UVGA 3JQ7A 1YOVB 2OUIA 2AHRA 3L6DA 2C29D 4IJWA 3D1LA 5TIIA 2VRCD 4XQ9A 4PG6A 3P2OA 2EERA 2PV7A 1X7HA 2HMUA 5ICMA 2Q2VA 4NPCA 2A94A 3JD2A 3KBOA 3IJPA 4BNYA 4XX0A 3GN2A 3HQ4O 1YL6A 3GFGA 1WAMA 1GV0A 1BSVA 3ZWXA 2EG9A 4KDFA 3RROA 1B3BA 3PZRA 4PN3A 5I7VA 4H15A 4L73A 1HL3A 1LDBA 1Q0LA 5TC4A 3WWZA 4DYDA 4RZHA 5C7IO 1NVTA 1A7KA 1XU9A 4GL4A 1OOEA 4B4OA 4FB5A 2W2LD 4D44A 2P2SA 2YZ7A 4AJOA 1B8PA 2GO1A 4GKBA 2FR8A 3C24A 1KEWA 3L77A 4YT5A 2IZ0A 4BB5A 4O59O 4K26A 3WGHA 5FWNA 1R15A 4EJ6A 3QWAA 4ND1A 5TQVA 3V2UA 3JQAA 5CEJA 1R37A 2RH4A 2XXBA 1B0AA 2WTBA 3ZWNA 1C1XB 1C14A 2XF8A 4FD3A 4JGBA 3A9WA 5BNTA 3WLEA 4CM4A 4BUCA 1J0XO 1XIVA 1DBVO 3D4PA 5B4UA 4NHEA 1HLDA 1EDZA 3LC1O 3OEWA 4NU5A 1DFGA 3E6AA 4ALLA 4GH5A 1ZKMA 3VZRA 1E0DA 1EE9A 3ZWCA 3DWFA 3BMOB 3F3SA 4PVCA 4W6ZA 1VE9A 4BNGA 2B37A 1ZW1A 5JFOA 2ZYDA 5KJ6A 2YHIB 1EVJA 2CVOA 4DMLA 4BNVA 3K96A 4FPXA 3KRTA 1EDOA 3GEGA 3M1LA 1I2BA 5H83A 1U5CA 1NVGA 2ZYAA 5FI3A 2EF1A 5K6AA 5CEEA 5AVOA 1C1DB 1X0VA 2I66A 1PIWA 4M89A 4CLDA 4GI2A 1KEVA 3UCFA 3DXFA 4CMIA 2BGMA 3ASVA 3PHLA 4I08A 4PLFA 3FCOA 1T1SA 1Y5RA 1PZFA 1JWBB 1SCUA 2VWPA 3JQCA 4M8SA 3S2EA 4CV3A 3ZW9A 4YRAA 4PLWA 2Q45A 4LSMA 1E5QA 1H6BA 2CSUA 2GUGA 2LDXA 3RUFA 4DQUA 3DZJA 4NK4A 1GV1A 5G4KB 4MVJE 2B36A 1WDKA 5CDTA 2BELA 2Y1OA 4RV9A 3BXXA 1HE5A 4RQTA 3SVTA 2Y67A 3WGYA 2POQX 1G6KA 2JKVA 1GZ4A 3ANNA 1MV8A 3S8MA 3PZBA 3OSUA 3GH3A 3DAGA 4G2NA 5ADHA 1CQJA 2G0TA 2UVDA 2WDZA 1EBFA 2C82A 1EFLA 4YAGA 1ZJZA 1NM5A 4CV1A 2J8ZA 1LJ8A 4Y6PA 3UH1A 1XCBA 1K0UA 4I5FA 4NJMA 1F06A 1SNYA 4PFJA 3T7CA 3E82A 3VPXA 3OM9A 3PQDA 4Q3DA 1JW9B 1EK6A 3H3FA 4BNWA 2C5AA 3P2YA 3AOEA 4R3WA 4HFRA 4CMBA 3WJ7A 1P44A 2VYVA 4RF2A 3RSHA 2E49A 4JJGA 5DBIA 5HS6A 2X86A 5A1TA 2PD6A 1A27A 1OFGA 2HO5A 2IODA 4HY3A 3BA1A 3INGA 4W99A 1LSSA 1ADCA 2VRBA 3JSAA 4N5LA 1DJQA 5JDCA 1X7DA 4JIGA 4CMEC 2VN8A 1JU9A 4NK5A 1SOVA 1OI7A 1JAYA 5TLSA 5EINA 4GMGA 4RO0A 4B7CA 3EHEA 4FFNA 4B4UA 5THKA 4BO1A 1KERA 4XWYA 4ZQEA 4NFSA 4RZIA 4F45A 3STHA 1GR0A 1TXGA 4DC0A 3HFGA 4Q39A 5EJ2A 1ZMOA 4FFRA 1HEUA 1LBEA 2VT3A 3JYOA 1DAOA 5I7SA 4CM9D 3PJDA 1SEPA 4LMRA 3RJ5A 4ND4A 4U6QA 2H5LA 2PGLA 4L4RA 4MVJP 4ZQHA 4GPD1 1ISIA 4MIYA 1ZSVA 3GGPA 4WNIA 7MDHA 3BTUA 3JD1A 4PLHA 4P8RA 2O3RA 2X1HA 1BG6A 3IJRA 4EITA 1P1FA 4F3YA 2YFHA 2FWMX 1E1KA 4BO8A 5JMPA 2RH8A 3F46A 1ISGA 5H81A 1X1TA 4CR7A 4BL5A 5IF3A 3DMYA 4IXWA 4CMHA 2PD4A 4E30A 4WUVA 5F5LA 4I1IA 2DPGA 3GPIA 1Z6ZA 3SJ7A 4LMPA 4YR9A 2W4QA 3WGIA 1Q0QA 3H65A 4UULA 4MIOA 2OO5A 1X7GA 2X9VA 5L3ZA 3SC6A 3V2GA 4D3SA 1N7GA 3D64A 3OQ1A 4XJSA 3TZHA 4NBUA 2IDZA 3LLVA 2WSBA 1O5IA 3SBOA 3H5RA 1ENPA 1N1EA 2PWZA 3DBRA 1RJWA 4JBHA 4N5MA 1BTOA 4NDNE 4NI5A 1KVTA 5ES3A 2GYYA 3MJTA 1Y5MA 3ROQA 1UP7A 3RFXA 3FTNA 2D3TA 3EDMA 1PGNA 4NBVA 2AG5A 4XR9A 4NQZA 2DBZA 4CM6A 2WJPA 2H6EA 1E6UA 1D1TA 1F12A 3EAGA 3OF2A 1I10A 4A2CA 1YS4A 3ENNA 1Z74A 3LQFA 1A9YA 4X54A 2WD8A 1B16A 3V1TC 3F5SA 2YFQA 1GTMA 1PZGA 1XLTA 1PEDA 2V65A 4M54A 3QVOA 1KY5A 1CF2O 4CV0A 4P4NA 3GRKA 1BRMA 2D4AA 1MFZA 2V6FA 1LLDA 1NASA 1JWAB 2QIOA 3JQFC 1DC5A 2BFAA 2UYYA 4WCFC 4BKQA 1ZO8A 4FC6A 4IMRA 2AXQA 4IDBA 3UKOA 3QVXA 3VOSA 4H7PA 1I3MA 1M75A 1M67A 3RUCA 3RFVA 2QX7A 3HE3A 4KTTE 2VZ0A 2GCGA 4G65A 4E5KA 4EJ0A 3AUUA 4L4XA 1P0FA 2BRUA 5IDYA 3L9WA 5GMOA 1VPDA 3V1YA 5KJEA 3I9MA 4J49A 3OIFA 1R12A 2P5YA 1IOLA 4WGGA 5A3VA 2YHIA 3CTMA 4ALJA 5B1YA 1KC3A 4Q3CA 4AFNA 4QT0A 3ICCA 1Y1PA 3EUWA 4FN4A 1QYVA 5C37A 4FJ2A 3G17A 4W7IA 3FI9A 1T26A 3H9JA 3DZFA 3GAFA 4ZA2A 5TJ9A 5ENDA 5F1KA 1YL5A 3MOGA 5HWSA 1NHGA 2WEKA 1U3WA 3ZU3A 3JCZA 1X15A 4MVJA 3SC4A 2PK3A 1NX6A 1DOHA 3CEAA 3IP3A 4DLAA 1QP8A 1YE3A 4AJ4A 5B4TA 3U5TA 1ZNQO 4DLBA 5L40A 1E7RA 5A06A 1F17A 3L4BA 5MGBA 3JQAB 4DQVA 1MXFA 4IIUA 1C1XA 3IS3A 1Z45A 4NJMB 4XDZA 1T2AA 4AICA 4FIZA 3JD3A 2W90A 3OEYA 3H4VA 3PQEA 2HUNA 4UUMA 5BSEA 1R16A 3WIEA 1TA4A 1ZEJA 5I7EA 2O2YA 3SX2A 3AY6A 2B5VA 4WEOA 2FPPA 1O89A 2NM0A 4WPGA 1NFQA 1M6HA 1R6DA 4YXFA 1ONNA 4GKVA 4UUPA 1HETA 4O0LA 5A5EA 3MWEB 5JC8A 3VAZA 3BMCB 3ONEA 4CUJA 5JBIA 1IUKA 3GVIA 2J3JA 3I3OA 2GN6A 5A9TA 3TNLA 5B4VA 4MVJI 1XWFA 5KKAA 1L7EA 5KVSA 2CF5A 1O94A 4Z3DA 3T7EA 3PJEA 1P31A 4D7AA 2B4TO 1V6AA 2DUUA 4ZQFA 3U4HA 1NTOA 3PFFA 2Y1GA 1K6JA 1MP0A 1SB9A 4YVFA 2JAPA 4KTVE 2YQ5A 1MC4A 2W2KB 4CQMD 2Q1TA 4DC1A 5U9CA 2QZ9A 1NQTA 5ER9A 3AM5A 1U3UA 2QHXA 3L07A 2F00A 2BGLA 1GUZA 3WGGA 1YQGA 1M76A 5CHEA 4B4VA 4E12A 1HWYA 4PLVA 1VKNA 4C4OA 2ZTUA 1XYGA 3PHGA 3RVDA 4L0QA 5A9RA 3ONFA 3SLGA 4R01A 4JJIA 5JCJA 2CD9A 4IM7A 2O23A 4OMUA 4MVJG 4IQ0A 4FSHA 3RFTA 1ZK1A 3X2EA 3A06A 4JX8A 5CDGA 2B5WA 1QORA 3ZU4A 4BHTA 1Y8RA 2IXAA 3R3SA 3DL2A 4J1NA 1BXGA 3GT0A 3OQ6A 1HDGO 5I7FA 1PQPA 3F5QA 3ITKA 3WGZA 4GLLA 3WOHA 4IZIA 8LDHA 4L8VA 3WYCA 3GUCA 5DN9A 5DDIP 1ARZA 1ONOA 9LDTA 5FI5A 2Y1EA 4MKZA 4CM1A 4CM9A 3U49A 1X14A 3BMQB 1DIAA 2NU6A 3Q1LA 3GDOA 4M86A 5JW6A 5DCYA 3H2SA 1DC3A 1E3LA 2C54A 1Z73A 1YVEI 1RYEA 1U7TA 3AOGA 4BS9A 3AUAA 3AW9A 4EZBA 5JO0A 3ETDA 4BO7A 1DC6A 4R16A 4PLPA 3HJAA 1P45A 2Z95A 2VWGA 5G0UA 3TSCA 5JE8A 4EUFA 2QYTA 3MJCA 3ZWVA 1K89A 3GY0A 4BO6A 5IDQA 1KOLA 1PX0A 2W98A 2RCYA 3P7MA 1FXSA 1LA2A 5ENVA 2HCTA 1MUUA 1GAEO 1UDAA 1XQ1A 4OXNA 2BKAA 3WICA 5T5QA 3QHAA 3OIDA 3OICA 4UEOA 2C7VA 1FJHA 4HFNA 4PLYA 3OETA 3JQDA 1E3JA 2CDBA 4ALKA 1ZBQA 4FJ0A 4Z0PA 3WGOA 1DAPA 2EGHA 5IXSA 4WEQA 5DZSA 5THQA 1ISFA 1AUPA 3WQQA 4OKNA 5U4QA 2GZ2A 3U0BA 2ZIZA 5KVQA 4OL9A 1HDRA 5IZCA 3I23A 4E5NA 2NVWA 3GG2A 4W4TA 4TRRA 4R9SA 3WS7A 4HV4A 3E1KA 3GZNA 1PGJA 2DM6A 1MFPA 1Q0HA 1YKFA 4S1VA 4XYBA 1AXGA 4ILKA 1D4FA 1V3TA 2BD0A 1Q7BA 3UAGA 1F0YA 2QZZA 1R4MB 1WDMA 3BMNB 1DFIA 1YH3A 1UZNA 3K5PA 3QRWA 1TI7A 5JLAA 4CQLB 2O3UA 4XB2A 1EFKA 4QFCA 3UHAA 4BGVA 3H3JA 4GX1A 4XIJA 1O8CA 1V8BA 1BVUA 2ZQZA 1JKJA 2PZKA 4R3NA 4NG5A 1OZAA 3I9JA 3PQFA 3JYLA 4U8GA 1P1IA 5GZ3A 1LC0A 1QYXA 1O6ZA 2NSDA 3ADPA 2XPCA 5BNIA 3DOCA 3ORFA 1N9GA 2HDHA 3KLMX 3LYLA 3QWBA 4PG4A 1DLIA 1IB6A 1ULUA 1HLPA 3PJFA 2DT5A 1NBOA 4RPJA 1LTHR 4XDYA 3DEYX 3ROMA 5L4LA 2PZLA 4NBWA 1GZ3A 2R2GA 3WIDA 3VPGA 5IZCC 2G82A 2NU8A 3NT5A 1E77A 1GYPA 1YWGO 1Y9EA 3LT4A 2O4UX 2YUTA 4XYLA 2IEBA 2CDCA 1AXEA 2EJWA 3DBLB 3Q9UA 1JA9A 1VC2A 1G0OA 4Q3EA 1QLHA 2YV1A 1CWUA 1WP4A 3JYNA 4ND2A 5G0WA 3TZCA 3KYBA 3OA2A 3UVEA 1P1KA 5EMHA 4IDEA 1C0IA 4RF3A 3OECA 2E4AA 1P9LA 4AJLA 4WKGA 4WOKA 5AYVA 3Q0EA 3GDFA 3EVNA 1OC2A 4R68A 4YJHA 1U28A 2NNLD 4RPHA 3DQPA 4EW6A 5EQDA 4MO2A 5FFFA 3ICPA 3AU9A 1H9AA 1UXHA 2HU2A 3ANMA 1T4BA 1PJ2A 3VH2A 4BNTA 5JS6A 1K3TA 2VYNA 1PJCA 3IOYA 3HDHA 3CUKA 4UEKA 3HWRA 3FNFA 2C5EA 1E92A 4BOYA 2Q3EA 3U4IA 2JAHA 3GFBA 4J1SA 1ZCJA 4NH4A 1U3VA 2R00C 3I9LA 4NMHA 4CM8A 2DFVA 2AEMA 3DZBA 2X58A 2WYVA 2X7HA 1N2SA 5TT1A 3A28A 2W2KA 1E3EA 3WTCA 2ZB4A 1KVSA 3NV9A 4YCAA 3O9ZA 4E2ZA 3ZWAA 5ITWA 2FR0A 3QJ5A 3D3WB 4FJ1A 3V5NA 3GEMA 3PVZA 1IZ0A 2ET6A 2WD7A 3VDQA 3DC2A 5BSHA 4DPLA 4U6SA 2HKIA 4B3JA 2HRBA 5HA5A 3JTMA 1GD1O 3OMLA 3COSA 1CRWG 2EKQA 1AGNA 1KVUA 1T2EA 1GQYA 3B1KA 3QV1A 4J1TA 4II2A 1VJTA 1N92A 1AE1A 1RM3A 8ADHA 1QR6A 4YAEA 2X5OA 1ZFNA 3UUWA 1I32A 4J2HA 4R69A 4BNJA 3WSVA 3S55A 2VHZA 3CH6A 1E5LA 2TMDA 2HQ1A 4LISA 4NZ9A 4P4LA 2Q99A 4YJFB 3QVTA 1IHYA 2DPHA 3T4XA 3ZZNA 5DCUA 2EWMA 2ZJ1A 2YQ4A 3PHJA 4EDFA 1Y6JA 3RBXA 1GEEA 3RU7A 4I5GA 4D79A 3NGLA 3EY4A 2O4CA 3I6IA 3DMTA 3TN7A 4OJNA 2CY0A 1QYDA 2Y0EA 2BI8A 2DBQA 5FF9A 3RC7A 2QW8A 4I9UA 4YAIA 4KQXA 4CMCA 1GCOA 4CM3A 4GX5A 5CPBA 4Q3BA 1E7SA 3WX0A 1LC3A 1LUAA 2IEDA 3EYWA 2OL4A 2LDBA 1LSOA 1R66A 3FWNA 3QW2A 4OYRA 2DBRA 1ENYA 2DUWA 1N8KA 4K6FA 1X13A 5JNLA 1Z7BA 4CM4B 2VNAA 4HFMA 1A9ZA 3PXXA 3OP4A 5DCWA 2X0JA 5TT0A 4PLCA 5FEUA 4F6CA 3TWOA 3WYEA 5C3MA 4YJDA 2DU8A 3NTQA 4ESOA 2EV9A 1XR3A 5JYEA 2GZ1A 4PGFA 2D59A 2D0IA 1PTJA 3GC6A 1B8UA 2JFFA 4QSMA 4PLTA 3Q3CA 3NYWA 2UAGA 4IINA 2J5KA 3DMTC 1X0XA 2IE0A 4N7RA 1DDOA 3BTOA 1HKUA 4KUEA 1H6CA 2ZB3A 2D1YA 3KSUA 3VVBA 5JY1A 2PH5A 3GAZA 4OQZA 3DBVO 4RPGA 4DIBA 4IQGA 4IJKA 1EMDA 1EVYA 1PJTA 2VHVA 4WOJA 3H5NA 1AHIA 5B37A 2O3TA 1H9BA 3VTFA 4R1TA 2JD1A 3DAFA 3RBVA 3S1LA 1E7WA 3KEOA 5KKCA 2I3GA 3Q2IA 4E6PA 2Y1FA 2C7GA 3R3JA 1D7OA 3CPSA 3FPLA 2AMFA 2EIHA 2P91A 2Q4EA 4PLGA 3JQ7B 1KIFA 4IDAA 3U62A 3BHJA 1ZSYA 1SMKA 4G81A 3TFQA 4TZTA 3ZWBA 1NWHA 1PWZA 1ZXLA 5JPIA 3ZHYA 2CFCA 1F8FA 4HP8A 5KIAA 1B3RA 2AE2A 2VT2A 4R9RA 2BFPA 4HXYA 3PFWO 1VL0A 1GQQA 1SC6A 2EHDA 1ZSNA 3ST7A 3W4JA 4A27A 4UEJA 3HB4X 4LCEA 1NWCA 1YGYA 5ILGA 4BVAA 4CL8A 1GPDG 4RF5A 2PR2A 2C0CA 4LSWA 2FPGA 1ZEMA 3PYXA 3GG9A 4WCDA 3W8FA 1ID1A 3AFMA 1SZJG 3K2BA 3K92A 1OC4A 1Z75A 4YAJA 3EVTA 3W8EA 1D1SA 1HDYA 3JYQA 1P0CA 3IIEA 1JLLA 3HG7A 5K0ZA 2P9EA 3GEDA 1LX6A 3KYCA 4HFJA 5JDCC 2OGUA 2OHXA 3UXYA 2HMSA 4HBGA 3WTBA 3ETGA 1I3NA 4Z9XA 1PS9A 1DO8A 4J6FA 3BAZA 3H2ZA 1S7CA 5COAA 1WVGA 1YBMA 3EZYA 4EEXA 3O03A 5EPOA 3RD5A 3D7LA 5GZ6A 4PZEA 1C3VA 4YYZA 3I9OA 3I9KA 3SJUA 3GVCA 2A4KA 4HNGA 3OQBA 2V6GA 2TMGA 2I67A 4BO0A 3CZMA 1Y7TA 3GHYA 4GWKA 4BB6A 5BT9A 3KB6A 5U1PA 4H3VA 3L6OO 2QRKA 1KS9A 2IZ1A 2ZATA 4S3MA 5BQFA 2NVUB 1GUYA 4IDFA 5TRTA 2FY8A 5CPFA 3OJ0A 3KSDO 4U5QA 4A26A 1LRKA 3WFJA 3JV7A 5L4SA 5L7TA 4O63O 3R0IA 3MJVA 1AN9A 2PKQO 2Q1UA 1CDOA 2ZB7A 4MVJM 5CP8A 1FDSA 3G1UA 3O8QA 3QQPA 3AJRA 3HHPA 1E6EA 1BDBA 4CLOB 4CODB 5ILOA 3DBHA 1C0PA 2PZMA 1NFRA 4YB8A 4K28A 3FHLA 4J0EA 2EKLA 5F1PA 1PGOA 2AQHA 3CZRA 3IMFA 3VZSA 2BH9A 4TROA 3TRIA 4NBRA 2E6UX 2B83A 3MTGA 4IUYA 2I3AA 1PL6A 2R6JA 4E33A 3V2HA 5DBGA 3DHNA 1CIVA 3GMSA 4HNHA 3PDJA 5AQ1A 3DBRB 3WSWA 5TGDA 3LC2O 4R54A 4JLWA 4J4TA 2DTDA 3MJ4A 1BWSA 4XEHA 4XR4A 3QY9A 4C7KA 3DFUA 1MC5A 5BSFA 1PGPA 1DXYA 4U0JA 2X6TA 2NACA 4O6VA 3AI3A 1XU7A 3NAQA 4DIFA 3F9IA 3VH1A 1H6AA 3TZQA 1P33A 1P3DA 2YJZA 3B1FA 1T2FA 3ZNPA 3BTVA 3QWIA 1QXSA 2EP7A 3ZWOA 2PH3A 2E37A 4L9RA 3PLNA 4EEZA 3NTRA 2AEFA 4GGPA 1UJMA 1IPFA 3C3XA 1TB4A 2HK7A 3ETEA 4XYMA 5L4NA 4J91A 3IL2A 5A04A 4EUHA 3GR6A 4LRSB 1EVIA 4WLVA 2Q1WA 1WZIA 4IIVA 1IZ9A 5KJFA 5KWEA 2B35A 4MJLA 1ADGA 3Q11A 3C7DB 4CQMA 1T2CA 3GZ4A 3QA9A 3MJEA 1IHXA 2EW2A 3GVHA 1XELA 3GHHA 1J5PA 3I1JA 1OBFO 2FZWA 4YAKA 4R1NA 3PHHA 1O9BA 4FC7A 4P22A 1DC4A 4Y6RA 1NP3A 3DFZA 3WXBA 5LC1A 3WG9A 3MCVA 1QSGA 2O7SA 3NJ4A 3U4DA 2W8ZA 2FSVA 3NGXA 2PFGA 4PZDA 1IE3A 1LLUA 2V7PA 3JQ8B 4WNCA 2Y0DA 4FW8A 1HYGA 3CSDA 3KYDA 3ZI0A 5ICSA 1PJ4A 3G0OA 4L74A 1ZIDA 2FN7A 3L4BC 2VUUA 1YOVA 4ZHSA 2H63A 2OXIA 3WDSA 2QYSA 1PQWA 4ZVVA 5C7LO 1NXQA 2VZ8A 4YACA 2ZK7A 1Y8QB 5IJZA 1CJCA 3NRCA 1B26A 1UP6A 3TZ6A 5JAZA 4OGWA 1YDWA 5ITVA 4LK3A 1A7AA 1HXHA 2GF2A 3KUXA 1VKOA 4TVBA 4WE3A 3HB5X 5HTOA 2NV6A 3W8DA 1PR9A 2VOEA 1E3IA 4URFA 3WWYA 3GDGA 4TKLA 1BMDA 3KLPX 4BGUA 4BKUA 4AJPA 5F1OA 1U2DA 1UAGA 3RCBA 3A1NA 4TQGA 1E6WA 3K8ZA 1MLDA 1B7GO 4OAQA 4XKJA 4JNKA 5F21A 4ZQGA 3HDYA 3VKUA 4ND3A 3K6JA 3WMWA 2CVQA 1TLTA 2VZ9A 1YO6A 3OH8A 4LN1A 4CV2A 1GADO 5BSGA 4AL4A 3BMOA 1M66A 1LDGA 2DAPA 2ZCUA 4D3DA 2YDYA 1UDCA 1HYHA 3GA0A 3TFOA 3CIFA 4ZRNA 4BMNA 1JN0A 4W82A 1U7HA 1LLCA 4MP3A 3DZHA 1HZZA 3LVFO 4AJ1A 4YWJA 4FGSA 4Q3AA 1AHHA 2NTJA 4JK3A 5A9SB 4BKOA 5I8WA 1PU2A 3PYMA 3RUAA 4L4SA 5F3RA 2OP0A 4D43A 4RPKA 4QUKA 1DFHA 3K31A 2BMAA 1ML3A 1WLYA 4E2YA 2E48A 3JQ8A 2UUPA 3KVOA 4MDHA 5T6BA 4DLLA 1QYWA 1BXKA 3AFNA 4ND5A 4CM7A 3MWDB 2Z1NA 5AXAA 2DVMA 5EESA 6LDHA 1LI4A 1L7DA 3MTJA 1H94A 4I9HA 3ENKA 2HJSA 2RHCA 4IBOA 3WNQA 4OKIA 4RQUA 3ZV4A 5LDHA 4J9UE 4AJHA 1Q2XA 4GAEA 4E3ZA 5JAQA 2BFOA 1T1RA 5CG2A 1YRLA 3K30A 1HDXA 5COBA 2XXJA 1PSDA 2AG8A 3GNSA 3I5MA 2Q49A 4CUZA 4J7CA 2AQIA 4AJ2A 1UAYA 3FBTA 2O48X 3QP9A 4NU6A 5KTKA 3GGOA 4BNFA 4J1QA 3H9UA 4QTZA 3C8MA 4HADA 4EGFA 4J4HA 1CEQA 1FDTA 3H7AA 4GMFA 4MINA 3NX4A 1I36A 4PRKA 1Y81A 5AXBA 4IZHA 1QMGA 3D3EA 9LDBA 2C07A 2V6BA 5L51A 3HFSA 3W4IA 3JQ9A 4A10A 3HUDA 3JQFA 1CYDA 3PIIA 2H9IA 3H9QA 4Z9YA 1DRWA 1I3LA 4Q9NA 3RC2A 3VH3A 4ZJUA 4MVJF 4M1QA 4IMPA 5H82A 2B69A 4FQ8A 1GL3A 2OZPA 2YV2A 3WGTA 3I6QA 4BQRA 2DTXA 4W7HA 3H5AA 1DJNA 1GFSA 2ZTLA 4E2XA 4UVEA 2NLOA 1JVSA 3ZWPA 1HYEA 2CUKA 2JCXA 3JD0A 4INAA 4JN6B 1R0KA 1FK8A 4EYEA 3LU1A 1FF9A 4RDHA 3CMMA 3M2PA 1P1RA 2D5AA 4PG5A 4YTEA 3AY7A 5F5NA 1DEHA 2A35A 1NQ5A 4OM8A 1CETA 1LNQA 5CAEA 4IGFA 2ZB8A 3N58A 3ANLA 4IS2A 2DKNA 4ZGWA 5GY7A 2AEJA 4PG7A 1I3KA 3A4VA 3DZIA 3N74A 1PS0A 4JP3A 1A5ZA 3OFSA 4BNUA 4PLZA 4CMKA 5I9MA 1V0JA 3LF1A 1E7QA 3G3EA 1ONPA 2GGSA 4J90A 1LSJA 4MKRA 1BXZA 2VUTA 1LXCA 2Q2QA 4E5YA 3BMNA 5GZ1A 3VC7A 4PG8A 3DBLA 1H2BA 3I4FA 4J7XA 4DQXA 1NPDA 2O2SA 4IDDA 4JBGA 4YT4A 5BR7A 1BW9A 1M6WA 4N54A 4XQEA 2NU9A 4XA8A 4OSPA 2VHXA 3VDRA 3D4NA 1SO8A 4E21A 4WASA 3S2IA 1BVRA 1H6DA 3GZNB 2P9CA 3AU8A 1K5HA 3H9GA 1N9GB 2YDXA 3KTDA 4L76A 4B7UA 1G1AA 2P68A 1GZ6A 1QRRA 1TT5B 4ZQBA 1F8GA 4D46A 3CE6A 5T64A 3PWKA 1T24A 2OBYA 3GPDG 1E3SA 3IP1A 4BMSA 2ILTA 1JQBA 1LRJA 4BGIA 4GVXA 1LRLA 3KXDA 1KBZA 2RIRA 1NPTO 4MVJD 1EQUA 3TF5A 2JL1A 4OXYA 4IS3A 1RWBA 3UICA 3WR5A 4MP8A 1P1HA 3L4SO 3LT1A 1UXJA 2BFMA 4YJGB 2WYWA 1UP4A 1P77A 1SPXA 4FFMA 1KEPA 1XDWA 2OMEA 2J5RA 3Q9NA 2EW8A 4E4YA 2WM3A 3TL3A 3GQVA 4O1MA 1VM6A 5EL0A 3KOUA 4GQAA 3MEQA 1A71A 1FDWA 4D41A 4R41A 4G5HA 1ZJYA 3KHUA 5JO9A 1WPQA 2P4QA 3TPCA 2WWRA 4KP7A 4RORA 2O7QA 3WB9A 1IULA 4BNKA 1PQUA 5L7WA 3D5QA 1DIHA 4OH1A 4F46A 5G4KA 4OSOA 5TF4A 4XGNA 3WQRA 4DUPA 1WW8A 1GU7A 1CERA 1CQIA 2B0JA 4JBIA 1SEVA 4OOEA 1GYQA 2GD1O 4GSKA 3DB2A 5DP2A 3S2GA 3EK2A 1VJ1A 1HT0A 1B8VA 2VNSA 5T57A 5JYDA 5ER6A 1LDMA 2A9FA 5J23A 1TT5A 5G0VA 5HS4A 4LRTB 1RM0A 3MZ0A 3BHIA 1MA0A 4XIYA 3RKRA 3IUPA 3ZNOA 2W2LA 1PJ3A 3AOEC 1LQUA 1U4OA 4WLEA 5A4DA 4CM8B 4EI2A 1O0SA 1Q7CA 4B3HA 1V3VA 1BGVA 1K6XA 3RUDA 1I2CA 3X2FA 3OJFA 1J4AA 2IYOA 2AQ8A 1MG0A 3I52A 4I8XA 1RM4A 2NQ8A 3E9MA 5DBFA 3F6YA 3PPIA 3TZKA 4DPKA 3U09A 2UDPA 1B15A 4TMFA 3TOZA 3RWBA 3B70A 2UUOA 1L1FA 1N5DA 7ADHA 5JY6A 2DLDA 1LSUA 3E5RA 1HTBA 3DO5A 4R5HA 4AJNA 3ZWWA 3LK7A 1QV7A 4RLSA 4B8ZA 1YBAA 4QX6A 1HSOA 4RF4A 4XZ3A 2HMTA 2BI7A 4D0SA 1DHTA 1A4IA 2Y0CA 1UXIA 2O50A 4OO3A 5A3JA 3B20A 4Y9DA 4XCVA 4RVSA 2VCYA 5IG2A 3D4OA 4GVLA 3RUEA 4BNIA 4CQLA 2X0IA 4Z6KA 1XG5A 5L7YA 2OOSA 4FFOA 2VWQA 1HE3A 3I4CA 4WJZA 3NT2A 1VSUA 3DTTA 2HK9A 4Z0TA 1GCUA 1U8XX 3FN4A 3HN7A 4YBZA 4A0SA 1E3WA 3ROKA 1W0CA 1U1IA 5DULA 4ZICA 1U5AA
chains in the Genus database with same CATH superfamily
2DFLA 2Q5CA 1ZD3A 1RKXA 4AJKA 4CKYA 4B79A 5FLKA 5AM0A 4C22A 1F2TA 3AGPA 3PYLA 3FWZA 1L5ZA 1Q11A 2GEVA 2I1LA 3QMPA 4MQUA 2H16A 1YZFA 1S3FA 3KZ1E 3OHMA 4BFWA 6AT1A 5JHHB 3NPAA 1Z6QA 2O1SA 1CRZA 4PPQA 4Q4JA 1IZ8A 4QJ5A 5CB4F 1FDOA 1A4UA 1GPYA 2IDKA 1JG4A 4PC6A 1YC2A 5ALKA 2VHJA 4LOJA 1YRYE 1CQPA 1DTSA 2ID4A 3LQQA 4PQGA 4OQYA 3L6BA 3WV4A 1RXVA 3DVAA 3T95A 4D5EA 3AF1A 3G2PA 5DISB 3ZUGA 2CMGA 1N0UA 2W2OA 5IK2A 2NPFA 1QWSA 3LUDA 1OASA 4BMVA 3VPFA 2VF7A 5FCDA 4J16A 3WMXA 4DMFA 1I8TA 2CK3A 2VSQA 4CEJA 1A8QA 3BDAA 3WSTA 2YV3A 5AUNB 2V03A 1T0JB 3ESYA 3WY9A 1VCIA 3JAWB 4LYFA 2AV6A 5HYVA 1JDJA 5BNWA 2I9PA 2CXQA 1YI1A 5E7MA 5FNZA 3SZUA 3UXMA 3W6UA 3LSYA 2VTVA 1BROA 1P9NA 5CIWA 4TKUA 4AUKA 4DIOA 3U2QA 821PA 2VK4A 3L0YA 5D3ZA 1C9NA 3C1TA 3NXKA 3R3UA 3CUEF 4OQXA 5HW0A 3HSYA 4DWWA 5JWOA 2M9MA 4DEVA 2C3YA 4D8XA 4GGOA 1UKZA 5JAIA 1J00A 5LSAA 2J32A 1QDEA 3OZEA 2UKDA 4E5PA 1NNLA 4RVHA 2C2WA 5DT9A 3QLVA 1DADA 3ZD9A 3EVZA 5K6AC 3G1WA 3T1HB 4O4IA 2C1ZA 1OIWA 4FHCA 3KV3O 2FSGA 3B9QA 5A5FA 5ETJA 1F7UA 4Z1MD 1C30A 3FA2A 3KD3A 1PK9A 3ZE6A 1BX0A 4EMSA 3QIVA 1FDVA 5IBCA 3OJLA 2FRXA 3K2EA 4BATA 4INOA 4BNLA 5J4LA 3FCCA 2NQ2C 5DLQC 3S7ZA 4HSEA 4B48A 1Y4ZA 3VU0A 4EMBA 2WVHA 3V48A 2RBGA 2FU5C 3EDYA 1LJLA 3ZGYA 3C4VA 4KWEA 4B5LA 2ODTX 3WJ1A 2MINB 3COZA 1FU4A 4N1AA 1EINA 1Z0AA 1C7JA 1KJJA 1VBMA 3NYRA 4HMPA 4Q3LA 3U44B 3B78A 4UXIA 3ZCVA 3OD1A 1AKEA 1FS4A 2NO4A 2RHMA 5KYYA 1TYZA 1YOBA 4DDWA 3QVWA 2WIJA 4ALMA 1IAVA 4RHXA 5FIUA 1W96A 1CK4A 2WBLC 1NSYA 1W73A 2HQSA 1N6NA 1NQOA 2PPLA 2WJWA 3QEMB 4BKPA 3K73O 1SOMA 2CVPA 4ZYZA 2Z5VA 2VHEA 1SA0A 3PSAA 1XVTA 4ES6A 3U3XA 1ORRA 1F0NA 3I5AA 3KDPA 1YQDA 2I6FA 2VT7A 1QIIA 1QG6A 2Z5LA 3HUUA 2JFHA 4HC4A 1ETUA 4PX3A 1MJHA 2EZ4A 1TQ2A 4FFLA 1QK5A 5KVVA 1MAVA 1NVMB 3MCAA 4KAFA 1ZK0A 4KE9A 3UXEA 4ER0A 4ZAVA 3WO0A 4OL0A 3T7KA 2O2JA 5IH3A 2JBWA 3NFYA 3S40A 4AYWA 5BW8A 4D8UA 2P2GA 4QUIA 4TV8A 2IZ6A 5IU6A 5LP6F 3ETCA 2DFPA 1XN4A 3WJ2A 4R4JA 1UDBA 3BTSA 1VHWA 2SICE 3SBDA 2G5CA 2C9DA 3PJRA 3VR5D 2X5KO 1UT8A 3RO7A 1BXGB 1RCTE 4BO3A 1P2BA 3OFJA 4LG1A 1G2PA 3Q1KA 3UFXA 3UPUA 2IH2A 4PBRA 2HYDA 2GCIA 4MICA 3RBZA 4DIDA 3S1SA 1R6VA 2DRIA 2OZVA 4MGHA 3KL2A 3MS7A 4ZODA 4XARA 1RLIA 4LOKA 3RABA 2IKQA 3D81A 3F78A 4W1SA 5CDFE 4IL5A 4C08A 4E22A 3ZVLA 1VI2A 3HLTA 1WY5A 2IXEA 3LL7A 4YA6A 4BLUA 5CDUA 2FDCA 5KQGA 1EWQA 4WXMA 4RZ3A 4HGNA 3CB2A 5T6MA 1HOTA 2FJPA 3TOXA 2GERA 4EK9A 4BFVA 3BH7A 4UZFA 3O8OA 1N33B 2J3IA 4J0FA 1Z4IA 2CXPA 1WZEA 1YBVA 2OM2A 2WD7B 1WMDA 1Q12A 2NV0A 3DR3A 4IIHA 5ES4B 5TMEA 1PKEA 1CUSA 2I7DA 3FDJA 4WINA 4RSHA 3GLIB 4KQFA 4MA5A 2MINA 2FXIA 1KH3A 4PCLA 1PR3A 1ZPDA 3AI1A 3RT7A 2ORIA 2P0EA 4TUYF 2FW1A 2JI9A 4UTRA 1OBOA 1C4OA 2CFSA 2L0XA 4JOSA 4TL6A 1Z3IX 1I4WA 4BMXA 3H97A 4C0XA 4FFPA 3TZLA 1CLEA 2J0SA 5DEIA 1V5IA 4JROA 5EE1A 4EGQA 2AQKA 1VYTA 2YJTD 3LF2A 4NR0A 4U0KA 2WJAA 3PK0A 2YVUA 3NUGA 5T4EA 1QO0D 1DU4A 1SIBE 3DE6X 3PX2A 4DBZA 2W2QA 3E9NA 2FFBA 3C8DA 1NQAO 3E8XA 1AUXA 4P2GA 2EDAA 4KDEA 4UCXA 1Z16A 2H1SA 2P0AA 4QYTA 3TLCA 5IS2A 1YL7A 3AVYA 3AZQA 3LDUA 2X1LA 3PNSA 3U61B 2EQ5A 1BHO1 3E4CA 3JQAD 2WSSD 1DIGA 2I22A 4QOJA 4TMVA 2FQ1A 1EJ2A 4XDHA 5CCDA 3CISA 4EHBA 1T25A 2JCYA 2VPTA 4ZMRA 1O6BA 2QQGA 3FBGA 5KQPA 1H22A 2YY5A 4J76A 1ZZEA 1NV9A 3K9QO 1NNUA 1IXYA 3H8JA 2HXGA 4TL7A 2N9UA 5TJHA 1Y6FA 1YT5A 1QB8A 2EEZA 3W6ZA 1I7LA 3OPYI 2HQOA 3L8FA 4X8OA 3EW7A 1XOIA 1Z0IA 4BQQA 3G5MA 3HBFA 5ARBA 4NYIQ 1B6RA 3ZV3A 3A1EA 4JJKA 2YZ2A 3AF5A 2C03A 4TM8A 3FOZA 3CXUA 5A2GA 2V0NA 3G88A 2GKSA 3HI4A 3F6SA 5CDHA 2HW8A 3ONDA 4BAZA 2BAGA 1IJKA 2A1IA 2X8LA 2JASA 2ZDGA 3EUAA 3ZU6A 3DJFA 4MYSA 1L5YA 1LY1A 1HF3A 1QZZA 1ZI9A 3QV2A 1DO2A 3QZUA 3O74A 3PUIA 4ZEWA 4AQDA 4DDKA 1JIXA 2Z2ZA 1FVHA 5FYDA 4C4RA 3LY7A 3OCCA 3VUEA 3V8MA 1H5QA 3AJ9A 3U9LA 4DLWA 4GBJA 3ZGXA 3ZWMA 5IFLA 1YONA 1H8HD 3FR8A 3GLQA 5KNCD 1EA5A 4YRMA 3IEMA 4HAYA 1CY7A 1HGXA 2YZMA 3P94A 4X1IB 4ZP1A 5EP4A 4BCCA 3KZCA 4JSTA 2YHUA 2CNOA 2IE8A 1F5NA 1H93A 3EXHB 3L1HA 4FR5A 1R0LA 4OHYA 4F3NA 3I9NA 1IY8A 2MIIA 5EZYA 4FDLA 2CFTA 3PD7A 1JQDA 2PV0A 2VEDA 4K87A 1IWBB 1U9IA 1Z4LA 4L08A 1UUFA 5CXXA 5HJ7A 1ZK3A 2Z56A 4V1CA 3MK31 1ZD4A 1OYWA 2O2IA 2V7QD 5CVTA 1E64A 3SDZA 1N6HA 4X3OA 2AJCA 2RGYA 4KGZA 4FMDB 1FJGB 4WUTA 3EBPA 2GPTA 3DW1X 3W9SA 5EXEA 4LHSA 4UPVA 4RANA 1Y4DE 4G36A 1JMVA 2D3WA 2RJOA 1A9SA 1E5TA 5DM60 1ZY2A 4D3FA 3QKIA 4BV8A 5L3VA 2XF2A 3GCDA 2O8BB 1P2TA 5BSVA 1T2VA 1NNEA 1ZOPA 4XD7D 1H2YA 2GZMA 1HZJA 4G63A 4PGGA 1GUFA 2V7TA 2Z2JA 4TRJA 1WF3A 2QLJA 2VRCA 3FIUA 2WWFA 2R1TA 3PCXA 4HO1X 2DUNA 1U3TA 3F2IA 5A3SA 4JQCA 4LJ8A 4AZWA 3V1UA 5KJ1A 1ZVKA 1EFAA 2A57A 1CRQA 1E3WB 3OY7A 4LRYA 5AOVA 1UR5A 4ZKEA 4P1ZA 4DZTA 2J33A 4R8SA 5HM6A 4S1WA 3EFHA 2G7MC 2VIIA 3KS9A 1Q50A 2Q5HA 1P5RA 1KI1A 1ZVMA 1G7RA 2YJ5A 1V71A 4RL6A 1Z8FA 2AWNA 3AIKA 3I6ZA 3LY5A 5AJVB 4O2AF 1GY8A 4D8WA 3T5PA 3GMDA 4IGEA 4Z9BA 1BHSA 1P3Y1 5G0SA 3OOEA 1ZNXA 5HBRA 4P93A 3J81A 2I76A 2NW6A 1C81A 4GPIB 3JARA 4P58A 1O95A 2WFAA 5ISMA 1E7MA 3A1TA 4QHTA 5EY5B 3CF0A 1AKWA 3KLBA 2ACWA 1CUWA 3GV0A 5H16A 3AB3A 1T9CA 4DCCA 5HOEA 4ZJZA 4D4MA 1UBLS 1R4NB 2BGIA 1PZMA 1BCSA 4LXYA 1I4LD 4RD6A 4BV3A 4I5DA 3ESDA 4Q18A 3RE1A 3OD5A 3REQA 4IPTA 5FBRB 4LA4A 3IC5A 3RS2A 3COVA 1W36B 2VK2A 3FUTA 1KYZA 1RWVA 3KQYA 5KOIA 1A88A 3B1VA 1WOYA 1GUAA 4IVPA 4TS4A 3NTVA 2JLAA 4NXNB 3EASA 2APJA 2BBTA 2GN8A 2WMDA 1ISJA 3L02A 3MA0A 1GVHA 3IMGA 2WLTA 4RX1A 3RS7A 3FNGA 4AUNA 1T4CB 5LOVA 1LS1A 1KQGA 3NDIA 1KRWA 2NWQA 4DA4A 2J6IA 2XGOA 3DG9A 3LUFA 1D4ZA 3FVQA 4M3NA 4P5PA 1XZLA 5AOCA 3VDXA 1SQ6A 3GFSA 1JJBA 4KWTA 4PYMA 2O8BA 1WWKA 1OKKD 4DRXB 1T2DA 5C4GB 3ZV7A 4UAGA 1Z0SA 2PX4A 1WQ3A 2VQDA 4CMGA 4WY5A 4TTPA 1ENOA 5LN1A 2CF6A 3A11A 2CJPA 3ZQ4A 2IW1A 2JD2A 3I9V6 4FHGA 4ZI7A 1B2LA 5FPYA 3WGNA 1VLZA 1VYVA 1XLVA 2GUWA 2Z2XA 4CTKA 1D6NA 3UOWA 1XALA 2D4HA 4A2PA 4N76A 4KYUA 1W35A 3N2LA 2IU4A 4ID9A 5FWYA 1ZK2A 1KU0A 1P7WA 3KZVA 5JMWA 3L49A 2QRJA 1IU9A 2A9VA 2V7GA 3MOIA 2HO4A 3FPJA 2OHHA 4KI0A 4QGAA 1LTQA 3AKDA 1GG5A 4MO9A 4DR2B 4ACAA 1ZHHA 4Y6LA 3DOOA 1RW4A 4X9XA 1QYCA 1J1ZA 2F1JA 3SQOA 2IUYA 1P62B 3TQTA 4EYQA 5G40A 1YUBA 1IZZA 1V48A 2QV0A 1FXWA 3OU6A 2XLCA 3E7WA 5CK4A 4D8TA 1M34E 3IKVA 3STWA 3MCZA 4UVHA 3L0CA 5ALMA 5E7JA 4JOQA 3O8QB 3X2SA 3HNOA 2VPWA 3F6BX 3RGGA 3WLFA 1U0OC 4FONA 3FNHA 1MO2A 1PR5A 1Z4OA 1YK0A 4H16A 4NMWA 3WK4A 5TNXA 4GOKA 4GYYA 2X77A 2IY7A 5CVCA 1JIUA 4ARSA 1TMOA 4PFQA 1CQXA 1EIZA 2FXVA 3LBHA 3ZDXB 4J2TA 3A31A 4MOWA 1JP7A 1UBOS 4ND6A 1C5KA 1JKMA 4NCJA 3UKDA 1P61B 3EGWA 1GR1A 1M2NA 1W5AA 2G07A 3AQIA 2XA1A 4C6HA 3TOCA 4K0KB 2ZRAA 4IFBA 5PGMA 1W93A 1XJCA 2QE6A 1IM8A 4X94A 6Q21A 1R74A 1S4MA 4X90A 3SQXA 2ZBUA 1J9GA 4TTVA 2QTMA 4BLVA 2BP7A 1EBBA 3GAMA 2BY4A 4OUDA 1NKVA 2ZUBA 4GM0A 3UMCA 3UMYA 1IN6A 1WP9A 2YJ3A 4ARUA 1MH1A 1NL3A 3PC3A 2J3EA 1T5SA 1SVIA 1XZDA 1IZ7A 3OZCA 4R51A 3F1KA 5JSQA 2JIZA 3ENWA 3CWZA 1EESA 1UMCA 2FJ0A 4IEEA 1TKAA 2CXXA 4XB6B 4TOIA 3WKDA 3ZH9B 5JCJD 4WLNA 4DMMA 2J3KA 4YN3A 2W6ID 3MT8A 2BW0A 2PS9A 3W5BA 3FGOA 2RHWA 3FOCA 3JZAA 5F23A 1JHYA 2WYUA 1P6QA 1LDYA 1CUIA 1SHZA 2GILA 1O4VA 3N3AC 4G9GA 4U00A 1SBYA 1CNMA 3BGIA 2VBIA 4YRDA 1TZBA 1YXMA 2BE7A 1RXUA 3CFYA 2ECKA 3OFKA 4FOSA 4HTFB 3ET4A 4UNPA 4W8GA 3WLAA 2GR9A 4YUAA 3QKRA 4GT1A 3B12A 2JJ1D 2H0AA 5AXDA 5JD3A 2HPHA 3M6FA 4MQMA 5HBGA 1UK8A 1V16B 2Q5IA 2GXQA 2X4GA 5LDGA 4DKXA 1M74A 1J25A 1VI5A 1P5JA 4AVYA 4DYVA 4OUDB 4TUYB 4RA9B 5JHGB 5AW0A 1Q0RA 3TGLA 4J03A 1SCUB 4KWCA 3ZTTA 1EHIA 3N1UA 3CR7A 3OESA 3OZIA 2VTKA 2QR2A 4XGIA 3SR0A 2BGKA 1DPGA 1R27A 6GPBA 2V3WA 1H2HA 2CZQA 4DA9A 2M6RA 1QLJA 1R18A 2IYRA 2IVFA 3MLEA 3FRJA 4CF6A 4FXPA 1FMCA 5GM2A 3THOA 3D0QA 2ZPTX 3IOMA 6ADHA 1YDMA 5JNWA 1UWLA 3LL4A 3LJKA 3RI3A 4RHYA 2G28A 4C30A 2Y9PB 1KPIA 2PLNA 1Z22A 1P9WA 3WK8A 3BIXA 2DQ4A 4CKZA 2DBVO 1ECBA 2CL7X 3OC6A 1TC1A 3NDPA 3DHVA 3KTAA 1H0KA 2X3UA 2D7DA 3X44A 1GL9B 4A8TA 1XZ8A 4Q4HA 5AUPB 1E1QD 4DSAA 2AUMA 1JHQA 2GI4A 2Q27A 5EPEA 4CM5A 4B82A 2X2OA 2B8TA 3EXEA 3G2OA 1OWMA 1X80B 2RKOA 4FNOA 4JNCA 4U6NA 3EIFA 3QKSB 3RNLA 3I05A 5AK5A 3HV2A 4WZ6A 3K8YA 4RY8A 1XJ0A 4LTDA 1RQPA 4CGYA 2Q4OA 2BISA 1P6XA 3DHYA 2PGOA 3TLBA 2D06A 4BWGA 2VUHB 1W6UA 5D84A 3G2NA 4H7FA 1U2PA 4DREA 4U2FA 5HNKA 1JSZA 1XTQA 1JR3E 2C20A 3R5FA 3VI3B 3B52X 3AR7A 4FEYA 3K0EA 3A32A 7GPBA 2ODBA 2XH8A 1YQTA 2JAWA 2XODA 4LXQA 2YWXA 1E1LA 2C5BA 1O5OA 2XOXA 4G25A 3WFIA 3VPHA 2C8KA 3AM3A 2OZEA 1CE8B 4UE6A 4B74A 2J5XA 5JXHA 1FFYA 1QHHA 2ZJ6A 5DP1A 2ROQA 4XW2A 1WQ4A 2XZLA 1GZHB 5DTQA 2NUAB 4FBGA 3QUCA 3K9NA 1L4BA 1IM2A 3JR7A 2VTEA 2D8MA 1I6WA 3DV0B 1I2MA 3HYTA 3I01A 4HXEB 4OHRA 2QMHA 4TKMA 3LXRA 3IEXA 3SS8A 2ZT6A 5G0TA 4QXOA 1MW8X 4XPIB 3HM2A 3NQ41 3ME5A 5CNKA 2AMLA 2R5FA 2DY1A 1E1NA 1TM2A 1ZITA 1G20E 2QTFA 3R3XA 1G64A 3WL4A 2HAEA 1A72A 1QDLB 2WOOA 3CKYA 2BV3A 4J7UA 5LUBA 1XZHA 4AF6A 5K1ZA 4ZVTA 5IN5A 4IOLA 1KI7A 1U7ZA 2AGVA 4LVNA 2ZRQA 4QGSA 2UZ0A 4MITA 1J49A 4ZARA 1A5TA 4CMAA 1KKUA 2A59A 3AM4A 2ZETA 4HWGA 4QFBA 3WBBA 1Q7GA 1R6TA 3G0IA 1EWRA 4P86A 4KHPB 3KKQA 1SOAA 3OM8A 2P40A 1BCSB 1RYDA 3ORYA 4NOMA 3AFIA 5LU9A 4LNAA 4Z1MA 2CK3D 1GL7A 5A03A 2KW5A 4IHKA 1GLNA 3E5MA 1QHHB 3V1KA 5IDXA 3USES 1RHJA 1JKFA 4L8LA 1H42A 3QU4A 2R47A 5HPYB 4S2UA 3PB3A 2ZJ3A 3NAZA 4AG3A 4B7XA 2FK8A 1XXHB 1PSWA 2JK0A 4NNJA 3RHSA 4PBSA 2HU5A 4BQOA 4CN8A 2JZCA 1HQKA 3T3IA 5JDIC 8MHTA 3S3TA 2R1VB 1UKAA 1OHHA 3CINA 3IURA 3IAHA 4DCUA 1Q16A 2WHXA 3G23A 3S2FA 1TTTA 2ASVA 2MYUA 4NHOA 1W9MA 2ZE7A 3BVPA 5BVHB 2EJTA 4U7JA 3UCEA 3KK0A 5AJYA 5F2NA 1JXOA 2AH5A 3EXG1 3KJQA 1KPGA 1UKBA 4Y9UA 1N9ZA 3OOJA 3OX3A 2CVZA 4Z86A 3RSGA 5JVDA 1O4WA 1XP5A 1XVVA 3NUZA 3OZBA 4BMOB 4F7DA 2IHVA 1BJRE 1ZU4A 1U8UA 3AHHA 3OEHD 4Y2PA 5JH7F 1PZXA 4X95A 3W3AA 4Q4HB 4JJ8A 1F38A 2JCGA 3E3NA 5BPFA 1BX1A 2C2MA 3LO5A 1JDBB 2QY6A 2YWHA 2NYAA 4D82A 4DJJA 1YOVB 3A6GA 3H16A 3DMPA 3PA8A 3L6DA 2QVGA 3MJDA 3OPYB 4IJWA 3ZEIA 3ZE8A 5JASA 5TIIA 3JASB 1U0JA 2EERA 1U6IA 3K20A 4G5YA 3NHZA 4JHXA 5ICMA 2JANA 3A6EA 1PFVA 4QC2A 4CIDA 5I3ZA 1LBIA 3LPCA 2WWYA 1YL6A 1FNDA 3PCTA 1Q84A 4R8VA 1WAMA 3HL4A 4O4IF 4B09A 5B58C 2H1OA 3I04A 3IODA 3SS7X 5BUZA 3ZWXA 1VBNA 2AOXA 2KSQA 4HLDA 5HKBA 3VU9A 4EKDA 2EG9A 1QPBA 1Z33A 5I7VA 1PNQA 2OB2A 1QRTA 4H15A 4CW7A 1HL3A 1A95A 1LDBA 2AN4A 1YUMA 1GGFA 1L7QA 1HM5A 4YUVA 4RZHA 2IWRA 1NVTA 2P4EA 2HF7A 1V8ZA 1Z08A 4K9PA 4AS3A 4DA8A 4DSOA 3OI7A 5GWXA 4OQPA 2ZRDA 4B4OA 1E96A 5C7YA 4D44A 2YZ7A 4AJ9A 4KO3S 2FR8A 1IZYA 1WXQA 1JAIA 3AINA 3E2IA 2D2EA 4YT5A 4LX8A 4RJKA 5HRAA 4OHZA 4BB5A 5HZMA 1AKVA 2BMDA 1ZS9A 1UBSB 4D8YA 4NECA 1E2JA 1R15A 3RIGA 1MVLA 4B3FX 3QWAA 4ND1A 4G9BA 5TQVA 4CN9A 5BMVB 3BQNB 3JQAA 1R37A 3MELA 3KFVA 1X7WB 2FEOA 2GHIA 3MGCA 4KQGA 5BQPA 1NXTA 3W9UA 1RYBA 1V96A 1KJZA 4EB0A 1XIVA 4L27A 4N82A 3VR4H 1DBVO 3NCHA 1FIUA 2RH9B 2QQ0A 4NX2A 4UNIA 3U6KA 3LYHA 2F3QA 2PT5A 4E70A 3LC1O 3OEWA 1NUTA 4UFNA 3S1AB 1DFGA 3E6AA 1AGXA 1PT8A 1WB6A 1MU0A 1EJBA 1E0DA 5FI1B 4EQZA 5GINE 5FUBA 2VT6A 4PVCA 1OH7A 1CG6A 3FUXA 1Z0UA 2R8BA 3JZFA 3T9FA 4OV6B 1ZLXA 1TTPB 1ZW1A 4BNGA 1M0TA 3VC2A 4M8IA 3VNQA 5AVKA 4KR3A 2IBMA 4ML3A 1JYFA 4DIKA 3ACBA 1EVJA 4IP0A 4JUIA 4DMLA 4E15A 1ES9A 4FPXA 3WLQA 3GEGA 3MWEA 4B35A 1I2BA 4M98A 4CT4B 4Z7JA 1VFNA 4NENB 4B3GA 1R0XA 5CEEA 4MKHA 2ZUFA 5EXPA 2E5FA 4RK7A 4D81A 3I53A 4BYMA 4GDFA 3UCFA 1KO7A 1EXVA 4TYPA 2QN1A 3PHLA 4M1ZA 4TL9A 2QQEA 5DLEA 4DMHA 4KYVA 2NVOA 1SCUA 4MWEA 3KQHA 3T0GA 2FDXA 2Q45A 4HDNA 2I7CA 5ADUS 4LSMA 2J09A 3MAJA 2GUGA 3C7KA 4GXQA 2CB0A 5AKKA 2WUFA 1WHSB 3U3ZA 3B7WA 2ES4A 3DZJA 1GO2A 2CZGA 1K6MA 5G4KB 3H0CA 3TXYA 4OLBA 4TYNA 3E2MA 4HLCA 1HE5A 2D2XA 1DDIA 3SVTA 1JMKC 2WM2A 2BR3A 3C5EA 5DYWA 3L8CA 1UAAA 2WSIA 1QB7A 1GA4A 2Y1WA 4QPCA 1CF9A 1UZUA 3EXIA 2O2XA 3VPDA 4Z4CA 1CW2B 1DAIA 2OZLA 2Q6OA 1QQTA 1E2HA 2WICA 3IQIX 3NBKA 4YJ2F 5E2IA 2RHOA 2V9ZA 3GH3A 1KKMA 1JFSA 1C4KA 1RBYA 4FYMA 4TSFA 4BNDA 4PNEA 1JB1A 2FLVA 4G2NA 1Y89A 4ZQIA 5LR6A 1X92A 2LXNA 1CQJA 2VQSA 3ANTA 1QMPA 2SCUB 3D8RA 1CZHA 2AZDA 2Q4RA 2WDZA 1WEHA 1ZN9A 1FRVA 2IS2A 2C84A 2C82A 4YAGA 3ZJ4A 3T9EA 3V34A 1CY8A 3CVJA 4O2LA 3AL0C 1UOQA 1A77A 1QHGA 4CV1A 1YRQA 3CF6R 3KTOA 1UBJS 2J8ZA 3GJ6A 2H06A 5EHGA 1AKRA 3KKPA 3UH1A 2QZSA 1K0UA 3ZIAA 1VG8A 1UJNA 3VPXA 5EJ7A 3V3KA 4YRSA 1K66A 4NQRA 2O8FA 1E0SA 1EK6A 1C8LA 1MJGM 2C5AA 1HV8A 3C3PA 5BMVA 1YHNA 1A04A 1E60A 3PGA1 1VKJA 4TWZA 2ID7A 2Z6AA 4CMBA 1I9CA 1WR8A 1B4DA 1EPUA 1RP7A 2ODPA 1FUUA 1VGQA 1A76A 1D2HA 2LIVA 2ZBEA 4G9EA 3UFXB 2X86A 3TECE 1IBKB 4BFCA 1OFGA 2P62A 2HO5A 2IODA 4H6XA 4J3JA 3INGA 1XMJA 4MRNA 1OTYA 1LSSA 4NV1A 4OHXA 4MR9A 1KXZA 3RIYA 1ADCA 2OGWA 2VRBA 2ZSJA 4N5LA 5FXMA 4LHXA 2XMSA 2XOKA 2H65A 5EEHA 4I7EA 3IAM6 2VN8A 1UIRA 2XRMA 2GA9A 3WIOA 5TLSA 3U3KA 3IAAA 1NBHA 2ZUEA 2HU8A 4BO1A 1KERA 2ESRA 1DX9A 3FMPB 3AEYA 1T1GA 2D54A 3DAOA 3FTQA 4MUXA 4ZQEA 5DTIA 3SAJA 4I1PA 4YJ3F 4IG9A 2E55A 3NHAA 5DE3A 5JADA 2E9SA 2VT3A 3F7NA 4AZ0B 5FOQA 3JYOA 4A6EA 5I7SA 1OLXA 3EDCA 1MVOA 4HLQB 4H35A 4LMRA 1O95D 3RJ5A 1CEEA 4NCXA 3S29A 3ZKWA 2PGLA 2PL9A 4L4RA 1M34B 4MVJP 1UFKA 1FMFA 2XKJE 3ZY4A 5CNMA 2G80A 4BE4A 2XUJA 1GG9A 2Z2YA 3AJ8A 3L7NA 4IWXA 1U9YA 1HFEL 2PUHA 2XNJA 4GPD1 4ZQHA 1ZSVA 3EXHC 3RS4A 3BTUA 4WFQA 3TCKA 1JNXX 1OXUA 2TS1A 1VHDA 3JD1A 5LD2C 1AT1A 2NZUG 4PAGA 4PLHA 3F6PA 2IEAA 1XZJA 1BG6A 4QM7A 3C4QA 4EITA 3ROTA 2O07A 3WIBA 1P1FA 4F3YA 2B1RA 4BO8A 1E1KA 4P32A 2Q0SA 2RH8A 5DGTA 2I4IA 2HJ9A 5JMPA 4MQ4A 3F46A 4WN3A 3R9XB 3RYCB 1BCRB 4NZNA 5IF3A 1JR2A 3DMYA 4WXEA 4QM6A 1JHPA 2WFLA 4FDUA 3Q88A 1XCGB 4KGVA 1K88A 4EB8A 4H9GA 3AY0A 4CMHA 2PD4A 1AV6A 2G67A 5F5LA 2DPGA 3RJTA 5AFSA 2FZCA 1IBLB 2HR1A 3EE6A 1RWOA 2W4QA 1R8QA 1Q0QA 3H65A 1CIJA 1O9GA 4N9QA 3WRWA 2OO5A 1P81A 1MQAA 4G86A 5EAIA 1ORTA 4MGIR 1H3EA 3OQ1A 1U5BB 2GZHA 1UZAA 3I0MA 1M3SA 2K5UA 2WSBA 4Q05A 5TR9A 4H4EA 3SBOA 5KQRA 4LXTA 1ENPA 1A5SB 2PWZA 1WU8A 1Y6QA 2WIKA 1E1RD 3LUKA 2OB1A 1JSLA 2GYYA 4NI5A 1BD3A 2VKQA 4Q1AA 1MB3A 3ER8A 1L1QA 2D3TA 2W4IA 3EDMA 3ELYA 1XKTA 2AG5A 4MUAA 1OTHA 2J9FA 2PWYA 4XCQA 5CT5A 5BNZA 2AK2A 2HCFA 3ZHQA 1SQSA 2NUPB 2GKOA 1SVNA 1Z26A 4M9UA 3IO5A 1E6UA 4HNQA 1W47A 4KI7A 1M1YE 1I10A 3EWNA 4RE6A 1FVXA 2VH5R 3ENNA 3TLMA 3LQFA 4OB8A 1XQYA 4FOTA 5J3JA 4HF7A 1B16A 4GIBA 4ND8A 1WRBA 4NE2A 4IFTA 3WK9A 1GTMA 1PZGA 3Q41A 5AK4A 1PEDA 1XAIA 4DLNA 2BFEA 4PSAA 4Q9AA 1X9GA 4G07A 2H7VA 4U3JB 5CFRA 4IVNA 3S28A 2I78A 4E94A 3LT5A 4P4NA 4EY8A 1VIAA 3JQFC 1JWAB 1L4HA 1WXEA 2C3PA 3ZVNA 2ZSIA 4PV7A 2EC5A 2HB6A 3ELWA 4WCFC 1PK7A 1HT1E 2FWBA 2K4MA 1L8OA 3DCIA 5KMGA 4YHHB 4G6ZA 1A9QA 1Y0BA 3WLSA 1X74A 2OPBA 3ESXA 4N8SA 3FVRA 4O4JB 3RUCA 4C03A 4YPVA 3UHFA 3O9MA 1BMFD 3HCCA 2H07A 2VZ0A 1AURA 3TPZA 3R9XA 2GCGA 3N2YA 1MO6A 4EL0A 1DG9A 3BXEA 2YOFA 2BJVA 3SMVA 2N42A 3UWDA 4ZEMA 3H18A 5DLDA 4F4DA 1BE6A 1I7DA 4GI7A 5FL7D 2Q6KA 4EJSC 4J49A 3KB8A 3O91A 3QKRB 4YO8A 2VPXA 2ZDQA 1YR1A 4KBGA 2C04A 2XWSA 1IOLA 4WZAE 3AHIA 5AW6A 3WLIA 4ALJA 3EG9A 4BP3A 1KC3A 1LPMA 4AFNA 4QT0A 4ZI7F 3OHPA 5B1YA 4JASB 2FWNA 1ZVVA 4LCBA 5C37A 3CM0A 1KZ9A 3NS7A 1CUYA 1T9GS 3EW9A 2NX2A 1ZH2A 2CXNA 4MHTA 4KPEC 3C4JA 5AJWA 1DL5A 1QE0A 1EFVA 4N9WA 5K45A 2JIRA 3N2ZB 4JVOA 4YP7A 3DE7X 3DTNA 4FEAA 4JLBA 3LPMA 4TS3A 4C04A 4QG3A 2P5SA 1FYWA 3I12A 5FBWB 1X8KA 1L5FA 1UBTS 3MS2A 4UJ5A 3ZU3A 2D1RA 3JCZA 2ZT7A 2HBYA 3X1ZA 1DOHA 2PX2A 1QP8A 1V4NA 2R8EA 4RW0A 4AJ4A 4WKCA 1G2IA 3U5TA 1I2DA 1UJBA 3HSSA 3L4BA 5A06A 5MGBA 1BS9A 1KJYA 1KMHB 3H13A 1UMDB 5C34B 4TN5A 2B3DA 1YTLA 3H11A 2QKYA 3HBNA 4LDJA 3IS3A 2C94A 3PRYA 4MCAA 3RVSA 4B6PA 1I5EA 2R11A 2R25B 3QU9A 1FW8A 4RD1A 5JTTA 4JFAA 4EJSA 1K5GA 1Z38A 4J3NA 2E85A 3U4QB 3OEYA 3V42A 1K8YB 1S89A 1M1YA 3SYNA 1E98A 4RD4A 1R64A 2W8BB 2ODNA 1ZEJA 1JHDA 3LG2A 2DHQA 3C48A 1REQB 3GJ0A 1E9DA 2X0FA 1STOA 4OLAA 2O2YA 3SX2A 3QF4B 4BQFA 2B5VA 1CUVA 3WHIA 1NFQA 3SR4A 4F91B 3H9CA 1QZUA 3QFFA 4YXFA 1ONNA 3B9RA 3KQVA 2OHIA 4C6SA 3QX7A 3UV7A 1U6JA 4ENTA 3TCXB 3V33A 4GBMA 5JC8A 3TJZA 1P9OA 4D9MA 3TW0A 2AR9A 1ZAKA 5C18A 3P26A 2BEUB 3I3OA 4TVSA 2GN6A 5H68A 4BAUA 5LIPA 4BXOB 4RU1A 1G8SA 1TEXA 2YMPA 1XWFA 4RGVA 5KKAA 1L7EA 4NJEA 4TLBA 3WWDA 4U2BA 2AXNA 1G5PA 1HZZC 1R9MA 3M5DA 2REQB 3CG0A 3L01A 1P31A 2DUUA 4ZOBA 1NTOA 1BOOA 4FU0A 1S8AA 5CCXA 1E3DA 2EJCA 2IGBA 3QPBA 4CQMD 4DC1A 2YQ5A 2W2KB 3M33A 3PBKA 3UENA 5LYYA 4AMBA 1NQTA 2FWJA 4EUSA 1KK1A 4HGYA 3Q12A 1BU8A 2LPMA 3OOWA 2BGLA 1KI9A 3PUHA 4B83A 5KNDA 3FRHA 2QB5A 2KLHA 5K7SA 5J47A 5CHEA 4B6EA 1QRDA 4R2LA 3K6RA 1VPVA 3OPQA 3N39C 1GTL1 4PLVA 5HP4A 1JG3A 1KFEB 1EM8B 5DXJA 3RVDA 3ZC3A 4C3VA 3TQIA 4OX9Y 3ONFA 1YS2X 1FDRA 4Y0NA 1BWPA 1K7YA 1I14A 3U4GA 3VR4D 2CD9A 2JAXA 4G1BA 2O23A 4NBNA 1OXXK 2ZBVA 1KI2A 3IKLA 4FR2A 4TS9A 1UANA 3QYFA 1MD9A 1ZN2A 4MVJG 3AEQB 5EKSA 1A4RA 1K97A 2C4NA 3A06A 4B3BA 4JX8A 4YCJA 4CQJA 4BP1A 5JBQA 1JE1A 5P21A 2PMKA 5ICCA 3IAEA 1BXGA 3R6GA 3GT0A 4UHJA 3OQ6A 5IM5A 3UQZA 3PQ5A 5I7FA 1Y33E 5J4VA 4MZDA 1P0IA 1KFBB 1WKBA 3H2BA 4UE3S 4K9KA 1AGPA 2ZLBA 4LJYA 4LPSA 5BR1A 3N53A 3SJAA 3WOHA 5BV8A 1BDHA 1TAUA 5TGZA 1MEJA 3QLUC 1HYBA 3C6XA 5LU8A 4KREA 1ONOA 3OF5A 2I3DA 4WESA 5AM1A 4ZAZA 3SC2B 4QLBA 4MKZA 1V7CA 1S2DA 1Q7TA 4YMWA 4ARCA 4BVLA 4EA8A 5JW6A 5JFGA 5DCYA 3H2SA 2WT9A 4DJAA 3QX9A 1RMTA 1YR3A 1P2DA 1DC3A 3GJTA 3Q0IA 2FPKA 4JLAA 4DY4A 3K5WA 5DASA 2C54A 3NP7A 3OPVA 1Z73A 1WCIA 1RYEA 1U7TA 3B3AA 4EZBA 3AUAA 3AW9A 4E88A 5JO0A 1JV2B 1U31A 2G6TA 4W5WA 1ZD2P 3ETDA 4JVSB 3V9AA 3DKKA 2Z95A 1HX7A 4YXWD 2WYHA 4JI2B 2CKMA 5AVOA 3EVCA 4IG4A 6PFKA 1EK2A 4C5CA 3MJCA 5DW3A 1P17A 2G4CA 5F33A 1ID8A 3UT0A 1GSOA 3SIPA 1K89A 1Z2NX 3GY0A 3PFBA 3PS9A 5KHAA 3UB4A 2C0QA 1KOLA 1PX0A 1IN8A 1OWOA 5ALWA 4B2LA 4EPYA 3QEOA 4OMDA 1A96A 2W98A 1TU3A 2H1CA 3BXFA 3C3CA 4NP6A 1F6DA 5CNIA 2Q7DA 3LHFA 4DJFC 1KA9H 1VJRA 2C2BA 3Q3IA 4R2KA 2J48A 2QTCA 4HDSB 3CUSA 4JEMA 5E8RA 3ZKWB 5T5QA 3HU3A 4B7ZA 3OIDA 1YVPA 1CUUA 4MB0A 2C7VA 4UEOA 5AW7A 5K3EA 4PLYA 3V1LA 1C3JA 2NOAA 2G4VA 4CKWB 1E6KA 1PTJC 4ALKA 5WRFA 4US0R 4FNMA 3BFXA 3OZAA 1A2OA 5ALPA 1F0KA 4XTRA 1E8MA 3F49S 3AT1A 4RZ2A 1I2AA 4EYOA 2O2ZA 4UD6A 2GZ2A 3U0BA 3RRBA 1BHJA 2Z30A 5FUWA 2DR0A 3NRBA 1PUIA 4IXDA 2ECFA 3SBEA 3I23A 5B7QA 2NVWA 3CS3A 3TM4A 1XFDA 3CU5A 1YQQA 1J42A 3FDZB 3KUKA 4LXGA 1OFTA 3DMHA 2HMYB 2OCAA 4HV4A 1CZUA 2H4XA 3GGJA 1ZA2A 4KAJA 3ZTYA 1MFPA 2H7XA 5A3RA 1YACA 4XYBA 2YR0A 5C32A 5B36A 1D4FA 1V3TA 2BD0A 1K75A 4N3BA 3QW4B 3UAZA 3DUFA 3X3HA 1WA5A 4C0AC 1DI0A 1G8FA 1ZCAA 2CUZA 1KEEA 3H75A 1AQIA 1UZNA 4O8CA 1WTAA 2O3UA 1EFKA 1C7ZA 2X0DA 3UHAA 1T5DX 5IBQA 3OX2A 5HF8A 1RWNA 4GX1A 3TE6A 3WYAA 1X8LA 1BVUA 5C46F 4P34A 5IAKA 4AWXA 2UVQA 3PQFA 3UPTA 4B80A 2ZJ7A 4P4SB 4YRRA 1LC0A 1Q17A 2B6HA 1O6ZA 4B34A 3ADPA 5JVDF 1RLOA 1KR5A 1UBFA 3QWBA 3KLMX 1XNQB 4XTCS 1HLPA 3WAKA 3PJFA 1NBOA 4RPJA 4MJ3A 3G9TA 4K6OA 2LGJA 1SUEA 1YB2A 1ZKDA 3WLOA 3ROMA 3I8XA 2PZLA 5CIQA 3UMFA 1GZ3A 1Y9DA 2G71A 2O6LA 2GS9A 2R2GA 2W2XA 3A9CA 5E6SA 2BHNA 5A4JA 3R9KA 1OLUB 1C4XA 1N75A 1GP2A 5J2UB 3O3NB 1AMUA 1YWGO 2ATXA 3HB0A 4MKGA 4OHCA 4B6OA 4L78A 2QR3A 4R8LA 4XYLA 3VVLA 3DCJA 4HUQA 1AXEA 1U0FA 4IWNA 3ZZ1A 3D6NB 3M6MD 2HOQA 1RXSA 1JA9A 3BWEA 4ZDIA 1VC2A 3HVKA 1US8A 2P75A 4ZOLA 1N2OA 3ESQA 4KQMA 1TZMA 5DNYB 3HC7A 5FQNA 3I64A 1RPZA 1WP4A 3D7SA 4QUDA 4I55F 3TZCA 1TIPA 3LFHA 4MA0A 3DL0A 4EF6A 1FYFA 2GX6A 3DXXA 3HY4A 5ESRA 2O8NA 4P7BA 4F1JA 3SXUB 3V00A 5HUHA 2G04A 3K0HA 4HNAA 1YNSA 4AJLA 5AYVA 3Q0EA 3K9FC 3GDFA 3WGMA 1WXHA 4QYMA 4EW6A 1TFUA 3PL1A 5EQDA 5A71A 4MO2A 1NVWQ 1X86B 4ER7A 2V4UA 2HU2A 2WHPA 1T4BA 1J39A 2PL1A 1SCNE