3SQXA

Structure of mss116p (nte and c-tail double deletion) bound to ssrna and amp-pnp
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
publication title High-Throughput Genetic Identification of Functionally Important Regions of the Yeast DEAD-Box Protein Mss116p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
total genus 196
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sqxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sqxA02
3UG7A 4NBSA 5G3ZA 1EFHA 1S9DA 1AK2A 2A9KA 4ZV4A 3W8RA 4FI3C 3ZH9B 1Q1QA 1W4AA 4QBIA 5KUTA 1IXSB 5LPNA 1WXQA 1XXHE 2ZE5A 1CJMA 1NBMD 4W9MC 4Q9HA 4M1OA 3W9YA 3NH9A 3K0AA 3ONWA 1XBTA 5GVRA 4UXJA 4NH0A 1NMYA 2G1KA 3AVQA 4US0R 3THXB 3H4MA 3IO5A 1GG2A 1AQUA 3LD9A 3LLMA 2W00A 1SXJE 2GILA 2O8CB 3HPQA 3C4JA 2QU8A 4FMDF 2OCAA 1LS6A 1QF9A 1Z08A 1ZYUA 2VHTA 2CCGA 2A5YB 4TZ0A 4LV8B 4HLUA 5HCNA 1NKSA 1KO8A 1P75A 1XTQA 3AUYA 1M7HA 1X1SA 1JB1A 1YJ5A 2D7CA 4IEIA 1W48A 4NCKA 3SQWA 1MH1A 2OFOA 4A1FA 1DEKA 1EFRA 4WZBE 4TZ6A 2QAJA 2GNOA 3WBKA 1II8B 1K8RA 5GJVC 2ERXA 5JEDA 1JECA 2DB3A 1ZU5A 1QHSA 3LW7A 2PEYA 5JRJA 4AIIA 1U0HC 1XF9A 2FFQA 3BC1A 4IDNA 5GJWC 4DDTA 2VH5R 4A8JA 2L0XA 4DUGD 4ZDIA 2XJ4A 1JNYA 3U7EB 2ZI9A 3AQ4A 3U61B 2J7KA 1E1QD 3W6OA 5SZHB 4EJSC 2RGCA 1OFUX 2ZS7A 4GDFA 1F3OA 2DHRA 1P2SA 3ETLA 4KVGA 4U5XA 4G1UC 4D0GA 2GJSA 3LQRA 3AF1A 3VX3A 3KQUA 3IPYA 2ZVPX 2IYUA 3KKMA 3RSLA 4H1VA 1DAMA 5JJLA 5AR1A 1GVNB 2DR3A 5G41A 1E79A 3DM5A 3TGPA 4ESHA 1RRGA 1X1RA 1C4OA 1ELOA 2ZVQX 4OK6A 1OH6A 1HE8B 2NZ8A 5L8VA 2LWIA 2YOHA 1UAAA 2FV8A 3NHBA 4M0LA 4O0MA 2ODWA 3PEWA 3AVXA 3SBDA 3H84A 4Q47A 4PPGA 2CEAA 4Q4AB 4G3XA 4TSFA 4EPTA 1W2HA 1Z5ZA 2ZSEA 4B3GA 2QENA 4YMTA 3FYHA 2R65A 3TUJC 1CXZA 3DMNA 1GDDA 4IDQA 1Z0IA 2CK3D 3KXKA 2QN6A 4GOKA 4TTRA 3PJRA 3U7HB 1B23P 4F7WA 4RZXA 3X2SA 2GWHA 5H8WA 5JHGB 2CLDX 2JLUA 1E2FA 2FN4A 2NMVA 1KSHA 2ZS9A 3EPJA 4KBFA 2QT0A 2VF8A 2Z4RA 3BOSA 4IVPA 4MUAA 1DAHA 1KK2A 3B7GA 5FTNA 2GEVA 2IUUA 1WP9A 3K9LA 2QT1A 1SKYB 4DJTA 1CIPA 5H68A 1TF2A 5A4JA 3MWJA 4NPHA 3UKDA 5FBVB 1EG7A 3E5HA 1OJLA 2Q3FA 2BOVA 4HLDA 2BJWA 3LRPA 4KXFB 1CR0A 1G3IA 5DE3A 3SR0A 1WF3A 5CLQA 5J4HA 3CNOA 1Z47A 1OFHA 2ZYVX 5JRZA 4DBLC 4Q7MB 1DO2A 4I1VA 2GJAA 2JGNA 3CW2A 2O0HA 3DDCA 3T12A 1MO3A 2FJUA 5K8UA 4WOPA 2KWIA 3K0AB 1R8QA 4JS0A 3LVRE 3MGCA 4W7SA 4GI7A 1UDXA 2FPKA 3B1WA 3OE7A 5TDHA 4ERNA 3THYB 2A2ZA 2VP2A 5FUXA 1OE0A 3QXSA 3RWMB 3RS7A 5BW8A 1NVXQ 1IQPA 1OKKA 1XB2A 3IQWA 3TMKA 5E4FA 4KCGA 4Q21A 4TLEA 3KKNA 3VU9A 1WCV1 3U3RA 4DSNA 1AM4D 4QJ4A 1ZNZA 5DH9A 1D9XA 2ZAMA 221PA 3OFND 2RGDA 4QM6A 2A5DA 3U3MA 5IF9A 3EARA 3GLGE 1LTQA 5EE3A 2WVJA 4C2UA 3BFXA 4UXHA 2BCJQ 2WWIA 1OLOA 1KDPA 2UZ3A 4Z1MD 1I4LD 2QUZA 4Q1BA 4DIDA 1U9IC 2H16A 4Q1CA 5IHPA 2ASEA 4DRZA 3V4FA 4MYTA 5J4YA 1XMJA 1GUAA 2Q21A 2GF9A 1MABA 4BFZA 4TYWA 4C30A 4OI0A 1ANKA 1FQKA 2O8BA 4A8JB 3UATA 1XEWX 3ADBA 3ZD6A 1XNJA 3KUCA 4EKDA 5CM8B 1YZQA 2WSSD 1XJ0A 2XX3A 2ZANA 1NVVR 1BOFA 2HJVA 2E9SA 3QPVA 1ESNA 5FBQB 1BH2A 1W49A 1QHNA 2WWHA 2F3RA 1SULA 3QEOA 4NDZA 3SBEA 3K70C 1TMKA 5KSYA 5C18A 1E9DA 2YKGA 1BS1A 4NMMA 3W6PA 4B6EA 1UEIA 3HWSA 3FB4A 3PUYA 1OB2A 2EYQA 4IVQA 1OW3B 2WKQA 1E2LA 1NG9A 1IOZA 1KNQA 1P9WA 1RYFA 2X8AA 2C96A 3ZYCA 4WIAA 2PX0A 2ZRLA 5FTLA 4DB4A 1P60A 1YHNA 3MG9A 6Q21A 3TSOA 1FW6A 1A5TA 2IYYA 2RGBA 1G4UR 1KSFX 4DVGA 3CO5A 3CF2A 2QMOA 3RHFA 1H8ED 3W3AA 3AKYA 5EP3A 5BN5A 3MUFA 2ZAOA 3OAAA 5EXSA 3WMGA 1IY0A 4A36A 4NP6A 3NBYC 1E9FA 3I4LA 4DCUA 5P21A 2P3SA 4TQAA 3LH5A 4M9QA 4KSCA 4IFEA 4CYMA 1YRBA 3ADKA 2EQBA 5JS7A 4FCTA 4UNQA 5EE5B 4PZYA 1U0LA 4YONB 1D8TA 5HTKA 2F1JA 1TEXA 1P61B 3CX7A 1PUIA 2IA5A 3K09C 5EXPA 2C2HA 4Z1MA 3AGPA 2OHFA 2V4ZA 3H2YA 1ZNYA 1D5CA 3CLVA 4N0EA 2RKOA 1Q21A 1PLJA 1XZQA 4L9SA 2YWEA 5KPDA 1DAEA 1J90A 1KJWA 1ONBA 1GWNA 4Q48A 3FMFA 4XWOA 1YU9A 2RHMA 3EPHA 1GTVA 1OHHD 4QHTA 1XFAA 4B43A 5AJWA 3GPLA 1G291 4AG6A 2HLDD 5IK2A 1WB9A 4C7OA 4NYMQ 2BBWA 5DYIA 4ZDJA 2YVUA 1UKYA 4R98A 3T61A 4DWJA 5BYKA 1NVVQ 2JJ1D 4FINA 3VNVA 5G40A 2PT7A 3RS0A 1CP2A 4X8MA 5B57C 2ZU6A 1XEWY 2AKAB 1RRCA 2B7CA 5FOTA 4A0HA 2VHCA 2UZIR 1MRNA 1E1RA 1UPTA 2WJYA 1JBKA 3EZ2A 2ZRGA 2QTFA 1OH5A 1FPMA 5FOWA 2J41A 3CNLA 4LHYA 2BMFA 2P6RA 4HYYA 5AUQA 3SHWA 3U7FB 1P9RA 5J4LA 1E2EA 5FOUA 1FUUA 4AY2A 1H8EA 3ASYA 4QOSA 1G5PA 3VU9B 4CEIA 2FNAA 1UBGA 2CDNA 4Q18A 1WDTA 1KI3A 2ZREA 3VAAA 1N5KA 2ZR7A 3DMDA 5KTYA 4D26A 2FFHA 2IXEA 2REOA 1IXZA 3PENA 5TARA 4YXWD 4O25A 3F5FA 4E09A 3G0HA 1UJ2A 5KPJA 3B1YA 1RJ9A 4JLMA 1ODFA 1QHYA 1X8LA 4LHWA 5A5GA 1MO5A 4P4SA 2C03A 2W6JD 4ASUA 1KK1A 4K46A 2ZUBA 2H18A 4UJ5A 4UXIA 4HB2A 5JLJA 4TWZA 5KNCA 3I8XA 3TIFA 4S2EA 2NO9A 5JMTA 1L4YA 3A1TA 2B92A 1FQJA 5TV2A 1PV4A 2O8BB 2IUTA 3EZ6A 1KI9A 3BK7A 1SXJD 1XCPA 5EP1A 4P4UA 4BUJA 2ZTSA 4JBWA 4JL6A 2PZGA 5HPYB 3KB1A 1KI1A 3B8HA 4KYUA 3LBHA 3DHWC 5IDVA 4AYWA 5JCPA 2KB0A 2VA8A 4QBFA 1ETUA 4OHZA 3EWAA 3PEUA 3SJBA 1C1YA 1E2NA 2PX3A 4AD8A 3V4RA 4C9BA 5KHOC 2OAP1 3UG6A 3DKVA 1FX0A 3KB2A 2P65A 1XD8A 3HR7A 1TADA 5CIQA 4XSGA 4JMPA 3TBKA 4L9WA 1IONA 1UBEA 3B1XA 3O8CA 1W0KD 4JLAA 1EXMA 1A2KC 2CHVA 1T6NA 4B33A 2PLFA 2HT1A 1TAGA 121PA 1E94E 2P6UA 3X1ZA 2BBSA 1OSNA 3CWZA 4EPYA 2AFIE 5AK0A 1KO7A 1QRAA 2VHJA 5JSZA 1LB1B 4IDPA 3NEJA 2ZRCA 1YKSA 3SU8A 2WWWA 4JVLA 2RHDA 3I8SA 3TUZC 1G7TA 2DY1A 1GILA 4A92A 3VKGA 3QG1A 1G5RA 1V5WA 2F55A 3K0CA 3WP0A 2XSZA 2BWJA 1GP2A 1PLKA 4US2R 2W0MA 5K8LA 2C95A 2VP4A 3KXLA 3IIKA 1TPZA 1CLUA 2HF8A 4BFTA 1DG1G 2W6JA 4L4UA 2B21A 1LW7A 4AKIA 4MYUA 5G53C 4OI4A 4QM7A 4GSYA 1EWRA 4OL0A 3DM9B 3FDIA 1X86B 2KSQA 5SZIA 2NO1A 2ZSBA 2GCNA 5FUVA 3KJIA 1MOZA 2WOJA 3NVAA 2R6AA 1DBSA 3JVVA 2QAGA 2LKDA 3MJHA 2GRJA 2ZIAA 5FR1A 3FMOB 3RRMA 4A4DA 4D80A 4IHQA 4C7OB 2XJ9A 1W47A 1CKEA 4C2TA 3T5GA 2J0UA 1ZMXA 1NN1A 1W4BA 1OIVA 5FPTA 3KJGA 3SC3A 3B6EA 1HT1E 2V9PA 2IS6A 1ZUNB 3B60A 4JYCA 3PXGA 1OYYA 2JJ2D 1DS6A 3PUZA 4GL2A 5DI3A 3H0KA 4BFYA 1Z6GA 2ANBA 2D3WA 3P26A 3R8FA 2A78A 3THWA 3IPXA 3LBNA 4Z51A 2FPLA 2C98A 1QG2A 4CEIB 2BMDA 1A4RA 1SVSA 2NOAA 5HKKA 5FI0B 3OIUA 4CW7A 4DLTA 1UM8A 2F1RA 1G8HA 4HEJA 3U6KA 4KHZA 3T1OA 3RRYA 3HYTA 1QHHA 1WMSA 4GZLA 4NTZA 3RC8A 4PPNA 1RJ9B 2JLWA 4OJKA 4I1UA 2OE2A 4R71A 4D0NA 1FNNA 4B47A 3BIFA 3DVLA 3S1AB 2C5LA 1G8PA 2WPDD 1SVLA 4OQFA 2J3EA 2K5UA 3NC0C 1TNDA 4QG7A 2G9NA 3UPUA 2QPAA 3U5ZB 4UNPA 3CH5A 4JKYA 3QI2A 4YDSA 1AGRA 1HV8A 2Z0MA 2HEIA 1P6XA 4IVRA 1GITA 3MMPA 1AKEA 2OV2A 2PEZA 2OO7A 1DADA 3QF7A 1R6BX 4GP7A 2P6NA 2XB2A 2V1UA 3QKRA 4M9XA 2EWWA 1E2QA 1M1YE 1KK3A 3ZIAD 2JAQA 2QG6A 2OBNA 4R7ZA 1IN4A 3A4MA 4TMWA 5CB8A 1Z63A 2RGGA 3L43A 2FSHA 1FX0B 1TQDA 4JVMA 1G1MA 1VHLA 2A5GA 4EJSA 1XD9A 2WAXA 4C0LA 2H57A 3T06B 3VHXA 4IOMA 2XXAB 1WA5A 1C9KA 3FHOA 3CB4A 4NU0A 2ZYWX 2SHKA 1WE2A 5JS8A 3D31A 3GMTA 1V43A 3NBFA 2ZRAA 2VSXA 5AWFC 1E32A 3GJ0A 2FG5A 4EAQA 3EG5A 3AP2A 5JJIA 4B2IA 2ZRIA 1VCOA 1T8UA 1TQ6A 1NL3A 4JSYA 3ZZTA 1MT0A 2NGRA 4KLZA 3CF0A 5K8TA 5KOYA 4C0JA 4PTLA 4A82A 4Q66C 3PIRA 4E5UA 2ZE6A 4DLYA 1WBBA 1K6MA 4A0FA 2O8EB 4PSVA 2QQ0A 2YJTD 4BE7B 2Q3MA 1R8SA 1XXHB 1SKQA 2OM2A 3W90A 2JA1A 1I2MA 4CRWB 2VPPA 1VTKA 1GIAA 4IW3B 2NO6A 1ZUHA 2AWNA 2J5XA 4HI0E 3O8RA 5EE9A 1E9BA 2V3CC 2WJJA 1QVAA 1SXJB 4KBGA 1K5GA 3T5DA 5FPKA 2QROA 2XEXA 2YWFA 4P31A 3KJEA 2QGNA 3U44A 4M8NE 4UQOA 4AYTA 4XSHA 4PHGA 3GJ3A 2J0UB 5LDDC 3CZQA 4GBMA 3ZIAA 3EASA 4Z8XA 4WZAE 2XZPA 3O8DA 3VFDA 2ZSDA 3U3JA 4KFTA 2ZS8A 2QTHA 1LY1A 4MRNA 1QG4A 1RVDA 3GJ4A 4TLCA 1F2TA 2F6RA 2H7VA 1N6OA 3EWSA 4JBYA 1AIPA 4PHHA 4ABYA 4DCTA 3ASZA 4G5GA 4WA7A 1VMAA 2G88A 2Z5FA 3OIYA 4C0SA 1EESA 4N0DA 3THWB 2IXFA 5FBRB 1AS2A 4LBZA 1FNMA 1W1WA 2JDID 3WXMA 4Q9IA 1XPUA 2W0SA 1KZGB 2Z4SA 5LD2B 3R9XA 4PC6A 1JR6A 2ANCA 1EFRD 2WWXA 3GJ7A 1IN5A 3FOZA 1P5ZB 2CXXA 2GHIA 3Q72A 1ESMA 3GEEA 3FKSA 1DO0A 1KK0A 4NYJQ 4Q4JA 4X8OA 1IM2A 2ATVA 3K1JA 4IOJA 4LJ8A 5FOXA 1KOFA 3KFXA 4D6PA 8OHMA 621PA 1NLYA 3JZAA 4NYIQ 2ZJ2A 1N5JA 1L8QA 1ZNXA 5IRCD 1T0HB 3QUSA 4K8OA 4Q1AA 5JWHA 4O2RA 4L8GA 1XWIA 3SN6A 4URXR 4QGFA 3E1SA 1NKTA 5HCIA 3KTAA 1MRSA 4PC7A 3LO5A 1W44A 1XP8A 4QNRA 2CVHA 1Z6TA 1XTIA 4Q7JB 1U8ZA 4YQFA 3NH6A 1U9IA 2H8KA 3QKRB 1GNQA 1SVOA 1E79D 2G83A 3BAFA 3FPAA 3ND9A 3QXJA 3U3KA 2PBRA 3AP3A 4ARZB 2IYLD 1T0JB 4XTCS 2NO7A 2KBEA 1D2MA 4JL5A 2OUKA 5FPHA 3J81k 1NP6A 4RD2A 1HUQA 2AKYA 3AV0B 4DLRA 4TSFD 1DAGA 1E2PA 5TY0A 4LJ6A 2KE5A 1EWQA 2GCPA 4LYFA 4Q19A 3WMEA 2CL7X 1P4SA 5JHHB 3K9HA 5D3MB 4G01B 1Q12A 2B6HA 3BB1A 4MDEA 3A6PC 1IHUA 2JDIA 4UNSA 5FOSA 1KYIA 1G9XA 2YV5A 1U8AA 3K53A 4E22A 4JLDA 1KMHA 2JIZA 4OI2A 4C3ZA 5KDLA 1E4YA 3CIOA 2ZQ5A 5B2ZA 3RC3A 1J7KA 3F8TA 4C4PA 1XEXA 3A1WA 3O8BA 4PAOA 4LJ9A 3GP8A 3DPUA 4Y0AA 1QZXA 1X8JA 5GADl 3R9IA 3K0FB 3CRQA 4F91B 1ZNWA 1Q22A 4V02A 1GOTA 2R44A 3L8YA 3FTQA 5TVKA 3VX4A 4P0TA 1FMLA 3I73A 3LDAA 4NCJA 1YZTA 2VSOA 2W58A 4RFVA 4YMSA 3VKWA 3VKHA 4W5JA 4CT5A 2XB4A 4PAMA 4LDJA 3SI7A 4JJKA 4BWYA 5F2EA 2B7BA 3EIQA 3NDBB 1YRAA 1KJZA 2WM9B 4A0GA 1OV4A 3DOEA 2AHOA 3X1WA 2OBLA 2V6JA 3K09A 3ICEA 4AK9A 4RVCA 2QMHA 5BQ5A 2FFAA 4O2LA 3B78A 2WWYA 2PL3A 2P67A 5JI3E 3U44B 5HE8A 1G16A 1E98A 2FOLA 5H1YA 1Z29A 4M1SA 3T1QA 3TQCA 4JSTA 4LC1A 4RKFA 3WYGA 1AQYA 3MLEA 3NTUA 5M04A 3GLGB 4CGZA 2Z43A 1OXTA 4XVQA 3OE7D 3K9NA 2XZOA 1Z3IX 4TL7A 4TYQA 5FL3A 2FFBA 4G0NA 4RD6A 1OKKD 1F2TB 4JZKA 4TLBA 3NIBA 1CS4C 1QHGA 4DLWA 2GVZC 4BZXA 3MAAC 4XTRA 3QBTA 3VR2A 2VEDA 1SHZA 1BMFA 1GKYA 3EC1A 3SFVA 1Z6YA 4QHSA 4Q5IA 1X6VA 4URYR 2WBLC 4LCBA 5JZVA 3X1DA 1YZKA 4DC9A 2H1LA 2DWOA 1XD2B 4LK2A 3IO3A 1G8YA 1D6JA 2QSYA 3MWKA 3SJZA 1T5LA 3IDQA 3CBQA 4PR0A 4JLVA 4AKHA 5HZHA 2ZXUA 3I5YA 1Z6AA 1XPOA 1XRJA 1LFDB 1P2UA 2GEUA 1P7CA 1QDEA 2EFCB 1ZJ6A 2A30A 3RAPR 3CPJB 4OJQA 4YMUA 4LJ4A 4B73A 2Q3HA 1XEFA 3SOPA 2ZJ5A 1E2JA 2D06A 3DKPA 1KKLA 4PQRA 4C0BA 1R0WA 2WKPA 5A0FA 4B2LA 1NVUQ 4GMXA 1UADA 1M34E 2GETA 2IEYA 5AJYA 3KTAB 1AA9A 5EE0A 5CYPA 2A5JA 3SZRA 4Z8YA 1GRRA 4HLCA 2EW1A 4PO8A 4WAUA 4A0RA 1TU4A 2VP9A 4PSKA 1T3HA 4EQ6A 3QVVA 4BZPA 5KNBA 1UBFA 4Q4LA 2C99A 1E9AA 2J45A 3Q5EA 1NN5A 4RZUA 1CR1A 2DFKB 2EU8A 2NG1A 1E2GA 4LY6A 4JVNA 4OQNA 2IYZA 3TJZA 1ZM9A 1GSIA 4I1SA 3QSYA 2VTKA 3QY0A 3SQXA 3MCAA 4C0KA 3REFA 2IUSA 4PQYA 1OB5A 3OAAD 1BKDR 1UKZA 2P2LA 4J0QA 2HYIC 2HXYA 1OXSC 2J0VA 2BKUA 3ZVMA 1NJFA 3M6AA 1W4RA 4DCNA 2BC9A 2MSEB 2XZLA 4OQXA 4FMCF 1RIFA 1KMHB 5H70A 5HE9A 1P2TA 4EFLA 3IEVA 2XNDA 1KDOA 1MO4A 4LUCA 2J0QA 2QE7A 1VIAA 3PG5A 4EPXA 4RZ2A 4DSOA 3BBPA 2IYQA 1PLLA 2QMEA 4PQFA 3KQNA 4PPFA 3P20A 3QKTA 2GA8A 3A1UA 4U02A 3CRVA 2J1LA 4PAQA 2G3YA 4NYMR 3RWOA 4TYNA 1TF5A 3IBYA 4MKHA 4LX0A 1GNRA 3RRNA 4EPWA 1XJQA 5UKDA 2KI5A 5IK2D 2PZEA 1CEEA 2GESA 4D0LB 1DG3A 4NL4H 4H1UA 4BEBA 4GZMA 1KY3A 4MA4A 1A2BA 1PJRA 3LXRA 2IYTA 1Z22A 2Q0HA 3VHLB 5F98A 2IYSA 2HJGA 4BFUA 1XPRA 4QHYA 3A37A 1GL7A 2VHUA 3AB3A 1JAIA 2BKEA 1E1RD 2WIAA 4JLNA 3BFKA 4GP6A 2B8TA 1NJGA 3GLIA 1NF3A 3KUDA 3RS5A 1NN0A 3RS4A 3I62A 1Z0JA 5KDOA 1ZM7A 2GAOA 1QHIA 4UNNA 4BFXA 3OEHA 3LW8A 1N6RA 2CE7A 1N6HA 3KDSE 4F4JA 2GJ9A 3CKLA 2DBYA 4MUBA 2WJHA 1CTQA 4MKGA 1Q44A 3HR8A 3TNFA 2AL7A 3GEIA 1P72A 5CIWA 4ZO4A 3K8YA 4Q9LA 2A7QA 5SZKB 4A2WA 2OXRA 2DWPA 4ASUD 1TUEA 3NWJA 3PEVA 1S3SA 3RANA 5AJXA 1TU3A 3A4NA 4A8JC 5FBLB 1ZCBA 4BLSA 1VYTA 2WWGA 4HAXA 4CVNA 2ODBA 2GZDA 1HY3A 4B44A 5FOVA 1VCNA 4D4KA 2F1IA 2GF0A 3WMFA 4JT4A 2P0EA 3H1TA 1NLZA 3TVDA 1G5TA 4DEYA 5KSOA 3SJCA 2QMUA 3ZJYA 1DAFA 1E2DA 2WSMA 4QBGB 5IT5A 2OCPA 2OLKA 1W7AA 3D3QA 3IKJA 4XWKA 5CITA 3CZPA 1NG1A 4JIMA 4NCNA 1JPJA 4IFBA 1DTSA 1R5BA 3FVQA 4B2PA 3SYNA 2VSFA 1P62B 2OFXA 5DGXA 3I72A 4K81B 2IX3A 4BASA 1YVDA 4ZCMA 3MD0A 2BIFA 2V8OA 1T3SA 3WHLA 3UK6A 2OCYC 3FKQA 4URZR 1IAQA 3BS4A 3OZXA 3DEFA 3E70C 3P27A 3ADCA 2OLJA 4ITRC 3EPLA 4I99A 5C2JB 4PFSA 2C04A 1TEVA 3OHMA 2MMGA 4KAXA 3T15A 2IYVA 4HUQA 2XSZD 2I4IA 2WMOB 2FA9A 3PVSA 3FMIA 3K0SA 4BLTA 2O8DA 4E07A 5CDFA 3LFUA 1ZC3A 1ZM2A 1Q1ZA 2BV3A 1U2RA 2J7PA 1MABB 2R6CA 1IN8A 4OHVA 3TUIC 3D7MA 1XTSA 4FMDB 1P73A 4EFMA 3BD9A 4HAVA 4HDOB 1FOEB 2GZAA 2Q9BA 2X2FA 3WBJA 2DFTA 2BCGY 3PUWA 4XH9B 2GTPA 5J40A 2JLQA 4JLPA 1G3QA 2Y8EA 1U98A 4V0NA 1CR2A 4Q02A 2ECKA 2G1JA 2IYRA 4L5BA 4P33A 5DLQC 2CMKA 4ZCIA 3OIWA 1ZM4A 4D81A 4QGAA 1KTVA 2ZRHA 5EZ5A 3RNLA 4WXPA 5EXXA 3AVVA 2RCNA 2FU5C 1NNEA 2REXB 721PA 2OSBA 1SQ5A 4V0KA 5J47A 1CR4A 3BORA 4P4TA 2VHQA 1YZGA 2GK7A 3C15C 2HXSA 2J46A 3GLIB 2QRNA 2IHBA 3L0PA 2I3BA 4RCYA 1DOAA 1Z6XA 2H17A 5B58C 1M8PA 3NEYA 5HKKD 2ZUDA 1G6OA 2UKDA 1N25A 2DYKA 3UWKA 4PZZA 4DDVA 4TYYA 3WRXC 2ZI6A 5KDDA 2FWRA 1E9SA 2WWFA 1JJ7A 2XGJA 5J4KA 3V00A 1N5LA 4O3MA 3EXAA 3RS3A 1MR3F 2QP4A 4B6FA 1QVRA 2F9MA 3OEEA 4U7DA 3MWLA 5KNDA 3ZD7A 2V7QA 4DHEA 3GQBA 3HDTA 4FMBB 1PVOA 1FP6A 4WZ6A 1W36B 4KFRA 1NIPA 3B85A 1ZM3A 4LSGA 1RC8A 2JLYA 1YR6A 4BEJA 4F4IA 1Z07A 3RVBA 1Q57A 2F9LA 2RH5A 3B5JA 3AKEA 4ACAA 2C9OA 1D9ZA 3EA0A 1CBUA 4GFDA 2X2EA 5GVSA 2CLCX 2OG2A 2XTNA 2GXAA 4YMWA 4LYJA 3U4QA 2CL0X 3AGQA 5DNYB 5CJPA 3JVUA 2QA5A 1HEIA 1DAIA 2YWHA 3PFIA 4XD7A 4AKGA 4EPVA 3SYKA 1O3YA 3W5JA 4LJYA 4BRUA 2R2AA 1U8YA 2BEKA 1R10A 2ATXA 4ZDWA 1CJTC 4XVUA 2V54A 5BXQC 2QM7A 4YXWA 4OBEA 3EZFA 3IQXA 3M1IA 3UIEA 2Q9AA 1E6CA 1OT3A 3SDZA 1VG9B 3ADDA 3P4XA 3I1FA 1E9CA 3L0OA 4UNRA 2BBTA 1JXMA 2AD1A 2DFLA 1Q1BA 2HUPA 1E2IA 2C8VA 4NONA 3QVUA 4KLNA 1OYWA 4MYCA 4BLRA 5EE1A 3NDPA 1HYQA 3M4YA 3GLIE 4HZUA 1W5TA 3FFBA 3BH7A 2O8DB 2PJZA 2QP9X 4KVAA 2CJWA 3SJAA 1S9HA 4MRSA 4P4SB 3TW4A 4ZCLA 4B3CA 4MH0R 4DLZA 4TN1A 4H9GA 4PC1A 3A58B 3BB4A 3NXSA 5FI1B 3TSWA 2IXGA 2RB4A 3GJ5A 1KGDA 2YC2C 4P32A 3ECCA 3IHLA 4BLQA 4GPTA 1E0AA 4CEJA 2HDNB 2GKSA 3BE4A 2DPXA 5FPSA 1DE0A 2V1XA 3AVWA 1G21E 3RYTC 4DSUA 1G8GA 2H92A 3VR6A 3IHWA 4M9SA 4HB3A 3UMSA 1IXRC 2BM0A 3L8ZA 2JLZA 4RD4A 1SVKA 2QL6A 1N6LA 5DISB 4NE2A 3HU1A 1KHTA 1G8FA 1W46A 2E87A 2XNSA 3E2IA 3ZGXA 2NIPA 4F92B 4OHWA 3LWNA 3GEHA 4RY2A 3W8NA 2CNWA 2VP5A 5FL7A 5C46F 2CCKA 5DYGA 5HZKA 2DCUA 1FTNA 2BMJA 4HSEA 5F9FA 3I5XA 4OHYA 2WJIA 3R9WA 1VPLA 1JI0A 2AK2A 3TAUA 3I32A 3L0SA 4HAYA 3C14C 4HDCA 5JSZB 1AGPA 4X8HA 4MKIA 4NYJR 4OK3A 1OIXA 4KV9A 1TX4B 4KI0A 3LA6A 1W4CA 1CULC 4NYIR 1GL9B 3CH4B 2O8CA 3FKSD 3Q9LA 1GNPA 1O87A 3CM0A 2BMEA 1SGWA 1Q20A 3D8BA 1P2VA 1J99A 3B13B 2ZE8A 1NIJA 3RLFA 2D4HA 5ELXA 2GK6A 2O8FA 2YYZA 4ACBA 3MJRA 4EFNA 3PUVA 5CYOA 2QQEA 1T5IA 3B9QA 3I61A 4MGKR 4HB0A 3REGA 3WHKA 1NI3A 1KY2A 3BXZA 5C4MA 2BEJA 2X19A 1II8A 1YZLA 1GRQA 4LYAA 2QAGB 4BLPA 2MSCB 5AUPB 5CDFE 2PCJA 2IBMA 3VR4A 4M1MA 1R5NA 2QGZA 3BJIC 4PSAA 1FTSA 3T35A 4Q01A 2EFHB 2NZJA 3CONA 1EGAA 1US8A 3K9GA 1S96A 2OAQ1 1Z83A 3WY9A 2R8RA 4G5QA 3QNUA 1PZNA 3CR8A 1KAOA 3ZVLA 4F4CA 5DI3B 3IBGA 2FSGA 2QSZA 2Z6VA 1GRNA 1JXOA 2F1HA 3CNNA 5DHFA 3BFVA 3THOA 1NLFA 3K70D 3CX6A 1IY2A 3AH8A 3P1JA 4JKIA 5L3SA 3TE6A 2ZSAA 4PC2A 5FTJA 3UXMA 2IK8A 2ZJAA 3C5HA 4JLJA 3ZS8A 1N6KA 3EPKA 1AZTA 1LV7A 4B3DA 3HJNA 1VKJA 2QEQA 3M0EA 2JIZD 2ZJOA 4KFUA 3L82B 4ZPXA 2ZEJA 3CRMA 3K0CC 3O47A 1GL6A 1QHHB 3GLHA 1RRFA 1KDTA 5D3QA 4HZUB 4Q4AA 2RMKA 4TLAA 2GXSA 4WXRA 1D2NA 2FE4A 4A6PA 2CJWB 2W2VA 2YOGA 4PX9A 2D74A 2QY9A 3BH0A 5JCZA 2ZI5A 4CF7A 5E95A 2FSFA 1G20E 4I1OA 1LF0A 4V03A 4FW9A 2YZ2A 1N0WA 1SXJC 1HT2E 1CRPA 3LAWA 1YE8A 1E9EA 4HB4A 1Q0UA 4MYHA 1F60A 1VECA 3QBVA 5JWRA 1OH8A 1G17A 5AJVB 4AWXA 4Q03A 1PUJA 2FZLA 1LVGA 1L2TA 1OFIA 2ZJYA 1COWA 3GD7A 4B75A 3A1SA 2GJKA 1R0XA 1FL9A 2O52A 4D4MA 3TSZA 5TMPA 1YR7A 2V55B 4BFVA 4WBSA 2AFHE 4YLGA 2N1BA 2Q9CA 1H8HA 3TRFA 1E2KA 4EJSB 1NMZA 3EZ7A 2EFDB 5FR2A 1W0JA 1IJFA 1KI4A 2W6IA 4LZZA 4DCVA 3CPHA 1K5DA 1AS3A 1BMFD 4ZI3A 4RD3A 4OI1A 2IT1A 3KX2A 4R2IA 1DARA 1E4VA 2KJQA 1XMSA 1VG8A 2BM1A 4FIDA 3CWQA 2ZPTX 5LD2C 5LBIA 2XXAA 1N0VC 2FH5B 2QNRA 1RW4A 2BJVA 4EIWA 2GBLC 2ZSFA 5DN6A 5L3VA 4AYXA 3THYA 3QG5A 3PV0A 1Q3TA 4M1KA 2AK3A 4NCIA 3H86A 3SNHA 2R9VA 1JQJC 4F93B 4GOJA 4Q1EA 2J0SA 3G5UA 1JR3D 4TTQA 1II9A 4F38A 1UEJA 4B35A 4HUTA 1GFIA 5CB6A 4TYPA 1Z06A 5EJEA 2REBA 3V9PA 2VYFA 4M21A 4R2HA 2O8FB 4M1TA 3A8TA 3W5IA 3CX8A 5BN3A 4QNMA 2DFNA 2QM8A 1XTKA 421PA 3QQ5A 1E0JA 1LS1A 2YOFA 4I4LA 4A9AA 5F9HA 1E69A 4BRWA 3Q7QA 3ZQJA 2WIBA 5L3QA 4IKEA 2CE2X 3R8CA 1N0UA 4V0MA 2IYXA 2IC5A 2VP6A 2R62A 3W3ZB 3QEJA 3AKCA 1N6NA 1A1VA 4HZIA 1Z28A 4HAUA 2OESA 1JQLB 2EFEB 1VYVA 3Q5DA 1US8B 4PANA 4LJAA 5E7MA 3KQHA 4US1R 2JLVA 1KJYA 4D82A 2HCBA 2FSIA 4X8LA 1NMXA 4TMVA 5KYKA 1E2HA 2W83A 1J2JA 2ONJA 1U81A 4XOIA 1A7JA 3CPEA 4IOKA 4WW0A 2IF2A 4Q7KA 4II7A 2JASA 5L3SB 2V6IA 2A5FA 3KFVA 2ORWA 1NBMA 1N6PA 2FZ4A 4LJ5A 3AVUA 3L0IB 1ZD1A 4DDUA 2W2TA 2XNDD 1UKVY 2ZE7A 2ZR9A 1KKMA 2QE7D 3GLHB 2IWHA 2JLSA 2Q6TA 2QPTA 3AF4A 3PEYA 3A1VA 4Q4JB 4Y0VA 3R20A 1JR3A 3WP1B 5E3HA 1KSJA 4XVRA 3AVTA 1G7RA 3BB3A 4PPQA 5FBWB 1AS0A 1G6HA 1NVWQ 4D4JA 4YMVA 4TL9A 3VMFA 3QE0A 4KFSA 3SEAA 1DPFA 2PLRA 5EUMA 4CEHA 2RGNC 3TR0A 4GT1A 4QGHA 3QPWA 4KU4A 3AF3A 4W5HA 4BGDA 4CT4B 3U60B 2GJ8A 5EXTA 1IY1A 5AUNB 4URUR 1XZPA 2ZYTX 1KIMA 3ZQ6A 4QC2A 4C0QC 2QI9C 3UMRA 1L7VC 5JEEA 2OXCA 4DUGA 1GZSA 4DXAA 1KDRA 3AKDA 4BZQA 1UF9A 2IL1A 5JECA 4C0AC 3KQLA 3RS2A 1E1QA 4LBYA 4FWIB 3AVYA 2IF0A 2HV8A 3FWYA 5FUWA 3W6NA 1M74A 3KKQA 2F7SA 2AR7A 4PXAA 2ZRKA 4NCHA 4MGIR 4JLBA 2CCJA 5JI2E 4OK5A 4M22A 3B9PA 1VDZA 3N2IA 3OEHD 5DIFA 5LB2A 5B64A 4PO9A 4M1YA 3BERA 3RRZA 1NSFA 3K70B 1ZVQA 1XU4A 3ZZ0A 2O5VA 3C7KA 3QPUA 5JJKA 2IS4A 4M9ZA 4MRRA 1YR9A 5EZ6B 4RD1A 3B2EA 3GLFA 1J8YF 1BO6A 2FMXA 1GAJA 2HCJB 1XEXB 2G0NA 1U94A 1OPXA 1T8TA 1W36D 2F43A 1KMQA 1ZRHA 3AVOA 2OFWA 1Q3HA 2QZ4A 3GFOA 4RZ3A 1NN3A 4Q1FA 1RYHA 2J9RA 1ZP6A 4M1WA 3VR5A 1WQ1R 4BLOA 4RCZA 3HU2A 2VBCA 2CK3A 2ZRDA 3GJXC 3I3SR 4QFMA 4QBHA 2VL7A 3T1TA 3JZMA 2GEDA 1HH4A 4QL3A 3LY5A 1VHTA 1CU1A 4FCWA 2ZRPA 3GLHE 5DO9A 4BFWA 2N46A 2WJGA 1XTJA 2BBOA 4B3BA 2QORA 3IIMA 5L3QB 1DELA 1ZU4A 2C9YA 2JATA 2FEMA 4FXPA 1M7GA 5EUQB 5BYJA 4N3NA 1N5IA 1HQCA 5F3WB 2IWRA 3Q3JB 3UANA 3IGFA 4B74A 3GFTA 2OZEA 2N42A 3AF2A 1M7BA 4LV5B 2NO0A 4N1AA 2NPFA 4AURA 1KI6A 4XWAA 1AJEA 2A3RA 4HDQB 2PH1A 4HLUC 5L3RA 1SKYE 3DOFA 3F0TA 1R4AA 3HPRA 1EK0A 1NRJB 4A2PA 2R6DA 3TW8B 5FH9A 1X8KA 1W5SA 4DEXA 2XTMA 4LV6A 1I4DD 2OCBA 3CRRA 1G18A 1XTRA 1JEEA 1SHKA 4XIGS 1SVWA 3VTKA 3B1VA 1VG0B 4EPRA 3KL4A 3UWOA 3QKUA 3U3OA 2QBYA 5EP2A 2J7PD 1L4UA 3QXCA 4BECA 1E0SA 1Z8FA 3KZ1E 1ZIOA 5CJ2A 2C9CA 1BYIA 4G5SA 2AXPA 3I92A 3EC2A 2X77A 1G64A 4AC9A 1Y3AA 3OFNA 2G6BA 1RRPA 4ILEA 1CF4A 4CEHB 1TUIA 3DZ8A 5ANRB 3SS8A 3W34A 3PUXA 1ZW6A 2FX3A 4URVR 2J59A 2FGJA 2YWGA 1Y63A 2VF7A 3GCGA 1S8FA 4B32A 1WBDA 4DCSA 4RFSA 3VR3A 4EQ6B 1G19A 3KXIA 4MRPA 3DL0A 2JEOA 4JJZA 1GKIA 1J8MF 4JVSB 4IDOA 3OIVA 1AZSC 2G77B 2WSSA 1G3UA 4JLKA 3PR1A 3WNBA 1U99A 1E9RA 5BN4A 5BWMA 4JT2A 2AX4A 2WOOA 3N5CA 5C1BA 2FEOA 5C4GB 4LOAA 3NC1C 4R9UC 3TAHA 4BFSA 2VP0A 1RE0A 5KSPA 3ZVRA 4LYHA 4I81A 3HYRA 4V0ME 1ZBDA 3LVQE 1OXVA 1HTWA 1OXXK 2EFGA 2EWVA 4B48A 3AM1A 2R6FA 4Q4HA 4KODA 1Z0AA 1BIFA 1GM5A 3MFYA 3QF4A 3FMPB 4JYBA 3C16C 1FP7A 3FHCB 2GVDC 4HATA 4LRWA 3GLFB 2ZROA 1YQTA 1QHXA 3EW9A 4ZKEA 1M6NA 2AD5A 2VLIA 1G41A 3OEED 2ODNA 4FN5A 2V7QD 2ORIA 3PQCA 1MO6A 1R5OA 3LNCA 2F43B 1IBRA 1S4QA 1XMVA 2RGAA 3C5CA 3A36A 4RD0A 2RGXA 2FDCA 1NBME 2ERYA 4MGYR 5FTMA 4JBXA 1JEDA 2Z83A 1G3RA 1KO1A 4DDWA 3HU3A 2D2FA 3U6BA 1JPNA 1RFLA 1ZAKA 2B8WA 1R2QA 1E3MA 2LCFA 1F2UA 4QJ3A 2YNMA 4MKFA 1II0A 3K0EA 1SZPA 4JL8A 2PMDA 3U7GA 4GMDA 4W5WA 4P3YA 2WTUA 2CHQA 3AP1A 1JR3E 3B82A 1RZ3A 2H5EA 4S35A 4XD7D 3S1AA 5K8IA 4D4LA 4Z54A 4RSGA 1KSGA 3CF6R 3LX5A 3KKPA 2GDJA 2MMCA 1W2GA 2IS1A 2RAPA 3GFPA 4TMZA 1CJKC 1OHHA 1FFHA 1I4TD 1YZNA 2GXQA 2VQSA 1E0KA 4HLQB 4TQ9A 3WYFA 5JFGA 1KI6B 4A2QA 3CRW1 1IJEA 2GAAA 2HLDA 3QKSA 3R7WA 3Q85A 3LQQA 1E96A 4L15A 4DLXA 3AVPA 2JJ8A 4MQBA 4DKXA 3IEUA 4DIEA 2WKRA 2ZU0C 2P5TB 4GRAA 2JJ1A 5JWOA 2XTZA 2WHXA 2IS2A 5E7IA 4LHXA 4B3FX 4YDHB 1GKUB 4URWR 4OHXA 4Q7LA 4E03A 4OKSA 1SVMA 1Z2AA 2FPMA 4LBWA 1Z0DA 2CHGA 1CJVC 5FTKA 3ZZUA 2NQ2C 3LV8A 1HE1C 1MKYA 1XCMA 2YINC 5LB4A 1FZQA 4D25A 1Z2CA 2ORVA 2ZRJA 2QBYB 3EIEA 3NKVA 3FFAA 4DB2A 3ICQB 2D7DA 1VCMA 3TLXA 2WAYA 3HP1A 1N2CE 2ZITA 2I1VB 4Q9JA 1LNZA 3SHFA 4M4SA 2QTVB 4MGZR 3FE2A 1G7SA 3N2EA 1XDBA 3C41J 3A4LA 4EDHA 4FCVA 1Q1EA 2ZRBA 4IJMA 3GLFE 2XITA 2C78A 1IN7A 2O8EA 3ZDQA 1XX6A 5GJBA 1DVRA 5JBQA 1XXHA 4MDFA 2OBMA 4LHVA 4RFSB 2ZJBA 2HF9A 4DLUA 3WRYC 3LX8A 1AN0A 4A6XA 4HAZA 4TMXA 4HAWA 3B1ZA 3NBXX 1P9NA 4GOXA 1NSTA 2ONKA 5E7JA 3VNUA 2CNWD 1SXJA 5FL7D 4PC3A 4IEEA 3TH5A 1R7RA 2OEPA 3BGWA 1IN6A 5J4VA 2CVFA 5EP4A 2CBZA 4L16A 3X1XA 4M53A 2PZFA 3TQFA 5AJZA 4B71A 4Q9KA 5TB5A 3BH6A 4POAA 2ZETA 3Q8XB 5EQTA 2OILA 4ZIRA 3EAQA 2GCOA 521PA 4ZKDA 1OIWA 4DZZA 2G0TA 3AUXA 4Q4HB 4DLSA 2JLXA 5KU1A 1T3LA 1UFQA 1ZUIA 2PCLA 3AEZA 3DO6A 2IEZA 3QF4B 2WJVA 1HQYE 4HUQB 4AKEA 3RSOA 2ZI3A 1RPZA 4TTPA 1W0KA 2AXNA 1D2EA 2GZHA 2OT3B 3EZ9A 3QIAA 2P5SA 3QJYA 2VRWA 4G5RA 1W36C 1JALA 1B0UA 1S0UA 3KQKA 1KI7A 3QOFA 1VIYA 4MITA 3SYLA 4IRUB 2YC4C 1FUKA 2CLSA 3LXXA 2E1RA 4LBVA 1JJVA 3PCRB 4AI6A 4EUNA 5DHAA 2RGEA 5SZJA 1T9HA 1N3BA 1F48A 3G82C 1OXUA 1NY5A 2NPIA 2GBLA 2WMNB 4G5OA 1EFUA 4OQLA 1OH7A 2MSDB 1S3GA 3LBIA 1G3MA 1OF1A 4TT3D 3ZLJA 2X1VA 1ZC4A 2XOKD 4DT1A 1F2UB 1EFTA 2D62A 2NTYC 1VG1A 1VYUA 4FMCB 2QP3A 4AG5A 4BQSA 4CDGA 2ZRFA 4PHTA 4LHZA 1ZIPA 4IDHA 2ZM5A 2HYDA 1CRQA 3OESA 2IHYA 3IIJA 2CL6X 4PHFA 1EFCA 4BPBA 1TF7A 3MRSA 4NHOA 3U2QA 4Q1DA 1T4GA 2VIIA 2I1QA 2YHSA 3KKOA 2ZYUX 4NKRA 3T1VA 2F3TA 1UBCA 2O0KA 3GJ8A 2IYWA 2EVWX 2EYUA 1NY6A 1S2MA 3BWDD 1E2MA 3MWYW 2QRZA 3QKSB 3TVTA 3R7WB 2AWOA 4RKEA 3TK1A 1JAHA 2UVQA 2IW3A 4TQUS 1XMIA 4TLDA 1ZD8A 5CK5A 2WV9A 2PJRA 1G4AE 4JLOA 2BHRA 1E99A 4ARZA 3THXA 2BVNA 2PT5A 4TL6A 1S1CA 4KYIB 3P4YA 4LPKA 4B76A 2ZI7A 1N6IA 2PMKA 4QRHA 2JJ2A 3NBZC 5CK4A 1ZCAA 2QPOA 1MV5A 4D2IA 3CUEF 4QXAA 1EX6A 3N70A 3L2OB 1XCGB 1S1MA 1UKEA 1Z0FA 3BRWD 3EX7C 4Q00A 3NHAA 4LWZA 2W2XA 3GJ6A 1FMJA 2WICA 2GXUA 3DZDA 4PZLA 2ZRMA 5D3MA 3TR5A 3WYAA 4OYHA 2D2EA 1KZ7B 2HT6A 2JCSA 1F6BA 4ON9A 3ND8A 4ZI2A 5KO2A 1YZUA 2J87A 3VR1A 1QBKC 3X1YA 1BYUA 4KITB 1R0YA 3ZS9A 4FD2A 4TT3A 1H65A 1YR8A 3UMFA 2XOKA 1KI8A 3K0FA 3QENA 4V0OA 3U4QB 1TTTA 1COWD 4DLVA 4TMKA 4V0LA 1SVIA 2C77A 3IILA 2JLRA 2KBFA 3EIHA 3NG1A 3QXHA 2FF7A 1I2DA 3KJHA 1U0JA 1HURA 4XJXA 1R0ZA 2WPDA 4KO8A 5HR5A 2ZUCA 4LGMA 1LF5A 1P3JA 3RABA 1H8HD 4LI0A 3D6TB 3T34A 3SE0A 1W0JD 4KJZA 4ESVA 2W6ID 1KI2A 2RGNA 1TQ4A 5CM9C 2BDTA 2XAUA 2ZRNA 2ODEA 3AF0A 1KAGA 1F5NA 3F3YA 4OQMA 1EX7A 1ZINA 4TMTA 4B3XA 1T91A 4IXNA 1A82A 5G3YA 1TL7C 5CLLA 4B34A 3GLGA 2ZR0A 5DSZA 5DN6D 3RDPA 3SFZA 1CJUC 4RJLA 2ZJZA 2GCOB 4ZIRB 5B30A 3FHTA 4QKQA 4FWTA 4U00A 1XJCA 4LC0A 2ZJ8A 1M2OB 4DSTA 1KO5A 1TQ2A 3TKLA 1Z0KA 5FFMA 5FUYA 5KSZA 5TXGA 3PITA 5DI9A 1RKBA 3EA5A 2LKCA 4IOLA 3QXXA 4MRVA 2VO1A 3MSXA 4ZDKA 1OFTA 3OF5A 1DAKA 1XD2A 3IUYA 1AKYA 4PO1A 1VCIA 2TMKA 4LJ7A 5J5CA 1UDWA 3WNDA 4CZ2A 4LPSA 4QJ5A 2QAGC 3C8UA 4YC7A 2O0JA 4M2LA 5FPYA 4NZYA 4QGGA 3LLUA 4CIDA 4GNKA 4CEJB 4TL8A 3CR7A 4IXMA 1U90A 3Q7PA 4DT1B 2DWQA 4UKDA 2FGKA 5GJCA 3P32A 821PA 2AN9A 4KSBA 1KO4A 4C0HA 3WNCA 1X3SA 1HA3A 2R6GA 4A15A 4WVFA 5AUOB 1J70A 3VQTA 1G7CA 1WRBA 3ZVNA 2WZQA 1KNXA 3FGNA 2ZI4A 4UJ3A 1ZD9A
chains in the Genus database with same CATH superfamily
1P4HA 5AHKA 3L7MA 4C4TA 1AB5A 4TGLA 4A73A 1MW9X 4EO4A 3LY8A 2XDWA 1FTWA 3CW8X 3DBOB 1ODSA 1PWZA 2PSDA 5BSRA 4WPGA 2I8AA 3IE1A 1SXPA 3CUSA 3DVRX 2HRZA 4YMGA 2HMUA 4MZXA 3JQEA 1XXHE 3HZRA 1CJMA 2WU3A 2P2DA 1L1QA 4W9MC 4A0SA 1VHJA 1YR3A 1EM6A 1XBTA 2WB2A 4UXJA 4FDVA 4NH0A 2FPGA 3HKDA 4RDCA 1NMYA 2P0YA 2QM0A 2J6IA 1YFJA 3I2IA 3FYUC 2VAMA 4AJ9A 4EVQA 3IQDB 3H4MA 3AI2A 5T5QA 3VYSB 3LD9A 3HRKA 3OCVA 2UDPA 3PQEA 2C7VA 1POXA 3CLUD 1EXNA 4FLFA 4FMDF 4P4GA 4RDHA 3UGTA 5AT1A 3VGPA 1MTOA 1PR2A 1PWYE 2BKVA 3NM6B 3OT1B 3P9IA 1HOTA 1MB4A 3EHDA 1NXOA 2BAGA 2V98A 1KC1A 1NVAA 2Q1UA 1PR3A 1YQUA 1KO8A 3KKZA 4HLUA 5EIBD 5K20A 3M3PA 1SC1A 4TYMA 2JVIA 1RXWA 2P4SA 1TMOA 1X1SA 1YJ5A 3AUYA 2GKGA 1NU6A 2WY2D 3S68A 1XVLA 3A2NA 1IN1A 3QWIA 2I76A 5KTOA 2C4KA 1C50A 4IHJB 2CZGA 4MROA 1H9BA 1KBZA 1OTXA 1YJCA 4AJOA 1O95D 2FR0A 4ZMSA 1K8RA 2ERXA 5DEOA 4AJPA 1RTTA 2PWZA 2QR3A 4EITA 3GEPA 1QHSA 3LW7A 1IWPB 2PEYA 3ND6A 4DTCA 5GONA 3L4BC 4AIIA 4PVCA 5JCOC 2DHQA 4HL6A 2VH5R 4JEMA 2Q5JA 4X0EA 4O4IA 1C3JA 5AVZA 2L0XA 4DUGD 3KELA 4ZDIA 5AVQA 4B3JA 4OPMA 1CFJA 4JQCA 3SNKA 2OZKA 3AQ4A 5DDIP 1E1QD 3IA2A 5SZHB 1ES9A 5KB3A 3L8MA 2GOYA 4JODA 2WZBA 2ZS7A 4GEKA 4GDFA 1V0JA 2Z95A 3A6KA 3ETLA 4BB0A 3ZWOA 3B1KA 4E1AA 2Q2WA 4KQKA 3ZY5A 3H11B 4XM1A 6LDHA 1L4KA 1U02A 1J0BA 2AI3A 2E4ZA 1IZ8A 3LCJA 3KQUA 2ZVPX 1P4JA 2IYUA 3RSLA 1UMDB 1YVPA 4Y6PA 3GVIA 1DAMA 3IV7A 3O7MA 5G4LA 4K8RB 4C2BA 1GPLA 1ECPA 1GVNB 3CNBA 3W8DA 4DR3B 1VRCA 1ZESA 3W4JA 4L2IA 4ESHA 3BIJA 5P8WA 4Z49A 1X1RA 1YV9A 4PEVA 2ATIA 1ZHHA 4EGJA 1QX4A 2ZSUA 2LWIA 2IPAB 1IOVA 2WMYA 3JTMA 4UU0A 3ES9A 3MW8A 3OY2A 3WTCA 3PEWA 4F6RA 5AJUA 1NQXA 2XVMA 1EFLA 4G3XA 2YIJA 3G89A 2QK4A 2GK3A 2W6NA 2WHYA 1RJGA 5C8XA 4WVLA 2R65A 4X6UA 1WZEA 1UK9A 4WCFA 1NZJA 3VVBA 4CMKA 4KREA 2GTHA 1J39A 1J9ZA 1A5AB 1GDDA 1LPSA 1Z0IA 2CDCA 3B5IA 4XRRA 2GSWA 1O8BA 4GOKA 2KM1A 4IHAA 1B23P 1YXMA 4UATA 2XIJA 1GV0A 1YOVA 3MYYA 4RZXA 4G4GA 3ZWCA 3RTEA 4LI3X 2IUYA 1RBQA 4KLCA 1I1NA 3VZRA 2ZS9A 3Q7TA 1LGYA 4IVPA 1SU8A 4TRNA 1TJ5A 1DAHA 4GWGA 4D3FA 2GEVA 2JIBA 2O1XA 1FE8A 3K9LA 2QT1A 1A5SB 1LPAB 4MV9A 4WASA 1RAIA 3CKMA 5B3LA 2CV0A 5H68A 1ISMA 1T13A 3MWJA 4MWDA 4IJ5A 2F17A 3ANYB 4G5HA 1ZLXA 1SPBS 2AJTA 2G4LA 4YCBA 1OJLA 4RVNA 5C5IA 4CR7A 5DWQA 2Q4EA 4KXFB 3SKVA 4DPMA 1LBIA 2EATA 5CLQA 3G9QA 2GZRA 4NPAA 1DOZA 2PKQO 3GYBA 3ONNA 4M7OA 4V0QA 1GFZA 1UKCA 3MCUA 1I2CA 3OOEA 5IBRA 7YASA 4MOWA 3HCRA 3ZZMA 1F38A 1K27A 1QRUA 5LUAA 2IZ1A 1HDYA 3GRZA 1A7KA 2EHJA 2WRZA 4MARA 4YI5A 2O0HA 4E2ZA 2H1FA 3GGPA 3MTIA 3SP1A 1N75A 3OH8A 1MO3A 2ENUA 3HCWA 2OZLA 4JA0A 2G0AA 1L5QA 2JB9A 2DGDA 4LVUA 4UFPA 1X9GA 1UDXA 1RU3A 3O4JA 1LWNA 3THYB 2PGXA 2VP2A 5FUXA 3QXSA 3FFWA 4R01A 3NHYA 3E84A 3ZLBA 1IQPA 1OKKA 1TD9A 2WD7A 2Y67A 3O9ZA 3OLVA 2EIHA 5ESRA 5E4FA 4HPWA 4YRSA 2E4YA 2LDXA 1O4VA 4ZEWA 4IXDA 4EY7A 2HADA 1AM4D 4MWGA 3RCBA 3BIXA 3RV3A 2XUAA 4QYWA 3FD8A 2BUAA 4YRKA 2VHZA 4LMBA 4ZVOA 1D9XA 4XIIA 2PD3A 1D2RA 1YZHA 1E60A 2HN9A 3EARA 4N5DA 1SCQA 3MTEA 3DBHB 2FKAA 2WIGA 3E22A 3GUHA 3QFRA 4YP6A 1QIDA 4Z6KA 1NJ5A 4NY1A 4DG5A 5AW2A 2W71A 2FLWA 3V4OA 4Q1BA 4TKVA 1DMRA 2B8EA 2Y1DA 2VQ3A 3HGTA 2ASEA 4DRZA 1Z4IA 4MYTA 1AQJA 4EENA 1JQBA 1BRMA 1U8EA 2ZIWB 1O89A 5K0GA 4TYWA 2R47A 1EFDN 3ADBA 2PUAA 2N9UA 2DM6A 2CMHA 3AF5A 1TCCA 1UBUS 3KUCA 5CM8B 3GJTA 3KYDB 1KGSA 2WSSD 2EWMA 1B15A 5I51A 1CZUA 3PWSA 4KEAA 5EEGA 4TN5A 3P2KA 4CMCA 1ESNA 2NZUG 3WB9A 1N1EA 2F3RA 2R1VA 1OWMA 3SBXA 2NVBA 2E4VA 3HHEA 4GOMD 5DTQA 3OQIB 3VBCA 3ZHXA 3X1MA 3AJ8A 5LLDA 2BFDA 5KSYA 1W52X 1VIMA 2JS7A 3E3OA 1U2DA 3H05A 3L01A 4MI3A 1GUDA 5EERA 1UC5B 5C18A 3ONEA 3GOHA 4B6EA 2J4FA 2DP4E 4UCQA 1EK2A 2VJNA 1N4DA 1OW3B 2ZBEA 3IUEA 1BEEA 1Y8CA 1NXWA 5HWSA 1P9WA 4BO2A 1KVTA 3VJMA 1RYFA 2X8AA 3E35A 3L41A 3ELWA 2QMQA 4I4CA 1HNNA 1YHNA 1XVUA 2O0LA 1TD1A 3O7WA 4HNGA 3CF2A 3PWZA 4S2UA 4MEBA 4I1RA 1MFPA 4LZWA 3W3AA 5EP3A 4LY0A 4CLHA 2OLEA 2E85A 5BN5A 3FBTA 5J9FA 1GT6A 5DU2A 3NBYC 1E9FA 1OYVA 2BMAA 3GCZA 3K9QO 4TQAA 3LH5A 3IMFA 4JDUA 1I5RA 3QVMA 3N7AA 1XGKA 3WLPA 2A9OA 4KMRA 2EQBA 3C85A 4L4ZA 3C0KA 1U0LA 4YONB 3KT3A 2BFEB 4EPRA 1D8TA 3GVXA 4F5DA 2XBMA 3CX7A 1P61B 5BR1A 5G1NA 2ZZNA 2QQGA 2YNMD 3IBCA 3R0ZA 1I3LA 4TM8A 1T9ZA 3H2YA 4XJVA 2G17A 3FAZA 4N0EA 1X0VA 3MAGA 3MMZA 1V9CA 1WUKS 2RKOA 3MS4A 1W59A 5JNUA 3FCUB 1PLJA 2K6GA 3V1YA 4CM7A 3CJTA 3QJ5A 4G4SP 4L9SA 2F1KA 3U17A 1JFVA 1PJZA 3W3AH 3SXUB 1J90A 1YGPA 3RUFA 3VHQA 5K3OA 1DSSG 3P19A 4Q48A 3FMFA 3GPBA 4R0MA 4LOIA 3HJGA 4BVKA 1QZZA 3K32A 2ZUEA 3RRFA 4B43A 4X85A 3LWBA 4D56A 4HGNA 2RHOA 1PR4A 4YCJA 2CXNA 4BJHB 5L4NA 2X7JA 1WB9A 1SOVA 2DTXA 5DSTA 4E51A 3H9EO 1MG5A 2QU7A 1QCDA 4C7OA 4FW8A 5MN6A 4JJFA 1Y5MA 5JAZA 2JFVA 4R98A 4DWJA 3WK9A 1NXQA 1U1DA 2G5CA 4FINA 4R40A 1T1JA 1IVYA 2CNDA 2ZTVA 3B6MA 1NMQA 2PT7A 1CP2A 4XPZA 2OKGA 2ZU6A 3FSRA 3QU9A 5B57C 1ZCZA 3U3DA 1AE1A 2AKAB 2B7CA 3ZDRA 2HJSA 3E4DA 1KPHA 4LTDA 1MT3A 4LC9A 1VPVA 3ITEA 2WW8A 1UPTA 2AOUB 1SCAA 2WJYA 5A3VA 2ZRGA 1V9SA 1E6KA 5EWMB 3MWEA 5EKDA 3CMCO 3FUTA 4ZVRA 1Y1LA 2BMFA 4M38A 3P0EA 5AUQA 1YIDA 3SHWA 3NIWA 1P9RA 2PRIA 4KDEA 1EDOA 1FUUA 4BU0A 3QBDA 1RXIA 4QOSA 2ZVJA 3GL9A 2DFVA 2FNAA 3QIVA 3ILYA 4MICA 5B2EA 5F4BA 2CDNA 3N05A 4OXRA 1WDTA 5C7LO 4RAOA 3LKVA 1O9GA 2W4MA 2HQSA 1PO7A 2YIVX 4YYEA 1QZTA 3PC3A 5TARA 4E09A 4FC6A 3ETDA 4DARA 1ADBA 1YULA 5ALXA 1E20A 1T9CA 5F2KA 3B1YA 4C2AA 4N0PA 1I30A 1X8LA 4LHWA 4AT1A 4D57A 3JD4A 5GQSA 4F71A 2J30A 1LPNA 4MS1B 1GUZA 2GYWA 2Q6LA 4A2CA 3SIWA 1GCAA 1KK1A 5CG2A 5JLJA 4HB2A 5DV9A 1Z7BA 3I8XA 3H65A 2DAPA 1YZVA 3HN7A 2PGLA 3A1TA 1FQJA 3LKZA 1PV4A 2O8BB 1TA9A 1E7QA 3C6YA 1LWOA 2NQTA 2HR1A 1R6VA 2Y2UA 3LT2A 3F2IA 3AV3A 3BK7A 1CUEA 2FUNB 4MPJA 4NJMB 1FZTA 4P4UA 4BUJA 4JBWA 4QOGA 3RYCB 2PZGA 4TV9F 2VPZA 3KB1A 4J07A 1UZAA 2FZKA 2OA0A 4ZWNA 1JW9B 3SR3A 3LBHA 1WUHS 3Q7SA 3U9SA 4YJ3F 4YMIA 5H5JA 1EXDA 4HQ6A 3PQ7A 1P0PA 4KOAA 2WYUA 2OYCA 3SJBA 1FP1D 1E2NA 2J3LA 3D7LA 4WCVA 2ZRQA 4M8KA 3PJFA 1AHPA 1P29A 1JV2B 3LDUA 4INOA 1YK1A 2ZWOA 3BTVA 3DKVA 2P65A 1R6DA 3E9CA 4MV5A 4NF2A 4UD2A 3H3XA 1P0CA 4KQ9A 2VVTA 2IU4A 1D4OA 3RSCA 4JMPA 5KTNA 2Q5QA 3F1KA 3KQWA 2YJ6A 4YV0A 5KQMA 4W5NA 1JPUA 1E5VA 3KVNA 3O38A 4HDNB 4C4SA 1SQ6A 4K3VA 2A0KA 2QTTA 1PYDA 2JVKA 1LBTA 1Z2NX 4XUDA 5FWNA 5ECGC 5C1DA 4Z4EA 1E94E 2A4KA 1ZI9A 2BBSA 3LLCA 3K20A 4EA9A 4IQ0A 4EPYA 4F8EA 2JGLA 3DV0A 1QRAA 1U4NA 1UFVA 2PIAA 2BSXA 2W8BA 4IDPA 1TCUA 3NEJA 4MB0A 4N6OA 2WWWA 3I8SA 2PTHA 2C97A 1HE4A 1R8YA 1USVA 4RVUA 3H99A 3P9NA 4MAAA 3G2QA 3FYSA 2VPIA 1HPLA 1FS5A 1V5WA 5F77A 1RAFA 3U48A 2PLAA 4URHA 2ENWA 4JGBA 2F55A 2Q29A 3RAFC 1TFUA 5K8LA 1QQ7A 1E77A 1R6XA 2W0MA 2GZ2A 1SC6A 1U6JA 2IZ6A 5HS4A 1TPZA 2WJ3A 4Z0TA 5C7OO 1G8KA 2W6JA 3B20A 3D1VA 3RKRA 4JJ6A 1BXGB 5ILOA 3DB1A 4YUWA 3DZIA 5LIRA 3AHGA 4QM7A 2NNLD 2VDRB 4OL0A 3FDIA 4CN9A 1ZR2A 2JKYA 1GYPA 4O5AA 2ZSBA 5FUVA 1C30A 2BUCA 2FPSA 4OY3A 1WP4A 3NVAA 2P69A 2H1WA 1RAEA 1DBSA 2R6AA 5CX1A 3JVVA 5B55A 1I24A 2LKDA 1I0LA 2GB4A 2GRJA 3I01A 3SEFA 1AUPA 2PUWA 5FR1A 2R7AA 5BN4B 4DNXA 4R41A 2BKAA 4A4DA 1S3IA 1X1BA 5G4KB 4RPCA 4DPLA 3TXXA 1ORVA 5DYTA 3DR3A 1CKEA 1EE9A 3T5GA 1L7RA 4IRXA 5T57A 3IMKA 4IH9A 2B1RA 1NN1A 1CDZA 1YZYA 1KP2A 2EG9A 3DMPA 3KJGA 2BZ0A 2D1SA 4C7BA 2XKAA 2IS6A 3E7XA 2UZAA 3B60A 2C83A 2D8AA 3PXGA 4KRFA 2B1JA 1YL6A 3ZHSA 1JKJA 2PS1A 3LY9A 1WETA 3TNYA 1C3OB 3ZLUA 4BTLA 4DWOA 4E5DA 4EDFA 1GPWB 2H2DA 3NAMA 3H0KA 5DI3A 3KHUA 1R37A 1Z6GA 2D3WA 3EFOB 1BJRE 3E7PA 3P26A 3KZVA 1JHOA 2XTJA 2J09A 3B7PA 4OJYA 3THWA 1CZRA 5BSFA 3D2AA 2FPLA 1FFAA 1QG2A 4FR2A 4IPTA 1X74A 1Z38A 1HK7A 2BFMA 2QJWA 4IYJA 4TXHA 4X7MA 5C32A 4EA7A 4F6LA 1SVSA 5HKKA 3IC5A 4RLSA 5I8ZA 2Z5VA 2F1RA 1AZWA 1G8HA 4HEJA 4BV9A 4EG4A 1RMTA 1KH3A 1WSBA 1L4NA 2VHWA 4GZLA 4LXGA 3TZHA 2AVDA 4DMHA 4DW8A 4JI6B 2QVBA 2BP7B 2HRQA 2JW5A 3NTLA 5CT8A 3I9LA 5J2UF 3F7MA 2HA0A 1FNNA 1YCDA 2JI4A 3DUFB 2EBFX 3UJHA 3PLAE 1JXQA 1SELA 1K9VF 2QVLA 2WEKA 2FHSA 3S1AB 4MV4A 5IEJA 4LF5B 3EXFA 2J3EA 3AOGA 2J6HA 2K5UA 3CE6A 3NC0C 4MV6A 4QG7A 5HS6A 2QXYA 3WLFA 3C6QA 3VKFA 1JHXA 4GX0A 3PNBA 4MUXA 4JKYA 2MJLA 4XGNA 4DILA 1CNMA 2Z0MA 1F0NA 4WXEA 2B8JA 1I2BA 4Z2AA 4G0XA 3A0UA 1CUBA 4EW1A 3BX1A 2P7HA 3A9UA 3QF7A 2XB2A 1ZAYA 1AQIA 1CY6A 3QKRA 2XQJA 8ATCA 4LOLA 2AE2A 3ZIAD 2JAQA 4IH4A 5I6DA 3OPYA 4WK0B 2VCYA 4H17A 4H7PA 3G9XA 1NHWA 2X41A 1PN3A 3Q3CA 5ECDA 1ILEA 2G40A 2I54A 4WERA 3T1NA 3DR5A 4IWNA 5F1OA 5K6AA 2A5GA 2IDZA 3SSMA 1XD9A 5LXTB 1P0FA 2E5LB 2EKQA 3QW2A 1FFWA 1UBMS 2W90A 3HN6A 4L5CA 4M6WB 4I6GA 1YS1X 5D1HA 3IV9A 2NVWA 3ZHYA 1K5PA 1DKPA 2FXIA 4BMZA 4LF9B 1WE2A 1JIXA 1C8VB 4JA2A 2WHEA 1E32A 2IPXA 4Y7DA 4ZQBA 2P1RA 4NFSA 3BMOA 4P3KA 4ZYYA 5JJIA 2IZ0A 3N6RA 4UHEA 1BTOA 1U8FO 3QKIA 2NGRA 4HNVA 3BL5A 5K8TA 2FSVA 3M9XA 1ORIA 3SC2A 4PTLA 2HA3A 5DX1A 3PIRA 1OAAA 1WBBA 3Q9UA 4QSHA 2VDLB 5D5HA 1VPEA 3QNMA 3GJQA 4MQMA 2QQ0A 2UUCB 2R6JA 1XWWA 1R8SA 3MJTA 4L8VA 3W90A 3JQFA 2JA1A 1KC3A 2TMYA 4G0PA 4MS3A 3LYLA 4IGIA 4QQFA 2BKXA 1C9DB 1XROA 2VPPA 4UU8A 1IJBA 1H3NA 2WJPA 2KLHA 1ZN2A 2NO6A 1DIOB 2WYWA 5IXYA 4I50F 3V8RA 5EE9A 2JIMA 1NDUA 2WVAA 4HX5A 4QDTA 4OU4A 1G6Q1 3AFOA 2Q8QA 4YHHB 2V3CC 3UN1A 4MWTA 1TUBA 5DNAA 4MQ5A 3AERB 3QITA 5I47A 2DVMA 2IKQA 4O59O 2WF9A 1GU7A 2J0UB 1GA1A 4RMHA 2NADA 3EISA 5LQNA 4HH1A 2PX2A 1VL1A 3BGVA 2IPMA 5FA6A 3BIWA 1T9BA 1N7GA 1TAQA 3Q0EA 4OCZA 4YMHA 3AG5A 3CF4G 4GOND 4TLCA 1F2TA 1ZG3A 2F6RA 4NBKA 4WZBB 3RBVA 4FGJA 2HU5A 4K3UA 4R3NA 4ABYA 4DCTA 1QOQB 3FZEA 3I28A 2H51A 5BOSB 2F8TA 1SJ9A 1SEPA 3PRYA 5GV8A 3OIYA 2ODAA 1ULSA 2Y1OA 4N0DA 1EESA 4E5YA 3OBIA 1INLA 4KN9S 4ML3A 4HH3C 5C3MA 1JJFA 5M3BA 2L2QA 1GUBA 1E7MA 5LD2B 3CRZA 5DP2A 2NXWA 3D5TA 4WEQA 1JR6A 1CQZA 2EQ5A 4MQLA 3TM5A 5CLGA 5ICCA 1QC5A 4KO2S 2I2WA 2WWXA 4HXYA 1PR5A 1P5ZB 1M9NA 3ORSA 4H16A 1ZD4A 4UM7A 4KI7A 5T4HA 1GPYA 3GEEA 4BP1A 2V5AA 1Z25A 3COZA 1PJSA 2ZB7A 3FKSA 3N6VA 3EVZA 4WXMA 5BV7A 2ATVA 1UWLA 3LHFA 4D6PA 1FYVA 2FR1A 1NLYA 3RHSA 3RAEC 4JP8A 1T36B 1PZGA 2NT3A 2ZJ2A 4HTAA 4QPPA 3W7VA 2IH4A 3D43A 1T0HB 3MIZA 1A8QA 2J3MA 3OT4A 3QNWA 2OORA 2A59A 3OQHA 4URXR 5LQRA 2ADOA 3COYA 3E1SA 3F67A 4MQUA 5HCIA 4AUNA 9LDBA 3GOQA 4IR7A 4PC7A 4R9RA 1TEZA 1XP8A 3FX2A 1XQ6A 1DC8A 4QNRA 3V46A 3ZW8A 5JASA 3M1YA 1GZ4A 1Z6TA 4XR9A 1Q0TA 4QREA 1Y6ZA 2ZYRA 3CUYA 3IAFA 1EFAA 1GNQA 1XTUA 3DLIA 1SVOA 2PR7A 3O4VA 1TLLA 3F8WA 5LVAA 3QXJA 1XNRB 1H0KA 2RARA 2A67A 5HJ7A 3AM5A 5ER9A 1MP0A 1MFZA 1IEWA 2IYLD 1GNTA 1RBYA 4QATA 1D2MA 2Z1DA 3BZUA 4RD2A 3S28A 1CUUA 4CM1A 1Z4OA 5KAMA 2AKYA 4H1TA 4NRDA 2N3ZA 4RQUA 4U7JA 1IBSA 4I1IA 4OGWA 5FNZA 4PGAA 4IJUA 4Y30A 4IIUA 4PCUA 2CNBA 3OWXA 4EY8A 1K8XB 1P4SA 1XVTA 2FQWA 3OZ7A 3WWPA 5JHHB 3YASA 3EXHB 3UO8B 4KPYA 1E4OA 1LBSA 4O1IA 4RCVA 2JDIA 1UPAA 3PLRA 5HKAA 2IPLA 3RADC 1LSUA 2IEBA 2OV4A 4E22A 1KJIA 2JIZA 4YPVA 4XCXA 3N8NA 3R3UA 5ER6A 1TYBE 1RXUA 3AEKA 5KDLA 2PMBA 1FXUA 1J7KA 3GZNA 3KKEA 2EZUA 1XEXA 3OM0A 1K66A 4PAOA 5DMXA 3EBPA 1J97A 1QZXA 3NIGB 1QO7A 5JVDB 5HVNA 3AB7A 1FTGA 3CT4A 1OT5A 2JBWA 3HY6A 1HE3A 4GX2A 2F3UA 4RM2A 4KQXA 3OWOA 4P0TA 1FMLA 2CY0A 2W6PA 3GA0A 4RFVA 4RL4A 4MR7A 4FILA 5JISA 5LKRA 3NJ4A 4CT5A 1XMQB 3L77A 4PAMA 1A9YA 2FW7A 3ME5A 1TUGA 4BWYA 2B7BA 3NDBB 2JF0A 1KJZA 1ZK1A 1EP3B 5EHQA 3JD1A 5AK5A 3GHHA 3USCS 4YAGA 3JAKA 4FS3A 4B5LA 1D1TA 1RM5A 2O2ZA 4UUNA 5I9BA 3K09A 4AK9A 4BNDA 1VJGA 1RXEA 4HX2A 4MKXA 4LYEA 4RVCA 4BL5A 1KQPA 2FFAA 2WWYA 3B78A 4M54A 2VT2A 4RM3A 1IY8A 1G16A 3SVLA 1NRIA 5H1YA 3BRSA 3T7SA 4E32A 3MJSA 2JFPA 4P22A 4O4HA 3MLEA 3GLGB 5K2MA 1N2IA 1FRFS 2Z43A 3KOWA 2ECPA 3NHPA 4CF3A 1ZI6A 1Y1QA 1X80A 3K9NA 4ND4A 5CG1A 4DR5B 2GS9A 3EZLA 2FFBA 3EDYA 4PGMA 5EIWA 1RHJA 4JZKA 4RK5A 3QWAA 4KTTE 3NIBA 1QHGA 1FTQA 4ZVUA 4ECAA 5IDQA 2ECFA 2JFZA 2VEDA 4MYRA 4FPXA 1BMFA 1GKYA 3EIUA 3GNTA 1XELA 2WF7A 3SFVA 2W4QA 3HBLA 4QHSA 2CFOA 3FWHA 1GN9A 2NUAB 1T5OA 2XZTA 2IDJA 3KOOA 3C8MA 4LK2A 4BXOB 3WYNA 4MK4A 3IO3A 1G8YA 3L04A 3C1OA 1IUKA 2QSYA 4X94A 1ZSNA 1E1MA 3MUNA 1AB6A 3IDQA 4QUAA 4PR0A 2V74B 4CCYA 5REQB 2JLCA 3TECE 5MFZA 1QAMA 1XTPA 1LFDB 1XRJA 1FYWA 2H4XA 4CFSA 4EX6A 2HJWA 4YRBA 1NUHA 1HDGO 2E5WA 3SF8B 1JLLA 3H4TA 3TZ6A 2EFCB 5A9SA 1ZVJA 2A30A 5A04A 5D6OA 3OOJA 4BQIA 4XQ9A 4DDMA 4YMUA 1BVRA 2H54A 2Q3HA 3PGJA 5K99A 2PMFA 4EHDA 3OCJA 5HILA 5BVHA 1E2JA 1ECFA 2OCIA 1KKLA 3JQQA 1SIUA 4IJVA 4PQRA 3PNYA 1W5FA 3UICA 2GRAA 4B2LA 4FE4A 3NMUF 1UADA 5EZQA 5IXJA 3I83A 2GETA 2IEYA 2P7IA 2ID7A 1ZZEA 2DECA 2WYVA 2ZYIA 4XYMA 3KTAB 3H9JA 4RTQA 2X8BA 4I4TA 2A5JA 2H65A 2ZBDA 1RMYA 3GPIA 2QOEA 1YWGO 5EJ2A 4GI5A 4A0RA 1ZUWA 3X44A 4KXUA 1SBNE 4F9EA 2KX7A 4BZPA 5KNBA 5GTDA 2J45A 1E9AA 3EGWA 5B3JA 3KKKA 1OILA 1NN5A 1SU6A 3OLXA 4MQFA 3KUUA 3FNIA 1E2GA 4LY6A 1LV8A 3TNLA 4CDRA 2PYZA 5DM1A 1GPUA 3KQYA 4GZ3A 3P52A 5AM1A 4JI4B 1NUPA 1IDN1 2P79A 4C0KA 1B0PA 2DLDA 4G0YA 4RC9A 4CDMA 2P2LA 3M5DA 1Y34E 2QUAA 4J0QA 1EUCB 2JC3A 4U0JA 4FQ7A 4ZT4A 2ODTX 3DLPX 4BVHA 5KYXB 1H2ZA 4DG9A 4ZQIA 3WBFA 1Y7IA 3F6BX 4OUKX 1N57A 2H1RA 2Q46A 1W4RA 1U1IA 3GZTB 3ZGNA 5KNBH 3LOUA 2DSNA 3V9AA 2VKTA 1CYEA 5EGSA 1KZ6A 1ZZGA 4WNAB 5KWSA 3A32A 3DFZA 1RIFA 5ADHA 5LU8A 3D3WA 3DBVO 2OV1A 1H66A 3NB0A 3K8OE 1MO4A 4NV3A 2XKBA 3A1NA 3S4YA 4AS2A 2QE7A 1TT5A 2X13A 3JRXA 4RZ2A 1DKMA 5E8RA 1I6KA 1N2EA 2Q3LA 1MW8X 2IYQA 3CFYA 1NR1A 4PPFA 4DY6A 3M4ZA 5BQPA 3A1UA 2PUDA 2E82A 1UPUA 2ZT6A 2WU4A 3IODA 4X6YA 3ZNQA 4RV5A 2G3YA 5EJIA 1MA0A 4RH0A 4TYNA 1R8XA 1GGEA 2VXBA 3TOSA 3WWEA 5CBPB 4KE7A 4L57A 2ZBPA 5TQ2A 5ICMA 2XQGA 3GUCA 3ZCRA 4NL4H 1ZIDA 3FFXA 5CPFA 1JKMA 1JG7A 1GTJ1 1KY3A 2PGAA 1Q95A 1V6AA 5A5DA 3LXRA 2Q0HA 3AY3A 1UKAA 3VHLB 4G1BA 2JRLA 4YI3A 5AIBA 1XPRA 4QHYA 3IAEA 2VHUA 3U40A 1U2SA 1VPTA 1JAIA 4K2HA 4RVFA 4RYDA 4M0DA 1E4EA 4JLNA 4BO9A 3UKJA 1WVMA 1Y8RB 5F5NA 2ILTA 5ALNA 4RIGA 5AI0A 1YB4A 2H2IA 2XUKA 3F90A 3RS5A 4K6KA 3A3YA 4RVDA 4DMFA 1C7EA 1XA4A 2B9VA 3ESXA 4P4NA 1FSPA 1G4HA 1Z0JA 3IEPA 4UPVA 1PNOA 5K0FA 4ENUA 1MEJA 2WJ6A 1O77A 4UNNA 4KN8A 3UT5B 1QR6A 3VMMA 3WLSA 3DTVA 1QZUA 3FMGA 5B4UA 1XG5A 3IQIX 5AHRA 2CE7A 1KZ4A 4F85A 2I3AA 5CAEA 1N6HA 1ZGHA 3FNFA 3ORRA 4N9WA 1QYCA 5KQRA 4C4AA 4PF1A 5DEIA 1RP1A 1PJ4A 3IQGX 1LRLA 1LQUA 2QMZA 5EINA 5IJ9B 3IS3A 4LDPA 1QQAA 4LRXA 3JARB 3V8QA 4ZO4A 2RHHA 4CV3A 4QVGA 3F6EX 1D6NA 2A7QA 5L6LB 1Q83A 4CETA 4ASUD 1TUEA 1FU4A 1BFDA 5E7QA 4FBLA 3RANA 1C4KA 3EGEA 4LRYA 4IIGA 2XDAA 1J2YA 2IHTA 4HQRA 3EULA 5TJ9A 2DQKA 3IQFA 3HM9A 1NDHA 2P1ZA 5IT9A 4CVNA 4F21A 2WYHA 3F49S 1GQSA 1NM5A 1HY3A 2FJ0A 4FP9A 4J3JA 4PZ9A 4DC0A 1B0AA 2IELA 2CLIB 2XMPA 1ECBA 1KVQA 1XKTA 1GPMA 1D0IA 3SK0A 4AKSA 1GZ6A 1NJ2A 2JAUA 3TVDA 5ALPA 4OUDA 1KWKA 2OKCA 1E7YA 3ZGVA 2P27A 5KSOA 4IV8A 4OQQA 3NBMA 2H9AA 3IE2A 2B2CA 1DAFA 3LVFO 3VZBA 5TQ0B 3WWYA 1WX1A 1R74A 5IT5A 1KYYA 1W7AA 4J4TA 5HFNA 5ALJA 4YV2A 3RI3A 3CZPA 4JIMA 3EOBI 1JPJA 4IJQA 5FV7A 3QZUA 4OLFA 1RHRA 3SYNA 2VSFA 1CUWA 4GKBA 5DGXA 1NONA 1PBNA 2FZEA 2JH8A 4PWYA 3R7DA 1YVDA 3FYTA 4AUKA 4PLCA 1NFRA 4BASA 4B7ZA 2X7HA 4X20B 3ZGZA 2CXUA 5JH7F 2AYXA 2GN2A 3KSUA 4K6GA 1NFFA 1W87A 1TJ4A 4ND7A 1T3SA 5F2OA 3WHLA 3FSGD 3OHSX 2IE0A 5DW0A 2GNPA 3JQAB 3I6ZA 3HA5A 1DINA 3NQ41 1PE0A 2BEUA 2EP7A 3FKQA 3K15A 4MA5A 1K0FA 1O5OA 1GG5A 1IAQA 4M7PA 4NEQA 4WCFC 3OZXA 4FUTA 2O3RA 2NU9A 3P27A 1XVIA 2OLJA 2CFRA 4I99A 5EVJA 3JV7A 1LSOA 4PFSA 2MT9A 5JCJD 4PZDA 3LCMA 1P1JA 4GQBA 2IX9A 3MT0A 2DOKA 2QZSA 5CIYA 3F78A 3QYPA 3T15A 4HUQA 3HCBA 3DGFC 3PVSA 3KWFA 3ODPA 4BLTA 3FOEC 2LPMA 2Q1SA 3IAUA 4NBRA 4UE6A 3VTZA 1OX4A 1ZC3A 3B8EA 1Q1ZA 3R5JA 4CKEB 3FJYA 3FJOA 4BV3A 2J7PA 3G9TA 3PVZA 1M73E 1EDDA 3HA3A 5ES4B 1WPRA 2AG8A 3GH1A 3LDGA 3B9RA 4EKIA 4YRIA 2O59A 3H42B 1FOEB 2P9HA 2Y0PA 3FPCA 2DFTA 3LCCA 3O4HA 1O96B 4IFTA 4GF5A 1L5NA 3C3BA 3N53A 1QHFA 3WAKA 3OMWA 3O92A 3M4JA 3TSYA 3PT5A 3DZCA 2GEBA 2VYVA 1IY9A 2ECKA 2IYRA 1SAYA 3H1AA 4QPCA 2R00A 2TSYB 5FAKA 2CMKA 2HDWA 4OIMA 4C3VA 1BX1A 3HFJA 2QX9A 1DV2A 1BE0A 1IBCA 1OR8A 2H00A 2Y4NA 3G7SA 3NR2A 4KZKA 4QGAA 5DXJA 5EXXA 5HMLA 1Y42X 3S99A 1PEAA 2O8VA 1ADCA 1NNEA 1J06A 2H5IA 4U2CA 3UXHA 4DNOA 4I66A 4JB3A 1S8OA 2DHCA 3DUWA 4P4TA 2B4KA 1NQTA 1Y7PA 2UVPB 2J46A 2OENG 3K05A 4NE9A 3ZDAA 6PFKA 1XZBA 4IKPA 4WXHA 3ZQKA 3GRYA 4HJXA 5CGZA 2FZGA 4AZ0B 5HEKA 5EI5A 4QE3A 4L7VA 4ENSA 2QAIA 5AYVA 4MJLA 4RCYA 3D8NA 1ORDA 4F3RA 1KJQA 1JHMA 1S2DA 2H17A 2X8LA 3H1PA 4ND3A 4ZI7B 4X7PA 3TINA 8AT1A 1F8FA 2YWBA 1ZMTA 1G6OA 2UKDA 3EXEA 3GPCA 3O4IA 3ZNNA 4OOEA 2X7XA 1RYMA 4H77A 4BCDA 2FW1A 2QRPA 3AEUA 1VKNA 4DMLA 1E9SA 3T5MA 3FSEA 2XGJA 1C3VA 2BCEA 1K7FB 1UOQA 1JQKA 2CB9A 4FFRA 3E2PA 3V00A 1PL7A 2ONYA 3ZYZA 3U9TA 5LOVF 1TE2A 2WHRA 5AI9A 4WKNA 1KEEB 2GERA 5DM2A 3RFTA 2QP4A 3PFNA 2QRHA 2I6QA 3OEEA 4U7DA 3MWLA 5KNDA 2V7QA 4RGQA 2X0JA 3DEJA 1R4NB 3OX1A 2HL6A 5AD1A 3MINB 1MEOA 1BWRA 2H31A 2JFBA 1CRZA 4RA9A 4EY3A 3RUPA 4G1EB 3RNOA 2RH5A 3B5JA 3AKEA 3N8DA 2C9OA 3SX4A 4RBNA 4ACAA 4EQZA 1QU3A 4BUZA 4TRRA 5JNVA 2WDPA 3QA9A 4JEHA 4ETIA 5GVSA 1H9CA 4MCAA 4YO7A 2BLNA 1GRCA 2PBLA 1YMQA 1SA0A 4LYJA 4N5HX 2HQ1A 1YONA 2FOXA 2XKKA 3T4PA 3ZI7A 2FP4A 4P81A 3AGQA 4WN9B 3DAOA 4DA8A 4RABA 5DNYB 3O91A 1BOOA 4C76A 3FI9A 3OZBA 5KNDH 2PXXA 1TYDE 1YE3A 5CNJA 4K9NA 3ZWNA 3D2CA 4XD7A 4CWAA 5H3HA 4EPVA 4P7BA 5BSVA 2BHNA 2NU7A 3K6SB 1G42A 5AW0A 3GDGA 4BRUA 3AO0B 1L5YA 2R2AA 4ZI5A 1DRKA 2O50A 1GD1O 2ATXA 3H4IA 2B3DA 3WKBA 4A6DA 5LMUB 4CLXA 1N0HA 2V54A 3DEYX 3FTPA 3KZXA 3V2HA 5K0TA 3BJRA 3QMPA 3ABIA 4QARA 1BE8A 1P5JA 2B4YA 1OT3A 1SRRA 2J32A 2O07A 5EJ9A 1X15A 3P4XA 2DU8A 2ZIUB 4UHJA 4M0PA 3LIIA 4E0BA 3VU8A 2AD1A 5CVVA 5CCDA 3KCNA 1E2IA 1Q14A 4V1CI 1KKUA 3RU3A 5LIPA 1Y98A 5IYZB 2MYTA 3NHJA 4BLRA 4PBSA 4RF3A 1CZHA 4YBZA 3RIHA 1TTHA 3WJ7A 2W2MA 1OC2A 1FDRA 3RT1A 3GU3A 2PJZA 2QP9X 3HR4A 2CJWA 3V8NA 4TKLA 4MZDA 4V0RA 4MRSA 4P4SB 5FWYB 3ROKA 2E48A 1K7XB 3TW4A 4BVBA 1UT5A 1OV6A 2XMSA 2PUGA 1ZA2A 4DLZA 3QP9A 4XYGA 1USUA 4YLYA 4QEKA 3VTFA 3TGLA 1OPRA 3A58B 3FHJA 4AMYA 5JO0A 3BB4A 3OF3A 3IP8A 3TSWA 4HDRB 2RB4A 5T8KA 1CSEE 4GUDA 4BWGA 3ENZA 3LDFA 3EXIB 4H7EA 4GPTA 2VRBA 5FQOA 4JI5B 1TCVA 5IBCA 4CEJA 2GKSA 3E15A 1ZISA 4MQEB 1T5HX