1T2DA

Plasmodium falciparum lactate dehydrogenase complexed with nad+ and oxalate
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
315
structure length
315
Chain Sequence
b'APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 122
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2dA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t2dA02
4OXYA 1PL8A 1H6BA 2ZJ1A 3HQ4O 3D3EA 2V6MA 3NT5A 1GEGA 4BB5A 4K1LA 3IJPA 2Q1TA 1HEUA 1W8DA 4K6CA 1X14A 3PEFA 4CMEC 4EW6A 3EZLA 2YW9A 2XPCA 3T7EA 3BHJA 4MKXA 4PLHA 2GN4A 4PLYA 3CPSA 4OL9A 3ST7A 2DUWA 5IXYA 3WGTA 3AOEC 2EV9A 4LCJA 4PLZA 1ZIDA 1LQUA 2WSBA 5IDYA 2VZ0A 3ZHXA 4BO1A 4BNFA 1DIRA 2C82A 1PJQA 4R1SA 1XG5A 4UEKA 4AJPA 3VHRA 3WXBA 1UR5A 5MDHA 2PD4A 1DIHA 3VPSA 1PJ2A 4OJNA 4RZHA 4Z0HO 2IODA 2XOXA 4HXYA 4B79A 5TQVA 3ADOA 1HYEA 1GADO 4FJ2A 1WDKA 1K2WA 4EZBA 1IUKA 1BWSA 3F5QA 2PD6A 2WJPA 1MLDA 2PGDA 3BIOA 3OIGA 3GMSA 3RC7A 3WLEA 1JA9A 3RC2A 4OXNA 5AOVA 2RBEA 3I9MA 3ICPA 5GZ6A 2QHXA 4ZN6A 1M2WA 3BTSA 4LSMA 5A3JA 3VDQA 1M6WA 1YBVA 2ZB3A 5B4TA 2HAEA 2D5CA 2LDBA 5IZCA 1VJ0A 2EKLA 4H7PA 1KC3A 2I3GA 4CLHA 3ZV3A 1K5HA 4XJTA 4LMPA 4ONEA 4XQCA 5CPFA 3I3OA 3M6IA 5F1OA 2HQ1A 1NNUA 4WEOA 5C7IO 4E5NA 1VL6A 3HNPA 1VJ1A 4CM1A 3E8XA 1HF3A 4GPD1 4WLUA 5DBIA 4L4SA 4YT5A 5CG2A 4CQLA 1PGPA 3NDJA 1LSUA 1A9ZA 2P4HX 2F1KA 3IQDB 3K9QO 2BFPA 3D3WA 3KBOA 1ZSYA 3G79A 3MWDB 1HDGO 2GGSA 4P4LA 1U5CA 3I52A 4EDFA 4L76A 1NYTA 3U3XA 4JIGA 5G0TA 4DGSA 3WQRA 4F3YA 4W7IA 3JQ9A 4K9DA 4JP3A 5GZ1A 1E3JA 2NVUB 1QP8A 4PZCA 4CL3A 5EPOA 1PGOA 2X23A 4U7WA 1AHIA 3RC1A 4ILKA 3AY3A 3VPFA 1XKQA 3R6DA 3T7CA 3JYNA 2D59A 1UXJA 4CMHA 4DMLA 3AUTA 5L7TA 3D4OA 1LQTA 3ONFA 3OSUA 4IDBA 3ICCA 4WLOA 1I30A 1A7KA 1F06A 2CVOA 1N2SA 1J6UA 3NX4A 2NTVA 1XU9A 3RI3A 4G2NA 3RAJA 5A06A 3KSDO 1SO8A 4LCEA 4NJMA 4NK4A 1V0JA 4CLXA 3JD0A 4YBZA 4P38A 4ND4A 3JYQA 2VQ3A 4QQRA 3U4DA 1NAHA 4BO7A 2QYTA 1KBZA 2EGGA 4ALKA 1IY8A 2O23A 5B1YA 3BMQA 2IRWA 3WYEA 1LDBA 3DZJA 3H9QA 1QLJA 4CV2A 1NVMB 3B20A 3EGOA 2Q1SA 4CQMD 5U9CA 3MCVA 4R5MA 4WLEA 4A7PA 1G1AA 3H8VA 2EG9A 1DRVA 1ID1A 2CUKA 4PCVA 4J0EA 3ZHZA 1E7SA 2Z1NA 5TNXA 2NTJA 5DCUA 3S2IA 1GZ3A 4PN3A 1H9BA 3OP4A 3ADPA 1Q2XA 5BSHA 4DLAA 1HDZA 5DNAA 4Z0TA 1YQDA 3KETA 1DFHA 3GUCA 4XR4A 1MFPA 1ML3A 1ZMOA 3WDSA 1C1DB 4XB1A 1UZNA 3RUHA 5JDCA 1K3TA 3EHEA 1K6IA 2Q2QA 2R6JA 1QYDA 4BNMA 4BB6A 4NDNE 2AEJA 1ONOA 1ZNQO 4B3HA 3ZZNA 3FNEA 1PZEA 4R5HA 1GQ2A 3L4SO 1BHSA 1E1NA 1S6YA 3BA1A 3PDJA 1OI7A 4FN4A 1VLLA 1AGNA 1DAPA 4M1QA 1NQAO 2H63A 2JFGA 2CVQA 2VUTA 1QYCA 4W99A 1KEWA 3H65A 4AJJA 1LRKA 2VTEA 1ZH8A 3BZUA 3CUKA 4CMGA 4GBJA 1FDWA 4AVYA 1A4IA 2B36A 1VPDA 5JCJD 1KVUA 5LDGA 3HG7A 3I4FA 1QXSA 4IZIA 1UJMA 1ENYA 1IB6A 1PQWA 2X5OA 4K6FA 3HJAA 5TSDA 3U09A 1ISFA 2Y0DA 3NJ8A 1X15A 3DBHA 5KOIA 5IG2A 3IDSA 4IBOA 3TSCA 3LYLA 2W2KB 2CZCA 1P3DA 4CUJA 1DXYA 4FPXA 2FZEA 3DONA 1M66A 2BI7A 2GRAA 1VC2A 4P4NA 4CM4A 1DC3A 3TOZA 4GL4A 3JD3A 1PQUA 4QEDA 5THQA 3WS7A 3C1OA 5KJEA 4PLTA 2X86A 4BO9A 1CRWG 4PG8A 3ITKA 1V35A 3JYOA 4WLNA 5KJFA 4XQGA 1MGOA 2PKRA 4GMFA 1DLIA 4ZVVA 1SOVA 4L9RA 5F5NA 4OO3A 1PZGA 3H3FA 3LT0A 5L9AA 1WMBA 2CVZA 4ALMA 4Z3KA 2HMTA 5KVCA 3C1TA 4Y98A 1KEUA 1FDUA 4IM7A 3DZHA 5GZ3A 2QW8A 3C7DB 4LRTB 2C20A 3T4EA 2YHIB 3RBVA 5CFZA 4B4WA 4WECA 2ZIZA 3BAZA 5F1PA 4YXFA 3GEMA 4BNIA 2CDAA 2ZCUA 4OQYA 4IDFA 5TRTA 1SEVA 2DTDA 2EJWA 5C7LO 1E1MA 2Q1WA 5TIIA 2Q4EA 3GNSA 3UOGA 2FZWA 3WGOA 3PFFA 4A73A 5C5IA 5L4NA 3GVXA 2VUSA 4LVCA 3QA9A 1J4AA 2VWQA 1QSGA 4I1IA 4RZIA 4CQLB 5JXWA 2AE2A 1E7MA 2NVBA 3PTZA 2BFMA 3AFMA 4MVJG 1F14A 4YCAA 4DLLA 1ONPA 1FMCA 1HYGA 1ZSNA 3D3WB 3WGIA 2X9GA 4YQZA 1P74A 3FNGA 4YT2A 2Q1UA 5TF4A 1YDWA 3H5RA 4M89A 1IYZA 1JQBA 3I6QA 4BNXA 4B3IA 3BYZA 5L40A 1C1XB 1T2CA 2I9PA 3GHHA 3QVTA 3LC7O 2FMUA 4DTIA 3GFGA 1BGVA 1T1SA 3E48A 3F5SA 3VVBA 1D7OA 2IYPA 2NV6A 4AICA 5CG1A 3BMOA 4XIYA 1Q0LA 2AHRA 3HUDA 2DC1A 3KLMX 3OIDA 1DRWA 4FDAA 2WTBA 4IMPA 4W9NC 4IY1A 3O38A 4E2ZA 4TRMA 2HU2A 1E1LA 3GVCA 3WJ7A 4OKNA 2RHRA 1LLDA 5AXDA 1YQGA 3VKVA 1KVTA 1XCBA 4J90A 2BGMA 4CLRA 4ZICA 3I9NA 1B0AA 2J5KA 3GNQA 1T1RA 5ICMA 1LDNA 4JP2A 3PQDA 4QXMA 3AM3A 4BV9A 5LCXA 3GEDA 3UCXA 3PHHA 4RQTA 5CHEA 2DFVA 2DQ4A 5HA5A 3WGYA 2TMDA 2X6TA 5DT9A 5L45A 4PLPA 2DU8A 5TT1A 3ZWOA 2GSDA 3V2HA 5IAAA 5G0SA 1PS9A 4Y9DA 1JKJA 5IFLA 4G81A 2E6UX 3GDGA 3NTQA 4BKPA 4LSWA 4R4JA 1ORRA 3IKVA 4ZA2A 2YV1A 1H6AA 3RQSA 4CMEA 1H9AA 4JGBA 4NJOA 3DOCA 5AVOA 3PHJA 5IN5A 1ARZA 4WPGA 1CQJA 4RPKA 3GGOA 4OGWA 3AOEA 3DL2A 2GO1A 3DO5A 3ZN2A 5KIAA 3FBTA 4J91A 4Q3NA 2HRZA 4E2XA 4J7XA 1UXHA 4GKBA 3P7MA 3RFTA 1H2BA 2JHGA 5JY1A 4PLFA 2E48A 1EFKA 4PGFA 4MP6A 1JKIA 3QWFA 1U5AA 4AJOA 5TLSA 2QZZA 1HSZA 2IZ0A 2P91A 2ZTVA 3VDRA 3QVOA 2JD0A 4OIMA 2WMDA 3INTA 3QWBA 1ZZEA 3UFXA 4AJLA 4YJHA 3KXDA 5TS3A 1XQ1A 4J4TA 1ZXBA 4NHEA 3JQ7A 4BNJA 2E82A 1E3IA 3OQ1A 5JW6A 3HSKA 1F12A 3W6UA 4YRBA 1F8FA 1GAEO 3PRJA 5K0ZA 1X7HA 1DC6A 3NGLA 4BO4A 4DWVA 1MG5A 1TXGA 4EGFA 1H93A 4BNVA 3WFIA 1E5QA 4HY3A 1N7HA 4I5EA 4INAA 1WMAA 2HMVA 5I7VA 3DB2A 5L4LA 5EIOA 1HE2A 3ONDA 1GUZA 3QWAA 3RVDA 3PLNA 3W4IA 2Y67A 3INRA 2B35A 2VZ8A 1IPEA 1FK8A 1R16A 4NPCA 1N1GA 3DR3A 3VZSA 4R16A 1XLTA 1BXGA 1DRUA 1ZVMA 4J1NA 3ZV5A 2G1UA 3Q3CA 4YAIA 1HDXA 2EJVA 3P19A 3DBHB 1JW9B 3ZWAA 4Q39A 2G0TA 3MWEB 3S2EA 3HFGA 4NBUA 4FFRA 4K26A 2Y1OA 4YDRA 1YB1A 3RFXA 4KUGA 1CQIA 3ABIA 4MJLA 1IZ0A 3QY9A 3S2FA 3VH4A 2PZMA 4J1QA 1MC4A 3JQ8A 5J23A 1UXKA 4CM4B 1R15A 3OJEA 4RPHA 1Y1PA 2HMWA 4GAEA 4XGKA 1X1TA 1HLDA 4II3A 2AG5A 1A5ZA 2X0IA 3X2EA 4W6ZA 4JN6B 1TA4A 4E5MA 4U8GA 3U4HA 3GZNA 5TJ9A 1PGNA 3W1VA 3RSHA 1NFFA 1EDZA 1KERA 3MTJA 1R6DA 3ZWNA 2QX7A 3EZYA 1IE3A 2I6TA 2PZKA 2X58A 2HCTA 3RD5A 2DVMA 3W6ZA 1Q7BA 5L7WA 1C0KA 3O8QA 3JQ6A 4XDYA 5EQDA 2DAPA 2LDXA 3RUDA 4FIZA 4I5FA 1X13A 4GKVA 1CJCA 4XZ3A 1Y7TA 3U9LA 4CM3A 3EC7A 1PJ3A 4UVDA 3LU1A 1QKIA 3G0OA 1A4UA 4E6PA 1ISMA 1LXCA 1WDMA 4MOWA 2E4AA 2A94A 3CH6A 2Q99A 4FCCA 3DQPA 3PHLA 3I6IA 1I2ZA 1PGQA 5BT9A 4AFNA 1YVEI 3MJEA 4N18A 3ON5A 4Q3AA 4UVHA 3WJAA 4R3NA 3H9EO 3G1UA 5ES3A 3A1NA 1PZFA 3SX2A 1U7TA 1I8TA 1G0OA 2WWRA 3F1LA 3NAQA 3E1KA 3C3XA 2C07A 3STHA 3GMDA 4DA9A 4BNYA 2ZCVA 5I7FA 4WCFB 3H9UA 4PG4A 1R4MB 2FSSA 3U0BA 4BKOA 3WNQA 3UKOA 3OA0A 4RDIA 4O0LA 2WM3A 1LLCA 3JQFC 4FFPA 3VPGA 1NHWA 1IULA 2DLDA 1GUYA 3N58A 4ZQBA 3DFZA 4U6QA 5EERA 3G49A 3N7UA 4N5NA 2EW8A 4OH1A 4JJIA 3FD8A 3QE3A 2H5LA 2GPTA 4J9UE 2NUAA 4Y67A 1EVIA 4WLVA 9LDBA 2OOSA 4M86A 3BMOB 3M2PA 3UF0A 1YKFA 5A3VA 3PYMA 1SAYA 2EIHA 1MX3A 1VKNA 2HMSA 5G2OA 5EJ2A 3BMCB 3H7AA 3JQGA 3PVZA 1R0SA 4UEOA 1SCUA 4W82A 1N92A 2I99A 4RO0A 5CDUA 2Q50A 4ZGWA 1TLTA 4BNLA 4RF3A 2ZQZA 3EK2A 4UUMA 3UN1A 5KJ1A 1Y8RA 3F9IA 3K30A 3L9WA 2ZQYA 1U2DA 5KTKA 5T67A 1NP3A 2UUOA 3K2BA 3NTRA 3ZU4A 2NQTA 2OO5A 4MVJP 3E9NA 3IUPA 1HLPA 3KZVA 1NWCA 4I5GA 4CM9A 3VZPA 3FI9A 4WKGA 1LSJA 3QRWA 4IPTA 3LT2A 1I36A 2P2SA 1A7AA 4MP3A 5JFOA 3ZWYA 3ZV4A 1NFQA 4CLOB 2FPIA 2B5WA 5JMPA 4YAGA 1DB3A 4YR9A 5FWNA 4R1UA 4CQMB 5ITWA 1BVRA 1Y5MA 5G4LA 1HSOA 1I3KA 3NYWA 5FEUA 4HKTA 1PJBA 5KJCA 1WDLA 4YJGA 2NU7A 3L4BA 4R01A 4EEXA 5KJ6A 4FOSA 4HP8A 1DFIA 5CDSA 3OICA 4IJVA 1TI7A 3UUWA 2A92A 2Q4BA 4RF5A 4FFOA 1DC4A 2RH8A 3M2TA 4WOJA 1CIVA 1YONA 1R0LA 5DZSA 5EESA 3SC4A 4AJIA 4C7JA 5B4UA 2YFHA 3JQ7B 5HBRA 4YQYA 1K89A 1BMDA 2EKPA 4B4VA 1VI2A 1E3EA 3DC2A 3QVWA 4XR9A 5A05A 3CINA 3LC1O 2NWQA 2P4QA 4BNWA 3P2YA 2Y93A 3L6OO 1ZMTA 4UAGA 4ZHSA 2GF2A 3WR5A 1MV8A 5B12A 1SEPA 3SVTA 4NR0A 4JNKA 3UXYA 4XDZA 4D41A 1GQYA 4XYGA 1T24A 4UREA 3NT4A 1EK6A 4BNNA 1J0XO 4DYVA 2Q49A 1EUCA 1RYEA 4IIUA 5KVQA 2I3AA 3ENNA 1J5PA 2DTEA 1B7GO 4JK3A 4NBRA 4HWKA 5DP1A 4Z6KA 3B70A 1MUUA 1NX6A 2VTDA 1PGJA 4ITUA 4XRRA 2DBRA 4G65A 3C1AA 1DFGA 2PGJA 3DBLB 1P1JA 1YXMA 2J3KA 1MFZA 5AXAA 1ZXLA 2YDXA 1NPYA 4FR5A 3JQ8B 2PGLA 4BHTA 1E1KA 5KWEA 4X54A 4ESOA 2HDHA 2AE1A 2NM0A 4LK3A 4GWKA 3KRTA 2UAGA 1XGKA 3V1TC 1XELA 3X2FA 3FR7A 2VZ9A 3OBBA 1PJCA 1V8BA 4N5MA 1DC5A 4WNIA 4BNZA 3Q2IA 4D3DA 2V6FA 2BH9A 4IGFA 2AXQA 3ROPA 1E5LA 2VOJA 3GVIA 4MVJA 3ZWBA 5MGBA 4NFHA 1LEHA 4ND5A 4UVEA 4BO6A 5HTOA 5T57A 1TT5A 3OEYA 2DT5A 1VJTA 1CDOA 1PX0A 4W9NA 2UDPA 3F4LA 4Y6SA 4FOOA 5C3MA 4KP7A 1N7GA 3O8QB 1R12A 2AQ8A 3OQ6A 2IE0A 3HHPA 5DOZA 2DBVO 3FPCA 3CZMA 3JQBC 4RVHA 4L0QA 2NACA 4E33A 2AA3A 2VUUA 1EE9A 2VNSA 5JC1A 3BHIA 1U4SA 4R9RA 2GYYA 3QP9A 4JXKA 3VPHA 3EVNA 3I9JA 4IUYA 2WDZA 3TZQA 5IZ4A 4D0SA 4CM6A 3UCFA 2Y66A 3F1KA 4FSHA 3RBZA 4P8RA 1A9YA 4GVXA 1PTJA 4XQEA 1ZK3A 4Z0PA 4EITA 4FC7A 1XEAA 5ADHA 3SLGA 1ADBA 4YVFA 4YA6A 4XD2A 3LT4A 4IXTA 4CLEA 2H9IA 4YTEA 2NSDA 5BQFA 4J3FA 5JAZA 2B4TO 3GVPA 3HDQA 3TFOA 4J2HA 4MVJE 2EEZA 5A04A 2GN9A 4CR6A 1KVRA 4AJ2A 3GVHA 1TT7A 1XHLA 4M49A 2O4CA 4GX0A 4RORA 1XSEA 4D3FA 4M8SA 5BR7A 1H94A 2CMDA 4ALLA 2D4AA 2H6EA 4EJ0A 3FTNA 2EP5A 4CMAA 3ZU5A 3DFUA 4BL5A 4MIEA 5IDXA 2NTNA 4NK5A 2WD7A 4B7CA 2FSVA 3BMNA 2JAHA 1GCOA 1T2DA 3GA0A 3IP1A 3JQGB 4JCOA 3NDIA 2YHUA 2VWHA 2GLXA 1BW9A 3OEWA 1B26A 3LLSA 3GQVA 2TMGA 4RVGA 5JPIA 3OJFA 4NBTA 1WVGA 1WNTA 2R00C 4NBVA 2VHVA 4KTVE 5DCYA 3HDHA 1Y8RB 1VSVA 3H2SA 4JBGA 3IKTA 4OHUA 4Q3CA 2Y0CA 3NDRA 3E03A 5FI5A 3BTUA 5CEJA 2ET6A 1JKFA 5JSFA 2YY7A 5COBA 4L74A 5TGDA 1ZK0A 4GMGA 4XCVA 2JFHA 2ZB8A 1I3MA 5HM8A 3NUGA 4JX8A 1NASA 1PL6A 2ZATA 1YRLA 3WSWA 3DAFA 1PR3A 4BO0A 2I66A 4HNHA 2J6IA 4C7KA 2GERA 2CD9A 5CDYA 1K6XA 4OQZA 3GK3A 1X1EA 2V6GA 3UVEA 4CMKA 4GLOA 1HTBA 1O0SA 1TVEA 5JDIC 2O50A 4BO3A 2Y1FA 1PWZA 1EVYA 2C7VA 3FNFA 3HE3A 1ZCJA 1U1IA 2H1SA 5EMHA 4EEZA 5DBFA 5FYDA 5C37A 4EUFA 1KEVA 1Y81A 1FDTA 1HDYA 1R4NB 1W6UA 2W2LA 3O4RA 3GH3A 2W90A 1RKXA 4U0KA 4HV4A 3ULKA 3V5NA 2QG4A 5L95A 4FBGA 3WQSB 3ETEA 2X5JO 1IHXA 1S7CA 2Y99A 5L51A 4DQUA 4R1TA 2DM6A 5FF9A 2YQ5A 4K28A 4MVJH 4ZRNA 1NR7A 1XQ6A 1I01A 3OJLA 3T4XA 1Q7GA 3FF4A 3OMLA 2C5AA 2PKQO 4YPOA 1YJ8A 1Z7EA 3CIFA 2P68A 4PFJA 1E6EA 1PWXA 1AUPA 1GV0A 2QZ9A 1V9LA 4A27A 4DIFA 2EGHA 1JAYA 4XEHA 5EN4A 1Y6JA 2J3IA 3NKLA 3OIFA 3MOGA 4N54A 5A9SA 1FJHA 4S3MA 3LF2A 3GC6A 1AXEA 4B8WA 2VYND 2J8ZA 2P9EA 3V2GA 4Z9XA 2WEKA 1DJNA 3TOXA 2OP0A 4KOAA 4CV1A 1YQXA 4CL8A 2JHFA 4RF2A 3DWFA 4FGSA 3F6YA 2PD3A 4Z3DA 1Y8QA 3ANMA 2FHSA 2P9CA 3TRIA 1LLUA 1LI4A 4MVJF 1EVJA 3SJUA 1GCUA 1TT5B 3HFSA 3KOUA 2IZ1A 4J1TA 3EYWA 3PQEA 1NWHA 3AU9A 3E9QA 3FWZA 3D1LA 4E32A 5A02A 4FQ8A 4PG5A 1M6HA 1LRLA 1EQ2A 3JQDA 5BSFA 2A35A 4URFA 1H0KA 1OC2A 1QG6A 3NT2A 4B4OA 1SZJG 1EBUA 2WYWA 2V7PA 3KLPX 1L7EA 3GR6A 4F46A 4W4TA 4RVSA 4JBHA 1YWGO 2X4GA 4FFMA 1U9JA 3KYBA 4GI2A 1B2LA 4D43A 2YV3A 1EEHA 1E3WA 3HADA 5G4KA 1DHRA 1YL5A 3U62A 1YL7A 1N1EA 1I2CA 4B4UA 3AU8A 1J49A 4LISA 3GY0A 3GRKA 3GF4A 4NBWA 5T8KC 3C7CB 2ILTA 3FSRA 4IMRA 1NHGA 4FD3A 2VRBA 5HS4A 4RLSA 1BXZA 3VOSA 1I5RA 1WLYA 3AK4A 5L53A 1EQUA 3KVOA 1HE3A 1EZ4A 5A5FA 4A0SA 3ZWVA 3GDOA 1L1FA 2CNBA 3TL3A 3AOGA 1NQOA 4UUOA 1JDJA 3UICA 4RV9A 4MP8A 3OJ0A 4BMSA 3AUSA 1SBYA 4AJEA 3TJRA 1AE1A 1ZK1A 4MVJM 2ZYAA 3DHYA 2P5YA 2D2IA 1V3UA 2OBYA 5HS6A 1UAYA 3I83A 4IDGA 1U3TA 1B8UA 3H5NA 3LLVA 4AL4A 1HDRA 3TZHA 1DIGA 1IL0A 1MC5A 3BMNB 3RU7A 1EFLA 3M1AA 2C7GA 4E5PA 3QVXA 1OOEA 2FR8A 3TN7A 1ISIA 4LGVA 2BFAA 3LZ6A 4II2A 3TDKA 4IS3A 1GYRA 2YJZA 3F46A 4MKZA 4RPGA 4DBVO 3VH2A 4NJMB 3U4CA 2QRJA 3B1FA 1LTHR 1T4BA 1AXGA 4NNJA 3RBXA 2NLOA 4GGPA 4NFYA 1NTOA 1RM5A 3WTCA 4CM9D 3TPCA 3GG9A 4XYLA 4B8ZA 5IZCC 3GAFA 4YJFA 1UP6A 3DMTC 3QIVA 3TZ6A 4PZDA 2C2XA 3BMQB 1RM0A 1P31A 3DXFA 4YEDA 4E12A 1X7DA 2FOIA 2ZTUA 2Q3EA 2GR9A 3ZWPA 2I65A 1U3VA 1E6UA 2V6BA 4BUCA 2JCVA 1NAIA 3ZW8A 4U5QA 1NFRA 3VAZA 2CF6A 5CPBA 4YT8A 2EF1A 5JS6A 1SB8A 1V3TA 1BTOA 4Q3DA 1DOHA 3ZNQA 2D3TA 4Q3BA 1ISGA 4UUNA 1QYWA 2O7SA 4DUPA 3CKYA 3Q9NA 4FFLA 4BNKA 4R41A 4CMJA 4BMNA 1JWAB 1QV7A 1LX6A 4LVUA 2SCUA 1FDSA 2VN8A 5IDWA 5EQFA 4BVAA 3OH8A 4ZQHA 2QQ5A 2EHDA 3JQ9C 4HX5A 1IHYA 3WOHA 3QHAA 2QIOA 3PGXA 4FJ0A 4XKJA 4RF4A 4TRRA 3AM5A 3AI2A 2QRKA 2OP1A 5CAEA 1E3SA 4UULA 4D46A 3PJGA 4D3SA 4TSKA 4JJGA 4EJ6A 1QMGA 1KY5A 3IL2A 1UUFA 3PK0A 4R69A 1LUAA 1ZSVA 4E13A 3JQBA 4YYZA 3WQQA 3JD1A 5AXCA 3GPIA 3WG9A 1KVSA 3IAHA 3IS3A 3E9MA 2AW5A 2BI8A 4GX2A 4D42A 3HN2A 4TKMA 4R54A 3LSYA 4FC6A 3C7AA 1N9GA 3AJRA 3DZGA 3WFJA 4E2YA 3TZCA 4JLWA 1ULSA 4DREA 1H2HA 3IP3A 1BRMA 1YL6A 4CM7A 4KMSA 4UUPA 1U3UA 1JLLA 4LMRA 1PJSA 5A9SB 5TT0A 2NADA 1P77A 3K96A 1BDBA 2RCYA 3WTBA 5IDQA 1I0ZA 3EY4A 1CERA 3H3JA 4JBIA 2DKNA 1GYQA 2PK3A 2ZJ0A 4R9SA 1Q0QA 5H82A 4DMMA 2XAAA 2BD0A 1PS8A 4R3WA 5KNLA 3OHSX 1EUDA 1M67A 3MZ0A 4Y8VA 4ZJUA 4AJ1A 1ZW1A 3AUAA 2AEMA 1P1RA 2PKQP 3NTOA 3Q2KA 3QSGA 4WNCA 1T2EA 2VYVA 1KIFA 2NQ8A 3CMCO 4YAKA 2JCXA 5JE8A 5F3RA 1HL3A 3JYLA 2PA3A 4IDDA 1C3VA 3L6EA 4KQXA 1ZJZA 2PNFA 5AYVA 1PIWA 4XJSA 3F3SA 2OORA 1ENOA 1QR6A 1T4DA 4KUEA 4JROA 3OA2A 5CDTA 3KB6A 1UDCA 1RWBA 4TQGA 1TB4A 2WYUA 3R3SA 1I3LA 3PZRA 5K6AC 4E21A 4QFCA 1R0KA 2R00A 3ITDA 3D64A 3LQFA 3U5TA 2Z1MA 3EAGA 3PPIA 2O2YA 4IJKA 4NH4A 1DBVO 2ZKLA 4ZU3A 4CM5A 4J1SA 1A71A 1LSSA 5TX7A 4HFNA 4EUEA 3DOJA 1E3WB 5G4KB 1KC1A 4KTTE 1M75A 2JKVA 5G0VA 5B4VA 1NVGA 2POQX 3L77A 1BXKA 5DULA 3ZHYA 3OF2A 5BSGA 4BQPA 4NQZA 3FBGA 5CDGA 3G3EA 3EW7A 4HFMA 1ZEJA 1CETA 4DXHA 1U2GA 3LF1A 3KV3O 1I24A 4BO2A 1MB4A 2GUGA 1DO8A 3RUCA 1HYHA 2Z5LA 3SJ7A 3TQHA 3WSVA 1ZJYA 1GD1O 3O9ZA 4OKIA 4E0BA 1B3RA 2IYOA 2F00A 2GZ1A 4UVGA 4XYEA 3TL2A 3JD2A 2G5CA 3VH1A 1DHTA 3OQBA 1IOLA 1Z7BA 1Y9EA 2OGUA 2WYVA 3AFNA 3C8MA 4IIVA 3WX0A 2D1YA 2B37A 5LDHA 1ULUA 3ETDA 3KEOA 5JDIA 1U3WA 4XX0A 4J0FA 3NJ4A 3VH3A 4R51A 1LDEA 2Y0EA 4EBFA 1W4ZA 4ND3A 2W98A 3RU9A 2B83A 3AI1A 4AG3A 4CLRB 1UDBA 7ADHA 1U8FO 1YH3A 3LT1A 3WWZA 3W8FA 2C0CA 3V1YA 3KTDA 1EMDA 4WGGA 4IGEA 3P2OA 3ENKA 4HFRA 5JAIA 4PVCA 2GZ3A 2IEBA 4YRDA 4P4GA 4ZQEA 3PJEA 4WEQA 2X8LA 1E77A 3DDNA 2HLPA 5AQ1A 2B69A 1YS4A 1UZLA 4YJFB 1ADGA 4IS2A 3WIEA 3AM4A 3PI7A 2VRCA 3VPXA 5JCXA 5KKAA 3GAZA 1ZEMA 5A9TA 2HRBA 2X7HA 2NU8A 1LJ8A 4B7XA 1Q1NA 4YWJA 1U28A 2O3JA 3OECA 4U6SA 4KDFA 2PZLA 4IQ8A 3GGPA 5F21A 1SC6A 4PIVA 2X0NA 4BNHA 1ZK2A 4TRNA 3O26A 5JAQA 1ADFA 1O5IA 3AI3A 1DAOA 1K0UA 2C54A 3GT0A 4MPDA 3KSUA 1M76A 4QSMA 1X0VA 2EW2A 1P1FA 5COAA 4E30A 4WASA 4RVDA 4F6CA 2ZB4A 4WCFC 3LVFO 2W2LD 2BKAA 4I08A 4QX6A 4BKRA 3K92A 1Z45A 1GDHA 3DAPA 1OAAA 1H6CA 4YJHB 1KS9A 3H9JA 1YE3A 1BVUA 4PLGA 3VZQA 3COSA 1JVSA 1X7GA 4MO2A 4J49A 1VE9A 3JQAA 3AUUA 4QUKA 3TZKA 4LN1A 4U0JA 4YRAA 2DBZA 4MVJI 4Y6RA 3WLFA 2CFCA 1LC0A 3JSAA 3LK7A 3MJSA 3C24A 5EL0A 2NU6A 5C7OO 1WXDA 4E3ZA 3ONEA 4J43A 2P9GA 2JD2A 3RJ9A 1HT0A 2O4UX 4XRGA 3K8ZA 3RKRA 4BNGA 1EVZA 3Q1LA 1HE5A 4IJWA 5I9MA 1T2AA 4E31A 4UVIA 6LDHA 4NIMA 3VZRA 1BXGB 1UXGA 3K73O 2AG8A 4I9UA 3FN4A 1JN0A 1N9GB 3MJVA 4O5OA 1B8PA 5T8KA 3B1KA 3EUWA 1YB5A 1QORA 2Y1DA 3ORFA 3KO8A 4IDCA 1XYGA 3DOOA 1GV1A 1QLHA 3PDUA 5H81A 1WZIA 1AHHA 2GD1O 5F5LA 1Z73A 3S55A 3GLQA 2PV7A 2Y1GA 1XDWA 1UP7A 4OSPA 2HK8A 3B6ZA 1LDYA 3RUIA 1UP4A 1I33A 2W2KA 3CEAA 2Q2VA 3GZNB 1F8GA 5JBIA 1DSSG 1MG0A 4HFJA 3AY7A 4M55A 3MTGA 1UAGA 4OMUA 4I9NA 4FFNA 1PSDA 2BGKA 3FRJA 3VTFA 3HB4X 3V1UA 2XXJA 3GZ4A 3PWKA 4GLLA 4WJZA 1U7HA 4BO5A 2V65A 3OFSA 3NRCA 3JCZA 1ENPA 3PWSA 2GN8A 5ICSA 2JD1A 1HETA 3TWOA 1E0DA 5ILOA 1G6KA 2UVDA 1WPQA 3G1TA 2D0IA 4AJKA 4NU5A 4ZD6A 1GR0A 1V3VA 2J5RA 3E5MA 4J4HA 1YB4A 1Z74A 4KWHA 4XIJA 4XYBA 3RC9A 3D7LA 4QO7A 3WYBA 2Y05A 1HXHA 4NMHA 3PFWO 3H6KA 3WICA 2YZ7A 5TJHA 4O6VA 3DAGA 3I4CA 3DZKA 4J7UA 3SLKA 3ZDFA 5IN4A 2OXIA 2YHIA 4GGOA 3OETA 3DMTA 3PJDA 5AXBA 1QYVA 2C2YA 5JYEA 1RM3A 2PR2A 3WMXA 3MEQA 5I8WA 3I9KA 4DL9A 4PZEA 1K6JA 4L4RA 4OAQA 4RGBA 1KY4A 1YBMA 3K6JA 4MDHA 1RYDA 5K9ZA 4GSLA 3EVTA 1GZ4A 4OOFA 1MXHA 5LC1A 3S8MA 2G76A 3R3JA 1N8KA 2FWMX 4XWYA 5FFFA 1QRRA 3KM0A 3VC7A 4EUHA 1NBOA 2UUPA 2Y1CA 3E5RA 3I23A 5ER6A 4PRKA 2I76A 1KOLA 1G0NA 2ZB7A 1JWBB 1MP0A 2CY0A 2BELA 1LA2A 3IJRA 2PWZA 3FR8A 1JAXA 3VTZA 1GPJA 2C29D 4WK6A 4F45A 4CUKA 1O8CA 2EWMA 1C1XA 3R1IA 4O59O 3L07A 4DBZA 5GMOA 3H9GA 3M1LA 4GWGA 1VL0A 2HJRA 3DHEA 4GVLA 1DJQA 5I8ZA 2ZYDA 3AY6A 5I7SA 3SBOA 1WAMA 1A72A 1D1SA 2OUIA 1NXQA 1ZO8A 3Q0EA 4AJNA 2EP7A 4RLHA 2X22A 4D7AA 3ROQA 4E2WA 2VWPA 3FWNA 3NGXA 4JQCA 1ISHA 1JTVA 1P1KA 4MIOA 4IQ0A 3ANNA 3MOIA 1B3BA 4M87A 2NNLD 3H4VA 4ZQGA 1B14A 5TC4A 3ZWXA 4E5KA 1GFSA 3D5TA 1GPDG 1R66A 3ZWWA 2HSDA 3U4IA 3HB5X 1GYPA 1Q0HA 4BV8A 4DIBA 1BSVA 3RASA 1C0IA 2DTXA 3WGGA 2O48X 3CXRA 2YDYA 1E7YA 2O3TA 3RIHA 4JJFA 4OM8A 4ROSA 3U49A 4NI5A 1NPDA 3PIIA 3FCOA 4PLCA 1H5QA 4YJGB 3RJ5A 4BIIA 3CZRA 3HDYA 4TZTA 1Z75A 1ONNA 2X0JA 4A10A 2B4QA 4GX5A 1YO6A 5A03A 4XGNA 5G0UA 1LDMA 1GUFA 5U4QA 3QQPA 4QO8A 2UYYA 5HWSA 5A4DA 4CR7A 5JLAA 4TKLA 3BXXA 4BGIA 3S2GA 3JQAB 3PXXA 4EYEA 3JQCA 8ADHA 1OZAA 3LC2O 2CSUA 2J3HA 1KVQA 3DZFA 1DPGA 3CMMA 1WP4A 3RCBA 4BO8A 2DFDA 3MJCA 1LLQA 2D8AA 1IPFA 2PZJA 1DLJA 3IMFA 3Q9UA 3ZNPA 4DQXA 3UH1A 1LNQA 3A9WA 3E82A 2D5AA 3PYLA 1OC4A 2WE8A 1P0CA 2VHYA 1LDGA 1VSUA 3ZHBA 2JAPA 3ZH2A 3UAGA 2FPPA 5KKCA 5K6AA 3UHAA 1HZJA 4IJUA 1MXFA 4G5HA 4HNGA 1GY8A 2OL4A 4NFSA 3GGGA 4CPDA 2OZPA 1EK5A 2ZTMA 6ADHA 3ASVA 4YB8A 1HWYA 9LDTA 3ROKA 5BNFA 2I5PO 2GDZA 3QWIA 1LBEA 4ND1A 5JY6A 3CTMA 5EINA 3SXPA 2Q2WA 2IXAA 1D4FA 5B37A 2VYVD 1F17A 1GL3A 1Z82A 1T25A 3KYCA 3PIDA 5JAMA 2G17A 2Y1EA 4KDEA 3JQFA 5CP8A 3O03A 1P1IA 4CMBA 4EJMA 4GSKA 3W8DA 4M54A 4L4XA 2HUNA 1D3AA 3ZNNA 3DZBA 4KUHA 4FS3A 2QRLA 3HZZA 2J5QA 4J2OA 3WMWA 2HK7A 4H3VA 3WBFA 4D44A 5HRUA 1NM5A 2OHXA 2EERA 1EUZA 3I9LA 1WWKA 4BNUA 3CE6A 3LDHA 5DBGA 1RM4A 2Y68A 2IZZA 3P5SA 4TVOA 4GQAA 1I2BA 2RIRA 3PHGA 1JVBA 3L4BC 3ZU3A 3KYDA 2OMEA 3RUAA 2O7QA 3BTVA 1Y5RA 2I67A 2O2SA 3K5PA 5DDIP 2E49A 5DCWA 2FRDA 1JU9A 4KZPA 1IZ9A 4L73A 2VT3A 4N5LA 4Y6PA 1SMKA 5IF3A 2Q46A 5T64A 1PJ4A 4OYRA 2BLLA 1NVTA 4TROA 4PG7A 3W4JA 4OOEA 3GHYA 1N5DA 1FXSA 3V8BA 4RPJA 1OBFO 1C0PA 2AEFA 4TWRA 1E6WA 3KUXA 4LRSB 3GG2A 3KEQA 3KSZO 2DPHA 4CMIA 5JNLA 5DP2A 4F6LA 3A28A 4UEJA 4NG5A 1AN9A 1F0YA 5THKA 4N7RA 1HRDA 3GN1A 1FF9A 1PJTA 4YAEA 3DBRA 1NPTO 4BS9A 4ALIA 3WGZA 1YOVA 4A5OA 2X9VA 2QYSA 2DPGA 2VNAA 1E7RA 4J9VA 4ZQFA 3D4NA 5U1PA 4IXWA 5I9LA 2B0JA 2GASA 2X5KO 3WGHA 4I9HA 4WCFA 1ZFNA 1R4MA 2CF5A 1P33A 2X9NA 3PQFA 1HZZA 1LU9A 3QVSA 3D5QA 2WD7B 3JYPA 4J16A 4DIOA 4CV0A 4DVJA 5BNTA 4Q3EA 4ALNA 1V6AA 3QW2A 4E4YA 2UV8A 3JTMA 5L4SA 4QT0A 1BW9B 1D1TA 1YBAA 2GCGA 2NVWA 2X0RA 3JD4A 4R68A 1E92A 3OM9A 3F47A 5G0WA 2RHCA 3S1LA 4H15A 3ROMA 4DPMA 3WNVA 2VRCD 3IOYA 4WE3A 4PLWA 4FGWA 4WOKA 1CYDA 3BMCA 1UH5A 3E6AA 4RL6A 2AQHA 1FDVA 4I5DA 4YT4A 1OMOA 5A1TA 4PG6A 4BGVA 2FY8A 3FNHA 1U8XX 4RCVA 2YYYA 1H6DA 1ADCA 3IUSA 3SC6A 5GY7A 3G17A 3OJOA 2O3SA 1UDAA 2DUUA 4BGEA 1C0LA 4RJTA 2Z95A 2DBQA 4XA8A 3VKUA 4O1MA 3R0IA 2HJSA 4DC1A 5KCZA 1CF2O 1E7QA 2FR1A 1XR3A 2GNAA 2HKIA 3RWBA 4XGIA 3TF5A 3HN7A 4CMCA 5IXSA 1O89A 5JMWA 4DYDA 4ZRMA 1B15A 1LRJA 3GRPA 3JQAD 4PVDA 4CLOA 2IXBA 2A9FA 5T6BA 3PP8A 4CQMA 3DBVO 1X0XA 1SB9A 1A27A 2JCYA 2O3RA 2VHZA 3H2ZA 4LW8A 4BGUA 4NZ9A 1P1HA 2R2GA 4W7HA 3NEPX 1UZMA 3L6DA 3K31A 4QECA 1D8AA 4GH5A 2BHLA 4DLBA 3E18A 4A03A 1ZK4A 4CLDA 3QV1A 1R37A 3DHNA 4TMFA 2NU9A 1WW8A 2G82A 1ENZA 3ZWMA 4E5YA 3A14A 1CEQA 3DEYX 1QYXA 4AJ4A 3GNTA 1SOWA 4HBGA 3QLJA 3FTPA 1RJWA 2AQKA 5H83A 3F4BA 3GEGA 4O63O 1CWUA 3PWZA 4CM8A 1DDOA 2EKQA 1W0CA 1GZ6A 1P0FA 4A26A 2JL1A 3WGQA 3GUYA 2AMFA 1GQQA 1MA0A 3H5AA 4OXKA 4MKRA 1W73A 5COQA 5JYDA 2FN7A 4DPLA 4DC0A 1VKOA 3PLRA 4RDHA 4Z9FA 4BQRA 1P9LA 4PLVA 2WE7A 2CDBA 3FHLA 4MVJD 5CEFA 2CDCA 5A9RA 4WLFA 1ZUD1 1YDEA 2W8ZA 3KYCB 3PJFA 5ER9A 5I9NA 1O6ZA 3RFVA 5JCJA 4TVBA 3D4PA 3VVCA 4RVUA 3EDMA 4PRLA 1Y8QB 2FPGA 3DBLA 4TZKA 4H16A 4YJDA 3INGA 3N74A 5ITVA 1YGYA 3IIEA 5I7EA 4GX1A 4J4BA 3PYXA 3PGJA 1ZKMA 5KVVA 3B1JA 3AW9A 3WIDA 1T2FA 3ZV6A 4D0RA 2GZ2A 1NQTA 2BFOA 5ILGA 1GEEA 5JDCC 2VWGA 4CV3A 3ASUA 3KYDB 2BGLA 3WYCA 1PU2A 1XA0A 2AQIA 4IQGA 2VYNA 2FP4A 2VOEA 4ALJA 5T5QA 2PTGA 2WD8A 4IZHA 3Q11A 2B5VA 1B16A 1EBFA 4QTZA 4IDEA 4J6FA 3RUFA 3RUEA 1Z6ZA 1PS0A 4HADA 2HK9A 1PR9A 4ND2A 3JQEA 3I9OA 4KWIA 3ZNOA 4L75A 1VRWA 2ZYGA 5BSEA 4B7UA 4CMIB 1SNYA 3DTYA 1BG6A 4YAJA 4BKUA 3IC5A 1RPNA 1GTMA 4FB5A 3BHMA 3MJTA 1E3LA 2E37A 1Y9AA 2O3QA 3GDFA 3DBRB 4B3JA 1E7WA 5JO9A 5ENVA 2BMAA 4C4OA 3L0DA 1YOVB 1SPXA 1ISJA 3DTTA 4D79A 5JC8A 1C14A 4YACA 1NQ5A 3JV7A 1PZHA 3PZBA 1GU7A 4CODB 1PEDA 2BF7A 4RPLA 1VM6A 1U4OA 2VHWA 4IINA 4J7CA 1I3NA 7MDHA 3FPLA 4XYMA 5F1KA 3ZWCA 2VT2A 4TRJA 4R1NA 3W4KA 4BNTA 1ZBQA 2YQ4A 4NU6A 5IJZA 1XU7A 2BRUA 4KQWA 4I8XA 3MJ4A 2PLAA 3I5MA 4DPKA 2NVUA 3WB9A 5L3ZA 4P22A 4A2CA 3ZW9A 3K2EA 5FI3A 4CUZA 1KYQA 2Q45A 1BDMA 1EE2A 2O3UA 3C85A 5JO0A 2PFGA 2VHXA 2YUTA 5CEEA 3W8EA 3HDJA 2GN6A 4CJXA 3TFQA 1XWFA 1HDCA 3GOHA 3AWDA 3GPDG 1DIAA 4WCDA 3GN2A 4RQUA 3KHUA 3L9XA 5A5EA 3RKUA 2HO5A 1PL7A 1O9BA 4RVFA 3RROA 1LC3A 3I1JA 3PHIA 2ZTLA 3WBBA 3Q6IA 3BTOA 4D45A 2PY6A 1YJQA 2IDZA 4MIYA 5ENDA 4AJHA 2YFQA 3ZI0A 2HMUA 2ZK7A 5L7YA 5DOVA 2YV2A 4WUVA 4Z9YA 3UCEA 1XIVA 1B8VA 2PH3A 3D0OA 4Q9NA 4MINA 4S1VA 4XB2A 4CR8A 1TEHA 3WWYA 2J3JA 2B4RO 1LSOA 2JJYA 4ID9A 2W4QA 3TNLA 1WZEA 8LDHA 1NR1A 3ZGYA 4BKQA 2IEDA 1L7DA 1QV6A 1EDOA 1O94A 3DZIA 3ZCXA 1KEPA 3ETGA 4EI2A 5BNIA 3QWHA 3A4VA 2RAFA 3DMYA 3QJ5A 2X1HA 1O95A 2VCYA 1HDOA 1KETA 3V2UA 1PJLA 2XXBA 1DIBA 1PQPA 3UGKA 2OBNA 1C1DA 1DEHA 3UW3A 5DF1A 3NV9A 1UXIA 1OFGA 2EXXA 2PH5A 1HKUA 2A4KA 4DRYA 1HE4A 1T26A 1P44A 3GFBA 4BMVA 4DQVA 2RH4A 1I10A 4BOYA 1I32A 4L8VA 4XQ9A 5DN9A 3SEFA 1R4NA 3HWRA 2FR0A 3EMKA 4FW8A 3ZU2A 4QFDA 3ANLA 4FJ1A 1Q7CA 2P5UA 2XF8A 5KVSA 3A06A 4OSOA 2C5EA 4CM8B 3CSDA 1P45A 1VL8A 2C59A 2OFPA 4IDAA 4HUJA 2JFFA
chains in the Genus database with same CATH superfamily
3TZBA 4OXYA 1PL8A 1KAGA 1WRBA 4N48A 1A9QA 1H6BA 2IYWA 2MYUA 1E0SA 3HQ4O 5K8JB 1JQAA 5I7RA 5CM9C 4LJRA 1WXEA 1EGHA 3T1HB 5A5VA 4XWOA 6REQA 1KYTA 3OT1A 1UDWA 1PNOA 4FINA 3AV0B 2BJWA 2VFAA 4MQMA 1X14A 3PEFA 4NF2A 4RD0A 5AI8A 1V6SA 4KVGA 3AJDA 1EVKA 4NU8X 3AKYA 4WESA 4XUCA 4PLHA 4Y0AA 5IAGA 5IKMA 2JATA 1VJRA 3EIUA 2DUWA 5AVKA 5J4KA 3AOEC 3KL2A 5LP6B 1Z6GA 2PS3A 3Q7TA 1D1QA 2AG1A 1ZISA 3P2JA 1XFDA 2WSBA 5LP6F 2QL6A 1FL9A 1ABBA 2ZRKA 4BO1A 4AKIA 2C82A 3MOSA 1PJQA 4OU4A 3SIPA 1AT1A 4QQNA 1AX9A 3HGTA 4PR0A 3WXBA 4FNAA 3KE8A 3VPSA 1F7UA 1PJ2A 2Q9UA 4RZHA 2IODA 2XOXA 1D9XA 3ADOA 3O3MB 1HYEA 2XWBF 3Q12A 2ODAA 5CD1A 1K2WA 3Q7EA 3OIGA 2WJPA 2PGDA 3EH2A 4WOPA 4Z5XA 3IQIX 1JA9A 4J0CA 2VSXA 2GAIA 4QNMA 5JS1A 2G4VA 4NULA 5GZ6A 2IOYA 2QHXA 3BTSA 4DCPA 3C45A 3PC8C 4I3GA 2FUNB 4L95C 5DTEA 3SJCA 5BMVB 1SELA 1XAHA 4QJIA 5BMVF 3C14C 2VDLB 3B13B 1N7JA 2HJ9A 3T9BA 1KE2A 5KB3A 3RK4A 2B61A 2ZVQX 2BBTA 2EU8A 3U3KA 4CLHA 2X2EA 4JASB 4AZ0B 2WAXA 3KELA 2B7CA 2GAOA 1GTVA 4EQ6B 5LKRA 4EG4A 1Z7YA 1THZA 1W5TA 4XJTA 1PWHA 5DCLA 5GGXA 3VOAA 5JAOA 4FS8A 4W8OA 2QIPA 4ZT2A 2OAQ1 5CPFA 3VKWA 1KSFX 4W9RA 3S5JA 3I3OA 3QX3A 1E69A 1H69A 3D5EA 4CETA 3LUGA 4IDPA 4E5NA 3AR5A 1XLTC 4AURA 2HX1A 4Z4IA 2QLBA 3K09C 4QA9A 1C1HA 1FPMA 1CB0A 3FHTA 3O9MA 1HF3A 2QTHA 3U44A 3BJZA 2FPXA 1YS2X 2VJKA 1YT5A 2GBGA 1OBVA 3MRSA 3I3SR 5HZHA 4UEWA 3M83A 4ERNA 1I1QB 2GTPA 1LSUA 5D5HA 3Q3JB 3VR6D 1X7XA 4M60A 1L1QA 2GJSA 5BQXA 3IQDB 5I5EA 1KMHB 2BFPA 2BSAA 3CEPB 1Z0SA 3LCMA 2NYUA 4YAWA 1Z68A 2H17A 2V3CC 2NO9A 5IDVA 2ZI7A 4JI1B 3T5PA 1OXBB 4LKRA 1F3OA 1A97A 4KO3S 4P4LA 1U5CA 5BOVA 2I7CA 4E5VA 4LYFA 3MINB 4EDFA 2CV1A 1P61B 3CBQA 1NYTA 4L76A 1T9KA 5J43A 3C39A 1IN5A 2PXXA 4JIGA 1KTIA 2SHKA 5GV7A 1W581 2ZIXA 5DPMA 3ZHUA 1LS6A 4I4TB 4K9DA 3AKZA 2P3LA 3UG6A 1JFLA 2IQIA 4DWWA 2GRJA 3GLUA 3O2SB 4GOMD 1KZ4A 3H4IA 3L5KA 1GRQA 5DYNA 4MCIA 3FZQA 5JRZA 1UEXC 3AY3A 4QARA 2H1WA 4C29A 2EKZA 2GM4A 3M5PA 4N65A 4MQ4A 4TV9A 4BYMA 1MJHA 4ZC1A 2X2OA 2Q5QA 2D59A 3TKAA 3G0HA 4DMLA 3ZBQA 1T35A 2FW1A 3HJCA 3OIYA 5CK4A 4OD0A 3ONFA 2CDRA 3KQVA 3Q3HA 2B99A 4JJZA 4AO6A 2OLEA 4B1FA 5F2OA 1AB6A 5ELMA 4YONB 1R9MA 3CY6A 2QRQA 3OKFA 3DLBA 3O0DA 1P7YA 1X86B 1YMUA 1SO8A 3IT2A 3QY0A 1V0JA 3Q8MA 2QTCA 2ZVPX 5JJKA 4CKZA 4MWTA 4MDYA 3C97A 5C81A 4YBZA 8AT1A 5K05A 4ND4A 4L6IA 4ETMA 1GT91 1JPJA 3JYQA 2VQ3A 4X7PA 2HXGA 4BU0A 5B3JC 1TYZA 1Z8NA 3EWNA 3I04A 1G8SA 1RI2A 2JZNA 4X95A 5KTPA 2EGGA 4RKYA 2PV0A 4RZUA 4ALKA 1JEDA 1UBEA 1INLA 3GJ8A 5B1YA 2BMFA 2GEJA 3BMQA 2IRWA 4A8PA 1LDBA 4LPKA 5BWLA 1LK7A 5BYBA 1H3FA 3V2IA 4EEKA 1QLJA 4CV2A 4AXXA 2C3YA 3A3KA 3H8VA 2OC4A 2EG9A 4QYMA 1VJDA 1DRVA 1P8AA 5J40A 5LYYA 4OX9Y 1Z39A 1THGA 1P19A 4RXUA 4YPFA 4DVGA 1LCIA 2FDXA 3GLIB 4EPWA 3WWPA 3W7VA 1E1CA 1G8PA 3WKEA 1U6KA 4NC9A 3WGJA 1OWOA 5BSHA 4DLAA 2O5CA 3N87A 4GP6A 4IHKA 1YQDA 5DNAA 4Z0TA 4BC0A 2IY8A 1DFHA 2PZBA 1K1EA 3GUCA 3HU1A 4XR4A 3WDSA 3N07A 3PEEA 3VYVA 2OCKA 3W6OA 1GM5A 1M6VB 3ZQKA 3LDFA 3RUDA 5REQB 4LF7B 4U5XA 4WNAA 1U0SY 2AI3A 4NDNE 1FRZA 4UATA 1LPNA 1YBFA 3PCRB 4BB6A 3VSCA 5KOYA 1TYAE 1NC3A 3THYA 2WMYA 3GDWA 4L72A 1ZNQO 2XAUA 4HNQA 4B3HA 1GNRA 1RJFA 1FP6A 1PZEA 1YSCA 3OIUA 1GQ2A 1M2NA 2IE8A 4FN4A 1VLLA 3IXLA 1DAPA 1SUIA 5E3IA 1NQAO 5EE0A 5GWXA 3URMA 4F1JA 2BFEB 4U3JA 1QYCA 3FUCA 4IG9A 4ZOLF 3W2TA 2B8WA 1LRKA 4L2IA 4JDPA 5KO2A 5IK2A 1C3JA 3BZUA 3CUKA 4MA5A 4Q21A 3AESA 2XWPA 1FDWA 2BPOA 3GJXC 3K6KA 1U2EA 4OXQA 2POCA 2YCLA 4MV1A 2IWRA 1XMQB 2P4SA 3BN3A 5LBIA 3BD8A 4ZCIA 5LDGA 3HG7A 3I4FA 4IZIA 4G4SP 2V5UA 1THMA 3EJWA 3RVJA 2X5OA 4P31A 2OFWA 4M0LA 1RXVA 1LI5A 4C89A 2OV3A 4DV4B 3N2GA 4LTMA 2QMUA 2Y0DA 1JHZA 4EK9A 3HYCA 3L1KA 2OM6A 8OHMA 2P2YA 5IG2A 5ECGC 3SJ7A 2PSFA 1XQWA 3PNLA 1UOPA 1R5BA 4CDNA 1TU0A 2CZCA 2VAPA 2Q6KA 2V03A 3VHQA 4LXHA 3NVKI 1WXXA 3OPNA 4P7BA 4GQBA 3DONA 1FW8A 4TLLB 1DDIA 2QLJA 2M9MA 2RGDA 3N2KA 4Y2GA 4GL4A 1L7RA 1TLLA 5THQA 2QP4A 3WS7A 5A5GA 4LXQA 1N77A 2DXIA 4MWZA 3HBFA 4ZCSA 2CHUA 3WLHA 3CLSD 4V0KA 5C1IA 4OB8A 4B40A 4BN0A 4JOBA 5HM6A 4ZFNA 1FVOA 3QI2A 3GELA 1V35A 3ITKA 3JYOA 3MLEA 4WLNA 4GZMA 2OENG 4KIUA 3TS1A 5KJFA 2O8FB 2BFDA 2P7HA 3AKCA 1NURA 1FJ2A 4GMFA 4HB3A 2K7ZA 5GVRA 3NEAA 3VHLB 1SOVA 3I2IA 3O8LA 4QXQA 5JJLA 5F5NA 1OIWA 1PZGA 2WZCA 2ZJ3A 3H3FA 4X66B 4U2CA 2CYAA 4ALMA 1M1YA 2HMTA 5SV2A 3CC8A 3OC0A 5HRCA 3RYIA 4B2YA 2R8ZA 5C80A 3EDRA 3I8SA 2GJKA 4HNUA 2QE7D 3CUSA 5FWYB 1ZW6A 4CDMA 4YLYA 2O14A 1TL7C 3TD6A 1YE5A 3D2BA 5B3LA 1X3LA 2QUBA 1Z3IX 3TTSA 2ZIZA 1L5RA 3MK31 3N2IA 2ZU6A 3TUZC 3LECA 2ZCUA 3EVAA 2QV7A 4IDFA 4OQYA 4EHJA 5JISA 4TT3D 4Z4EA 1NQWA 4MGKR 4N3CA 2II6A 5C7LO 1UK9A 3QVKA 2LCQA 4DMCA 3PEWA 2GVNA 4K9MA 4QU5A 1CR2A 3UO8B 3ZY5A 4Y9TA 2PDAA 3DBOB 3K3PA 3WGOA 1MDBA 3TSWA 1X38A 2IXFA 2O1XA 2DQSA 2VUSA 3GVXA 4LVCA 3TRJA 5A0TA 3N2EA 3QA9A 1J4AA 1RXYA 4MR8B 4ACAA 2G9NA 1YOBA 4RZIA 5I4IA 5JXWA 1E2JA 4NNOA 2PLWA 2NVBA 1S9HA 3PTZA 4DZTA 1KQFA 3R0XA 3RYHA 2DEUA 3RSCA 3AFMA 1H1LB 1SBIA 4W9MC 4OA8A 1II8B 2KSQA 1B8OA 2BGRA 5F76A 3NFRA 2VQDA 2XTNA 3C6MA 3ZKWB 1V16B 3I4LA 4M9RA 4IV5A 4YT2A 1CC1S 3ZHCA 2Q1UA 1OFIA 1E9VA 1F2TB 2FETA 2IVZA 2YCBA 3A1CA 3LK6A 3TR6A 4ZJZA 1X1AA 1W29A 3EEQA 1N5RA 2VYCA 4BNXA 1Z0FA 1DX9A 1QO7A 2NPOA 1C1XB 1G66A 2RC5A 3GRVA 1N6NA 3QVTA 5KX5B 4RADA 5KX5F 2B20A 3B1VA 1C8VB 1XQYA 2VJMA 3GFGA 3ZZUA 4YUXA 2XIJA 3F5SA 2V58A 3MGKA 2IYPA 1M1YE 4AICA 1R7RA 2HJGA 5CG1A 1A1SA 1Q0LA 2A59A 2R6HA 3BGVA 3KLMX 4XIYA 4TOIA 1E96A 2O1EA 1SA0B 3BUSA 2NSYA 5IVIA 3IE0A 3K2QA 3DTVD 5FUVA 4ZVMA 4E2ZA 1T4CB 3FCAA 4XM1A 3C70A 3R5FA 4TRMA 5DTQA 1LVGA 5IJAA 5C5DA 1EIWA 3HKBB 3WJ7A 4OKNA 5LU9A 2W83A 5AXDA 3BWMA 2OC9A 5DLEA 1DV2A 4WA7A 5E2BA 4NBSA 1RKUA 1NVUQ 2C9CA 1BKSB 3SYMA 2LIPA 1B0AA 2J5KA 3TTVA 1EBBA 1DTWB 2VNJA 2XBLA 3GNQA 2VH5R 4KPUB 1EFPB 1M0WA 3QXGA 5H9WA 2WTEA 3PQDA 4P82A 3AM3A 4ESEA 5LCXA 3GEDA 3UCXA 3V8MA 4ZI3A 4HLUA 4JJ4A 1IZZA 2NG1A 2Z3WA 2OQVA 2VUHB 2BM8A 5D3ZA 4JBYA 4HDSA 2B1RA 1X1BA 3SKVA 4CKEB 2O8BB 5L45A 5H4HA 4PLPA 4ZKEA 2OHFA 1T43A 1GGNA 4OG2A 2UYOA 3AR2A 4G01B 2DFLA 5F2KA 5TT1A 3VAYA 3LMKA 2IEAA 3EPKA 4QJ5A 4RFLA 2YVLA 1O94D 3GDGA 5K8IA 5IM4F 5LMCA 3K15A 4BKPA 2N47A 3EIXA 1N2CA 5EWLA 1MJ5A 3TNYA 2UYHA 1ORRA 3H5IA 4ZA2A 1ETUA 5KDLA 1H6AA 2HGSA 4O25A 4CMEA 1H9AA 1O95D 1G6OA 5DHRA 1YRHA 1NVAA 3SYLA 4YV0A 1FDIA 3EA5A 4RPKA 1CVRA 5AOBA 1WB9A 2GO1A 1CZOA 4X1YB 3MQ4A 4J91A 4Q3NA 1ZNZA 4G0XA 1I94B 3O82A 1QBKC 2V8OA 2XUPA 4N8DA 1UBMS 4HATA 1QHIA 1VE6A 1EFKA 4MP6A 1JKIA 1U5AA 3KXKA 4AJOA 4F97A 3MT0A 2FMTA 2QZZA 3RT1A 5DKFA 3OQPA 1P17A 2QROA 4YI5A 3LKVA 5IMSA 3PL1A 2J5XA 5AVRA 3QWBA 4AJLA 4YJHA 1D6NA 3ICVA 2G8LA 3THWB 3U4MA 1XQ1A 5AW4A 2MSNA 4KXXA 1E3IA 5D1HA 3RS2A 1MX5A 4NMLA 1OA1A 1LV7A 1M2HA 4UCQA 4BLTA 1DUVG 1FXWA 2QPAA 1EK2A 2XQKA 3NGLA 4BO4A 2YH2A 1O77A 2H1FA 4DWVA 1TXGA 2FLKA 1I9GA 2YWJA 4I1SA 1OR8A 3L7OA 5AT1A 4BNVA 1OX4A 5IASA 2RGXA 3E3OA 3VO8A 1N7HA 4I5EA 2UUBB 1I2MA 2DHCA 2RGAA 2ZI9A 5ILQA 3CZ9A 1C7FA 4EUSA 1QGYA 2O8CB 4ZANA 3NHFA 5LYJB 4GWLA 3ONDA 5EHQA 4ENUA 4BB0A 4D9HA 3QWAA 5LYJF 3CR7A 3L02A 3W4IA 2Q3CA 4YRJA 5IBCA 3EVEA 4JR1A 3INRA 3DJFA 2B35A 2VZ8A 1IPEA 4NPCA 3KKEA 2FW9A 1IXSB 1N1GA 2VPTA 3VZSA 5A6SB 4OHBA 4PS0A 1KQ3A 2C4KA 1YZ3A 1YZVA 2OCLA 5FA8A 3SQOA 3LKZA 2E87A 5FBZA 1JW9B 3E8MA 4EB6A 4F2PA 1K88A 3JAWA 3MWEB 3BWYA 4QYIB 3VV2A 1K4YA 4Q7EA 1L0BA 2C2GA 1YB1A 2Y1OA 1Q0SA 1CQIA 3CW2A 4M1WA 4YDRA 3RFXA 3TD2A 3WKCA 1JFRA 4ZQIA 5G53C 2QTZA 3CEMA 2Z58A 1R10A 4CM4B 4JLDA 1HOXA 2IEYA 2CMHA 2L2QA 4XGKA 4JBXA 1OFUX 3LP5A 1PT8A 1W4CA 2WD9A 3DMGA 3LUPA 3PXBA 2JAWA 2OLKA 4GYWA 4KPGA 4II3A 4P4SB 1GNPA 2AL7A 2X0IA 2R85A 3Q0IA 4LJ5A 3X1ZA 3NHRA 1RWVA 2WOOA 3A1DA 5TV2A 3KU1A 4X41A 2JFOA 1N9ZA 4LHXA 4U8GA 4JI5B 1YR1A 3ZE6A 4B9EA 4E5MA 1SUSA 1JRLA 1T2NA 3B5JA 3NVAA 4FU0A 1FFXB 2H06A 4RTSA 1ECPA 1NFFA 2R68A 3ZZ1A 5KQSA 4CEJB 4AK9A 4INPA 4WY8A 1MHTA 2FSFA 2QX7A 4CQNA 1V1JA 2PZKA 3NC1C 3W6ZA 1Q7BA 1SHUX 3MA0A 2J07A 4XDYA 2B2NA 2WJ6A 1XYYA 3JQ6A 5TGZA 1YZTA 4FIZA 3KWMA 3CF2A 3OZAA 1SXJC 5CX1A 2LRHA 3GA7A 1X94A 1TF7A 4TGLA 4QOHA 1IHDA 1JHOA 3C6XA 3AZQA 3OMWA 3T5MA 4A2QA 1PJ3A 4UVDA 4PYKA 1Y1LA 1QKIA 3CUTA 3G0OA 5ECDA 5CDHA 1TUGA 3DGFC 4DAOA 2A94A 4EBBA 4FCCA 1BKYA 1OWNA 3DQPA 4GU5A 3UB3A 1LWNA 5D51S 1VSQA 3HU2A 5FTWA 1I2ZA 1PGQA 3OI7A 3DEZA 5BT9A 3VBCA 4DJAA 1UFQA 3MJEA 2X77A 3SEAA 1PNQA 4N18A 1SK9A 1K7FB 1KMQA 2C42A 3S81A 1EX9A 3HKDB 3M70A 3RWMB 2VBCA 4M7WA 4UU8A 4JP8A 3SX2A 4FE4A 3KHSA 4G1VA 4F2HA 1Y6ZA 2H7CA 3E1KA 2QWXA 2C07A 2WAYA 4FHEA 4HB4A 4JYMA 3HMQA 5IH7A 1KDPA 3O93A 2YYSA 1KYVA 4D9CA 3QFCA 2VDJA 2OV6A 2JJ2D 2VLIA 1N0IA 1NJGA 3WNQA 4YMTA 4CTNA 3UKOA 1WP9A 5SICE 4YASA 4EB0A 4RDIA 4O0LA 1SIOA 1LBSA 4KYTA 3WA7A 4GUAA 4R83A 3VPGA 2RONA 4WXPA 2DLDA 2JGLA 3OEEA 5J1TB 4ZPJA 1KSHA 1UMDA 3G49A 4N5NA 4OH1A 2EW8A 2P62A 1NLUA 2H5LA 4DR2B 4Y67A 3B6JA 5DEOA 3WLKX 4D9EA 5M2QA 2Z3VA 1TZBA 5FEMA 4QQFA 3JW8A 2WSMA 1W44A 1EG7A 1JDBB 1NTRA 1JFFB 1VKNA 2HMSA 2PANA 1Z0UA 1QK3A 1ZINA 2DH6A 4BJ3A 3BMCB 4RIGA 4L5IA 3TLJA 3H7AA 4CG0A 5ES4B 3KQMA 1ODKA 4HLCA 1E60A 1VG9B 2EFGA 2AH5A 1SH7A 1KFJB 1ZJJA 1N92A 2F1JA 2I99A 2NTEA 2WU8A 3F96A 4TUYF 2Q50A 1M5TA 4E11A 5CDUA 4C4SA 3IVGA 5EXEA 4IIGA 4D5EA 1OF1A 3O6VA 2HHCA 2D62A 4EPTA 3FF1A 2WSSD 3ED1A 5J4LA 3AINA 2P2GA 1FMFA 3UKJA 2Y27A 3A9UA 2B9EA 5JT1A 3F3KA 4O08A 2PN1A 2YIVX 2ZQYA 3L9WA 1U2DA 1DTEA 1TQDA 3GLHA 2RGBA 1XZMA 3H18A 4PX9A 1QGOA 4AROA 5ITZA 2CLSA 1NP3A 2UUOA 1I6MA 3K2BA 4AZTA 5HK9A 1PV2A 1WZ2A 1SVIA 2PS1A 3O73A 3U3MA 3IUPA 1G42A 2C92A 2FYTA 5IVPA 3CE9A 3TMAA 2GPNA 4X1KA 1TEZA 1RC1A 3VZPA 3FI9A 2JVKA 1XTIA 4B43A 4B6JA 2E1RA 2AI2A 3Q87B 1J07A 2DFNA 3QRWA 4DV1B 2SBTA 3LT2A 2OBXA 1A7AA 1QVVA 2WF8A 3RLIA 3IIKA 1QHHB 1T0PA 2FPUA 2Y1WA 4C3OB 4K2AA 2KJQA 2Z2XA 1BCRB 1NE2A 2H29A 3HEMA 4U9UA 4PYMA 5K0TA 1YS9A 3GJ3A 4F21A 4MS4A 1A5AB 1BVRA 4TLDA 5G4LA 1QDEA 3JWHA 4MTLA 1RP1A 1VYHA 5BRNA 1PJBA 1WDLA 4YJGA 2H0RA 1QK5A 3WB0A 3AVPA 3EASA 4ND6A 1KFCB 4NCJA 2FXIA 4R01A 2XLBA 4FOSA 1DFIA 1MB0A 1FFDA 2IDMA 1DBWA 5AKZA 4BDTA 4A82A 4RF5A 3GD7A 2HXSA 3UFXB 1YONA 1UKZA 5EESA 3NIDB 3N8DA 2ZWMA 5HBRA 3JASA 3JY6A 1BOOA 3PNSA 1BMDA 3JWGA 4HX9A 3L93A 4B4VA 1VI2A 2Z3ZA 3G2IA 3L7BA 5A05A 3OU2A 1I5EA 2ERCA 2Q7DA 4C4ZA 3GLHE 2Y93A 3NZEA 3V34A 4R8SA 3WHLA 4L7QA 4N82A 4UAGA 3W2HA 1LK5A 2CHQA 4ZHSA 3OQMA 3Q7IA 2FQYA 2PGNA 2D3WA 2ROQA 4NR0A 3OHPA 4JNKA 4OK3A 1EWRA 2OZVA 1O54A 1TCBA 4TM8A 4H1UA 2RG7A 4YRIA 1ZCAA 4HGNA 1QRUA 2DQYA 2HF9A 5GGYA 4EAAA 1LBTA 1J0XO 2R5FA 4MJ3A 3ZIAA 2PSDA 5EJ6A 2P35A 4IIUA 5KVQA 1XAGA 4BNDB 1ULTA 1B7GO 2JEYA 1SVWA 4JHLA 2VTDA 1NX6A 4G65A 1BX3A 3DM5A 3QOYA 4NESA 1DFGA 2PGJA 1RWXA 2XNDD 5HBGA 2GCEA 4RD2A 5BNWA 2PSSA 1ZXLA 2YDXA 1NPYA 1Z15A 3JQ8B 3PNOA 4X54A 2IXDA 1YBHA 1EFVA 1WEHA 2DY0A 4R84A 2FEAA 1TKBA 3KRTA 3SICE 1L5OA 4KQ9A 3C5WP 3GXBA 3LH5A 4JNCA 1AS3A 2CWDA 2QQ0A 1G8JA 4HMOA 3OBBA 3X2FA 3H6HA 3LKBA 4OA5A 5A7GA 4WNIA 2VXOA 3PQCA 4F1KA 2WIKA 3KOMA 3W05A 4PHFA 4KXUA 3ABOB 1DU4A 2FPRA 4UVEA 2EZ9A 2NYRA 5HTOA 3UEOA 2AZMA 5GONF 5KYUA 4GC5A 4XWWA 4W9NA 2ZJ4A 3PNMA 1WSWA 3RU7A 4CTMA 4HDNB 1GSIA 4GR5A 2ZYUX 2WUEA 2O52A 3P94A 3UOWA 5C3MA 3O8QB 4DCOA 5MHTA 1FRFS 3OTIA 1JI0A 5E1BA 3CLUD 1MVNA 3RJZA 3USZA 4E70A 2PSJA 4EG0A 2DBVO 4KFTA 3LUDA 4Q05A 1HT3A 5B6PA 5CFMA 1XZKA 2ZU0C 4EGAA 4EUNA 3JQBC 2ODBA 5BUSA 1HDIA 4RVHA 1P39A 4HNRA 5FR2A 1BDJA 3GRYA 4WINA 4FDTA 1TVCA 2BR5A 3GLVA 4D6PA 4DCGA 1E79D 5TF0A 4E33A 1P2BA 5IU6A 5C4GB 5AMXA 1Y6FA 4KN6A 2GN2A 3H5OA 5SZJA 3W0LB 3D3QA 5JHHB 4JI2B 3NAGA 4ENRA 2GYYA 3AHFA 1KXJA 2HF7A 2HA3A 3RTDA 3LPLA 1CE8B 1XNQB 1JHYA 3RAGA 2IGBA 3KCQA 4FXOA 1FP4B 2ODWA 3OZ7A 4H08A 5IC4A 1RMQA 5FHRA 4CM6A 3UCFA 4TS4A 3MTQA 1T1EA 2VXYA 4LY6A 3D8SA 5L3RA 4Z0PA 4EITA 1XEAA 2X2PA 3CQ9A 2AI1A 1C3EA 3NR2A 1A8HA 4YA6A 1EP1B 5CA1B 2VDKB 3QYFA 3W9UA 3H16A 4K6KA 3KZMA 4K3VA 4Z2YA 1H2WA 1G291 2FPKA 3TECE 1T36A 5JAZA 1C9EA 3GVPA 5IAKA 3L7IA 1FA9A 1LI7A 1TJ5A 2D00A 2ECKA 2QVGA 1JHDA 1XRRA 4J2HA 4M53A 4YMUA 5I9IA 1AF4A 1FYWA 2GBFA 3ZJYA 1NI5A 1N2EA 5BYKA 1XHLA 1IXZA 4RORA 1I2AA 4RH3A 3R7AA 4AG6A 3QNMA 4D3FA 1NW9B 2GAJA 3JWJA 4MWSA 2CMDA 2NUAB 4IOJA 4ALLA 2H6EA 4UXJA 4IGKA 4ZO4A 1Z6AA 4MI3A 5EJGA 1GKLA 5FNVA 1UC5B 3R9XB 1V2HE 2WPNA 2HPZA 1Z2DA 2IS2A 4U9IS 2PWBA 3KZ1E 1OJLA 5A1JA 2FSVA 2GNPA 3BMNA 2JAHA 4Z4GA 1T2DA 4Q15A 3GA0A 3D2AA 4HJRA 4I99A 3WYNA 5HRAA 3O4GA 1G8GA 5CXSA 2W2QA 1SCUB 3LG2A 4MAFA 5EMNA 2R1VB 1T2UA 2E4ZA 2W37A 3CG0A 4HL6A 4LQCA 2I6FA 3LLSA 1O6GA 2M1XA 3IVXA 3PFIA 4I1YA 4KH1A 5JPIA 1XVTA 2Z4SA 1G7SA 1WVGA 1WNTA 2R00C 1JIKA 1KDYA 4AN1A 5ABPA 2ZZNA 2RMKA 1F2UA 1G5HA 4KTVE 5DCYA 3LUAA 3LTNC 1OFTA 4CT4B 4F38A 4A8HA 1A4RA 2C9DA 5JRJA 1PJRA 1REQA 1SOAA 2Y0CA 4BXOA 5C8YB 5JSFA 4UKDA 9ABPA 5C8YF 2JFPA 1BZYA 2FWNA 2PKCA 3PA8A 2QL5A 4CIXA 3C4QA 1DEOA 1DEKA 4L74A 4GMGA 2ZB8A 1F2DA 1NASA 4HVLA 5IAOA 1AQ6A 1PL6A 3LA8A 3AVXA 4F3NA 5AVVA 3FIUA 4EHFA 2QMYA 1U2GC 3Q7QA 4ZJYA 1W48A 3NORA 3ZWQA 4EW1A 4BO0A 2I66A 4HNHA 2J6IA 5K0JA 2Q5IA 1OWLA 2Q4DA 2QT0A 2GERA 4I2VA 1GHTA 1NU6A 1PR4A 2CD9A 5CDYA 1ZONA 1BX0A 3CGGA 3T9EA 1X1EA 1I14A 4CMKA 1JJIA 3THXB 2ZAGA 3KS9A 5JDIC 5I7AA 4BO3A 1E20A 1K27A 1Y1TA 3FNFA 4ZEVA 1ZCJA 1U1IA 3TFOA 1OHHD 2QGZA 2WUWE 2I7XA 4GI3A 3TQOA 1QZXA 1YUNA 5D8DA 1D9ZA 1QOZA 4INJA 2EQBA 4FFDA 2WSYB 2GXUA 4EG8A 1CUJA 4BFTA 1R4NB 3AERB 2BHTA 2A8YA 3QUAA 1WHTB 3TQFA 5J1SB 4A91A 1DC7A 2R11A 3GH3A 2W90A 4U0KA 3OO1A 2QG4A 3HNOA 3V8VA 1GJRA 3ETEA 1FTWA 1MEJA 2AZDA 3OZUA 4K03A 4OI4A 4OQDA 4Q7QA 3WVNA 3TBHA 2FG7C 3FE2A 2R66A 5FPQA 4JI3B 2YQ5A 2UZ0A 2CEAA 2J46A 3GEEA 4K28A 4ZRNA 1NR7A 4AQ7A 4PM4A 2H0QA 5SZKB 1N2XA 3WIOA 5IT4A 5AM5A 1RXIA 3EQ6A 3OMLA 1T3HA 2FW7A 2AKAB 3DXXA 4ANFA 4WXRA 4DCCA 1KR2A 3OZXA 1EUCB 1Z7EA 2HBYA 4C06A 3MWLA 4PFJA 1PWXA 1AUPA 1GV0A 2QZ9A 3QVGB 5DLDA 2JK0A 1GLVA 1ZN2A 3NI2A 2ECQA 2EGHA 4IQFA 5THXA 1ZHOA 2NUPB 3R74A 4XEHA 7REQB 1A82A 2I7DA 4EP1A 4UQOA 1YACA 1S5PA 3KEFA 1KZ9A 3R7WB 2GSWA 3HVIA 3NKLA 3OIFA 3MOGA 4N54A 1A77A 1FJHA 2EGUA 2YFYA 3RREA 1SJ9A 4CIBA 1I0IA 3GC6A 5IBQA 4AKHA 3ZVMA 2Y2VA 10MHA 4JU9A 3EUAA 4XE5A 4K0KB 1U04A 1G98A 2WEKA 3EAFA 3HKEB 1DJNA 1WKBA 5JH7B 4KOAA 1Y6QA 4GBGA 3MWGA 4IO0A 5JH7F 1JIUA 1B6GA 1KDRA 4UBNA 2DYKA 4CL8A 2IGTA 2XUFA 3HZOA 2AOXA 2G1PA 1KWKA 4PYLA 4UD6A 3FUWA 3VTKA 3FH0A 4N0MA 1SRQA 2BJVA 1ATIA 3ANMA 2ZRFA 3L0BA 4YY3B 2QM0A 3DYVA 2FHSA 1IQRA 2OAP1 4L0MA 2IHYA 2XADA 5CU7A 3PSHA 2GYUA 2HCBA 1TVKA 1TAUA 1EVJA 2PUVA 4IEFB 4MV6A 2AOUA 3PGMA 3ZLVA 3EFOA 2HDOA 5F3DA 1RP7A 3EYWA 4ZAZA 5IARA 1NWHA 5A02A 3GBVA 1V9CA 4E32A 3FWHA 4Q1DA 2FUG6 2AFHB 5ERYA 2QVLA 1VSTA 4HEQA 4O4HA 3KQLA 2GM9A 1GKYA 1U2QA 4YYEA 5GVSA 4C9BA 3IA7A 1XU4A 4P83A 3ICWA 5A9RA 4GEKA 2VVTA 3QTBA 1DTSA 3E05A 1L7EA 1MPTA 1FP2A 3FROA 2P1DA 3A4MA 1A2KC 2PMBA 3W2IA 2GJ4A 4UBIA 1G8AA 4EVIA 3DO8A 2OV1A 2LR0A 4WXEA 2O2DA 1ECBA 4R2IA 4GI2A 1IY1A 2YV3A 2JFVA 3UENA 1B73A 2A1UB 1DHRA 1YL5A 4HZUA 1XXHB 1GGVA 3AU8A 2VKTA 2WJAA 5E0KB 3GRKA 3KT3A 3EPRA 3MS4A 4NBWA 4WZ6A 3ZEAA 4JR0A 1G55A 1W7AA 3FSRA 4KQMA 2VR1A 2BVNA 2OOKA 2VRBA 1EQAA 2X7XA 4Y7DA 4LOIA 3QHPA 4RLSA 1NJSA 1Z4JA 3BG5A 2WVJA 3DVAA 1TO6A 3FFAA 4KQIA 4X3PA 4A0SA 3CVYA 4OX9B 2XTMA 1L1FA 4BJ6A 3U61B 1FC0A 4BUZA 2JG3A 1WCIB 2XYQA 1KH1A 2XZTA 1NQOA 3AOGA 4HN2A 4XTCS 2CJYA 3GI1A 1KEEA 4B3SB 1E98A 1JDJA 1RW4A 3I92A 4RV9A 5HG0A 4B33A 3C1UA 5LA6B 3D0RA 1Z4IA 2XE7A 2D1FA 2OTCA 2PVCA 4OP1A 4AS1A 1GZDA 1IOVA 2GN1A 2I80A 1UAYA 3I83A 4BVGA 2J4DA 3LLVA 3I73A 5CW1A 4D25A 2OV2A 2RG1A 2FX2A 3DPIA 2AIRA 3IP5A 4QPPA 2XCLA 3BM5A 2JBAA 3I28A 2VP0A 4GM1A 1EFLA 1R0ZA 2C7GA 3EG9B 5FULA 3MF4A 5KVAA 2WHPB 4KACA 4LVOA 3RFCA 4KPYA 2BFAA 1FRNA 4K81B 1J2JA 3Q3GE 3TDKA 1RYBA 3SM3A 3BGIA 3DLTA 4MKZA 1OLXA 4RPGA 3VH2A 4CFZA 4X65B 3K0FA 3QIAA 1U1FA 4NOLA 2DFTA 4LWPA 2AC2A 4HQ6A 1BOFA 2NLOA 3HYSA 4LZNA 3WTCA 4IIBA 1N3BA 4XYLA 2ZUCA 1BWRA 2JARA 2VAXA 4YR7A 1UP6A 1W19A 3EXFA 3GRZA 3JWEA 3O8OB 1IAQA 4G1EB 4PZDA 4RLQA 4MW9A 4X85A 5A3RA 1GTL1 4HGPA 1ISRA 5JZBA 3JALB 4JZKA 4XGQA 3UAWA 4YEDA 4E12A 4MS3B 2ZTUA 2Q3EA 1P0PA 3QUQA 2CHFA 2ZDQA 5JRDS 1KHTA 3H4MA 3ACBA 4FFSA 1EAMA 2K2WA 3MC1A 4GHWA 3OZGA 5TE9A 4PSKA 4B3DA 1R9GA 1M74A 1QDUA 3PFBA 3IPAA 4J29A 1FQJA 3EGEA 4U5QA 4E46A 4WN9B 3DHWC 3VAZA 4YT8A 3A2MA 1E5TA 2EF1A 2QAGC 5JZVA 1VG0B 5K2OA 1V3TA 1EINA 3U6BA 1BTOA 2Z43A 4FHZA 6Q21A 4ZZ2A 3NG1A 1JQ3A 1XZBA 2HA0A 3UW1A 1QO0A 2BSQA 2IX9A 1Z6PA 4MR7B 3SSNA 3ZNQA 5IJXA 3M1YA 4BNKA 3JYHA 4FFLA 2YX1A 5ECYA 1EA7A 4CMJA 4FSXA 3PRYA 3KD3A 1U8EA 3ER6A 3ECAA 5LZ4A 4LVUA 4PHHA 3WNCA 2ATIA 3N2ZB 1SCKA 3NANA 2VN8A 4MUBA 3OZBA 2X5NA 1KO4A 4XPIA 4BVAA 3ZYCA 3L4JA 2WIDA 3JQ9C 4HX5A 4G0VA 2H11A 1SHKA 4YGYA 2Z5GA 1YAJA 1HYQA 2QIOA 3BSFA 1K8XB 1VBFA 2A1IA 2JA1A 2XB4A 4JT4A 4MKHA 3BORA 3AI2A 5DYGA 3L6CA 4AO8A 1BU8A 2I2DA 2VSNA 4BFXA 5FBRB 2W6OA 4TSKA 4FMDB 2VK2A 1FTSA 1QMGA 1J5EB 1CKEA 3GGCA 3QITA 1H2RS 3FGPA 3PK0A 4UCXA 3WLIA 2PR7A 3DEKA 5KOHA 2ODPA 2K87A 2UU9B 4G0UA 1ODJA 1IJEA 1ZC4A 2Q1YA 2WDPA 2VPQA 1JZSA 5F73A 2D2FA 4KIWA 3WQQA 4Y2QA 4CIVA 2PL5A 3OOJA 3FJOA 3O1HB 4LRWA 3T12A 4Y3UA 3EXHC 4OB7A 2BI8A 2X2FA 3NPMA 3PE3A 4L28A 3UM9A 5FCDA 3UWDA 2ARKA 4D9BA 2XRFA 4FC6A 3C7AA 4IUDS 4LHEA 3ZH9B 2RJOA 4JWTA 4ZYUA 4JLWA 2D2EA 4RFSA 3TW6A 4KE7A 3BOSA 4DREA 4RVNA 1BRMA 4KE9A 5C31A 4YRTA 1F9AA 1Y98A 5BYAA 5C4IA 4Y2XA 4LMRA 3ITNA 5A9SB 5B30A 3K96A 4OBXA 4JENA 3IILA 1WXIA 3A7DA 1BDBA 2B1IA 3WTBA 2HJWA 4E5DA 2F8MA 5IBRA 1Z4MA 1OGIA 1G8YA 2ZRLA 3N7AA 5DK6A 2DKNA 2ZJ0A 3A1VA 3GJ0A 1DAKA 4JC5A 1Q0QA 4KXYA 5TVGA 4OMFG 3NWOA 1HFKA 3OHSX 1XALA 4MW1A 3BEDA 3CJTA 3FCYA 2OGWA 4UM5A 3ROEA 3HXTA 2AYXA 2IT1A 3NTOA 3Q2KA 2XBUA 3QSGA 3V48A 4DDTA 1Z6QA 3QE4A 1VIVA 2JDIA 4CKWB 3T5GA 3O4IA 3M82A 2SICE 3NBMA 2GBLC 4QZVA 1RWMA 4IDDA 1NUHA 3CNLA 1L1RA 1CVLA 1ECJA 3L6EA 3W5IA 3P45A 3MHTA 2QSUA 3TIXB 2GLTA 3Q3IA 4IHJA 3GJQA 5CLHA 2VXCA 3U3JA 5E4FA 2PNFA 3CV3A 1PIWA 3JWPA 4AY3A 3HJNA 2AHOA 1QR6A 4EGJA 5KTMA 1T4DA 2JGAA 5TPWB 4BTVA 1W36B 4KR6A 2X8WA 3UANA 4PZ9A 3L7MA 3PGA1 16PKA 1DO0A 1JSCA 3BIXA 4BMPB 1XRQA 1JFSA 4QFCA 3D64A 5DHPA 1NV9A 1X2BA 4MRMB 4N4AA 3PPIA 3OM0A 4EHDA 4CM5A 1DBVO 2ZKLA 1BDIA 2QJTA 2CNWD 1LSSA 1N2GA 1YDMA 5CJ2A 4ZU1X 4ZXFA 5KQRA 5AVZA 1E18A 4JBLA 3SEZA 4OUKX 3BDIA 1FDRA 3I9FA 4MZXA 1ECCA 5G4KB 1LBHA 2VAVA 4JY7A 2I78A 1M75A 2QUIA 3F7OA 3OUUA 3Q7PA 4FNMA 4QQKA 1QIMA 1G18A 1VDZA 2BGIA 3D8RA 2DWCA 2WIGA 3RFUA 3QZUA 5CDGA 2ZJBA 2X13A 1QC5B 3CFYA 3G3EA 1ZEJA 3CNQS 4HFMA 5J2TA 2V3WA 2RGGA 4MGIR 2WAMA 1IZ7A 1I24A 4BO2A 1L8QA 2BE7A 3CEJA 5HJ5A 4H31A 1DO8A 1PT6A 3L05A 3TQHA 5C9ZA 4AD8A 1ZJYA 2R97A 3VBEA 3AEYA 4E0BA 2NO5A 3UNXA 2IYOA 3CZPA 2GZ1A 4XYEA 2OVBA 2H85A 2IK8A 2JFBA 3GCGA 3FFBA 2AF4C 3BXEA 1C9JA 3KDSE 3VGPA 3VH1A 5CBPB 3HO8A 3C8MA 3ZY4A 2OGUA 2WYVA 1D1PA 3AFNA 4IIVA 4OLAA 1J0EA 1FBNA 1H2EA 2RHMA 2WIBA 1IONA 2K6GA 3MFYA 4G5RA 4N3BA 1RPZA 4OKSA 3OJWA 3KEOA 4NS4A 4YJ3B 3LI2A 2PHZA 4B0PA 4OH7A 5JJBA 1VQ1A 2OHIA 1QH8B 4QC2A 3IT1A 3V4FA 3O1IC 4RD6A 4R51A 1LDEA 1Z26A 1DKUA 3AI1A 2BEVB 4GP7A 3IFSA 2QJWA 1SRRA 1STOA 1Q3TA 1U8FO 1UDBA 1YH3A 3D7KA 4JC0A 2BR4A 4Q3OA 1OXXK 5HIJA 1GXSB 3QMVA 4YJ2B 1ZAYA 3FJYA 1J8FA 1WW2A 2PZGA 4MJXA 2OD2A 1QIHA 1XEXA 2G3YA 2P5TB 3A36A 2BYTA 4CEIA 1EMDA 1XTTA 3HCPA 3P2OA 5FQOA 1CRLA 3RJMA 3ZS8A 3P2EA 1TA9A 3QVLA 2CL0X 4MH0R 4BGDA 2IEBA 2QLMA 1FLAA 1PQYA 3KSMA 1CUEA 1R1DA 3BJIC 4LGYA 4ZQEA 1V71A 5ADWA 1U5BB 5KJCA 2G9RA 1H2ZA 4K9SA 1U9IA 3WLS<