3SQXA

Structure of mss116p (nte and c-tail double deletion) bound to ssrna and amp-pnp
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
508
structure length
508
Chain Sequence
SKLIHVPKEDNSKEVTLDSLLEEGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLINTKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High-Throughput Genetic Identification of Functionally Important Regions of the Yeast DEAD-Box Protein Mss116p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
total genus 196
structure length 508
sequence length 508
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2011-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sqxA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sqxA02
1XTRA 5CM9C 5EE3A 3QXSA 4P3YA 4C7OB 1GZSA 3A37A 3BH7A 2GBLC 3ADCA 4F4CA 1XD2A 1BYIA 1G64A 1Z06A 1KIMA 3A4NA 3VU9B 3FE2A 3NDBB 1G18A 5BN4A 5AUQA 1L7VC 1ZAKA 1XCMA 1P3JA 4PSVA 1UM8A 1KSGA 4HAUA 4TQ9A 3U6KA 1Z83A 1P5ZB 3NVAA 4V0MA 2V6IA 1K8RA 5FUXA 2O0KA 1FUKA 221PA 2CCKA 1VCOA 4LJ8A 3U2QA 3QVVA 3UG6A 3RRMA 2WAYA 3ZGXA 2P65A 1P7CA 4JJKA 3SS8A 2ZUCA 4GI7A 2VHJA 2RGXA 2G83A 4M9QA 1U8AA 1X1RA 3R7WA 4MKIA 4J0QA 2W58A 5DSZA 3FHTA 2VYFA 1SGWA 4US1R 4Y0AA 5GVSA 2IL1A 2RGDA 3B82A 3HR8A 2XEXA 1CXZA 1EGAA 1G1MA 4CW7A 2ASEA 2ONJA 3X1YA 5JI2E 1J99A 2O8DB 1GNRA 2JLSA 4Q4JA 3MWJA 3U7FB 4ZCIA 1E32A 2AR7A 4WXRA 4RVCA 3L8YA 2QENA 3GLFB 1GKIA 1ZUHA 1DARA 2Q6TA 3U3OA 621PA 2P6RA 2NZJA 3UMRA 5BYJA 1S9HA 2WKQA 4TMTA 1OB2A 2RGBA 2Q9CA 2CE2X 5JRJA 3LW8A 1EESA 1BS1A 3FFAA 3WY9A 4PO1A 2JLUA 3AF0A 4ARZB 3NBFA 4DT1B 2FMXA 2FFHA 1G4AE 3NBYC 2YC4C 5TDHA 3I1FA 3PUXA 4KFRA 2ZUBA 1L4UA 5FI0B 3QUSA 1CS4C 3S1AA 1XP8A 1D9ZA 3D8BA 4X8LA 4LV5B 5HPYB 5F9FA 4RZ2A 2ZJ2A 2HEIA 1OFHA 1WA5A 2P2LA 1J90A 5SZJA 5BXQC 5DIFA 5H70A 1G3QA 3CRMA 3LRPA 3PQCA 3AH8A 3AKDA 3D7MA 3SFVA 3QXJA 4P4SB 3S1AB 4E03A 2XNDD 5H68A 3SNHA 1GKUB 4A1FA 4C0JA 3GP8A 2D2FA 2FNAA 2OCAA 2I3BA 1Z47A 3U7EB 1JPJA 2YWHA 4XSGA 1D5CA 3GLHA 1BIFA 1G3MA 2C96A 4KI0A 2GAAA 3Q9LA 1VDZA 3BK7A 1ESNA 2YJTD 1HURA 1ZNWA 3IIJA 2A3RA 2P67A 2GEVA 4BFUA 3IIMA 3C8UA 3KJIA 4DEYA 3VR5A 4PPGA 4URXR 4DB2A 3AVPA 4FMCB 1U0JA 3RS5A 3N2IA 5EXPA 2D62A 3V00A 4JVMA 4OHXA 4R7ZA 3A58B 1FTSA 1NLZA 4LZZA 4PAMA 3QVUA 3CH4B 2F43A 3MCAA 3PV0A 3R9IA 5A5GA 4CZ2A 4B75A 5CIQA 4UQOA 4Q18A 3UMFA 1FPMA 3HDTA 1FMLA 1QG2A 4OI4A 1W0KA 3GFTA 2YWGA 3FPAA 2RHMA 4CRWB 5G3YA 1E99A 4C9BA 1GUAA 3EX7C 2WJHA 1RFLA 4AYTA 4B48A 4CDGA 1U90A 3K0CA 4XH9B 4EPTA 2FFBA 4GMDA 2AK3A 2XZOA 1W36B 3OAAA 2DYKA 2V1XA 2BKEA 4B35A 2YVUA 1U0HC 3I72A 4HYYA 2QY9A 3THOA 4B47A 1R0YA 4URZR 1JR3D 1MRSA 1TQDA 1AKYA 1GVNB 1OPXA 5EUQB 4E22A 1OXSC 4FCVA 1ZC3A 2FZ4A 3EAQA 3P27A 4TYYA 2NO0A 4U02A 3B5JA 1XEWY 3ZD7A 3RWMB 3MUFA 1OKKA 3IUYA 5DN6A 1OLOA 1Q1ZA 2R2AA 4MH0R 4M1TA 3TK1A 3Q3JB 5E95A 3TUJC 3IBGA 4AYWA 1HT1E 2ZREA 2XNDA 3JZAA 4HZIA 1DO2A 3O47A 4JVNA 5JCZA 1SVWA 4JSTA 5EZ6B 4YLGA 3X2SA 3GLHE 1ZC4A 2GNOA 3GJ5A 2FSGA 1XZPA 2V55B 4A0GA 2VP0A 4QM7A 1YR6A 4D4MA 3ZLJA 2A5YB 2AK2A 4UXIA 4JLVA 4AKGA 3DOEA 3QI2A 4IW3B 3QPVA 2G9NA 3SBDA 3U4QB 4XWAA 1FUUA 3AF4A 3LAWA 2XOKD 5TB5A 2D7CA 2Q3MA 3QXHA 5C18A 3TKLA 4D2IA 2QG6A 3IHWA 2ODNA 1IJFA 2OCBA 4TLBA 1N3BA 1P2SA 1JECA 3F8TA 2ZI9A 1HYQA 2A9KA 3GQBA 2ORWA 4XVQA 1XTQA 2XB2A 5EXTA 4NL4H 1N5JA 1JB1A 1W2HA 3OAAD 2QEQA 1YJ5A 1WB9A 4AI6A 3V4FA 2ZRNA 2X2FA 3A1SA 3RSLA 3SYKA 1NLFA 2KWIA 4HUQB 4URYR 1ZM3A 4MITA 2IUTA 2BV3A 5CITA 3AKCA 3RABA 1AS3A 1H8HD 2RHDA 4G3XA 2KSQA 2ZR7A 4NBSA 1XD9A 3GLGA 5F9HA 2QA5A 5DN6D 4TYWA 3CWQA 1BYUA 1N6NA 4A2QA 1NRJB 1GOTA 2CEAA 3MJRA 1KK0A 4XD7D 4DLZA 2GK7A 1QG4A 3GCGA 2ZRMA 1S3GA 3BWDD 3GJ4A 2OFXA 3U44A 1WBDA 5BWMA 1XEXA 2GA8A 1WDTA 2J45A 1YZLA 2DBYA 1XXHA 4DWJA 1OIXA 3CW2A 3HYTA 4HLQB 1G4UR 4LJ5A 5CJPA 1NBME 2D4HA 4MGKR 1QHIA 4KBFA 3TR0A 2AXNA 1E2MA 4ILEA 2WWFA 4M9XA 3AVUA 3GLFE 3LBNA 1U98A 2QM8A 1Q44A 1ZIOA 2D3WA 2MMCA 3CPJB 4LJ7A 3U6BA 3BERA 5EE1A 4LWZA 4OYHA 4GSYA 3LVQE 3EXAA 2IEYA 1CBUA 3TVDA 1ZU4A 4PQYA 3CX6A 2PEYA 4XTRA 3SN6A 2OG2A 2ZYUX 3U5ZB 3THYA 2QAJA 2JIZD 3WNCA 3GLIA 3PITA 5LD2C 1D9XA 3UIEA 2GDJA 4RFVA 1GRNA 4M1WA 4L8GA 4MYCA 3THXB 2DWPA 1UKEA 4TL9A 4BPBA 1U9IC 4QHYA 1E9BA 1RRGA 2W2VA 4YC7A 3OE7A 4D26A 4BZPA 2J87A 3GEIA 4OK5A 2AFHE 1MABB 3I5YA 4QHSA 5DI3A 1RJ9B 1G7TA 1KI3A 2A5DA 5KNDA 3KTAA 3WNDA 3B7GA 2ZSFA 2XAUA 3H1TA 4QC2A 3AVYA 4JLBA 1ZD1A 3TR5A 2G1KA 3TLXA 2JCSA 2C9OA 2EFHB 2HF8A 3DMNA 2PZFA 2O0JA 4TWZA 1J8YF 2AHOA 4TLDA 4RKEA 3ADBA 1OYYA 5DYGA 1KK2A 4BQSA 5B57C 1OJLA 2VTKA 2IW3A 4QNRA 3BB3A 3VR2A 3SQXA 1KO7A 3AM1A 3KZ1E 3GLGE 1XTIA 3KL4A 2D74A 2IWHA 1KMHB 2WPDD 4TZ0A 4FMDF 2ZAOA 4C0LA 3TUZC 1EWQA 5FR2A 3NC1C 2P6UA 2YWEA 1KSHA 4ZPXA 5KPDA 5JHGB 2WTUA 2JLVA 2H1LA 4WIAA 3DOFA 2DY1A 1E0JA 1W4CA 1JXOA 2KJQA 2V9PA 3CRVA 5SZHB 4A6XA 4BFVA 1P2TA 4CIDA 1CLUA 2N1BA 4ERNA 4QJ3A 5DNYB 2CHVA 2A78A 3EZ2A 5K8TA 1KZ7B 2F1RA 2FV8A 1XEXB 1Q57A 2ZTSA 3FGNA 3B9PA 1HE8B 3VTKA 2OT3B 3FFBA 5JLJA 5DI9A 3M6AA 4KITB 1Q20A 5AJZA 3ZIAD 4WW0A 3MRSA 1W36C 4FMDB 1VCNA 1Z2CA 1G5TA 5KU1A 2GEUA 4WZBE 2FSHA 2QP9X 2VP6A 3B1XA 5DLQC 4YDHB 2BWJA 3C5HA 3AP1A 4DXAA 4DKXA 4P33A 2GJAA 4LJAA 5EP2A 2G3YA 1JBKA 1GKYA 4FCWA 4P31A 3W5JA 4HZUB 1XTJA 2R65A 1OXVA 1S8FA 1E9EA 3VMFA 2HV8A 5KSYA 3SC3A 1E2IA 4O3MA 2O5VA 4N1AA 2XGJA 1YZNA 1TF2A 5JBQA 5FUYA 4TTPA 4B43A 5JZVA 4TZ6A 3WMEA 2J0UA 2C78A 3AP3A 3LLMA 4X8OA 2H8KA 4KVGA 5AR1A 1VHTA 2ODEA 3RAPR 1KKLA 3ZVLA 3PEYA 3H84A 5UKDA 4BFXA 2RH5A 5HCIA 2FEOA 5BW8A 4MRNA 1N0UA 3TQFA 3I62A 2FZLA 5KPJA 1SVSA 2ZJAA 2QI9C 4V03A 2ZIAA 2GJSA 1EFCA 4DBLC 1AQUA 2CE7A 2NO6A 3W6PA 2ZRJA 2HLDD 2CCGA 1NVWQ 2YC2C 4ON9A 3UWOA 3ND8A 5EE0A 3U60B 3AVXA 4A92A 2ZRAA 4YONB 3NH9A 1G5RA 1OH5A 5K8UA 1G3IA 4EPRA 1FP6A 3IQWA 2JJ2D 1NKSA 3FB4A 1KI6A 2JDID 2NZ8A 5CM8B 4NYMQ 2IBMA 2OLKA 5EXXA 3CZPA 4WA7A 4LDJA 4TT3A 1GRRA 2ZVPX 1KDTA 4FIDA 1OW3B 2QE7D 3FMIA 1B0UA 1JPNA 4I81A 1R0WA 4OI2A 5FUWA 1S0UA 3CM0A 5JHHB 1IY1A 1GL6A 1Z07A 1R10A 1QHGA 4A8JC 1W0JD 3K9LA 4XVUA 1TX4B 4MQBA 2JASA 3T34A 4GRAA 1KI8A 1DAKA 1OFTA 4HB3A 2VSOA 4MA4A 4Q03A 3PUWA 3QENA 3DHWC 4HATA 4PC7A 3B2EA 3B6EA 4EKDA 2IUSA 3GJ7A 1K6MA 2EW1A 4TYQA 3VHLB 2ZJZA 4FCTA 1HA3A 5FOTA 4UNRA 2JA1A 4ZI2A 1CR0A 1D2NA 4YMWA 1DG3A 2OSBA 4PHGA 4QBHA 1LF0A 2PX0A 4DLTA 4LYAA 1EX6A 2EWVA 4MKGA 3VR4A 4QKQA 5JRZA 4B32A 2ECKA 2OXRA 3SOPA 421PA 2PT7A 3EA0A 4A2PA 3IIKA 2J0QA 4HEJA 4GDFA 2OO7A 3UK6A 1XCPA 4KBGA 3EIQA 5J4HA 3RS3A 4FMBB 5AJYA 4JSYA 3KKMA 3QQ5A 4C7OA 2WJYA 2F9MA 1KI2A 5BQ5A 4O2LA 2QROA 1IXSB 1A7JA 3DM5A 3I92A 2ZVQX 3KKQA 2W6ID 1NN0A 2QAGC 1YVDA 2B6HA 1LNZA 4AG5A 1N6RA 4K81B 2BOVA 4D4LA 1KI7A 5TV2A 4M21A 3X1ZA 4TT3D 1G5PA 3AKYA 2ZQ5A 1GM5A 2J59A 5CLQA 4E5UA 2OILA 4G5RA 3DKVA 1AQYA 2X19A 3B1WA 2JLRA 3IO5A 3KXLA 2R6FA 2ZI7A 4KHZA 4TYNA 1ZYUA 3UG7A 1IQPA 1II0A 4MGYR 3TAHA 3FVQA 5FTLA 2ZYTX 2GXUA 2O52A 2JJ1A 1GAJA 5KUTA 1PLLA 1X8KA 4QJ4A 4HAXA 1AGRA 4Q19A 3SYLA 1C9KA 3ZH9B 4PZYA 4XWKA 4KODA 1T6NA 4D82A 2H92A 5JWRA 3KFVA 1I2MA 3BE4A 1NP6A 4JT4A 2CDNA 2YNMA 4G5SA 1ZMXA 4PO8A 2IS6A 4KLNA 4F4IA 1YR8A 3OE7D 1MR3F 2CVHA 2A30A 4CGZA 4NCJA 2OXCA 3OFND 2WIBA 1OH7A 4GT1A 3REFA 1QVRA 1JALA 4ZIRA 3PR1A 4M0LA 3T61A 2QGNA 4NZYA 2AN9A 3FHOA 2QP3A 3KKNA 4AK9A 1XMJA 3OEEA 4P0TA 3TNFA 1P60A 2ZS8A 1Z22A 4URWR 2Z5FA 4B2PA 4AKEA 1E9DA 4II7A 5HCNA 1TEXA 2VA8A 2A5GA 4Q4AA 2ODWA 2BDTA 3KQHA 4XVRA 2H17A 2AWNA 1T0JB 3N2EA 4IJMA 3ICEA 4BZQA 3OIYA 3WYFA 1G16A 3HJNA 1XX6A 4BRUA 4L9WA 3ZS8A 4P4SA 1M6NA 3FKSD 3DEFA 3PUVA 3T1QA 5HZKA 2HT1A 5EUMA 1SXJB 4FI3C 3KJHA 2ONKA 1IOZA 2ZS9A 1X8LA 3WNBA 2DWQA 2XNSA 2QSYA 5KNBA 3K70B 4WBSA 4Z8YA 1RKBA 1DAFA 1OHHA 1NMXA 2VIIA 5AK0A 1VIAA 3G0HA 3K0FB 3LQRA 3GEEA 5E7MA 4FINA 2ZRGA 2HYIC 4CT5A 4IOKA 5CJ2A 2JLWA 2FE4A 4YXWD 4V0NA 4G5GA 3IILA 1ZINA 4UNSA 1J7KA 1Z28A 1NN5A 2VP2A 1CULC 2QZ4A 4V0OA 3CF0A 4TLCA 1QF9A 4A9AA 4B73A 2IEZA 4JL5A 3RWOA 4D0NA 2ZRCA 1TF5A 2XTMA 3GEHA 4PAOA 1FMJA 2O8CB 1SQ5A 3T1OA 4RZ3A 4OHYA 1UPTA 5HE8A 3O8BA 5CB8A 1RZ3A 1R2QA 5IK2A 1T9HA 2ZRPA 4PO9A 3L82B 2IK8A 1NVVR 3W3AA 2ZS7A 1SXJC 4TLAA 3LBHA 2QPAA 2XSZA 4L16A 1EX7A 1U81A 2QMHA 2J46A 2BEJA 1PLKA 4QGFA 1R8QA 2C03A 4MYHA 2ZAMA 4K46A 3L0PA 4TLEA 2GF9A 2G1JA 4NH0A 1IY0A 1QDEA 2YWFA 4QGAA 2QQ0A 4KV9A 4M22A 1XPRA 4NONA 1W0JA 1FL9A 2CL7X 2IWRA 5IDVA 1C1YA 5K8IA 1NI3A 4JS0A 5SZKB 3VX4A 2BMEA 4Q9JA 5CIWA 4MDFA 3EIEA 1R5NA 3SI7A 1AGPA 2W6JD 4A0FA 3GJ8A 3WYGA 2ODBA 3WRXC 1IONA 1DO0A 4LHXA 3GLFA 3AB3A 4M8NE 1YZTA 2KB0A 2Q9AA 4CEJA 1N6HA 1N6IA 2J7PD 1M1YE 5FPKA 1F2UB 3I73A 5BN3A 1HTWA 2P5SA 4H9GA 4JJZA 1DELA 4HAVA 4Q7KA 3U7GA 1CTQA 1AZSC 4BASA 2H5EA 4AKIA 1M7GA 3C41J 5KDLA 2IYYA 3QJYA 1XMIA 2F1HA 1YU9A 3T35A 4KAXA 1GTVA 1NNEA 2GCPA 3SR0A 5FI1B 5FTKA 5JS8A 4MUAA 4IDHA 2LWIA 4LJ4A 1X3SA 5JS7A 2C9YA 1LVGA 3CNNA 1IN7A 1DAHA 2CL6X 1VG8A 2CNWA 2FSFA 2QSZA 3QKRB 4D0LB 2ZEJA 3ECCA 3RRYA 4L4UA 4WVFA 1E2DA 2F43B 3L0SA 1M8PA 1UBEA 4XOIA 3W8NA 5FR1A 4D4JA 1ZNXA 4QGHA 3FKQA 2ZANA 3NBZC 1CRPA 2VF7A 4JLMA 2ZJYA 4BE7B 5JJKA 1YR7A 5FOSA 5GJVC 1SKYB 2IT1A 4EFMA 1H8HA 1Z0AA 2FFAA 1Z0DA 3OIWA 4TMZA 4DCVA 2F6RA 4BLOA 4PQFA 4B33A 1QHYA 4JT2A 4LC1A 1YKSA 5BYKA 4BLSA 4DDUA 2I1VB 2QM7A 1KJZA 1RYHA 2ZE8A 3NKVA 3AUYA 2PZEA 3K70C 3X1XA 3SBEA 4PHHA 1NVUQ 2XX3A 2WM9B 3EW9A 3FOZA 3HU1A 3BORA 1XEWX 4FMCF 4DVGA 3KKOA 3WBJA 1NN1A 1PJRA 3B1VA 2RGEA 1FZQA 1E79A 2RAPA 3QNUA 1XD8A 2O8BB 2W0SA 2X8AA 3VR3A 4C0QC 4B44A 2QORA 4LK2A 1ODFA 2UZIR 4IVPA 1N5LA 4LX0A 4BRWA 1DBSA 1TQ2A 3ASZA 4I4LA 1P9NA 4KFTA 4Q4JB 5J4YA 1JEEA 4RCZA 4NU0A 1FNMA 5M04A 1S96A 3LY5A 1Q22A 1XF9A 2BBOA 4QNMA 4NYJR 4WAUA 2PMDA 4ESHA 3QPUA 4B3GA 2OV2A 3BFKA 4EPYA 4KO8A 2AFIE 5FBVB 3HP1A 1P6XA 2PMKA 2J0VA 2G0NA 3AF2A 4OHWA 2WPDA 5CDFA 2JLXA 2ZE6A 1E94E 3SFZA 3WBKA 5DO9A 2PCLA 3EZFA 5FL7D 1HQCA 3W8RA 1IBRA 1VG9B 2ZRBA 3T06B 3KTAB 4QBGB 2GJKA 2DHRA 1LW7A 4JLJA 3R8FA 5KHOC 1MRNA 3RVBA 4ASUD 5IK2D 2WZQA 2OAP1 4Z1MA 4PHFA 2ZPTX 1OKKD 4ZIRB 1BMFD 3T5DA 1R5BA 3QG5A 4DUGA 1MT0A 4B2IA 4IKEA 2NOAA 3MD0A 1S9DA 1ESMA 4IOJA 4Q21A 4PAQA 3K0CC 3KQLA 3QE0A 5JEEA 5G3ZA 3GFPA 3U3RA 3L0IB 2K5UA 3IBYA 1RW4A 4OQNA 4OK3A 3U3KA 2F3RA 1KSJA 2FEMA 3TW8B 3SJCA 1KZGB 2HJVA 5DYIA 3CONA 2LKCA 5KNCA 1AS0A 1F2UA 2GXQA 1OIWA 2VL7A 4LBZA 5JJIA 1UBGA 2AKAB 2PX3A 1E9AA 2B8TA 1P61B 2GZDA 4FD2A 3UMSA 2BM0A 1DS6A 1E1RD 4ZDIA 1YQTA 3DMDA 3MMPA 2FGJA 2B7CA 1F48A 5AJVB 3W34A 1IJEA 3VU9A 1W1WA 5AJWA 4PX9A 2PJRA 1XMSA 2IA5A 3MJHA 5GVRA 2PH1A 4AG6A 1DAMA 2FG5A 1CEEA 3W9YA 1KJYA 4RD0A 3NG1A 3ZQJA 5DHFA 2F1JA 3QXCA 4QBIA 3OEED 4OQFA 1E1QA 4R98A 4Z8XA 5FFMA 2I4IA 5IRCD 3NC0C 3W90A 4NTZA 4HZUA 3AUXA 3SU8A 3AVOA 2QTVB 1HQYE 3I8XA 1UKZA 1KNXA 2H7VA 4NYMR 3FHCB 5H8WA 3QF4A 4IXMA 1MOZA 4C0SA 3KJGA 2VHUA 3R7WB 2AX4A 2VSXA 2HUPA 4LOAA 4EJSA 2EVWX 2ORIA 3BIFA 3RSOA 3K09A 2VPPA 4DDVA 3N70A 5JFGA 1GITA 4TYPA 3DM9B 3IGFA 5C1BA 5A4JA 1WCV1 5LB4A 3CR7A 2VHTA 2VF8A 3RDPA 1US8A 4C0KA 3X1WA 3PIRA 2ZJOA 1BO6A 1S1MA 3HYRA 3Q5EA 2FDCA 3GJXC 4BLRA 2LCFA 4CF7A 4CEIA 2VEDA 5GJCA 2OUKA 2TMKA 1OE0A 4DJTA 1AN0A 4G5QA 4G0NA 4BFZA 1IXZA 2REBA 4MRRA 5CYPA 1EFHA 2WMOB 3K8YA 4HUTA 2OLJA 3E5HA 1GDDA 4IRUB 4PTLA 4QRHA 2JGNA 1W47A 4OI0A 4I1VA 1XWIA 3TIFA 1K5DA 1AK2A 2VHCA 4ZO4A 2IX3A 5A0FA 4RD1A 5CLLA 2DCUA 3BH0A 1KY2A 3K9GA 1NLYA 1Z3IX 1OXUA 3CKLA 4DSTA 1KHTA 4HLUC 5FBQB 1H8ED 1E2KA 2NO1A 1O3YA 4U7DA 3QKSA 4KVAA 4H1UA 1E9CA 4MYTA 1NSFA 1E2EA 1R8SA 2IYTA 1KDRA 4ZKEA 4TSFD 1SKYE 2NIPA 1YRAA 3CPHA 3TQCA 1KMQA 1KY3A 2ZI5A 4KJZA 2GHIA 1P75A 4PFSA 4URUR 3BFXA 1FOEB 1I4DD 1NY5A 3K0AA 4Z1MD 5BN5A 2GXSA 1UBCA 3RYTC 3KX2A 2E9SA 3T5GA 1IXRC 3VAAA 1TEVA 1NG1A 4BLTA 2E1RA 4B74A 1FP7A 3GLHB 1R7RA 3B1ZA 1ZM7A 1Z0JA 2IYQA 4TTRA 3SEAA 1NF3A 2J5XA 3ZQ6A 2P6NA 4NCNA 2H57A 1LFDB 3VKHA 2BM1A 2WWIA 1ZRHA 2BBTA 2A5JA 1F5NA 2ZR9A 3LVRE 3CX8A 4PANA 4E07A 2AD1A 2PT5A 1RRPA 2X1VA 4LHYA 1PV4A 2NGRA 1K5GA 6Q21A 2ZM5A 1AZTA 3EWAA 1OF1A 2OFOA 3K0FA 3ADKA 2GF0A 1E2FA 1MO4A 2DFTA 5FTJA 3R20A 5FUVA 2XZLA 1E79D 1KK3A 2J0SA 1XXHB 2ZE7A 2ZRDA 3O8DA 3SHFA 3DDCA 1L4YA 5L8VA 5AJXA 5AUPB 5E7IA 3K53A 2OFWA 1DEKA 1KGDA 4QM6A 1UKYA 5L3SA 4EJSB 3H2YA 2ZJBA 2EQBA 5KO2A 1G8PA 2HXSA 2GAOA 4EAQA 5P21A 3HWSA 2D7DA 1SKQA 4OHVA 1JR6A 2ZITA 1XDBA 1A2KC 2RB4A 4HB0A 4HDQB 3DKPA 4PHTA 4M9SA 2RGGA 4US0R 1SZPA 3FKSA 2V6JA 5DI3B 1Q12A 5JWHA 1XPUA 3CRRA 4JYCA 3Q72A 1BH2A 3GLIE 3G82C 1B23P 2XJ4A 4B6FA 4TQAA 2NPIA 1T3LA 3BAFA 3BH6A 3Q7QA 1UKVY 5TXGA 1FQKA 2CNWD 1LY1A 4U5XA 3VR6A 2Z6VA 1E0KA 1JQLB 3LFUA 2PLFA 1E2QA 2WV9A 3UPUA 2RGAA 3FWYA 4GMXA 4M53A 3DZ8A 2IYVA 4Q9HA 4AYXA 1BOFA 3AVQA 3DVLA 1IN6A 2R6GA 1TUIA 2WSSD 3IO3A 4QL3A 4Q4AB 1L2TA 2SHKA 2FPKA 4G01B 1E9SA 1II8A 1NIJA 1E98A 4HAWA 3ADDA 3H4MA 4IOLA 1NMZA 1D6JA 3OHMA 4JLDA 1ZM4A 4PQRA 4UKDA 4V0LA 5G40A 4LYHA 3TH5A 3VHXA 1Q3HA 1Z0IA 3M0EA 5JSZA 4PPQA 2J7KA 2Z4RA 3MFYA 1XMVA 1KI4A 4PC6A 3WHLA 1G6HA 1T5IA 1E9RA 5L3VA 2ZETA 5FOUA 2HDNB 4PZLA 1G20E 4YMSA 4MDEA 1OYWA 1KAOA 3RS7A 1EK0A 1M34E 2FSIA 4KSBA 4GFDA 4EIWA 3P20A 1II9A 2VLIA 2XZPA 3AV0B 4ZCMA 3LXXA 3BBPA 5EXSA 2JLQA 3AKEA 3BS4A 1E4YA 5FBWB 4LBVA 1RPZA 4BLPA 3U44B 1N6OA 3P1JA 2J41A 1XTKA 1ZD8A 3KXKA 3NXSA 4GZMA 5FOVA 3ZVRA 1ZBDA 2VP9A 5FL3A 1KO4A 3FTQA 5JCPA 1UDXA 5EQTA 4A36A 3MWKA 3ICQB 4Q4HB 1PUIA 4C4PA 3WP1B 5B58C 2BIFA 5KOYA 3DPUA 3CWZA 5C4GB 2PZGA 3CBQA 4W9MC 4F7WA 4GZLA 1W36D 3NIBA 4FWIB 4Q9KA 3SJBA 4M2LA 3EZ7A 3PVSA 3D6TB 1D8TA 3OIUA 4QHTA 5HTKA 1VYUA 1S3SA 4IFEA 1RIFA 2AWOA 3AEZA 1CJVC 3B1YA 2WJVA 1TU3A 3CX7A 4Z51A 4P4TA 1VECA 1LTQA 3KQNA 1JNYA 3TE6A 3A6PC 2V8OA 3P32A 1WBBA 2ZRLA 3RC3A 2ZRIA 2RCNA 2N42A 2LKDA 3CNLA 2HCBA 3OZXA 2CHGA 1JXMA 1GWNA 4TL6A 5JECA 4C0AC 4YXWA 1ZD9A 4LJ9A 2C99A 1D2EA 4BFYA 3AF3A 3CUEF 1VPLA 1LS6A 2R9VA 2VQSA 3RRNA 4N3NA 2BC9A 4FWTA 2QRZA 2OEPA 2REXB 3LBIA 1QRAA 5J4LA 4B3DA 3MGCA 4JLKA 2MSEB 4M1MA 5L3QB 4ZDWA 2O8EA 1H65A 4BEJA 3VKGA 2BKUA 3ASYA 1E2HA 1F2TA 3KUDA 2V7QA 4FW9A 4NMMA 3QSYA 3P26A 2OE2A 4S2EA 3KQUA 5ELXA 1KKMA 1NJGA 4JKIA 3PEUA 1XXHE 4OJKA 1OSNA 5ANRB 4G5OA 4D81A 4YQFA 3CRW1 2OAQ1 2WMNB 1OV4A 2ATXA 1CJKC 5B64A 5CK5A 5FPHA 2IF2A 1RC8A 2WWWA 2CK3D 2GCOA 3B13B 3ZJYA 3GPLA 5FBRB 1DE0A 1XJQA 2X77A 2XTZA 1CR2A 4KXFB 5F98A 1SXJE 2VRWA 1Q1QA 5G41A 2JJ1D 4Q66C 3LA6A 1R4AA 3IKJA 4C30A 1GG2A 4AIIA 1OFIA 721PA 2AKYA 1J70A 4DCNA 4A8JA 1A2BA 5EP4A 4HUQA 1TNDA 2PEZA 4XD7A 2Z0MA 1Q21A 3OFNA 4MGZR 2NMVA 3PG5A 4RD6A 5FOXA 4LBYA 1M2OB 4HAZA 3UATA 5FOWA 1LS1A 4DCUA 3ONWA 3IQXA 1DTSA 2MMGA 4Q4LA 1V43A 2OCPA 4JZKA 4QXAA 2CLDX 4GOXA 5HKKA 3PEVA 3T15A 1G3RA 4GP6A 4D0GA 4EJSC 3R8CA 4MRSA 1JJVA 4JBYA 4LCBA 2O8FB 2J1LA 2XB4A 1GL9B 2XXAA 5GJBA 3JZMA 1HH4A 2JAQA 2NTYC 5HZHA 2QT0A 4DCTA 2IC5A 4FN5A 2W83A 3CPEA 5GADl 1G21E 2OZEA 3D31A 5HR5A 3LX8A 3SQWA 3DO6A 5FPSA 4AC9A 4BFTA 1COWA 2GK6A 1G3UA 1RE0A 1EFRA 1E3MA 3UXMA 1Z6YA 4BZXA 4MRPA 3ZZUA 2UZ3A 4RD3A 4L5BA 4GOJA 4EQ6A 1WXQA 2Q21A 2XOKA 1CR4A 1GSIA 4ITRC 1P73A 4RKFA 4PZZA 2UVQA 1UAAA 2XJ9A 2QT1A 5CDFE 4M1OA 2FFQA 4LI0A 2WJJA 5J40A 1YZQA 4Q1CA 1N6PA 1J2JA 4OBEA 4FXPA 1CJTC 2BCJQ 2J9RA 1DPFA 2KBEA 4NP6A 4QFMA 3R9XA 4ZDJA 3H0KA 3TBKA 4DC9A 4UNQA 3RHFA 1WMSA 1YHNA 1W44A 1RRFA 1W46A 4BECA 2ZU0C 3ZD6A 2ORVA 1H8EA 2H18A 3Q7PA 5E7JA 4F91B 2Z4SA 3GJ3A 821PA 3B8HA 2WICA 3DL0A 1ZUIA 2DR3A 1IN5A 1AIPA 2I1QA 5L3RA 3HU3A 1JQJC 2IHBA 2J0UB 1E2PA 1U9IA 4PR0A 3QPWA 3I5XA 1HE1C 1ZM9A 2HF9A 2UKDA 1UEIA 4NE2A 4R71A 4ARZA 4DT1A 2OBMA 4EFLA 1ZVQA 4GNKA 2WHXA 4TMKA 4BWYA 4RD2A 4IOMA 3CR8A 1DOAA 2EYQA 2ZRFA 5KDDA 2YV5A 4JBXA 3C7KA 2ZSDA 3CLVA 3OIVA 4QOSA 1KOFA 3L8ZA 4RZUA 3QIAA 4EPWA 4ZI3A 2NO9A 1G17A 3KB1A 3LXRA 1SVMA 2WAXA 2RGNA 2C95A 1VKJA 2R6DA 1FX0B 4NHOA 2ZUDA 3CB4A 5EZ5A 1R0XA 4QJ5A 4OK6A 4EDHA 2VSFA 2C77A 2QGZA 1FQJA 1KMHA 4Y0VA 1U2RA 2GZHA 1GIAA 3A1VA 4IVRA 1KI6B 3M4YA 1XJCA 4A6PA 2ZRHA 1P72A 1Q1EA 2IF0A 4HLDA 5DGXA 4V0ME 2QE7A 3BXZA 2V1UA 3U4QA 4BLQA 4JMPA 3KJEA 4U00A 1VYVA 2PJZA 2YOGA 2WJGA 1MO3A 1Z6GA 4WZAE 4JVLA 3TSZA 3R9WA 1GNPA 1I2DA 1EXMA 3A1UA 5LDDC 1W5TA 2BHRA 1CRQA 1IHUA 1NMYA 4TMXA 3AVVA 4MUBA 1X6VA 4PPFA 3IEUA 3VKWA 2B92A 2RKOA 1SULA 5DH9A 3AP2A 1Q0UA 2F9LA 2NPFA 5E3HA 2JIZA 2ZI4A 2VP4A 5KTYA 3QKRA 2R6CA 1JR3E 2VO1A 5JWOA 3NH6A 3EWSA 3TJZA 4OQXA 1MKYA 5G53C 1ZUNB 1XTSA 3QKTA 1Z8FA 2IS2A 2IHYA 3W6NA 2ERYA 3I3SR 2J7PA 4NCHA 5AWFC 2EFEB 3W6OA 3CIOA 4WOPA 4C2TA 3VNUA 1QHXA 1U8YA 2GKSA 3K9HA 5AUNB 5IT5A 2G77B 2RGCA 2JLZA 3WP0A 2V7QD 1N2CE 3KUCA 3OEHD 4M1SA 1X86B 2Q3HA 3B85A 4CEHB 3L43A 3QEOA 1PUJA 3UWKA 2KE5A 3PJRA 3A1WA 3WRYC 1TADA 4JYBA 2P3SA 4XSHA 2R62A 3QF7A 3RNLA 3FMFA 4MYUA 4Q1EA 1E1QD 4LBWA 5H1YA 1F6BA 1XBTA 1NIPA 4A4DA 4OI1A 2G6BA 2J3EA 4EFNA 4JL6A 3BGWA 3LV8A 2CHQA 1BKDR 2WKRA 4DLVA 4OQMA 1NVXQ 1ONBA 4TL8A 5D3MB 4MKHA 4BFWA 1G7RA 1KYIA 4L9SA 4YDSA 4IHQA 3LO5A 2YHSA 5TY0A 4ACBA 3U7HB 1SXJD 1ZIPA 1ZNYA 5C46F 4R2HA 3RANA 2NQ2C 2IYWA 3L0OA 2ANCA 3VX3A 3BB1A 2A5FA 4I1SA 1UJ2A 2DFLA 2GTPA 3MG9A 1Z63A 3VFDA 3ZVMA 1WQ1R 2IXGA 2WKPA 2D06A 4B76A 4KSCA 2GCOB 3LLUA 4NCKA 4CEJB 1Z08A 1LF5A 2QPTA 1L8QA 1U94A 4CEIB 4JLAA 4UNNA 2DB3A 2MSDB 4S35A 4NKRA 4TSFA 1CJMA 1HT2E 1II8B 3MWLA 1HV8A 4B3CA 1NL3A 1IN4A 2F7SA 3D3QA 5JMTA 1KDOA 3KB2A 2REOA 2ZE5A 1CJUC 1FFHA 1Y63A 3H86A 4RFSA 2DFKB 2ZSAA 4A82A 4Q1DA 4LHWA 2GVDC 1NJFA 4D25A 3RS2A 1T8UA 1RJ9A 1G7SA 4E09A 1X1SA 2Y8EA 3TSOA 4HDOB 1Z6AA 2YYZA 4DIDA 1VG1A 1R5OA 2ZJ5A 1QZXA 4M1YA 3RLFA 2HCJB 2HXYA 4B3FX 1AJEA 1SXJA 2C04A 3WYAA 2YKGA 2H16A 1OIVA 1SVIA 2WSMA 4POAA 1A5TA 2IYSA 5J4VA 1NBMD 1QHSA 3EZ9A 4IVQA 1QHHB 5B2ZA 1KI9A 1TQ6A 3E1SA 1NKTA 4HI0E 3CRQA 2ZR0A 3VQTA 4EPXA 3TAUA 1RVDA 1Z5ZA 5IF9A 3KKPA 4JIMA 2RMKA 3RS0A 3IHLA 3FDIA 1T5LA 3IEVA 3NEJA 121PA 3K0AB 4OQLA 1W7AA 4C2UA 3ZDQA 1XPOA 4A2WA 1RRCA 4ZDKA 1KNQA 1WF3A 2NO7A 2YZ2A 3U61B 3C14C 3B9QA 4C0HA 1IM2A 1ZM2A 3KQKA 4DCSA 2OESA 4DLSA 1ZNZA 5DHAA 4B3XA 3EIHA 3ETLA 5TVKA 5JJLA 1T91A 1T4GA 4M4SA 3QY0A 2QTFA 1N5KA 1Z6XA 2BMFA 3LWNA 5EE9A 5JEDA 2PL3A 1OB5A 1E2JA 4TQUS 1XD2B 2EU8A 1I4LD 1WE2A 3IPYA 4OL0A 1E1RA 1M7BA 5EP3A 1CP2A 3EPJA 2IUUA 1SVKA 3U3JA 4A15A 4V02A 4PC2A 3A36A 4LY6A 1W2GA 1X8JA 4KFUA 5TARA 3RC8A 3VNVA 3A4MA 1NG9A 2QN6A 3GJ6A 2DFNA 5KDOA 2FPLA 1OT3A 1W0KD 3T12A 3THYB 1SVLA 5FBLB 3GLIB 3AVWA 2GETA 3J81k 1AKEA 1MO5A 2QPOA 4JL8A 1TL7C 1P62B 1U99A 4I99A 3TUIC 2P5TB 4IEIA 3NEYA 1EG7A 4TTQA 1Q3TA 4RY2A 4M1KA 4XWOA 3PEWA 3C4JA 3MAAC 4Q1AA 4DEXA 3SJAA 2VHQA 1Z0FA 1DAIA 4DUGD 1ZJ6A 2V4ZA 2BMJA 4NCIA 1TU4A 2VP5A 3C16C 4LHVA 1BMFA 3B60A 1FW6A 4ESVA 2F3TA 1KO5A 4JLPA 2JLYA 1P2VA 1UADA 4RFSB 2X2EA 1NVVQ 2QUZA 4KFSA 1FNNA 3NWJA 3LW7A 5EP1A 5FL7A 4O25A 2O8EB 5GJWC 1VHLA 2CXXA 2HYDA 2RGNC 1E2GA 5TMPA 3EC1A 3EPKA 2B8WA 2JATA 3LX5A 3C5CA 2IXEA 1DVRA 1O87A 2OBNA 4TMVA 5C4MA 3WXMA 4KCGA 4AKHA 1FX0A 4X8MA 3ND9A 3V4RA 3HPRA 1G19A 4IEEA 3RRZA 4PC3A 1N6LA 1AM4D 3BOSA 4OJQA 2W2XA 1VTKA 4RJLA 3TSWA 4ASUA 4Z54A 2O8FA 2ZYWX 3K1JA 1COWD 3O8RA 1JAHA 1XJ0A 2GWHA 3ZZTA 2XTNA 4DLUA 4K8OA 3PENA 1TQ4A 3QEJA 4PSKA 2FWRA 4H1VA 2GBLA 3T1VA 5K8LA 4KU4A 5HE9A 4US2R 2OCYC 2FA9A 2YINC 1F60A 2MSCB 2Q3FA 1XEFA 4GP7A 4W7SA 2GESA 1F3OA 4LC0A 3KXIA 4LHZA 4W5HA 1ZU5A 3OESA 5EE5B 3QF4B 4CEHA 1TUEA 4IFBA 3K70D 3A4LA 1W5SA 1CIPA 3BD9A 4QGGA 3I4LA 4IDPA 2XXAB 2G0TA 3EPLA 4QG7A 1S1CA 1DAEA 4UJ5A 1G8GA 1Q1BA 1SHKA 2Q9BA 4NYIR 4Q9LA 3G5UA 2O0HA 1GFIA 1CU1A 3QG1A 4B6EA 3ZVNA 3KDSE 2GEDA 5C2JB 2Z83A 1YZKA 2CCJA 4CYMA 4DLXA 4HSEA 4UXJA 4PSAA 2HLDA 4WZ6A 3RS4A 4DHEA 1I4TD 2CJWB 3BFVA 2ZRKA 1G9XA 4CT4B 2F55A 2JJ8A 1A4RA 4RCYA 1GL7A 1N25A 3MSXA 3WMGA 1OHHD 4O2RA 3SJZA 1VCIA 2C2HA 2L0XA 2JEOA 3LDAA 4C3ZA 2O8DA 4B71A 1V5WA 3NHAA 3OF5A 4HAYA 2ZROA 2WOOA 3X1DA 1KO1A 1PLJA 3AGQA 2BJWA 1ELOA 2DWOA 3B78A 3I32A 3N5CA 4I1OA 1KSFX 5LPNA 4Q02A 1M7HA 1LB1B 1OFUX 2W0MA 2AL7A 4CVNA 4Q47A 2ZSEA 2P0EA 5L3SB 1U0LA 3E70C 1PVOA 3WHKA 3BC1A 4XTCS 1NN3A 4NYIQ 2FJUA 5KSZA 2W2TA 1T8TA 2W6JA 4OHZA 4QBFA 2QAGA 3JVUA 3AQ4A 2YOFA 1N0WA 4R2IA 1ETUA 2C8VA 5L3QA 1JJ7A 2F1IA 1VG0B 3LH5A 2AD5A 3GFOA 4GL2A 4D80A 1FTNA 4LJYA 3AF1A 4TN1A 1E9FA 5F2EA 3PUYA 3ZIAA 1NBMA 5JSZB 2WVJA 3QBTA 2ERXA 3K0SA 1QBKC 2QQEA 3CF6R 3FMOB 3K9NA 1T3SA 2XSZD 4NDZA 3F5FA 1ZW6A 4HLUA 1KTVA 2W6IA 3NBXX 4ABYA 1MH1A 4RZXA 3THWA 2E87A 2QL6A 1XFAA 3F0TA 5B30A 4IDQA 3ZZ0A 2ZU6A 4EPVA 1LV7A 3TGPA 2C98A 1E96A 2CMKA 1E2NA 4LPKA 1DG1G 2BJVA 3SZRA 1EFRD 1MV5A 4BFSA 4BGDA 4TL7A 2Q0HA 3PCRB 4X8HA 2QRNA 2GJ9A 2N46A 4LV6A 4LYJA 2BVNA 2FGKA 1J8MF 5DE3A 2EWWA 2R8RA 4DLWA 1QVAA 5FH9A 1AS2A 2WWHA 4ZCLA 1KI1A 2C9CA 1Y3AA 5J47A 1YE8A 5HKKD 1TMKA 1VMAA 3LNCA 4DSNA 2O8BA 2ATVA 2O8CA 1OH6A 1GILA 2CJWA 5D3QA 3GMTA 2CLCX 4LYFA 5FPTA 2FX3A 2QP4A 2GRJA 1D2MA 3UKDA 2KI5A 2BBSA 4UXHA 4HB4A 4PXAA 3F3YA 4Q4HA 5FTNA 2WWGA 4XIGS 1HY3A 3O8CA 3L2OB 4V0KA 4LUCA 1N5IA 4F4JA 3V9PA 3C15C 3SHWA 4UJ3A 1A82A 1HEIA 3TW4A 1YR9A 3REGA 2CL0X 3SYNA 2BMDA 4Q9IA 3PUZA 5SZIA 2OM2A 2YOHA 4HB2A 1QHNA 5EJEA 2BBWA 4YMUA 1G7CA 1W48A 2QMOA 4B3BA 2CK3A 4HDCA 2EFCB 4MGIR 4I1UA 1ZCAA 1G291 1GRQA 1P2UA 4MKFA 5LB2A 5IHPA 1VYTA 1OXTA 3THXA 1WP9A 2QNRA 3OEHA 2JDIA 2NG1A 3EG5A 2QAGB 2FH5B 2IYRA 2FOLA 2CLSA 1G8HA 3K0EA 4IDNA 1DADA 5CB6A 3M1IA 3TMKA 1TF7A 2GCNA 5D3MA 1SVOA 1US8B 4PPNA 3P4YA 4B34A 5AUOB 1P9RA 3EASA 4JLOA 5KSOA 4AWXA 1EFUA 3DZDA 2FF7A 2ANBA 4AY2A 1ANKA 2WJIA 3GJ0A 4YMVA 5J4KA 5CK4A 2IS1A 1SHZA 4UNPA 4BUJA 4DIEA 4A0HA 1RYFA 3Q5DA 1PZNA 1XU4A 2OBLA 3A1TA 2ZI3A 4ZKDA 2IS4A 4JKYA 1E6CA 2A7QA 3IPXA 1CKEA 2B21A 4LRWA 3PXGA 2G88A 4Q5IA 1IY2A 4DDTA 1N6KA 2R6AA 4AURA 4DSUA 5LD2B 3THWB 2HJGA 1OXXK 2GJ8A 1TAGA 3MWYW 1IAQA 1CR1A 1ZCBA 4DB4A 4N0EA 3I61A 1W49A 1UFQA 2ZI6A 2GILA 1P4SA 1VCMA 3U3MA 2XITA 4Q48A 4DZZA 4GBMA 1Z2AA 4P4UA 4W5WA 4D6PA 2VH5R 2BCGY 2KBFA 3GLGB 521PA 3EA5A 2WIAA 4Q00A 2R44A 1EWRA 4A8JB 2ZYVX 2PCJA 4M9ZA 4F92B 4NPHA 4DSOA 2A2ZA 4LGMA 1UF9A 1CF4A 2QU8A 2PLRA 1A1VA 1U8ZA 3NHBA 4IDOA 4LPSA 4DLRA 1UBFA 1W4RA 3CO5A 3FYHA 3NTUA 1KDPA 3CNOA 3HPQA 1E69A 4JLNA 1XNJA 1XB2A 4JBWA 4EQ6B 4LJ6A 1GP2A 4AD8A 2V54A 3CF2A 3KFXA 4RSGA 4ACAA 1QHHA 3SE0A 3FMPB 3E2IA 3W3ZB 1G6OA 4F93B 4ZV4A 2B7BA 2FN4A 1S4QA 1EFTA 4F38A 2GVZC 1G8YA 3BB4A 4KYUA 1JI0A 1KK1A 2Z43A 3AGPA 1XRJA 2QMUA 1N0VC 4D4KA 2V3CC 2GXAA 3MLEA 3QKUA 3NDPA 3QOFA 5E4FA 3GD7A 4RD4A 3T1TA 3QBVA 2ZSBA 2AXPA 3EPHA 8OHMA 4GPTA 4PC1A 3ZYCA 4Q7MB 3BJIC 2D2EA 2ZJ8A 2QBYA 1UEJA 2WSSA 4OKSA 4IXNA 3LD9A 2IYUA 1NY6A 4LSGA 4XJXA 4P32A 2VBCA 2CBZA 1G41A 5J5CA 4JVSB 1XZQA 1MO6A 4HLCA 1F2TB 4TMWA 5FTMA 3CH5A 1R6BX 4DRZA 5KSPA 1P9WA 1XCGB 1TTTA 4MRVA 2WWYA 2QBYB 1JR3A 1YZGA 2IYXA 5DISB 2BEKA 3HR7A 1T0HB 4EUNA 4R9UC 1DAGA 1TPZA 4Q7JB 1MABA 1GNQA 3Q85A 1YRBA 5F3WB 1E0SA 2JJ2A 3WMFA 4B2LA 1HUQA 2WWXA 3P4XA 1KO8A 3Q8XB 5KYKA 4Q1BA 4URVR 2EYUA 3EZ6A 1Z6TA 2EFGA 1Z0KA 3AVTA 2W00A 1YZUA 4N0DA 2C5LA 1AA9A 1E4VA 1W4BA 1T3HA 4GOKA 3TRFA 3A8TA 2OHFA 1JEDA 2IXFA 5FPYA 1C4OA 4Q01A 1IN8A 3CZQA 3QXXA 4O0MA 1E0AA 3HU2A 4NYJQ 1JAIA 1Z29A 3UANA 2FU5C 3JVVA 1W4AA 1VIYA 5JI3E 3IDQA 1NSTA 3PFIA 1ZP6A 2GZAA 1UDWA 3EARA 4DDWA 1KJWA 4W5JA 2QTHA 2PBRA 2EFDB 1E2LA 4L15A 4WXPA 1G8FA 3TVTA 3W5IA 4C0BA 2IYLD 2IYZA 5CYOA 4A0RA 2CVFA 3I8SA 2DPXA 2WOJA 4Q7LA 3QKSB 4Q1FA 2QMEA 4YMTA 4KYIB 4G1UC 1OH8A 1WRBA 2FPMA 3EC2A 3VR1A 5LBIA 4BEBA 2ZXUA 1S2MA 4DLYA 4KLZA 3SDZA 2HT6A 1R0ZA 3ZS9A 3BRWD 2WBLC 3K09C 1KAGA 4LV8B 1M74A 3LQQA
chains in the Genus database with same CATH superfamily
5KJ6A 1U1DA 2OQVA 1EK5A 2W2PA 4P3YA 2A14A 3IEKA 1J0DA 4NMLA 4CQLB 1KYWA 4ZZ0A 4RTPA 1O97C 3BH7A 4P3OA 5BW5A 4F4CA 4I6GA 1LPAB 2XCTB 5IBPA 1BYIA 1V6AA 1VE5A 5CAEA 1B8OA 3VU9B 3FE2A 3DBLB 1QRDA 1X13A 4WNAA 4W63A 1TJNA 2X9QA 3PHIA 5BN4A 1O6FA 1C7IA 2WTNA 3C87A 1HE4A 5F1KA 3PK0A 3VJKA 1T9BA 3MA0A 1Y3FE 1A69A 2WT4A 3X1KA 3ZBQA 3H5WA 4N9QA 2HMWA 3QVWA 3AJ9A 2YFKA 4R7TA 1IY8A 1IB6A 2CCKA 4QJIA 3ZTTA 4CIVA 3HNOA 2H9YA 4LJ8A 3U2QA 3QVVA 4YRGA 3G79A 3DFFA 1QRTA 2WAYA 1OU4A 3FVVA 3QX7A 5T6BA 3ZGZA 1WZ2A 1P7CA 1ZXLA 3CLTC 4MMXB 2ZUCA 4GI7A 3VGPA 2RGXA 3ASVA 1U8AA 1XZLA 4Q3CA 2F3QA 4KYVA 2JGLA 5FFNA 1OFGA 2W58A 3L4BA 2VYFA 5DSZA 3QE9Y 3BWBA 4J29A 4XGIA 2CF6A 4RK0A 1ATZA 2FCRA 4RVSA 2UZ0A 1CUVA 4RTRA 1WSBA 2O5EA 2JI6A 1CXZA 1EGAA 3FYCA 4CW7A 4RXMA 2ASEA 2ESRA 4DLPA 1YTLA 5KOHA 1AQNA 5F5XA 5JI2E 2O8DB 1BSVA 4Q4JA 2JLSA 5FPQA 3WB2A 3GWZA 3EUWA 1DC4A 3T3DA 1OU0A 4G4IA 3CLUD 4UPEA 5DOVA 4ZCIA 1V9CA 2AR7A 3W7VA 3W5AA 4RVCA 1WXFA 3PUJA 4WK4B 1GKIA 4JP3A 1TJ5A 2I33A 3KOXA 3ONEA 3QM1A 1DEAA 4I14A 5F2OA 3WLQA 621PA 1S9HA 2CFCA 4UM8B 3QUCA 1F2DA 3SIPA 5EPEA 1TM4E 4AXBA 2P6OA 1VJ0A 2AJBA 2JIPA 3OZCA 1TYEB 1V9LA 2CE2X 1L4HA 2TRSB 3TQOA 3WBBA 6REQB 5A2QA 3WY9A 3JASB 4OXXA 3ENQA 3NBFA 4D6XA 4IJ6A 4OJMX 4L78A 4BE9A 3ZXIA 3I1FA 3PUXA 4KFRA 2ZUBA 1C4WA 2R85A 4MV7A 4LHEA 4QDJA 5FI0B 3WL8A 1JQDA 3FVWA 1SCBA 3DVAB 1XP8A 1D9ZA 2HKIA 2W98A 3D8BA 4XIFA 3L1HA 4YMHA 5HPYB 4W5RA 2PUGA 5I7VA 4C0XA 2R7AA 4E21A 3DE3X 4EG0A 3AY3A 3GRYA 1KARA 3OHPA 4QAQA 3UICA 1J90A 5DIFA 1X1DA 1NYQA 1FSGA 1JNXX 4R1PA 5CNMA 1UK7A 4RSMA 3SFVA 4P4SB 2OYCA 2JFPA 2XNDD 3C45A 3ELWA 4WOJA 5K09A 4X1KB 2D2FA 1QIGA 3C7CB 4IQ0A 1JPJA 2YWHA 3U7EB 3GN2A 3KZVA 4GWKA 4XSGA 5CT8A 3G0IA 3V1MA 2BGGA 1PGPA 2VDKB 2C1XA 2R11A 1BIFA 3COVA 3KUUA 4CM9A 3Q9LA 2PT9A 2HY7A 2QVCA 2P9QA 1KYQA 3TCXB 1U1EA 2A84A 2BFFA 2HQBA 2JFNA 2P67A 2Y2VA 3B48A 3G1UA 3C3JA 4M38A 5EWMB 1HDOA 3UJCA 5JYDA 4NAHA 4DB2A 1BVHA 3NAGA 1CZOA 2GA9A 3D2LA 4FMCB 4M49A 5EXPA 2D62A 3V00A 4IMPA 4H16A 4DR6B 5JVDB 4WXMA 3EF1A 2PZLA 1FTSA 4DREA 2BI7A 4TRRA 5IM4F 3DFUA 3QU5A 2BH9A 4PNZA 5IVHA 2F43A 4JBNA 1DBRA 2YZNA 4YAUA 5A5GA 5J43A 4B75A 1Q50A 2UDPA 5CIQA 4UQOA 2G4VA 4Q18A 1B0ZA 3AHGA 4OI4A 2IE8A 3Q2KA 1J8FA 2X5XA 4AJPA 1SIOA 4EOGA 4Y6PA 2IP2A 1N78A 2AFIB 3HEAA 4CRWB 5G3YA 4RMIA 2GBIA 4C9BA 5DBIA 3EX7C 1RFLA 2CXTA 3QVGB 1FFEA 2GAJA 4XH9B 2Z2IA 4X65B 3A25A 3EIFA 2COKA 4YPVA 1IM8A 1ZBQA 3G0BA 5JD4A 4B4KA 1QH0A 2DYKA 1NJ8A 3PVZA 3T9FA 5K0EA 1GZ7A 3U1TA 3PUIA 3LT5A 2PTGA 4Y2TA 5M34A 2YVUA 2IITA 2QZJA 3AV3A 4HNAA 3THOA 4URZR 1XZCA 3GVCA 1JR3D 1J97A 1TQDA 2IOFK 1NV8A 3EQZA 1MAWA 3GJYA 1OXSC 3P27A 2FZ4A 3EAQA 3NU1A 4CCYB 4UTRA 3B5JA 1XEWY 4NIMA 3DT6A 4MCIA 2C7OA 5KQLA 3RC7A 2QL5A 3UFXA 2AG8A 1PVDA 1Q1ZA 2R2AA 2QN8A 1GRCA 1U1FA 3HN2A 3Q6MA 4M1TA 4RZIA 3VOTA 1WETA 3TUJC 3VV3A 4FOOA 3IBGA 2R1VB 4QX6A 4WY2A 1CY1A 2HZ7A 3SFTA 5JR3A 1IOWA 3T7JA 1RPNA 4MSUA 1HT1E 1T1EA 4FJ2A 2YVKA 4HXEB 5TPWB 3AIKA 4Z7JA 1EHIA 3UV7A 1ML4A 1DO2A 3PXUA 3RU9A 5JCZA 1DI0A 4KB5A 3T4XA 4NWIA 4MP3A 3REOA 3X2SA 2H5IA 4MO2A 4QRIA 3GLTA 4L8YA 5KVAA 4XIJA 5IUKC 2DKNA 1NXOA 1D1TA 2QRUA 4D4MA 1MAUA 1OLSA 3PSAA 1ENOA 2YTZA 1SN7A 1SXHA 2AK2A 2WP8J 1UZAA 1KOLA 2NUBA 2A9RA 1NR5A 3L0BA 3O4JA 1FNBA 1L8XA 4IW3B 3QPVA 5CX1A 3HDVA 3SBDA 3U4QB 4A5SA 3E84A 1VPWA 5CT9A 2WU0A 1FYEA 3A7EA 3G02A 3NNNA 3E1GA 1E66A 3FPHA 1YC2A 3ZWDA 2X2PA 4MVJF 2FWIA 1FIUA 1I3KA 5CGZA 3J81A 1HYQA 3GQBA 4XVQA 3WGQA 2BKXA 4YJ2F 4ITUA 1U6KA 3C1UA 5ITZB 3EPRA 1AC5A 2RDMA 1NNUA 3C0KA 1WB9A 3OQVA 3W6UA 4HVCA 1H2BA 2ZPAA 1JIIA 3P0FA 2ZRNA 4QUBA 2C4KA 4GICA 3RSLA 1D6MA 5SYMA 5C4IA 4EL0A 1NLFA 4MJXA 3GARA 5DWQA 3RABA 5CITA 5KNBD 3IKLA 2RHDA 1RQXA 4FHEA 5JLAA 2KSQA 3RHSA 3T3EA 5KWVA 4TYWA 3A7DA 5DN6D 1JP7A 2EJVA 1BU8A 2DOKA 3BN3A 1N6NA 2NX2A 1Q5PA 4MS4A 1NRJB 1Y7HA 2I8CA 2VPIA 4C14A 4CIBA 3AFHA 1K98A 4QRDA 3SQDA 1P4JA 1IQUA 1Y6JA 3TR6A 1QG4A 2C0PA 3MCVA 3WO1A 5AVOA 2ZRMA 2NZWA 2QB5A 3BWDD 2OTCA 3GJ4A 3JAMA 3U44A 1FB5A 1WBDA 3VO9A 1KMMA 3V8MA 3BEOA 4MUKA 5AW8A 4K40A 3PHLA 1KMIY 4ZEOA 4ENUA 3FNHA 4HLQB 1DQZA 2PUTA 4CGYA 4DWOA 4LJ5A 2XQIA 1GHTA 1YB6A 2D4HA 4NMHA 5DHUA 4AF6A 4EFDA 4ZEVA 1QHIA 5JD6A 5FLXA 1NTRA 3ZNPA 4ILEA 3WI7A 2EKDA 1N36B 1DKUA 2WWFA 3FBGA 1I1NA 2G8NA 3AVUA 3E8XA 2J3IA 3IOEA 3L8CA 4X3CA 2OORA 1JLLA 1ZIOA 2MMCA 5LWHA 1EFVB 3EFHA 2XA1A 3G9UA 4RTOA 1ZG3A 4OYHA 4P7BA 4XB1A 1NP3A 3G0GA 4K6KA 1EM6A 3R8XA 1FVOA 4QREA 4Q9AA 1L5SA 3CX4A 3U9TA 6LDHA 4KR2A 2ZYUX 4FYXA 3G88A 1GKLA 3WNCA 1YKGA 4X00A 3Q0IA 5LD2C 3EXHB 2G17A 6REQA 4RPKA 1L8LA 3R6TA 2GK4A 3UIEA 4PLGA 3I2IA 4AJLA 4QUAA 4MYCA 4YAKA 5JW6A 4MVXA 1O03A 3PC3A 1PUXA 4HWPA 4MLPA 5CDGA 1C0IA 1NM5C 3TG8A 4NXNB 5KQSA 1WXIA 2D00A 3OE7A 3S3TA 3ELYA 2JANA 2YICA 4IH9A 2P9ZA 1Y7LA 1YJCA 2QJOA 2HA4A 1MABB 3GT0A 3JQAB 3NCHA 2E37A 1WVIA 4IDFA 4X44A 5JY1A 2PDAA 2A5DA 3H8VA 4ZVMA 1O97D 3KTAA 4MB0A 1Y8RA 1GUDA 5ISMA 4RULA 3B7GA 3VZBA 2ZSFA 2XAUA 1N2XA 1KAEA 4QC2A 4JLBA 3W5CA 4G65A 3UAXA 1ULZA 3V55A 4F2PA 2BHSA 2DJ5A 5KTOA 1XYVA 3T8YA 1X1TA 1VSVA 4Z7NB 2PZFA 3ABZA 1A8QA 3HS3A 2II6A 1JQKA 2VBIA 4IIJF 4QJBA 2QTCA 5ECGC 2C1EA 1NW6A 2WHEA 1EP1B 4XLLA 3VNSA 4BQSA 1QVVA 2I67A 3BB3A 5LQJA 1KO7A 2P1DA 4BN4A 1VA5A 1D1PA 4KPUA 4R1SA 1WOYA 4ZWNA 1YI1A 3KL4A 3K6JA 3BM5A 4FFRA 2IWHA 4O2BB 4WEOA 1XA0A 2VTBA 4TZ0A 3QXGA 2ZAOA 5FR2A 1U7PA 4MZXA 2C59A 4FGZA 5KPDA 4UHKA 4CMGA 2XIQA 1LBSA 3CSDA 3NHUA 3DOFA 1R18A 1JXOA 2KJQA 1C3OB 1H66A 3CRVA 1DKLA 5CAEB 1EK2A 4BNNA 3SQLA 4YYZA 3EZ2A 5K8TA 1EP3B 2FV8A 2FPXA 4LI3X 3ROTA 1Q57A 3ZQUA 2ZTSA 1HYGA 2VCHA 1HE8B 3A1CA 3B9PA 2X0FA 1U3FA 3FFBA 4GW3A 3B3AA 2FFJA 4KITB 5AJZA 1VB5A 3R3JA 4HDMB 3DHEA 2BUAA 2C8LA 3NTXA 4ZVPA 1BMTA 1ZXBA 2HH9A 2J30A 2PWAA 4Z9BA 5AI5A 2OXIA 2NXCA 2QP9X 1RCUA 2VP6A 3B1XA 1EEXB 3FWKA 5DLQC 4BBAA 3L1VA 3C5HA 3GY0A 3VM6A 4AM8A 3DWIA 3OQNA 2GPNA 4GOOD 4J91A 2OHXA 4JASB 3R0IA 4O4IA 3R4CA 1XTJA 1YK1A 4F5EA 1VCHA 1S8FA 2A6PA 4GLOA 1E9EA 1N9KA 3VMFA 4GG1A 2HV8A 2J3KA 1WG8A 3AM5A 3HDYA 1E2IA 4MI3A 4J6EA 2O5VA 3EGDA 4E11A 4N1AA 5LP6F 2XGJA 2F90A 3BA6A 1EPUA 1JW9B 5H16A 4TZ6A 5PNTA 1XYYA 3UBMA 4KV7A 1FNSA 2N9UA 2AC7A 2IOQA 1K0UA 2ZWVA 1ZK1A 5AR1A 1VHTA 2PWYA 3I37X 1X1CA 5HIKA 1L7OA 2EKBA 1GPJA 3M6MD 3H84A 1LJ8A 3PEYA 1X15A 4PE5B 1Y5MA 5HCIA 3HGMA 2FEOA 3TQHA 1GLNA 3K15A 1RYNA 4X41A 2RI0A 4RDIA 5KPJA 3KETA 3I62A 1SVSA 4V03A 1P4GA 1WLSA 5ALXA 3MWEB 3ZC3A 4DBLC 3D3NA 5ECYA 3DPIA 4GBED 2AJCA 2NO6A 3DV0A 3IP3A 3PUKA 4BO4A 3AVXA 2J5BA 1NVWQ 2YC2C 4ON9A 4WACA 3ND8A 5EE0A 4F3YA 3PWKA 4YONB 3A2LA 4HYQA 3NH9A 1ESZA 3IMKA 5AJTA 3NIWA 2MYNA 2XVAA 1RXCA 1U80A 2BE9A 3S7ZA 1GNVA 4MI6A 1KI6A 5BSFA 1MJGM 4XB6B 1UAYA 3L0CA 1F0PA 2R8EA 3RVSA 4JJFA 2IBMA 4NYMQ 4DMCA 2JHCA 5EXXA 1KOGA 5BSHA 3CZPA 4WA7A 4DV7B 2WF8A 3FJ1A 4TT3A 1GRRA 4JHXA 5EKUA 1YDEA 1OW3B 2QE7D 5ADWA 1G20B 1JPNA 4NCAA 1V7CA 4MW6A 3PLAE 4O4JA 1PW7A 3LCMA 4FC6A 4II3A 3EBOA 3OTIA 3I23A 1GTMA 4NOLA 3V1LA 3CM0A 5BWOA 4LQ4A 1IY1A 3IT1A 1GL6A 1R10A 4LZLA 3RFUA 1E7MA 4ES6A 3A3NA 4NZMA 1IWBB 1UKCA 2JASA 3H1PA 4GRAA 3SZGA 1HKUA 2HJ9A 4ERXA 1OFTA 5A3SA 4H08A 4HB3A 4MA4A 5D7BA 1RIIA 4Q03A 6CHYA 1X7XB 4Y8VA 2XGSA 1J9ZA 3IIEA 5A4IS 3GFBA 4IXTA 2OGWA 4MTLA 4TUYB 3WYCA 1L9KA 3D4IA 1UM9B 2IUSA 4DJ5X 4TYQA 3IP1A 4R2XA 4O6VA 3WQSB 2W6OA 4FCTA 2XYPA 2C7BA 4ZI2A 3RTGA 2PJUA 4HRVA 2BDUA 2FQYA 3BCSA 3ESDA 4QBHA 5LQSA 2MCFA 4DLTA 1IPFA 2X9VA 2ZVJA 4EY6A 4YUAA 3SOPA 2AYYA 4UPVA 2DTEA 1SC1A 3DH0A 1C1XB 1LTHR 4OLBA 4Y2JA 4RTJA 5C8YB 4FGUA 2BH2A 1EKXA 4JV5B 1QK4A 1BWSA 2MYPA 3PQFA 2H2GA 1XCPA 2BGWA 3EZNA 2JLAA 4BUZA 3EIQA 1ZD2P 4A3SA 4EO4A 5J4HA 5KYVA 1DTWB 3TNLA 1VE7A 2FMHA 2ILVA 3R6GA 3SEQA 4EHAA 2WNSA 3F2IA 3KKMA 3QUQA 1ES9A 3IS3A 1KI2A 1EFVA 2WM2A 2ZATA 1QC5B 2P9BA 2B9VA 5C8YA 3I92A 4B7AA 2X0RA 2BSAA 4GGPA 5MN6A 1W9MA 5L4NA 4Y9RA 2QAGC 2Z1NA 2UUPA 1IH8A 5D1HA 4IY1A 4K81B 3ZZ1A 1O6ZA 5I7HA 3DTTA 1KI7A 2EKLA 5TV2A 3DZBA 3E0QA 4D9CA 4IIGA 4M21A 3EVTA 4FQ7A 4WDRA 5IS2A 4ML3A 2YMQA 3NYIA 1KJ8A 3LP5A 5EFOA 3K71B 2OILA 2OHIA 3DKVA 4G5RA 4GOMD 5CH8A 4EMSA 5J2TF 2ZSKA 1HSOA 1SB8A 2NZVG 3PDCA 5TGDA 3VVMA 5JCOC 3NTQA 3UO8B 3KXLA 4LVCA 5B1HA 1QYWA 1IUKA 1B8VA 3UG7A 5CIYA 2OL4A 4Z4CA 2Q8NA 2IOHA 4GUDA 2GXUA 5CLIA 1XXLA 1A71A 1JHMA 2BFNA 2M1ZA 3EVZA 3Q7RA 1VKNA 3C3BA 1TRHA 2QKYA 4HAXA 4Q34A 4YHBA 1KVUA 4Q19A 4RLHA 2DE0X 2HIAA 5AP9A 3SC2A 4EG5A 4PZYA 3PGXA 7MDHA 1M6VB 4D82A 3T3OA 1DXOA 3SDBA 4V3CA 1OLUA 1FFAA 1U8EA 2F17A 3PZBA 4BB0A 4HT3B 1CZRA 4JT4A 2I3AA 5FNVB 1FU7A 4FFPA 1Z35A 1XVLA 3FUTA 1B8NA 2IELA 2CVHA 3OE7D 3V4ZA 2WUGA 4DV2B 4JENA 3LHIA 1TVKA 2OXCA 3OFND 1EU1A 4K87A 2EBFX 6NULA 5CVTA 3E3OA 1QVRA 1JALA 1UK8A 3FA2A 1MW9X 3REFA 4QGBA 3S7TA 3T61A 5L6MB 2OOSA 3JYOA 4NZYA 4DDHA 5JNRA 3GD5A 5TS2A 1AMNA 4N8EA 2YVLA 4EL5A 3OEEA 4HPXB 5IAOA 4ENQA 2VSQA 1GFWA 4UFPA 2J08A 3RODA 1E9DA 3P9XA 3EVNA 1TEXA 2XDWA 2A5GA 3IP5A 2ODWA 4Q4AA 2BDTA 2C2OA 4YCJA 4DXHA 4XM2A 1T0JB 2HGSA 1PNTA 3GWGA 1USWA 5DLPA 1SXGA 2ASVA 4WJLA 5HZGA 3U40A 3ZZMA 5ICCA 1GGMA 1YB1A 1XX6A 1XQYA 3HXPA 1M6NA 1SUDA 2OBBA 3IBCA 5H3LA 3FKSD 3KE8A 3GLVA 5HZKA 3NJ4A 1SXJB 3LA8A 3P96A 3QI7A 1X2EA 1SPBS 3DAOA 3EMKA 1X8LA 4KKVA 3WNBA 1ZESA 4KP7A 2QSYA 3RU7A 2HDOA 1SCKA 3DR3A 3CUVA 1RKBA 2H2IA 1I30A 2YWCA 2IDKA 3LQFA 1RYDA 1XZKA 2AT1A 3F5MA 4O1IA 2C7PA 3FF4A 3I58A 2QZPA 3L4BC 4JXJA 3IRVA 3LQRA 2R3SA 2HMYB 3F96A 1G63A 3DZFA 3OX2A 2ZRGA 5I7OA 3R9WA 4X94A 2RK6A 5AVRA 2FRDA 2FE4A 1I24A 4DPLA 1W93A 4DEVA 1HM5A 3IILA 5H3HA 3B2NA 1J7KA 3OE1A 2VP2A 3BHMA 4S2UA 4F2WA 1BXRA 3T0GA 1WUYA 1OZ0A 3K5WA 2BFEA 2IEZA 3QX9A 1KVTA 4G26A 3TLKA 1VDMA 4D0NA 1Q3KA 4ECEA 1RMQA 5KYYA 1FMJA 1RHQA 5C1IA 1T5SA 3MCUA 4E88A 3RWBA 1UPTA 1E77A 2GJ4A 3DOJA 3NRJA 4AO7A 2EZ4A 3LHKA 4OD0A 3OBIA 4L9RA 2Q49A 5EKTA 3MZ0A 3HTXA 1PE0A 4QOFA 1ONSA 3VR4H 1NVVR 2ZS7A 4HMOA 1ZH0A 2AZ4A 2WMDA 3A6LA 4X93A 2XUJA 1E5XA 1R0SA 4L16A 1EX7A 2OK7A 3BXFA 4J90A 3AHIA 3UB4A 4K26A 1I7PA 2I2BA 4X6YA 4K6HA 2QLBA 1D2GA 4QGFA 2ZLBA 4FFBB 1DWPA 3L0PA 2PD4A 4FDAA 3W2FA 2VUUA 1YD7A 2GERA 3WLAA 2G1JA 3EAGA 4NH0A 4ONEA 2Z8ZA 4IICA 5FYQA 3VUFA 1YAHA 3ZJTA 1GV1A 5H59A 3QOYA 3C5VA 5I7SA 3EUFA 2CL7X 3ONDA 1WHSA 2ACWA 1NI3A 2P9FA 4LF9B 3VX4A 1Y8RB 2M98A 1QS0A 2VK4A 1WHTB 5I5GA 1WB6A 4MDFA 1JG2A 1SFRA 4E4RA 1NUHA 1AGXA 3N2ZB 1RHJA 2HI0A 4A0FA 4B4VA 3GJ8A 5IDYA 4KXVA 3WYGA 2ODBA 4PG5A 1IUOA 1E5VA 1NT2A 3ETJA 4GPBA 3LZ6A 1DO0A 4UCQA 3R75A 3WRXC 3AB3A 2C42A 1JHAA 1AQ6A 3A1EA 4UD2A 5JJBA 3IE1A 4H59A 2X4IA 4RF2A 1F2UB 3I73A 4C6SA 4CL8A 1HTWA 5K4HA 4YMLA 1RD4A 1DELA 1VJGA 5D5PA 4Z3KA 1FLVA 4YCNA 3M2PA 3VH2A 4WBNA 2ILTA 4ZTUB 1R0RE 2M6RA 2XCSB 3P97A 2VRCD 1M7GA 3K96A 4LWQA 3ZWOA 3QJYA 1TFRA 1QCDA 1YACA 1PT9A 2YFHA 4QXMA 1W581 4KAXA 4HDKB 4BV8A 3SR0A 1NW7A 3I2FA 4X3OA 3SIRA 3ZWPA 5A1JA 5JS8A 2O14A 4NU8X 2C9YA 1LVGA 1FU4A 4HBZA 2IYOA 3H6GA 4YJKA 4ZEXA 3ECCA 3GFRA 4KTVE 4D0LB 4H15A 2D0IA 4WVFA 4JP5A 2F43B 2XT0A 1UBEA 3G89A 4WESA 3Q8LA 4YN3A 1ZNXA 4D4JA 4KPYA 5LCXA 3CISA 4HC4A 1GQFA 2ZANA 3MMSA 4HDRB 4LWPA 3IUMA 2AJTA 3CVYA 4AO6A 1L3BA 2VT3A 3RC9A 2P2YA 4P9NA 2XCRB 4XJVA 5JJKA 5HJ5A 2X8JB 5BR1A 1X87A 2IT1A 3DS8A 1H8HA 1Z0AA 1CEQA 2QX8A 2Y6UA 4IQGA 4OVKA 4UDYX 4BLOA 3SGLA 4CF3A 4B33A 1QHYA 4XWYA 3KQSA 4BLSA 1F1BA 3DT9A 3MTAA 3OFKA 3U16A 3GBVA 1QGZA 3SBEA 2QUIA 1B0AA 3AF5A 3PXEA 4YWJA 1Y4UA 1DEOA 2X8JA 2NSJA 2WM9B 2X76A 1KYZA 1O9HA 4FMCF 3BORA 1XEWX 1VGRA 1HNNA 4P82A 4ZVUA 4ALLA 1NN1A 4D8YA 1P7WA 4UM9B 5I9MA 1E5TA 2XV1A 3V4PB 2IEDA 3IQZA 1ZGJA 2X8AA 1RKQA 2FLWA 1GKKA 1A98A 2PKXA 3G7SA 5ALZA 3VR3A 5KVVA 1CS0A 2QORA 4HWTA 4LK2A 1ODFA 4G41A 4RENA 1FK8A 2AS0A 1C7QA 2AJLI 2C57A 4LX0A 1EUQA 1SQ0A 4BVAA 4OX9B 1TQ2A 2FP4A 2YBDA 4FGSA 1NP7A 2OV4A 4AQDA 5J4YA 3TAXA 4F06A 4GVPA 1D7AA 3LT1A 5HNKA 1O0CA 2ONYA 2BTQB 4D9BA 4Y2PA 4QNMA 7YASA 2HQRA 1KEEB 2GD0A 5D84A 3MNFA 2OV2A 4YH1A 1IMOA 1JFLA 3AXSA 4B3GA 1WKCA 2JAOA 2REQA 4FOPA 4J0JA 4JUDX 3ZE1B 1F06A 5JAUA 1B4DA 1P6XA 3E35A 1T9AA 3NHYA 4RJTA 3D43A 1LEHA 4RDXA 1U9YA 2I1WA 2XYRA 3RIMA 5NULA 1KIAA 1EWTA 4MR9A 3UGQA 3IMFA 4N0QA 4ZCRA 1KYXA 2PCLA 3MCZA 3PVCA 3M81A 2X8BA 1TIBA 5E9QA 5BV2P 4INOA 3N8DA 4N7MA 2Y99A 3R8FA 2C94A 5BUQA 2Q4DA 1MRNA 4RK4A 1QRUA 2OAP1 3ND7A 3QWBA 4ZIRB 3FCCA 3FIUA 3BKXA 3URMA 5ES4B 4DG8A 3LFHA 3E7PA 1QIMA 3OLYA 3A2NA 1JE0A 1G5FA 1U7HA 3MD0A 1K3FA 1S9DA 1YZ3A 4FOTA 1GQQA 4TWJA 1RWOA 4YJGB 4G2TA 4A8PA 4PLFA 1PWXA 3EDRA 1PFKA 3U3RA 2K5UA 1AF4A 2IIBA 3LDGA 3RD5A 4OQNA 1RW4A 4OK3A 4UE3S 2XADA 4Q3BA 1WUJS 2OVBA 4TT8A 5LC1A 3U3KA 4GE0A 1ISIA 4E13A 1KSJA 1OUMA 3FFWA 2HU7A 4U6QA 1CCWA 3DMPA 5DYIA 3CONA 1YDHA 3EDMA 3OZDA 2Y92A 2WYUA 1OIWA 4XJSA 1NULA 4ZHSA 2PX3A 5A05A 2F8LA 1JZTA 1WUTA 4E5PA 1Y8QA 1TC2A 4UVHA 1P61B 2PLWA 3QPDA 4PO3X 1H85A 3D7NA 3KLPX 2BTOA 1YK0A 1SUBA 2D1QA 3FYUB 3PQDA 5I7UA 4HADA 5LQUA 5E7QA 1VLZA 2XXBA 1D1QA 2X23A 5F77A 3ZOZA 3IJRA 4QAJA 2YJ5A 1C81A 3GPDG 4XKJA 5AJVB 3W34A 4C6HA 1XDSA 4DUZB 1VI6A 1N77A 3FSEA 3OWXA 2IA5A 1EI9A 2CJXA 4UTXA 4XXHA 4ZREA 4DPKA 3DLHA 1DAMA 3MAGA 4CV0A 2G67A 3W9YA 5H4HA 1ML3A 4HQNA 3WTCA 1XHFA 4RD0A 1W73A 1Y8ZA 1QBGA 1Z0UA 3LCUA 3OEED 5LBTA 1JWLA 1L9XA 1J23A 1E1QA 2PKEA 5CVDA 4G24A 4OHMA 3RB8A 3ET5A 4B79A 1DCTA 3AUXA 3UUFA 4C4OA 2IP1A 4RIGA 3SU8A 3VRHA 1UP7A 3EDYA 2LBPA 3ZXYA 4L08A 5REQA 3NXKA 4G07A 3FHCB 2VJDA 3S1LA 1PV2A 3H4IA 3R3YA 1NC3A 4AY4A 4N7JA 3VPCA 3LMKA 1GA6A 1K8XB 2AW5A 2P0YA 5LU9A 2OO3A 3HXLA 4L1KA 4MHTA 1H4TA 1MQ8B 2H4JA 3R7WB 3I5MA 3FB1A 3COSA 2HUPA 5D51S 3U3DA 3ZU4A 2ORIA 2O07A 1ISHA 1NJSA 3TL3A 2XMZA 5IAAA 1N5DA 1MX3A 1QYRA 2ERCA 1K6JA 2VYVA 3UMGA 4YRSA 3FG9A 5A62A 1WSDA 4A8TA 3KZNA 4M37A 4TYPA 1U28C 4HNRA 4QICA 1I9CA 4CIWA 5MFZA 3FJOA 2J07A 5A4JA 4EKYA 4ZOBA 2VHTA 1WULS 2WZCA 3EQ2A 4R68A 3L7NA 4CM5A 1B6SA 4OIFA 5CCXA 5KIAA 2X0DA 1K8ZB 3VYUB 4PZDA 5K0FA 3Q5EA 4TWRA 5AICA 5K2MA 4QODA 2LCFA 4BAZA 3MHPA 4CF7A 4NZOA 4LF4B 4ZVKA 4R0VA 1IHPA 1YNSA 2X5KO 3MJEA 3RT7A 1AKUA 2TMKA 3AHFA 1TEZA 5EINA 1M5TA 3FOCA 3DDUA 4G5QA 5U4QA 4BFZA 5ITSA 1IXZA 1P31A 3EIWA 5CYPA 3ZQKA 4M1ZA 3TL2A 1BCRA 2WMOB 3WR5A 2IJGX 1CY4A 1W47A 1Z4OA 4OI0A 3ENZA 1AZLA 1K5DA 4A8HA 1AK2A 3OPVA 2A1UB 1F9EA 2AMYA 3RKSA 3X2EA 5JS1A 1TKRA 2IX3A 3DCYA 3W5BA 4K2HA 1CFZA 3A6GA 4QPNA 3F78A 3BH0A 3JQ7A 1WJGA 2EGGA 1JDPA 2PGDA 3BGDA 3FTNA 3HZOA 3AXTA 1TQ8A 2BR3A 1JKXA 2YV4A 3I1JA 1E3TA 5JYBA 3EDCA 1RKVA 3ZE6A 1GRVA 1SU8A 2ZJ3A 1E2KA 1SPXA 3QKSA 4KVAA 1TOAA 1P7VA 3WDMA 2XQVA 4G0MA 1E9CA 4IHAA 1WPGA 4MYTA 5IF3A 3RCBA 4JAVC 3H0CA 5F64A 1K4MA 4TS9A 1XZEA 1R9GA 2IYTA 1PYDA 2PX2A 3G9QA 1CUAA 1SKYE 1XIVA 2J4FA 1GFSA 3PL1A 1GQ2A 2XKBA 3IRUA 4X97A 5DCLA 1KY3A 5ICMA 2ZI5A 1JDBC 2D5CA 1P75A 3ZIDA 1N34B 4ARCA 4X1YA 2QR5A 4IIXA 3SP1A 4RQBA 1VIDA 2VZ8A 1YHYA 1ZEMA 3DP7A 3QWHA 2GCGA 3RYTC 3ZV7A 3KX2A 3NHMA 3ZDBA 2E9SA 3T5GA 1IXRC 1YMUA 4HDMA 1QHEA 1FDVA 5D7NA 4QPCA 4BLTA 2QUJA 2E1RA 1U2TA 4CMCA 4RHUA 1E1LA 4RA6B 5BSGA 1RHKA 3PPXA 5EWJA 4TTRA 2BI4A 1L5WA 2QVLA 3SEAA 5BQ3A 1TMGE 2AEEA 4JT9A 4LA4A 5K3SA 5IZCC 1GPDG 3AHJA 1WP4A 4BMYA 4NCNA 4CG1A 4DOMA 4ZI7F 1KFJB 2BM1A 3C97A 3LX4A 1F0YA 3Q7IA 3GFVA 2BM8A 3R7AA 2BBTA 4BP3A 2A5JA 1I5EA 5COBA 1TVMA 3LVRE 5C1DA 1Z74A 2O2ZA 4PANA 4ZZ2A 1RRPA 2X1VA 4RH0A 2V7EA 2C3OA 4PBTA 1Z5GA 2EHDA 3CR3C 1SZDA 3LM8A 4YTEA 3U1BA 1SM4A 1V5GA 1Y1TA 4KO3S 2OFOA 3ENVA 3K0FA 4EYEA 2GF0A 2DFTA 2QTLA 4AZ0A 5FUVA 1R6UA 3QVLA 3TQTA 1R9NA 1ZK4A 1AB5A 1LPNA 3CLSC 4ZU1X 4KIWA 2AJDA 1E79D 3U7QA 5BMOA 1W4ZA 4O8CA 2H06A 2ZRDA 3DMRA 3GOQA 4UULA 5L8VA 3AT1A 3KOYA 4C3VA 5E7IA 1TVCA 4QQFA 1DHTA 3K53A 3L49A 4QUJA 4WERA 5M3BA 1DKNA 3K1ZA 1QH9A 5AOAA 4B8ZA 5L3SA 5F76A 2YJZA 4RLQA 2GPSA 4NBTA 3V3TA 2EQBA 3NOOA 3KO8A 4QU9A 1L5LA 2L82A 1OI2A 3O91A 1J24A 3GP5A 3KWFA 3NUZA 5JNSA 4ZOQI 2ZULA 3HWSA 1SKQA 4BJ5A 1JIKA 2I9PA 3FWHA 3IAS1 2MDTA 3P94A 3PCTA 1OI4A 1TW3A 4YXFA 4HDQB 4E33A 3KSRA 4CKCA 1K7FB 1PL0A 3N8NA 5E2BA 1THZA 2JCGA 3HP4A 1XKTA 5DI3B 1IB0A 3IAUA 1Q12A 3VJRA 4ZT2A 1XPUA 3CRRA 4JYCA 3Q72A 3SSNA 3YASA 1KJ9A 1Z4PX 1B23P 2XJ4A 5C3UA 4JGBA 2FW0A 1T3LA 2GT1A 3BAFA 1C7JA 3BH6A 3Q7QA 1EVKA 5CNIA 3GEGA 4OLJA 2I80A 3LPNA 4FXOA 5JCOA 3ZCXA 3D8RA 3CUTA 4MUXA 2HHHB 2WG2A 1LY1A 1UPBA 1VLVA 4JLWA 1GU1A 4ND6A 3WGYA 3WJ7A 3E9YA 1GQSA 4O8ZA 2L18A 3LLVA 3FWYA 3OJEA 1K4YA 1RC0A 3GMDA 3Q87B 1FXUA 2A9QA 3KYBA 3R1IA 4AYXA 3IKTA 1IN6A 1DC3A 1GTJ1 2Y68A 3RTDA 3QPAA 3BJMA 1WZCA 2FPKA 1JSZA 1XU7A 4HAWA 4FGLA 2WAMA 2OHGA 1ZM4A 3NHWA 4NS4A 1T5OA 3ND6A 4NG5A 4PQRA 4V0LA 5HHTA 1MJ5A 3M0EA 3FPEA 1EVQA 4MQ4A 1T0IA 2JFWA 1F1JA 2YNMD 3D7KA 4ADSG 3MFYA 3CV3A 4PC6A 4RKRA 3WHLA 4CKWB 2OHHA 3N5KA 2I2DA 4XYEA 5FOUA 2HDNB 1EM8A 2XDQA 1JLRA 3CRNA 2FSIA 2RBGA 1PZXA 4X7PA 2CKDA 4KSBA 4EIWA 1NDQA 1P7YA 4ZVLA 4EYQA 1S2NA 2XUPA 4BMZA 1VXOA 5EXSA 2HA6A 1A9QA 1DKOA 2B99A 1T43A 1WKVA 2PJDA 2ZUWA 3EE6A 3O1IC 5FBWB 4WXYB 3QHQA 2NYAA 2BP7B 3B89A 1WEHA 2P2ZA 3O03A 1ZD8A 3P1JA 4ITVA 5KB3A 3IP6A 1T4CB 2VP9A 1Q0PA 5JFOA 4G9GA 1PZEA 2E4VA 1UDXA 1Y9DA 3P9NA 1LFAA 4MQFB 2H0RA 3OH8A 4I3HA 1Y9AA 4A36A 1GG9A 4WOCA 2NZ2A 1PUIA 1VL2A 3AYZB 2J3DA 3N7AA 5BQOA 3N1UA 2BIFA 2QE6A 5FUBA 5B58C 5KOYA 1QTQA 4JFAA 1YT5A 3C3DA 1AX9A 1KE1A 4O4LB 5C4GB 5EJGA 5C80A 3NIBA 4Q9KA 1T0BA 3FWPA 2CSUA 4K9SA 2I6UA 3U81A 1RM5A 4AKSA 4JI7B 2AQIA 2FMUA 2Q3EA 1O94D 1E6MA 2RH4A 3D6TB 2DLNA 1ZN8A 2DM6A 4MVJM 5IN4A 3ZDCA 4M54A 4RFLA 1WY5A 2WHYA 4GKAA 1CJVC 3K0KA 1BNCA 1SBNE 3CX7A 4LF8B 3KBBA 1VECA 4PFQA 1JNYA 4OOEA 3A6PC 2V8OA 1WBBA 2JGMA 2ZRLA 3V2IA 3PQ7A 2Z2ZA 4E1BA 2LKDA 3CNLA 4RCVA 4XD2A 4YFYA 5MN4A 4KL8S 2CHGA 2K6GA 2O1WA 1ABFA 4MA5A 3A6EA 2G1AA 4M8SA 4TL6A 5T4BA 2FPPB 4JEIA 4MCJA 1DJNA 4YXWA 3Q98A 3BULA 3QLUC 4N12A 4I8DA 3UOWA 1YV9A 5FOQA 5A6SA 1QGAA 5DVZA 3AF3A 3CUEF 3PC8C 2PWPA 2WJAA 3NGXA 2ZK7A 1VRVA 1HXHA 2R9VA 2QN7A 1T6BY 3PCXA 2VDOB 1V3QE 1UK6A 4YJFA 4MKZA 4L8WB 1QRAA 3TEJA 1HL7A 3MGCA 3AW9A 2ZCUA 4ENWA 1EVJA 1OZGA 3WV4A 1H65A 4F04A 1E2HA 3KUDA 5AXCA 2YRWA 1GLGA 1UZMA 3EXG2 4JOSA 3UGTA 4B6GA 4U5QA 4HN2A 4MKHA 2IPLA 2IW1A 4QE3A 4GR4A 2Q2NA