3SQXA

Structure of mss116p (nte and c-tail double deletion) bound to ssrna and amp-pnp
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title High-Throughput Genetic Identification of Functionally Important Regions of the Yeast DEAD-Box Protein Mss116p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 196
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sqxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sqxA02
4EIWA 2IA5A 1FNNA 3NEJA 3WBKA 4EKDA 2NMVA 1P2SA 3QXXA 4W5HA 2J1LA 1L2TA 1S3GA 2QU8A 1J8MF 4MUBA 1TNDA 4NP6A 1QBKC 3VR1A 2QTHA 5FL7A 3CRRA 3U3OA 1J99A 1XCPA 2FSIA 5J4HA 3T1TA 4TZ6A 3TSWA 4NU0A 1YR8A 3AGPA 1U90A 5CYOA 1KI2A 3AF3A 1HT2E 1T91A 4MYHA 4RZ3A 3IEVA 3U3JA 1E2EA 1BS1A 4RFSB 1IAQA 4JIMA 4ZV4A 2LCFA 4B71A 3MJRA 2DFLA 4BLOA 1F2TB 1RRGA 4TLCA 2BJVA 2BM0A 4V0OA 4OBEA 3OF5A 4RCYA 1OSNA 2BC9A 2K5UA 2DR3A 3IKJA 2PCLA 3I61A 1HTWA 5EXXA 5DSZA 3UK6A 3ZIAA 1XD8A 3QPWA 1KTVA 4LHYA 3H86A 2ZXUA 4F91B 4D26A 2B7BA 2XEXA 1OHHA 3QBVA 4C2TA 3ADDA 1KSHA 5TXGA 4B3BA 5B30A 1E2JA 3CIOA 1T4GA 5EJEA 3KUDA 5FPHA 4R9UC 1DAKA 1HY3A 2J59A 1QHXA 1Z0AA 2YOFA 3R7WB 1R0YA 4A0RA 2O8FA 1ZCBA 4LSGA 1DE0A 1QG4A 1E2MA 2GRJA 2J87A 2FSGA 4CF7A 1T5IA 4DLVA 1Z06A 4O2RA 2V3CC 4KVAA 1SVIA 4B2IA 4RY2A 3N2IA 5JJLA 2NTYC 2IS4A 3TE6A 5DN6A 4V0NA 5FUWA 3BB1A 1IJEA 3QVUA 4B3FX 4RD0A 3MWJA 4QNRA 4DDWA 4X8OA 3ECCA 2CLCX 4JKYA 3KJHA 1E9SA 5IRCD 2QQEA 2BIFA 3KX2A 4PO9A 2C9YA 2CJWB 4CEIA 1W46A 4XIGS 2WSSD 3HU1A 2MSEB 3F5FA 4QFMA 1NY5A 3GP8A 3THWA 4D4KA 1ZINA 3DDCA 3EZ2A 3W9YA 3WHLA 3B60A 3SJCA 3BRWD 2QP3A 4GPTA 5IHPA 1DEKA 1JNYA 2PEYA 2WVJA 2IUSA 2QBYB 2GF0A 1G5PA 1CU1A 1GWNA 3I73A 3JZMA 1NMXA 5L3QB 3SYLA 3TSZA 1MO4A 1S0UA 2GDJA 1OKKD 4BZQA 3WMFA 1TPZA 3K0AB 1FOEB 5J4VA 2BBTA 1KO7A 2BHRA 5FL3A 1YR7A 1E9CA 3K09A 3AB3A 1WMSA 2HLDD 1KZ7B 4GZLA 5FI1B 1W36B 3LFUA 1VYVA 3UMFA 4MUAA 4GZMA 2EFCB 1IN5A 2VSOA 4GI7A 2IEZA 1J90A 5CM8B 1GL6A 3U7GA 2IXEA 5FTJA 3TUIC 2WIBA 2EYQA 4WBSA 3B1WA 5FBWB 3LX8A 1VKJA 3SJBA 4QHSA 1W5TA 4MDEA 2AN9A 2RHMA 2ZJ5A 5DYGA 3ADBA 4UJ3A 1QZXA 1E79A 3BBPA 3X1DA 2PLFA 3K9NA 3DZDA 2XJ9A 3NEYA 3IO5A 3EPJA 3KQNA 3FMIA 2DHRA 1E0SA 1F48A 2CL0X 3B78A 3SOPA 3HYRA 4CGZA 2D2EA 4CT4B 2BVNA 1GL9B 1HE1C 1KI6B 1SXJA 2GWHA 2W2XA 3O8RA 4WAUA 1WCV1 4EFMA 3C8UA 2ZIAA 3SC3A 2QAGA 5KDOA 2R62A 4XSHA 4DSUA 3JVUA 2YHSA 2AXPA 5G40A 3QBTA 2VQSA 5TARA 1CRPA 4O25A 4Q9IA 2PZFA 4X8LA 4D0GA 1C1YA 3DEFA 3RS2A 3L0SA 5B58C 2PBRA 1LY1A 1KSGA 4W7SA 4A0FA 2O0KA 5JS7A 1YVDA 4NKRA 2A3RA 4LBYA 5GVSA 1M7GA 1AK2A 3L82B 5J40A 4JLVA 1MR3F 1EWRA 4MQBA 4Z8XA 1RW4A 4AG6A 1M6NA 1G4UR 2OT3B 2AXNA 4KVGA 1N6PA 5IDVA 1VG9B 3OIYA 4NCNA 3ZVLA 1Q1BA 1Z8FA 1XMIA 5KNCA 1OJLA 2GBLA 3HDTA 2JAQA 4PPGA 5AJZA 4QXAA 2X2EA 3BFXA 3HPQA 3U61B 3L2OB 4HLUA 2XTNA 3WP0A 1T5LA 3LLMA 5FOUA 3ZVRA 4L4UA 3FHTA 1NVVQ 4PQFA 2WPDA 2O8FB 5FPTA 3KTAA 4JL6A 4XD7A 1IXZA 1TADA 2QEQA 4M9SA 4C9BA 4NE2A 1XTRA 1NIPA 4HUQA 4DUGD 2A5DA 4LJAA 4DB4A 1D9XA 3QKSA 3LY5A 2C98A 3SE0A 1G64A 2HEIA 4BFZA 4C2UA 1KOFA 3ZZ0A 2A9KA 2CCKA 2VBCA 3VFDA 2P5SA 3RS3A 1DAEA 4DSNA 3NHBA 3T61A 4ZKEA 3P20A 1G3MA 4M9QA 5HKKD 4JVMA 4PO8A 1OYWA 1A5TA 4GMXA 4B76A 1F5NA 1KHTA 3VR2A 1ZRHA 3CF6R 4CEIB 1TEXA 2JJ1D 3KKNA 5FBLB 3K0EA 4QOSA 1PLLA 1E2DA 2REOA 3CNOA 5FOWA 3T5GA 1JEDA 2ORIA 4XVUA 3R8CA 2ODNA 3THWB 2ZAOA 2H16A 5HE9A 3KJGA 1XBTA 5A0FA 4N0EA 3TNFA 1VCNA 1AZTA 1WDTA 3L0IB 5TV2A 1XX6A 3EIQA 3I3SR 3B9PA 1CS4C 1Z83A 1JECA 1UM8A 2P5TB 3B1VA 4I4LA 4ARZA 1I4DD 2ZRMA 5BYJA 2F1IA 1LF0A 3LWNA 1BH2A 2WSMA 3W3AA 1KAGA 1RRPA 3KZ1E 3BERA 4PX9A 3TUZC 3PEVA 4TN1A 2A7QA 2C2HA 3QY0A 2ECKA 1CR4A 5SZKB 2PJRA 1YRAA 1L7VC 1VYTA 1M8PA 4PR0A 4DLYA 1RVDA 3QVVA 2RGDA 5JRJA 1XPOA 5G53C 1X8LA 1JR3D 3THYB 3GLHA 5BWMA 1QHNA 1FX0B 2YOHA 2BMDA 1P9WA 5J4YA 3OFND 4B3DA 2JLUA 1SXJE 1ZNZA 2ZRDA 3ZVMA 2FH5B 2YC4C 3CB4A 3PV0A 2ZTSA 5CLLA 2O8BB 5CK4A 4AYTA 3A1TA 3K0CA 3T1OA 4JVSB 3I5YA 3KKMA 3MMPA 2O0JA 2CVHA 1XJ0A 2R44A 2ODBA 4G5QA 1Z2CA 4RVCA 1Y3AA 2EWWA 4PHHA 1ZM7A 2GZHA 4LJ9A 2HV8A 1P73A 2EFDB 3BFKA 2CHGA 1OH6A 1SXJB 4L9WA 1HH4A 1MT0A 2EFHB 3O47A 2OG2A 2ZJ2A 1OH8A 4QM7A 2QAGB 1CR2A 2G77B 1TQ2A 3SQXA 1EFUA 3A36A 3VR3A 3IBGA 2AFIE 2J45A 4HAVA 4IDNA 1P4SA 3OIVA 1XFAA 2GEDA 3SFVA 2CL7X 1GVNB 1EGAA 2QSYA 1XD9A 2OO7A 1RRCA 3VU9A 3OAAD 3TR5A 3B6EA 1P2UA 3WMEA 1P5ZB 4TTPA 1CJTC 2XZOA 1Z6YA 2VF7A 4TT3A 1T8UA 2W0SA 2WSSA 4M1KA 2AK3A 4NTZA 2WAXA 4H9GA 3QKUA 3U5ZB 3PJRA 1E69A 2D4HA 2F7SA 3AVWA 3REGA 4G5OA 4YC7A 4NMMA 3IHWA 3T34A 1E6CA 4KXFB 3SJZA 2QN6A 5J4KA 1E2GA 2JLSA 1NVWQ 4TMXA 2OBNA 1OKKA 1XCGB 2QORA 2FA9A 1YRBA 1Q44A 1E96A 3DOEA 2C95A 2Q9AA 4LJ5A 3HPRA 1OIWA 2HLDA 3FKSD 4H1UA 2OAQ1 3CZQA 5CB8A 4OL0A 621PA 1R2QA 3ADKA 3KTAB 1US8A 4BASA 3F0TA 1NSTA 1MOZA 4NCHA 4HUQB 2IHBA 2V6JA 3RHFA 4M53A 5SZHB 3QKSB 2V7QD 1A2BA 2JIZD 2OFWA 2EFEB 4M1SA 1TUIA 5EE9A 1GFIA 1NLFA 3EWSA 5LD2B 1MV5A 4Z1MD 1P72A 3B1XA 2UZ3A 4LBVA 2O8EA 2YZ2A 4Q18A 2VYFA 4TYPA 2FJUA 4LV6A 1XWIA 2RH5A 2XX3A 2OLKA 4BFTA 4IDQA 1JR6A 2N1BA 4BFUA 3F8TA 4QHYA 1IJFA 2OCPA 2QMHA 4OKSA 1E9RA 3FTQA 3LLUA 4LWZA 4YLGA 4DZZA 3GLGA 3V9PA 2ZE7A 4EUNA 2JLWA 5CM9C 3EWAA 3KFVA 1YKSA 1YZTA 1WA5A 5FL7D 2B7CA 1E99A 3J81k 3HU2A 2J9RA 4TL8A 1TQ4A 3A4LA 3GLHE 4OQXA 2IYZA 2G3YA 1OXUA 3CONA 1VECA 4KFSA 1WBDA 4POAA 2FGJA 4QBIA 4MRPA 4ARZB 2QZ4A 2XSZD 1AM4D 3CNNA 3MSXA 4EJSC 4PHGA 1JJVA 2YNMA 4TL6A 4Q7KA 2OESA 1LTQA 4TZ0A 2CLDX 3GJ5A 3PR1A 4X8MA 2IWRA 2FSHA 1YZNA 2F1JA 4GNKA 5BN4A 2QPOA 4LJ8A 1TF7A 3QIAA 4FMDB 4PQRA 4RCZA 4KYUA 3LV8A 3GLHB 3LO5A 3TKLA 4C0AC 1KGDA 3W6NA 1Z0DA 1B0UA 3AEZA 5AJWA 5EXSA 4QJ5A 3X1YA 3OE7D 1KK3A 3EPLA 3LVRE 1M34E 1G7CA 4TLDA 1LNZA 3EG5A 1I4LD 1N3BA 2Z0MA 4HUTA 4WXPA 4LCBA 3X2SA 4DWJA 5JCZA 2GBLC 1CJMA 2JA1A 1HQYE 5A5GA 4NH0A 5DI9A 1KDOA 2GXQA 1DAHA 5FI0B 5HR5A 2QP4A 2OILA 4HLUC 2CBZA 2JLZA 4BWYA 4MA4A 3PEUA 2UZIR 2P6NA 1OLOA 1OIXA 4ACBA 1KY3A 1NN5A 4DUGA 5K8UA 1D8TA 3LBHA 3BH6A 2ZSAA 1UKVY 2NG1A 3FGNA 4DBLC 5HZHA 3FPAA 3NVAA 2IYSA 3RWMB 4R71A 3AVVA 3WNDA 1TUEA 4KBFA 2I1QA 3U2QA 2BOVA 2ZUDA 3DMDA 1KSFX 3WP1B 1LS6A 3AVUA 4QC2A 1E2FA 4PFSA 5AUOB 4TMKA 2O8DA 3VU9B 5HKKA 2J41A 2ATVA 2ONJA 1KMHA 3AKYA 4BFWA 4E5UA 3P4YA 2NZJA 5EUQB 5FTLA 2JJ1A 5KU1A 3ZQ6A 3NBZC 1WRBA 1X86B 2H57A 4EPYA 3AVOA 1P60A 3KL4A 5DNYB 1K6MA 2VF8A 2J3EA 3AKEA 4NPHA 1ANKA 4MKFA 5G3YA 2J0QA 1KYIA 3BB3A 4EPRA 2ZE6A 2OE2A 4Q5IA 4V0LA 3EW9A 2D74A 4OHWA 3WMGA 5GJBA 2EWVA 3K0FA 2VSFA 4OI0A 1E4YA 4FCVA 1GITA 4ESHA 4RFSA 2ERYA 1YHNA 2W2TA 4KITB 1MH1A 4U00A 4XH9B 5FOTA 4F4JA 1CRQA 2G83A 4JS0A 4F93B 3BJIC 3U6BA 1JR3A 2QMOA 1X1RA 2W6JD 4PQYA 1US8B 4Q9LA 3UG7A 3THXA 3BB4A 4PZZA 1PJRA 3SDZA 1G3UA 2HXYA 3QXHA 2ZYTX 5EUMA 1GOTA 4DCTA 3K0SA 4A2PA 1G21E 4ITRC 3VKGA 3U6KA 5BN3A 4R2IA 3GLGE 3M0EA 4DRZA 2WKPA 4HDOB 2HCJB 4HAZA 2QTVB 4Q9KA 3EIEA 1GILA 2JLXA 2FU5C 2QAJA 4PSKA 1KAOA 1ZC4A 1CJVC 1CP2A 3PUVA 1BKDR 4A2QA 2BJWA 1OV4A 1K8RA 4MDFA 1DARA 4KU4A 4YDSA 3QE0A 2O8EB 4GP7A 5D3QA 3PUXA 1XNJA 3W6PA 1LF5A 4M2LA 1Q1ZA 5FBQB 4BFSA 2F9LA 1H8HA 3I8SA 3DOFA 4IEEA 2XJ4A 3RYTC 3GLGB 1E1RD 1TTTA 4PAMA 1NNEA 3RNLA 4OI2A 1W0JD 4MKIA 2RKOA 3A1WA 4WA7A 3UKDA 1D9ZA 3BOSA 1T3LA 1J7KA 3SHFA 3PQCA 3H2YA 4IVQA 4PXAA 3OAAA 1PVOA 2F1RA 2CVFA 5AUQA 4C0JA 1KKLA 1NMZA 1E9AA 1WQ1R 1Y63A 3GEIA 3PEYA 4KFTA 3JVVA 1YZGA 2MSDB 4ACAA 5LDDC 3BORA 4BE7B 2BKEA 3RS0A 1EX7A 4BLPA 1ESMA 2BMEA 3IBYA 2QBYA 2ZRNA 4HAUA 4OK3A 4GOJA 3UATA 1NBMD 3EZFA 3OIUA 3CLVA 1P7CA 3PG5A 3QPUA 4BECA 2SHKA 4Q7LA 2OHFA 1XB2A 1AQUA 3PUZA 1OB5A 1T3SA 1E0KA 4ZCMA 1G7RA 4AD8A 1IN8A 2NZ8A 3QG1A 4D0LB 2DWPA 1E3MA 3LVQE 4A0HA 3CWQA 4RD4A 4FI3C 5E4FA 1P3JA 3ZVNA 4Q03A 1Z0JA 1JAIA 2H8KA 4Q66C 4PAOA 3I8XA 1M74A 2I4IA 2GJ9A 5IF9A 4NYIR 4BZPA 5C1BA 4MGZR 4QM6A 5JJIA 2W00A 3NBXX 1VHLA 2OLJA 1O3YA 2GZDA 1KO5A 2V7QA 3CWZA 5FPKA 2JIZA 3UXMA 4II7A 3FE2A 4RJLA 2BMJA 2WWFA 1D2NA 2YWFA 3ASYA 2ZRAA 2ZITA 3G5UA 4KLNA 4RD2A 4Z1MA 1KDPA 1OT3A 2JLRA 3X1ZA 2O8DB 4GOKA 2QE7D 5KSPA 3X1XA 1KMHB 2FEOA 1KI6A 3TVTA 1VG0B 4Q1AA 5EP2A 1R0XA 3KKPA 1YR6A 1FTSA 1HYQA 2JASA 2G6BA 1RZ3A 1G6HA 2GCNA 1YU9A 2H92A 2ZAMA 4MH0R 5LB2A 4B6EA 1JR3E 4PC3A 3GPLA 1N0WA 1RE0A 1J2JA 1Z63A 3K0FB 1U98A 2XSZA 1W1WA 3M4YA 4EQ6A 4M1OA 1CLUA 1QHHA 3FMOB 4TL9A 2OXCA 3SBEA 3CH5A 5J4LA 2ZJZA 4P4SB 1D2EA 1N6LA 3UWOA 3SN6A 2YINC 1RC8A 1U9IC 3RC8A 4LY6A 3AVQA 2IHYA 3THXB 2CE2X 4XWAA 2UVQA 3OE7A 2EFGA 2QPAA 2FWRA 2O0HA 3EZ7A 5KUTA 1UF9A 1MRNA 2DPXA 3A1UA 3T1VA 4MYUA 1SKYE 1CF4A 1P61B 1A4RA 1FP7A 4FMDF 121PA 1Z6AA 3VHXA 1G7SA 2VL7A 1GSIA 5UKDA 3GJ7A 3RVBA 4FCWA 3ZS8A 1E32A 1XRJA 5E7JA 4NYJR 3X1WA 2PT7A 3EPHA 3RS7A 1TF2A 3LX5A 1Q22A 2IYTA 3B9QA 1XEWX 4PPFA 1NLZA 1JAHA 2QTFA 2QY9A 3CRW1 1SKYB 2ZI5A 2V54A 4FWTA 4PANA 4KO8A 4JLBA 1VYUA 4AKHA 3TQFA 3A37A 1GKIA 3U60B 4LYAA 3T5DA 1ETUA 3ZH9B 421PA 2VTKA 1E9BA 2QM8A 4ERNA 1SVWA 3D3QA 4TQUS 3A4MA 4C0HA 4AWXA 1II8A 2C8VA 2C9OA 4JLPA 3AP3A 3PENA 4LHWA 2R6FA 1OFIA 3CPEA 4UXIA 1F60A 3CBQA 3QEJA 5FBVB 1UDWA 2O8CA 1P2TA 1Z6GA 4JL5A 2PLRA 2GAAA 4MRRA 3TMKA 2QT0A 3K9GA 2W83A 3K9LA 3VNVA 1JXOA 1IY1A 2VSXA 1X8JA 2GEUA 4BLQA 4MRSA 5KNBA 1IN7A 1KJYA 3OIWA 4ZI3A 3ZD7A 4G01B 2NGRA 1ZMXA 2YWEA 3EARA 1CJKC 5TY0A 4A4DA 3B13B 3CF2A 2PL3A 4ZDJA 3N70A 1G41A 1KO1A 4CEJA 2FX3A 2CEAA 2H1LA 5CIWA 5GADl 1OXVA 2VO1A 3CRQA 5BN5A 3Q72A 1N0UA 5JCPA 1QVAA 1Z0KA 1TAGA 5EE0A 4AYXA 4G5GA 1KMQA 4G1UC 4PZLA 2W6JA 4BRUA 3THYA 1IHUA 4ZCIA 1HV8A 1GM5A 1FX0A 1NRJB 2W2VA 2ZJAA 1UAAA 2GETA 1PZNA 1KJWA 3KKOA 3LXXA 4GRAA 2O8BA 1UKZA 2PZEA 1G20E 3FWYA 1ELOA 1SULA 1UFQA 1HURA 3DMNA 1Z6XA 1G3QA 4DDTA 2FNAA 4TYWA 3SYKA 1K5GA 4US2R 2PMDA 5L3RA 1DELA 4A92A 1Z22A 2ZUBA 4XVQA 2V4ZA 2PX0A 2YC2C 4HSEA 3A1SA 4B3GA 5BXQC 4QGFA 1R5BA 1V5WA 2ZRIA 1AS2A 3CW2A 4YXWD 3SQWA 4LHXA 1E1RA 1E2NA 2Z4SA 4FMCB 4JLMA 2RGAA 2GVDC 2Z43A 3QF4A 3RAPR 1W0JA 1Z28A 2RB4A 4HB3A 3DHWC 1NMYA 1G7TA 2RGEA 3GJ6A 4OYHA 3QF7A 3REFA 1T6NA 1DO2A 1AQYA 4IFEA 4B3XA 3RRZA 4NBSA 4EQ6B 4D25A 4I1SA 1QHHB 3MLEA 2H5EA 1HUQA 3RSLA 2QL6A 2RCNA 4V02A 2ZE5A 3B7GA 4QKQA 1P6XA 4IEIA 1W47A 1B23P 2REBA 2W6ID 1P9NA 1OIVA 3BGWA 3Q9LA 5DLQC 4NDZA 4GBMA 2IYWA 1NVUQ 4TSFD 3LNCA 3GLIA 4NHOA 4QJ4A 3EIHA 4BGDA 1NBMA 4WZ6A 3AH8A 3WY9A 1EK0A 3E2IA 4F4CA 3NWJA 4PHTA 3HU3A 4BPBA 3GFOA 4WVFA 1PV4A 4TQ9A 5C4MA 1DG1G 4EAQA 2ZS9A 4EFNA 1NF3A 1L4UA 1NN1A 3U3KA 1R0ZA 1VHTA 1WE2A 1E9FA 4M8NE 4B48A 4B74A 1W36C 2VPPA 1ZNYA 4LJ6A 5IK2D 4HAXA 2JEOA 4B43A 4YQFA 5A4JA 1ZW6A 2QG6A 2Y8EA 1CR1A 1G19A 3AQ4A 4MGKR 1ODFA 3RS4A 4WIAA 2VP2A 4MITA 4E07A 2FFQA 4AURA 5JMTA 1AGPA 2GESA 1QHGA 3AF0A 2X8AA 4DT1B 1NVXQ 1V43A 4Q48A 1A82A 4M0LA 1ZU5A 3QKRA 4RSGA 4FIDA 4RZUA 2ZJ8A 4TL7A 5F98A 3A58B 2QE7A 4HI0E 4UNRA 2CHVA 1E9EA 5KYKA 1D2MA 3ZLJA 1II8B 2ORVA 2ZRBA 2NQ2C 2ZE8A 2ZU6A 3GLFA 2IUUA 3BE4A 5JZVA 2Z6VA 4KJZA 1GKUB 2O8CB 1XMVA 2GCOA 1RYHA 2WAYA 4QHTA 1G8GA 1KIMA 2VHCA 2QROA 2CLSA 2W58A 2AD5A 2QMEA 5KO2A 4Q19A 4DKXA 4DLZA 3W5JA 3IIKA 2DWOA 3IO3A 2WJIA 3K70D 2YV5A 3V4RA 2HYIC 1LW7A 5HE8A 1S96A 4KSCA 2P2LA 4CEJB 5KSOA 2LWIA 3CF0A 2OAP1 3GCGA 2VA8A 2PMKA 1U2RA 3NXSA 3QG5A 2J7PD 3QOFA 1H8ED 2HT1A 1Q12A 3TQCA 3EC2A 4HB2A 3DPUA 2WICA 3OEED 2ZYWX 1DAFA 4UKDA 4LK2A 2FE4A 1M7BA 1W49A 5CIQA 3Q7PA 1CTQA 4HZIA 2O52A 4US0R 1BOFA 1NG9A 1N5JA 3MWYW 4JZKA 1ZIPA 1XZPA 5AUNB 1S9DA 2IWHA 4FCTA 1OF1A 2X77A 2GXAA 4M9XA 3HJNA 1G16A 1W48A 2WKQA 1LV7A 2J0VA 2BWJA 3TJZA 3TUJC 2A5FA 3TH5A 3WNCA 4A82A 1MABA 2V6IA 2ZSBA 3I72A 3SFZA 1ZNXA 3GMTA 3PIRA 2NPFA 3D7MA 3QF4B 1SQ5A 3OHMA 4EPTA 1NKSA 1ZBDA 4O3MA 3P27A 3GLIE 2NOAA 5HPYB 1NBME 3B85A 3M6AA 2FDCA 1FL9A 1XF9A 2QSZA 3RABA 3CR8A 2AL7A 1OB2A 1N6IA 3DL0A 4C7OA 5FTNA 5KTYA 5DE3A 5B2ZA 2IBMA 2ZUCA 3NBYC 4NCIA 4DLRA 4F7WA 2FFBA 1G8PA 3IEUA 4PC6A 3N5CA 3EC1A 4AKGA 4IOKA 1KK1A 3B2EA 4I1UA 3KXIA 1E2PA 4GMDA 4ASUD 3GLIB 4DIDA 2OSBA 3KQUA 3A1VA 3SNHA 2AFHE 4P0TA 5JECA 4JLDA 1FZQA 1OFTA 2D62A 5FTMA 3ZZUA 2FPMA 1TQ6A 4IW3B 3NC0C 1DTSA 1N2CE 4CVNA 3VTKA 2NO6A 3QPVA 4LI0A 3NDBB 4F92B 1W2HA 2J5XA 2WHXA 4URUR 1AA9A 1CBUA 1XXHA 5EZ6B 2R6CA 5FOSA 3K09C 4L15A 4EPVA 2P65A 4W5JA 1XPRA 3L8YA 1KDTA 1Z3IX 4DLXA 1QHYA 1YZQA 2C77A 3KQLA 2ONKA 2I3BA 3TVDA 2RGNA 2F3RA 4L16A 4LC0A 4OI1A 4NYMR 1J8YF 2OEPA 1S4QA 4D0NA 3GLFE 1IXRC 3CO5A 2JLYA 1Z0FA 3GJ0A 5FR2A 1JEEA 2OCBA 3SEAA 4XSGA 1FP6A 2FZLA 4I1OA 3QKRB 5EZ5A 3AGQA 2PT5A 1R7RA 2PZGA 4YMWA 1XEWY 4DDVA 1ZIOA 3CZPA 2HCBA 5FFMA 4HZUA 1GRQA 3LBIA 5JHHB 3C5CA 3CRVA 4CEHA 4LJYA 3GLFB 4YXWA 1SXJC 1S1CA 2GCOB 2QAGC 5JI3E 4C0LA 3AVYA 1VDZA 3A8TA 2WIAA 4KSBA 2ZROA 4RKEA 1L4YA 1KK0A 4QBGB 2ZJOA 4HLDA 2BEJA 3KB1A 3WNBA 1FUUA 2XTZA 5C18A 2HT6A 3R8FA 1TX4B 4FMCF 4OI4A 3NIBA 2JATA 1G18A 1ZUNB 3CM0A 1VMAA 4DLWA 3I32A 4V0MA 3VX3A 4MYTA 1ZU4A 1JI0A 4LRWA 3O8DA 3C16C 4QBFA 1W2GA 2HF9A 1FUKA 4BFVA 3FOZA 4AI6A 3LD9A 2V8OA 2NO0A 2D06A 2OV2A 2KWIA 2ZREA 1GL7A 1SVOA 1NP6A 1UBEA 1T8TA 2F1HA 3MCAA 3NH6A 4IXMA 4JLNA 5J5CA 2F55A 2GA8A 3EZ9A 4Z54A 2C03A 2ZR0A 1NG1A 1NIJA 3FMFA 3H4MA 4DLTA 4Q01A 4ZO4A 1ZM4A 2GEVA 5E7IA 3DM9B 2B8TA 1WP9A 2FG5A 2R2AA 3KUCA 4DCUA 3MG9A 2XAUA 1II9A 2Q3HA 1QHSA 4HB4A 3B5JA 2YJTD 3P26A 2PX3A 4IOMA 2A78A 1MO5A 1XMJA 4EPWA 1M1YE 2GCPA 3OESA 5IK2A 1N6KA 3H1TA 1ESNA 2FFAA 3HWSA 4M1TA 1XJCA 3FHOA 1MABB 1E1QD 4NYJQ 3ZQJA 5H68A 4D6PA 4ZDWA 1ZD9A 2AD1A 2F3TA 1RIFA 3RDPA 2A5YB 2FPLA 5DHAA 2XOKD 2C99A 3GJXC 1GNRA 3NKVA 1NVVR 5EP3A 1OH5A 3IPYA 521PA 5JWHA 2ZEJA 4EDHA 4GP6A 3ASZA 4OK5A 5LD2C 2PJZA 4FW9A 4S2EA 3WXMA 3FDIA 4IHQA 2H18A 3FYHA 1S3SA 2BV3A 4UNNA 3WRYC 3L0OA 3LQRA 2ATXA 4C7OB 5JEDA 4TMTA 1TQDA 3VR5A 3FFBA 2IL1A 1D6JA 1OFHA 3NTUA 5AJVB 4QBHA 1P9RA 2IYRA 3I62A 2MMCA 3U7EB 1XXHE 2ZVQX 2HDNB 3W5IA 2XGJA 1DPFA 5FOVA 2GAOA 1I2DA 1WB9A 1UKYA 1EXMA 1ZM2A 5FOXA 2J46A 3CNLA 4GFDA 1S2MA 1DG3A 2WWIA 3LAWA 721PA 1NL3A 4JLOA 1G8YA 3HR8A 4XTRA 4RZXA 3Q3JB 4P4TA 5BW8A 1U8YA 4FXPA 1XXHB 3VNUA 1KNXA 2OCYC 4P4SA 5HCIA 2J7PA 2NO1A 1EG7A 3EZ6A 3BD9A 1NSFA 2E87A 3OEHD 2MMGA 1MO3A 4Q1EA 1HA3A 4HLQB 3PITA 4HDQB 3A4NA 3OFNA 1AIPA 4B75A 2WV9A 3LA6A 3Q5DA 5HCNA 5JBQA 2D2FA 1G5RA 2FV8A 1GRNA 3NC1C 2JCSA 3M1IA 4CW7A 2IS6A 2W0MA 4IXNA 5C2JB 2OXRA 2QRZA 3K0CC 3U4QA 4M1WA 1D5CA 4UJ5A 4KCGA 5JEEA 3SR0A 1AZSC 2KSQA 3BIFA 4HZUB 4QG7A 3TAUA 4CEHB 4LGMA 4YMTA 1T9HA 2CHQA 2D3WA 3KJIA 3QXCA 3KKQA 4V0ME 2GTPA 3E1SA 2HXSA 2G9NA 2P0EA 5GJWC 3FMPB 3W3ZB 1XMSA 2B8WA 2IK8A 1E79D 2AHOA 2BM1A 4F38A 5TVKA 4PZYA 4KHZA 5H70A 1UBGA 2RGBA 1R10A 4XWKA 2IXFA 3MUFA 4TTRA 4BLRA 3P1JA 1Q21A 1N6OA 2IC5A 2OBLA 3KXLA 3PUYA 4DXAA 4ZDKA 4GL2A 4L5BA 2ZSDA 3DM5A 1Z29A 4JYCA 4G5RA 4A1FA 4LHVA 3CUEF 1KI4A 1S9HA 4IDOA 1XTKA 3KB2A 2IYXA 3DO6A 1E9DA 4DIEA 2IF2A 1O87A 3E70C 2R6AA 3CH4B 4M1YA 3THOA 4PSVA 1VTKA 2ZETA 4ZCLA 2IYUA 2KB0A 2QQ0A 1NN3A 3BFVA 4B47A 1FTNA 1ZD8A 1NJFA 2FSFA 1KKMA 5KPDA 5IT5A 2FOLA 4AG5A 1XPUA 1N5KA 2ZANA 4RD1A 2XTMA 5DGXA 3K1JA 2DYKA 5BQ5A 3UMRA 1KO8A 2VP5A 3WYGA 3QXJA 3FKSA 5K8IA 1LB1B 2ZS8A 1EFRD 1YE8A 2Z4RA 3ETLA 1FQKA 4FWIB 5EXPA 3L8ZA 4C0KA 2GNOA 1I4TD 1XEXB 1MO6A 1R4AA 4JT2A 4Q4AA 2ANBA 5KSZA 3R9WA 3AM1A 2RGNC 1E94E 4TQAA 2J7KA 2IYQA 8OHMA 1AJEA 1NI3A 2QNRA 2R6GA 1IXSB 3L43A 3H0KA 4LBWA 4Q47A 1EFCA 4B2LA 4DSOA 3CPJB 2ANCA 1OW3B 5FPSA 4LJ7A 2ZR9A 4TMWA 1VG8A 4E22A 4CRWB 1KI3A 3T35A 3ZYCA 2JLQA 2IS2A 4OHXA 3S1AB 5DISB 821PA 1LFDB 3ICQB 3U44A 2IS1A 1VCMA 4LDJA 4O2LA 4DCSA 2GVZC 4EPXA 1GUAA 4IOLA 1Z08A 2Z83A 2CMKA 1OH7A 1X6VA 3D6TB 4I1VA 3C15C 1GDDA 2Q9BA 2ZI4A 2RGCA 5JWRA 3CX8A 5G3ZA 1GZSA 3K70B 3QKTA 1NKTA 1EX6A 1BYIA 4IFBA 4JL8A 1XD2B 2QGNA 1F3OA 2WJVA 2OFOA 5SZIA 3LRPA 2J0UA 1T3HA 3IUYA 4YDHB 3BAFA 5DI3A 2C04A 1SZPA 2CNWD 4LYFA 3A6PC 3W90A 4C3ZA 2LKDA 2Q6TA 1YZKA 1VCOA 3BS4A 2IW3A 2IEYA 2EW1A 2VEDA 2GXSA 1ZD1A 2WJJA 1IBRA 3MWKA 4G0NA 4JMPA 4U5XA 1QDEA 5BYKA 3IDQA 4LZZA 2IYYA 4JT4A 3U4QB 3AF4A 4IJMA 1NJGA 2WJGA 4Z51A 3BWDD 4D2IA 2GF9A 4N0DA 1Z47A 4Q00A 5CDFA 4V03A 5K8LA 4B35A 1AGRA 4UNQA 4DC9A 1X3SA 4XVRA 1E1QA 3R20A 4P3YA 4K8OA 2EYUA 1A1VA 5FR1A 1Q3HA 3FVQA 4I99A 4B44A 2FF7A 3QUSA 2XOKA 3IIJA 2J0SA 4DT1A 4TYYA 3AKDA 3EX7C 1UEJA 5JWOA 3CKLA 5DH9A 3HYTA 1S1MA 2XNDD 3DVLA 1KSJA 3QXSA 4KV9A 1DBSA 2WJYA 3BH0A 3HR7A 4DCVA 2V1UA 2CK3D 5J47A 3CX6A 2H7VA 2IXGA 4OHVA 1Q1QA 1TEVA 1Z07A 4JJKA 1R6BX 1RFLA 6Q21A 3GJ8A 3H84A 4AKIA 4HYYA 1IONA 1JJ7A 5FPYA 1ZYUA 2ZR7A 2AWOA 2WBLC 4UNPA 5EE3A 4H1VA 3ICEA 5CK5A 1W7AA 5EP4A 1VG1A 1COWD 4PPNA 2HYDA 4NONA 3NG1A 3GQBA 4A9AA 3ONWA 1ZJ6A 3B1ZA 3K70C 3U3MA 4N3NA 4BEJA 2N42A 3E5HA 1R0WA 4TT3D 4JLJA 4Q7MB 2Q9CA 4L9SA 1FMLA 2Z5FA 5EE1A 4ESVA 4IVRA 1KJZA 3AUYA 1G3IA 1G17A 1SHZA 2HF8A 3ND9A 1R8SA 1OPXA 1WXQA 4JSYA 3OEHA 2FGKA 2VRWA 4Q4AB 2WZQA 2L0XA 4Q1CA 3D31A 1SKQA 2QT1A 1T0JB 4ZKDA 1Q20A 1R5OA 4AIIA 1QHIA 1E2LA 1UADA 1YQTA 4KFUA 5E95A 5KSYA 2KBFA 2WMOB 4CIDA 4NYMQ 3T15A 2JGNA 1DAGA 2H17A 4URVR 2JJ2D 3VHLB 5ELXA 4TLEA 1W4BA 1XJQA 4A6PA 2C78A 1SVLA 3TIFA 3EAQA 4JLKA 2LKCA 1XTIA 2ZRJA 3TRFA 1UPTA 3Q5EA 1I2MA 1GNPA 3AVPA 2YWHA 4MYCA 1XTJA 5AWFC 3RRYA 4JVNA 3MD0A 4K81B 4IKEA 3U44B 1GAJA 4JBWA 2BEKA 4LPKA 4TYNA 4TLBA 1XP8A 3NBFA 5HTKA 1FMJA 1SGWA 3PVSA 5LBIA 1NLYA 4V0KA 2ZYVX 1GKYA 1G8HA 5EXTA 2ZRFA 4LHZA 1U81A 1W0KD 3G82C 3QEOA 4WZAE 2P6RA 2KJQA 3BH7A 3IILA 4N1AA 4X8HA 1IM2A 4FMBB 2RHDA 2G0TA 3IQWA 4BUJA 1ZC3A 4XWOA 2WTUA 3W6OA 1DAMA 2WWHA 3V00A 1KK2A 1AKYA 2A2ZA 5HZKA 4D4JA 3TBKA 5D3MA 4B73A 1H65A 1GTVA 2J0UB 2AR7A 4CYMA 2R6DA 1XU4A 4QL3A 4XTCS 5DI3B 1UJ2A 2JDID 1IY0A 4D82A 2OUKA 2DY1A 5CDFE 4JBYA 3Q7QA 5JS8A 1FFHA 4Q21A 1CJUC 3I4LA 3RLFA 4TTQA 4EJSA 1U0HC 1VPLA 1ZP6A 1C9KA 3U7HB 2NPIA 1QF9A 3LXRA 5JSZA 1II0A 1W5SA 1CULC 2CCJA 2ZS7A 1EFRA 2ZJYA 4URZR 3SS8A 2R8RA 2VP4A 4LJ4A 2BMFA 2ERXA 4JSTA 1AS3A 2D7DA 1UBCA 221PA 1BMFD 1TU3A 4P4UA 3VQTA 4DSTA 3VR6A 3WRXC 3TAHA 4BQSA 4URYR 1YZLA 2FEMA 1QRAA 1CR0A 5B57C 2BCGY 3L0PA 5DIFA 5CJ2A 2ZI9A 4PSAA 3TLXA 4C0SA 1VIYA 5KPJA 2ZI3A 2ZRPA 4US1R 5L3SA 2EQBA 1KZGB 4Z8YA 4K46A 4OK6A 1M7HA 5EE5B 2YVUA 1W4CA 2ZRGA 3EA0A 3RSOA 3DKPA 1W4AA 1CXZA 4MKGA 1U0JA 2QM7A 4NZYA 4KI0A 4LBZA 1U99A 1FNMA 1EFHA 5KNDA 1GG2A 1W44A 5JRZA 4C30A 1AN0A 1UBFA 1E2KA 1JQLB 2FZ4A 3AVTA 3HP1A 1Q57A 3GD7A 3DZ8A 1OFUX 3PFIA 2YWGA 3JZAA 4MKHA 4MGIR 4MGYR 2QUZA 4M9ZA 1DAIA 5LPNA 2ZM5A 3SHWA 3MWLA 2FFHA 1AS0A 5GVRA 2VHQA 3KQKA 1SHKA 2AKAB 2P67A 2RGGA 2WMNB 2ZRCA 5AUPB 1FPMA 4IDHA 2QENA 2QPTA 2ZQ5A 1DADA 3RRNA 4PC1A 5F2EA 2CNWA 1KO4A 1PUJA 1ZUHA 2WWXA 2QP9X 3U7FB 4KAXA 4EFLA 1G6OA 4J0QA 4RFVA 5F9FA 4Q1FA 2PEZA 2GJAA 4NCKA 4Q4JA 3VMFA 4Y0AA 5FUYA 4M22A 1N6RA 4GOXA 4DLUA 4F4IA 4AY2A 1KDRA 3CR7A 1U94A 1GRRA 1K5DA 2A30A 4QRHA 2VP6A 4P33A 5JFGA 3WYAA 3LDAA 4A8JA 3ZD6A 2XB2A 3MJHA 3PCRB 4I81A 4C0BA 1RRFA 3AF1A 1YR9A 1XTQA 4C0QC 1E2IA 4R98A 2F9MA 5FTKA 4B6FA 1R8QA 1OXTA 2QGZA 5H1YA 1E2QA 1JALA 1N5LA 1XZQA 4ZDIA 4FN5A 3FKQA 4JLAA 4PC2A 4M4SA 1G4AE 2ZPTX 5CJPA 2VP9A 3FB4A 3MRSA 3CRMA 2QRNA 2EU8A 2I1VB 4Y0VA 3LBNA 4RD6A 3PEWA 3R9XA 4PTLA 4DVGA 2G0NA 2XNDA 2V55B 2GZAA 2N46A 1EWQA 3LH5A 1YZUA 2CK3A 2DBYA 4DLSA 2C96A 1U8AA 2KI5A 4G3XA 3ADCA 4U02A 3W34A 2V1XA 1TMKA 1CIPA 5AJYA 1IN4A 3EASA 1A7JA 2ZRKA 4ILEA 1P2VA 3VX4A 4C4PA 1ZCAA 4YONB 4BEBA 5TMPA 5F9HA 1G1MA 2CE7A 2B92A 4ABYA 1OXSC 1T0HB 1H8HD 5D3MB 3PXGA 4JYBA 2Q3FA 2IYLD 1U8ZA 1N6HA 4DEXA 5L8VA 4AK9A 1NY6A 1LS1A 2R9VA 4KBGA 4NCJA 2BKUA 2JJ8A 2WOOA 5FBRB 3TW8B 1X1SA 3NH9A 4Q1DA 3TK1A 1EESA 1HE8B 3EPKA 4WW0A 1COWA 2WOJA 4OQLA 5M04A 3K53A 4B33A 5KDLA 4BFYA 2NO7A 3OZXA 1R5NA 4EJSB 4JVLA 4MRNA 4PO1A 4UQOA 2Q21A 4UNSA 1EFTA 2Q3MA 1VIAA 4YMUA 5JSZB 3V4FA 1E4VA 3EXAA 2FMXA 2VH5R 3F3YA 1G8FA 3B8HA 2ZJBA 5AR1A 2E1RA 1ZM3A 2IX3A 4OHZA 3QENA 4A6XA 1RYFA 2BDTA 2WKRA 3IPXA 2DCUA 2C5LA 3UMSA 1ZUIA 2DFNA 4FINA 3RWOA 2G1JA 2VIIA 5KDDA 1A2KC 2GXUA 2V9PA 1MKYA 2ODEA 4Q1BA 4NYIQ 1CKEA 1N25A 2JJ2A 2XNSA 1JPNA 1G3RA 4HDCA 1WF3A 3KJEA 5B64A 4M21A 3PUWA 4AYWA 3UANA 1KI7A 5L3SB 2DWQA 1W36D 3MFYA 3KXKA 3SZRA 1KNQA 2RMKA 3B1YA 1WBBA 4Q7JB 4P32A 5SZJA 5TDHA 4JBXA 4ZI2A 4W5WA 1DOAA 3WBJA 2DB3A 4DB2A 2KBEA 3BXZA 2XZLA 4QGHA 5FUXA 5C4GB 4WZBE 2X1VA 2ZRLA 4QGGA 4ZPXA 4BZXA 1ZVQA 1IOZA 4HEJA 4HB0A 2B21A 1W0KA 3VR4A 1DS6A 2IT1A 1JPJA 5JLJA 4B2PA 3IIMA 1JQJC 2P6UA 4DJTA 4KFRA 1Q1EA 2F6RA 3GEHA 2XXAA 3W8NA 2OM2A 4LC1A 1KI9A 3AVXA 3O8CA 4TLAA 2VHJA 2ZI6A 1XCMA 4DCNA 2WWYA 3UPUA 4TMZA 2MSCB 5KOYA 2OCAA 2FPKA 2W6IA 4MRVA 4ZIRA 2CL6X 1Q0UA 3I1FA 2JDIA 3VKHA 1Z2AA 1N5IA 2E9SA 2AX4A 4TSFA 4A15A 1YJ5A 3TGPA 3C14C 1JBKA 1G5TA 3P32A 4Q4JB 4D80A 2DFTA 1VCIA 2A5JA 1UEIA 3IGFA 1G9XA 2JLVA 5EP1A 1Q3TA 4Q4HA 3TR0A 4GSYA 3ZJYA 3RRMA 1MRSA 4A2WA 4PAQA 4RD3A 1KI1A 4YMSA 1C4OA 2XITA 3KFXA 4PPQA 2XZPA 4AC9A 2WJHA 1F6BA 4A8JB 1L8QA 2F43A 1DVRA 1ZM9A 3MGCA 3T12A 2NIPA 4Q9JA 1U9IA 2IF0A 2UKDA 1XEXA 4A36A 2IUTA 2Q0HA 3Q8XB 2BBOA 2BBWA 1BMFA 3ZIAD 2GKSA 2YYZA 2GHIA 4LYHA 3BC1A 3QJYA 4BRWA 4W9MC 1OHHD 2GJKA 4M1MA 5C46F 2HUPA 4GDFA 2CXXA 4QNMA 2WM9B 2ZYUX 4CT5A 2A5GA 2C9CA 3GJ4A 4NL4H 2PCJA 2VHUA 2WWGA 5K8TA 3UG6A 4AKEA 3T1QA 5LB4A 4B32A 5P21A 2X19A 3NDPA 3ZZTA 2O5VA 2ZSEA 2RGXA 3S1AA 2QMUA 2REXB 2BBSA 4FD2A 2ZSFA 1ZAKA 3CPHA 1P75A 3WHKA 4DDUA 4O0MA 4XOIA 1JB1A 3QQ5A 4CZ2A 3EA5A 5FUVA 5DN6D 1UKEA 1HQCA 1U0LA 4E09A 4LUCA 5F3WB 1RJ9A 1F2UA 1NN0A 4OJKA 4OQFA 4WOPA 1PLKA 2IYVA 4UXHA 3AP1A 1TF5A 3ZS9A 1XD2A 3BK7A 2RAPA 4URWR 2HJVA 1Z0IA 3W8RA 3GFPA 4D4MA 4BLSA 4B34A 4HAWA 3AP2A 1ONBA 5JJKA 2GILA 1H8EA 3P4XA 1XTSA 3ND8A 3AF2A 1AKEA 5E3HA 3QSYA 1UDXA 2EVWX 1GP2A 4LYJA 2ODWA 3R9IA 3G0HA 3OEEA 5DYIA 5GJVC 2CDNA 1XDBA 4HATA 3GEEA 1SVSA 1SVMA 1Z6TA 3LW7A 5ANRB 3SU8A 4A0GA 2TMKA 1P62B 5FH9A 4JKIA 3VAAA 5TB5A 2YOGA 1BYUA 3KDSE 3N2EA 1S8FA 2OBMA 2PH1A 1F2TA 3SI7A 4QGAA 4A8JC 1TL7C 2GK6A 3FFAA 4B3CA 5E7MA 2ZVPX 2ZI7A 1CEEA 3NHAA 3GFTA 3KQHA 3I5XA 1ZNWA 4BFXA 1GNQA 2OFXA 1E98A 2AWNA 2BCJQ 4KYIB 1QG2A 4Q02A 1SVKA 2B6HA 4KLZA 4Q9HA 2KE5A 2ZU0C 3RS5A 1J70A 4HAYA 4R7ZA 4CDGA 3O8BA 1Z5ZA 4R2HA 2FN4A 4D4LA 1OE0A 3VKWA 2GJ8A 2G1KA 2P3SA 2XB4A 4IDPA 3UWKA 1LVGA 3WYFA 3C4JA 3R7WA 5G41A 2VHTA 3TW4A 1RPZA 1OYYA 3QI2A 3C5HA 3RC3A 3AV0B 2GK7A 2VP0A 4G5SA 5CB6A 1PUIA 2G88A 4OJQA 2XXAB 1W4RA 3UIEA 3C41J 4LV5B 1SXJD 5JI2E 4RKFA 1N6NA 4PC7A 4P31A 4E03A 3DKVA 1BIFA 3MAAC 2AK2A 3D8BA 4WXRA 1JXMA 4ZIRB 5JHGB 2R65A 4LOAA 4OHYA 5AJXA 4TWZA 2HJGA 1KI8A 2VLIA 4KODA 4ASUA 2GJSA 1DO0A 1E0JA 1RKBA 2OZEA 4LV8B 1X8KA 1KY2A 4HLCA 3T06B 2DFKB 3K8YA 5L3VA 1GIAA 3LW8A 4Q4HB 4IVPA 3SYNA 2CJWA 4PHFA 1M2OB 5DO9A 3SJAA 5CYPA 1PLJA 5GJCA 4TMVA 3IHLA 4DHEA 2F43B 1IY2A 5DHFA 1HT1E 4LPSA 5CITA 1BO6A 3LQQA 4S35A 3I92A 5CLQA 4RZ2A 4LX0A 2D7CA 2NO9A 5AK0A 3ZDQA 4Q4LA 4DEYA 3CX7A 5H8WA 5L3QA 3RANA 4GT1A 2YKGA 3SBDA 2QI9C 2AKYA 3K0AA 4UXJA 1G291 4TYQA 2CCGA 4YMVA 1IQPA 4ON9A 4L8GA 3B82A 2X2FA 3FHCB 3U3RA 1TU4A 4OQMA 3TSOA 1N0VC 2WPDD 1QVRA 5EQTA 1XEFA 4XD7D 5KHOC 4URXR 4U7DA 2ORWA 4JJZA 2ASEA 1OXXK 4OQNA 2ZRHA 3IQXA 2WWWA 1FW6A 1HEIA 3GJ3A 3ZGXA 3C7KA 3QNUA 4D81A 3AKCA 4XJXA 3AUXA 4QJ3A 1E0AA 3K9HA 2QA5A 4IRUB 4IOJA 3Q85A 1E2HA 1RJ9B 1F2UB 1FQJA 4BLTA 1IN6A
chains in the Genus database with same CATH superfamily
5LYJF 3LGSA 4EIWA 4EKDA 3IUBA 1FMFA 1AKWA 4LNHA 4ZALA 4FDUA 3JQ7B 5K8VA 2VNHA 2H2FA 3D4OA 1N9KA 1NWCA 1J8MF 1TAHA 4J1TA 2HSWA 4NP6A 5E1DA 1WDKA 5DM60 2EKLA 5E4JA 2HQBA 2QYOA 4G5HA 4LGVA 3U3OA 1CNEA 4XQ9A 3IAAA 1KVUA 4FEYA 1BRMA 4GX1A 1MVNA 1JFRA 1YR8A 4TV9B 3RT9A 3FYDA 1SU7A 3FPEA 3NAZA 5C8YA 5KYTA 3UBMA 2IP2A 4A23A 4QYIA 1J0BA 2PRJA 2V7BA 3HYLA 2B4AA 4RFSB 1IAQA 1Y1LA 3WKBA 3LUHA 4R2MA 2NO4A 3EVDA 4IO1A 2PLWA 3MJRA 2XF2A 4LDAA 3SVZA 4WNAB 1JHRA 5DTRA 4BLOA 1B8PA 3OWXA 5EPOA 5LJLA 3OLYA 2XMSA 3NU1A 4R1TA 5JYEA 3EYWA 5CG1A 1XVVA 1G0NA 3RE1A 1QZUA 2X3UA 3FOBA 3GZJA 3HKBA 2AHRA 2BC9A 4FVTA 4RCYA 3ZW9A 4UPEA 3PQ3A 1E5VA 1HTWA 1IEQA 1GFZA 1KYZA 5JSKA 3UK6A 4N0QA 3CLSC 4LHYA 2BGUA 1IEXA 3WC4A 3WLHA 5AMXA 2HA2A 1U28C 1XYVA 2H2HA 2R00C 2XEXA 3L4BA 4KQFA 4PM4A 1G4HA 1ZXXA 4QXOA 4Y6SA 2D1TA 1UBHS 3A2LA 3V46A 1WJGA 1KJ8A 2FHSA 1MAUA 2Y1DA 2GPBA 2WRZA 2WV7A 3EGOA 5SICE 2JGMA 2TMYA 3LRTA 3VZQA 4BV2A 4E7OA 4GSLA 1WPXA 3KEOA 1TT7A 3A10A 3E23A 3F98A 1XZJA 1BOOA 1ZCBA 1VKRA 3DNPA 2XUFA 3GBVA 1E2MA 5ESXA 4X0EA 4NAUA 1EFVB 4HEHA 5GIOE 3QX8A 4MCIA 1KH2A 5CBKA 3L7BA 1SVIA 2QAIA 4B2IA 3E0QA 3IJ5A 3FD8A 3TZBA 3N2IA 5JJLA 3OX4A 2IS4A 4ZEOA 2PG3A 1LJLA 3FLAA 1RLUA 3UZUA 1IJEA 1BDJA 4B3FX 2B3TA 3BGIA 1YIDA 2I67A 2K4MA 3MWJA 4QNRA 2YXEA 4XE5A 2CDCA 2D5LA 4IFTA 4M54A 4MS3A 4G4SP 4JKYA 3CW9A 4M8SA 2BIFA 3ZGVA 4DDKA 3F9CA 4G1MB 2CJWB 4CEIA 4MV4A 4E08A 2JJYA 1W46A 2MSEB 5AVXA 1MZVA 4U8HA 3QVWA 3VV3A 3THWA 1ZINA 3JD2A 3L8GA 4NF2A 4YJ3A 3U9TA 2DLNA 2EJCA 3V3TA 2LW7A 1LLCA 3B60A 4IJWA 2R7KA 5EGSA 1I7NA 3SJCA 1LDGA 4IIJA 4D9GA 4BY9E 3U3XA 2PEYA 1J5PA 3ICOA 4UZEA 1GWNA 1E5TA 2XGSA 3IQHX 4FZJA 5LZ7A 4QO7A 4TV8B 3F6SA 3HKCB 5FORA 5ICFA 1MO4A 3TSZA 1M75A 5JADA 3LC7O 4ETIA 1X8XA 4DLNA 4DMHA 4DUPA 5J4VA 1SB9A 2BHRA 3O95A 3RO7A 4MLZA 3D3JA 5AKEA 4PGGA 2BONA 2NVWA 3N07A 3QVMA 1WMSA 1KZ7B 4LXUA 3LFUA 2AOUA 1M1XB 2WP8J 2WZDA 1P18A 3E7XA 2EFCB 2OV8A 5CM8B 2AIRA 2IXEA 5FTJA 1J23A 5C7OO 4WBSA 2HTEA 3B1WA 1BTOA 2Q2VA 2Q45A 4XEHA 3DMFA 1EK6A 2XGGA 1W5TA 4E6PA 4JX8A 3SS7X 2AI3A 1E79A 3F3KA 1L4BA 4IILA 2XJ9A 4R3NA 3K32A 4WDQA 4GC5A 5EJAA 1JLKA 5BQXA 1UC4B 5DBFA 1ENOA 4MX8A 1P5HA 5AKLA 4M36A 3ZK7A 4RQAA 2AZ4A 2W4MA 2ZT5A 3O4JA 1GL9B 1CDDA 2O2SA 4P36A 2X40A 4KRYA 1SXJA 3RVRA 2W2XA 1BAPA 4EFMA 3F96A 2ZIAA 2P2YA 1MAHA 2QAGA 3IYLW 3G9UA 4IFIA 3C5EA 4DA9A 1GYRA 1R18A 1I10A 2JLBA 4XSHA 4CCWA 1PJSA 4QBKA 3NDJA 3V7YA 3G3EA 4G36A 4Z9AA 5G40A 4N76A 4UFPA 5IAEA 4PN7A 1LBSA 4YMGA 1CRPA 4Q9IA 5C8YB 3F74A 4K9OA 4LOHA 2WDPA 3I4FA 4QYIB 4RLSA 5GZ1A 1Q0PA 1E92A 1XJ5A 1QGED 1TVCA 3QLEA 2BUBA 2F62A 2O0KA 4PZCA 5A04A 1QYWA 5JS7A 1F2DA 1CUHA 2DKFA 4NBKA 1THGA 3RGGA 3YASA 3MHTA 1GPUA 1AK2A 1M7GA 2I7TA 1DWOA 2FQQA 3WDMA 4HB0A 4B1FA 4Q3EA 2AJTA 1EWRA 4ITUA 3RVPA 3HKBB 2GF2A 3O0DA 3EHDA 1VKOA 2BSQA 4KVGA 3R3WA 5AT1A 5IDVA 3PPIA 3U4GA 4RQBA 4JI3B 4QQ8A 3A6KA 4EW2A 1PL6A 3L7MA 1PZHA 3GARA 4II2A 4DTCA 3ZKWA 4EY5A 2ETXA 3M83A 1XMIA 3D4LA 3E58A 4QVKA 2XPCA 2JAQA 5F4BA 4PPGA 1UZLA 2BDUA 3REQA 1ZJYA 4EBFA 3IT2A 4FLFA 1WZCA 3QVTA 5LZ8A 1GR0A 1OI4A 1T5LA 1UANA 2J6IA 2JKYA 5YASA 4L4UA 3ZVRA 1NVVQ 1YHZA 3JR3A 3L0YA 3WIOA 4CM6A 2JHPA 4RWEA 1YH3A 4OA8A 5CCDA 4EF4A 2J4DA 1K2VN 4XD7A 4M87A 3ABZA 2PXAA 5G1OA 3VISA 1ZNQO 2B99A 4F06A 1JILA 5LP6C 4C9BA 3DYBA 2GRAA 1NIPA 1WY5A 4HUQA 4EO7A 1OU4A 1A7AA 4DUGD 5CNKA 2ILVA 5BW4A 4LJAA 3MCWA 5H59A 5KQSA 4HH3C 4MUFA 1XQ6A 2GASA 3JQFA 4YGYA 4Z2YA 4LRTB 1G64A 4AS3A 4L72A 4RHCA 3RVLA 4C2UA 2JKZA 4WH0A 2A9KA 4MV1A 2CCKA 3RS3A 2X9LA 4MS3B 2PBFA 3QWHA 1OYVA 4IRXA 5ALDA 1KS2A 3TLKA 5HKKD 4TS4A 1JQKA 5ES3A 1Z34A 2C4NA 3H2IA 3KHKA 4OVKA 1U4OA 2B1QA 1TEXA 4CEIB 2EBUA 1YCGA 5JATA 4Q0MA 3HBLA 2REOA 2ZTHA 3CNOA 4IV5A 4Y9SA 1VM6A 5FOWA 4D96A 1JEDA 2VTBA 3THWB 2XI4A 3AM3A 3C6YA 2YYYA 1TM1E 1Z35A 2ZAOA 2ZT6A 4YJ3B 1XBTA 3FNQA 1ZCJA 5A0FA 4IIJB 2GWRA 4XIIA 3QX3A 3GFQA 1ICIA 2BR3A 2IPAB 3KWFA 3TNFA 1VCNA 1I3KA 3A32A 1OWOA 2IYFA 3EIQA 4G09A 5CT4A 2W2OA 4AB1A 4ZZ1A 4UHKA 4KKXB 2F1IA 2V0GA 3CO0S 1LF0A 1PR1A 5JSQA 1BH2A 2WSMA 4XXHA 5BNWA 5L4SA 4GPAA 3DEAA 1RRPA 1Y1QA 3KBBA 5FQOA 3OI7A 1EAMA 3AOEC 1XTUA 2HMAA 1IZZA 3TUZC 2C3OA 2A7QA 1FYXA 3QU4A 2AB0A 4F85A 1CR4A 2PS9A 1L7VC 1VYTA 4TV9F 3LUKA 3CF4A 2RGDA 3LOQA 2EG9A 2AOUB 3GLHA 3IUSA 3KLOA 3QLUC 2WJWA 4JEIA 1UBTS 2AYXA 4BFCA 5EINA 2BMDA 1P9WA 3MJFA 5GINE 2FWBA 3KWLA 4RIFA 4RTSA 2FH5B 2YC4C 4MW1A 2ZTSA 3ADBA 2B94A 2FSVA 4UUAA 3MQFA 1R16A 4QSMA 1Z15A 3T1OA 1VLLA 1DP4A 4GKAA 5FB3A 3KKMA 4LN1A 2O0JA 4RVCA 2AQIA 4G5QA 3A1NA 5FBKA 2CKDA 4HH1A 1Y3AA 2EWWA 4QUJA 4HJXA 1ZHHA 3SOZA 3NHYA 4WGGA 3LKDA 2G7ZA 1P73A 4N0MA 1OAOC 1SXJB 2EGHA 1UP7A 3LK6A 4JZYA 4L9WA 1QK3A 2C2YA 2OG2A 2ZJ2A 1FBNA 1USGA 2QAGB 1CR2A 1T4BA 3LI2A 4LOLA 2PE5A 2AN5A 3VUFA 2FUNB 2DX7A 1S7CA 1A97A 2G63A 2PAFA 3IAFA 1H66A 3OIVA 5CDSA 1I6WA 1OXKB 1PSWA 1LQ2A 4RACA 3RK1A 4A1OA 1ULAA 3PHBE 2BF7A 3MF4A 2H1OA 2HWKA 4V3CA 3TJRA 3WLPA 3VU9A 3W2IA 3T3EA 3NAMA 1YAJA 1P2UA 3L41A 2X3FA 1IXYA 1P5ZB 3HZZA 1NONA 1YA8A 1Z6YA 2VF7A 1T8UA 2Q7XA 2NV6A 3PR3A 1GKLA 1WZNA 2IYOA 3B2NA 2UDPA 2GD2A 1GUDA 2HF7A 4NTZA 4C07A 3BQNB 2OBBA 1UBRS 2P9ZA 4OB6A 1JHVA 2CNBA 4OQEA 3WGKA 5EC8A 3DMPA 5M7EA 3AVWA 1T1JA 2XB6A 2IYPA 1P5JA 3ICWA 4YC7A 3SXPA 1DEHA 1E6CA 5IYZA 3UENA 2QN6A 5J4KA 2JLSA 4F5WA 4RF5A 1DLIA 1P4AA 4NARA 4WLVA 3ZKWB 2IXBA 1Y80A 1IM5A 1DRUA 1OKKA 2NVOA 3MCVA 4PWZA 5B58T 3RUEA 4BWVA 3HGTA 2OTCA 2XVXA 4KRGA 2ZXUA 2QTWB 1C7FA 4LECA 4G0UA 3WFJA 2ECQA 2HBQA 3REQB 2WC1A 4LF7B 2J3KA 3EVAA 2C95A 2Q9AA 3VHQA 3H0EA 2IXAA 2ZWIA 2BPOA 4LJ5A 2HLDA 4YCDA 4H1UA 2CFSA 1DFHA 3B53X 5LYYA 5H7XA 4KPFC 3OCVA 2V7GA 4OL0A 4UE3S 3HCNA 621PA 1R2QA 1S8OA 2CF5A 4TV8F 3BMXA 1H5QA 3OQ6A 4OXRA 2DKOA 3N2GA 4IY1A 1YZVA 5DNWA 2HRBA 4A0QA 3EZXA 1XZEA 4NCHA 3PTAA 4HUQB 3UV3A 3ZZMA 4Z6KA 1NNSA 5EPEA 5HMLA 4M53A 3OQJA 4FSHA 2BEVA 2H11A 2V7QD 1HNWB 3HQ4O 2F9FA 1A2BA 2FR0A 2EFEB 5DASA 1KJ9A 4MW6A 2BI8A 4H6WA 3UJ3X 1NLFA 3BTSA 1BXZA 2H5IA 3EWSA 4I3GA 4TMYA 4DIFA 2BR5A 5LD2B 2EC5A 5DBIA 2W2LA 1YZYA 1UCFA 4GAEA 1Z62A 2F3SA 2OB2A 2VDKB 2XD9A 2VYFA 4TYPA 3M9XA 3INNA 3MLBA 2XX3A 3HVHA 2OLKA 4IDQA 5IABA 1ZQ1A 1K7XB 3OCJA 3ZGYA 1FA9A 4B4VA 1B8OA 2QMHA 3GGGA 2PQMA 3IP3A 4OKSA 4RY9A 3GLGA 2VTBB 2D1RA 2VCYA 2F90A 3V9PA 2XCLA 3EOZA 3PFWO 1USUA 2E6KA 1KMIY 3S8YA 1VMIA 5FL7D 1YMQA 2O0MA 2B7CA 1Z8NA 4HMQA 1Z16A 1PCXA 5CDTA 3A4LA 4OQXA 3WL8A 4BNKA 1NQOA 1OXUA 2ESRA 1KKUA 1U0EA 3WGTA 1P0CA 4JI8B 3LUFA 1WBDA 4Z4CA 2ZB2A 2BGNA 1NVBA 4I14A 1WCIA 2BLNA 2KHZA 3KKEA 3OU6A 1AM4D 4KXMA 4B7UA 1NXWA 4EJSC 2Y9PB 1ODCA 1C2YA 3I9KA 1Z2PX 1XAHA 5BR7A 4IS3A 3KJNA 4L2IA 1U2GC 2CLDX 3PR1A 1W6UA 2RJOA 2VRCD 4TPKA 5BN4A 4FOSA 3NALA 3ZDFA 4RHEA 5C8YF 4ZPJA 1RWMA 3Q6NA 1PS9A 1P4GA 4NMLA 3GLHB 3TD9A 4BO1A 5KZMB 2ZW9A 3OIFA 1KGDA 3JQ9C 1O9BA 1TUBA 5U1PA 3NWEA 5EXSA 4L3OA 3L93A 1N3YA 2PMFA 3D4BA 1LNZA 5DZSA 3OJWA 1UC8A 1Z6PA 2X8BA 2IELA 1KDOA 2AG8A 1DAHA 2GXQA 4B8ZA 1VHQA 2GZ3A 1VJDA 1ZW1A 3IDZA 4UATA 5EJGA 4F1KA 4UEKA 3Q98A 3S2FA 5JCOC 1ZK3A 1PYDA 1WABA 4P92A 1NJ6A 3B8EA 1RBMA 1BKYA 1OLSA 2Q6IA 3HBNA 1V47A 3M33A 4JUDX 4WWHA 2CVQA 3DOIA 4ACBA 1Q83A 5K8UA 3TIIA 4P38A 2YXLA 3WGLA 4H3HB 2NG1A 4DBLC 1WO8A 2QE6A 2RKBA 3I9FA 5G2OA 3U26A 2IYSA 4MI3A 1JMVA 3WNDA 1VQ1A 3RADC 1KFKB 4CMGA 1UMBA 4EK9A 1U6IA 2ZUDA 3DMDA 3H1BA 5HK8A 4M7OA 1LS6A 4TOIA 3JTMA 4ND7A 1C8LA 4X84A 3AVUA 3R23A 3RUCA 3VU9B 2WYWA 4WLUA 3CX3A 2LPMA 5AJHA 3A1EA 2Z6UA 2WG0A 2XMQA 3HXLA 1ZUD1 4K6OA 3ZDYB 1LVHA 4BKQA 1TJPB 2D0OB 2JJ1A 1P17A 4E5UA 3UK7A 5FTLA 5KU1A 1CHNA 5CXUA 1WRBA 1X86B 2H57A 1Z37A 2XE8A 3EG9A 3OX2A 4EPYA 1P60A 3OLCX 4NHEA 1K6MA 3AKEA 2J3EA 1JDTA 3FMVA 4MUEA 1E1NA 1EXVA 4H27A 4RTRA 4TT8A 1NBOA 2VATA 1NBIA 2AXEA 1LH0A 2AS0A 2DSNA 2V45A 1BFKA 2ZE6A 3CSSA 3NPMA 5DYYA 5A6SA 4V0LA 3EW9A 3C8HA 3KE9A 4J0KA 4OHWA 4R1LA 3VPBA 5IUNC 2J3MA 1J42A 2GPYA 5IYZB 5GJBA 1J5XA 5KB3A 2CV2A 4FCVA 4LGCA 1YDWA 1B8NA 1LVUA 1Z12A 4N5MA 2ERYA 2W2TA 4RAOA 4UDOA 3GG2A 4YJ3F 3VOAA 1GNVA 4H18A 2XOXA 4IIJF 5ARCA 3CZ9A 4GGPA 4F93B 1K7CA 4LHEA 1ZK4A 1FUIA 2RHWA 1EAYA 3HY4A 4CKWA 4EOGA 3K72B 4WLOA 1NULA 1JR3A 1GNLA 5IBPA 1IH8A 1X1RA 3ZXIA 3LWZA 4UZSA 3N05A 2Z3ZA 4RH1A 5TR9A 3THXA 3N2GB 4PZZA 3P0HA 1PJRA 4IGKA 3Q87B 3SKXA 2HXYA 2ZYTX 4DCTA 2E4XA 1DJNA 1YS4A 2I71A 3T7EA 3VKGA 4PS1A 4ARCA 4JP1A 3MINA 4IH9A 3O73A 4Q3NA 3VH2A 3KRTA 2BEVB 2WKPA 1HM5A 4HDOB 4RF2A 1JDNA 5LFAA 2JLXA 2QAJA 4PSKA 4N7JA 1RWPA 1ZC4A 1CJVC 2JHGA 2WTXA 2RHTA 2P0AA 3EGCA 3ZI4A 2D00A 2OM6A 3C45A 5ERGB 3T5AA 1N4DA 1KFCB 1M2GA 2GZSA 3WZMA 2OP0A 3PUXA 1UOEA 2HC9A 4GHWA 3I2FA 4HGZA 4U39A 3C70A 1Q1ZA 1XCLA 1W8DA 2CXNA 3JQGA 2F9LA 1C3LA 4DTIA 8GPBA 1PJ8A 1YA4A 5IXYA 2YASA 3UT5B 3GLGB 1E1RD 4RNDB 1LWOA 3UMYA 4WMLA 1PHRA 5EZSA 3K0HA 3STTA 1QU3A 3K15A 3RNLA 1W0JD 8ABPA 5CT9A 4WA7A 1D9ZA 2YIMA 1T3LA 2JEYA 3DZGA 1NVAA 4L22A 2PX2A 4A26A 4B5KA 1JSRA 4FE7A 4A2CA 1IDOA 2H85A 5D86A 4PXAA 3ZCVA 5AUQA 1SUFA 3P5SA 4UDNA 1GDTA 4BVFA 5B7NA 4WNCA 2VAMA 2GN6A 3G9QA 2NUTA 2R8XA 4L2IB 4IMIB 3N6XA 3H9CA 3GEIA 4LK3A 1N75A 1WY7A 3RKRA 1ZJJA 1BMDA 2PV7A 3O9ZA 2K7ZA 5BN4B 2WTMA 4CIXA 5BPHA 1B00A 4INJA 4WKCA 4ACAA 4EVRA 1EUDA 1VOTA 1XZLA 1H22A 1ESMA 1XZBA 1TUBB 2BMEA 1G6KA 3WO1A 4DL9A 1ZJZA 1M8FA 2W6MA 1YK0A 4HAUA 2WABA 4GOJA 4OK3A 2H54A 1NAIA 2HPZA 4OYRA 2GM3A 3CLVA 3PG5A 3QPUA 5HXAA 1V48A 3CZ5A 2WQ6A 4K9KA 5T67A 2OHFA 1N4AA 4AMVA 1XB2A 4O63O 1OB5A 1T3SA 5JMPA 3MS2A 3WJ1A 4HL6A 1Z5WA 1J2EA 1K4YA 3ETEA 2JLCA 1TLLA 1X2EA 4PLZA 3D3KA 3BKWA 3VJRA 4IDEA 3QSGA 3ELDA 1CNFA 5H81A 4HJRA 1XLTA 3KS9A 4QXRA 4A0HA 1Z5UA 5JT1A 2NZVG 4RD4A 4NZPA 2VKQA 2JCYA 4BMSA 5AICA 5JCJD 1XHFA 4CUJA 3ZVNA 1RCUA 1Z0JA 3I01A 4X64B 4EMBA 3LFTA 1OLSB 1Y1RA 4ZZIA 1M74A 4RVHA 1U1EA 1THMA 1WXHA 5BNTA 3VR6D 5JJIA 2DU8A 1PJTA 3QV2A 3IQEA 4MA0A 5ECGC 5IAKA 3U48A 1O3YA 2GZDA 3FSGD 2VJDA 4NNPA 5JD6A 5FPKA 4K6HA 5IUKC 2VDUE 3FE2A 3UXMA 3DMTC 4RJLA 3VAYA 4AXBA 1UMBB 3ASYA 3L0DA 1WPQA 3G5UA 1ISGA 2ZRAA 3MMSA 3W2TA 4AMYA 1PSDA 5DXJA 1C8VB 1ZI9A 1YC5A 3H5VA 3M89A 2JLRA 3U40A 1GJRA 4O4HA 1F8XA 4KW7A 3X1XA 1R6TA 1EVLA 4FX2A 3UOGA 1Y3BE 3CJQA 3Q7IA 4E4YA 2JH8A 4CCAA 1VG0B 1DU4A 2H5JA 2RDMA 2CLOB 1RLJA 3EG9B 3MQ4A 1YR6A 4P8RA 3ZIUA 3L84A 4COOA 3ULKA 1L7EA 5E3IA 1ODLA 1ZGZA 2CXRA 3VR6H 3A31A 1QO0D 3G79A 4E1VA 2G6BA 1RZ3A 3PGJA 1RQ2A 4B6EA 5A02A 3IIEA 1CY2A 1BZYA 3IDOA 2AEFA 1TA0A 5A6SB 2F2TA 4YECA 1J2JA 4L4XA 4BV9A 1Z74A 3WK7A 2FR8A 5GY7A 1W1WA 1WB5A 3FMOB 5KWJA 2O4CA 5EKXA 3G6KA 1B73A 5K0GA 1SRRA 2OXCA 1FVHA 3HV2A 3PX3A 3FOWA 4IUDS 5J4LA 4P4SB 3PCTA 4M76B 1ESCA 3F46A 3LHKA 3RJZA 3O9VA 1ZK0A 4FYHA 3S2GA 1VPDA 3RC8A 3I0NA 2W70A 3UTDA 3THXB 5DYWA 3BMQA 1GTMA 4DV4B 1YQXA 3AC0A 1GU1A 2O2EA 2BZ1A 1YL6A 4LYDA 4XWAA 4CCSA 4DNPA 3V55A 1NI5A 2JFQA 2O0HA 1UDBA 1Z13A 2OG1A 3MINB 5BN3B 3TL3A 2NP6A 2YN0A 2WM8A 4L08A 2H29A 4WBNA 1P61B 4PICA 3AU9A 2OMKA 2HRRA 1TTPB 1Z6AA 4DNOA 1G7SA 4GXRA 3VDNB 4AZ0A 1K89A 1EINA 1SB8A 4IF6A 5JNRA 3DEZA 4CG0A 3ZZNA 3MRTA 5D2CA 1RCFA 1E32A 2QX7A 5E7JA 3X1WA 3KYCA 4TKZA 5H4HA 5EHIA 3JQGB 4DIBA 4JAVC 1A3CA 3D6JA 1Q22A 3H3FA 4ZJUA 1ML4A 3EDMA 5LJIA 1YB7A 5EUCA 3UK2A 3ZGNA 3WSTA 2QTFA 1EXWA 2C4WA 4N8EA 4YAOA 3C6MA 1X1TA 4EMUA 5AKKA 4DZTA 5AW5A 3RUPA 4AKHA 4BAZA 1LPOA 4QVGA 1J0DA 1UKAA 1N8NA 2VBGA 3MQ2A 3WISA 3ZH9B 421PA 1IBMB 1GA4A 3PDIA 2JGLA 3HXPA 3GUYA 2O59A 1N92A 1NBWB 1VJ1A 4LOKA 4ERNA 4RXUA 3GRVA 1D6MA 2CMFA 4IH4A 4J0FA 3KVYA 3FFXA 4TQUS 1R66A 3GDHA 5HUJA 4QT4A 4P7GA 1II8A 1Q7RA 4IZIA 4OIFA 3PENA 1M1UA 2NUTB 2PJDA 2Q6KA 2R6FA 3QYAA 1OFIA 2FI1A 3HC7A 4G2TA 5FBVB 5J1TB 1RMTA 2Q4OA 3MB8A 4KDCA 3LK7A 4ZZ0A 1RP7A 2QT0A 4NZOA 5KVQA 1EUDB 1QX4A 1QOPB 1L5MA 1X7YA 2CBGA 3K9LA 5GONA 1G0OA 2XY4A 5CTAA 3VNVA 4G0OA 2GEUA 4MV0A 3U5TA 1JXAA 4J91A 1KJYA 1PQWA 2FRDA 3OIWA 3ZD7A 4QDTA 2NGRA 4PYJA 2KLHA 3OM1A 3L7AA 4YK7A 1C0KA 1OC2A 1VFNA 3HI6A 1OILA 4M55A 2V98A 4CEJA 4AKSA 1DQZA 1HPLA 2XYGA 4MVJA 1M8GA 4IMRA 2H1LA 5CIWA 2BW0A 2P2CA 4Y1RB 1OXVA 2VO1A 3RT7A 4ZFNA 3PHCA 1N0UA 3VSEA 2RJNA 5FLXA 1FE8A 2P9JA 3I5AA 4G8CA 5IYZF 4Z9BA 1XZNA 3THYA 3N87A 3QVLA 1J07A 4HTFA 2WLSA 4L5IA 4F2WA 1C4XA 1FX0A 2Z8XA 3GCXA 5A4AA 5BQOA 4E2WA 5CDGA 3TZEA 1Z4IA 1G5QA 3K4QA 3UT0A 2H2DA 3RK0A 2JGKA 3PNKA 4Y0NA 1FLVA 1UKZA 1YTLA 4QDOA 4UMEA 1EEHA 2SICE 5HS6A 1SULA 2OAGA 1ENYA 1QRDA 2C4UA 3HY3A 3KZNA 4UHBA 5ICSA 4TYWA 5AW1A 1QGAA 4X6XA 3NONA 3NDRA 5JZSA 3S6JA 3TLMA 2FPIB 4EMTA 1AV6A 2PUVA 1Z22A 2CXTA 4O4HB 4HSEA 3G49A 2ZRIA 1V5WA 3NTLA 3CW2A 2Y3IA 5FUQA 2D5AA 4J3FA 1DRKA 4CM9A 4EX6A 4EX7A 4FMCB 1L4KA 1N9ZA 1NP3A 1DFIA 1FLNA 3GRCA 4JLMA 4BNUA 4J8PA 1JEQB 4HS9A 3W1VA 4KC0A 4PRLA 3VR4D 1DKNA 1Z28A 2B20A 5F1OA 1M5RA 3IMCA 2RGEA 3UHAA 3VOBA 4EG7A 4BVAA 3GD5A 3REFA 1T6NA 5K51A 4ZAVA 2NYAA 3ST7A 4CDMA 5AFSA 2O1WA 1DO2A 3U1TA 3UVEA 3U19A 4I1SA 1QZZA 1G8JA 2D5BA 2H5EA 1TEZA 1XC7A 3GAZA 1EQUA 5BYAA 4XYGA 3GUVA 3FTNA 3B7GA 4QKQA 3DLIA 1P6XA 3PKIA 1W47A 2I6TA 4REQA 4UULA 1B16A 1A88A 1DWPA 1F8FA 1XDWA 2WNSA 2AUTA 1P0MA 5EIFA 5DCYA 2VQFB 1THTA 3L46A 4JI6B 4LZJA 4TSFD 2JARA 3BMQB 1CUIA 4NHOA 1HNZB 4BGDA 1NBMA 3ZW7A 3VR4H 1JSCA 2HR1A 4MJXA 1EK0A 1M2HA 4Z0PA 1OXBB 2MWMA 3E2IA 3DHNA 3NWJA 4W7HA 4F3KA 4A27A 4F4CA 4BPBA 3E9QA 3LC2O 1SQ6A 4WBNB 1FLDA 5C4MA 2I4LA 3ILYA 2AUMA 3C39A 1JDZA 5REQA 4AZ0B 1TC2A 5EHQA 2G07A 1NXTA 1A9XA 4JI0B 2WIJA 3SMQA 5ESRA 4EFNA 1JHXA 1CIVA 2CXOA 2GN0A 1NN1A 1JVSA 1R0ZA 4Y1GA 4J2TA 1E9FA 3Q9UA 1QP8A 5HIIA 3IEMA 1W36C 1F4VA 2VPPA 3HJHA 3KYCB 4YWJA 1FW8A 1RI5A 4B43A 4YQFA 5A4JA 2QG6A 4RTQA 1P3Y1 1CR1A 1G19A 3AQ4A 1R1DA 4QJ3A 4EG1A 2X1MA 3RS4A 4N65A 3SJ7A 5F77A 4CM7A 1ST3A 2FFQA 5CH3A 4E07A 4KTTE 1G9TA 3D8SA 1SCQA 1U8TA 3ZNQA 2O05A 3S2UA 3C8DA 4Q3BA 3M4XA 4IIHA 2WFAA 4MA5A 3ZEAA 1A82A 2I2AA 3PDIB 4M0LA 2RFLA 1U5BA 2QL7A 4P53A 4RSGA 4TS3A 3V1LA 4WXYB 2C3PA 5F98A 5CA0A 2RK3A 2QE7A 1Z73A 4UNRA 1YJQA 3OT1A 4DR2B 1E9EA 5A7FA 1II8B 3RI3A 4TLMB 3MERA 1L7OA 2VR1A 2IUUA 3GLUA 5EJ2A 1V9LA 4KPEC 1HWYA 2IOFK 3P9RA 2Z6VA 1OQAA 2H48A 1RYHA 3ZWQA 3WO0A 3DG9A 3CZCA 4QHTA 1KP3A 5DMXA 2Q49A 5FEMA 2I1LA 3G8CA 1PDOA 3PA8A 1QX3A 2W58A 4I66A 5GONB 2AD5A 1U2ZA 2HOQA 3P0EA 3RQSA 1SBTA 4ODIA 3ITEA 4WKOA 3HEBA 1YRLA 4WY5A 4RZIA 4X66B 2DWOA 4PLYA 2JZOA 2E4AA 1ZAYA 3ILVA 3K70D 3JZFA 4B83A 2HYIC 1C9NA 2YIDA 5HE8A 1OI3A 3PWTA 1GXSA 1S96A 5FT9A 4CI0B 4RA6A 4KSCA 3OQHA 2HB6A 4CEJB 3HUUA 4UDYX 5C31A 2IZ7A 2QRUA 3K1AA 3PQEA 1NXOA 3IE0A 3QG5A 3RU7A 1J24A 4JYPA 5HIAA 1Z4LA 1ZOPA 1P6UA 2OOKA 4W6ZA 2V8BA 1YZFA 2W71A 3E8XA 2FF5A 3GYBA 4HTFB 5EXEA 3TQCA 2B5OA 2GO7A 2QZPA 3H4VA 5COAA 4MWSA 4LK2A 3UH0A 4PR3A 5B36A 1X2BA 1J49A 1FS6A 1OWPA 2EZ9A 5J5VA 1RXWA 4BMVA 1DRWA 2QQ5A 1PVDA 4WOJA 3MWYW 2ZTLA 3DOCA 2WQZA 3R3JA 4M7PA 5AI9A 4PZPA 3RKUA 3TNYA 5JBNA 3NDIA 5IT9A 1ZIPA 1XZPA 5AUNB 3R6LA 2WDZA 2X77A 3ANTA 4RENA 3UFBA 1WW8A 2WKQA 3BJEA 5TIIA 4DS3A 5HJ2A 3TUJC 4BBZA 5K6RA 1F38A 3MC1A 2GPTA 1UAGA 1C0EA 3D0QA 5IG2A 2BHNA 2XYQA 5DLEA 3SFZA 2VP3A 3DTYA 4FYPA 1OBFO 3GMDA 3IP5A 4DHWA 2ZWMA 3ON5A 5FXMA 4YHHB 1SQ5A 1Y5NA 2DQZA 1QGDA 4XDZA 1MJ5A 3D8HA 1QE0A 2EL7A 3CZMA 1M1YA 4N8DA 1PF7E 1PK9A 2NOAA 2W6QA 3BHIA 3MN1A 1FL9A 2QSZA 3CR8A 2K2WA 3FBGA 5KTYA 1U8UA 2HKIA 4RPIA 4WCFC 3ZX5A 4F7WA 4XKJA 2NO5A 4YAKA 3N5CA 3TDMA 4YRGA 3NHJA 3OU7A 2A3NA 2HCTA 5DBGA 4REQB 2YV4A 5B53A 4FHEA 3SQLA 3X3HA 4RMGA 4WBXC 4FOLA 3B2EA 2CUZA 1KQ3A 3I05A 4GMDA 4IJ5A 2D0IA 2ZBEA 4Z0NA 4UM5A 1F14A 2Q41A 2JIQA 2A6PA 4ALJA 3VPHA 4JLDA 1FZQA 4JBHA 2YUIA 3MHPA 3EUAA 3SAJA 5FOQA 3AEUA 4GBED 2OGWA 3K73O 5MFPA 3P97A 2D54A 3H1EA 1HE5A 4RHYA 3H2HA 3VTKA 3NDBB 3CIFA 4ZVUA 5JJBA 1CP3A 5REQB 5A6VA 1I32A 1A9XB 4UUQA 4FONA 4FOOA 2R6CA 4EPVA 4W5JA 4EJ0A 3L8YA 1XPRA 1HDZA 4MV7A 1DMRA 4FOPA 4BNYA 4DCPA 4ND6A 3K9FC 2EBFX 1N2HA 1FB5A 1JG1A 2JCGA 4LC0A 4EYKA 2HY7A 2VPZA 2XBLA 3FDJA 1OI2A 3UGKA 3GLFE 1IXRC 2I4TA 3KR0A 1IZ7A 2O2IA 3TZLA 1Z0FA 3HN2A 5FR2A 3WK9A 2C7PA 4AY6A 3OF2A 4FDTA 2O19A 2PGLA 1XDDA 2Q8NA 2YXPX 4KTVE 3H3JA 5BSTA 3MS4A 4IX1A 2FZLA 3AGQA 1U5BB 1ZJ4A 1RAEA 4NJEA 2PZGA 1V8BA 2QVXX 1ZIOA 4L76A 2HCBA 2YMMA 4H4CA 5T8KC 5CA0B 2PUFA 3AETA 3OT1B 5JHHB 1LPNA 4LJLA 3C5CA 3FF4A 1N3LA 3PLNA 2JFOA 3GGJA 2ZZKA 1J25A 2FW9A 4LZNA 4URHA 2D0PB 2ZUTA 3FFTA 1YGYA 2LIPA 1VDZA 3OOJA 5CRIA 3RW9A 2V0NA 3CCBA 4PX5A 3PJEA 4AJLA 2ZROA 2C5FA 5AI4A 1N2OA 1KK0A 1QYCA 3F71A 4O4HF 5CVJA 4QBGB 2ZJOA 1GCOA 2BEJA 2QN3A 4ABTA 5KEIA 2WJPA 2DPLA 3HB9A 3WICA 4EB8A 5IBCA 5K3DA 3WDKA 3GA5A 5ALZA 1AA6A 2GCIA 1BGWA 1SQFA 2CYAA 1GXSB 2HT6A 2GM9A 2NTVA 3GV0A 4FMCF 3ESDA 4D8TA 3OTOB 1KZ6A 1DDGA 1K7SN 4KXQA 4YCMA 2BFNA 4YPFA 3VX3A 1KEUA 1ZU4A 2BY4A 2J9XB 1JI0A 3K1AB 2ZCVA 4LRWA 3C16C 4QBFA 3BWVA 4TVBA 4D3FA 2DH5A 2PSSA 4FEEA 2XUAA 3LD9A 1KIFA 4WSOA 2YRFA 4BNZA 4RV5A 4BMXA 2OV2A 4U2GA 2KWIA 3BD8A 2Z9CA 3FSRA 4EFKA 3R3YA 2Y4NA 2ASVA 3MCAA 3NH6A 3DTTA 2P35A 2GA8A 3G7SA 3QYPA 4HNGA 3FHLA 4NH4A 1I4OA 2XTAA 2ZR0A 4F9GA 3RG8A 1NIJA 3BDVA 3FMFA 2RAVA 1UXHA 4EHJA 1HYEA 5C34B 5KU7A 2GEVA 2C42A 3PNLA 5E7IA 4CF5A 3V42A 4B6RA 2R2AA 1KAHA 2YZ7A 3KUCA 3WWPA 1ETHA 2XAUA 4BTLA 1T0UA 4BIIA 1B93A 3B5JA 4V38A 4O59O 5IXJA 2VT2A 1JDJA 3L77A 4EPWA 2RBKA 2X58A 2GCPA 1D7OA 5JW6A 3ONEA 3OOYA 3AUSA 3M4ZA 3TCXB 2CHUA 3ETDA 4QQFA 3TSCA 1XJCA 2Q4BA 1PJBA 5CFOA 3S7ZA 2A5YB 4LQLA 3RVJA 2CXQA 1RCTE 3SYMA 6CHYA 5LL6P 4LZOA 1G2OA 2YJ6A 3IPYA 3N3BC 2R8PA 3QUTA 4L75A 5JWHA 4EDHA 3I09A 2PGJA 3EGDA 3SICE 2VT6A 4OK5A 3LO8A 1M1YB 3V8VA 4DADA 1OJ7A 2QPLA 2VHYA 3FYHA 1S3SA 2BV3A 2PY6A 2VCEA 3E5MA 2F59A 1I9GA 5LUBA 1TQDA 2ATCA 2LNDA 3HMQA 1D6JA 3ZI0A 3GRRA 4RE6A 1P9RA 4YCAA 5B1EA 5ELLA 2C7QA 1K92A 3I62A 5AYVA 3U7EB 2I9PA 1U31A 5FA8A 2ZVQX 5AW2A 4PLPA 1AHPA 1DPFA 2I4RA 3CKMA 1I2DA 5FOVA 5JD4A 3GI1A 3L8EA 4QXQA 1ZM2A 1K3TA 5IAOA 1T9AA 2OSVA 4MV3A 2J46A 4NU8X 3T5MA 3VOTA 1XI2A 3CNLA 3GFBA 3UW1A 3NHPA 3KALA 1DG3A 2DVMA 1AVTA 3WK6A 2UYGA 2WWIA 1EBBA 3AEUB 4D57A 4RZQA 1YS9A 1NL3A 5IDYA 3IFSA 4K9NA 5JNWA 2HUNA 2ID8A 5CT5A 3MJCA 3IULA 5EYPA 3EDQA 4FXPA 5DOZA 4MOWA 2FPWA 5DHRA 1P4HA 5GONF 3UXHA 3FXAA