3SQXA

Structure of mss116p (nte and c-tail double deletion) bound to ssrna and amp-pnp
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-Throughput Genetic Identification of Functionally Important Regions of the Yeast DEAD-Box Protein Mss116p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
total genus 196
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sqxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sqxA02
3RS5A 3B78A 3EWSA 2WM9B 1T9HA 5JHGB 4TLCA 1XB2A 1UKVY 3U5ZB 3ZJYA 2UKDA 1N3BA 3REFA 2WKPA 2J0UB 1B0UA 4XH9B 3Q5EA 1G17A 1EFUA 1Z2AA 4Q01A 1G8PA 4YMSA 5JEDA 1XDBA 3BB3A 3CR8A 3QEOA 4KLNA 4TMZA 2VIIA 1VECA 1U81A 2ZYTX 3LDAA 2QAGA 3REGA 2ZJBA 3GLHE 3BWDD 2ZS8A 1VCMA 2GWHA 3B5JA 3CM0A 4DLWA 1OB2A 3B1XA 2ZR0A 2YV5A 1W46A 2Z0MA 3B1ZA 2EFHB 2ODEA 1U98A 2QGNA 3DM5A 3VR4A 4ACBA 2VP2A 1TMKA 3HPRA 3SFZA 1JAIA 1CJVC 4UXJA 3VHXA 2ECKA 1R7RA 2YC2C 4OHXA 2G83A 3UMSA 3TGPA 1GKIA 1ZM3A 5TY0A 3FFAA 2W0SA 2FF7A 3RDPA 1VG9B 4BFXA 1UBFA 2MSCB 1U90A 3E5HA 2OBMA 3RS4A 3VR3A 4HLUC 1YRAA 2FH5B 4FINA 4DSNA 4GL2A 1RRPA 3RRMA 3NBZC 5JFGA 1KK1A 4L5BA 3L2OB 3HJNA 5E7JA 1TQ6A 1OSNA 4FW9A 2D7CA 2C9CA 5DNYB 2V6IA 1M7BA 4YONB 1SXJA 4HB2A 4NU0A 3PIRA 2H92A 2O52A 4KYUA 4TMWA 2OG2A 2VA8A 1HY3A 521PA 4C7OB 1IY1A 1E9EA 2QTHA 3QNUA 3AVWA 1Y3AA 2A5GA 1OF1A 2XB4A 4FIDA 1WBDA 3TBKA 1WA5A 1WF3A 4LUCA 1BKDR 1E2FA 2JJ8A 3K9HA 1QHSA 5KSZA 1Z6TA 1YZNA 2FNAA 1R0XA 5KHOC 2P5TB 2BKEA 4ZI2A 4C0SA 1C9KA 2GJKA 3GFTA 3KKQA 3DM9B 3P27A 1II8A 4CZ2A 3NHBA 4C7OA 1GM5A 4IFBA 4WZAE 2YC4C 2QBYA 1VYTA 4PTLA 2G9NA 3ZQ6A 1DO2A 1G3QA 3KXKA 3UPUA 3KKPA 4KSBA 4ESVA 5G40A 3BBPA 5CB6A 3GP8A 5FOSA 3VKWA 3RS7A 1YJ5A 4GP6A 3SJBA 3QXCA 1E9BA 2IXGA 5FTKA 1KKLA 1P2TA 4B75A 1N25A 4OKSA 1A1VA 4R98A 4PFSA 4HDOB 1G5PA 4LPSA 5SZKB 3T5DA 2VP5A 3HP1A 2O8BA 3QI2A 2NQ2C 1OHHA 3K09A 4JZKA 3KXLA 2Z83A 4QC2A 1XXHE 1U0JA 4Q1DA 3P20A 2CL7X 5L3VA 5L3QA 1NP6A 1Z0DA 3ICQB 3EAQA 4JJZA 4NONA 2G77B 2QMUA 3CNLA 3KUCA 1JAHA 3LBHA 2QMEA 4P4TA 5FUYA 1P4SA 2B8TA 3OFNA 1KDRA 3BERA 4L16A 3AUYA 3K0AA 3I5YA 2ZRAA 2PT7A 3JZMA 2CLDX 1NLZA 2JIZA 3BE4A 4OQNA 2IYXA 2WPDA 3G5UA 4C0QC 2NZJA 2JLVA 4CEHA 1NMZA 1KSHA 3DOFA 4RD2A 4BFSA 1TTTA 3UKDA 3TNFA 2P6NA 1ZIPA 1VG8A 1YVDA 1TF5A 3O47A 4M9ZA 5J47A 3B1VA 4I1OA 1EFCA 3H2YA 3K1JA 3I72A 2QMHA 3KB2A 5CK4A 3SJZA 1OV4A 1NG1A 2O0JA 4E09A 4EQ6B 1NN3A 3BD9A 1ODFA 4TTRA 1OYYA 3OZXA 4DIEA 5C18A 3O8BA 3DHWC 3QKSB 2OLJA 4CRWB 1ZRHA 4F4JA 1W2GA 2PCLA 4A1FA 4RD3A 3TQFA 2ONKA 4ARZA 2CBZA 3VU9A 2NPIA 4JT4A 5FTNA 2CHQA 3EPJA 3PVSA 4JS0A 2ZSBA 3ONWA 4KBGA 1SVOA 4FWIB 3JZAA 2GRJA 4IKEA 3CX6A 3P26A 3IDQA 3TW8B 2CL6X 4NH0A 4UJ5A 2J59A 1P72A 2RGXA 2NIPA 3CNNA 4DUGD 4A15A 3PUXA 5LDDC 4JT2A 4BFYA 1UDWA 1SHKA 1G3MA 4A92A 3L8ZA 5HKKD 4HUTA 4EUNA 1G6OA 1JR6A 4HAZA 1IXZA 3HR7A 1WBBA 3SEAA 1D8TA 2F1HA 5AJWA 1KAOA 5B58C 2WOOA 1N5LA 3VR2A 2ZQ5A 5KDLA 4HLDA 1IXSB 3AB3A 1YZGA 2I3BA 5KSYA 1K6MA 2RGGA 2BBWA 3U61B 5B30A 3SDZA 1G8GA 1DADA 3CF2A 2ZI6A 1TPZA 1J70A 2A5FA 4IVPA 4JL5A 5AK0A 3MWLA 4IW3B 2IUUA 1E3MA 4DLVA 3RWOA 2QUZA 1GRQA 1NY5A 1T0JB 1EX7A 4R7ZA 3ZLJA 4DDWA 2D7DA 5AJVB 2ZETA 1E2NA 1FX0A 2FV8A 1XJQA 4HAUA 3QEJA 3SS8A 3FFBA 3I32A 3LH5A 4HAVA 1G1MA 4LJ4A 3UK6A 4G5QA 3H4MA 3TSWA 1PV4A 2QM7A 3LRPA 1P75A 2MSEB 1YR9A 3DVLA 2R2AA 4Q4LA 2C77A 2ZSEA 1P73A 4N1AA 1QHIA 3VNUA 5E4FA 4QG7A 2D4HA 4A6XA 3L0OA 2QQ0A 4GP7A 3MJHA 4DC9A 2HF8A 3SJCA 3UG7A 4PHFA 4M0LA 2A5JA 2QEQA 5D3MB 1NKSA 3AP3A 5C4GB 3AVQA 1IN8A 1EESA 4QJ4A 3RRNA 1TEVA 2J3EA 2IUTA 3ZS8A 2GXQA 4BEBA 5CDFE 4KHZA 1G64A 2ZI7A 5CIQA 1G7SA 1NMXA 1ZC3A 3CR7A 4ZIRA 2D74A 2PMKA 4BLTA 5CLLA 1XMVA 1NVUQ 1GNRA 2WHXA 2ZYVX 3QXHA 4LGMA 1KMHA 1X86B 5K8UA 3U3MA 4WBSA 2J0QA 1CJKC 1AQUA 1PJRA 1T3HA 2BMFA 1YZUA 4L9WA 5EE0A 1L7VC 4LX0A 3MAAC 4DLUA 1PLJA 1XMSA 2AD5A 3HU1A 3RS3A 1W1WA 4LV6A 4I1UA 1IN5A 3FOZA 4O0MA 1FTNA 3GEIA 3KB1A 5ANRB 1Q12A 2G88A 3KKOA 4Z8YA 1FUUA 3AKDA 2W2VA 1X8JA 1HT1E 3O8DA 1BMFA 4ARZB 2G6BA 2B6HA 2HLDD 3EC2A 3OFND 1CJTC 4PQFA 5DE3A 1G7TA 1ZIOA 5DIFA 4OBEA 3TH5A 2GHIA 5JZVA 4QKQA 3S1AB 2IA5A 2GJ9A 1US8B 4RD6A 4EQ6A 4NDZA 1OE0A 2A5DA 1G19A 1YU9A 4CVNA 4F92B 3PCRB 4WVFA 3L0PA 4JLJA 5KNDA 4M4SA 2Q9BA 1JI0A 1NSFA 1D2MA 4CEHB 1N5JA 4XVUA 2ZRIA 1JXOA 4Z54A 2O0HA 1XD2B 1XP8A 3PG5A 3IQWA 1Q44A 2FPMA 4URXR 4TT3A 1EFTA 1UKZA 2Z5FA 1HYQA 4F7WA 4FMCF 3WNBA 1NBMA 4FMDB 3NXSA 1UF9A 4M53A 3IILA 1DPFA 3GLGA 5CYPA 1RYHA 5IRCD 2CJWB 2NO9A 2VP9A 1P3JA 2QTFA 2R6AA 2Q3MA 4X8HA 3VU9B 1E9FA 2ZAOA 1U0HC 2VHTA 5K8LA 3OIYA 3FTQA 3UIEA 1JPJA 4O2LA 4DT1B 2EFCB 4QOSA 1HTWA 4HB4A 4C0HA 1F2TA 4DSOA 4TMKA 1QHNA 1U94A 1Z22A 3DKVA 2QSZA 4OK3A 1ONBA 3Q3JB 4EPWA 1AIPA 2JASA 3MRSA 1R8SA 4DWJA 2FGJA 5GJWC 1NNEA 2PEYA 2XITA 2XXAB 5EE3A 4AC9A 4PHGA 1Z0JA 1OFTA 1YR6A 4TLBA 5JSZA 3SE0A 3O8RA 1Y63A 3NG1A 4A0HA 1G41A 1Z28A 2W0MA 4UKDA 4B6FA 4EPTA 2ZM5A 1KK3A 1GOTA 3B7GA 3EA0A 2ZI3A 1NMYA 4B2IA 5EP4A 2FSGA 3UMFA 1KMQA 5KU1A 1JB1A 2WJYA 1IXRC 5EP3A 3LVRE 3QF4A 2GJSA 2GEDA 2KJQA 3KJIA 3QKRB 4TTPA 4OI4A 4O25A 4YMUA 1R0ZA 3ZGXA 1SKQA 4PC6A 3IEUA 5L3QB 3K9GA 4MDEA 4AI6A 5FH9A 1P6XA 2ORVA 1ZW6A 3H1TA 1ETUA 1VKJA 1OFIA 1TL7C 2OESA 4URVR 4Q4AA 2C9YA 3U6KA 4L8GA 4LC1A 3BB1A 4TMVA 4M9XA 3X2SA 1X3SA 1XWIA 1W0KA 1S96A 1EGAA 1S9HA 2EYUA 4KFTA 5FFMA 2IS2A 4AKGA 2ZYUX 4UNQA 4Y0VA 2YOFA 3LQQA 3AF4A 3OF5A 4HATA 2HCJB 4IOJA 4D0NA 3DMNA 4MKHA 1K5GA 2NGRA 2CXXA 4QGAA 5LB2A 3IHWA 2WJHA 3C5HA 3RSLA 2Q3FA 3PENA 2WJVA 5C2JB 3TUJC 3U3KA 4NZYA 2ZI9A 4BWYA 2A30A 4ABYA 2IUSA 1ZNZA 2J7PD 3WHLA 4KFUA 1W4RA 4IOLA 3QE0A 3IPYA 2FZLA 2R62A 3T1TA 3TUIC 4Q4JA 2IYRA 821PA 3HYTA 1DAEA 4HLUA 3TW4A 2GAOA 1SKYB 1T91A 4KCGA 1I2DA 5DYIA 2QZ4A 4DB4A 1NVXQ 1T8TA 2IYLD 3U3OA 1S2MA 2QI9C 2ZXUA 2QGZA 4PO8A 3F8TA 4TMXA 3VAAA 2JAQA 3E2IA 1E6CA 1S3SA 5E7IA 4D4JA 4DLTA 4Q7KA 2DWPA 1RKBA 4LYJA 4LHWA 2VLIA 2ZROA 1TUIA 3K0CA 1UKYA 3DZDA 3ZZTA 4QJ3A 2XTNA 2VL7A 3GLGB 2EQBA 1E2HA 2VP0A 1OXUA 3QF4B 3DKPA 4DDTA 2E1RA 1S0UA 4IEIA 1G21E 1EFHA 2OHFA 3DL0A 4KO8A 1WCV1 1JECA 4P4SB 2WSSA 4PPQA 2QE7A 2CVFA 3IGFA 2NPFA 5E7MA 1W36C 3NEYA 2F1RA 1IY2A 1XD2A 2D2FA 1DAMA 1KI3A 2ZEJA 3NVAA 3K70D 1WP9A 1NF3A 3K0FA 3U6BA 5JS7A 2V54A 1V43A 2WBLC 3BH7A 4C0AC 1MKYA 4L15A 1E2KA 3RSOA 3T1OA 3VR6A 4Q1EA 4XWOA 1GWNA 2WICA 2ZI4A 1GNQA 1S4QA 3GLIB 3CH4B 3U4QB 4ASUD 1Z6XA 3CWQA 3EZFA 4Q00A 1E2GA 2LWIA 3A1SA 1VCOA 1KTVA 1QBKC 3LXXA 1XTSA 1EX6A 1F48A 1SVWA 2WWWA 3AGPA 4QRHA 2VF7A 1ZNXA 5FL3A 2JATA 3NH6A 1AKEA 4QGGA 2GDJA 1FNMA 1XEXA 1KO5A 4Q9IA 5KTYA 2Q21A 4DZZA 2F55A 3SQWA 5TXGA 2PCJA 3KUDA 4TZ0A 2RCNA 5JI2E 2RHMA 4WZBE 4LI0A 4LJ6A 3CZQA 3ADBA 4DUGA 2KI5A 1QF9A 1BYIA 2RB4A 1OFUX 2EFDB 4RZ3A 5JRJA 3AVTA 1DE0A 4BPBA 2IXEA 4NL4H 4DJTA 5C1BA 4Q66C 1N6PA 3DEFA 3BS4A 1R4AA 4DCNA 1VMAA 1G9XA 1S9DA 2Q0HA 1Q20A 4AKEA 1AM4D 2GZDA 4GZLA 4PSVA 5L3SA 3BH0A 1QRAA 5LPNA 4I81A 3QPVA 3FMOB 5FPTA 2ZJ8A 2ZE6A 4PO9A 4QHTA 3W5IA 1ZM7A 4WOPA 5B2ZA 2O8CB 4ZIRB 1DS6A 5JWOA 4BRUA 4MYHA 5BYJA 3TVDA 4DCTA 4QBGB 3MWYW 3R20A 3SR0A 4DIDA 4Z1MD 2NTYC 4Q5IA 2WMNB 3UANA 1T6NA 2WIBA 1XJ0A 1KI7A 3I3SR 1F3OA 4LJ7A 4Q48A 5D3MA 4EFMA 1OKKD 2QENA 1KK0A 2HYIC 4OQMA 1QVRA 1AS2A 1CLUA 2OFOA 1H65A 3PFIA 4HB0A 1SVSA 1G4AE 4OHWA 5B57C 5DN6D 4CF7A 3U3RA 4CT4B 2OV2A 5DI3B 2IF0A 4LWZA 4ZCLA 2IYUA 4W5HA 1D9XA 3WYFA 4D6PA 3OESA 4QNRA 1ZD1A 2BMJA 4PAQA 4V0LA 4RZUA 2DR3A 4JLNA 2IX3A 4A4DA 2IYQA 4FMBB 3CF6R 4MGYR 2J0UA 1AS0A 1AK2A 1ZUNB 2QAJA 2IHBA 4F4CA 2GXAA 1VPLA 1FW6A 4P32A 1MO3A 2GAAA 5JBQA 1FX0B 3E1SA 4FD2A 3WRXC 4NBSA 4B35A 5FR2A 1M34E 2NG1A 4KXFB 3W6PA 1O3YA 4LOAA 5CB8A 4RJLA 4CIDA 3GLFE 2IYVA 3PUVA 3NBFA 2JLXA 2DWOA 1XTIA 2A9KA 2P65A 3Q7PA 1F2UA 2J41A 2XJ4A 2ZPTX 3ZVRA 1DG1G 4GZMA 2XSZD 2V3CC 3OEHA 4JL6A 5AJXA 4K8OA 5EXPA 2AKAB 8OHMA 2IS6A 3VKHA 3P4YA 2WJGA 2Z43A 4Q7LA 1ZP6A 2FSIA 4YLGA 4HLQB 4PO1A 3WNCA 3LLMA 4JLKA 4ACAA 2O8EB 1Z8FA 3Q9LA 4IDOA 4MRSA 5CIWA 4GPTA 1TQ4A 4IJMA 4NHOA 1H8EA 2ANCA 1MO6A 2XZPA 4G1UC 3UWKA 3VHLB 3FHOA 5BWMA 1RRCA 2HXYA 1KI6B 3X1WA 3ZQJA 3R9XA 4JYBA 4JLPA 2Z6VA 1W0JD 3X1DA 4B73A 4AY2A 2DYKA 1VIYA 2ERXA 1U8ZA 4PPFA 3TK1A 2RGDA 3AF3A 5IHPA 4RCYA 1G3IA 2YOGA 2FDCA 2HCBA 4DRZA 1EK0A 1T4GA 2AFHE 1MO5A 3U2QA 2F3TA 1E69A 1Z2CA 4EJSA 1Z83A 4B43A 3ADKA 4XOIA 2FEOA 1NVVR 3HYRA 4A8JB 2SHKA 3LW7A 4CEIA 2FGKA 5DSZA 4OHVA 1OIVA 1T0HB 4LSGA 1D9ZA 3M4YA 5FBLB 1GZSA 1KSGA 2ZSFA 5JJIA 5IK2A 3R7WA 4LRWA 2JLZA 1FP7A 1EG7A 1VHTA 2YWEA 4WZ6A 4LBVA 5LBIA 4QJ5A 5F9FA 1P2UA 2P6UA 4XWKA 4HYYA 1E1QA 4NTZA 1H8ED 4EDHA 5J4KA 2WAXA 1KOFA 2W6JD 4MGKR 3D7MA 3D6TB 1NSTA 1KDTA 3FHTA 2RGNC 2CK3A 3THXA 2PLFA 2Z4SA 1ESNA 1SVKA 2R9VA 2ZE7A 4JVMA 5KNCA 4QBIA 1F5NA 1DARA 2XX3A 2W2TA 5AWFC 5G53C 4DLXA 3VKGA 1Z06A 4HAXA 1V5WA 1PUIA 3K0FB 4H1UA 2VHCA 1ZAKA 2X19A 3DPUA 4URZR 1QHXA 2ZTSA 2WSMA 2JLRA 3MJRA 3WYAA 4ZCIA 1N0UA 4E07A 1YZKA 2QG6A 3FHCB 3GJ0A 5FOVA 2QRZA 1R0WA 4P31A 4I1SA 4ERNA 2ZJZA 2BIFA 4A0RA 2IL1A 4D2IA 3LNCA 5GJVC 3GLFB 5FI0B 1UBEA 1AZTA 4PQRA 1KZGB 1J8YF 3A58B 1XEFA 2O5VA 4KV9A 3QXXA 2V4ZA 4BZXA 5FBQB 1R5BA 1OPXA 4US0R 3OEEA 4MKGA 1FMJA 1EWRA 2CK3D 1E79A 2ZVQX 4F38A 2ASEA 5JS8A 3W34A 3ZZ0A 2H7VA 4TYPA 3T06B 1QHYA 4G0NA 2YINC 3ZD6A 3THOA 3A1VA 1P2SA 4CW7A 4Q7MB 4J0QA 2YNMA 2H18A 1LW7A 3BIFA 3SBDA 3W8RA 3QUSA 2XNSA 3T61A 4MGIR 4CYMA 2V1UA 1KSJA 1MO4A 4GOKA 4YDHB 4B3GA 3ZVNA 3AP1A 3QPUA 4GI7A 5BN4A 4HUQA 1G7RA 1KI4A 1AA9A 1VG1A 4C0BA 1CBUA 5AJYA 3RANA 2GF0A 1HH4A 1GSIA 5FOTA 1KO8A 1II8B 4EAQA 2DFNA 4IFEA 2HV8A 3AVOA 4FMDF 4UNRA 3GLGE 1EFRA 2GCNA 3EXAA 2J5XA 2WWYA 4B3CA 4B3XA 2QP9X 4KITB 1U8AA 4V0ME 4C2TA 2V1XA 2QL6A 3WY9A 4URUR 3AEZA 2XEXA 2H17A 4LCBA 4BRWA 4Q4HB 4D4KA 3VTKA 1YR7A 3UG6A 4RZ2A 2AR7A 2G1KA 2ZR7A 4PX9A 5CDFA 1K8RA 4NE2A 4E5UA 2XOKD 4OYHA 4XWAA 3VNVA 5F9HA 3BC1A 1GIAA 4OJQA 2FWRA 3A6PC 3GFPA 4JLDA 2BEKA 3BFXA 4EKDA 2FJUA 4O2RA 5FBRB 2XGJA 2ZS9A 2BJVA 4PC2A 2W6JA 1HEIA 2E87A 4UXIA 4TLAA 1W47A 4B44A 4YXWA 1YQTA 2QBYB 3KXIA 4QHYA 4XSHA 3RC3A 1CKEA 2ZANA 2ZE8A 3F5FA 5K8IA 1NI3A 4HSEA 2UZ3A 5BW8A 1HQCA 2FPKA 3U44A 1GKYA 4XVRA 2P5SA 1FTSA 5P21A 5FL7D 4DHEA 1M2OB 1YHNA 4DSUA 1OLOA 2ORWA 5GVSA 5H70A 1UADA 4F91B 2DPXA 3LFUA 1I4TD 4ZDJA 2YKGA 3ETLA 2IEZA 4Q9JA 3L0SA 1DO0A 1W5SA 3V00A 3ASYA 3KL4A 2XTZA 1ZNYA 4HLCA 5DLQC 5KDOA 1P9WA 1IOZA 1H8HD 1R6BX 2F43A 2GEUA 2QRNA 2WWXA 4M22A 4Z51A 4BGDA 1IJEA 4WIAA 3AVXA 2XTMA 2GZAA 3FGNA 4TYYA 1ZUHA 2IEYA 3PUWA 1MOZA 2GA8A 3GJ3A 4QL3A 1NVWQ 1NRJB 5HZKA 1TNDA 5F2EA 3NBXX 3OEHD 1G5RA 1NN5A 1Q21A 2W00A 2ONJA 3AF2A 5F3WB 1HE1C 1I2MA 4V0OA 4NCKA 5HE9A 2GCOB 4JBXA 1TAGA 5AJZA 5SZJA 2J45A 2JJ1A 2XAUA 3IIJA 5HR5A 3A36A 2WIAA 1DTSA 4D25A 2GCOA 5CK5A 2BBSA 2LCFA 3CRMA 4KVGA 3WBKA 1QVAA 4NP6A 1GFIA 1Z6YA 3RS0A 4BLQA 3QKUA 4DVGA 1MR3F 3Q8XB 2XNDA 4PANA 1VYUA 2I1QA 2AWOA 1OXSC 2AHOA 5FL7A 2VSFA 2R6DA 4HDCA 4DCSA 2V7QA 3LWNA 2OCAA 3TSZA 2OZEA 2QORA 2MMCA 4MRNA 1R10A 3AH8A 4Q4JB 4M1SA 3T34A 1RZ3A 1KJYA 2GK7A 1N6OA 2REBA 5GJBA 1G18A 1KYIA 2G3YA 2VSOA 1XPUA 2IYWA 2CEAA 3FYHA 1Q1BA 2ZR9A 4Q47A 5DO9A 1N0VC 4NCHA 5L8VA 1XPOA 1W4CA 1E2EA 221PA 2GILA 3B8HA 4LK2A 4LV8B 2QROA 4OJKA 4K46A 4BQSA 4Q1CA 1J99A 2QY9A 4M1TA 1PVOA 2BWJA 4Q9KA 4GMXA 5H1YA 5JCZA 3THWB 4OI1A 2CHGA 2OBLA 4G3XA 1G3RA 2GETA 2D2EA 4QHSA 2BMEA 3PEWA 2ERYA 2ZRNA 4EJSB 5C46F 4TN1A 4XD7A 1SXJC 4QGFA 3L82B 5DI9A 4B2PA 1YE8A 3RS2A 2PX0A 3X1XA 4Q4HA 2PZEA 2FFAA 3MUFA 5EXTA 5EP2A 3K53A 4JLMA 2FOLA 2WSSD 3TR0A 3QKRA 4IEEA 5DHAA 1C4OA 2ZRDA 1QHHA 2RMKA 3EZ9A 3ZVLA 2PL3A 4V0NA 4B74A 4N0DA 1G16A 3ECCA 3K8YA 3W3AA 3UMRA 2BKUA 1VG0B 1KI1A 1AN0A 2GXSA 2QP3A 4M1OA 1OH7A 1A2KC 1WE2A 4PPGA 1IN7A 1OIWA 3QVVA 3QXSA 3P4XA 2IXFA 4O3MA 3ZD7A 4YMTA 1E99A 1UEJA 4FXPA 2ZRHA 1MRSA 2AKYA 2J9RA 2J1LA 3ND8A 4ESHA 4MUBA 1IHUA 2CCGA 4XTCS 1NN0A 5LD2C 1E2DA 3VX3A 3B2EA 5D3QA 1CXZA 3H86A 2F1JA 2X1VA 1T3SA 3KJEA 2WMOB 1KO7A 5AUQA 1R2QA 1TADA 2D62A 3OEED 4TYQA 3K70C 1G20E 1E32A 1RFLA 1ZU4A 5FOWA 2P0EA 4ZPXA 1AGPA 2A5YB 2D06A 3CWZA 1SVIA 1OHHD 2ZRGA 3SYKA 4IOMA 2KSQA 3EIEA 4BECA 5FPSA 4D26A 2Y8EA 4A8JC 2RAPA 2V7QD 2X2FA 3NC1C 1AJEA 2VF8A 4PHHA 4B2LA 2FX3A 2P67A 3LY5A 3GLFA 1MV5A 4YC7A 2AD1A 2FSFA 3PUZA 3MCAA 2VH5R 2PX3A 3KFXA 3W6OA 2FPLA 2CHVA 5CYOA 3AM1A 4TL6A 1KI6A 1KKMA 4EPYA 1G3UA 1N5KA 4URYR 2RHDA 2Q6TA 3BFKA 4JYCA 4U02A 5DGXA 4DDVA 4MUAA 1UJ2A 4YXWD 3U7GA 2JLWA 3D3QA 4X8LA 1A7JA 1XXHB 3GQBA 5CM9C 4F4IA 1E2PA 2IS1A 2BBTA 2YOHA 1TF7A 1SZPA 3OIWA 4MH0R 5IDVA 4PR0A 1KK2A 2CNWD 5CM8B 3KKMA 2OFWA 3DOEA 3CW2A 4NYIR 1RPZA 1M1YE 2HJGA 5HKKA 4N3NA 4V0MA 1ELOA 2G1JA 2GVDC 2ANBA 1NL3A 3MFYA 1NJFA 4RFVA 1PLLA 2OAQ1 1IY0A 4BLPA 5KO2A 1VYVA 4JLOA 4FCVA 1A4RA 3GJ6A 1A5TA 4IDPA 1XZPA 2I4IA 4LJAA 1FZQA 3BB4A 3KKNA 3SOPA 3PUYA 2XNDD 1N6NA 5FUWA 4M1MA 1Z63A 1SXJE 4M1KA 3W8NA 4IRUB 1GVNB 2VQSA 4G5RA 4GRAA 2FA9A 1IBRA 5JHHB 3LW8A 1KY2A 2J7PA 2A7QA 3I1FA 4D4MA 1RE0A 1AQYA 1OXTA 1J7KA 4JVNA 3AKEA 3GLIA 3NC0C 4XSGA 2ZAMA 1S8FA 3RVBA 1SKYE 2ZRKA 3AF0A 4PAOA 4OHZA 1M6NA 4HEJA 1W5TA 3NHAA 3CRQA 3AF1A 2XJ9A 3FKQA 4POAA 2G0TA 2ODBA 3VMFA 3BORA 1VDZA 1HURA 4Q03A 1CIPA 3RC8A 1Q22A 2GF9A 1X1RA 4ILEA 3IBGA 1QDEA 2V6JA 3CPJB 3ZS9A 3WMGA 2LKDA 1E79D 2YJTD 3BOSA 3BRWD 1JR3D 1AS3A 1JQJC 2OT3B 1QZXA 2QT0A 2XB2A 2RGNA 4NYJQ 2AX4A 1RJ9B 3HWSA 1R8QA 4KVAA 1NBMD 2AN9A 1EXMA 3SNHA 3T12A 3MLEA 1NJGA 4P33A 5K8TA 4W9MC 3LQRA 2X77A 4NYJR 1NG9A 4TQAA 2AFIE 2ZUCA 2PZGA 4CEJA 2W6ID 4JKIA 4DSTA 2ZE5A 4TL8A 4NYMQ 3THYB 4BEJA 1RW4A 1EWQA 1XJCA 4GOJA 1XD8A 4LC0A 2DCUA 1E9DA 4NYMR 4IVQA 3W5JA 1CULC 2PZFA 3B9PA 4NPHA 4S35A 4FWTA 3AVUA 1LFDB 3X1ZA 2AK2A 2LKCA 4EFNA 1ZM4A 5DI3A 1GRNA 3GLIE 3TRFA 3U60B 5J5CA 4C0LA 2CDNA 3SHWA 2K5UA 5KSOA 4KBFA 3BK7A 1XRJA 1W48A 3LBNA 4XVQA 4NKRA 3MWKA 4C0KA 4DLRA 4QFMA 3U4QA 1COWD 2GVZC 3TKLA 2ZRLA 4LDJA 3L0IB 3PEYA 2X8AA 1XU4A 1GUAA 3SZRA 5CJPA 4BFTA 1N6KA 3SI7A 5IT5A 2OLKA 5CLQA 4C4PA 2GEVA 1NLFA 3EA5A 3E70C 1SXJD 3K0CC 3RRZA 5LB4A 3CH5A 2NO7A 3A4LA 1KDPA 5HE8A 1Q0UA 2FFBA 4Q1BA 2WV9A 1XEWX 4PC7A 1JJVA 1UBCA 1OJLA 2GZHA 2JA1A 2QMOA 4P4SA 4V0KA 5FTMA 1UEIA 1WRBA 4Q4AB 5F98A 1NVVQ 1BH2A 4CGZA 3WP1B 2QA5A 2O8DB 4Z1MA 2IYSA 3KFVA 2A2ZA 4R2HA 2IYYA 4MKFA 3TAUA 3P1JA 2BV3A 3L8YA 4M1WA 1PLKA 2GBLA 1XEXB 1P62B 5HTKA 4WW0A 2DFKB 2XSZA 4AKHA 4MRRA 1D5CA 4B33A 2AXNA 1LS1A 1ZC4A 1XCGB 4FCTA 1VCNA 1TUEA 4LJ5A 3GEHA 1DAKA 3LVQE 4G5OA 1HA3A 2VEDA 3GCGA 4MQBA 3RYTC 4AYXA 5L3RA 2XZOA 4Q21A 2OXRA 5JMTA 3WYGA 4A36A 3C5CA 2DFTA 4TSFA 1Z6GA 5G3ZA 3NEJA 2ODNA 2OM2A 1YZTA 3Q7QA 1LTQA 4MRPA 1E9AA 1BO6A 4JMPA 1OIXA 1TX4B 3LLUA 4MRVA 3RAPR 4W5WA 1BS1A 1YKSA 3TIFA 3PXGA 3IIMA 1JEEA 4BFZA 1SQ5A 2CLCX 2CVHA 5KUTA 3R8FA 4BASA 3CNOA 1UAAA 1DAHA 4V02A 4CDGA 4BZPA 4MYCA 1RVDA 1R5OA 1W44A 4U00A 3EX7C 3SHFA 2KWIA 1AGRA 3EASA 2BVNA 4DLYA 1I4DD 2R65A 2IHYA 3U7EB 4DT1A 1KNXA 1N6HA 4WA7A 2CE2X 1ZM9A 1NIJA 3CZPA 1XTRA 4KJZA 4QGHA 1XTQA 2C78A 4M9QA 2FFHA 4M8NE 1KSFX 2H8KA 4PSKA 2W58A 3CX7A 2AXPA 2ZIAA 1CR0A 2ZYWX 1NIPA 3OIUA 2CJWA 4MYUA 3CX8A 2C98A 2JGNA 2B8WA 2KE5A 4B3DA 1L4UA 4RKEA 2R6CA 1CRPA 4BE7B 5KYKA 2QAGC 4AK9A 4NCNA 1U9IA 2ZRCA 3RLFA 1VHLA 1P9RA 4BUJA 4ZV4A 4N0EA 3AVVA 1UBGA 3FPAA 1KI8A 3T1VA 3NDPA 4Y0AA 3G0HA 5JWRA 2ZU6A 3GJ4A 2OCPA 1E9RA 6Q21A 2IYTA 3SFVA 1N6LA 2JJ1D 4OQFA 1DELA 4Q7JB 1E2QA 3O8CA 3I92A 1P2VA 3CLVA 4LJ9A 4QBFA 4A9AA 3CRRA 1RRGA 4TL9A 3I62A 4ON9A 5DHFA 4ZKEA 1W0KD 5JRZA 2PT5A 1JR3A 2V55B 2J87A 4DEXA 3K70B 1FOEB 5JSZB 4LHXA 3CRW1 4NCJA 2BJWA 3TAHA 4B34A 2VTKA 2ZRMA 4GSYA 4ZCMA 1U8YA 5KOYA 4BFUA 1H8HA 5FOXA 2WJIA 4B6EA 5E3HA 2O8FB 1MRNA 3LA6A 3V4FA 4A2WA 4B32A 5LD2B 3IQXA 2WKQA 1M7GA 3B1WA 1F2TB 3PITA 3FKSA 1CR1A 1Z0IA 3N70A 3OE7D 4YMVA 1FUKA 1JR3E 1KZ7B 3ADCA 5M04A 1CJMA 4MYTA 4LHVA 5TARA 3QQ5A 1P60A 4GBMA 1S1MA 4A82A 2A3RA 3W6NA 4KI0A 1CRQA 3BFVA 2NO1A 3QG5A 2BCGY 5AUOB 2EW1A 3DMDA 3CF0A 1SULA 1G5TA 1R0YA 2OAP1 4BLSA 1OH8A 1S3GA 5EP1A 4D81A 4IXMA 1Z29A 3QVUA 3TR5A 3R9WA 1EFRD 3CPEA 3VR1A 4D82A 1IJFA 4EPVA 1E2JA 4M2LA 3C7KA 4WXRA 3GMTA 2WVJA 1X6VA 1YR8A 1P7CA 1KNQA 4M21A 1MABA 1GRRA 4UQOA 3T35A 3QIAA 1OFHA 2W6IA 2JLSA 1GTVA 2GCPA 2J7KA 5JCPA 1GAJA 3MMPA 4B71A 4XTRA 2XXAA 2KB0A 2WZQA 2VBCA 4TLEA 3KQLA 1ANKA 1FPMA 3A4NA 3S1AA 4MGZR 1AKYA 1LF0A 4NYIQ 4PPNA 4BZQA 5A5GA 5C4MA 2IT1A 3EPLA 1M7HA 3HU2A 3TUZC 1G8HA 2NZ8A 1HT2E 2B92A 4G5GA 2P3SA 5ELXA 3OAAD 4RVCA 1LY1A 2VHJA 3VFDA 1D2NA 2YZ2A 2GK6A 1IQPA 1ZUIA 3KTAA 2FN4A 2ZRPA 2EWVA 3QKTA 1DEKA 4HZIA 2RGCA 2N46A 2VHUA 4LJ8A 3LO5A 5JECA 3EZ2A 4AIIA 5DYGA 1FL9A 1SVMA 4C3ZA 3GLHB 1ZJ6A 4FN5A 3TVTA 4B47A 3EPHA 2JLYA 2GKSA 4A2PA 1P5ZB 3NWJA 4IDHA 2C8VA 3EIHA 3EIQA 5FI1B 1XF9A 1CJUC 2DBYA 1Q1ZA 2OSBA 2A78A 3QXJA 3CRVA 1X8LA 2RGEA 2B7BA 1AZSC 1U9IC 3HPQA 2HT1A 4OHYA 2ZJAA 5J4HA 1D2EA 2BBOA 2Q9CA 1US8A 5G3YA 3SJAA 1BMFD 1U2RA 5FPYA 3C15C 2AL7A 3EZ7A 4V03A 1G7CA 1IAQA 3KJHA 4XIGS 1GKUB 4US2R 5G41A 4HDQB 2ZJ5A 4C0JA 3R7WB 1XEWY 1XZQA 3OE7A 2KBFA 1UFQA 2GESA 3IO5A 2YWGA 4AURA 2VO1A 2QQEA 4GDFA 1YZLA 1P9NA 4M1YA 2B7CA 2TMKA 3KTAB 4IXNA 1GL6A 3ZYCA 3GD7A 2CCJA 3LBIA 3AGQA 2VP6A 2AWNA 3C4JA 4JBWA 1F6BA 2HXSA 2R44A 2OFXA 4JSYA 1R5NA 4XJXA 4B3BA 1T5IA 1CU1A 1I4LD 3BGWA 4RD4A 4KLZA 4JIMA 1JJ7A 3EZ6A 3QBTA 4OQXA 2JDID 5EZ5A 1WDTA 2OXCA 1U99A 1FNNA 2QM8A 2W2XA 1G8FA 1HV8A 2YVUA 3NKVA 4PC1A 4UXHA 1ZD8A 3EWAA 3NDBB 1XX6A 4LYAA 4TT3D 4OI2A 2IBMA 1E96A 1NN1A 4LY6A 3PJRA 2AK3A 5KNBA 2ZREA 2OBNA 3IIKA 1CR2A 3AKCA 2HJVA 4JJKA 1OH5A 1XTJA 1TF2A 3WMEA 2IS4A 2FU5C 1X8KA 4JLAA 5A0FA 1RYFA 2REOA 2DB3A 1GDDA 1N0WA 3K0AB 3QPWA 5BN3A 1E2MA 3D31A 2DWQA 3UXMA 1X1SA 3Q85A 3LAWA 4I4LA 4P4UA 3CB4A 3EC1A 3ASZA 1JNYA 3I8SA 5SZHB 1KO1A 1ZCBA 3B1YA 2JDIA 4LYHA 3MGCA 4DCVA 4Q1FA 2Z4RA 3NH9A 1Q1EA 4P0TA 1ZBDA 5KPJA 2F3RA 5A4JA 3DZ8A 4L4UA 5JWHA 1ZINA 4LHYA 1IONA 2BM1A 5J4VA 2ZSAA 2PJZA 4Q19A 3FDIA 5B64A 4EFLA 4U5XA 4GOXA 3FVQA 3QJYA 5HPYB 1DAFA 1E94E 3JVVA 2OO7A 3T5GA 2YWHA 3GFOA 2ZUDA 1KDOA 1MABB 2WAYA 3C14C 4RCZA 3IBYA 2QNRA 4K81B 3M6AA 4CT5A 1HUQA 3JVUA 5HCNA 3LX8A 3KZ1E 4S2EA 5KSPA 3HU3A 3T15A 1M8PA 1RIFA 5IK2D 1A2BA 5EE9A 1XXHA 5EE1A 2HF9A 3B6EA 4AKIA 3I73A 4TL7A 1OYWA 4KSCA 3QY0A 4DLSA 1RRFA 5L3SB 4I99A 1N6RA 2QSYA 4JL8A 4JVLA 4MA4A 4Q1AA 2UVQA 4ZI3A 2H5EA 2C2HA 3CO5A 2ZI5A 2ZJOA 2OE2A 4URWR 4II7A 2ZU0C 4EPXA 3A4MA 3QENA 1XPRA 2PJRA 1ZVQA 1Z07A 3CONA 3W3ZB 421PA 4F93B 2VP4A 2BDTA 2C95A 4KFRA 3CUEF 3K09C 5AUNB 3M1IA 4B3FX 1FQKA 3C41J 4US1R 4D0GA 3M0EA 1E2IA 2WWIA 4FI3C 1TU4A 2GXUA 4TLDA 3PEVA 5GADl 3CKLA 1UDXA 3A8TA 3UATA 3EW9A 1GNPA 3RNLA 1KO4A 4A0GA 2O8BB 2C04A 2QPTA 4LJYA 1XTKA 3DO6A 4YMWA 5FBWB 5DISB 121PA 3B85A 3SN6A 1N6IA 5TV2A 4ZDKA 1Z6AA 5HCIA 1COWA 3GJXC 3LX5A 2R8RA 1K5DA 2H1LA 4RY2A 1G291 2GNOA 3A1WA 4TZ6A 3EG5A 3TSOA 2HUPA 1N5IA 1WQ1R 4AD8A 5EJEA 3BAFA 4KU4A 3RHFA 2NMVA 2WPDD 4NCIA 1LF5A 2BM0A 1ZD9A 2PMDA 5EE5B 3GPLA 2F6RA 4QM7A 2DY1A 2QE7D 2X2EA 3ZVMA 2WWHA 4OI0A 4AG6A 2HT6A 2O0KA 4U7DA 4BFVA 5H68A 4PXAA 4FCWA 2F1IA 4RFSA 5FTLA 1DG3A 3HDTA 1GG2A 4IOKA 1VIAA 2WWGA 1ESMA 4LBWA 2YWFA 1QHHB 4DXAA 3RRYA 2JCSA 3WP0A 1XMIA 2Q9AA 1QG4A 4LHZA 5KDDA 3AP2A 3WHKA 3NBYC 1Z5ZA 3I61A 1B23P 1SGWA 4H9GA 5JJLA 3SYLA 4ASUA 4LZZA 5GJCA 3H0KA 5GVRA 4BFWA 1ZCAA 5EUQB 1W2HA 2QPOA 1W36D 2O8DA 3U7FB 1TQ2A 3W90A 4PSAA 4QM6A 2NO6A 3R8CA 4C30A 2BC9A 2WOJA 1T3LA 2CMKA 4HB3A 4C2UA 1ZYUA 4LYFA 5KPDA 1NLYA 4JLVA 1G4UR 1TQDA 3GJ8A 3ZIAA 4B48A 3B13B 2REXB 3IHLA 3LXRA 5TB5A 4OL0A 1BIFA 2R6FA 2W83A 2NOAA 1PZNA 2XOKA 5EXXA 5H8WA 1E1QD 1CP2A 5TMPA 2HEIA 4GFDA 2VRWA 2HLDA 1CEEA 1E1RD 2ZUBA 3CIOA 2VPPA 3I8XA 1IM2A 1Z47A 2F43B 4LBZA 1O87A 4MKIA 2QP4A 5SZIA 4M9SA 3HR8A 1Z08A 2FEMA 4TWZA 3EARA 1JPNA 1JEDA 1JXMA 1SHZA 3Q72A 2VSXA 1G8YA 2MSDB 3CBQA 3IKJA 4A0FA 1XCPA 4G5SA 3TLXA 2D3WA 621PA 5AUPB 1XBTA 2IK8A 2YHSA 4ITRC 3PV0A 4TTQA 3SYNA 4AG5A 3V4RA 2UZIR 3IO3A 1Q3TA 2OILA 3U44B 5TVKA 2IWHA 1E0KA 1II9A 1E2LA 4Z8XA 2IWRA 3L43A 4IDNA 3THYA 4UJ3A 4X8MA 4CEJB 2OCBA 1J90A 4KYIB 2QPAA 1S1CA 1HE8B 3RABA 2VHQA 2BMDA 1XCMA 5EQTA 1SVLA 3MD0A 2IYZA 2ZVPX 4YQFA 5FR1A 4TYNA 3GJ7A 1U0LA 3BJIC 1CF4A 1UKEA 2GJ8A 1ZU5A 1KI9A 4E22A 4UNPA 1LNZA 1KY3A 2FSHA 1KMHB 4DKXA 4RKFA 5J4LA 2FG5A 2HDNB 3GJ5A 1CTQA 1E0AA 3C16C 3SC3A 1Q3HA 4R2IA 3FMIA 1J2JA 2GBLC 2DFLA 4DLZA 4EIWA 1QHGA 3DDCA 2RGAA 4EPRA 2JLUA 3MSXA 2WTUA 3FE2A 5BN5A 4TQ9A 1DOAA 1JQLB 3BXZA 4W7SA 1OH6A 3P32A 4TYWA 1YZQA 4Q9LA 3KX2A 1XNJA 4Q18A 1IN6A 2CE7A 1FFHA 1DBSA 3IUYA 2V9PA 4IDQA 4RD1A 2QAGB 1UM8A 4RFSB 4DDUA 3KDSE 4TSFD 2JJ2A 5E95A 1GITA 2PH1A 1N2CE 4BLRA 4HAYA 1ZM2A 1E9SA 4DBLC 3KQNA 2CLSA 4HUQB 3J81k 1JALA 2GJAA 2IW3A 3GEEA 4AWXA 2HYDA 1WB9A 2NO0A 2IC5A 1KHTA 4QNMA 2P2LA 4ZKDA 4TQUS 4GT1A 5EUMA 4DCUA 1P61B 3F3YA 3G82C 1KJZA 1RJ9A 1W36B 1CR4A 4GMDA 3NTUA 4FMCB 3WBJA 3OAAA 3FMFA 1OB5A 1W0JA 3NIBA 2EFEB 2QTVB 3R9IA 2C03A 4KFSA 1II0A 3FMPB 2RKOA 2ZSDA 4OK6A 2EFGA 1E4YA 1TU3A 1VCIA 3SU8A 3D8BA 2C96A 3X1YA 2V8OA 2QN6A 4JVSB 2JJ2D 3TE6A 1E1RA 5BXQC 5JI3E 1G6HA 2J46A 5BQ5A 3TMKA 4Q9HA 1FP6A 2JIZD 3FKSD 4KODA 4PZLA 2XZLA 2VYFA 3V9PA 1DAIA 1ZMXA 3ICEA 3AVYA 2ZS7A 1E0SA 1WMSA 4P3YA 4Q02A 5EZ6B 1CS4C 2ZJ2A 1FQJA 5FPHA 1W49A 1E9CA 2RGBA 5DH9A 3UWOA 4B76A 5UKDA 2EWWA 1T5LA 1F60A 3TQCA 4JLBA 5HZHA 1L2TA 1OW3B 4HZUA 3AUXA 1MT0A 2YYZA 3Q5DA 5BYKA 2OUKA 1HQYE 2J0VA 1NKTA 2F9LA 1L4YA 3FWYA 3W9YA 3VR5A 3ZZUA 3WXMA 4DB2A 3N5CA 2G0NA 1XFAA 4QXAA 4XD7D 3IEVA 4UNSA 4G01B 2C9OA 1T8UA 3KJGA 4PAMA 5AR1A 4PC3A 3SBEA 4C9BA 4IHQA 5IF9A 2WJJA 4LPKA 3K9LA 3A37A 1PUJA 1KJWA 2BOVA 3A1TA 4L9SA 3AKYA 4X8OA 3TJZA 2C5LA 3VQTA 5JJKA 4BLOA 2E9SA 4E03A 2ZJYA 1RC8A 1YRBA 2ODWA 4TMTA 4OQLA 1ZNWA 4JKYA 721PA 1DVRA 2IF2A 5FBVB 2QT1A 4YDSA 3U7HB 3LD9A 4QBHA 4RZXA 2OEPA 2H57A 2ATXA 1LV7A 3U3JA 2ZITA 5EXSA 4DEYA 4ZDIA 1C1YA 4PHTA 2DHRA 3OHMA 2J0SA 3I4LA 2F7SA 4UNNA 4R71A 4JSTA 3F0TA 4KAXA 1TEXA 4PQYA 3AV0B 2BEJA 1WXQA 1Z0KA 1XMJA 3WMFA 1M74A 1OXVA 1VTKA 3ADDA 3ZIAD 5CITA 3H84A 1W4AA 4IVRA 3CPHA 2PEZA 1A82A 2FZ4A 3ND9A 4D4LA 3QSYA 2R6GA 5JEEA 4HAWA 2C99A 4PZYA 4HI0E 2O8CA 2JLQA 1F2UB 4A6PA 2MMGA 1D6JA 1Z0FA 3FB4A 4ZDWA 2KBEA 3SQXA 1Q1QA 1MH1A 3THXB 3LV8A 1FMLA 1L8QA 3N2IA 1XD9A 3A1UA 5J40A 1Z0AA 2ZRJA 4PZZA 2ORIA 3MG9A 2O8FA 3B9QA 4AYWA 1GP2A 1Q57A 2Q3HA 3OIVA 4WXPA 1DAGA 1E4VA 2L0XA 2RH5A 3QF7A 1NBME 3QG1A 4LBYA 2P6RA 2OCYC 3THWA 1E0JA 4R9UC 1KI2A 1W4BA 4I1VA 5CJ2A 4A2QA 1LS6A 4RSGA 2N42A 1KIMA 2CNWA 1GL9B 2WKRA 3PR1A 5J4YA 4CEIB 3ZH9B 3WRYC 1OXXK 2H16A 2I1VB 4A8JA 3T1QA 3QBVA 4JBYA 3K0SA 3PEUA 4WAUA 4ZO4A 3AQ4A 2FFQA 3B82A 3VX4A 2GTPA 3KQHA 2EYQA 4D80A 3BH6A 2PBRA 2EVWX 3N2EA 1GILA 1J8MF 4GNKA 1IN4A 3K9NA 5FUXA 3KQKA 1W7AA 3KQUA 1E98A 2BHRA 5FUVA 1UPTA 5TDHA 4HZUB 4RD0A 3PQCA 4H1VA 1BYUA 2FE4A 1LB1B 1SXJB 4MDFA 4LV5B 3WNDA 1KGDA 2B21A 1GL7A 4NMMA 4EJSC 5FTJA 2O8EA 3IPXA 2JEOA 5FOUA 1Z3IX 4MITA 1OKKA 1OT3A 3RWMB 1LVGA 2WWFA 2ZRFA 1JBKA 3GLHA 5DN6A 2PLRA 2ZRBA 2CCKA 3C8UA 3K0EA 2ATVA 4OK5A 3MWJA 3EPKA 2N1BA 2QU8A 3B60A 4D0LB 3I5XA 4AYTA 3QKSA 2CL0X 1QG2A 4W5JA 1NY6A 2F9MA 3AVPA 2FMXA 2EU8A 1BOFA 1KAGA 3QOFA 5FPKA 3ZDQA 2BCJQ 5JLJA
chains in the Genus database with same CATH superfamily
3RS5A 1WP4A 5FWXA 4MMXB 2EXXA 1VI6A 4Y1FA 5EXEA 2FUNB 3U5ZB 3NIWA 4RA9A 3ZJYA 2QY6A 3WQBA 2BZ1A 1CHDA 1K7SN 2FZKA 3IHTA 3CUWA 5IJAA 5CLFA 1TTHA 3Q5EA 1G17A 2VYNA 4GS5A 1PL7A 3ZX4A 3ER9A 1G8PA 1J5EB 1JF8A 4YMSA 4N8EA 3V48A 1B0PA 3QWIA 2VIIA 2ZYTX 1DZIA 4OB7A 4L7VA 2H31A 4XUGB 3MNFA 3GLHE 3KVVA 1U3CA 3HCFA 3UHPA 5B3LA 2D3TA 4QU9A 3FIJA 4DLWA 1I2ZA 2PV7A 3IKLA 1KL7A 2PX8A 1PKEA 5LU8A 4U2BA 4FPXA 3AEQB 2YV5A 3QEBZ 2OAEA 4Y2JA 4CF5A 5ALMA 3DM5A 3ONEA 3SEFA 3VR4A 1FFCA 3QVLA 1MFPA 2HLPA 3HPRA 4Y1EA 1GN9A 4MMZB 1BN6A 2PSDA 1CF9A 3QFCA 4BLWA 1JAIA 4ZZIA 5CBPA 1PE0A 1L7EA 1OBVA 2V4MA 4UXJA 3VHXA 4NU6A 4ZVVA 2YC2C 3TSYA 1P31A 3CZ5A 4RCVA 1ZM3A 5B2EA 2ZSHA 3G2NA 3W5VA 2EFJA 1MGOA 1DRUA 5EIBD 2FF7A 4JUIA 3UB2A 3ZWAA 4MWTA 1YVPA 2ABWA 1UBFA 1QORA 1H2EA 2MSCB 3E5HA 4N5LA 3OKPA 4HLUC 4FINA 2F8TA 1X1AA 1RRPA 5G0TA 3FOBA 3LC1O 4L0DA 4NE9A 2IU6A 1UC4B 4A73A 3T9CA 4YX9A 3DLIA 4L5BA 1BFKA 2YZGA 3L2OB 3HJNA 4H7KA 5KAMA 4I2VA 3VZSA 2EGGA 1DZ3A 4FW9A 3R9KA 3R0IA 1U80A 3VI4B 1BCRA 3BKXA 1M7BA 2D59A 2V9ZA 3UUEA 5IH7A 4NU0A 2YIVX 5IVHA 1JXQA 4KYUA 2DE0X 4EJFA 4MUMA 4ROTA 4BB5A 3KETA 1R9GA 2NX2A 4JJ7A 1E9EA 3AVWA 3MUNA 2GN0A 4S1TA 1EFAA 1H1LB 3I1IA 3M3HA 3FMGA 4LRTB 2JJ8A 4XPIB 1P4HA 1SUDA 3K9HA 1UAYA 3EIWA 1RQRA 2J5KA 1CVRA 3OM9A 3UUGA 5K0ZA 4BN0A 5KSZA 4LMAA 2P6OA 4FNOA 2P5TB 3AFMA 4O5OA 2BKEA 4BP1A 4DG8A 1K08A 4X97A 3QXGA 1O9HA 1C9KA 3AX6A 3GFTA 4I36A 2XVYA 3IKTA 3OZAA 3P27A 3FSRA 3T5PA 1ZD3A 1KMMA 3MJCA 4NAVA 4CZ2A 2D8MA 3K0HA 4GVPA 3JARB 2HRCA 5AVSA 2GAFA 3CUYA 1VYTA 4PTLA 4WCFB 1V37A 1VE3A 2PUDA 3UPUA 2IXBA 4KSBA 4XFKA 5C7LO 1UWKA 2OFFA 3QE9Y 5CB6A 5B55A 4RTKA 5FOSA 1NR5A 1X1DA 2IQIA 4S24A 3VKWA 3SJBA 4Q6WA 3GP8A 1SC3A 1YD7A 1GG9A 3BWCA 4BC0A 2IZ0A 3INTA 3ELWA 1NVMB 5B36A 1KKLA 1P2TA 3KCQA 4M49A 3LZCA 3QRWA 2QN9A 3VTZA 4HDOB 2FB9A 1U2SA 2VP5A 4II3A 4PZ0A 1OHHA 3CW8X 3K09A 4OMDA 3KXLA 2Z83A 4QC2A 1XXHE 1JWBB 2AOXA 3E5RA 4I4CA 2X0DA 4AZSA 3H8WA 3MRTA 1G8KA 3MLAA 1NP6A 4R1OA 3L6DA 4H6WA 4AJKA 1E1KA 1C3EA 3EAQA 1AUOA 2QMUA 2WU0A 2ZGVA 3AQIA 1P19A 1Z35A 2PFGA 3KUCA 3LBHA 4RXMA 5FUYA 3M4ZA 4D3YA 4BWGA 1P4SA 2B8TA 2H1VA 4F84A 2WV7A 2O05A 1B14A 3OFNA 5AHOA 1KDRA 3CMMA 5LQCA 3AUYA 4K9KA 3BKWA 5JCXA 3PD0A 1D1SA 2QVBA 1MHTA 2L82A 2ZRAA 3I2FA 1ENOA 1I6MA 1RM4A 3JZMA 4EYQA 1M2EA 3R2JA 2NZJA 3OZVA 4GPD1 2VWPA 3WTBA 4RD2A 4BFSA 4AO8A 2Y77A 3R77A 4RHFA 1AXGA 2GCGA 2KX7A 1YVDA 1UZUA 5L4LA 2EF0A 4DQLA 4ISCA 3LK6A 4I1OA 1X7WB 3FRJA 3I2JA 5ALGA 1PFGA 2JFYA 3N07A 2HIGA 5TE9A 1OV4A 3A6EA 1NG1A 1J0XO 1Y1TA 2O0JA 3W9UA 4EQ6B 3FXAA 2P6MA 1EZ4A 1NN3A 1K5PA 3QE4A 3AJAA 3OLCX 3OP1A 3WGTA 4CM7A 4DJFC 3OJWA 3IVAA 3OIDA 4YJGB 1L5NA 3TINA 4UUAA 4E5PA 5DNCA 2Z8YA 2PHZA 3BJZA 1GDHA 1EDOA 1ZRHA 1GPWB 1VL1A 2YXEA 4TXMA 2Y1GA 1L5WA 1ZQ9A 2YFKA 3P9SA 4A1FA 3TQFA 4DC0A 3PXBA 3P19A 5IJXA 4B3JA 3F74A 3HDGA 1QVVA 3NAQA 1E6LA 1SU4A 2ONZA 2BCEA 2GUWA 4GQIA 3EVNA 3JZAA 2BAGA 3KVOA 2YICA 1UPUA 1GG8A 4FYPA 4GLBA 1OA1A 5ILQA 5I7SA 2P11A 1LK7A 2RGXA 4A15A 3PUXA 4YJFA 5C1OA 1GUZA 1QK3A 3MT0A 5A62A 4YECA 4KNVA 3GUVA 3N2NA 2DWCA 2Z56A 4JT2A 2HLNA 4ZYWA 2FQ1A 1YONA 2C3MA 4J0DA 4A92A 1YACA 1RHKA 1G6OA 1Q7CA 2R4UA 3O1JC 3TSCA 4BAGA 4Y9DA 3ZQKA 3O3OB 1COZA 5AM0A 2ZT5A 2PUWA 4DLKA 3MINA 3OQHA 3WA6A 1GPH1 2BEVB 2PR2A 1JTFA 1I01A 1WDWB 5ALIA 2CB0A 3SEAA 3DA8A 4MCJA 4Y2TA 2WDZA 2F1HA 5AJWA 3CSSA 2WOOA 3DO8A 3HDQA 3CJQA 3BSSA 3TOXA 4NJEB 2V3VA 2ZULA 2QQGA 4HLDA 4CM4B 3AB3A 1T5BA 4TV9A 1YZGA 4E13A 4YUZA 4AULA 4Z49A 1EWTA 2XB9A 2XQKA 3F6YA 4G81A 3CF2A 1DADA 4BVBA 1TPZA 3DT9A 2OORC 1E3MA 3ZXXA 3RWOA 2OKGA 2BM9A 2VPQA 3DSRA 3A9VA 3UK1A 1FX0A 5K20A 2FV8A 3ILVA 3WYBA 1TQ8A 4HAUA 1PJ4A 3BCRA 4D45A 3LX6A 1NXOA 3GT3A 2CF5A 3PPIA 3V8BA 1TYBE 2QM3A 4LJ4A 4J1SA 4UAVA 3UK6A 5LP6F 2FHPA 3H4MA 2R1TB 2QD4A 1AUVA 3LRPA 1I0LA 2EDAA 2HGSA 3DKRA 2MSEB 3I39X 1QBGA 1Y81A 2ZIZA 5JAUA 1FB5A 3FAKA 1T5DX 4FVTA 3UN1A 1RJEA 1Z26A 2HSZA 3O6VA 4OM8A 2ZSEA 1P73A 3EMDA 3JWJA 5BSRA 1IBSA 3VNUA 5E4FA 4DMUB 3LNTA 3IPLA 2EV9A 2PH7A 2D4HA 2H0RA 3ONVA 1C14A 3L0OA 4QOIA 3UPDA 3MJHA 1GZUA 2FWMX 5C1DA 2HF8A 1KH1A 2WI8A 3UG7A 2QDXA 4KMRA 1SRRA 3JCZA 3CCBA 3M33A 4M0LA 4PHFA 3WGHA 2A5JA 3RUAA 3N2YA 4ZQHA 1CX9B 3AP3A 2HMUA 4LEIA 1SWVA 1NWHA 1F4PA 4MDHA 1FQOA 1CDEA 2CXPA 1G9TA 2P7HA 1QGYA 1N9KA 5EWMA 2GN2A 2ZI7A 1MC1A 1NMXA 1DKMA 1LPAB 2D74A 3LQKA 2D54A 1B1AA 1PFVA 3M49A 2PMKA 4GSKA 4Z4IA 2DQYA 1XMVA 1NVUQ 1GNRA 1ZPDA 2QJFA 4JD5A 4LGMA 4E33A 4RZHA 2C3PA 3TJRA 1AQ6A 3N3BC 2XODA 3FJOA 1PJRA 2BMFA 1YRYE 1POXA 2V7EA 4JIGA 5H7XA 1L7VC 1JG6A 2XKJE 1VL8A 1C4WA 2B78A 4DLUA 1PLJA 4S0XA 3HU1A 1JWLA 3V2HA 4KQKA 1Z4QA 4TS4A 3RS3A 1W1WA 3GRVA 3M4JA 3O4RA 4I1UA 4PVCA 3WJ1A 3CNQS 7MHTA 4UTVA 1U02A 3ZW9A 3GEIA 2EKLA 1SKBA 3ZDRA 4M8SA 5ANRB 4MQMA 2AYYA 4LK3A 3OQMA 1P74A 1SD1A 4JI0B 2ODAA 4Z8YA 4I5DA 4JP3A 1U11A 1DWOA 2FZWA 5CLIA 1TJPB 1L5LA 4YUAA 1X8JA 3HWWA 5JNSA 3JRXA 3U26A 4XGIA 2B6HA 2HLDD 1PP4A 5J2TA 1CJTC 5CBKA 1RZRD 2WILA 3PA8A 1TZKA 3URMA 1TCAA 2X4GA 5KYXB 3EGIA 4R84A 2I29A 2MINB 4OBEA 4P92A 5LYYA 1DRJA 4YJ3F 3FR7A 3IPRA 4HQRA 3TH5A 5D86A 1TYDE 3T3PB 5JZVA 1BE8A 1VLQA 1YNSA 1VRWA 1EFKA 2CN1A 3KOXA 5HHTA 4CQMB 4FEEA 2AGVA 2IA5A 5U9CA 1HLPA 4RD6A 1MC8A 4NDZA 4L4YA 4F92B 3D3EA 3NRJA 1A4XA 3PCRB 2WHPA 3GF4A 4D3XA 3L0PA 1QKKA 4PG5A 5B4TA 1GCGA 1O95D 1NQOA 2D8AA 2H08A 4JLJA 3A3OA 4G5FA 3K96A 3CB2A 4AY4A 3DKIA 2Q9BA 3E7PA 1SZJG 3RRBA 1JI0A 3H11B 5EPOA 4EGCB 4LWPA 4BEVA 3DZCA 2YL2A 4FE7A 4D99A 1GPLA 2JGEA 4BCBA 3BA6A 3V2IA 3WQSB 4E5SA 4P7BA 2ZRIA 4M87A 3CT4A 1T3ZA 3OSZA 1N8TA 2BGJA 4O3FA 5E1OA 3U7JA 3WKDA 3W1WA 2EWMA 1QFZA 3IQWA 1M6WA 2PUFA 1EFTA 1UKZA 2VAWA 4ZU3A 1FE8A 4BKPA 3T52A 2CVZA 1UF9A 2FLVA 1ZN8A 1IHDA 4ND7A 2WYIA 3IILA 3D5QA 1Z8NA 4MVJF 4EG1A 1R74A 3OX4A 3HSKA 1ZOLA 3IPCA 3HY6A 3V8EA 2F4VB 1X15A 4C7MA 1J06A 2VP9A 4AU1A 3ACBA 1TZCA 4RU1A 2FDRA 4JNKA 2W2KA 1NE7A 1J8DA 2OCXA 2ZAOA 4FGLA 1HL7A 1H2BA 1U0HC 2FEPA 2O50A 2VHTA 3PQ8A 4EUKA 1KMNA 2QJWA 4WZAB 4C07A 4BYMA 2K4MA 3LKZA 1JPJA 5AW5A 4FMPA 4DT1B 1XNRB 3PYXA 3UH1A 3MS2A 2ZIEA 3COPA 1CEXA 1WG8A 4RDCA 5DBIA 2HTFA 4C0HA 2O5CA 4JYMA 1GSOA 1OTHA 2CLFB 4OK3A 2X58A 3HV2A 3TEFA 4X1YB 4YFYA 4EPWA 3JVDA 3MRSA 1O96A 1R8SA 5AVUA 4DWJA 4J3FA 5GJWC 2PEYA 1WF6A 2DBVO 2ODQA 1CERA 1THGA 4RMIA 1UKBA 5HEKA 1LXCA 1EM8B 3SE0A 3O8RA 1AKRA 4EX6A 5JAHA 1B0AA 1A97A 2IU0A 1KK3A 1GOTA 1SCAA 2Q5FA 3QU4A 4JA2A 5KX5B 4NHEA 3GJTA 2IH4A 3RYFB 4LXYA 4MWCA 1XJWA 2CW5A 4AAYA 4EVSA 3Q2OA 4QUBA 1CUZA 1FX1A 1PI3A 2H63A 2ZBRA 1PEYA 2IDKA 2Q29A 2R96A 3BWXA 2Q6VA 2WJYA 4GC5A 4D4GA 1A8PA 3PXCX 5EQJB 3GFRA 3I0ZA 2DCMA 2HQOA 2C9BA 3LVRE 4RF2A 2KJQA 3WL3A 4G1EB 2F2TA 4YMUA 1R0ZA 2WFMA 1R0LA 3E4DA 1DTEA 3T3MB 3QLVA 1OLUA 1WXEA 4LE2A 5AKJA 4GLJA 2F8MA 5LXTA 2HHHB 2QS9A 1I3LA 1QR2A 3KHTA 3OX3A 2IV2X 1RWNA 2QU7A 4EG6A 3UK0A 1OFIA 4HS9A 5HRCA 5D1NA 1WV1A 3L07A 3RIHA 1A0OA 1V5EA 2Q8PA 2QUBA 4Q3CA 4ENPA 3FVTA 4HBGA 4HDMB 1QJCA 4ND4A 5BQOA 4KG7A 4OG2A 4RH3A 2F9FA 5CVDA 1XWIA 1WCYA 4G0MA 5IF3A 1W0KA 5T4BA 4B8ZA 2VTEA 2ZTHA 1EGAA 1S9HA 2EYUA 5H82A 4O63O 1O08A 5L95A 2GSWA 1QTIA 5BW6B 4FLMA 2MR6A 3U80A 1N2IA 2G1AA 5DLEA 2UVDA 3LQQA 1KBZA 4HATA 4IOJA 3FGZA 4NFSA 1UOPA 1Q6ZA 3S7TA 3DMNA 3WHPA 3H0CA 4WOKA 5KX5A 5TT0A 4H0NA 1OAOC 2DQKA 4U9HS 4CL0A 5EMJA 1YS4A 2A30A 3DB2A 4L0QA 3DR3A 2IUSA 1ZNZA 2A6PA 3O91A 4HJXA 1UUFA 1GTSA 3QE0A 1F8FA 1B6TA 1DKRA 3WGMA 2YYYA 3EJWA 3EW7A 1B7GO 4WJZA 2R62A 2IYRA 2VWQA 5U4QA 2GKOA 3I9MA 3EGXB 4KX3A 3K5HA 3G2PA 4HLUA 1C0EA 3C3PA 3PWSA 2H0QA 3Q4GA 1I13A 4FDAA 1LPOA 2GAOA 4L4ZA 4KCGA 3LF1A 3HJCA 1FFAA 3HBNA 3AR6A 1SWWA 2EL7A 4P22A 3LIPA 4HV4A 3INGA 5LD2C 3F8TA 4CCYB 5A9SA 4BUZA 1E6CA 3QELA 2FY8A 4D4JA 5CX4A 4FFOA 4DLTA 4RULA 1BTOA 4M0DA 3V8NA 4KMSA 1RKBA 2ZUUA 4LYJA 1UXHA 4CM5A 2D7JA 1OOEA 2R4TA 3DZDA 3ZZTA 3WLPA 2XTNA 2W8BB 4I50A 5DU2A 3U1TA 3ZW7A 4BYGA 1FC0A 5EKXA 3DW3X 3WK6A 3DKPA 4AJ4A 2E1RA 4CIAA 2JLXA 1EFHA 3SF8A 2JGKA 1YKFA 5DTMA 1QTQA 2WSSA 2DX7A 4TWBA 1ZJ5A 1CUWA 3IA7A 3RYFA 4U7PB 3NEYA 1W36C 2RK3A 4YIKA 2PA0A 3U81A 4ZT4A 1KI3A 2ZEJA 1WVMA 3SFTA 2F3SA 1WP9A 2WTMA 2WT9A 3JASA 3W8EA 3A9SA 4CKEA 3LBYA 5AKLA 5A0TA 4BOYA 2RHOA 5JS7A 3U6BA 4MEBA 2UVPB 4K5QA 1MKYA 4L15A 4Y6RA 3RSOA 3SX4A 3T1OA 3V7YA 1GNQA 2XGGA 2JCVA 3NYRA 3U4QB 4EY3A 1VPWA 1LA2A 3TEMA 4ASUD 4P36A 4LYEA 3A7EA 1XPJA 3PPXA 3OLQA 3E2PA 1QIJA 4UM9D 4IEFB 1JB9A 1F48A 2BKVA 3AGPA 4QRHA 3E9RA 2ZAYA 4L6IA 2JATA 1UMCA 5EJMA 1KVUA 2JLBA 3SSNA 3TOZA 4H1TA 3J7AC 1EE9A 3IV9A 4Q9IA 3WK8A 3ODGA 2IITA 4MQ5A 3CVJA 4DZZA 3SQWA 2PCJA 1B8VA 1RS0A 2WFLB 3MN1A 4DNFA 2IZ6A 2RCNA 3AEKA 4ENVA 2AOWA 3EVCA 1SKUA 4DIKA 4LI0A 3CZQA 1XAHA 3ZI4A 3ND5A 4G5XA 3OE4A 4P2GA 1WPRA 4ER6A 4DR2B 1UFKA 3O3MB 1JQ5A 1OFUX 2PO5A 1S2DA 2OXEA 2Y1KA 3EGCA 5AOAA 1OASA 2X23A 4B4KA 2IXEA 2E5FA 4NL4H 4Q66C 4B80A 1IL0A 5AXCA 4TWAA 1VMAA 1DP4A 1S9DA 2GZDA 4G25A 5B3KA 5AVYA 1I9CA 2Z57A 4I81A 3V80A 1CDZA 3E35A 3S2EA 2FJ0A 2OECA 3KZCA 3LE8A 3Q12A 1K0UA 1EP3B 1UM9B 1ZM7A 3R3XA 3W5IA 2GD6A 3NR2A 4KPUA 1LSSA 2FPSA 3VISA 4ZIRB 1QRRA 4K40A 3GEDA 4GPAA 3W6ZA 1VYHA 3TB4A 2VHWA 2V74B 2ON6A 4JELA 3UANA 4IO1A 4NF2A 1KI7A 3I3SR 5D3MA 4Q48A 4EFMA 4NIMA 4PF1A 1J0EA 1QVRA 3MRXA 1CLUA 1M67A 1H65A 4HB0A 5B57C 3OSUA 1W59A 3AWIA 1H0KA 4CF7A 5KIAA 3WLNA 1M0EA 3WFJA 3MMNA 2OV2A 4WLOA 5HIJA 2WJ4A 4CT4B 2IF0A 3TQHA 1LU9A 3OMWA 4W5HA 3NX4A 3P9RA 4HTFB 3SSOA 3ICCA 3X44A 1D9XA 3L6RA 4ARVA 5B6JA 4QNRA 5CT6A 4V0LA 3KEMA 4PAQA 4YA6A 2DR3A 4JLNA 2CDAA 4ESEA 5ICCA 1DKNA 1ZKDA 3FYCA 3H2KA 3S44A 2ESRA 3NKFA 4MLPA 3IDZA 4H6VA 1BGVA 4EB6B 5A04A 4B3MB 2QYSA 2WTNA 3HN2A 4W5RA 4G4JA 2GXAA 5BQ3A 2H4WA 2O7NA 3K9BA 4AMGA 1NVTA 1YI8A 4L95C 1SBZA 4MRMA 4P32A 4QRDA 1MO3A 1O8CA 2FSVC 2GAAA 3HA5A 1P4AA 4NBSA 5FR2A 4Z9YA 1R9JA 4RIGA 1ML4A 4KXFB 2QNIA 1JVSA 1A9OA 3DBOB 3AXSA 5CB8A 5CEFA 4CIDA 1Z2DA 2EP8A 2VP3A 4LY0A 1JKFA 1MEJA 2IYVA 4FYMA 4MUKA 1DXHA 2E21A 1XTIA 2A9KA 2VVTA 1FVXA 2B7LA 3PX2A 4AUEA 1F2UA 3WLFA 1HF3A 2R60A 1TEZA 2XXJA 1UJ4A 1V3QE 5JTUA 1ZITA 3U4AA 3CF4A 1QG0A 1NR1A 1PYOA 1ZSNA 2WVHA 2XSZD 4GZMA 4OFZA 5GONA 1UMKA 3OEHA 4ZZ0A 2V3CC 1A9YA 5AYVA 4Y9SA 3AT1A 4TRMA 4RSRA 4QRIA 2BEVA 2WJGA 5TGTA 1KQGA 4HYEA 4M7RA 4PO1A 4XCXA 4F0JA 3OPYA 1THZA 1X7YA 4FHFA 4JLKA 4ACAA 5IZ4A 4DWOA 1HORA 2AMJA 1X7ZA 2DBZA 1Z8FA 2H4XA 4IDOA 4U2EA 4QUGA 4GPTA 5CIWA 5DWVA 4IJMA 1RLJA 1MNQA 1ZNQO 4NHOA 5IW8A 2HIHA 2WHPB 3EUWA 3FHOA 3M6LA 3R5JA 3WKCA 3X1WA 3ZQJA 2Q5IA 5AJTA 4TVOA 2EGHA 2V98A 1HDGO 1L8AA 1S7CA 2FFJA 4H4EA 4JLPA 1SEPA 4PICA 3TTTA 1NM5C 1C8VB 3NFYA 1VIYA 4MV3A 3FZNA 1M2FA 4AQDA 2WIDA 1SOVA 4LX8A 1IXYA 1NW9B 4RCYA 5KQMA 4Z3DA 4DLLA 3PHHA 3SP1A 2FWAA 1MO5A 2XF8A 1A9RA 4MWSA 4BX9A 1IUNA 4C7XA 3ED1A 1TD1A 1CHNA 2YJ3A 1R6TA 3ADKA 3GUZA 4XEHA 4CEIA 5DSZA 2HCTA 1M2VA 3M4YA 4NEQA 1KSGA 4QXPA 1JXAA 2CDRA 1U8CB 1TUGA 1Y9EA 2P5UA 2O2XA 3QIVA 3R7WA 4JASB 4ZARA 2YWEA 4WZ6A 3O9ZA 4LF9B 2P6UA 3KLOA 1ZMBA 3NAMA 3L4EA 3EODA 1YQWA 5FD8A 2QLBA 5EHXA 2R3SA 4JZYA 5TS3A 4F2PA 3IAAA 3D7MA 3D6TB 1R1DA 3RIXA 3HNRA 1L5OA 5CB4B 3B48A 3C8ZA 1O5OA 3NPMA 3PNMA 4FP9A 4BU1A 3AUSA 3G2OA 5GINE 2RGNC 1NUUA 4MWGA 2Z4SA 4QARA 3FHTA 1JL3A 2XB6A 4LNUA 4QBIA 1F5NA 1V1MB 1A95A 1E92A 1YI1A 3GD5A 3RKUA 3V7NA 4HAXA 5B58T 3EOZA 1V5WA 4MINA 1FRNA 2CT8A 4LZJA 1ZAKA 3DPUA 1L4LA 4URZR 5EJFA 2PAAA 3WYAA 3IA2A 4E5KA 1N0UA 2QG6A 1ZMOA 4A5OA 4C78A 1HDRA 2VCYA 3DC7A 3P2IA 3PJGA 3BBLA 4KO3S 4WNIA 3E7DA 5T3YA 1NW5A 3H5OA 4FYKA 1P5FA 1S2IA 1YFKA 1C8KA 2BIFA 4A0RA 2BGLA 2IL1A 3LNCA 1XSEA 4ZVUA 1N34B 2IRWA 5KVAA 1XRRA 1AZTA 3GRFA 4PQRA 3UTCA 2Y0EA 4V1CB 5KQLA 4Y2VA 2J0EA 3WGVA 3SZLA 1Y1PA 3D6NB 2HU2A 2WJAA 4KV9A 5HCUA 2IV3A 1OLXA 1B26A 4UDOA 2WA2A 4EEXA 2YWBA 1FXWF 1QIEA 3DF7A 4HWKA 1K97A 1CJBA 4NNJA 2ASEA 3E7WA 4WH0A 4WLVA 3ZZ0A 3VKGA 2H7VA 4QYSA 2PZAA 2BEUA 1CDDA 1XKLA 2HO5A 4XFJA 2XHZA 2YINC 1K75A 2GB4A 1P2SA 1T26A 1TW3A 3CLKA 3EY4A 5B37A 4CW7A 5K0BA 3PB3A 2H18A 1LW7A 3BIFA 3HCPA 1ZGGA 3AYXB 4CFZA 4RACA 2XNSA 4PCUA 1ODTC 4Z4QA 3RADC 4CYMA 2GZSA 3WYDA 1UMBB 5LZ5A 5KTRA 1DIAA 3HBJA 1SNYA 2HRRA 3AP1A 5D85A 1CE8A 4GI7A 2RB5A 1W85A 4DR1B 2QSJA 3PUHA 5KTTA 4DNQA 4ECEA 4KQCA 1JNXX 2VDLB 3UFXA 4B3TB 1CBUA 1WUIS 1GSIA 5FOTA 2RE8A 5FDFA 1RAFA 2WQ7A 1II8B 3JQQA 4J4BA 2DFNA 1RCFA 1K68A 1L4KA 3AVOA 3WGGA 3DO5A 3TDMA 5IZCC 5CU7A 3K0KA 3P0RA 2QB5A 1N1MA 3IQEA 3GLGE 1DV1A 1S2OA 2GCNA 4IGKA 2J5XA 2WWYA 1JE1A 3MTJA 2QP9X 1MENA 3PFGA 4WDQA 2NLOA 1H1LA 2V58A 3HUDA 3DMTA 4M0PA 3ZWNA 4C2TA 1OC2A 2IP4A 3NV9A 2FG7C 4CLHA 3BPSA 3K70C 1OAKA 2CEKA 2Z9CA 5ECWA 5MHTA 4WXYB 3ZR4B 2C1EA 4Q4HB 4KXQA 3KVYA 5HBGA 3VTKA 3SAJA 5BVGB 2MSWA 4K6KA 2XRZA 2AR7A 2G1KA 2ZR7A 4QODA 1ORTA 4NE2A 4OYHA 4TZKA 2EX1A 2R7MA 4PO3X 1LX6A 5BSEA 4KAJA 3S40A 1IK4A 4F60A 5LL6P 1GIAA 3FIUA 4BVEA 2O1XA 1JLSA 1CEYA 1TTPB 2BEKA 3EZYA 2QRKA 3FOCA 1IY9A 1NQVA 5FBRB 4W99A 3W8DA 4EYKA 2ZS9A 2XGJA 3A32A 2REQA 1HEIA 4GDMA 4PC2A 3T5MA 1N8KA 5KX5F 5JSUA 4OHFA 1FJHA 4QPJC 2F64A 1I7PA 4J94A 1YQTA 2CVOA 1V8BA 4K9PA 2A4MA 1R0RE 4IX1A 2QBYB 2IEAA 2HF2A 2FWNA 5CDHA 3IURA 1P17A 1XRQA 3LF2A 3R23A 5LZ7A 2IIPA 4OLJA 3RU3A 4LFAB 2G9VA 3AUTA 4OUKX 3U44A 3KP1A 2FPKA 3L8FA 1GKYA 4E32A 2P5SA 5P21A 4DHEA 5BV2P 3K3PA 3N2LA 5JSFA 4DSUA 1EFVB 1QFJA 1TJNA 3UH0A 2B9VA 3NHSA 4O33A 1UADA 2DPXA 4FJ1A 3FSEA 3T99A 4WNCA 1P3Y1 1FDVA 1L4FA 1ZBQA 3MJVA 1I4TD 5K9ZA 1RHJA 2IEZA 4QJBA 5B7QA 3AMVA 1U2GA 1ZXXA 1UOQA 3L0SA 2PX2A 2Q7XA 3KALA 2Q0QA 4WKOA 3BRWA 2XUPA 5LZ9A 2XTZA 3DR5A 4WN9A 1C9JA 1PR3A 1ZNYA 4YALA 3WWZA 2AFIB 1O0CA 1Z4PX 1W88B 1IOZA 1H8HD 2IEGA 3AIIA 3HL0A 1NXQA 4P4GA 2B36A 3JQ8A 4E3WA 5EY5B 3AVXA 1YQDA 2Y71A 4JBNA 5DCYA 2Y66A 1MOZA 2GA8A 3GJ3A 1K9SA 4TSRA 1NVWQ 1WPXA 4AO7A 1H4VB 3RIEA 5FWXB 1UXIA 4HQLA 1G5RA 2GK3A 1TO1E 2V7XA 2VEOA 2W00A 2ZTVA 3MLBA 4FFLA 3R41A 3S2FA 4AJPA 4EWLA 5ILOA 1I2MA 1ULBA 3COJA 2HWWA 3HCAA 2M1XA 1C9EA 5CIYA 3H2BA 3A2KA 5HOEA 2PBZA 2JJ1A 4WFQA 3IIJA 4GVXA 5DBOA 3WDSA 4HNHA 2WJPA 4YJKA 1M1XB 1W5BA 2MHCA 1M6VA 2PS1A 3RFUA 3LP5A 5LYJF 4CHTA 1IWOA 3VUEA 4PINA 5DHQA 4MI3A 2B61A 1XRSB 2BBSA 3F4BA 4BV2A 2PUBA 2RCYA 4N41A 2PQ6A 1HSOA 4NG4A 4ZEWA 3Q7IA 1J5PA 4I4NA 2HBRA 4NP6A 5FA5A 4OHCA 1TYAE 2XWSA 4BLQA 1JGTA 5EZYB 4DVGA 2BFMA 3GJSA 1MR3F 3HSSA 1M2GA 3SIWA 4PANA 4FX5A 5B1SA 3PQFA 1VYUA 3T5BA 2I1QA 3WGUA 1Z39A 2AWOA 1NVEA 1GVHA 2AHOA 3DJFA 4JQYA 4QPNA 3U0BA 2R6DA 4DJDC 1K7CA 2HA6A 2RH9B 4I66A 4QDKA 3WV5A 1U4OA 3AO0B 2GM4A 2G9QA 3A0RB 2R48A 1SRQA 1GU0A 1RZ3A 5JD5A 1IHOA 2REBA 1W9MA 5JRDS 4QU0A 3S7ZA 2G3YA 3ETDA 3DFIA 1B00A 5IJ9A 2VNIA 2P9HA 3GIWA 3FYHA 1XPUA 1Q1BA 4DR6B 1V2GA 5DO9A 3HS3A 1GPUA 3RI3A 1YVEI 4K28A 1LBQA 1AKQA 4HQOA 3KL2A 4ZT7A 4QREA 4ER3A 5L8VA 1HRKA 4IKOA 3B8HA 3WQQA 1XAIA 4LY9A 3ZDAA 4OJKA 4DW8A 3R3HA 4K46A 4WECA 4AT1A 2FSPA 4Q1CA 4BQSA 1EVQA 3AXTA 3I83A 1VL6A 4M1TA 1PVOA 1I4OA 3FD8A 5L7TA 3H9GA 1BU5A 3W79A 1EK1A 5H1YA 3THWB 2REQB 2Q4RA 2IPMA 4WINA 1BDBA 2OO5C 4NNOA 3IP1A 2O2JA 1BQ4A 1UINA 1DGQA 2ZUEA 3QLTA 1FYVA 1NT4A 1R00A 3TE7A 5KWJA 4Y9TA 1TLLA 2ERYA 2HPHA 4EHKA 4F5DA 2EBWA 3L82B 3V9AA 2XT0A 3ANYB 1ZOOA 1NYQA 5E2BA 4FZ3A 1C9NA 4L9AA 3A9TA 5CT5A 4ARIA 2B1JA 2XCSB 1RC1A 3QEMA 5GMOA 4RZQA 1K9VF 3CA8A 3INYA 3TR0A 1ZL0A 3G6WA 2VJYA 2AH5A 4IEEA 2NTNA 1C4OA 2Q4OA 3ILSA 3FVWA 4UOQA 4QTYA 2WD9A 3QWBA 2O2EA 3DL7A 2OSVA 3FETA 2MWMA 4BXOA 3I2YX 2DUUA 1V4NA 1XZAA 4P34A 4WD3A 3OJ0A 3EN0A 4PN3A 3BMNA 5CFPA 2P1RA 2IYFA 2VYVA 3FDZB 2YJGA 5CVCA 4AMYA 4DNOA 3TIVA 2NVUB 2J6BA 1WS6A 3VVCA 3PFKA 2X0EA 3HDVA 2X3UA 4LHEA 1HZZC 4IDGA 1XZIA 3W1VA 3FPLA 4H3VA 2WQZA 4H7EA 3BA1A 1ODKA 2ZSUA 4HP8A 3C7AA 1NMQA 1WD7A 3KQPA 1UEJA 2DPHA 3D02A 4FXPA 3IVRA 3PU6A 3JQ9C 4MB0A 4U7HA 2J9RA 3ND8A 1DXYA 1O96B 3NIGB 4XIFA 4YT4A 4AZTA 1IHUA 4KYTA 1L5QA 5FADA 2J6CA 2FPIA 3CEMA 4MJ3A 3WK9A 1X77A 3GBSA 7ADHA 4WLUA 1EMDA 3DQQA 4QU8A 4NNPA 3V1YA 1XN1A 4AP6A 4X84A 4DM3A 3U56A 4AP9A 1G5IA 3KJEA 1Z5PA 1JX6A 1DQNA 2JFQA 4WUTA 1EQAA 2WMOB 3G0CA 3MQ2A 2XWJI 5I4IA 1Y5RA 3I53A 1TADA 4P58A 3ZDBA 3DBHB 4I9UA 3R5SA 4D9JA 1T1EA 3JTEA 2D06A 3EEQA 3Q98A 5HKAA 1OHHD 4LF7B 3BAZA 4UM9B 5ALUA 4DMKA 3DAOA 4LZWA 4IV5A 4ALNA 1ICIA 5FPSA 4D26A 2Y1EA 2ZUSA 1ZJZA 1X2EA 2RAPA 1SC9A 2V7QD 4Z7NB 4HF7A 4E14A 1PZGA 1Z34A 3HWX1 1HDZA 2NUTA 3G0BA 3JD2A 4PHHA 1GO2A 3VNSA 4B2LA 2PKQP 1JFTA 3AZOA 2ZCVA 1J8FA 4HEA1 5CGQB 4F6RA 1AMUA 3MCAA 3KFXA 5ES4B 2FPLA 3ZGOA 1KZ6A 1QHEA 1KI6A 1A2OA 1J2YA 1KKMA 2HM7A 1P9OA 2NYRA 3GLQA 4ZT3A 4A26A 2JI8A 3FYTA 3O31A 3R44A 5HIMA 2PX6A 3UGTA 2PGIA 2QDKA 4RPHA 3SKXA 4YXWD 4I7EA 1D2CA 3GQBA 3SX0A 3Q87B 4INPA 4UEJA 3CO0S 4GOND 3ZWXA 2YOHA 4V0RA 4EHDA 1DU4A 1OXBB 4JC0A 1I1HA 4Z3OA 3TI7A 4PR0A 3DE5X 3DLBA 2CNWD 3NBAA 3S2UA 5JV5A 4CKWA 2J3IA 2OFWA 3IE1A 3D3KA 1R0BA 4NYIR 4MS3B 1T3TA 4M9CA 2VSNA 4UE6A 4ZFNA 1RPZA 1ELOA 2GVDC 4XI9A 1ZGCA 3MFYA 4KPGA 4V3CA 1JW9B 1PLLA 2XWBF 4P7JA 2QLMA 5L53A 1OBCA 4G24A 3DBLA 1WB6A 2FAXA 3FTEA 1M2VB 1L6IA 1X9GA 1EVLA 1XZPA 3VPFA 1I0IA 4MA5A 1U7HA 2JCGA 3KD2A 4LJAA 1FP1D 2YZ7A 5ENZA 2IBTA 2XW6A 3SOPA 3SWWA 4XOUA 3DCNA 4XIJA 1J56A 2XNDD 4M1MA 1SXJE 2V65A 3NUGA 3W8NA 3OCCA 4ZAGA 4C3OB 1I3CA 1C3OB 3OVMA 2IHJA 4RGQA 1Y4DE 1Y9DA 3IESA 4IZOA 4N03A 3I9JA 5JHHB 3T7SA 2E6KA 1P7WA 1KXZA 1QX3A 2PKXA 3I1FA 4KAAA 3SKVA 4D4MA 4W5NA 1QYRA 1Z62A 1KBOA 4EYOA 5FNVA 2XCTB 4YQZA 5FI3A 4RTNA 5C8YA 2JBWA 4M1EA 2PSJA 4JJ8A 2PE5A 3NC0C 3AR9A 3A9CA 1W19A 2CKMA 4LGCA 5C34B 3RVBA 4ND8B 4UVGA 4M1ZA 5AM5A 3MFQA 3VDXA 1KYTA 3GW8A 4QFCA 2YBEA 2C82A 4OHZA 2ZUFA 3GNSA 2W2LD 3LP6A 4QUEA 4KPFC 4YRIA 4RADA 3I30X 3H42B 3Q88A 5I4BA 3FKQA 4POAA 3TRIA 3JYHA 4CQNA 1SUBA 1NXWA 1D09A 3GDHA 2JHFA 2XAAA 4W5TA 4ZYYA 3BORA 1SBYA 3IEMA 1Q22A 1D4ZA 1ESDA 2QMYA 5H81A 3TZEA 2R7LA 3ZTWA 5I4KA 2QYOA 3IBGA 3JD0A 2ZLBA 1G98A 2DJ5A 4U5QA 3AG6A 3IB3A 5TMDA 4DIOA 5ADHA 3ZS9A 4GUDA 1B3RA 2AG8A 2FN9A 3DWIA 2OCKA 2QHXA 4ALMA 1UZNA 1RRKA 2LKDA 3H2GA 3BRWD 4O8CA 3TL2A 2PQ0A 2BFDB 2QT0A 2XB2A 4DIUA 2RGNA 3UT6A 3EDQA 4H2DA 4XKJA 3WKAA 5ERYA 1RJ9B 2Q6LA 2ZYSA 1D8AA 4NDNE 1F3LA 1EXMA 2JZOA 1HLFA 4NZZA