1T2DA

Plasmodium falciparum lactate dehydrogenase complexed with nad+ and oxalate
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 122
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2dA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t2dA02
4GSLA 4DBZA 2OP0A 5F5LA 1E7WA 4ZICA 2NM0A 3K5PA 4YJGA 3RUIA 4K26A 1PGPA 3WYBA 4KTVE 3PP8A 1HRDA 4GQAA 2B4QA 4A5OA 1C14A 1YJQA 2WE7A 3GLQA 4A03A 1BW9B 3B1KA 3E5MA 2GCGA 5ITVA 1WMBA 2P9CA 5BSFA 4GPD1 4PVDA 1D4FA 2P9EA 4EI2A 4PLGA 5A4DA 2HRBA 3ZGYA 3FNGA 2CZCA 3GMSA 3RFTA 4Q3AA 4GGPA 2NU7A 1ONNA 2ZCVA 3TF5A 3H9UA 3JD4A 2EG9A 1ADBA 4CQMA 2UV8A 1GV0A 4GSKA 4XWYA 2A4KA 4RVFA 3CZRA 3DBHB 1GEEA 3OQBA 4RLSA 4WECA 3ZN2A 3ORFA 3TOZA 5FWNA 5A05A 1WZEA 2Y05A 1EQ2A 2GF2A 2IODA 2IZ1A 2WE8A 3U09A 4WEQA 3TZKA 1IULA 2D3TA 4EUEA 1E3IA 2I67A 3IKTA 3JQBC 1O95A 1ZK4A 1UAYA 2OL4A 3PQFA 4CR6A 1KVTA 2PGJA 4NHEA 3WGOA 1C1XB 2Z95A 3ADOA 1S7CA 2LDBA 5TNXA 3VH2A 1RM5A 3WLEA 3OJ0A 3GNTA 1PQPA 1EVIA 4BNYA 1R15A 2OZPA 1YOVB 4W4TA 3QSGA 2VUTA 1GY8A 3FBTA 4WLNA 3RUCA 2NQ8A 4IDGA 1W0CA 2PR2A 8ADHA 3H9QA 2FR1A 4WJZA 4ZRMA 1LBEA 2GERA 3ITDA 2WJPA 3PXXA 4XB1A 3LSYA 4DPMA 4E13A 4J1SA 3S8MA 3IJRA 1RM4A 1XEAA 5KJFA 3GEDA 1PJTA 2VZ8A 2PA3A 3QVSA 2ZJ1A 4MOWA 1F8FA 2YDYA 3DHYA 4B3HA 3LU1A 1VL0A 1Y9AA 2VYNA 1JAXA 3GRPA 3KYDA 3D3WA 3VDQA 1AXGA 4ALJA 2YHIA 2V6GA 3MJSA 4QT0A 2C7VA 4I9UA 5KWEA 3VKVA 1PIWA 1U3VA 3RU9A 4DXHA 4BL5A 5KJCA 4R5MA 2NU6A 2CDCA 4AJ4A 3AW9A 2X8LA 2UVDA 4JP3A 3VZSA 5KOIA 1Z73A 5H82A 2BFOA 5TJ9A 3ON5A 4TKLA 3PGJA 1DC3A 2G17A 1BGVA 1IPFA 1SPXA 1E7SA 1DIGA 5IXSA 1DFGA 2DU8A 2X9VA 4CQMD 5GZ3A 4RPGA 4A10A 1U4OA 2ZQZA 1N7GA 4CLDA 3L07A 1ISGA 1B14A 4BOYA 1KYQA 3E18A 4E33A 2BLLA 2GNAA 2HQ1A 4NNJA 5G0UA 1JLLA 4B8ZA 5L51A 1GZ3A 3KTDA 4II3A 3E5RA 1PJLA 1XCBA 4JN6B 5FFFA 2C20A 2VYVD 1V3UA 4CMAA 2AEMA 4CV0A 3GF4A 1P3DA 1YXMA 2O7QA 1R12A 1K0UA 1NHWA 2EKLA 1K89A 1E1NA 3BYZA 3UOGA 2HAEA 5L3ZA 1V0JA 3ZHXA 3DR3A 1YE3A 4AJOA 4BNGA 5DZSA 3BMOA 4XIJA 4QO7A 4IIVA 3V5NA 3W4JA 4OAQA 1MP0A 2X9NA 2J5KA 5CG2A 2I65A 3ZWWA 1E7RA 4LW8A 1LDNA 3ZNNA 4IS2A 3HB5X 3ASUA 2X86A 3A4VA 4BO3A 3I5MA 3A06A 3H7AA 4W6ZA 3CEAA 3H9JA 3CTMA 3AI2A 1NP3A 2D5AA 2NVUA 2WMDA 4RPHA 2ZATA 1NWHA 4JK3A 1JVBA 3WR5A 4BNNA 4AJ2A 1H9BA 4AJPA 1AN9A 1NFQA 1YBVA 2Q49A 4J9UE 4KUGA 3I9JA 4PLZA 3B70A 4Q9NA 1HZJA 3D7LA 4XYMA 1W8DA 1NFRA 1MG5A 3OJFA 3L77A 3FR8A 2F00A 3L6EA 3MJTA 3GT0A 1LA2A 4HY3A 4A27A 1Q1NA 4N5LA 4BKQA 4AJLA 3SLGA 2BH9A 1GYPA 1VL6A 2P5UA 1GZ6A 1M2WA 2FOIA 3WGGA 2IYOA 3B1JA 3FNFA 4ZGWA 3KYCA 4ND3A 2VHXA 3R6DA 2WD7A 1UP7A 2R6JA 4CLOB 5U1PA 5HRUA 3KYBA 4NDNE 4XRRA 1R0LA 3QHAA 4IJWA 1VJ0A 4F6CA 4CMJA 4XCVA 1LDEA 1NFFA 3FNEA 3S1LA 3Q2KA 3WB9A 3OJOA 4QXMA 4NIMA 2FSVA 1P33A 5A1TA 5KCZA 5K6AC 1ENOA 3ICCA 4ZU3A 4N5MA 1YONA 3RC7A 1JDJA 5TS3A 2YQ4A 1ZNQO 3DFZA 4E32A 1LSSA 1UXKA 5A9SB 5CG1A 3LVFO 1CEQA 4IDFA 1IPEA 1ZMOA 3E9NA 4XQ9A 1I30A 5H81A 4EITA 3AOEA 1PS9A 4XGKA 4HFNA 3F46A 4YT5A 2VT3A 1J6UA 3LYLA 1E7YA 1C0LA 1O9BA 4WUVA 1LLDA 4DGSA 3VH3A 1I3KA 4LRTB 1E3JA 5COBA 1U5CA 1X0VA 3EW7A 4NFHA 3B1FA 2X0JA 4DQXA 1ADFA 2C59A 3GOHA 4TQGA 1QYCA 3D64A 2VRCA 3TL2A 3FD8A 2E37A 1JWBB 3NKLA 3WGIA 3AM3A 4NK4A 5JXWA 2X0RA 3M2PA 1EQUA 1BDBA 3K31A 3U62A 1JKJA 3PIIA 1YQXA 1EK5A 2VTDA 4TRJA 3AUSA 5TSDA 1RJWA 2JHGA 4QUKA 2W98A 5JYDA 1EVZA 3DAPA 2BFAA 4BNHA 4UEOA 3DBHA 3JQFC 5CEFA 1X7GA 4ALKA 1Z74A 4YQYA 5JMPA 3WGTA 2HRZA 1BVRA 1DFHA 1WP4A 4CMIA 5EIOA 3GDFA 1GV1A 3I9LA 4B7CA 5EJ2A 4XYLA 3DOCA 3K92A 1WMAA 5BSHA 2HSDA 1KVQA 2OO5A 2JD2A 3ZNPA 1C1XA 3LDHA 1TT5B 4GKBA 4NJMB 3KEQA 4TSKA 3TRIA 4B8WA 1H93A 1I2ZA 4WCFB 1E3WB 4XGNA 3VZRA 2B36A 4FS3A 5CHEA 4AJKA 3DFUA 2G82A 2OOSA 4PRKA 1NM5A 3U0BA 3PHIA 5JDIC 4EEZA 1HE4A 5TRTA 3KETA 2DBZA 3K30A 1IZ0A 1E0DA 3KLPX 1LX6A 1V35A 3TDKA 4JP2A 5ICMA 2EJVA 1VKOA 3I9KA 4CLEA 2PV7A 3DOOA 1D1TA 2X5OA 4BNVA 5JBIA 4KOAA 4O59O 2Q99A 3IP3A 4A26A 1U3WA 1PL7A 1MGOA 3E03A 3TZCA 3M6IA 3ITKA 3KXDA 3GAZA 1LSOA 3OJEA 4FQ8A 2NTJA 4FC7A 1DAOA 2HO5A 4C7JA 1VJTA 1IOLA 1I3LA 1Y1PA 1Q7BA 1TEHA 1EK6A 3H9EO 1R4NA 3OQ1A 1HL3A 4J43A 4ZVVA 5IXYA 4PLPA 4ZQFA 3QW2A 3LT4A 1N1GA 4UVDA 3PPIA 4DLBA 1NVTA 4UUPA 2YJZA 2DTEA 4PLFA 2I9PA 4NBTA 1H94A 5LDHA 3EC7A 1EEHA 1H6CA 4PG5A 3RWBA 3R0IA 4BNZA 1UXHA 5CDYA 5KIAA 2Y1FA 1JA9A 3VPXA 2NWQA 4AFNA 4YAIA 5CAEA 1P1RA 2NVBA 4DA9A 1H2HA 3WJ7A 1CERA 3G17A 3ROQA 5JS6A 3DO5A 2Q2VA 1T2CA 3G1TA 2ZB8A 1DJQA 4YJGB 1U9JA 2FN7A 4E5NA 1Q2XA 5JPIA 1E6UA 5A03A 2RCYA 4XQGA 1BXGA 1XU7A 1WW8A 3TL3A 5JO9A 4IDCA 1C3VA 5KVCA 1ISMA 2BF7A 3ADPA 5C7OO 4Z9YA 1LI4A 4NI5A 5DBIA 5FI5A 2ET6A 1EUZA 5L45A 4G65A 4U0JA 5DCYA 3IP1A 4E6PA 2P91A 2RHRA 3WSVA 4BO5A 1PJSA 4PLVA 3KO8A 4ONEA 3AFMA 1YJ8A 3GEMA 4M87A 1O5IA 1C0KA 5CPBA 2PKQP 4WLOA 4CQMB 4R69A 3O03A 5A5EA 3NJ8A 4BKUA 2BFPA 4R9RA 4XGIA 3WYEA 3GGOA 2TMDA 2B35A 3JTMA 1JVSA 1Q7CA 2IRWA 3VOSA 4AJJA 4J0FA 1LC3A 3WNVA 2BHLA 5AYVA 1GCOA 2C2YA 1HZZA 4L4XA 4OOFA 4IMRA 1KOLA 1MFZA 1RPNA 4QSMA 3BAZA 1MX3A 1DPGA 2HMUA 3JQDA 4YJFA 4BO8A 4Q39A 4YCAA 4YT4A 1SB8A 4FB5A 3MWDB 1CETA 3HUDA 5ES3A 4E2ZA 5L4LA 4L4SA 4OIMA 1ZFNA 1XYGA 3JQ6A 3PFWO 9LDBA 3RU7A 3E8XA 1NYTA 1ULUA 3VC7A 1T2EA 3FWZA 3O9ZA 3U4HA 1UUFA 3AWDA 4MIEA 4CLXA 4CM9A 5T64A 1OZAA 1LRLA 3VPHA 4YJDA 1OOEA 3GNSA 3Q9UA 2GLXA 2GDZA 3RD5A 1JWAB 1A72A 1KETA 2YDXA 5ILGA 5CDTA 4NU6A 1YB5A 4GI2A 5IJZA 1H0KA 3VVBA 4CMEA 3WTBA 1R6DA 1EFLA 3IKVA 2ZIZA 3DMTC 1QKIA 3A14A 1VRWA 3D3WB 3KYDB 5TIIA 1Z6ZA 3ONFA 1NVGA 1PS8A 2BGMA 1JW9B 2DVMA 3RIHA 3OHSX 1LQTA 4PLHA 1LSJA 3JQ7A 3OA2A 4TZTA 4WCDA 5U4QA 3W8EA 3OJLA 4BO4A 4ALIA 5AXDA 5HBRA 4BO1A 3HDJA 4NU5A 4XEHA 4MVJA 1Z75A 5A9SA 5L40A 1N8KA 2Q4BA 3PK0A 4S3MA 3ZNQA 4XQCA 2PFGA 4XYBA 1UZNA 2B0JA 2EIHA 2HDHA 5DT9A 3GDOA 4AJNA 4OKNA 4U0KA 3TOXA 3E1KA 1PJ3A 1H5QA 2JAHA 1HDXA 3K8ZA 5A02A 1OC2A 1P9LA 1T1SA 3NDIA 2P9GA 1KVUA 3MJEA 1NQTA 1PU2A 2DAPA 2IXBA 3E6AA 3OMLA 3I1JA 3V1UA 5IN5A 4BNMA 4U8GA 4ALNA 3IJPA 4OQZA 2WM3A 4FJ1A 3ZCXA 2HMVA 1U8XX 1TVEA 1ZK3A 3H2ZA 1W73A 4FIZA 4IUYA 1EFKA 1SBYA 3GC6A 1PEDA 4U7WA 4TVOA 3BMOB 2VWPA 4A2CA 1B2LA 1NPTO 4CV1A 1O94A 4XJTA 1GFSA 5DCUA 3TZQA 3IMFA 3GNQA 3CH6A 5G4KA 4JXKA 1BXKA 3O26A 4KTTE 3T7CA 3O4RA 1I0ZA 5A9TA 1QYVA 2B5VA 3C7AA 1A4UA 1ISIA 3TFOA 1F06A 4IBOA 2R00A 3LC1O 3TFQA 3I9OA 2I3GA 3C24A 4N7RA 5AXAA 1VLLA 3GVHA 2GN9A 5EINA 4YVFA 2DPHA 1ZJYA 3Q1LA 2IEDA 5TT1A 5IAAA 1XQ1A 2TMGA 1H6BA 1KVRA 1P1HA 2AMFA 1DHRA 1HE2A 1Y81A 3QV1A 1WXDA 4YAEA 5JDCC 1SEPA 2ZTUA 1QORA 5I7FA 2XF8A 1TT5A 4JIGA 1DHTA 4EYEA 3OFSA 4QO8A 4M89A 1DLJA 1KEWA 3I52A 4HKTA 1N7HA 4AG3A 4BKOA 1W6UA 3BMNB 1DLIA 4BNJA 4RDHA 4RPJA 2CDAA 2GO1A 4RO0A 1DRVA 2X23A 4RQTA 5FI3A 3TNLA 2P4QA 3MJ4A 3V2UA 2W2KA 3IUPA 3WMXA 4LVUA 2AW5A 3GY0A 4D0SA 1ZSNA 4MKXA 1JQBA 3KYCB 4GKVA 4W9NA 5IF3A 3OEWA 1E3LA 1Z7BA 2X4GA 4FGWA 3GR6A 4WLVA 5BR7A 3C1OA 1B16A 4PZCA 3JQGB 3CPSA 4I8XA 2PH3A 3RASA 1ID1A 1HETA 3ZV6A 2O3UA 4A0SA 2GASA 1IUKA 4J1QA 2J5RA 3I9NA 5I7SA 5TX7A 2NTVA 3KEOA 3DDNA 1E5QA 4IXWA 4E5MA 1K6IA 3N7UA 4DIBA 1ZSYA 4UULA 2AEFA 3TQHA 1GEGA 4DQVA 1ENPA 2CSUA 4WCFC 1E7QA 5C3MA 4J90A 1K2WA 4NK5A 2G1UA 4CM8A 4NG5A 2Z1NA 1DEHA 1O0SA 1N5DA 1CYDA 1CQJA 2C07A 3U4IA 1PQUA 3BTVA 4DIFA 4TZKA 5GMOA 3HWRA 4C7KA 1J5PA 1HWYA 3PDUA 4FPXA 1M75A 4ZD6A 3VKUA 3F5SA 4PZEA 2X58A 4L73A 4GH5A 2I66A 1J49A 1I3NA 3NAQA 4GMFA 4IJVA 3SBOA 4PFJA 3ZV4A 2DM6A 5JCJD 1MV8A 2JCYA 4LMPA 1LC0A 5T5QA 3DBRB 4KQXA 2BKAA 4DLAA 4CM1A 2AQ8A 1LXCA 1E6WA 1DIAA 4QTZA 1E92A 3EY4A 3U4DA 4A73A 2VUUA 3WDSA 2PGLA 3RI3A 3SC4A 5IFLA 1AHIA 3NV9A 3WWZA 3BMCA 4MO2A 3WMWA 1H2BA 2OUIA 3RC2A 3TSCA 3H4VA 3S55A 2AEJA 5JC1A 3I83A 2C5EA 1H6AA 5CDSA 2EW8A 1PJCA 4TKMA 3FTNA 1QR6A 2D59A 3QQPA 4CMIB 2X1HA 4RJTA 4Y9DA 5L7WA 4LVCA 3DZHA 4GAEA 1B3RA 3FWNA 5KVSA 2VYVA 2PTGA 1XSEA 1HYGA 3D1LA 2JFFA 1S6YA 2V65A 1Y6JA 3H5RA 3NT4A 1E3SA 1XHLA 4KMSA 4ID9A 2OHXA 3AI1A 2Y99A 3WFIA 5IG2A 3VTZA 1D8AA 5JO0A 3ZWXA 4L75A 3HADA 1H6DA 1F14A 1TI7A 3K96A 2DFVA 1IE3A 3NEPX 4DMLA 2J6IA 3ONDA 3AUUA 3HE3A 3O8QA 4KWIA 3K73O 4GWGA 4R4JA 3AU8A 3FRJA 5K0ZA 1U2DA 3KLMX 1QYWA 2JKVA 5EQFA 4BGIA 3ULKA 3JQAD 3QVWA 4J91A 5EN4A 1TA4A 1NAIA 2JFGA 3RUAA 2VHVA 1YB1A 2VQ3A 1AHHA 3F1KA 5A5FA 1PJ4A 2YW9A 3CMMA 3W8FA 5L9AA 2GZ2A 4CMKA 2H5LA 3FTPA 1YL6A 3WGZA 4BV8A 1EBFA 3PVZA 4D43A 3GPIA 5G0VA 1FDSA 5KJEA 1R4NB 4YT8A 1M66A 4GVLA 3DONA 2P2SA 4MVJE 3ROPA 3TPCA 2H6EA 4H3VA 2YYYA 3TJRA 4KUHA 4EEXA 1QXSA 1MG0A 2D8AA 4ILKA 4RVDA 3ZWYA 4YQZA 3HJAA 4QFDA 3NUGA 3MTJA 2NSDA 4JBGA 1I33A 1DRUA 1D7OA 1AUPA 1KS9A 1XIVA 2J3KA 3HFGA 2YFHA 4CQLA 3ANLA 4OM8A 1IHXA 3Q2IA 3QWBA 3JYQA 2Y1DA 1HDCA 5DP1A 3WS7A 3PLRA 3V8BA 3JD2A 3Q11A 1V3TA 4YXFA 3C7DB 5CFZA 4R01A 4OYRA 3ANNA 1BXGB 3MEQA 4MIOA 1P0FA 3FSRA 4OH1A 2RAFA 3RC9A 2V6FA 1VC2A 1IHYA 4IJUA 1Q0QA 2FR0A 3A9WA 3BTOA 7ADHA 2XAAA 2DT5A 1LQUA 4RDIA 1L7EA 4BNWA 1E7MA 1OI7A 2CD9A 3WGYA 5HM8A 4R1SA 2FPGA 4LMRA 3HFSA 5DOZA 4FOSA 3GK3A 4OKIA 2GPTA 1MUUA 1GZ4A 5ADHA 4J49A 4U6SA 3QA9A 5I9MA 1LDBA 4K1LA 1TXGA 1CWUA 3OETA 3VHRA 4E21A 3SJ7A 3GN2A 4WE3A 1XWFA 5BNTA 3N74A 4LCJA 2D0IA 2VOJA 1T26A 3UCXA 4M55A 1N1EA 3F1LA 4M1QA 4Q3NA 3F4LA 1WWKA 2HK7A 3LT2A 4R54A 1ZZEA 1SNYA 4YJFB 1VM6A 4J7CA 2VWGA 3VAZA 3W6ZA 4BMSA 5B4VA 4L9RA 3WX0A 4BNXA 1GQQA 2EEZA 2Q1UA 3BMNA 3EZYA 5A3JA 3GFBA 2JFHA 1GYQA 1YDEA 3DXFA 3MOGA 4PGFA 4K6CA 4N5NA 4Z0PA 2RIRA 4B79A 2XXBA 4XYGA 1TLTA 3EHEA 3GMDA 5AXBA 3QY9A 4IXTA 1XLTA 5K9ZA 3BXXA 1VE9A 4R9SA 3PTZA 5JCXA 1PZHA 4LCEA 3IOYA 4CMBA 4OQYA 2X0IA 2Z5LA 2ZCUA 2O4CA 4R41A 3DTYA 2WYWA 3JQGA 5I7VA 4PLYA 1V8BA 2I76A 1LDYA 4J4TA 4N18A 1CIVA 5ER6A 5IN4A 3SXPA 4BNIA 3JD1A 4B4UA 7MDHA 5KKCA 3NT5A 4HWKA 5THQA 3LQFA 2PZMA 3WQQA 3Q0EA 2UAGA 2E82A 3JQ7B 3PJFA 3R1IA 4MVJH 2C54A 1BTOA 3PHHA 4TVBA 2BGLA 4CLRA 1YGYA 4RZIA 1BVUA 3C3XA 1C0PA 3AUTA 1RYEA 3RC1A 2VZ0A 1PR3A 2GN8A 1K6XA 4Q3EA 4HFMA 2QYTA 1DAPA 3WGQA 3RBZA 1BXZA 4IM7A 2BELA 1EVYA 3ZU4A 3TN7A 8LDHA 4TWRA 1EE9A 4MJLA 2QRKA 1VPDA 4WPGA 2QRLA 3PHJA 3OH8A 4CPDA 1G6KA 3GUCA 4P4GA 5IZCA 4WOKA 3GHYA 3F9IA 5JY1A 1B0AA 1GUZA 4D79A 1O8CA 1RWBA 2CNBA 2QX7A 3DAFA 3DBRA 3KZVA 1YH3A 3NGXA 2X6TA 1QV7A 3NTOA 1LRKA 1JU9A 1P1IA 5DP2A 3HZZA 1U4SA 1WDMA 2FZWA 4BUCA 2VWHA 1HE5A 1BHSA 4KP7A 4GX5A 1UXJA 3M1AA 4BNKA 4MPDA 4II2A 4D45A 4IGFA 5G4KB 3WNQA 2NQTA 4HUJA 1U5AA 5MDHA 2NADA 4IMPA 1B8VA 1BG6A 3AOEC 5B12A 3CINA 3LLVA 3NRCA 3AU9A 3WOHA 5BNIA 6LDHA 4P22A 3EVTA 2AQIA 3D0OA 4DBVO 2PWZA 2G76A 3L0DA 3L4BA 3IDSA 4CUKA 5JAQA 2EHDA 3L9WA 3VPGA 4KDFA 5B1YA 1U7TA 2O3QA 2B69A 3RBVA 4TRNA 1A9YA 3RFXA 2VRBA 3RROA 4W7HA 4H16A 4IGEA 3JD0A 4L8VA 2PKQO 2IXAA 4CV3A 4YDRA 5ENVA 3HHPA 2ZYGA 4M54A 3PWSA 3QJ5A 3LC2O 4Z0TA 1G0OA 2PKRA 4NJOA 2YZ7A 4OOEA 4KDEA 1V6AA 2WYUA 1NVMB 2CVZA 3RAJA 1HYHA 3COSA 4I5DA 1QV6A 1I36A 3UCFA 3WQRA 5FEUA 1MXFA 2X22A 3VVCA 9LDTA 5JNLA 2P68A 2IEBA 4LRSB 4CM4A 2W2KB 4FFOA 4UAGA 4UVIA 3PYMA 4PG8A 2Q2WA 1U7HA 1UJMA 3VZPA 4E30A 3HDHA 1MXHA 4E5PA 1X1TA 1FXSA 4BGVA 1Y5MA 2VOEA 5T6BA 3CUKA 1R4MA 1WVGA 1H9AA 4YJHA 3UGKA 1ONOA 5F5NA 3PYXA 1YDWA 4D0RA 3HSKA 4E31A 4D7AA 3ZWPA 2C29D 3MJCA 3H3FA 4NZ9A 4CV2A 2GN6A 2V7PA 4S1VA 1ADGA 2O23A 3B6ZA 4MVJM 1DIBA 3HNPA 3JYNA 1E6EA 4BS9A 4AJEA 1Y9EA 4XDYA 4YTEA 4EGFA 4HX5A 5KVQA 4FOOA 3GZ4A 1MFPA 2FMUA 4YEDA 1SO8A 4PRLA 4CM8B 1KC1A 4OXKA 5JAIA 4PLCA 2W2LD 3U5TA 1ENZA 3T7EA 1I24A 1HDRA 5L4SA 2YUTA 2VTEA 1PJQA 1UDCA 2H1SA 1UH5A 3OBBA 4FFMA 4ZQGA 4CM6A 4DLLA 3AK4A 3EAGA 1U1IA 4TRRA 3NTRA 1GQ2A 2JHFA 1EBUA 1DC6A 2X5JO 3IS3A 3P5SA 2H63A 2B83A 3KB6A 1I8TA 2HMSA 3CSDA 4YAGA 1F12A 1LDMA 1FK8A 3LF1A 4UVHA 2YY7A 4CMCA 3E48A 2J5QA 1CRWG 5KVVA 4RF2A 4OXNA 3CZMA 2QHXA 5JYEA 1I32A 3DL2A 1XELA 3MWEB 3RSHA 3FPCA 4WKGA 5T8KA 4CR7A 4XX0A 4D3SA 2Q50A 2EGGA 2P5YA 4QECA 3H6KA 3I9MA 1NR7A 4GVXA 2IZZA 3UW3A 4YT2A 3IUSA 2Q1TA 3BMCB 4ALMA 1E1KA 1EVJA 4I08A 2FZEA 1UXGA 3GN1A 1ZO8A 3ZU3A 4UUMA 2DUUA 5KJ6A 2V6MA 4CUZA 4G2NA 5T57A 3Q9NA 5A06A 4HP8A 1IB6A 2ZYDA 3FNHA 2BRUA 3QVOA 4Y6PA 5IDXA 5JAZA 4IDEA 4QFCA 3P2OA 3ZWNA 3ZU5A 3ST7A 1KY4A 1GTMA 3NT2A 4IPTA 1MC4A 2CFCA 4MINA 1V9LA 3D5TA 3OIGA 4FC6A 1YQGA 4YPOA 1DSSG 1HDGO 2I6TA 3LK7A 1RKXA 3KRTA 1DC4A 1KEVA 4MVJI 2AQHA 3AY3A 2FSSA 5DCWA 1DFIA 1NASA 3OM9A 3RVDA 4H7PA 3O8QB 4URFA 4HBGA 2Z1MA 4J4HA 4BO6A 4HNHA 1GU7A 4CM5A 4RCVA 3WJAA 4CLHA 4I9NA 2X9GA 4RPKA 5I9NA 3MTGA 4MVJP 5AOVA 1JAYA 4I9HA 1ARZA 4M86A 2YV3A 2VHYA 1KERA 3W4KA 3OSUA 1JTVA 1PSDA 1X14A 5B37A 3VH1A 3H9GA 4J3FA 5DBGA 2QRJA 4BQPA 2HMWA 3VDRA 3NX4A 3G3EA 3ZNOA 3U4CA 1ORRA 3PZRA 4EUFA 4IJKA 1KBZA 1ISJA 2J3IA 2ZB7A 5C7IO 3JQ9A 2Y1EA 3ZWBA 2FWMX 4E0BA 1R0KA 2VT2A 4JBIA 4CMGA 3NDRA 3P2YA 3AOGA 1LLUA 1UP4A 4FJ0A 3ETGA 2IYPA 3DEYX 1SB9A 1G1AA 3H8VA 3GGPA 1HLPA 1HSOA 4O6VA 1T25A 3C1TA 4CQLB 3SC6A 2QQ5A 3ZZNA 2EJWA 3S2EA 4BO9A 4BV9A 4AJHA 1ZCJA 2JCVA 3UUWA 2HJRA 1ISFA 3LLSA 4EJ0A 4FJ2A 2EP7A 2UYYA 3I6QA 3OECA 4MKZA 4U6QA 2GR9A 4W7IA 1RM0A 1QLHA 2NUAA 5IDWA 4BB6A 4CMEC 1UAGA 5CEEA 1KY5A 1YVEI 1WNTA 5L7YA 3DZBA 4L0QA 3JQCA 3GHHA 1NX6A 3PJEA 3RFVA 5KJ1A 1EUCA 2EW2A 3CXRA 4J6FA 3GVPA 4GLOA 4QEDA 4BGEA 1IL0A 2VWQA 5EESA 1DXYA 6ADHA 1DOHA 1OFGA 5GY7A 1QYXA 4XDZA 4EJ6A 3RKUA 4YR9A 1E1MA 4QQRA 4B7UA 1I10A 3K9QO 3PLNA 3DOJA 5GZ1A 3CIFA 3DZKA 1D3AA 2PD3A 3HG7A 3FN4A 4BO2A 4YRBA 2CMDA 1NPDA 4MP6A 5KTKA 2XOXA 5T67A 1ADCA 1G0NA 2G0TA 1EDOA 3V2GA 1PR9A 3INGA 5JCJA 2Q3EA 3EK2A 3KSUA 3U3XA 5ILOA 1P0CA 2VUSA 2A35A 4BQRA 4FGSA 1P1FA 1K6JA 4WLUA 1Y8QB 2O2YA 2QYSA 3D4OA 1DIHA 2DBRA 4E4YA 1M6WA 4TROA 2D2IA 2WDZA 1GQYA 4O1MA 4KUEA 1F0YA 1Z45A 1ZSVA 3C7CB 4GWKA 3DZFA 1B15A 2AXQA 3INTA 4FW8A 5TT0A 4BVAA 5L53A 2PZKA 4PG7A 4OMUA 3K2EA 4RVSA 1NR1A 1LLCA 1GDHA 4IQGA 2R00C 3RJ5A 1M67A 4DPLA 1XKQA 4XD2A 5JAMA 5KKAA 1C1DB 2QZ9A 1SEVA 1HTBA 2W90A 3DBLA 1GUYA 1N9GA 4Z6KA 1FDTA 3OF2A 3S2GA 3WIEA 3F6YA 1SAYA 2AE1A 4ZQBA 3F3SA 2OGUA 5HS6A 3V1TC 5HS4A 2J3HA 4D42A 3ZWMA 2GGSA 3DZGA 4XZ3A 1WZIA 2IZ0A 2GZ1A 4DMMA 3U9LA 3PQDA 1Y7TA 1P44A 2DQ4A 4K9DA 4XYEA 1NHGA 3TZHA 3GQVA 4CLRB 1E77A 5TLSA 3HB4X 4FFNA 4G5HA 3BMQA 3UF0A 1N2SA 2OMEA 4CL3A 3JQAA 4JX8A 1ZK1A 4IZHA 4ZHSA 2VN8A 1FDVA 4UEKA 3KUXA 4RV9A 3R3JA 3WYCA 1WAMA 3WLFA 2SCUA 1GAEO 4FFRA 1PX0A 4W9NC 3W1VA 4PG4A 3GVCA 1SMKA 2BD0A 4NBVA 3RJ9A 2NTNA 1T4DA 4B4VA 1X7DA 1LTHR 2G5CA 5JSFA 4ND2A 5KNLA 4Y8VA 5LCXA 1J0XO 3UHAA 1M76A 1ZJZA 3H65A 1HYEA 4FSHA 2QG4A 1ZXBA 4J2OA 4IQ8A 5ICSA 1NQ5A 3JQBA 4NQZA 5ENDA 3EMKA 3E9MA 3X2FA 4YRAA 1GPDG 1GL3A 3EUWA 1GCUA 1RYDA 4ZRNA 1PZFA 1PJ2A 3PQEA 2DUWA 3DZJA 3BHJA 2PY6A 4OHUA 3UVEA 3VTFA 4JQCA 3ROKA 1YBMA 2YFQA 4BKPA 4AJIA 3M1LA 3K6JA 4GMGA 4PN3A 5JE8A 1OC4A 1P45A 4I5GA 3ETEA 1A27A 5I9LA 4HFRA 3BTUA 3MJVA 3EDMA 4XB2A 5COAA 2GYYA 3B20A 1LDGA 3PYLA 4DQUA 3ZU2A 4PCVA 4EJMA 2X7HA 1QP8A 2CF5A 3QRWA 4AVYA 3VPFA 2DBQA 4HADA 2EV9A 2F1KA 4P8RA 1NAHA 2Q46A 2ZB4A 4JGBA 4RVUA 3C8MA 4DL9A 1A7AA 1R0SA 1OAAA 1EZ4A 3WQSB 1B26A 1ZUD1 4Y67A 4MVJG 4O5OA 4KZPA 4CM4B 4B4OA 2OBYA 5CDGA 3ZWAA 2W4QA 1TT7A 2OORA 4LN1A 5BNFA 1UXIA 2Y0EA 1YKFA 1JKIA 5F3RA 1R4MB 4WNIA 4YJHB 1ENYA 1DO8A 5F1OA 1ZVMA 2I3AA 4DWVA 1L1FA 2AA3A 3D4PA 4W99A 1Q0LA 1LUAA 3AUAA 3H2SA 4KQWA 4WK6A 3RUHA 2D5CA 5BT9A 1D1SA 5C37A 1OBFO 2XPCA 2ZQYA 3PJGA 4WASA 5A04A 3UCEA 3DC2A 3OIDA 3PWKA 4WOJA 3QIVA 3N58A 4Y6RA 1ZBQA 4FD3A 4PVCA 1BSVA 2Y67A 4BGUA 1EMDA 2JJYA 1FDUA 4I5FA 4J16A 3D3EA 3TWOA 1XG5A 3IC5A 4X54A 2Y1GA 2BI7A 3E82A 3OEYA 4ITUA 1HDZA 4U5QA 3GG9A 3NDJA 3PI7A 3GPDG 2A92A 1M6HA 3R3SA 4EZBA 4F46A 3ROMA 4JCOA 1ZXLA 4F3YA 4R1NA 5EQDA 5G0SA 4B3JA 3QWAA 3LF2A 2UDPA 4IDAA 3FR7A 1YL5A 3CKYA 1KEUA 1UDBA 3IQDB 4BMNA 4BNUA 2O7SA 3NTQA 4WEOA 2HU2A 4ZQEA 5F1PA 2FPIA 4RORA 3RQSA 3WIDA 2Y93A 1PGJA 2V6BA 3WICA 4IDBA 2VHZA 2HKIA 4R1UA 3DTTA 3HQ4O 3G1UA 4CM3A 1PGNA 2WEKA 1I2BA 1O6ZA 1DJNA 4JBHA 4YAJA 3GFGA 4Z9XA 5JLAA 4J0EA 2QZZA 1NXQA 3EVNA 3NGLA 4MKRA 1X7HA 1UP6A 4WLEA 3ANMA 4ND1A 2ZTVA 2O2SA 3GGGA 4PLTA 2RH8A 5BSGA 1NWCA 3CMCO 3ONEA 1U3TA 4RGBA 1B8UA 2JAPA 5DBFA 3SEFA 1Q0HA 1ISHA 4UVGA 1DBVO 2JCXA 3GUYA 1K5HA 3RUDA 4PG6A 2EKQA 1P1KA 4R68A 1KIFA 3RBXA 2YQ5A 4E3ZA 2GN4A 1ZH8A 3HDQA 1YBAA 3JD3A 1Z82A 4PLWA 3A28A 4PZDA 3W8DA 1Y8QA 4JJFA 1A5ZA 2W8ZA 5BSEA 4IZIA 4BNLA 2JD0A 1UDAA 2FY8A 4FFLA 5B4UA 4ZJUA 1LEHA 4GL4A 4UEJA 1PL6A 3BHIA 1WLYA 4R5HA 3GEGA 5COQA 3EGOA 4RPLA 1GADO 2VYND 1RM3A 3OA0A 5K6AA 3KBOA 3C1AA 1YS4A 1EE2A 1HT0A 4HXYA 3L9XA 1FJHA 4WGGA 4RVGA 4GLLA 2E49A 3ETDA 1NPYA 1ZMTA 3RKRA 1T2FA 2EKPA 2HK8A 1GPJA 1C1DA 1HDYA 4RZHA 5IZ4A 1J4AA 3JSAA 3HDYA 1MA0A 3HN2A 4BHTA 1T1RA 4O63O 3F4BA 1CDOA 1B3BA 2D1YA 4LSMA 2NNLD 2Y0DA 2GD1O 3U49A 2PNFA 2DBVO 3GA0A 3GVXA 4MP3A 5CPFA 2ZJ0A 1A9ZA 1U2GA 1UR5A 2A94A 1C0IA 1PTJA 4FR5A 3DZIA 3NYWA 3Q3CA 4EUHA 1GR0A 4Q3BA 2PK3A 3DHNA 4ESOA 5IDQA 3SLKA 3VH4A 1ONPA 3PGXA 4XRGA 1LU9A 5F1KA 2JL1A 2DKNA 5JC8A 3EYWA 1ZW1A 3AI3A 3WBFA 5EPOA 3WSWA 5C5IA 3WWYA 1I01A 3ZI0A 2Q1SA 4OO3A 4WNCA 2NACA 4YRDA 4ND4A 4TRMA 5AQ1A 3ZH2A 3LT0A 3W4IA 3WFJA 3GVIA 4ND5A 5TGDA 3FI9A 3LT1A 1E5LA 4O0LA 5TJHA 3G49A 2OXIA 1DB3A 3DAGA 2NU8A 4BB5A 3QE3A 1PZGA 3OQ6A 4NFYA 3JQFA 4E2WA 1MC5A 3GAFA 4E5YA 2CVQA 2QW8A 1VSVA 1XDWA 1U3UA 3GZNA 5A3VA 3WTCA 4B7XA 3JYPA 1ZEMA 2BGKA 1XR3A 1A71A 2VNSA 2NV6A 1SC6A 2WSBA 4FDAA 4BIIA 3JV7A 1FMCA 3BZUA 4E12A 5LC1A 1T2AA 1XU9A 3INRA 3ZV5A 1P77A 1BW9A 3ZHBA 4INAA 2I99A 2W2LA 5L4NA 2EGHA 5G0TA 2YV1A 1LNQA 3X2EA 1B8PA 3H3JA 1CF2O 3AFNA 5DDIP 3GH3A 4IY1A 1DDOA 1ZK0A 2DTDA 3PHLA 5EL0A 1GYRA 2IDZA 3MZ0A 4R16A 2B37A 4RVHA 2HMTA 4D3DA 4DC0A 5IZCC 1PGQA 1K3TA 5JDIA 4D41A 2GZ3A 3AY7A 5L7TA 1VKNA 1IYZA 2I5PO 2RH4A 3GG2A 5HA5A 1QG6A 5TC4A 4GX1A 3SX2A 4DVJA 4F45A 1LLQA 2B4TO 2CUKA 3BTSA 3ENKA 5I8ZA 4DIOA 4I5EA 3ASVA 4GX0A 4D3FA 3CE6A 4JLWA 4EDFA 3UN1A 1X15A 1VI2A 1ZKMA 1NNUA 2UUOA 4CM7A 3ZHZA 4RF3A 3MCVA 4R1TA 4R3NA 3JYOA 4NH4A 2HK9A 2VZ9A 2HCTA 5CEJA 1QMGA 2PH5A 4BNFA 1BDMA 1HKUA 1V3VA 1Z7EA 2X5KO 3JYLA 2ZYAA 4UVEA 4DTIA 4IINA 4Z3DA 1A4IA 3RUFA 1AE1A 2GRAA 3L4BC 1YOVA 3DBLB 4XR9A 3RUEA 1BRMA 2AQKA 2O48X 1N9GB 3RCBA 4CUJA 1F17A 3AY6A 3T4EA 4YACA 2EP5A 4YA6A 3VZQA 1Y8RB 3OICA 2Q45A 5I8WA 2A9FA 1YRLA 2EF1A 3DWFA 4J1NA 1DIRA 2PZLA 3O38A 3P19A 1SOWA 5HTOA 3L4SO 4DYVA 2O3JA 2VHWA 3KM0A 2Y68A 1PZEA 3LC7O 3ZW8A 1DRWA 1QYDA 4UREA 5L95A 4OSOA 3FCOA 3BMQB 4FBGA 5CP8A 3JQAB 3STHA 5H83A 2FP4A 1SOVA 2O3SA 2VRCD 3EZLA 1HSZA 2PZJA 3F5QA 4IS3A 2Q2QA 4RF4A 1WDKA 2E4AA 3JQ8B 4CMHA 1U28A 3V1YA 3FHLA 3I23A 3S2FA 2CVOA 2BFMA 2DTXA 4HNGA 4RLHA 4WLFA 5THKA 5CDUA 1LRJA 3DHEA 2ZK7A 1I5RA 4P38A 3DQPA 2EERA 4BO0A 3FBGA 4FFPA 2D4AA 3LZ6A 4DC1A 3L6DA 3MOIA 4G81A 3I4FA 2E6UX 3H5AA 4DREA 4OJNA 1JN0A 1LJ8A 2AG8A 3SVTA 1EUDA 3IIEA 1QLJA 4DRYA 4LGVA 1R66A 2XXJA 3ENNA 1CQIA 4NBWA 3KV3O 4YYZA 4C4OA 1ULSA 2B4RO 2Y1OA 3AM4A 4Z0HO 5B4TA 1WPQA 1GD1O 2PD4A 1HDOA 1HF3A 3I3OA 2ZKLA 4CL8A 3GDGA 4L74A 4R51A 1E1LA 1ML3A 2C7GA 4D46A 1GUFA 3G0OA 3PFFA 5DULA 5JFOA 3T4XA 5C7LO 4ZA2A 2H9IA 3TZ6A 2GSDA 1BMDA 3UXYA 4GBJA 3KHUA 3ICPA 1OMOA 2YV2A 4MDHA 1MLDA 1CJCA 2EWMA 2O3TA 3DB2A 3L6OO 4OGWA 4A7PA 1I2CA 3FPLA 1YWGO 3Q6IA 4M8SA 3ZW9A 4K6FA 3PDJA 3DMTA 5TF4A 1YL7A 3OP4A 1R37A 5T8KC 5FF9A 1VL8A 4XA8A 1YB4A 1L7DA 4IIUA 1JKFA 4FN4A 1KVSA 2ILTA 3WBBA 4IDDA 3PRJA 1SZJG 4L4RA 4P4NA 2R2GA 1R16A 5AXCA 1YO6A 5F21A 1P31A 3P7MA 3D4NA 3AJRA 3VPSA 4ROSA 4AICA 1HXHA 5EMHA 3I6IA 2X0NA 4HFJA 3QWIA 4EW6A 2J3JA 2NU9A 1PGOA 4J4BA 3G79A 4M49A 4GX2A 2FRDA 2O3RA 3IAHA 2PD6A 1Y5RA 3W6UA 3F47A 4PIVA 5JY6A 1X13A 1LSUA 2QIOA 2CF6A 4IQ0A 4NBRA 4CLOA 5U9CA 1XA0A 3D5QA 5DNAA 4DUPA 1UZMA 1T4BA 4YWJA 2LDXA 5MGBA 4XIYA 1FDWA 1KEPA 1ZEJA 2FR8A 2DPGA 4Q3CA 4RL6A 5G0WA 3OIFA 3KVOA 4GGOA 2YHIB 2OBNA 3K2BA 1VJ1A 2ZTLA 2O4UX 4Y6SA 5JW6A 2VCYA 1BWSA 4J7UA 3SJUA 2B5WA 1HEUA 4YAKA 1QRRA 3QP9A 4Z9FA 1B7GO 3PHGA 1F8GA 4KWHA 4YB8A 2VNAA 4MIYA 1HE3A 3ZWOA 2DC1A 4LSWA 4RF5A 1DC5A 1ZK2A 3JCZA 4XKJA 5EERA 3ZHYA 3M2TA 3KSDO 1P1JA 2AHRA 4OXYA 4JJIA 2Q4EA 2Q1WA 3ZWVA 4NMHA 1XGKA 1Q7GA 2RBEA 2AG5A 2PGDA 4P4LA 4XQEA 4AL4A 3PJDA 3A1NA 3JQ9C 5J23A 5AVOA 2Y0CA 1WDLA 3PZBA 4MP8A 3NJ4A 4NR0A 3GRKA 3QWHA 5JDCA 2ZB3A 2PLAA 3JQEA 2IE0A 3I4CA 1XQ6A 4K28A 5G4LA 1PQWA 4AJ1A 3V2HA 4Y98A 4J2HA 2C0CA 4DPKA 2Y1CA 4DYDA 5DF1A 4UUOA 2JD1A 3PWZA 3QVTA 4E2YA 3DMYA 1AXEA 4L76A 1NQOA 4J1TA 3QLJA 5LDGA 4CJXA 3HN7A 1A7KA 4JROA 2FHSA 4W82A 1X0XA 2WYVA 4MVJF 4ALLA 2O50A 2BI8A 3S2IA 3H5NA 5DOVA 5TQVA 1NBOA 5ER9A 3PIDA 3BA1A 1T2DA 4D44A 3ABIA 2EXXA 3KSZO 4CM9D 4CODB 3KOUA 5HWSA 5JMWA 2CY0A 2DLDA 1PWXA 4ZN6A 4B3IA 2C5AA 1O89A 4NFSA 3C85A 4UUNA 2HJSA 2WWRA 2NVUB 2CDBA 2FPPA 1X1EA 4RQUA 2C82A 3UKOA 1KC3A 4FCCA 3UAGA 1I3MA 1U8FO 1ZIDA 4E2XA 1QSGA 1E3EA 4OL9A 4NJMA 4HV4A 4J9VA 3BHMA 1FF9A 1PJBA 2Y66A 1MB4A 2GUGA 3ZWCA 3IL2A 1UZLA 4WCFA 4OSPA 1E3WA 1EDZA 4BO7A 4MVJD 3FF4A 5IDYA 4B4WA 2RHCA 4JJGA 4NPCA 4CR8A 5ITWA 3QVXA 2DFDA 1W4ZA 1AGNA 1Y8RA 3DBVO 4ZQHA 2WD8A 5FYDA 1P74A 3AM5A 4E5KA 1SCUA 1HLDA 4N54A 4NBUA 4QX6A 4I1IA 1T24A 2C2XA 5G2OA 1N92A 3E9QA 4JNKA 4EBFA 5A9RA 2HUNA 1IZ9A 4BNTA 2NVWA 1TB4A 2ZTMA 4BMVA 2E48A 2WD7B 4TMFA 3ZDFA 4BKRA 1IY8A 1VSUA 2UUPA 4F6LA 2YHUA 3BIOA 1PL8A 2POQX 5GZ6A 3JQ8A 1YQDA 1NTOA 2HLPA 3PEFA 5DN9A 2OP1A 3UICA 3WXBA 3QWFA 4LK3A 1PS0A 2NLOA 2OFPA 4Z3KA 5BQFA 3UFXA 2J8ZA 2AE2A 4H15A 4Q3DA 4R3WA 2BMAA 2WTBA 4YBZA 3ZV3A 1NQAO 4XR4A 3WGHA 4J7XA 4LISA 4XJSA 2P4HX 3GZNB 3UH1A 5I7EA 3WG9A 1PWZA
chains in the Genus database with same CATH superfamily
3H17A 1DT5A 4DUGD 3AW8A 2OP0A 2H2DA 3U80A 4I4TA 3KKEA 2OYSA 2GT1A 2CEKA 3DV0B 3K5PA 1XJWA 4X7PA 3RUIA 2IPNA 2OWDA 2C5HA 2X19A 3LZCA 3B60A 3HXQA 2KM1A 2RKOA 4GQAA 4A5OA 4HDQB 4ZC8A 1OH8A 1C14A 2JLRA 3GLQA 2QQ0A 2WJ4A 1U9YA 1ZUNB 2K2WA 3B1KA 3E61A 4JASB 3IV6A 2Q6VA 3KOYA 2GCGA 1IH8A 1U9IA 2PSDA 3EG9B 3F6BX 3LRPA 3ONNA 4TXJA 5T3YA 1L5LA 4DXDA 5BSFA 3IVAA 4PVDA 1R1DA 4EI2A 2GZSA 3AMVA 5A4DA 1C9MA 1IFXA 3GEIA 2CZCA 2JASA 2JGDA 3ES9A 3CX8A 4PNHA 2OZVA 4MV8A 5SY6A 4GGPA 4I3FA 3UBMA 4G01B 2AZTA 1N2GA 3I2KA 2R8OA 2VDUE 3QXGA 4LOKA 2XNDD 1K08A 3M9XA 3M6MD 3H9UA 3TF5A 2EG9A 4WZBB 1MZPA 2C96A 1KXJA 3FXAA 4EY7A 3DV9A 3K9WA 3I5YA 1JR4A 2ZPUA 4RVFA 4HQNA 1ODSA 2ACKA 2DQKA 4WFQA 4AROA 1RVDA 1ZYUA 3COZA 3OQBA 4YIKA 4WECA 1UWLA 3N3BC 4L95C 3ZN2A 1F60A 2O57A 3L7JA 1EQ2A 3AXTA 1GCIA 1N75A 1QQTA 2HGSA 2PX0A 1IUOA 4PF1A 3SJBA 1IULA 1VGRA 4OGFA 1V9SA 3GGJA 1E3IA 1QHSA 1EGAA 1QIKA 1ZOPA 3TRFA 2I67A 3IKTA 1H1LB 2Q1XA 1N32B 3H0EA 2QTRA 1WQ4A 4BRZA 4CR6A 1TADA 2PGJA 4JP8A 4DNFA 5J5AA 3RBAA 3E4DA 1C1XB 3V34A 3WGOA 1S7CA 1M7GA 2LDBA 5IJ9B 2QTAA 3DE0X 4O4IB 1J1ZA 1CUCA 2XDWA 3WFZA 1DBPA 1GG8A 2CCGA 4RH3A 1UPXA 1ANKA 4X91A 1VRVA 1AZLA 3LRTA 1SGWA 3FNBA 2E6KA 2QVXX 2XA1A 2OKCA 4HMOA 4IF4A 4W4TA 5HRAA 3SS8A 2VUTA 1G3IA 3GYBA 5JJKA 4G5YA 1XZLA 1JG4A 2BR3A 5DM1A 3TG8A 1L5HB 1SCIA 1BE6A 1K63A 1UOPA 3M3DA 2DFPA 2BCGY 1GNRA 3DT9A 3GJXC 1EP2B 1L5VA 1RLMA 2GERA 2WJPA 4GPIB 3G9ZA 3Q3JB 4JLVA 4U63A 1KMCA 3M34A 2ALJA 4YLEA 1C80A 3IJRA 1XEAA 1EJ6A 3TO5A 2QP4A 1NVEA 4KWCA 1D04A 2IYSA 2YDYA 1W1WA 2ETXA 3QV2A 3BWCA 3BGVA 1AJEA 1C8BA 1D6MA 3GNLA 4RQBA 3W8RA 2YWJA 1AXGA 2ZULA 4G0YA 6AT1A 1L6RA 1URPA 4DMRA 2JFUA 4KE9A 4I9UA 1BDHA 2BKVA 1U3VA 3SYRA 3D7KA 2M32A 1H0SA 3C45A 3AM1A 5KJCA 2ZIEA 3BD9A 3O9VA 4HN2A 4RY0A 4YUZA 2CDCA 3ED5A 4BEBA 3N1UA 2Y76A 4L9AA 2RKBA 1ESCA 2UVDA 4JP3A 3TQFA 1XNRB 2NP6A 4MWBA 3FKJA 3OUUA 1U5BB 3EASA 2ZUUA 2ZS9A 4TKLA 3E7FA 1BGVA 2G17A 4H3SA 4F71A 4P33A 4RTOA 3BFVA 3ETJA 1WMEA 2Q6OA 1NW3A 1C2TA 4A10A 2HDWA 1FLVA 4XLTA 4RHUA 4RFSB 3FPFA 1AS2A 1MH1A 5JH7F 2WZCA 1T1JA 3B6KA 1KYQA 4JYMA 1L5RA 1KI8A 3I73A 5KNCH 3G5LA 1KZ9A 5AI6A 3C6BA 3DEZA 4MRSA 2GNAA 2J07A 4NNJA 3ZDZB 4B8ZA 4OVKA 4WW0A 1EUDB 1GNVA 2P7IA 5JALA 5D3QA 4QPDA 1DS6A 2DKFA 1GFZA 2H08A 4Q1EA 4RD3A 1CQIB 2C20A 3EGIA 3LYAA 3COJA 2Y3IA 4H59A 4B43A 3OZBA 1KZHA 3VI3B 3QNWA 3I8OA 1YXMA 2PSJA 1MVNA 4RMGA 1JLSA 2JFQA 2EKLA 4CF3A 2HAEA 4L27A 4FNMA 3RYCA 2EBHX 3NETA 4D0NA 2YKGA 4I2NA 3BB1A 3KFLA 3EG5A 3N2EA 4RZQA 1DQSA 1NE2A 2YRWA 1Z3IX 9ABPA 4RZSA 5CG2A 5HZGA 3A4YA 4ZEXA 1VOTA 3ZWWA 5IAJA 1GGHA 3MJHA 1WJGA 3PT5A 1MIOB 4QYSA 2MSKA 1LDNA 1Y1RA 3VR5A 4QBTA 1IBCA 2I0FA 4NESA 1DP4A 3ZG6A 1F5NA 4F9EA 2WM8A 4IS2A 3O3CA 3QE0A 2O0KA 3HB5X 2PUDA 3ASUA 2X86A 3KR1A 4BO3A 4RCZA 4AG6A 4AMYA 2ZXFA 1S1CA 4CN8A 5ALSA 2E85A 1NSYA 5JQWA 2XHZA 2WMDA 1HX7A 1U11A 4F8YA 4DMGA 2ZATA 3EXFB 4UU8A 1WZUA 3WR5A 3O91A 4OCZA 5IFKA 3U1BA 4HQ0A 3GB9A 3NRJA 4IVRA 1RRPA 4K6OA 5SY9A 4D9MA 4PN7A 1TAGA 2EX0A 3DJYA 1XMQB 3CG0A 4OQNA 3I9JA 5A0TA 1UKYA 3R7NA 4CT4B 3BK2A 4P0PB 1NI4A 1HZJA 3D7LA 4XYMA 2OD7A 2QR2A 1JSZA 3O2SB 4FHCA 1UPTA 4D97A 4NBNA 3L6EA 2GDJA 1VG9B 3MJTA 4GZ3A 1U7PA 4AYXA 2BKXA 5FO1A 3M82A 4HY3A 4KIWA 4A27A 5HMLA 1Q3TA 4BKQA 4HDSB 1Y9JA 2O1XA 3A04A 5BXQC 2ZSKA 3GLKA 5BWLA 1N2CE 1KQGA 1XWWA 1VL6A 1Z7GA 5IVPA 2MIIA 2FOIA 3LTNC 4IL5A 1JF8A 1L4FA 4H77A 4WV3A 2QN7A 3M5WA 3VC2A 3KYCA 2VHXA 3R6DA 5CBKA 3EJ6A 3E4CA 2AZ4A 5ALUA 3B82A 2QZ4A 2WFAA 2BUBA 3LIIA 2GHQA 1F2UB 4QDKA 2J9XB 1WMFA 4IJWA 1VJ0A 4N12A 1E1DA 4HB4A 1NFFA 2CLLB 4ZMBA 3FNEA 2Z2KA 4P3XA 2X3FA 3OJOA 2GK6A 2AUTA 3D2CA 1FUEA 1ZNWA 5EXDA 5KCZA 3H8JA 3VO9A 5K6AC 3C7TA 2JBHA 3UB3A 3RC7A 1OCEA 1JDJA 4HR7A 4B0OA 2YJNA 4BLUA 4GKJB 4FDLA 4EHHA 3BFKA 4HEJA 5FKJA 3GGCA 1LSSA 4HQ6A 1KMNA 3LHFA 3T1OA 1NZDA 3LVFO 1SVIA 1IPEA 1J90A 1ZMOA 3D7NA 3GP3A 3GUVA 3IPYA 4N3GA 4XQ9A 2DR0A 2VSXA 4ZT6A 4DCOA 4ETMA 1I30A 3Q87B 4KPEC 1G5IA 5LYJB 4EITA 4UNRA 3PEWA 4RD6A 4BZPA 1VI5A 4HFNA 4YT5A 4GDFA 3LYLA 1NSTA 2F8MA 4I1RA 2XCTB 1C0LA 3C41J 3USCS 1O9BA 1QVAA 1V8ZA 2VLIA 1DUSA 4HB3A 4Q1CA 3VH3A 3LUAA 4EA9A 5E7QA 5BMVB 2HXGA 3DV0A 3GFPA 2YY6A 3OUTA 5F98A 4P9NA 2AK2A 3WKDA 3EW7A 5AK3A 6PFKA 1CUVA 2X0JA 3GGDA 4P3NA 4DQXA 1NUUA 3AEQA 3AYZB 3GOHA 1QYCA 4GEGA 3EPPA 1DRJA 4INOA 5KC9A 2HIMA 5ALLA 3W2EA 2VRCA 1P19A 3FJYA 3PQCA 3UMVA 4BQEA 4OYHA 1LD3A 4G67A 3EG9A 3NKLA 1YBHA 2I9KA 3BQMB 4BWVA 4OYLA 4UTOA 2NXEA 1B23P 3WHPA 2RHHA 3NIDB 4BCCA 4KAXA 1BDBA 1YI8A 2F55A 3GRAA 3I61A 4EKDA 2ZRDA 4CF4A 3I32A 1UL1X 4M1YA 3DYBA 2VTDA 2EU8A 4QUKA 4QRHA 3VC3A 2R97A 4ZAZA 5IAOA 4WZBA 1IBRA 4FMCF 5DHPA 2QUZA 3KB8A 4R1QA 1NW8A 1YCDA 3KQTA 4OU5A 1RPZA 3WRXA 2DF8A 4NCKA 1L3IA 4UEOA 5CEFA 1FLDA 4ND6A 4F91B 1L5KA 1E2LA 1M7HA 2EP8A 5HF5A 5JMPA 1OTYA 3G2OA 4P34A 2IGBA 1AGYA 2I8AA 3I9LA 1YZ3A 4U7TB 5E2IA 3S5JA 4ZCTA 4NU0A 4TWJA 5EJ2A 3G85A 2ECPA 3M0EA 4G1UC 3K92A 3RK4A 5BSHA 3SD7A 3WRYC 1XD8A 4KRXA 5A0FA 2JD2A 1OAKA 1FRVA 2QP3A 1C1XA 4UHDA 3HEBA 3W5IA 4EGSA 4NBLA 1XDGA 3KEQA 5IJ9A 3DMRA 4YAUA 4HX9A 3QVLA 2P2NA 4HGPA 1H93A 3EISA 1QHIA 3MUNA 1I2ZA 2RGYA 4ASUA 4WCFB 4ZZ1A 1WZNA 4Q4CA 3JALB 3LMKA 5KOJA 2FWJA 4O3MA 1Y7IA 1YS1X 2YR0A 4YPFA 2QUJA 3RT7A 4DLXA 3KLBA 3DPUA 1MTOA 3LUPA 3PHIA 4AY5A 4JR0A 3PUVA 4G4SP 3CRVA 5GJCA 3DEFA 5TRTA 5IWAB 1IN7A 1IJKA 1Y3FE 4ZALA 3CA8A 3SZUA 4WX2B 3KETA 5ABPA 4ZV7A 4FHZA 4NICA 4E5UA 1C9EA 1IZ0A 4N0MA 2AR0A 4B7ZA 1T5DX 3ICWA 3U7RA 3TDKA 3VGPA 2CK3D 3WKCA 5ICMA 2J0UA 3I9KA 1I2MA 4LF6B 4UXJA 3U3ZA 3T1NA 4CLEA 1YFLA 3C4VA 1M2FA 4W5NA 1P2FA 4C3ZA 2Q99A 3IP3A 1E1RA 2NZ8A 3HBAA 3O4VA 3E03A 4V0LA 3M6IA 3WIVA 4EJSB 3KSAC 1IN4A 3KXDA 4DDKA 3QMWA 1L7BA 1FX0B 1ISSA 1I4TD 3HGTA 4C7JA 3I72A 3AESB 2IHTA 3HEAA 1TEHA 1NXOA 5KYGA 4MGKR 5CNKA 4WH0A 4C7BA 3TMYA 1EFTA 1EI9A 2UZAA 3LT4A 3RF6A 5DGIA 2HJGA 4C04A 4UUPA 2DTEA 4MR9B 3PC4A 3GPLA 2VJPA 2O07A 4V1CI 5LDHA 1QVZA 1U5BA 1BU5A 3QNUA 1KAQA 4BNZA 1UXHA 2NX2A 1P5JA 3B1ZA 3N9IA 4LJLA 3GRUA 2O52A 1PLLA 2NWQA 2AFIA 4AFNA 3ECCA 2OCDA 2ADFA 5SICE 2TYSB 1BFUA 2B4AA 4B84A 5I3ZA 4DA9A 1CQJB 3WLHA 1JA0A 2UUAB 1DAGA 2V7QA 1CERA 2PWBA 2ZRGA 3S99A 3S5UA 1UFQA 3DO5A 3G1TA 2ZB8A 3NASA 1UIMA 2PT6A 1U9JA 2BLNA 2ZRQA 4JB8A 4E5NA 5JPIA 1R2QA 1GTJ1 2PJUA 4NYIQ 5A03A 1KDOA 2GEDA 2XWPA 1O03A 4MUXA 4C0LA 4P0QB 5EKDA 1W8IA 1WW8A 4A36A 3Q15C 4TLCA 1N57A 1XF1A 2C5LA 1K5PA 2ZI5A 1A2QA 4JXZA 4PZAA 5C7OO 2CKMA 1LI4A 3LDGA 2VPIA 2ET6A 5M29A 3KZMA 3MT0A 3PVCA 4JI1B 4BLOA 1P1CA 2X7XA 4IZOA 4PO1A 3H11B 4U3JB 3QU7A 5L3SB 1W4BA 3BK1A 5FUMA 5IBCA 5IVKA 3B7GA 2GQ0A 4LXHA 2R1VA 1DKOA 4IMJB 1MQSA 1S0UA 1GNQA 2QTFA 4JJKA 3SKXA 3KO8A 2ICAA 4I14A 5GONB 2X8JA 3W0LB 4V1CA 3H13A 1MIOA 2BEWB 3AG5A 4M87A 3ADKA 5CPBA 2JK1A 1E60A 4M2LA 4PO9A 4CQMB 3WLQA 2WJVA 3MD0A 2O6LA 3NJ8A 3P9KA 1WMDA 4ENQA 5A5EA 4EG5A 4YI5A 4MJ3A 3A25A 3EXHA 3MS2A 4UARA 3D8TA 1Y3BE 4IX9A 2TMDA 3TB4A 2B35A 1E1QD 2A4MA 2BHRA 2W2OA 4QOEA 2IRWA 4GE0A 4QUEA 4TWBA 2JGNA 4J0FA 3WNVA 1ZI6A 2YC2C 1U02A 2BHLA 5AYVA 3RSQA 2PZAA 4OOFA 3ABOB 5JZVA 5F23A 4MPTA 2YS6A 3NM6B 2P1ZA 3LHSA 3EW9A 3PX2A 4NHOA 1JG1A 3WO1A 1EK2A 2HMUA 3JQDA 1Z26A 3O2JA 3LG2A 3UAXA 2ZIAA 2JI9A 5SZJA 3OKFA 3UHJA 2XX3A 4IHAA 3HUDA 1TVCA 4PPQA 3RG8A 3SFTA 1AGRA 1DAMA 2ZRMA 4LTMA 4OIMA 4B82A 4JI5B 1H4VB 4QULA 4AX8A 5TS2A 5WRFA 3DAOA 4HDSA 2A9JA 3SYNA 2AUMA 1ULUA 4DSTA 2AV6A 1VCOA 2G06A 2JFYA 1YCGA 2Q3MA 1T2EA 3JQQA 3HUUA 1UUFA 2WMYA 4J0JA 4ERXA 1X8JA 1YR8A 2FGKA 2FJUA 4YJDA 1RJGA 5AOAA 4MW4A 3PCRB 3Q8KA 2R1TB 4MS1A 3H4IA 1M2JA 1X70A 4X85A 1V8FA 3RD5A 5EP3A 4LE1A 1A72A 1ATZA 2AG1A 4Q24A 3BEDA 1ABFA 2XVYA 3GUUA 4HDKB 1GWNA 1H0KA 2YYAA 3VVBA 4B6GA 3ADDA 3IKVA 4KX3A 1DL5A 3ZDFA 1RRMA 1GNPA 2YUIA 1HL7A 4QUAA 1N3IA 2EAUA 2CCKA 2GZMA 2R48A 3ONFA 1NVGA 1JW9B 4PSCA 5DYNA 2QM0A 5HOQA 4HGQA 1W34A 3KQMA 1Q20A 4EGJA 2G3YA 4IXNA 5C8YF 3OA2A 3OOEA 4TZTA 3AIKA 4ALIA 2G40A 4ZOEA 5AXDA 2C4WA 1I9GA 4BO1A 1Q6YA 2CL6X 3ANSA 2NUPB 4KH1A 3VHXB 3AF0A 1ICIA 1K5DA 2O2IA 4K6KA 2F9MA 2Q4BA 4Z4CA 2C9DA 4XQCA 4FVTA 5LYJA 2PFSA 3FPSA 1UZNA 1YVRA 1DX9A 2B0JA 2EIHA 1QOQB 4FYVA 3WK7A 3GDOA 4AJNA 1E9DA 4OI1A 4DNPA 2IYAA 1JDNA 3EVEA 3QSYA 2XZLA 4HF7A 1NQWA 1PJ3A 1VE5A 2FRXA 3E3MA 2PLNA 3HRIA 1FFGA 1OC2A 5BMVA 5JWRA 4NATA 1J5EB 2P9GA 1ETUA 1JMVA 1PWYE 2ZYUX 1AURA 4HEA6 4KH0A 4A15A 2FF5A 3MJFA 4I9GA 1OIVA 4DJJA 1EK0A 1AKVA 1T9GS 1W94A 2OV2A 4R31A 4V38A 4ZCSA 3HXPA 1LLFA 3PL1A 5F7JA 5IN5A 4BNMA 4DMCA 2G8NA 2WM3A 1FP7A 1N2EA 3D43A 4OQZA 5ERYA 4FJ1A 2YL2A 4QXRA 2G67A 3KKPA 4HGOA 1YVPA 4IICA 2P5TB 4C0BA 3NTLA 1RU3A 1ZK3A 2REXB 3H2ZA 4RXUA 3HXOA 2YFYA 4IUYA 1QJ4A 1RLJA 2WAOA 3VR3A 1DI0A 3IBCA 4HWSA 4P93A 1MRZA 1PEDA 5FYQA 3NWEA 2CNKA 4TVOA 3R9KA 4AP5A 3CRQA 1NY5A 4JP5A 1O94A 1SK9A 2G0AA 1VJRA 1QG0A 1QQ7A 1GFSA 1N5IA 3EWSA 4Q3LA 1QIIA 1HDEA 2RGEA 3GNQA 1BXKA 5HKKA 3PE4A 3O4RA 2C0PA 1SHLA 1XHFA 1HLGA 5A9TA 4ZU1X 3A8TA 4DV6B 1Z0ZA 3C7AA 1A4UA 2FEXA 3DTVD 2F7SA 1QBKC 1RI1A 3LC1O 3I9OA 2H07A 1RACA 3C24A 1JBQA 1HTWA 3DP7A 3OU2A 3D54D 1L4MA 2DPHA 2YNMD 2KW5A 1JH8A 2JLQA 1FVHA 3M8KA 4DR5B 3UAZA 2X8AA 1KVRA 2AMFA 3O94A 2IHKA 2FF7A 5AHWA 5DSXA 1G4AE 1WXDA 1PZNA 4MEAA 4C6RA 3D6TB 5BQXA 4G6ZA 5EE5B 4B71A 1E3QA 4KLAA 2CMHA 3AHHA 1US8B 1CUWA 3FPAA 3VJMA 2WZBA 2NO4A 1VJGA 4D4HA 4O2AB 3EQZA 3Q72A 2JLXA 2HLDA 4QG7A 3IP8A 4M89A 2DGDA 3DTNA 4RW0A 3JALA 4BV3A 4DLSA 2ES4A 1W6UA 3EBLA 4HOYA 2B25A 4R8MA 4C30A 5LKAA 2DCMA 3AGPA 3CISA 4ZWNA 1D5CA 1Q1AA 3AVUA 1IATA 4R2IA 2ZYWX 3NHJA 5D3ZA 2VP5A 3USES 4NAHA 2RGCA 2P4QA 5C32A 5E38A 3V8PA 2W2KA 1VIYA 2AW5A 1EG2A 1KO7A 2J3QA 3VSEA 5B3JC 4D0SA 1PDWA 3RHTA 4AN1A 1SUAA 4YMUA 3ZJYA 5JMOA 3VBCA 2DPLA 1B1AA 2MSDB 2FLWA 1Z7BA 2X4GA 4FGWA 4WLVA 3BE8A 2LUOA 1CY0A 4ECEA 2PH3A 2CE2X 1ID1A 4FR0A 4IOMA 4DWJA 4CKEB 3RC3A 3ZHRA 3C87A 3NHWA 3QFHA 4FEYA 2YRXA 5TX7A 5EHIA 1P9NA 3CEJA 3B3JA 2GWHA 2RI1A 4ITRC 3CW2A 2LIVA 2LV8A 3SAJA 4EBBA 3LFTA 2IV7A 2I8LA 2F4NA 1UT6A 4OFXA 3TSZA 4Y2GA 5KBYA 4UULA 2A8YA 3K0AA 3TQHA 1GEGA 3KWMA 1YRHA 2PMCA 4J2TA 3D3QA 3DH0A 2FWRA 3QUAA 5C3MA 4J90A 4DA8A 1DQYA 1K2WA 4NK5A 4CM8A 2IX3A 2AFIE 5LLSA 1KOGA 2G9QA 2HQBA 1ORWA 2XYVA 5DGXA 3R5JA 3VGJA 3TINA 3M6XA 1CQJA 1K97A 1UBSB 1R18A 1V71A 2NTYC 1TO6A 1MC8A 1YJCA 3IOBA 4HAWA 2QRNA 5GMOA 4Y1GA 3UJ6A 2O2DA 4CHTA 3HWRA 2AWOA 4IGAA 4KO4S 4FMPA 3JR7A 1XEFA 3K0EA 1P8JA 4FPXA 1M75A 2CMGA 3ZLJA 4PZEA 1TVKB 3DGFC 1YQ9A 3IQFA 1R8JA 3CLUD 2OPBA 4K9QA 2YWHA 4L73A 4MVYA 4N9WA 3EMDA 5INTA 1J49A 4GMFA 1GPLA 1KOFA 3PLAE 3ZV4A 4G1MB 4GECA 4KODA 1O3YA 3DBRB 4H6WA 1LS1A 3UMBA 2OENG 1EFRA 3JRXA 4XPIB 5CW2A 2R8RA 4AP6A 4M7PA 3EY4A 4IILA 3U4DA 5K0JA 1ZOSA 2BFCB 3FMOB 3A1EA 3WLLA 4KV7A 3MWEA 2WU1A 1OLXB 5GONA 3WDSA 4BU0A 2BEWA 3BJRA 3H8WA 3RI3A 1W85A 3Q5EA 3TIXB 4ER7A 1AHIA 2Z6VA 2ROQA 1F9AA 1A95A 2MJLA 2V5AA 1TAQA 3BMCA 3WGLA 1XMPA 9ATCA 2OUIA 1P3Y1 2GN2A 3H4VA 3O4FA 3S55A 2P8SA 3OIVA 3NVAA 1G38A 1E5DA 3I83A 2C5EA 1ZR2A 1H6AA 1KPHA 1EWQA 1JI0A 1HT3A 1PJCA 1GPYA 1QR6A 1W4LA 1VHTA 2G4CA 2LNDA 2OZKA 2RGUA 2WQZA 2X1HA 3NBYC 1BDJA 3BWMA 4Q4HA 4YCDA 3ZCUA 4LVCA 3DZHA 1TCVA 3JAKB 4ZCLA 3HR4A 2AI1A 2VYVA 2D00A 1CB7A 4JEMA 1YQQA 4PZPA 1A9QA 1S6YA 2V65A 4TN1A 1O6BA 3NT4A 3DD1A 1E3SA 4C20A 4RTJA 4KMSA 2JDIA 1U2SA 5K99A 1OH7A 5CUQA 1XXHA 3VTZA 4ARVA 1D8AA 4EYQA 1AN0A 4BBJA 4ZZIA 2VPQA 3K96A 1JT2A 1TI7A 4MQBA 2DFVA 4PYRA 1EE1A 3K09C 5GV8A 4PX5A 4DMLA 3ONDA 2RSLA 5F12A 3WGUA 1QH8A 1QRDA 1TMOA 3HE3A 4L4YA 1HQKA 5B7QA 3OPXA 3AU8A 1BQ3A 4M1KA 3QNMA 4DILA 2HX1A 3EAQA 2DX7A 1QYWA 3CJRA 2JKVA 3TXXA 3M5CA 1DWQA 4MHOA 2P8JA 1P0QA 2JFGA 3DPIA 4YDQA 3KAJA 1VPVA 1O97C 5HG0A 1AX9A 3C5CA 2BP7A 4LY9A 4X60A 1XC7A 2G9UA 1KK1A 1RADA 3FSEA 4QOGA 2YW9A 5CMLA 2ZW9A 2MDTA 4ND8A 4HDKA 1EJ2A 3HBNA 2GBLA 4A0QA 4HVLA 3JZDA 3IIMA 4PTZA 3HM2A 4D9JA 1XTZA 3U37A 1Y3HA 4JJAA 2CHUA 2N3ZA 2HZ7A 5AHKA 2XBMA 1XTBA 2ZP1A 3G9UA 1YL6A 1KAOA 3VJLA 1EBFA 3PVZA 3D8NA 3GRFA 4IXMA 3CX6A 2C4KA 3NALA 1ZH6A 1JQDA 1O95C 5EIEA 4YT8A 1INLA 1M66A 4LVNA 1F20A 5H4GA 1D0SA 4TL7A 1ZJJA 2VQDA 2O19A 4D5GA 1V8OA 3D3JA 1RFLA 2HHLA 5HVNA 2JFVA 1PR0A 2CLFB 2HQSA 2V3WA 3TJRA 4CCWA 1V16A 1MG0A 1UXOA 1U8EA 3B3AA 4RVDA 5FFNA 3L7DA 2P6RA 2EZTA 4QFDA 4MKHA 1J7JA 2NSDA 3MTJA 4JBGA 4YIHA 4R0NA 1DRUA 1KS9A 4CQLA 3L8FA 2J3KA 3QX9A 2YFHA 3BWXA 2JJ1A 4LSZA 3ZLUA 4HDCA 2VDNB 3Q2IA 1EBBA 2Y1DA 3EUAA 2CFOA 2C03A 5DP1A 4HNSA 2WTNA 4YLGA 3V8BA 2L2QA 1Y6RA 2M2IA 1PFYA 3SQDA 3UUGA 1T3HA 4J3NA 2EJCA 4WQMA 1RPAA 4L5AA 4TV8B 4KQIA 3H2JA 1CY1A 4YXFA 4LX0A 5JPDA 1UK8A 2C57A 2OCKA 2C9YA 4R01A 1C30A 4OYRA 2WTMA 3A2NA 1FVFA 1QCZA 3AYXB 2FSPA 1Z7YA 5D87A 4LS3A 3GDWA 4AXBA 3I01M 2P2GA 3PPXA 4YMGA 3L7AA 1KSFX 4K9SA 4NOLA 5LWHA 1OTHA 2FR0A 5D5HA 4H1TA 2PX6A 3BFXA 4EO9A 1LQUA 2FPSA 1E9AA 1OXSC 5AK6A 1E7MA 4MVCA 3I45A 2VJAA 3ZXSA 2XMRA 4Y1RA 4BNWA 2CD9A 1W581 3CU5A 4MR8B 4UBOA 5HMMA 4URXR 2BFFB 4L9WA 2UVPA 3A1WA 2PL9A 3A6HA 4KAFA 2VPYA 2OVFA 4LMRA 5TEWA 2OAQ1 5AVTA 1EHCA 3Q7EA 2ZI4A 2BFEB 1ESEA 4K9PA 1X7WB 3TKYA 4FXOA 2V7WA 2GPTA 3UB2A 3G0HA 4M46A 5JUWA 4UJ3A 2I7DA 1JHRA 4EGAA 1BQ4A 2IP1A 4EF5A 3GLGB 1CE8A 5K05A 5KYWB 2QL7A 3CFYA 2B4KA 4C4RA 1P2TA 1XWFA 3QBEA 5GAJA 4LCJA 2VOJA 5DLYA 1V4BA 1US8A 2BDUA 4QATA 4M55A 1N1EA 3UCXA 2HJ9A 3LT2A 5C1DA 2J0SA 1YB2A 3BE5A 4RPIA 4J7CA 5TVGA 4F04A 1CQXA 3S70A 2X8BA 1F6WA 1M34A 3E7PA 1DCTA 5I48A 3EZYA 5A71A 3U7QB 3VTAA 3QTBA 5A3JA 2QM7A 3AV0B 3E81A 2JFHA 3SU8A 1YDEA 1KRWA 1KAHA 1QF9A 1WIWA 3KXLA 1XCLA 3SOPA 1J39A 2ZROA 4YYEA 4AK9A 4K6CA 2Q29A 1TW2A 1ZCBA 2RIRA 2FEPA 3PDWA 1TLTA 4Q19A 4XYGA 3SM9A 3UJCA 4F2PA 4OQDA 2V3CC 1XLTA 2E5LB 1KI4A 3I76A 4R9SA 3X1KA 4KR7A 1NX9A 1PUJA 3GA5A 1K0FA 4AQ7A 4RTSA 5F7XA 2ZCUA 1E2KA 5K0NA 2JLUA 2ZS8A 5B55A 2QLTA 4UUAA 1AKWA 3FDZA 3P9RA 3MHTA 4D9BA 3D6NB 2PU5A 1C4XA 3SXPA 3DVRX 3JD1A 2CDRA 3UEOA 3QHQA 1YJ5A 2BV3A 1SXJB 2WHQA 4HWKA 3MSXA 5THQA 3WQQA 4MCAA 3D02A 2ECFA 4QQFA 3QX3A 3IOMA 4YX9A 4DRXB 4C1BA 3PJFA 1W5SA 1HNNA 1IHOA 3PRYA 1BTOA 5B1EA 1SCJA 1TZKA 2J5BA 2XCIA 5ESWA 1UDWA 1A96A 2BGLA 4CLRA 5FPPA 1ZGAA 1Q44A 3IVXA 1JQ3A 1A5BB 4JT2A 2VAVA 3BZBA 4R6XA 3OF3A 4H1UA 5H16A 1RYEA 2XQGA 2W5UA 2DUJA 4HLUC 5JRJA 2PIAA 4PC1A 5F76A 3IPAA 1K6XA 3WV4A 3RTCA 1D2CA 2JGKA 3WGQA 1QAQA 1BXZA 1ZP6A 2AOXA 4RKEA 3RBZA 3V7NA 1ODKA 4H9GA 3EFHA 5CFRA 2CUTA 4TWRA 2QTVA 1FMLA 2WYIA 2IJGX 1K7XB 2QRKA 4GMXA 1LPSA 1VPDA 2JIRA 3E3LA 4LXIA 1U2PA 4PTYA 3HDTA 5E3IA 5AR1A 2OXEA 2DXIA 1L8AA 2CCJA 1O0CA 1FZTA 1TKCA 3NWPA 3FPGA 5EJ6A 3ERCA 4RQAA 2HCFA 2LCFA 3BIWA 4FMDB 2G70A 5AFSA 3P2KA 1L4GA 1RZRD 4WOBA 1GUZA 5CD1A 1XLUA 1C81A 2ORYA 4M60A 4QHYA 3IEVA 2B8JA 1AOXA 1WB4A 3HUEA 3DAFA 2QX7A 3DBRA 3KZVA 4XUEA 2RARA 4NZZA 4CIYA 2JJ2A 4W1PA 4HEHA 3SY8A 5CXXA 5KYNA 2BE7A 5IAGA 1KYTA 1MEOA 2BFCA 4F3TA 1J1UA 3AERA 2EARA 4FQ5A 1L5NA 5CK5A 1UXJA 4H7KA 4EHAA 3AY0A 2O9JA 1LK7A 2V0CA 4JVSB 1A8HA 4LY0A 3WRYA 1OYYA 3KHKA 3X1YA 4IGFA 5G4KB 3WNQA 4OXQA 4CG0A 2VSOA 1GKYA 3AL3A 5E6SA 2EJBA 3B78A 5MDHA 5P8WA 2W48A 4LGMA 3DLPX 3G0DA 4S2EA 5FUVA 3ZBTA 2DG2A 2ORIA 5JJIA 5DE3A 2BMDA 4I4LA 4KVZA 4A1OA 1ZITA 4DCSA 2GVDC 2Y1WA 4XVQA 1J2TA 2FAXA 2VJKA 3L4BA 3WI7A 2JH8A 4CUKA 3HC7A 3IQIX 4F4UA 2PZEA 1QCDA 2KHZA 4KDFA 5EQTA 4HNRA 4BUJA 5A0VA 5K0FA 1Y4DE 2B69A 1CY4A 2XB6A 1P6QA 5JAUA 4TRNA 1A9YA 2AR7A 3RFXA 4C5BA 5JZ9A 2VXOA 3TDNA 4S24A 2DR2A 2X2PA 1X3LA 2EBUA 3QVGB 4W7HA 4IGEA 1G8AA 2FPKA 2V55B 1E2JA 2AL7A 4RJKA 3TBKA 4ES6A 1J8FA 3USZA 4GOJA 1VE1A 5BUQA 3TNYA 4Y9TA 2VRWA 4M54A 4C4SA 3QJ5A 1YB6A 2WOJA 4Z0TA 2VT6A 2PKRA 4LWQA 3T06B 2RAPA 1UFOA 5DNEA 4OOEA 1XPOA 2HPVA 1XAIA 1YTLA 2CVZA 2QLFA 2UZ0A 2WJJA 2WYUA 4TTJA 3ZDXB 1G7RA 4I5DA 1RHRA 1ZN7A 2CLOB 2JF0A 2QXUA 1OE0A 2QE6A 2YXNA 3WQRA 2JI7A 3ELDA 1MXFA 1PR1A 3WE7A 5CT6A 4CG2A 1WCIA 2F8TA 1QGDA 1N2CB 4LRSB 3GXOA 4PC2A 4UAGA 5FBKA 5LQRA 2O8DB 3RAFC 5HGJA 2LBPA 2O2ZA 1KFJB 4KRGA 3VZPA 4WXRA 4E30A 1ZRSA 4QGAA 3RIEA 2AKAB 3HDHA 3FLAA 1ZAYA 1NURA 4X1KA 3V46A 1Y5MA 2PUBA 1WVGA 1H9AA 2GAAA 3UGKA 1ONOA 3FZQA 4LVOA 1IG3A 1Y4AE 4LOLA 1SUIA 2YV5A 3OE7D 3PYXA 1VYVA 4U2EA 4EG8A 3UMMA 3P9QA 1Y98A 1CEXA 1GPAA 2GZHA 2ODAA 1B0PA 4C3VA 1EP1B 1UM9A 1KS2A 3UMRA 4LJ7A 1Z33A 3KDAA 3LPLA 4LQ4A 3D4LA 2ODBA 4PAOA 3MA0A 1DIBA 3HNPA 1EAYA 4G0QA 2WAAA 2XOKA 3NNDA 4L15A 4FHEA 4Q1BA 3RSOA 4YTEA 3SJZA 1KP2A 1QHXA 3GRCA 1G2OA 1NDQA 1CR2A 4EGFA 4I6EA 4C0WA 1CQZA 4AY4A 4AO7A 2PBRA 3ZK7A 1ZM3A 4QPCA 2WF9A 4IIBA 3D4IA 5ALYA 3I9V1 3QLVC 2FSGA 1SBNE 1NM5C 3HJFA 3C70A 3CW8X 1ZPDA 2GCEA 3LWDA 4URUR 1MO6A 3K5IA 5E4TA 5DHFA 3T4PA 1OXMA 4RD0A 5B6PA 4M7RA 1QUFA 1Y8CA 5L4SA 5L3VA 1IHPA 2XNKA 1UDCA 4BAGA 3OBBA 1GLGA 2O8NA 3EFOB 4FFMA 4TV8A 3AK4A 3EAGA 3W5CA 3O73A 4UPEA 2F3QA 4TRRA 1P80A 4UCQA 2JHFA 2X5JO 1DC6A 3P5SA 4EQ6A 4TOIA 2NZJA 1F1BA 2VFAA 2B83A 4N8EA 3MOSA 5FQOA 1E9CA 5ALIA 1YRBA 3T61A 2HMSA 1WD7A 3CSDA 3F8WA 4YAGA 1FRQA 2CFIA 4S0XA 1CZOA 2YY7A 1SU6A 1L7QA 1ZBDA 1CRWG 3A3PA 1C4WA 1XZKA 2HIGA 3OCYA 3PC8A 4HN9A 4DGQA 4HAUA 2HHCA 4XVRA 2B1IA 3M5PA 4XPZA 1Q7EA 1I32A 2Z3VA 2VQEB 3CUUA 4PNZA 1THMA 3FETA 4JJEA 2XW6A 1XRJA 2YVUA 4H1HA 4WKGA 4CR7A 2A1IA 4XJXA 2OGWA 4D3SA 5J58A 2P5YA 4R40A 4ZVTA 3H6KA 4J8PA 3C3AA 3C6XA 4UZFA 3FFAA 4X3CA 2WB2A 2BFEA 2IZZA 5EYPA 4CT0A 3D3KA 2QXYA 4C4YA 4I50F 1EVJA 5FNVF 5ICFA 5E0KB 2FZEA 4XWOA 2XJ9A 3D59A 3GN1A 2DUUA 1NUAA 2H29A 2W2PA 4QYXA 1H65A 1T36B 4KQ9A 5DMHA 4G2NA 3RGGA 2O05A 1RXYA 1SN7A 3Q9NA 4WESA 5DHTA 2VPPA 5DK4A 2G07A 2G09A 1IB6A 3PCXA 5A06A 3GLGA 5HJ7A 5KYWA 3F78A 3OZWA 2BRUA 3QXCA 4Y6PA 3SKYA 3AJEA 1NRIA 2ZBEA 4CCYA 4Y2SA 1A9TA 3AIMA 4RLFA 3ST7A 3ZU5A 1KY4A 1GTMA 1QGOA 3NT2A 1V5IA 4IPTA 4N3CA 4NQRA 5C8YA 4DSZA 4OB6A 3OFNA 5HIIA 1E99A 5FLYA 4FC6A 3U81A 4YPOA 4EG0A 1D5WA 3EWAA 3HCNA 1RKXA 3KRTA 4AZTA 1KEVA 5JJBA 2AQHA 1VIDA 1M34E 1P73A 2XYPA 1DFIA 4GMDA 4J0QA 4JT4A 4P7KA 3A4NA 3ICOA 4UNIA 3PQ4A 4O2LA 3IKMB 3RVDA 1U98A 3IO3A 2WTEA 3O8QB 4TMVA 1UZAA 1AMUA 5LA6B 1T6YA 1YDMA 1V5EA 2JI8A 4URYR 3F4KA 1EA5A 5A3QA 2XWSA 3LBHA 4CM5A 1DMSA 3FDIA 3JS5A 4QOSA 4RCVA 4RY2A 1T0JB 4JYCA 1EFVB 5K0GA 3C16C 4RPKA 1KBOA 4J6EA 4LRXA 4RL4A 5AOVA 1N6PA 3BRSA 2QVLA 3CGGA 4M86A 2VHYA 1KERA 3KK0A 3OSUA 4NEGA 5BR1A 5JZOA 3DP9A 3U6BA 3I5XA 3OI7A 2QRJA 3ENQA 4GLBA 2CXHA 4PS1A 4BQPA 4D6XA 3N39C 1M6VA 3NX4A 2P30A 3DWEX 3DM9B 3P45A 5SZKB 3L1IA 4WKPA 4NS1A 4TUYF 3FWYA 4RHEA 2VAPA 2IK8A 1R0RE 2EKDA 4IJKA 4MW9A 5GQSA 4EY8A 3PI6A 1ISJA 3D2BA 3EUEA 1T6ZA 2YIMA 1U8TA 3KR0A 4IV8A 4LMAA 2Y1EA 1Z0UA 4RVOA 3ZWBA 1SBTA 4JLKA 4E0BA 1R0KA 4GG1A 4YDHB 5KYXB 1AV6A 3O74A 3RRZA 2LVBA 1M74A 2FG5A 2V6JA 4UZSA 3QU9A 3AT1A 5CLJA 1HK7A 2WIKA 3DUFB 4BTEA 1NYQA 3H8VA 4QM7A 1WEHA 5LNK1 3SZMA 4FYXA 1QVVA 2Z6UA 4O6VA 4R81A 2D2VA 1VJDA 3SZLA 2V7GA 3C1TA 2IYWA 3LO5A 4IO0A 1G291 2QQ5A 3S2EA 4BO9A 4EIWA 2C61A 5CCBA 4HDOB 4AJHA 1ZCJA 2JCVA 2IP4A 4AUMA 3T5PA 1W4CA 3W9YA 1ISFA 3ZKWB 3QPVA 2ASVA 4LUCA 5JECA 16PKA 1J0DA 3CEPB 1NJFA 2QLJA 4MPPA 4Q18A 4WWHA 3ANXA 4O4JB 3M83A 2NUAA 3ZW7A 2D13A 2WTXA 2Q9UA 4BCDA 5CEEA 5I8PA 5IDWA 2PJRA 4YAWA 1YVEI 3F3MA 4B2IA 4ARBA 4DZTA 3LW7A 4AWBA 1THGA 3CZAA 4JBXA 3JQCA 2EZ8A 3PUYA 3K72B 3C5HA 2FJ0A 3N0XA 3QUSA 3T34A 3UXMA 4JLBA 3LKVA 3RFVA 3S7ZA 4HLDA 2WIJA 1ODIA 4MROA 1NVKA 4EPRA 2VWQA 3LQ1A 1DXYA 1E6LA 4A6PA 5JARA 5GY7A 4ZYWA 4L9SA 2VDPB 4DKXA 4EYKA 1QQAA 1XALA 3S28A 4JI4B 1SXHA 3BK7A 3JZAA 3K9QO 4B7UA 5DNWA 3ZH9B 1UC8A 1D3AA 1Y4SA 3HG7A 3FN4A 2W6MA 2ZRIA 2GHIA 4YRBA 1M5RA 1NPDA 4MP6A 1U1DA 2DJIA 3K8OE