1T2DA

Plasmodium falciparum lactate dehydrogenase complexed with nad+ and oxalate
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
publication title Identification and Activity of a Series of Azole-based Compounds with Lactate Dehydrogenase-directed Anti-malarial Activity.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 122
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2004-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1t2dA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1t2dA02
1U28A 2OFPA 4BOYA 2DFVA 2NSDA 4FOOA 3AI2A 4Z0PA 2OORA 3OFSA 1ZMOA 4OH1A 3QVOA 3U9LA 4E13A 4GLLA 5C7OO 2BRUA 3N58A 1W4ZA 2EF1A 3PXXA 5F5LA 3PQEA 4IDBA 8LDHA 1DFGA 4N54A 4LRTB 4NBUA 2YJZA 3JQBA 4CM9A 4FOSA 4YVFA 2IXBA 3K92A 3H2SA 4UVEA 2V65A 4GVXA 3JCZA 1DJNA 1P1HA 3U3XA 2C54A 3GEDA 3AY6A 3GVXA 1LDMA 3U4DA 5C7LO 4CLHA 1VKOA 3ETGA 3ASVA 4BO4A 1DLJA 2DUUA 3RUEA 5KJFA 2ZYAA 4FR5A 4TRMA 1EUDA 4BNUA 5JFOA 5TNXA 1EQUA 2O7SA 2YHUA 3AUUA 1XDWA 1HYGA 2UVDA 2ZYGA 4ZQEA 4N18A 3V8BA 4WLOA 3RU9A 2A4KA 1F8FA 1XYGA 2IDZA 4ITUA 4W9NA 3AW9A 4I9UA 3GQVA 1I0ZA 1I3KA 3GA0A 4ND2A 3S2FA 4QT0A 4RF5A 3ULKA 3SJUA 2VUSA 5L9AA 1AGNA 3NUGA 2G17A 2ZB7A 1GYQA 1XELA 1LLUA 1IB6A 1D1TA 4PLFA 4CMGA 3WGQA 1NQOA 1HEUA 1DPGA 3JQ8A 3H5NA 4B4VA 2B36A 3ANNA 4LRSB 4UUMA 4UUOA 1QLJA 4FPXA 4B4UA 4EW6A 1M2WA 1F14A 3DHYA 3C7CB 3MZ0A 1WLYA 3UKOA 2QRJA 3G3EA 4QFDA 4FN4A 4L8VA 1P1IA 1UXKA 3GGPA 1ZSVA 3OM9A 2WD7A 4E5PA 2CY0A 1IOLA 4TSKA 4XYMA 1D3AA 4RLHA 3PQDA 1LLDA 1U5AA 3E9QA 1PQUA 4PGFA 4UEOA 3RI3A 4Z0TA 2GZ2A 2HO5A 4FFMA 1E5LA 3OJ0A 2EKQA 4EDFA 2WD8A 3DMTA 1SB9A 2YDYA 1K89A 4P4NA 4E32A 5HWSA 2YW9A 1VL0A 3D0OA 4ZQGA 1PZGA 4YJGB 3QHAA 4CMJA 3SBOA 4B7UA 3DDNA 3I9LA 5DT9A 4PN3A 2CDCA 3AM5A 4BO9A 5AYVA 3W4KA 4B7XA 4E2ZA 1ENOA 5K9ZA 3DHEA 3L9WA 4HNHA 2HMTA 4E2YA 2PGLA 5IXYA 1PSDA 3FNGA 1PU2A 3RIHA 3AY3A 3I6QA 3T4EA 4D0SA 1GCUA 3D4OA 1IL0A 3WS7A 3GMSA 4PLZA 1BDBA 3W8FA 5ICSA 5JAIA 4YWJA 1K6IA 3Q2KA 1HT0A 3IDSA 4CLEA 3HFGA 3E5MA 3R3JA 1EFKA 3GN1A 3I9KA 4H7PA 4M49A 3L9XA 2A9FA 1YS4A 4ND5A 1P31A 4DIOA 2BELA 3GHYA 4E12A 4PLPA 2PGDA 4W9NC 1TT7A 2POQX 1V3VA 5A1TA 4K6FA 2BGLA 5HA5A 1N7HA 4CMAA 1GQQA 3PJEA 3ZWBA 1ZXLA 1I5RA 3EY4A 2NQTA 1E7YA 3OJLA 4R9SA 3SLKA 3O8QB 4PLHA 3NGLA 2C07A 2B0JA 3MJTA 3QP9A 4X54A 5JAQA 5AQ1A 3F9IA 3WG9A 3I52A 1R0LA 4BNGA 2C5AA 4MVJI 5A4DA 1EE9A 5A9SB 4E5YA 2WE7A 1PL6A 5A04A 1YQXA 1LSOA 3KSZO 2HDHA 5JYDA 4JJFA 4H15A 4JBIA 3Q6IA 3QWIA 3EVTA 1GD1O 2DTDA 3JQ9A 5C37A 2X0RA 1PJQA 1BDMA 4Z9XA 1P1RA 4CMKA 3AFNA 4NG5A 2Q45A 2RBEA 4Q3AA 4YXFA 2I76A 2Q2VA 4CV2A 3LSYA 1KBZA 5DULA 2B4QA 3CMCO 5CDUA 4ZRNA 4XKJA 4TWRA 1KETA 1F12A 1E6WA 3LLVA 4YAEA 4BNKA 4CLOB 1HLPA 3QWAA 4GMFA 4LCJA 4U7WA 4BV8A 2H5LA 2P4HX 2O3TA 1XG5A 4GX5A 1NVMB 1GYPA 1E3WA 3T7CA 4A7PA 4XYEA 5U4QA 1P9LA 4PLYA 1D7OA 3HNPA 3KRTA 3C7AA 5TGDA 5B1YA 3FPCA 3V2HA 4KDFA 1DJQA 4FW8A 4LMRA 4QSMA 5JPIA 3RUHA 3PHHA 2E6UX 4FQ8A 3IAHA 4GKBA 3RFVA 3KVOA 1B8VA 1EVYA 4BVAA 2QRKA 1WDLA 1Z7BA 3GZNB 4KP7A 4DLAA 4MDHA 3EDMA 4FD3A 1ZJZA 3KBOA 4IM7A 4J91A 2I66A 3F5SA 3WGOA 4YRAA 4IJUA 4BMVA 1EDOA 3JQGA 1D1SA 3LC1O 4RVHA 1C0IA 3PZRA 1YOVA 4A26A 3V2UA 3OECA 3HB4X 5G0TA 2C82A 5AXAA 2HKIA 3AJRA 4ALJA 5EERA 3WR5A 4FFNA 4HV4A 1W8DA 4YT2A 1EVJA 3PYLA 2E48A 2H9IA 4N7RA 5LDHA 3RSHA 1UZNA 1PJ3A 5KJEA 2FN7A 3C8MA 4RVDA 4AFNA 4RZHA 3ZHZA 2QIOA 4H16A 4R69A 3ROMA 1DSSG 4J1NA 3WGYA 4Y67A 4Z3DA 2ZCUA 5TT0A 4RJTA 2ZKLA 2NQ8A 2JAPA 1ONOA 1LRLA 1C1XA 4KUHA 4O5OA 1N9GB 2O2YA 3PHGA 1NFQA 3IIEA 2TMDA 5I7EA 1O8CA 3GAFA 1IZ9A 4JXKA 2A35A 4MIYA 3WLFA 3TSCA 2YY7A 4F6CA 2FR0A 2ZTLA 1K6XA 2HCTA 3JQ9C 2Z1NA 2D5AA 4ZVVA 3GEGA 1RKXA 5TIIA 2BKAA 3U4IA 4IY1A 3WSWA 1HXHA 1UP6A 5F1KA 4BNNA 1DB3A 3OHSX 2P4QA 5JE8A 5IAAA 1ARZA 4BB6A 3PFFA 1MG5A 4G81A 4IQ8A 3GVCA 2AQ8A 3WGZA 4MKRA 4MIEA 1OC2A 3OA0A 4IIUA 3BA1A 3DO5A 2JL1A 4CMBA 4L75A 3KB6A 3GNSA 3PRJA 3VTZA 1NBOA 1Q7CA 4RVUA 1NR1A 1P1FA 5G0VA 1NASA 1U7HA 3KOUA 2H1SA 3BMQA 2VZ8A 3WBBA 1EUZA 1PWZA 3IS3A 1YONA 1AHIA 1H2BA 3CEAA 3O9ZA 3DBLA 4IDAA 3AU9A 1O6ZA 3KYCB 1R0SA 5DCYA 3JD0A 2YV1A 3GPIA 2X7HA 4YRDA 2B4TO 4ALKA 3CPSA 1PWXA 1YQGA 4EUEA 1SC6A 4B8ZA 4TRRA 1XHLA 1YL6A 1Z6ZA 2Q2WA 1LBEA 1YDWA 2B69A 3FPLA 4YT8A 4IGEA 4YA6A 2JD2A 3GMDA 3OBBA 4D42A 3KYDB 1SEVA 4RV9A 6ADHA 2CVZA 3JYOA 1EUCA 4JNKA 2D1YA 5DN9A 5JCJD 1I33A 1U3VA 3K96A 5AXDA 3BIOA 1BW9B 1DBVO 1X1TA 2PV7A 3MTGA 3PWKA 3S2GA 3I9OA 4DVJA 1JW9B 3GT0A 1HDGO 4O6VA 3EHEA 5JCJA 5KIAA 1GQ2A 4AJOA 4YYZA 5GZ6A 4XCVA 5DBGA 2JAHA 3GFGA 4NK4A 3DHNA 4MPDA 2V6FA 8ADHA 2GGSA 3PYMA 3WBFA 2NVWA 2BI8A 2FSSA 2GF2A 2ZATA 4Q39A 1NR7A 2RAFA 1WZEA 2DLDA 3E5RA 2QHXA 4NU6A 1G0OA 2VHXA 4H3VA 4E5NA 3ZNNA 1JKJA 3KV3O 4NDNE 1MC5A 1HKUA 5IZCC 3O38A 3LQFA 4LISA 3TN7A 4L0QA 1BRMA 3ZU4A 3V1YA 4D41A 2J5KA 2O2SA 3AUTA 4AVYA 4YAIA 1X14A 1CRWG 1E5QA 1V8BA 5CDTA 2JFHA 2ZTUA 3HDYA 4DGSA 5IG2A 2FSVA 4Y8VA 5KWEA 1I3LA 3E9NA 3I5MA 2QZZA 3TZ6A 3C3XA 3FCOA 2WMDA 3PDJA 4DQXA 1A4IA 1YJ8A 3ZV6A 1UXIA 4EJ0A 5CEEA 1VSVA 1FF9A 1E7SA 4L4SA 4MVJM 1T24A 2NTNA 1AUPA 1EBUA 5IXSA 4GMGA 3ZHBA 1HDXA 2X6TA 3JYLA 3VPXA 4BB5A 2PD4A 2C0CA 1YKFA 4W99A 2VRCA 4S3MA 4RPHA 3QVXA 4LSMA 1BXGA 3MOIA 4HXYA 3MJSA 5DZSA 5AVOA 2GN4A 1R15A 3L4BA 3ZWOA 2OHXA 3ZU3A 1Y1PA 3DFUA 2QW8A 2DBZA 4K28A 3S8MA 3NAQA 4FFOA 4R41A 5L3ZA 3MTJA 2GDZA 1Q7BA 3PQFA 3BMCA 3H3JA 1NXQA 3ICCA 3F46A 1HRDA 1X7DA 5H82A 1EEHA 2YDXA 5KVCA 5BNTA 3IL2A 3G79A 1E3EA 4B4OA 1LUAA 1TB4A 3A1NA 1LSUA 3B6ZA 4XJSA 1GTMA 1EVIA 4ONEA 2GD1O 3CZRA 2C2XA 1PX0A 4BL5A 5JDCA 4YQYA 1E1LA 1N7GA 5BSFA 5TX7A 3NKLA 1ENYA 1VSUA 5G4LA 2FR1A 2LDBA 3RCBA 1GADO 5IDWA 2D59A 4JGBA 1MUUA 2VUTA 3WQQA 4KUGA 1FK8A 4PG5A 4DQUA 3OJFA 2IODA 1M6HA 2AW5A 5GY7A 5DBIA 4ALLA 5B4UA 3RROA 2J3HA 5DP1A 1R0KA 1LC0A 2G76A 1PS9A 3K30A 5DNAA 2I67A 4ALIA 3RUIA 1DC3A 2E37A 4JX8A 1T2EA 4RDHA 3JTMA 1NFFA 4C7KA 5G4KA 2FPPA 4CUJA 1NFRA 5JAMA 3WICA 1MX3A 3EAGA 2AA3A 1AN9A 4LK3A 3UCEA 1CQIA 3O03A 4A27A 2DQ4A 4OQYA 1YVEI 1ORRA 1Y8QA 3DOCA 1EFLA 1YRLA 4HFJA 1LDGA 3EK2A 4Z9YA 1RM3A 1T2AA 3MCVA 3QWBA 4RPLA 3LDHA 4XR9A 1KC3A 3F4BA 1XWFA 3E48A 4PLTA 2JHGA 3BXXA 2AEFA 4PG6A 3B1KA 4L74A 3SXPA 3PYXA 4S1VA 1UDAA 4BO5A 5G0UA 2EW2A 3FBGA 4DIBA 3NDJA 2EW8A 1YBVA 4BO7A 1DC6A 1I3NA 2AQIA 2GZ1A 4XD2A 4XDYA 1ZMTA 1MXFA 3FF4A 3AI3A 3D3WA 4Q3DA 3BMOB 4Z3KA 4IJKA 2CDAA 2EXXA 1WDMA 3U62A 1V6AA 2YQ5A 4CODB 2PH5A 3COSA 1ISFA 3L4BC 3LK7A 1QG6A 2VHZA 1RPNA 4JCOA 4RF2A 3GG2A 3UF0A 2YZ7A 4NZ9A 2P5YA 4J16A 3W6UA 2EHDA 3GDGA 1PZHA 5A3VA 2VYVA 1B0AA 3L07A 4BMNA 3ZW8A 3WNQA 3E03A 1GQYA 2JCXA 4URFA 4WK6A 2VHWA 4FSHA 4RCVA 5CEFA 1MB4A 3TQHA 3I1JA 3JQ6A 4R3WA 4CR8A 2BFPA 2FR8A 1XSEA 4E4YA 1YQDA 1E6EA 3ZN2A 4GX2A 1DFHA 3ZDFA 5CDYA 3L6OO 4KDEA 3DBVO 5I9MA 5T64A 3WTCA 3R1IA 1VC2A 4BKUA 1T1SA 2DKNA 4FIZA 4OL9A 3WB9A 1QYDA 3PI7A 2HMWA 4M87A 5ER6A 5I9LA 3ZNPA 1TVEA 4YBZA 5GMOA 3ZWAA 1VPDA 3BAZA 1DLIA 3QIVA 1Y9AA 1U8FO 3R3SA 4M89A 5A9RA 1ZSYA 2JCVA 2NM0A 3P2OA 5EQFA 1DRVA 4LMPA 1HE3A 4U0KA 3G1UA 5JMWA 2YFQA 1XQ6A 2CF5A 4NH4A 3SEFA 2DBVO 4XYBA 4A10A 4IZHA 2G1UA 4K1LA 3IQDB 4AJ2A 1NHGA 4E31A 1SB8A 4G65A 3DFZA 3A06A 4PG8A 2J5QA 1DIGA 1GPJA 4WNIA 3GFBA 2DBRA 1HF3A 3GG9A 5A06A 4R9RA 5H81A 5K6AC 3BMNA 4XB1A 4CLRA 3H8VA 1U4OA 4DWVA 3MWEB 1PGJA 3W8DA 4GI2A 2GZ3A 2PKQP 1VE9A 1B26A 2EJVA 3NDIA 2BLLA 4WLFA 4DPLA 3JQ8B 3SLGA 3AK4A 3OEYA 3RBVA 2EP5A 4M86A 4BGVA 5I7FA 2GERA 3VPFA 1UDCA 2HK8A 3F5QA 2V6MA 1KY4A 5ER9A 2FOIA 4BNZA 4CQLA 4GPD1 4E30A 3HB5X 4J4BA 4B4WA 2J5RA 3IKVA 4CV1A 2RHCA 2WD7B 3L6EA 3WMWA 3FI9A 3DTYA 5EJ2A 2Y1GA 2X5KO 3FTPA 3X2EA 9LDBA 1ISMA 4XEHA 3D1LA 5HRUA 3TZHA 4Z6KA 2Z95A 3OEWA 4MINA 4QQRA 4YAGA 1GV0A 1QMGA 3AY7A 4NJOA 4BKOA 3RC2A 2EGGA 3VH2A 1E1MA 3DONA 5JYEA 3HJAA 1DO8A 4P22A 1N92A 2W8ZA 2XF8A 3K9QO 1GR0A 1NQTA 4UULA 2QYTA 4EBFA 4K26A 2X1HA 4IUYA 4JROA 1C0LA 4OKIA 2ZB4A 5HBRA 2W90A 5MGBA 1CWUA 1YB5A 2Y0CA 1PJLA 1V0JA 1SAYA 3AFMA 2Q1UA 4J9UE 5KKAA 1GFSA 5TJ9A 2X58A 1T4BA 4RQTA 4PLWA 4NU5A 5DDIP 3IKTA 4CM5A 1JTVA 4I5GA 1T26A 4I8XA 2WWRA 2C7VA 5CHEA 5CDSA 3DZIA 3QY9A 4A73A 4ZHSA 1JLLA 3PWZA 3ZHYA 3GUCA 2E4AA 5JMPA 4A5OA 4G5HA 4DQVA 1C0KA 1LDBA 4OXYA 1V3TA 1CJCA 2CMDA 3HDJA 3RJ5A 3Q0EA 3GPDG 5KJ6A 3WGGA 2O3SA 2WDZA 2D0IA 2H63A 2P9EA 3U49A 5F21A 5JO9A 5G2OA 3S1LA 5IN4A 1HE2A 3F3SA 4XQEA 4EI2A 2J3IA 1K5HA 2HSDA 2SCUA 1PGQA 3VVBA 5I7VA 1ZK2A 5DCWA 1H9AA 3LC7O 3GUYA 2HJSA 5F1OA 4CMCA 1JQBA 1KVQA 4NFYA 4OSPA 3WTBA 2I6TA 2X5OA 3PJDA 5EQDA 4PRLA 3JYQA 4CL8A 4TKLA 4CJXA 1P0CA 2P5UA 1HE4A 1TT5A 2Y67A 1HETA 3V5NA 1F0YA 1QV6A 4BO6A 4U6QA 1X0XA 4DRYA 4GLOA 1EZ4A 1YGYA 4ZA2A 3JQ7A 3AUSA 4IDDA 4TRNA 1BVUA 4Y98A 2RH8A 1GPDG 3DL2A 5FI5A 6LDHA 3JD1A 4OAQA 1DIAA 3NGXA 4PZEA 1Z82A 1LLCA 4JLWA 5K0ZA 2YV3A 2PNFA 3MJCA 2DC1A 3IUSA 4ALMA 5JDIC 1JDJA 2GPTA 4WOKA 2PKRA 3OQBA 3GN2A 4YJFA 3U09A 5C3MA 1H94A 1JKFA 4MP6A 4PLGA 4N5LA 4NI5A 2XXBA 2YV2A 3FSRA 5IFLA 1M67A 2PWZA 3TFOA 3KSUA 1FMCA 1E3WB 3EZYA 1RM0A 4BKQA 3H9EO 3W6ZA 3PWSA 4CMHA 1GUZA 3WSVA 1T4DA 1U3TA 2E49A 4IIVA 1N1EA 1WWKA 3ITDA 4XGIA 2GN6A 1BSVA 1P1KA 1GUYA 1VJ0A 4FGWA 3H65A 1A4UA 4AJKA 3DQPA 4HY3A 4WLEA 1NPDA 1ISHA 3KETA 3PIDA 1H6BA 1ONNA 3G49A 4U0JA 4GBJA 2Y93A 1PJTA 4J2HA 1L1FA 1KEUA 3JQGB 4E3ZA 3VH4A 1AE1A 3JQCA 4PRKA 1YOVB 1ZK3A 1HYHA 4KOAA 4BO0A 1SCUA 4MVJH 2CZCA 1R4NA 1EQ2A 1NP3A 3RKRA 2UV8A 2BHLA 3ZWPA 4MOWA 3VZSA 3A14A 1YH3A 2WSBA 3OICA 4R68A 3L0DA 1VL6A 3CTMA 4JP2A 1Q0QA 4OO3A 3GR6A 4YJDA 2FPGA 5ADHA 5JAZA 1HYEA 4GSLA 2A94A 4R1TA 5F1PA 1C1XB 4DMLA 1MXHA 2CF6A 2EKLA 1JKIA 1NAIA 1BXZA 4DL9A 2HRBA 5T6BA 2C2YA 4IMPA 2VNAA 3D64A 1JWAB 1EMDA 3BTSA 2ZQZA 1QYWA 3FHLA 3X2FA 1J5PA 4NFHA 3RKUA 1QYXA 3KYBA 2O7QA 4QXMA 1U2GA 1UZLA 1E7WA 2AQKA 5HTOA 4IDEA 1SNYA 5JBIA 1HSZA 4MVJP 5L4NA 1Q0HA 3ST7A 2AG8A 5THQA 3ETEA 4XX0A 3E9MA 3DBHA 1VRWA 2HMSA 1QP8A 2ZK7A 3IP1A 4J0EA 1BHSA 4BQRA 3KHUA 4WCFC 1E1KA 5CEJA 4GGOA 4YRBA 4KQWA 4B7CA 3C7DB 3CMMA 4F6LA 3BHIA 3FWNA 2NU8A 1XCBA 2E82A 4I9NA 1UXJA 3AM3A 2Q1WA 3GZ4A 4LCEA 3E82A 4BNMA 4BHTA 1NM5A 1T2FA 1ADBA 3F4LA 3JQEA 3A9WA 1WPQA 2I3GA 3BHJA 4K9DA 3BMQB 1NNUA 4CLXA 3ZU5A 4AICA 3PLNA 4IZIA 4UEKA 2DAPA 5COQA 3DBLB 2HUNA 3DXFA 5L7TA 3RU7A 4BUCA 3LU1A 1Y5RA 4ZGWA 4II2A 4UVDA 3F1LA 3ZWMA 3WYBA 5CFZA 2DPHA 2X4GA 4E6PA 3GVHA 3AOEA 4KZPA 2WJPA 4AJJA 1U5CA 4EUFA 3VZPA 1FDWA 2EKPA 4CV0A 2GYYA 4EEZA 4J7UA 4WEOA 2ZCVA 1MP0A 1CIVA 4ND3A 1OI7A 3NV9A 1DIRA 1ADFA 1I01A 5BSHA 5T5QA 1I2CA 1GUFA 1LRJA 1VLLA 3VPGA 4R01A 3HFSA 1Z75A 1C1DA 2OOSA 3O4RA 3I9NA 3QE3A 1XA0A 1ZZEA 3NEPX 3QWHA 4JJIA 3HWRA 4QECA 4UUNA 5EIOA 3ADPA 3CUKA 4NHEA 3ROKA 3V1UA 3P7MA 4PG7A 2PZJA 1ULSA 1J4AA 1N2SA 2ZIZA 5TS3A 3GC6A 2Q50A 3O26A 3CKYA 4J7XA 1FXSA 1DHTA 5I7SA 3GAZA 1Q2XA 2HMVA 3RAJA 1EE2A 3IMFA 3W8EA 2VTDA 3OA2A 4D3FA 5IZCA 5I9NA 2Y1CA 1IZ0A 1GEEA 1YBAA 1J6UA 2ZJ0A 3ZV5A 1ZEJA 3ZGYA 3G17A 4DXHA 4TROA 4BO2A 4OOFA 5DOVA 3Q2IA 5A03A 1HDOA 1JVBA 2FP4A 5KNLA 2Q4BA 1Y81A 1RYEA 4O63O 3D7LA 3ETDA 5B12A 2NVUA 1U3WA 1Z45A 4XA8A 2GASA 5IDQA 1HDRA 4CPDA 4ILKA 4AJHA 2Z5LA 4XDZA 5LC1A 4XYLA 4UEJA 2WEKA 4A03A 1IYZA 2Z1MA 4UREA 4Y6PA 3VTFA 3LT1A 3TFQA 1QYCA 5T8KA 2VZ0A 1WMAA 1O0SA 2UUOA 4RVSA 5JXWA 4B3HA 2O4CA 2OZPA 2ILTA 2J3KA 3WOHA 1EK6A 1PR9A 2Q1TA 2YYYA 4HFRA 4XB2A 1OZAA 1M66A 3GHHA 5U9CA 3WXBA 2IYOA 1UXHA 2HQ1A 2VWHA 1PJSA 1SPXA 3QWFA 2HU2A 3P2YA 2D3TA 2I65A 2O4UX 1BXGB 3JV7A 5FI3A 4CM8A 4L4RA 4Q3NA 5KJ1A 1CERA 1ISIA 2FHSA 3UCXA 2XPCA 2D2IA 3AOEC 2PZMA 5AXBA 1QSGA 1G0NA 1UDBA 1ZKMA 4PVDA 4F3YA 3F6YA 3RC9A 2PK3A 3BMCB 3VPHA 2FMUA 5U1PA 4ROSA 3TDKA 1H93A 4L4XA 3E8XA 1A71A 3U5TA 4RL6A 3UUWA 2Y05A 4Q3BA 1JA9A 1R37A 2VYND 4DYDA 3WLEA 2CVOA 1HDCA 2P2SA 1P0FA 3PHJA 2ZJ1A 1E3SA 1F06A 3ZWXA 3ZWCA 1ID1A 5L53A 4AJ4A 2VYNA 1A72A 3D4PA 4CMEA 2CSUA 1ZCJA 1NQAO 3RQSA 4B3JA 3CH6A 4F45A 4RGBA 1ENPA 2B5WA 5BSEA 2B35A 4FS3A 4J1TA 2R6JA 3QQPA 1N5DA 2D8AA 3MJ4A 4LVUA 3UHAA 4YAKA 1E7QA 1ISJA 2PKQO 2EG9A 4BS9A 1E92A 5G4KB 2NVBA 4II3A 2EJWA 4MKXA 4G2NA 1R16A 4RPGA 4WNCA 2RCYA 2I5PO 1Y8QB 2OP1A 4XQGA 3KXDA 4OKNA 2VRBA 3JD4A 1EK5A 3OQ6A 4XQ9A 3AOGA 2PFGA 5T8KC 2BH9A 5JLAA 1LDEA 3KUXA 2NU6A 1E77A 1GYRA 4XWYA 1WMBA 3T7EA 3PK0A 5HS6A 4J49A 4WKGA 3TRIA 4CR6A 1KVUA 4FJ2A 3GLQA 5L45A 2TMGA 3DBRA 2YHIA 3D3WB 4W7HA 4QO7A 4E2XA 4TVBA 4IS3A 4MO2A 2G82A 2QRLA 3I9MA 3PZBA 3HSKA 1T1RA 1VL8A 4CM6A 3R6DA 3WYEA 5ENVA 5FWNA 1E0DA 1G1AA 2P9GA 3K2BA 3LC2O 5TF4A 2OBNA 3K73O 4LW8A 1QR6A 2LDXA 2JFGA 2IZ1A 4W82A 4CM3A 1LJ8A 4R1NA 2W2KA 1PJ2A 5A02A 4AJPA 3M6IA 4YT4A 2VNSA 1LQUA 3ANMA 4TQGA 1UH5A 1SOVA 4IPTA 3G0OA 3GDOA 1NTOA 1C3VA 4YPOA 5JCXA 2DBQA 4B3IA 1VM6A 1YDEA 3ONFA 3HN2A 3IJRA 3WJAA 4CQMD 1HE5A 3N74A 1MLDA 1SMKA 1UP4A 1KERA 5GZ3A 2AEJA 5AOVA 3WGHA 1JVSA 4CMEC 2VWQA 4NNJA 3S2IA 3VPSA 2BGMA 5B4TA 3L4SO 2Q99A 2DPGA 4PCVA 4CQMA 2VWPA 1H6CA 4P38A 2I9PA 2AG5A 4ZQBA 1CEQA 1V3UA 3JQFA 2AQHA 1XEAA 4BNIA 4N5MA 3UW3A 3W1VA 2YFHA 3L77A 3RC1A 3FTNA 5AXCA 4BMSA 2NU7A 4WASA 1LSSA 3MOGA 3H7AA 4EZBA 4GQAA 2NV6A 4XIYA 1K3TA 3BZUA 1U9JA 4F46A 1DEHA 2JKVA 3WIDA 5EN4A 1WDKA 5K6AA 1R66A 2W98A 4KWIA 1K2WA 2X9NA 3GH3A 4NJMA 2AHRA 1EBFA 5IDYA 4TZTA 2PZLA 4NBWA 3QW2A 3BMNB 2GN8A 3RFXA 4CLRB 4CL3A 3IC5A 2VHYA 3QJ5A 3ICPA 2ZYDA 3BTUA 3I83A 3KZVA 3LZ6A 3GEMA 1ZO8A 3LF2A 2D5CA 3HHPA 1NX6A 5JC8A 1KVSA 4I5FA 1H5QA 3H9QA 9LDTA 3ZCXA 2VTEA 2X5JO 3DR3A 3PIIA 3U4HA 1Y7TA 3GNTA 4UVHA 2NNLD 3CSDA 4IDCA 1RWBA 4CQLB 2Y68A 4P4LA 3TWOA 4NQZA 3UFXA 4CMIA 1R4MA 2CNBA 5EPOA 2GLXA 2G5CA 3WFJA 4EYEA 1Y8RA 1IULA 5ITWA 5FEUA 3RVDA 3JQDA 3GOHA 4BNTA 2IZ0A 4U6SA 4MJLA 4D44A 5IJZA 2X22A 3JD3A 1ZXBA 4Y6RA 3TOZA 3R0IA 2X0JA 3M2TA 3SC4A 4JBGA 2D4AA 2V6GA 2Y0DA 4O0LA 1P3DA 1GL3A 1GZ4A 4DREA 1PJ4A 1F17A 3BHMA 3AUAA 3DZJA 1HWYA 3PEFA 1C0PA 5CPFA 4DTIA 3JQFC 1I3MA 3OMLA 4DLBA 1PL8A 1KOLA 1ZK0A 1MC4A 4Y6SA 1FDVA 1MGOA 2WTBA 3AM4A 5A9TA 2VN8A 5TLSA 1E7MA 3AI1A 4D0RA 4J1SA 2AE2A 1D4FA 1QKIA 1LLQA 2W2LD 4FJ1A 2EWMA 5ES3A 5A3JA 2FZWA 3FNFA 1IPEA 4GGPA 2C20A 3ZI0A 3VZRA 1YJQA 2X8LA 4XRRA 3ZWVA 3ZZNA 2YUTA 3OSUA 5TT1A 5BR7A 1YL7A 3ROPA 4OMUA 2W2LA 3ITKA 3KLPX 1CQJA 1LA2A 5FFFA 1TEHA 1KVTA 4C7JA 4KQXA 1I2BA 5L7WA 3I3OA 3LLSA 4EJMA 4M1QA 3H5RA 1KYQA 2PD6A 5KVQA 3HDQA 1PZFA 1ADGA 5FYDA 3QVWA 3TZCA 1TT5B 1O5IA 4OGWA 2EIHA 1CYDA 1ENZA 4ZN6A 2ET6A 3DMYA 1NQ5A 4RPJA 1U2DA 1B3RA 1GEGA 1LTHR 1WVGA 1Z73A 5IN5A 3DC2A 1E3LA 1VJTA 3JQ7B 1BXKA 3GGOA 1P1JA 1XIVA 4IS2A 4GAEA 4J43A 4J7CA 1WZIA 3C1AA 3IOYA 5EL0A 5TC4A 4A2CA 3JQAD 1E3JA 1NWCA 3ORFA 4FFLA 5TSDA 3RUDA 1DDOA 1I36A 1LRKA 1OMOA 2CUKA 4HX5A 4CM7A 5JDIA 5J23A 3UGKA 3K6JA 1CDOA 3U4CA 1AXEA 1XU9A 1HZZA 4QFCA 1I8TA 4E21A 4RPKA 1WNTA 5EMHA 5DF1A 4AJ1A 2EERA 2BMAA 3JQAA 1KS9A 2PZKA 1FDSA 3FN4A 1YWGO 4JJGA 4NBVA 4OXKA 5L95A 1SEPA 4YJFB 3SX2A 3HUDA 4BNXA 2WYUA 4J90A 3EUWA 5L40A 3RUCA 2CDBA 3I4CA 3TOXA 3NX4A 4BGEA 3NDRA 1S7CA 4FBGA 2DUWA 3RUAA 4J4HA 1PR3A 5IZ4A 4MVJD 1GCOA 3QVTA 1BMDA 3OETA 2HRZA 4CM9D 4XJTA 1Y6JA 3W4JA 4ZJUA 3DZHA 3KSDO 4HUJA 1MA0A 1X7HA 2OO5A 3Q9NA 4DPMA 3B1JA 1OBFO 3WX0A 1BGVA 4HFMA 3ZNOA 4MVJA 1NWHA 4IDFA 2IZZA 1KVRA 4GWGA 1IHYA 1WXDA 3DAPA 4RORA 2C29D 1ZNQO 1AXGA 3EYWA 5DOZA 1MG0A 3PGJA 4ZU3A 5JS6A 1P45A 1B16A 1M75A 1QRRA 3DZFA 5T57A 1DIBA 2J3JA 2C5EA 1LDNA 3C1OA 3TPCA 4Z9FA 1U4SA 4YAJA 2Q46A 3ZWNA 1JU9A 3QRWA 1SZJG 4J6FA 1R4NB 4WOJA 4BQPA 4OHUA 2BI7A 3RUFA 4BV9A 1O94A 2Q49A 4Q9NA 4DYVA 4YEDA 4R51A 4XR4A 1V9LA 4YR9A 3HQ4O 4YJHA 4OQZA 4BGUA 3VZQA 3G1TA 3OQ1A 3EW7A 2J6IA 3LF1A 1NPYA 1U1IA 4HBGA 3TZKA 2QYSA 2X86A 3CE6A 3H4VA 4E2WA 2RIRA 3WDSA 4CM4A 1W73A 4WLUA 1OC4A 2VT3A 3DAGA 4YT5A 4ZICA 4D79A 2WE8A 4GX0A 1DAOA 3TJRA 3WGIA 4ALNA 5A5EA 4R1SA 4BNWA 3H9UA 4BKPA 1Y5MA 1X15A 3WIEA 1LI4A 3GVIA 3VKUA 1X13A 3WQRA 5JY6A 3I9JA 4U8GA 4WCFA 2DM6A 3WWYA 4RVFA 4JIGA 4ND4A 1H9BA 2IRWA 2UUPA 3DBHB 1NHWA 3WGTA 3HDHA 1ZUD1 3IUPA 1SO8A 2OGUA 3UICA 3NRCA 2AMFA 3GF4A 4E33A 2IE0A 2P91A 2QX7A 3ABIA 3ANLA 4I08A 5KTKA 3E18A 4CR7A 4D46A 4FC7A 2Y1EA 4QEDA 2GNAA 4DIFA 4XGNA 1X1EA 4L76A 2GSDA 2JCYA 5BNIA 3B70A 3VDRA 3UAGA 4CM1A 5CDGA 3JQBC 4UUPA 1XU7A 4OIMA 4MIOA 5EINA 1PS0A 3KEQA 1T2CA 3EC7A 4RDIA 3MJEA 4OOEA 1IUKA 3DZKA 1PTJA 5ICMA 1DFIA 5L4SA 3BTOA 3DB2A 3D5QA 3M2PA 3EVNA 3PLRA 5L7YA 4BGIA 5CPBA 1B3BA 5C7IO 3FD8A 3GY0A 4EITA 1RM5A 3NTQA 2Y66A 2NTVA 4UVGA 1LQTA 3ROQA 2GCGA 1GAEO 1P77A 3NT5A 4IQGA 2EEZA 3RASA 3RWBA 1M76A 4NPCA 4BNHA 2C7GA 1LX6A 1C1DB 1KIFA 1H6AA 3LT4A 1Z74A 2BFOA 4BKRA 4D7AA 3C1TA 3B1FA 1QLHA 1WAMA 5CP8A 3Q11A 2CVQA 4ZQHA 2Q2QA 4L9RA 4MKZA 3PJGA 4PLVA 3MJVA 4GL4A 1P33A 3ZH2A 4L73A 5T67A 2I99A 2Y0EA 5KJCA 1DHRA 5KOIA 5JC1A 1U8XX 3BTVA 4XIJA 1A27A 3INTA 5F5NA 1VJ1A 1LSJA 1R12A 1SBYA 4IJVA 4R4JA 1H6DA 2GR9A 2DU8A 1AHHA 3UVEA 5CAEA 2WYVA 5ITVA 1GV1A 2QQ5A 1J49A 2IEBA 4W6ZA 1A9YA 5TQVA 2HJRA 3NT4A 3LT2A 1TLTA 3DZGA 3MEQA 1ZW1A 3QA9A 3OP4A 4E5KA 1LXCA 3F47A 2NVUB 5JW6A 1PGPA 1MFPA 4YJGA 3WMXA 3PPIA 5A05A 4GKVA 3PHLA 3DMTC 5ILOA 2BD0A 4J2OA 4MP8A 4MVJF 3JD2A 5G0WA 1HDYA 4DUPA 4O1MA 2PH3A 2V6BA 1LU9A 4DBZA 2AEMA 1GZ3A 2Y99A 2FZEA 1JAYA 1Q7GA 1NYTA 2BFAA 2XXJA 4AJLA 3VH1A 3Q3CA 5GZ1A 3QVSA 4K6CA 4CUKA 4NK5A 3WNVA 1W0CA 1FJHA 1VI2A 4M54A 1DRUA 2NLOA 2DFDA 2EV9A 4OYRA 4CM8B 1I32A 1X0VA 5KCZA 2HMUA 3ZW9A 4Q3EA 5ILGA 3T4XA 4KMSA 4DBVO 4XZ3A 1GU7A 1YBMA 2R00A 3OF2A 3KO8A 4NFSA 4Z0HO 1L7EA 4R3NA 3VC7A 4WLVA 1I30A 1ZIDA 2JD0A 4BNFA 2Y1OA 3W4IA 3INRA 3CINA 4DPKA 1O89A 4YDRA 4PZCA 1JWBB 1HDZA 3PJFA 3C85A 3TF5A 2QZ9A 4RQUA 3EGOA 3SVTA 1ML3A 3KTDA 3O8QA 3S55A 4BIIA 3WQSB 4BNYA 1PGOA 3DZBA 4YTEA 3DEYX 3E1KA 5LDGA 1DRWA 3Q9UA 3OH8A 3WFIA 1KEVA 4LN1A 1ONPA 3D3EA 1NAHA 1EVZA 2JHFA 3I4FA 5COBA 4IMRA 4HFNA 5A9SA 1UZMA 1A7AA 4Q3CA 3NTOA 3V2GA 2WYWA 3M1LA 4R1UA 3CZMA 2O50A 3ENNA 2NADA 4JBHA 1I24A 1K0UA 3GRKA 3C24A 3HZZA 1XR3A 2P68A 3VKVA 2EP7A 4CLDA 4D3DA 5KKCA 1Q0LA 1YE3A 4OJNA 3RFTA 2B4RO 1MFZA 1N8KA 3WWZA 4JQCA 2GN9A 1PGNA 3FBTA 1CETA 4WUVA 3KLMX 3P5SA 3PHIA 2W4QA 5C5IA 5IDXA 3B20A 1YB1A 5FF9A 4DLLA 5JNLA 2X0IA 4CLOA 2NWQA 4IBOA 1YO6A 4B8WA 3JYNA 2NU9A 2XAAA 4WECA 1UAGA 4I9HA 2VZ9A 1DXYA 3NJ8A 4IDGA 3BYZA 4UVIA 2PD3A 1B7GO 4ZRMA 4JK3A 2QG4A 3E6AA 2VOEA 2IYPA 4P8RA 1UR5A 4I1IA 4R54A 4ZQFA 2X9GA 1B8UA 3ASUA 4INAA 3DAFA 1PJCA 1B15A 5LCXA 4ND1A 4PLCA 1B14A 1I10A 3DBRB 3ZWYA 2YHIB 2VT2A 1BTOA 3JYPA 3GZNA 2FRDA 2VOJA 1FDTA 1ZJYA 2RH4A 4HADA 2R00C 1T25A 2PR2A 2C59A 3UXYA 4B79A 1R6DA 1UUFA 3DOJA 1PQWA 2Q1SA 3PTZA 3ZWWA 1XGKA 4RZIA 4BNLA 2VHVA 3HE3A 2W2KB 2OL4A 1A7KA 3INGA 4W7IA 4HP8A 3SC6A 1LEHA 1HZJA 4LSWA 3A28A 1OOEA 3H9JA 5I8WA 4WPGA 5F3RA 3WJ7A 2Y1DA 3PP8A 2F1KA 4RVGA 2VUUA 4AJNA 4GX1A 2G0TA 1N9GA 1ZBQA 3ZV3A 4KUEA 4IINA 3PDUA 3AWDA 4FC6A 1E7RA 3K2EA 2PLAA 4GSKA 4CQMB 1M6WA 4M55A 1PS8A 3K8ZA 1ZH8A 3D5TA 2OUIA 2BGKA 4J4TA 3GRPA 4EEXA 3GVPA 5I8ZA 1LC3A 1U7TA 1Y9EA 3VVCA 3VHRA 4FB5A 4FGSA 2FPIA 2JFFA 2Q4EA 3K31A 5COAA 4WGGA 4PZDA 4O59O 4WLNA 4I5DA 1BVRA 4IJWA 7MDHA 1X7GA 4TMFA 4TZKA 5DP2A 3VH3A 4E0BA 1CF2O 2H6EA 5JSFA 3H5AA 2Q3EA 3Q1LA 4QX6A 1TXGA 3ZHXA 4HNGA 3VAZA 4NJMB 4J9VA 4BNJA 3HG7A 2R2GA 1EDZA 3PFWO 3H6KA 1XKQA 3QLJA 1DC4A 1ZK1A 3NT2A 5IF3A 1A9ZA 1NVTA 3FR7A 4LVCA 1A5ZA 3PGXA 4C4OA 2VRCD 3OIFA 5KVVA 3KYCA 3RC7A 4AG3A 4R16A 1S6YA 1HSOA 3WYCA 4KTTE 1QORA 3ZNQA 1WW8A 1BG6A 2AE1A 2OMEA 1B2LA 1H0KA 1NVGA 1TI7A 1ZEMA 4CV3A 2BF7A 1UP7A 3H9GA 4OSOA 1YXMA 1UXGA 2OP0A 1H2HA 4HWKA 2XOXA 2X23A 3KYDA 3H3FA 2B83A 1LDYA 2AXQA 5JY1A 1KY5A 4XGKA 4PVCA 4CMIB 1R4MB 3KEOA 1GY8A 1BW9A 1Y8RB 3A4VA 3K5PA 2OXIA 4E5MA 5G0SA 1C14A 5BT9A 1IPFA 3QV1A 4KTVE 4RLSA 4OXNA 1P44A 3NYWA 4BO8A 2O48X 3UH1A 4NR0A 2X9VA 5B37A 3ENKA 4J0FA 4J3FA 1K6JA 5JO0A 2HAEA 1PZEA 4JP3A 2ZB3A 4YCAA 1OFGA 1JN0A 4NIMA 4N5NA 3OJEA 4MVJE 2PA3A 3ZU2A 3ONDA 5TRTA 1J0XO 5B4VA 2HK9A 1B8PA 4WEQA 4FFPA 3MWDB 3HADA 4IXTA 3DWFA 2HK7A 3FR8A 1PQPA 5TJHA 2ZTMA 5DBFA 1RM4A 1T2DA 3TZQA 4CUZA 4PG4A 2PTGA 1NPTO 1GZ6A 1UJMA 3H2ZA 3HN7A 3OIGA 3STHA 4J1QA 7ADHA 2J8ZA 3GNQA 3EZLA 4QO8A 4TVOA 5L51A 3KM0A 3OIDA 1JAXA 1KC1A 2FY8A 1VKNA 4YACA 4ZD6A 1UAYA 3D4NA 2GUGA 1BWSA 5CG2A 1OAAA 1SOWA 2DVMA 4ID9A 3M1AA 4I5EA 1MV8A 5KVSA 1HLDA 5H83A 2I3AA 2DTEA 4R5MA 3QSGA 1KEPA 4NMHA 4FJ0A 1G6KA 5EESA 5MDHA 1U3UA 1DIHA 3OJOA 4NBTA 2V7PA 4QUKA 3VOSA 4D43A 4DC1A 4QTZA 1E3IA 3UOGA 3ZV4A 4TKMA 3DOOA 1QYVA 1HL3A 1DAPA 3LVFO 2B37A 4JN6B 4HKTA 3N7UA 1PJBA 5BNFA 1QV7A 1YB4A 3RD5A 5CG1A 4W4TA 2VYVD 1IY8A 1Z7EA 1GDHA 4WJZA 3UCFA 1QXSA 2PY6A 1ADCA 2HLPA 4FCCA 4BO3A 4MP3A 3FRJA 2NUAA 1Q1NA 1D8AA 2UYYA 4DMMA 4WCDA 3FNHA 3DTTA 1ZK4A 3ADOA 1O9BA 3JQAB 1L7DA 4AL4A 1HTBA 2O3UA 4A0SA 1IE3A 3U0BA 1ZSNA 4IXWA 4U5QA 4EGFA 3V1TC 2VWGA 1W6UA 2GO1A 1YL5A 5JDCC 4NBRA 2O3RA 5BQFA 4EUHA 4FFRA 4AJEA 1ZFNA 2BFMA 3IJPA 4IQ0A 4PFJA 5THKA 4BO1A 4XRGA 2O23A 1IHXA 2VCYA 2UDPA 2ZB8A 3L6DA 2X0NA 1E6UA 4M8SA 4YB8A 5DCUA 2P9CA 4DA9A 4ESOA 2DT5A 3FWZA 2PGJA 1DOHA 1F8GA 2YQ4A 3RBZA 3TL3A 3CIFA 1ULUA 1N1GA 4FDAA 5BSGA 3RBXA 3TNLA 3CXRA 3LYLA 1TA4A 1DC5A 3I23A 2UAGA 3NTRA 4EJ6A 2CFCA 4AJIA 4XYGA 4OM8A 4RF4A 4LGVA 1XQ1A 3JSAA 5HS4A 2ZQYA 4R5HA 1V35A 4MVJG 1KEWA 4GVLA 5HM8A 1ZVMA 2O3JA 3EMKA 4KWHA 3TL2A 2ZTVA 2F00A 3S2EA 2NACA 4PIVA 2O3QA 4XQCA 3FNEA 4BNVA 4D3SA 5A5FA 3NJ4A 3IP3A 4YQZA 3RJ9A 4D45A 4YJHB 4IGFA 2B5VA 3BMOA 4UAGA 1RJWA 4RF3A 3SJ7A 2IEDA 2RHRA 2WM3A 5L4LA 1PEDA 3F1KA 4CM4B 3GGGA 2GRAA 1PL7A 3UN1A 3ON5A 4Y9DA 4DC0A 3PVZA 3GK3A 1WP4A 3LT0A 1P74A 2CD9A 2VQ3A 4WE3A 1XLTA 3I6IA 4RO0A 4GWKA 1E1NA 2A92A 2OBYA 2DTXA 1LNQA 2EGHA 4P4GA 2JD1A 2Y1FA 1I2ZA 1O95A 2JJYA 3VDQA 4WCFB 3AU8A 2NTJA 2FWMX 5ENDA 3GDFA 4GH5A 4TRJA 1ISGA 3ONEA 2IXAA 1FDUA 3P19A 1RYDA 1PIWA
chains in the Genus database with same CATH superfamily
2FFJA 1Z17A 2UVPB 4BOYA 2DFVA 1J2EA 3CS3A 3AI2A 4FOOA 3R0VA 1KE1A 1RW4A 4WKPA 4W9MC 2BTQB 3OFSA 4N82A 2OD9A 2XQJA 2XOKA 3AJDA 3MTDA 3QVOA 1TGYA 3PB3A 1KL7A 2BRUA 1P2GA 1TTHA 2EF1A 2HA6A 2J46A 3BWBA 3N58A 1K97A 3FMFA 5CA0B 5FAKA 1F1JA 2XD9A 1DFGA 4LRTB 3NNNA 4CM9A 1KH2A 4FOSA 5D7NA 1ONSA 1N9ZA 1M10A 2IVZA 4Q34A 4WERA 4YRRA 3WRXC 1TYZA 1HLFA 3I0NA 1DJNA 3EQ9A 2ZIVB 4FFWA 1OF1A 2SKCA 3DMRA 3F3YA 4KVAA 3ML1A 3GVXA 4RHUA 1TUBA 3PXAA 3HM9A 3AKYA 4QJ3A 2FN4A 4WA7A 2LNDA 4PONA 4BO4A 4Y30A 3RUEA 3N2GB 4AZWA 3KT8A 3MYYA 4FR5A 2FWRA 1Y80A 5BQOA 1KGSA 4ZYLA 1Z62A 5C8DA 4JUFA 3WWPA 2DCMA 2ROQA 4KIWA 1EQUA 4FEAA 5TNXA 3CVUA 1B6GA 1U0JA 2YHUA 2P75A 3UAOA 2ZIEA 3T1HB 3VYUB 1IN6A 4FS8A 4ZQEA 3CR7A 2HCFA 1J09A 1CUWA 1DBQA 1DV2A 2IDZA 3EQ7A 4JI5B 4ITUA 3RSCA 3VPBA 3HBNA 2A1UB 3KOMA 4HVLA 4K46A 4OX9Y 2VJAA 1UWVA 1UT8A 4NNPA 3LO8A 3KQVA 2C42A 1I3KA 3ULKA 2V6JA 3IP8A 3BXFA 3KZKA 1NJSA 2VUSA 2ZBQA 4RF5A 4XUGB 4AF6A 4D0GA 3MWEA 5IAJA 5GONF 1RLJA 1YS6A 4MW0A 1T3LA 1LLUA 4WNYA 3NVKI 3KQYA 4PLFA 4ZI3A 3R8XA 1ETHA 1G8HA 3PHBE 3UJPA 3KEMA 1NQOA 4LJAA 3H5NA 5LA6A 2OC4A 3ANNA 2GLTA 1ZVJA 1XEFA 4UUOA 2B25A 5IANA 1JR3D 2J9RA 4Y7CA 5DGIA 1M2WA 2FSIA 3PQ7A 4XPZA 3W79A 1NMXA 1WLYA 3N2EA 1GCGA 5ALSA 3CLRD 1T6ZA 3O2NA 1V11A 5FV7A 2FMHA 3INYA 2YXEA 4GYJA 2ZS7A 1T9CA 2VSFA 4IDOA 1Z5NA 4KVGA 4PGAA 2WSSD 5D7BA 4ZAVA 3L8HA 1N5LA 1PUXA 1GA4A 3HUEA 2CY0A 4TQUS 4E5PA 1IOLA 3W5DA 4RLHA 3PQDA 2QZSA 4UEQA 2VBFA 1GXSA 5AJUA 5ALKA 4TMYA 5HG0A 5CAEB 2BIFA 2QXTA 2WAMA 3CLTC 4WHMA 5TB5A 5KYYA 4Z0TA 3FUTA 2IWHA 3OJ0A 1Y89A 1MHTA 1SXJB 1XUOA 4MYCA 3DMTA 1RAEA 1K89A 3I9V1 4YRKA 3R3HA 2ZREA 1VXRA 4P4NA 2A5DA 3VYTB 5B36A 4MAAA 2R751 2IH4A 3GLGE 2DHDA 2QNBA 2QUZA 3MB8A 1FXWF 4YJGB 2FMTA 3SBOA 2FUNB 4FMBB 3V33A 4N6OA 5T7BA 3VHXB 2CDCA 4UBIA 1N33B 4AWBA 3PKJA 4BFLA 1LWNA 1UKAA 4JB2A 1M2OB 3ZR4B 4V0MA 5CX1A 4IF4A 3ASZA 3KUUA 1KJYA 1WL8A 3PU6A 3Q6NA 5IWAB 3L2OB 4O3MA 3L9WA 1WY5A 4R1LA 3H5WA 3LPCA 5KQMA 4UC0A 5JWOA 2ZDQA 1CZNA 1DKLA 2ZYHA 1QVZA 2QXYA 3RREA 1T34A 3W8FA 1YK0A 3QJYA 2VS1A 1QIJA 3FPBA 5DPMA 4F4DA 3Q2KA 5FQOA 2OZVA 2VTBB 1H1LA 2Z4RA 1I1QB 3HY3A 4M49A 1JNXX 1PKEA 4KDCA 1F2TB 4FYHA 4HTFA 4WGFA 5E4FA 1ZIOA 4L8YA 1Y6QA 5EIHA 1EVKA 2WB2A 1I1NA 2XB6A 3CC8A 3UMRA 3TAHA 3UGJA 3MLAA 4C5AA 3NPMA 5ALPA 1YB6A 2DJIA 1TT7A 2HTEA 3OQOA 1QGUB 2Y0BA 5H80A 1A2KC 3LY7A 1N7HA 1Q44A 2Q0HA 1GQQA 1ZNZA 1IRXA 3PJEA 2WVAA 3VFDA 1YB2A 1ZJ4A 1ZXLA 5DU2A 4B6RA 4EHFA 1D07A 3LI2A 4JA0A 2CBGA 5J2TF 3SLKA 2K2WA 1J42A 3STXA 1Q3KA 2Q9UA 4KRYA 1EFRA 3NGLA 1C7QA 1CEYA 5AQ1A 4YNBA 1E62A 3KWLA 3HEAA 3I52A 4JX9A 5BV2P 3D43A 5JEEA 4B3MB 1P8AA 3L6UA 3LLUA 2C5AA 4V39A 2COKA 4Q3OA 4A0FA 4MVJI 3TCXB 3ECAA 2JGAA 1BHO1 2B3DA 5BURA 3IP7A 3TSYA 1LSOA 2V6IA 3KSZO 3GPBA 1DINA 2GWRA 1H8EA 3CW2A 2VA8A 4H15A 5F2NA 4XWTA 1AKEA 1MRSA 3AWIA 3AZQA 1XTKA 3Q6IA 4F3KA 3K70D 2Q29A 5CR9A 1P1RA 4CMKA 2I6FA 2MYTA 3FAKA 4EB0A 2UVQA 3WZMA 1TTTA 2L2QA 2UZ4A 5AI6A 2Q2VA 4QA9A 2P9JA 4HRVA 4IXMA 1SRQA 3SK0A 1KYYA 4EVQA 2WHXA 3CMCO 4A8JB 4DSTA 5BW8A 2CXHA 7AT1A 4TQAA 3W2HA 3WK4A 1NJ2A 4E1VA 5J4KA 2Z09A 1E6WA 4JLOA 4ABTA 1REQA 4CLOB 3QWAA 4AUMA 3U37A 4QPCA 1D8TA 1DTSA 1FFAA 3C3YA 3VYSB 4G0VA 1J39A 4LQCA 1VKZA 4M1MA 3UUFA 1WUJS 3FW1A 5U4QA 1J7KA 2Y4NA 1SCKA 3A26A 5B1YA 4HGNA 3C7AA 3EVGA 4JT9A 3FPCA 3V2HA 1SIUA 4LMRA 2ZGVA 4QSMA 5LN1A 1AGXA 1K06A 2OGWA 3JRWA 4RE5A 3PHHA 3THXB 3D1VA 3HJHA 3LYAA 2JLCA 3IXLA 5GWXA 5JCPA 1B8VA 2CMGA 3D7SA 1EVYA 3ETHA 1FNBA 4BVAA 1Z7BA 2EJCA 2PKCA 1CRQA 1FVHA 1FBTA 2ZAMA 3EF3A 3EDMA 4MDHA 2ZT6A 4MV6A 1S02A 2P90A 1AHNA 2VPIA 4IM7A 4X3PA 1NBHA 2ZM6B 3WGOA 1MVOA 4UCWA 1MDFA 1FP6A 1GU0A 1MIOA 4EX6A 5KEIA 1AQUA 2RJNA 1FVOA 4KQKA 3WMEA 4J0QA 4YMGA 4A26A 3PDHA 5BQPA 2IXEA 1QIEA 2BEWA 2XCLA 3HB4X 4LX8A 5K51A 2QIPA 4EO9A 1SM4A 5IC4A 1SUCA 5EERA 1HI9A 2ON6A 3OCJA 5F33A 4K1XA 1E2KA 5HIJA 4GI3A 2ORVA 3C8MA 2BMDA 3GWGA 1QHIA 3IO3A 4RVDA 3E70C 4NBNA 4ZEXA 5LQSA 1Z5ZA 2GLUA 4IH9A 3NHAA 3UHJA 3VDNB 1E2LA 4J1NA 3WGYA 4Y67A 4DQKA 1F8UA 4X45A 2XZDA 2XJ4A 2ZCUA 5TT0A 2JAPA 3EQ8A 1AB6A 3Q5EA 1ONOA 2GXAA 4FHEA 3GPLA 4OHKA 4ABYA 3FCYA 3D7NA 3TX6A 2O2YA 1BEEA 2FX2A 3OKCA 4WZAE 5TMPA 4IWNA 1LBSA 2QPTA 1V7CA 1ZESA 4BRSA 5I7EA 3GJRA 3ZIUA 4TMVA 2H2HA 2CV0A 1O8CA 1EWQA 1BQ4A 1IZ9A 1P7ZA 2G6BA 2HSGA 4KWEA 1GRRA 4G0XA 1E2HA 2XKJE 1NW4A 3Q3JB 4FGJA 4P7KA 4F6CA 5TS2A 3FCXA 4RYLA 2HCTA 3ETJA 4AY5A 4TL7A 2WJ4A 4Z54A 2DPMA 1YZYA 5TIIA 1KP9A 3UANA 4G4JA 1JJFA 3A1DA 5JCOC 1JSCA 5CM9C 3KB2A 1HXHA 2NZJA 3BWYA 5DSXA 4H31A 3OHSX 3YASA 3A4LA 3L6BA 2Q6LA 1TM4E 3UWDA 3O92A 2E9SA 1MG5A 2JGKA 3GVCA 3II6X 3RKSA 1BX0A 2JFVA 4MKRA 3STYA 2X15A 1OC2A 3RSZA 2GCIA 4IIGA 1Q1AA 1UBOS 2YNMD 2JL1A 2JASA 5KNCD 2Q3LA 4LXYA 4PWYA 4UM9B 3PRJA 7ABPA 1NBOA 1Q7CA 3G7NA 4Z4CA 4NDAA 1NR1A 3DT9A 3F2VA 3GGDA 2IOQA 2YXDA 4URYR 5JJCA 3BMQA 3DM5A 1GTL1 1OJLA 2VZ8A 4CU2A 1K68A 4PSVA 3VUFA 5LM3A 3QUTA 2PL1A 1YONA 1H2BA 3GFQA 3O9ZA 2WP0A 3DBLA 3L7BA 4AQDA 2E87A 4W6QA 5HKBA 1IN5A 1YR3A 3JD0A 3L0CA 3ICOA 4FHCA 1TTPB 4L6IA 2BSXA 2AMVA 1YC2A 3OMXA 3CPSA 1A8UA 1LPOA 3N2LA 4EUEA 5JWHA 5G40A 3Q85A 3IUYA 4B8ZA 3RVMA 1YL6A 5ES4B 1Z6ZA 4HLUC 5HF8A 5CCEA 2MWMA 3DE0X 1I4DD 4UMEA 4YA6A 2IX3A 1AF7A 2JD2A 4DF3A 4D42A 2ZUWA 3GD7A 1SEVA 4RV9A 1FNMA 2CVZA 4OBEA 5DX1A 4TUYF 4H4DA 3C16C 3QFCA 3DDHA 1HPLA 5HHTA 5JCJD 1SVIA 2DUJA 2C2HA 1MOQA 1YAJA 2IKQA 3CNLA 4UPDA 1BW9B 1WCV1 5H59A 1BQEA 1WG8A 2PV7A 3MTGA 2F8TA 2I1WA 2EZTA 3GT0A 3EHEA 3KT0A 4Q5IA 4H7IA 2FI1A 4HWTA 2QW1A 3PEEA 4YYZA 5GZ6A 5DBGA 3AVWA 5DSZA 3GFGA 4FSXA 3DHNA 2JA1A 3P5BA 2NO5A 4G9EA 4N0MA 3T34A 3PYMA 5AW8A 1W85B 3B9BA 3SIXA 2FSSA 2PXXA 2NP6A 1E1RA 2ZATA 4RZQA 3LOPA 1UEJA 1NMSA 2XUAA 2XUHA 4H4CA 1RLIA 1V5EA 2ZJZA 2Q4DA 4N12A 4Q1DA 3QKWA 4U2EA 3E5RA 3U26A 4KKXB 3PNYA 1RAIA 2QY6A 5CT5A 1GZUA 4Y9SA 1UKYA 2C94A 4Q6BA 1EESA 1Z7GA 3NASA 2VHXA 1JAHA 3ZNNA 4DHEA 1JKJA 4NDNE 4QVKA 3RYCA 3SBDA 1UMCA 1M1NB 3LQFA 3O38A 3TN7A 2RFLA 1SG6A 2AG6A 4L0QA 1XEWY 4F9TA 1R3DA 1RQ7A 1VGVA 2XYQA 3KEFA 3LXRA 1AGPA 2J5KA 4G5RA 4TMKA 4C2UA 5EUBA 2OM6A 4F85A 4DR7B 1WV1A 1V8BA 5CDTA 1ODJA 5I7HA 3MS2A 1L3IA 2VDKB 2PCJA 3R5XA 5E2BA 2QZZA 2NAPA 5TV2A 1W52X 4HX9A 4V0LA 3C3XA 3FCOA 1CDEA 1A4IA 1F8YA 1PNTA 4UU8A 1JLKA 5FAXA 3ZV6A 4JOQA 5A5VA 3LL7A 2V1UA 2BFDA 3CONA 3EIQA 2QD2A 2C8JA 4ZO7A 4L4SA 4MVJM 1JP7A 4D1YA 1ULHA 1RQPA 2FZGA 3I64A 4OGKA 4AKGA 4ZVUA 3MJHA 4GMGA 3UB3A 1QJCA 1J0AA 1N7IA 1YTLA 4HMQA 4KXXA 3AEKA 2O59A 3FOAA 2VBCA 1D6JA 2HL6A 1D4OA 4RPHA 1Z4PX 2VHCA 1P4AA 3SN6A 2GAJA 4LSMA 4PGMA 3MOIA 4EY3A 3L04A 1LPSA 5GONB 1QS0B 2QVXX 1Y4SA 1OPXA 5KWSA 3EX7C 2AKAB 3OTGA 5B3LA 4UM8B 2UYCA 3THYA 2Z4SA 1WV0A 2OHXA 4U4AA 3SU8A 3M5CA 3AFIA 3DFUA 1XHEA 3FZEA 3K5HA 3MAJA 1TVKA 4HDKA 4M38A 4R6WA 4K28A 5FUWA 5BSMA 3EZFA 3KJZA 3W5HA 5L3ZA 4F8YA 4R41A 5C8XA 3MTJA 2GDZA 3SJCA 4I1PA 1CULC 3PQFA 3ZUPA 4AY4A 3H3JA 3ICCA 5BUQA 1TZ2A 3F46A 2BR4A 3BXHA 3DQQA 2XYRA 4RWZA 1EEHA 1KFCB 1RHKA 2G72A 5JZMA 1Y4AE 5KVCA 5BNTA 3IL2A 1XTBA 1BFKA 1C7IA 3T8YA 2WU4A 4S35A 4V0KA 2ORWA 1OILA 1Q15A 1WR8A 1NUAA 1GTMA 1K92A 2PA0A 1MQ8B 1C4OA 1M9NA 3B6ZA 4I55F 4Y0NA 3RIMA 2VXBA 4MRMA 1M1YB 3RHZA 2PQ2A 3SM9A 1XMPA 2WAYA 4XVUA 4ZT3A 3IPYA 4L95C 4C6HA 3NKLA 1BHJA 1VYTA 4D74A 1ST2A 1VSUA 3V97A 5IFKA 1TO2E 1OREA 4IIFA 5TEVA 1GADO 1ORHA 4L50A 4JGBA 4OU5A 1MUUA 3I37X 1NW7A 4KUGA 4DQUA 2IODA 1B0ZA 1M6HA 1ZJ5A 3HK2A 3A1EA 3JTEA 2MINA 5CX4A 2BHTA 1SIWA 2GEUA 3ACCA 1R0KA 4TWBA 1E1QA 1BC5A 1Z0FA 4UNNA 1AS0A 2O8VA 3IPAA 3K30A 3O75A 1OXKB 2OCIA 2H7YA 2HRRA 3K9LA 5FI0B 4F91B 2QLTA 1OTHA 4JX8A 4MRAA 3HYSA 5H70A 3ESBA 1E4YA 3ZHVA 3MINA 1N8SA 2FPPA 4JYPA 4TTSA 1T1JA 1N2HA 1NFRA 5EXSA 4CFZA 2AA3A 3NTUA 4Q7LA 1CQIA 5LMUB 4LZOA 2VG8A 4PHGA 4B4KA 3UMYA 1X70A 2ASVA 3R7SA 1E18A 3NEJA 1EFLA 4XVCA 5CB0A 4G89A 1A5SB 1LDGA 3CN7A 3MCVA 1VCHA 3BRWA 3IDQA 3CCFA 4JUDX 1AJEA 4PLTA 1XKTA 4MW5A 3IUNA 4PG6A 4QG7A 4XVHA 5I4CA 5L6LB 2W70A 5CA1F 2Z5FA 3EOZA 1XZLA 2UYQA 1JPVA 4QTUB 1YBVA 3K94A 4N76A 3GARA 1YZQA 1DC6A 2AQIA 5T4BA 1M6VA 1ZGHA 4XDYA 1PRYA 5DT2A 3AI3A 2R87A 4M1EA 3HJFA 3H2JA 3OEED 5LQNA 1LI5A 1X8JA 2CDAA 1F5NA 3OE4A 1I4OA 3GRUA 4IJKA 1V6AA 5CJ2A 3U62A 5HUJA 3LPMA 4DOMA 1ISFA 3L4BC 3LK7A 1QG6A 4MV1A 5D01A 1XVVA 5AWFC 1XC7A 3FA2A 5J2TB 2XDQB 3HJRA 2HA2A 4A15A 3FMIA 4LBZA 4ER3A 4NSNA 2CLCX 3NV7A 3OUUA 4L5AA 3WYNA 2YZ7A 1C0EA 3I62A 1LI7A 4CEJA 5I48A 4M4SA 2E5LB 3TLYA 3W6UA 1LH0A 1ZD9A 2OAQ1 1QG0A 2I2XB 3FOWA 3DDCA 2CXOA 4FQ5A 5LOVA 1DTWB 3E03A 1VDZA 1GQYA 2JCXA 4FSHA 1KY2A 4E94A 3FVWA 3P4XA 3UV3A 3G2JA 2ACEA 4N01A 3R0JA 2WUDA 4MWOA 4XTRA 2BFPA 3C6XA 1XSEA 4F5ZA 5JTUA 3OKFA 2O8CA 4A2PA 3DKIA 2E3JA 3IR7A 1M2EA 4UOQA 1DOZA 3QU7A 2YJ3A 3DBVO 3I2IA 3A6KA 3KAKA 5K3CA 5C1DA 3PX7A 3U4AA 3M3HA 2O54A 1T0PA 1VLZA 4OL9A 5KX5A 1KE2A 4JSYA 4QBHA 1Q91A 3PI7A 4X20A 3ID6C 1H05A 5I9LA 3ZNPA 3DTVA 4YBZA 2WLTA 2OBXA 4HDOB 3AJEA 3HR8A 2IV2X 1IVSA 4XWAA 1E89A 3BAZA 4FR2A 3K5WA 1U8FO 3KQPA 1BCRA 5A9RA 2FXIA 4PZ9A 2NM0A 4MQFA 1VOTA 5IH7A 3TMYA 5IVHA 1DRVA 2AK3A 2AZMA 3TB6A 1R88A 3MILA 1NSFA 1S89A 2YFQA 3CA8A 3QX9A 1X1SA 3R9KA 1VJCA 3NHWA 1EUDB 2DBVO 1UOOA 2IPAB 4IZHA 4N40A 2G1UA 5LBTA 2H0QA 5AW4A 5HFNA 2IPXA 3AR4A 3K9GA 5C8YA 3AXTA 3O8LA 4HXFB 2CNKA 4ZCPA 3S1AA 1G4UR 1BQ3A 4E31A 3G59A 3OOWA 4G65A 2QPAA 1PTKA 4OA5A 5CUQA 1ELOA 5AJHA 1DIGA 1SVOA 4HR7A 1GPJA 4N5HX 4WNIA 3GFBA 3HU1A 3ES9A 3IAUA 1HF3A 1UBSB 4K6OA 3TSWA 5BWNA 5IUJC 4EECA 4N41A 3CR3C 2C0QA 4XB1A 2PXAA 3H8VA 2H3EA 3E22B 4JP8A 4RDCA 2C83A 2GAFA 3W8DA 5T4EA 4B3DA 4QXRA 2GZ3A 3V34A 2DFTA 5I9TA 1G55A 3BF7A 3QF4B 3U1TA 3JQ8B 3SLGA 4GUDA 5EZSA 3RC3A 5E6SB 4J6EA 1K88A 2FUG6 2JBAB 4O8CA 4BGVA 4BJHB 1J2JA 3VPFA 5MN6A 3F5QA 1QFZA 3COYA 2OEPA 3PUZA 2NP7A 3ZXYA 1L5NA 1J0CA 2F43B 4BQOA 3LX8A 1A2BA 2PS9A 3LOUA 4E30A 3HB5X 4J4BA 2F3UA 1XDSA 4GXQA 4B4WA 4MUYA 3IXMA 2RHCA 3WMWA 3PL5A 3KKZA 3MGGA 3DTYA 4AUNA 4CKWB 1VHQA 4JELA 1TKCA 3FLMA 3FTPA 9LDBA 1O0CA 2JJ2A 2W6QA 3D1LA 3EN0A 3TZHA 3BDVA 4FHDA 2R96A 1QQ6A 1TMOA 4MINA 5HE9A 4O2AF 3FNRA 5J1SB 2D5LA 3EZ6A 1O5TA 3O95A 4PYJA 5FLXA 3D4BA 1JV2B 3AY7A 3VH2A 1S4QA 4I50A 2IEIA 2WUGA 5K3FB 4BX3A 5KTPA 2QV7A 1AZLA 1CFJA 1N92A 5EKXA 4RPIA 3KQMA 1YFJA 2FZCA 5IAGA 3K9QO 4RHCA 4MI9A 3O3MB 4UBOA 4DM4A 2QYTA 4F9EA 3PL1A 5T3YA 1WF3A 4EBFA 2IY9A 3HYNA 3QKTA 4MUNA 1VE7A 4RPCA 1Q19A 2C5HA 1RJGA 3IMKA 2F2TA 4HDNB 1YB5A 2VDNB 4NMLA 4ZVLA 4ZPJA 5C5CA 1V0JA 2P2DA 4Q4JB 3ZS8A 3HM2A 1FBNA 3CUWA 4RQTA 2FWJA 4PLWA 4NU5A 3LG2A 1A95A 1VBKA 5EE1A 2IU0A 4I8XA 2C7VA 1EI9A 2BEUB 3DZIA 3TECE 3PWZA 2V7TA 1I5EA 1X3SA 2E4AA 1UCFA 1BROA 3DV2A 3PXEA 5JMPA 5D3QA 3ZIAD 4RJ2A 3U16A 2WUFA 2EC5A 4LXUA 5BMOA 3KAPA 1R6XA 1UPBA 3C4VA 3I92A 3N8IA 1OX5A 3AEYA 1LNSA 5T6MA 4YALA 3E0XA 4PC7A 4IMIB 4HGQA 1PE0A 1ZH6A 3GPDG 3RSFA 5GIPE 1Q12A 1PG5A 3PUKA 1MV5A 2AMJA 2WDZA 2Z57A 2D0IA 2H63A 1PLLA 4YROA 5EHQA 2RJOA 3BXPA 3VC2A 4KEAA 1QBKC 1GT91 4FONA 5DISB 4A0QA 1K7FB 1XD8A 1HE2A 1XTTA 2VATA 3OQIA 3EGIA 2J3IA 1K5HA 4HWPA 2SCUA 4YONB 1EFVA 2CWWA 2JH8A 5EQTA 3ZZ1A 1ZK2A 4DLRA 1H9AA 3FWPA 3CLKA 2HRDA 2HJSA 1TQDA 4XCXA 4CMCA 3WC4A 3BE6A 1KVQA 2WFZA 4K6KA 3WTBA 3RO7A 3LIPA 2X5OA 4GG1A 3HCRA 4PXAA 4PRLA 1WZNA 2MR5A 3R76A 5BORA 2FW6A 4PRYA 4TKLA 4UNQA 4K0KB 2QGNA 4TUYB 2YRWA 4WKNA 3SHWA 3M6LA 4W5QA 1HE4A 2P2LA 2QAIA 3RT7A 3O1IC 1GUDA 3OM0A 4OP2A 5LDDC 1HETA 1QH8A 4IHAA 3BWMA 2WF7A 3V5NA 4H0CA 3WLLA 4DVGA 4ZV4A 1I2DA 3R6WA 2Y0PA 1DWUA 1W9MA 3HS3A 2HFKA 3C3AA 2K5UA 4IDDA 3H04A 3DV9A 1GZDA 2RH8A 4JOSA 3SQXA 1EA7A 1AZSC 1YJBA 2H0RA 4Z7NB 3BRQA 4X64B 1FFEA 2J07A 3EDYA 5CM8B 4XLLA 3IDZA 5AT1A 2G9ZA 2MIIA 1Z82A 2WHPB 3OJCA 1XZGA 2A67A 5BXQC 3DMHA 3P9NA 1NI5A 1AV7A 4BV2A 2I34A 1ZIXA 2GMWA 3T9EA 3REOA 3ZZMA 5JDIC 4DJFC 3EXAA 3OQBA 1ZUWA 1CNMA 3GN2A 1FUYB 4MP6A 1L6IA 3DSRA 2F4NA 4PLGA 4WDRA 3ZD8A 3CPHA 5FPPA 2XXBA 2Q3CA 1XZQA 3EIXA 1TJ4A 3FSRA 5HQTA 1M67A 1K98A 2OG1A 5JQGA 2IY8A 3H9EO 1E0JA 3PWSA 2JIZD 1GUZA 4P0QB 2O14A 3QKSA 3KIPA 3DFKA 3NUQA 4HPXB 1T4DA 5LQCA 2W6JA 2ZYVX 2K7ZA 2QRGA 3CG4A 3OESA 3ITDA 4XGIA 3W5BA 1XPUA 3KTFA 5IRCD 2GN6A 1BSVA 1C50A 5CMLA 3O90A 3EGEA 1MRZA 1XMVA 2QENA 3OPQA 4MUAA 2CFTA 521PA 4HVAA 1SBNE 1GGFA 4HY3A 3AFOA 5ELMA 1I14A 2QM8A 2X7XA 1PEAA 3PIDA 1H6BA 4GMHA 3G49A 1P7VA 2C78A 3OOJA 4MJXA 4OI2A 4U0JA 4EYOA 1D2RA 2Y93A 2O2EA 4J2HA 3UAVA 3JQGB 2C96A 4TMZA 3DBIA 4I8IA 4Z99A 1ZX1A 3JQCA 2JJ1A 2XMRA 2WAAA 4DV0B 4DA7A 2HYDA 4OKSA 2L69A 1TPYA 4KOAA 2TYSB 4BO0A 2EHJA 4QHYA 5F2KA 3EA0A 5ALIA 4NESA 3OURA 5A3QA 1J99A 1MTZA 2GHTA 1L5OA 3P26A 2P35A 4GMDA 4FDUA 5IK2A 3QEAZ 4YCDA 2OO3A 3NYRA 3D7KA 5A4KA 3CX7A 2F59A 4MI3A 3R0XA 2X19A 4OMCA 1BJKA 2YWHA 5DMHA 2XRYA 3HKCB 1Q0QA 5KTMA 3K9NA 3T4PA 3P94A 4DIUA 2VSQA 3NCTA 1UBGA 3NP7A 4P53A 3UYKA 1ZGCA 2DMRA 3B2QA 2A94A 4R1TA 4BAZA 2JW5A 4DV6B 2YXLA 2XGJA 2RGNC 5LWQA 4P7JA 2I6GA 4DMLA 2RK6A 4I55B 2EKLA 1N5OX 1BXZA 4RA9B 2FSFA 3DULA 3UAZA 2SHKA 4AQ7A 1UIMA 4ZI5A 1OUMA 4KXWA 5CK4A 4Z9BA 1ZU5A 4KGVA 3SYTA 5JECA 4WESB 2QE7D 2JCSA 5A6SB 4ZDKA 4KNWA 4JLPA 1T2VA 1JWAB 1QH0A 2XCIA 2H92A 5LZ7A 4BWYA 2XUGA 4JLJA 2NV0A 1S0UA 3M4XA 4MR9B 2H06A 5EVJA 3C3KA 4QXMA 4IDEA 3HP1A 3Q8WA 4RH1A 1E9RA 4MVJP 2AXEA 4CDNA 5KDOA 2CUNA 1MMFB 1BWRA 2F4VB 3UT5A 5THQA 3RABA 3DBHA 3H83A 1VRWA 4V1CA 1EH5A 3F8TA 4RA6A 1WQ4A 4L8FA 4JLDA 4J0EA 1CUIA 4J2TA 1I6KA 4MA4A 4BQRA 1VHTA 3OCZA 2O8DB 4YRBA 1C7JA 2CW5A 2GDJA 1Z36A 2EEPA 2QJTA 4BNHA 2ZT7A 3LWNA 3CMMA 3FMGA 4J75A 1JTFA 2ZSFA 5EG5A 3D6JA 5A2GA 1KZ6A 2MJLA 1CZLA 3LY5A 4HDMB 4LQLA 4DS3A 2Z9BA 1XCBA 2E82A 5DNWA 2JGRA 3E82A 4YMTA 1OGYA 4P6VF 3M33A 1WPQA 2HRCA 2QT9A 5DXJA 5F1YA 2GK7A 3NVMB 3NUZA 1NNUA 1W4CA 5IYZF 4FGUA 4H1VA 2D1QA 3SZUA 4AICA 4IZIA 4OU4A 3EUEA 3NJRA 3SOZA 2DAPA 5COQA 2HHCA 2ADMA 2AOTB 3FRHA 3QU4A 3VNVA 3LU1A 4ZGWA 1FOEB 5CA1B 1U8CB 3LCJA 3OVMA 1TM3E 4UVDA 1TECE 3PX2A 1G3UA 3EGDB 4DLUA 3ZWMA 3WYBA 2PL5A 4CVNA 5CFMA 5FTJA 4PO9A 3K6KA 2DPHA 4GOND 5E4JA 5FOXA 4E6PA 4BYMA 121PA 4AJJA 1U5CA 5JJBA 4L8GA 1YIDA 3QFHA 4HZUB 4XPIB 1I1OA 4R8KA 4IRXA 3WB2A 4EEZA 2XRFA 1LW7A 3MRXA 2ATVA 2FUEA 4WTOA 4UZSA 5B3JA 3ZOKA 2HNBA 3K4HA 1ORWA 1Y3AA 1IMOA 1ZAKA 3BCHA 2ZZNA 5BSHA 1FRNA 1I2CA 3ESRA 3VPGA 4OBWA 2FYTA 2R6GA 2XEDA 3HO1A 1VMEA 2ZBUA 1GPMA 3A4YA 5EIOA 1UJNA 4U02A 3ROKA 1CY8A 1Z2PX 3ADPA 2ZXEA 4NHEA 3VKUA 3CEMA 4JUCA 2BKUA 4QNMA 3NM6B 5CNKA 4DTCA 4HN4B 2PUAA 1J4AA 1N2SA 2ZIZA 3VPCA 2OHJA 5TS3A 3RF6A 5BWOA 3G23A 4ED9A 3CKYA 3KZOA 2R66A 4J7XA 4C04A 2IP4A 5I7SA 4M0UA 3H42B 1F7VA 4N6NA 1K5GA 2LRHA 3BCRA 3W8EA 3LSTA 3SBXA 4C7VA 1CDZA 1L4UA 4D3FA 2AJCA 4R8LA 1JDBB 1M2GA 2WK1A 2Y1CA 4ZYYA 2Y6UA 3N7TA 2P0AA 4DLNA 3CGWA 3ZV5A 1FMJA 1JG7A 1G7SA 3G17A 3IMGA 3G8BA 1ZIPA 1QGOA 4U9UA 3IRUA 3WQBA 1SRRA 3U7EB 2FP4A 2CNDA 1MEEA 1V16A 2Q4BA 3E58A 1RYEA 4ZV7A 5JNVA 5KNLA 1DQSA 1V8ZA 4HYEA 4EH1A 1D0SA 1WCYA 3DDZX 3U7FB 1EHIA 2H2WA 2NVUA 1YULA 3KLBA 4FGKA 4XA8A 2GASA 5LMZA 5KQRA 1QG2A 3FKSD 1SXJC 1NNLA 3TRHA 4CPDA 2Z5LA 4XDZA 5LC1A 4XYLA 4QBIA 1NONA 4RK4A 2B8TA 4Y6PA 5A1JA 2BUCA 1Y3HA 2J59A 4ENSA 3P4YA 3WL3A 4CGYA 4F04A 4FBMA 4H9GA 4Q1EA 4K9OA 3SVLA 2ID4A 3W3AH 2OV8A 4F97A 2NO4A 3CJRA 2I8CA 3ZBPA 1MVLA 1ZHOA 1RQRA 4WA8A 1AOXA 4JAVC 2OLEA 1UBUS 2APJA 1CFZA 1BMFD 5B1HA 4BTLA 2GB4A 1V39A 4L78A 3BORA 3K6SA 5U9CA 3WXBA 3LNTA 4B0OA 2IYOA 5BUZA 1KJ8A 1KDOA 4R83A 4LOKA 3WL5A 3ZJVA 1SPXA 2PGOA 2VI5A 4X1KB 3TUIC 3P2YA 5EY5B 2I65A 4CM8A 4PCUA 3JV7A 2IE8A 2BUAA 2J5BA 3O1LA 4L4RA 5HMMA 1CERA 3ROGA 3E84A 3SYKA 3F5DA 5C32A 4C06A 3Q3EA 1XAHA 2XPCA 3AOEC 5I7UA 1QSGA 4HT3B 3ITEA 3ZDQA 2FWBA 1H3FA 3RC9A 3BL8A 5HQ3A 1KWKA 5FADA 5ALTA 1B1AA 3FCCA 2YJGA 5AKYA 1L2TA 2B3TA 2G9RA 2I55A 2ZSBA 3U5TA 1WVIA 3RIYA 3DFFA 3KJGA 2QUKA 1E4OA 4Q3BA 2HCJB 2YRXA 3VDMA 3ADBA 3WLEA 4BCCA 1OB5A 2Y1KA 5KYUA 3GT4A 3UV7A 3NATA 3PHJA 2W6MA 3F4KA 4XGQA 2ZIWB 3C3DA 1E3SA 2AZDA 5JYBA 1K8XB 1GITA 3TD2A 4KYTA 3NPAA 4UD2A 4RJLA 4JQZA 4O2AB 5L53A 1WW3A 2NN3C 2QU8A 2RAVA 3D4PA 3WBJA 4HUQA 2BFBA 3HKEA 3NONA 1ZCJA 1O3YA 4MLZA 4ZP1A 1DX4A 3UQYS 5I47A 4K6GA 3CH6A 3SR4A 2QP9X 5E4YA 2GTIA 4UBLA 1CX9B 1ENPA 2BFWA 4HEJA 5BSEA 3FGNA 4QARA 1FFYA 3L8CA 3U3OA 3F8WA 1L5MA 3UYLA 5FWXA 2DH5A 3PD1A 5B5SA 4P35A 1N5DA 5TPZD 2CVPA 3FHJA 4XFKA 4C4XA 2XB2A 1C4XA 3VX3A 2F3QA 1Z2EA 3PEWA 1E0AA 1OWMA 3PVCA 3D3KA 1N2CE 3O9MA 2ZBVA 1YR8A 5CFQA 3GUUA 3VVLA 1E92A 2ZRAA 2NVBA 3IEMA 4II3A 5A7HA 4MKXA 4G2NA 5FBLB 1R16A 4AMBA 5JCZA 2WW8A 4ZOLF 4WNCA 3QVUA 2VJBA 1Y5LA 1AKTA 1JNYA 1V37A 3IH5A 5EE9A 3P9IA 1NNEA 1H2EA 2VRBA 3QELA 3OZ7A 2Z9DA 5JLAA 3G6KA 1E77A 2VJOA 13PKA 4OQNA 3T7EA 1GUAA 4GEGA 2JNWA 5JVDA 4J49A 4U7FA 1WIWA 2IITA 2X4LA 2UYHA 1VHLA 2OV3A 3W06A 1FP4B 3N8NA 4P5PA 4IOKA 1SXHA 1OXVA 3GLQA 4QNNA 2H8KA 2R7AA 5HE8A 5PNTA 1XLVA 4QT4A 4YP1A 3FTFA 2TS1A 2GESA 2GCOB 4QO7A 4C76A 1UBRS 1XE3A 4TVBA 4EG4A 4WZBB 2XGGA 2F3RA 3I9MA 4CKZA 2KLHA 1D2GA 1VL8A 1MAHA 4KZKA 2B21A 2BM1A 2QTVB 3OIYA 5AOBA 1NOIA 4CM6A 5B2EA 3BSFA 5ENVA 4IWYA 4C30A 3OX2A 3HPQA 2QL5A 1G1AA 3K2BA 3LC2O 3S28A 3WZLA 2JFOA 1YE5A 2VF2A 2GQ0A 3A1FA 3AETB 3I34X 4LSGA 3K73O 2G9QA 5IKXA 4LW8A 1QR6A 2C1XA 3RRZA 1GM5A 4CL0A 3G9ZA 4MPPA 4CM3A 2IEGA 4M8KA 2W2KA 2XY4A 3NORA 4MQ4A 4R1NA 1I94B 4CKBB 2C3UA 3ANMA 4TQGA 1KJ9A 2B4AA 5BSUA 3MQFA 1NTOA 1HDIA 3ZI4A 1DS6A 1ZGJA 4QJBA 3E3NA 1C3VA 3RH0A 1UJ2A 1VM6A 1YDEA 3HN2A 3DLAA 3IJRA 4FKMA 1HE5A 2G07A 3LUBA 4HF7A 5K8JB 4MQEB 1KERA 4TKVA 1SQ6A 3KPWA 1N2GA 4CMEC 4A8HA 4GNRA 4H1WA 1EA5A 2H8GA 1SU8A 5EXDA 2DPGA 1WM1A 2P4SA 5H5JA 4P92A 3CUEF 5DK6A 2ANCA 3ORSA 4JEMA 2I9PA 4ZQBA 4ND8A 4MHOA 4ZI7A 1T5IA 1CEQA 1LBTA 1W2GA 1VBMA 2DECA 4TLDA 1JR6A 1L4BA 3L93A 4JH0A 3LO5A 4B6GA 3FPJA 3JPWA 5AJWA 3W5UA 1G8GA 4QRIA 3ANSA 3FTNA 1KJWA 2XLBA 5JYCA 4QUBA 1SG9A 4RKYA 5EJ7A 3H7AA 2Z8YA 2D2FA 4GQAA 3F96A 5E1DA 3SSAA 4ZAYA 2VT6A 1QFXA 1J21A 4XIYA 5K3DA 3MCTA 2XV1A 3BZUA 3KHSA 2JGMA 5REQB 3DA8A 4UARA 2H18A 2XADA 1C30A 1WPRA 3H5LA 5LU8A 5EN4A 2FPXA 4U7JA 4AY6A 4K3UA 3DWIA 4BN0A 3QEMB 3GH3A 3C5WP 4UBNA 1A9QA 2AHRA 4D02A 2IHZA 2PGIA 1B8OA 2WKQA 5IDYA 4NXNB 2ZRBA 1I4WA 3ND5A 4GMKA 1UMBA 4EJSB 4HRAA 1HNZB 3GQBA 4GIBA 1CE8A 2VF4X 3BMNB 2PZBA 3IC5A 2AVNA 2XIJA 5H3LA 2WNIA 3ICPA 1W5EA 3A2LA 3ZC3A 1ZO8A 3LF2A 3E8MA 3IAXA 1Z6YA 4NECA 4Y2HA 3ZLJA 5BR4A 2N75A 1JHXA 5B7PA 1ZOIA 2ZZMA 4BEVA 4J8PA 4QAJA 2WWFA 3VJLA 4L9SA 1CKEA 2RGUA 3IQEA 3RG8A 1B23P 3U4HA 3ABSB 2BR3A 1VLHA 3E7PA 3EBOA 3OHMA 4JNCA 1NF3A 4MQ5A 3KR9A 3KHTA 3CSDA 4CQLB 2ECKA 1XRMA 4QUDA 1FDRA 5DB4A 1W48A 4Y1FA 4QREA 1QIHA 1SY7A 3UMFA 3IUBA 5FWYB 2HT1A 3RJTA 3M34A 1AQJA 5ALHA 4FB4A 4JI1B 4NMWA 3RTAA 4HXEB 3W1WA 1MZVA 4V0NA 2GLXA 1AXRA 3H1FA 1P81A 1Z4JA 4HOYA 4EYEA 3D2CA 2GRJA 4QYIA 3RVDA 3OG9A 4V0ME 1VPWA 3GOHA 1P60A 2GD0A 3IURA 3FPKA 3TLZA 1RWMA 4MJLA 2G1JA 2HWKA 4U6SA 5HF9A 5M29A 4GBGA 4Q21A 3MCAA 2RB5A 4IL5A 4Y6RA 4TMXA 4EVRA 3TOZA 1J0EA 2HN9A 1VBFA 2QRVB 1IHUA 4PC2A 3SMVA 3RS7A 4DQ0A 4MWGA 3W3ZB 2D4AA 3KC2A 3VOAA 1Q1QA 3CJQA 4NICA 2P11A 1C3LA 3AUKA 4R7TA 3G2HA 3IGFA 4OAPA 3ZQJA 4KQFA 5A7GA 4D9IA 3D59A 1VRCA 1HWYA 3PEFA 3PUVA 2BAGA 4MR7A 3LV8A 2P9YA 4DTIA 4RXMA 4YBRA 1WPXA 1O7JA 2VHJA 3B7GA 2CNWD 3I5UA 4HPJB 4TS9A 3TVTA 4EUNA 1MC4A 1ML4A 3AM4A 2WTBA 1FU8A 2LV8A 5A9TA 4H7JA 1EX6A 2VN8A 3RWMB 4IX9A 4D0RA 2WM9B 1UM9B 1WUIS 4J1SA 1XNGA 5JUWA 4Y1EA 2AE2A 1FCJA 1KXJA 5IYZB 3CF6R 2W2LD 4FJ1A 2EWMA 3LQQA 4HSEA 5ES3A 1FLAA 4HAVA 2WIKA 3EGVA 2WM8A 1YRWA 4YDQA 1FFXA 3DOFA 2C20A 2OCYC 3AR7A 1KDZA 5CVDA 5F2EA