4M1WA

Crystal structure of small molecule vinylsulfonamide covalently bound to k-ras g12c
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
160
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETSLLDILDTAGQESAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords K-Ras GTPase
total genus 62
structure length 160
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1wA00
1CLUA 1HY3A 1I2MA 2YJTD 2J41A 3CRRA 3QF7A 1DAFA 1S9HA 2WSMA 2ZETA 1KI1A 2IL1A 3A1UA 4A9AA 2WJGA 3KXLA 5IHPA 1N25A 4US2R 1N6KA 1E32A 1NVVR 4BFXA 1QHHB 2XSZD 3B82A 4RFSB 4D6PA 3U61B 3NC0C 4C9BA 3I3SR 1NVWQ 3GLHB 3EPHA 4LZZA 4KAXA 2V54A 4Q66C 5KHOC 2WTUA 3PEYA 2G9NA 3RAPR 4EPTA 3G0HA 4PHGA 3IILA 3QE0A 1W36C 1FOEB 2QA5A 1AKEA 2ZJBA 4ILEA 2G1JA 4GZLA 2GVDC 3QSYA 5JSZA 1W49A 2ERYA 2J0UA 2J7KA 2QP3A 3H4MA 1W0JA 3TW8B 5B64A 2EYUA 3QENA 2IEZA 3KJEA 4IFBA 4LCBA 4Q9HA 4EPXA 4FINA 4C0AC 1AGPA 1UADA 2ZI7A 3GFPA 2A3RA 3KJGA 4GSYA 4TZ0A 1E0KA 3Q85A 3QG1A 1OXVA 1F60A 1UJ2A 2V6IA 2AXPA 3SJBA 3LLUA 1W7AA 5IT5A 5EJEA 4I1SA 1G7SA 1KDTA 2QPOA 4NYJQ 4RJLA 3R7WA 3S1AA 3VKGA 4TSFD 1ZM4A 4NHOA 2CCJA 1JECA 4LJAA 3K70C 3W34A 1SVSA 4OHWA 4V0ME 4EFMA 2QP4A 3NH6A 1E79D 2CJWB 4HATA 2P6RA 1NY5A 1HURA 1JXOA 2R9VA 1YU9A 2JCSA 5E3HA 5FTNA 5HKKA 4KU4A 1AK2A 2A30A 4WA7A 4EDHA 4LV5B 3AF0A 3QQ5A 2Q6TA 2VHTA 1JXMA 2X77A 2OAP1 3G82C 4HAVA 2CHGA 2CXXA 3EPKA 1ZU5A 2IUSA 4RZ2A 4TMVA 1ONBA 4Q4AA 4XTRA 4A0HA 1E4VA 4PPNA 2CMKA 1YJ5A 2AKYA 3UWKA 4NZYA 5FPKA 2QQ0A 1VCOA 4JIMA 3FKSA 3Q8XB 4I99A 2X2FA 4GI7A 1R8SA 3JVVA 1K8RA 1Z6AA 4B47A 1AZSC 2FZ4A 3ASZA 1W1WA 4QGAA 4NCJA 1ZAKA 4F4JA 3CH4B 1G7RA 1LF0A 2IWHA 3UXMA 5JSZB 1T3SA 3W3ZB 3GEHA 2B8TA 2QMUA 1GKYA 2V6JA 4I81A 4QKQA 4B6FA 1RRGA 3PUZA 3SN6A 2HF8A 1UKVY 1P2TA 4V0MA 1Z08A 1N6PA 1VG0B 4K46A 4Q4JB 4GDFA 1A5TA 1JR6A 5CIQA 4F93B 4Q1EA 1D2NA 4PQRA 2FGKA 4X8OA 4CW7A 5GJCA 5D3MB 1FNMA 2HXYA 1LW7A 1P61B 1G6HA 4KITB 1ZD1A 4QFMA 1NG1A 4IVRA 4AYTA 5CJ2A 4BFWA 4D4JA 3REFA 4U7DA 3QXXA 1T3HA 3RVBA 1N0UA 2WWHA 2VL7A 4A4DA 3X1DA 3FDIA 2FSFA 4Q4JA 2QMHA 3ND8A 1CR0A 3LNCA 4NDZA 1DELA 2BKEA 3A4NA 4TYYA 2YWGA 1TMKA 1XD2B 1KDPA 4FMCF 5FTJA 1S2MA 3P1JA 1IN7A 3GLGE 3T1TA 3UPUA 2PX3A 1E9BA 1QHSA 3RC8A 3BB1A 5JZVA 3LQRA 2RHDA 1GTVA 1OKKD 2Q3HA 5FL7D 2VF7A 2FH5B 1OE0A 3KB1A 4EPWA 2OCPA 1XXHA 3BH7A 3CRW1 1HE1C 2C9CA 1TTTA 2IYTA 5FR2A 3VAAA 3PIRA 2GCOB 1ZNXA 1UBEA 1U9IC 4B2IA 3K0CA 3VKWA 1Z2AA 3JZMA 4Q00A 1VG9B 3O8BA 1UBFA 4KLZA 3K0AA 2GZDA 4LYAA 3ZVMA 3HYTA 1E9AA 2ZRMA 1NF3A 3EARA 3SQWA 1G6OA 2HT1A 3R9IA 3CPJB 5G53C 3CO5A 4A0FA 5B30A 1N5IA 1P72A 2GJ9A 4F92B 4Z8YA 4LJ8A 1SQ5A 1CR1A 1YR8A 3IHWA 2WPDD 1HEIA 2QQEA 1DPFA 4IVPA 1GG2A 1COWD 1KO7A 3TAHA 1N6LA 1NLFA 3PFIA 4B71A 1W48A 1R0ZA 4JBWA 2H17A 2N42A 3TSOA 2OLKA 2IS4A 2IYXA 3EAQA 4FCVA 3N70A 5AUNB 3EPLA 3AVYA 3WNDA 1NN1A 4A92A 1M7BA 2JLVA 3K0EA 1KNXA 1E1QD 4Q18A 3HP1A 3FHOA 3HWSA 4LHZA 4UNQA 3THWA 3LLMA 5EE9A 1MO3A 1BIFA 5AUPB 4A15A 1XX6A 3AP1A 2GXAA 4MRRA 2HCJB 4WIAA 2PLRA 2VBCA 1H8EA 4LK2A 4XVRA 3W5IA 2ZRKA 2IA5A 3NBXX 3L8YA 3THWB 2ORWA 2NZJA 4C0LA 1SVWA 3QEJA 3DPUA 3TE6A 4FW9A 3C16C 4JBXA 4DDTA 1XD2A 2VP2A 2WWIA 1XTQA 2RB4A 1IY2A 4LC0A 1Z83A 1D5CA 4R71A 1Z29A 2B8WA 4QGGA 5JS8A 5SZHB 3ZIAA 1Z6XA 1SGWA 2RGAA 2IF2A 3HJNA 3VX4A 3ZDQA 2OFOA 2RH5A 1NSTA 2F1HA 3U7HB 4GRAA 4M22A 5C18A 2WMOB 2DWOA 221PA 3NEJA 1PLKA 3AF3A 4EFNA 1T0HB 2JIZD 3BH0A 2J46A 4L9SA 1G8FA 5G3ZA 2IUUA 4AWXA 1ANKA 1M7GA 2VO1A 1DO0A 2D74A 1NVXQ 4KFTA 2ZUCA 4FI3C 2W2VA 2DB3A 1H65A 1AGRA 1RE0A 5GVRA 3K0FA 3LX5A 1RFLA 1E9FA 3MSXA 5J4LA 5E95A 2C5LA 2WMNB 4OHZA 4HAYA 1KI2A 4Q4HA 1U9IA 3H0KA 1IY0A 4BLQA 4Q9JA 1Q0UA 5IK2A 1JI0A 1R0YA 2EFGA 1ZRHA 4Q7JB 1V5WA 2D4HA 1QZXA 3Q3JB 3QKUA 4G5SA 2ZPTX 2NPFA 1AJEA 1DTSA 4FWTA 4BUJA 2ZJ8A 5SZIA 5KTYA 4DCTA 3B60A 3EIHA 2YNMA 1CP2A 1L4UA 2EFCB 3K53A 3WNBA 3K0SA 1JR3E 2QN6A 1W0KD 4ZDJA 2ZI9A 1EFUA 2FE4A 3SZRA 5J4VA 3AKYA 1XB2A 5GADl 4W5JA 3OIUA 4XVUA 4KVGA 4M0LA 3I92A 4U00A 1ZBDA 2VPPA 3X2SA 1KSJA 1J8MF 2FSHA 4OHYA 1GL7A 4GNKA 2ATVA 3SE0A 3UG6A 4M1TA 3T61A 2GVZC 2YC4C 3OEHD 3W6NA 2H92A 2NO1A 3PEUA 3IPYA 1CU1A 2AL7A 5J40A 1T91A 1D8TA 1UKYA 3CZPA 4MYTA 2EU8A 2P67A 2VQSA 2WKQA 2IXEA 4BZXA 2Z83A 1IY1A 4R7ZA 4JLPA 2CVFA 1ZUIA 2HUPA 4J0QA 2WJVA 1ZIOA 1ZU4A 1KZGB 4CEJA 4RD4A 2WBLC 2JLRA 3EIQA 2JJ1A 1RZ3A 3IPXA 3TVTA 1DAEA 2VLIA 3D3QA 4DCSA 3DL0A 621PA 1IBRA 2BM0A 5L3QA 1L4YA 2CHQA 3B6EA 2IT1A 5EXPA 1TQ2A 1E9DA 3I73A 1PLJA 1X8JA 3U7EB 4A2WA 3BB3A 3GJ5A 5A4JA 1U99A 4MRPA 1IXZA 4WZBE 5F9HA 1HH4A 2R6DA 4JVSB 4S35A 4RD6A 4MYHA 2P5SA 1DEKA 2ZYWX 3FKQA 1Z0KA 1M6NA 4URZR 4G5OA 2IYLD 1QHXA 2Z0MA 3RYTC 3ETLA 2QMOA 2ZAMA 1P62B 2HDNB 3A8TA 4AKEA 2OG2A 1WA5A 5H70A 3NEYA 3FPAA 4UJ3A 4NCNA 2PMDA 3WYFA 4QM6A 1KSHA 3GJ7A 1G64A 2OV2A 5AJZA 4MKGA 1S9DA 2ZANA 3WNCA 4BEBA 4IW3B 4TLEA 2QBYB 1UEJA 4NYJR 4TYWA 3QUSA 2BOVA 1I4LD 5DI3B 3WYGA 4LRWA 2JDIA 2MSDB 3DKVA 1G7TA 1R0WA 1R2QA 1AM4D 2W00A 3WRYC 4MITA 4TL9A 5IK2D 1C1YA 1U8AA 5K8LA 5BYJA 3CNNA 1Z07A 1S3GA 1F2TB 3GJ6A 3HU2A 3D31A 1ZC4A 1ESNA 2O52A 3EPJA 5TB5A 2VP0A 3HU1A 3OAAA 1PUJA 1OW3B 3L0PA 4YDHB 1UM8A 2AR7A 5L3QB 4LHVA 4ASUD 1P2VA 3N2IA 3O8DA 3QF4A 1MABB 2GXSA 4UNSA 3PR1A 4ASUA 1D2MA 5DYGA 4Y0AA 1U8YA 2QM7A 4XOIA 4HB2A 1KTVA 1E0SA 4NYMQ 2QRZA 3K70B 2QAGA 3I1FA 1OF1A 1DAKA 4HDOB 1KMHA 3QOFA 2FPKA 3NG1A 2DHRA 4Q7KA 1EFRD 4D25A 1IXSB 3R8FA 4HI0E 2C04A 2Q9BA 2R8RA 2ZSBA 3D7MA 2WV9A 5DISB 1YQTA 4LBWA 3LVRE 2GDJA 2Z6VA 3BAFA 4LC1A 4DLSA 4L15A 4P3YA 4WXRA 4QG7A 1NRJB 5FOSA 1FQJA 3X1XA 1RIFA 3QKSA 2Z5FA 4TTPA 1RW4A 3EZFA 5GJWC 2OM2A 3CNLA 3SBDA 1FW6A 3KXKA 2OSBA 4HUTA 3SFZA 4DLZA 1KJWA 3KFXA 3CF0A 3T15A 3U3RA 5FOUA 4TLBA 4Q1DA 3DMNA 4EPRA 1OH6A 2VEDA 2CBZA 2DBYA 2JLQA 4ZIRA 4I1UA 2OAQ1 4OJQA 3KX2A 3WY9A 1R5BA 4AIIA 1ETUA 1EFCA 2KWIA 3GLIE 4V0NA 2RGNA 3KDSE 2ZJZA 4KV9A 5G3YA 1YRAA 4O2RA 1I2DA 5AJXA 2AXNA 2R6FA 3SYNA 3WP1B 3C8UA 1TNDA 4OI1A 3ICQB 1CBUA 1PUIA 3PG5A 2X1VA 2ZYUX 4FXPA 5SZJA 2WKRA 2VHUA 1JR3D 4D0GA 4DBLC 4JLDA 1FNNA 1ZUNB 4NL4H 1VPLA 4U5XA 2IEYA 2WPDA 4GZMA 4JZKA 3TH5A 4M8NE 1G3RA 4EFLA 1E2LA 3VFDA 1F5NA 4KHZA 4H9GA 1FL9A 1KSFX 2JAQA 2ODEA 4DJTA 2O8CB 4LYJA 2DWQA 1KYIA 1XCPA 3NBZC 1NJFA 1E94E 1II8A 1QBKC 1GAJA 4BEJA 3THYB 1MRNA 3GLFA 3LBIA 2OEPA 1O3YA 2F1IA 3T1VA 2XX3A 1HE8B 1LTQA 1TPZA 3SYKA 1DAGA 3BD9A 4HYYA 2HV8A 3K0CC 5CB8A 4LWZA 1S0UA 4DZZA 2VSOA 3B9QA 1NN3A 2R6GA 2OT3B 4P0TA 1WCV1 3KZ1E 2C77A 2ZM5A 3TUIC 2HT6A 3CX7A 4B3BA 2XOKA 4CDGA 3CF2A 4NMMA 2G88A 1PVOA 4YQFA 1P9WA 2ZXUA 2WIAA 3H2YA 4DLUA 4TSFA 5FI0B 1SXJC 3HPQA 2PEZA 1JPJA 3OEED 3U6BA 1EGAA 5E4FA 2XNDD 5KDLA 4BFZA 1GKIA 1KMQA 2J7PA 1NN5A 2E87A 1N6IA 3CLVA 2D2EA 2R6AA 2HYIC 1D9XA 4MUBA 1MO5A 4CF7A 3I5YA 4YONB 3ASYA 4X8LA 3IEVA 2RGXA 4DDVA 3AQ4A 1E2MA 3QI2A 4JKIA 2IYUA 1CTQA 4CEHA 3KJIA 2P2LA 2MSCB 1KK2A 2IHBA 5EE3A 3TK1A 2D7CA 2NO7A 1OIWA 3F8TA 3LDAA 4KODA 1E1QA 3KB2A 4B2PA 3U4QA 3W5JA 4E5UA 2VP4A 1NVVQ 1ZIPA 1YZUA 3ZH9B 2OLJA 3FFAA 5DN6A 5E7MA 5HCNA 2XZLA 4TTQA 3GLIB 3KQKA 1S1MA 1P9NA 1VCIA 2BMJA 5LBIA 4WOPA 2FJUA 3CIOA 4YMSA 4DLWA 2A5FA 1C9KA 2BBSA 4MUAA 4JT4A 4Z1MA 4BLOA 2AN9A 2QTHA 1II9A 2PT7A 4QJ3A 2BMEA 5FUVA 1UDXA 4PSKA 1CF4A 3NWJA 5HE8A 4AKIA 3OEEA 1G21E 2IXFA 3UATA 2CE7A 4Z8XA 1RJ9B 2IBMA 3IIKA 4ACAA 1XPRA 1XEWY 4M9XA 3AH8A 1KDRA 3I8SA 2H16A 2WVJA 3WHKA 1DVRA 3RABA 4Z51A 3A58B 3GJ3A 1ESMA 2WJJA 1OXTA 4UXJA 5CB6A 1P3JA 1N3BA 2LCFA 2IS1A 1CRQA 5D3QA 2OO7A 4ZI3A 4D81A 1HTWA 4DXAA 2BBOA 1EFHA 5JJKA 4NP6A 3NH9A 5E7JA 3UK6A 2JJ2A 4D0NA 4H1UA 4KYUA 1J7KA 4XWKA 2I4IA 4NCIA 3TW4A 5K8TA 3EZ7A 2GJ8A 4G5GA 4L9WA 1MABA 1P4SA 4IDHA 3QXHA 1NVUQ 2O8DA 5BN3A 3A1VA 1FX0A 1TF2A 2QSZA 4RKFA 1KDOA 2F6RA 3AVPA 2J0QA 2QENA 4KXFB 2AWNA 3PQCA 3B1XA 1JB1A 2BEJA 2GF0A 1KKLA 2P6NA 3L0OA 1YVDA 4KO8A 4P4SA 5J47A 1AN0A 3PJRA 4B43A 1XZPA 4ACBA 5BYKA 1LS1A 2QPTA 3EA5A 4EKDA 3LAWA 2HCBA 4CEJB 1G3MA 1TF5A 2XNDA 3AB3A 4PXAA 4FN5A 4CEIA 3VR6A 3K09A 5C1BA 1E9EA 4GP6A 1G20E 3SJZA 3QEOA 4ZKDA 1HUQA 2JLXA 4RFVA 3ZZTA 1F2UB 1T9HA 2XB4A 4PC1A 1IQPA 2XSZA 2JASA 3WBJA 2GEUA 3PUWA 3FMPB 1MV5A 2XAUA 4WBSA 1NG9A 1N6HA 2A5JA 3ND9A 1G3UA 3KJHA 1JPNA 3MJRA 2WSSA 1Z63A 2FFHA 2PJZA 3QXCA 1QHGA 1RRCA 1ZCBA 4M1MA 5DI9A 1NMZA 4V0OA 1QHHA 3AEZA 4TLAA 2RGBA 2J0VA 1Q44A 3FOZA 2NZ8A 2DFKB 3E1SA 5AWFC 4B34A 1KI8A 3CBQA 3V9PA 3MFYA 2G77B 4URYR 1X8KA 3HYRA 3DDCA 1E4YA 5DN6D 3BE4A 3AVQA 4JVMA 4TMWA 1OKKA 2GWHA 5FL7A 4DIDA 1KAOA 2HF9A 3PEVA 2J87A 4RD0A 2Z4RA 2VP6A 2QE7D 4JSTA 3VTKA 3ZD6A 2XOKD 1YE8A 4HB3A 2ZRFA 2QNRA 2BDTA 4U02A 5EQTA 3PCRB 2C95A 4TT3A 4HZIA 2WHXA 3R9WA 2ZE6A 5FUXA 2BMFA 3GJ0A 3QIAA 3HU3A 5CM9C 4V02A 4CZ2A 5FOVA 1J70A 1EESA 2EVWX 3MWLA 3UKDA 2IYRA 4MQBA 3GLHE 4KCGA 1XPUA 1G8HA 3TMKA 3AKCA 3CM0A 1U8ZA 4AYWA 5JI2E 2FA9A 1QRAA 2ZE8A 4M1WA 4IJMA 3K09C 5DE3A 1US8B 5C4GB 3RRMA 1YZTA 2BC9A 4PPGA 5C2JB 3GFOA 4ERNA 4UNNA 4Q48A 2BV3A 4FMCB 3RHFA 3U3OA 4BLSA 5B2ZA 1OYWA 2KI5A 2XXAB 1P2SA 1IN6A 2CJWA 4YC7A 1CS4C 5EXSA 3AVXA 3KKMA 4B6EA 2ZVPX 1KI9A 3SQXA 2ONKA 3I5XA 2G0NA 2DFLA 4LBVA 4ZPXA 1D2EA 2ZYTX 1CJMA 1FP7A 4XSHA 1AIPA 2WWFA 1X1SA 2ASEA 4URXR 1Z0DA 3VMFA 3RS3A 2YHSA 1KGDA 1WDTA 2P0EA 4NU0A 4RZUA 5CYPA 2J5XA 4M4SA 4C7OA 1GILA 3NTUA 4QBHA 3I4LA 1A82A 2ZYVX 4XIGS 1UDWA 4PHHA 3IUYA 2F55A 4IOLA 3T34A 2GA8A 2HYDA 2PCJA 4UKDA 2GAOA 3LW7A 4NONA 2FU5C 3JVUA 2PL3A 3TLXA 3E5HA 2XZPA 2KSQA 3QG5A 2JIZA 3EASA 3GLIA 3PXGA 1XEXB 1S1CA 5FBLB 4QRHA 2CL6X 2NPIA 2W6IA 4TTRA 1WF3A 2ZJAA 3L43A 5HCIA 3LD9A 2D7DA 4Q4HB 5E7IA 3DZ8A 3WYAA 4EUNA 2FEMA 1EK0A 2WIBA 1B0UA 4UQOA 5TXGA 4O25A 4JL6A 2IYVA 2CLDX 4BRWA 4DIEA 1ZJ6A 1VCNA 1A2KC 3GLGA 2RKOA 4Q19A 3RANA 4GT1A 3W9YA 1IONA 5J4HA 1NMXA 521PA 1E2DA 3AM1A 4W5WA 4JLOA 3TR0A 4IDNA 4W7SA 3A4MA 2QMEA 3JZAA 1R6BX 4LJ4A 1HT1E 1ZW6A 1LS6A 4E22A 1MO6A 4M1OA 4M9SA 1AQYA 1Q3TA 2B92A 1CULC 1OXXK 2BBWA 4FMDB 1XEFA 2ZE7A 4DT1A 2GHIA 1KO4A 2F9MA 4CT5A 1G8GA 4JVLA 5CLLA 5KSZA 4MGZR 3LW8A 2GBLC 3CH5A 3LXXA 2YWEA 4RY2A 2AX4A 1JR3A 2WM9B 2ODBA 5JECA 2HLDA 2GAAA 1G17A 2OFWA 3FHCB 5EE1A 4C0SA 4BLRA 1UPTA 3OEHA 2P5TB 4IFEA 4JKYA 4MRSA 1FZQA 4EPYA 2GEDA 3GEIA 4PHFA 3WBKA 1M8PA 1E9RA 1WBDA 4EJSB 1Q1EA 1GIAA 1GP2A 1L7VC 1N6OA 2V7QD 4NYMR 5EE5B 4GFDA 4BFVA 4LJ6A 4X8HA 2ZRPA 2ZUDA 1W46A 3TVDA 4BRUA 4R2IA 3B13B 2EYQA 3ZZUA 2ZRHA 1WRBA 3K9LA 5JWOA 1DAIA 4JLBA 4KBFA 1S8FA 1SXJD 4EAQA 1YR7A 3D6TB 4P32A 1JJ7A 1JEEA 3U3MA 1Q22A 3FB4A 4BLPA 4I1OA 5CYOA 5FI1B 3TAUA 4CVNA 3KQLA 4Q1CA 1IOZA 4QBIA 1G5RA 4TL8A 1NBMA 4N3NA 3QBTA 1HA3A 1O87A 1P5ZB 2GXQA 2PH1A 3B1VA 2XB2A 4B32A 2ZR7A 2GF9A 1GZSA 1BO6A 5IRCD 1TUEA 4IEEA 4JLKA 4URUR 2IUTA 4NBSA 1DARA 3OIYA 3U3JA 3QPVA 1SKQA 5EP4A 3UG7A 4DSUA 4MRNA 3VR4A 3WHLA 1RPZA 3EG5A 1MO4A 1XTSA 2EWVA 3ZVLA 1J2JA 4TQUS 5CDFA 1X6VA 4TYNA 1XEWX 3GD7A 2ECKA 4Q9IA 1JQJC 3MWYW 1KZ7B 2YOGA 2ONJA 4LOAA 2HLDD 4IOMA 3KKOA 2GCOA 4PAMA 2G3YA 2IXGA 4FCWA 2R44A 2EFEB 1TEVA 3SU8A 2UZIR 2ZSFA 2N1BA 4NPHA 5DI3A 1JAHA 3QKTA 4Q7LA 4AK9A 3KQHA 2C9OA 2ZRDA 5J5CA 4OI0A 1KAGA 3DKPA 2RMKA 1IN8A 2JJ2D 2BKUA 1TAGA 2CNWA 1NMYA 3MWKA 4AY2A 2B21A 1XZQA 3W8RA 3C14C 4W9MC 4NTZA 4LV6A 3CPEA 2Q3MA 2WAYA 2W83A 4DDWA 4AKHA 2GK6A 5LDDC 4I4LA 2XNSA 2VTKA 5EUMA 3S1AB 2FDCA 2EW1A 4TYQA 3FMOB 4WVFA 4HUQB 4YMVA 2CCKA 4PC6A 4A2QA 1KHTA 2FN4A 4IDOA 1J90A 3UMSA 3OAAD 3ZVRA 1AZTA 2ORVA 2GCNA 4F38A 5JMTA 4QGHA 2GETA 2RHMA 4TT3D 5P21A 4A8JB 4DCVA 3N5CA 2IWRA 4YXWD 1OXSC 1LB1B 5FTKA 1Z0FA 1BKDR 1CJUC 2A5YB 2I1QA 5FPTA 1SULA 2UKDA 3HR7A 5FPSA 1SVKA 2DFNA 2WJHA 2X19A 3B5JA 4Q5IA 4QOSA 2P65A 2DFTA 2V9PA 3EWSA 3KKPA 4BLTA 1QHIA 5G40A 1G16A 2VHCA 2B7CA 3MMPA 2PCLA 4DDUA 1ZC3A 1JALA 3HDTA 3CONA 1QG2A 1YR6A 1CR4A 2FFQA 4M2LA 5TARA 1N5JA 4DLTA 3NDBB 3RRYA 5HR5A 4PTLA 2Q3FA 2E1RA 2QAGC 5FOXA 1NKTA 2HJVA 3AP3A 1OHHD 3SC3A 2JLZA 1OFTA 1COWA 4LY6A 1U0HC 4HUQA 4PPFA 5DIFA 1BH2A 2Q21A 5DSZA 5L3SB 4D26A 3TSWA 2ZQ5A 4WZAE 4WXPA 2Q9CA 1XF9A 4TMXA 2O5VA 4OKSA 4HDCA 3SI7A 4LBYA 5LPNA 4C0BA 1NIPA 3P32A 2QG6A 4N0DA 1AQUA 3PUVA 2F43B 3PEWA 2YC2C 3HPRA 4QHSA 1E2GA 3P4XA 1SVIA 3R7WB 3I72A 3VR5A 2BBTA 5JRJA 3UIEA 1Z6TA 2OFXA 1CR2A 1XBTA 5TVKA 3LVQE 4IEIA 2BMDA 3EC2A 3TRFA 4Q4LA 3U3KA 3Q5EA 2F3TA 5BN4A 2CEAA 5KPDA 4XD7A 2FPLA 1W2HA 4YMTA 1XTJA 1E99A 2X2EA 3VU9A 2PEYA 1ZNYA 1XJQA 1JNYA 3O8RA 1A7JA 3EIEA 3IO3A 2HJGA 2JA1A 1B23P 1TL7C 4XWAA 4ZI2A 3PENA 2ZRLA 2DWPA 5JJIA 3LX8A 4V03A 3RS7A 3R20A 1KY3A 4PSAA 3ADCA 3LQQA 2PJRA 2QUZA 4PAQA 1MH1A 4A6PA 1M74A 3A6PC 3LY5A 1TUIA 3QBVA 1L8QA 3QJYA 2FV8A 1OIXA 2GBLA 1RYHA 3AVVA 5KNDA 1Q20A 2J59A 1G9XA 4XWOA 2REBA 1TU3A 2AFHE 1E2NA 3PITA 3GEEA 4QNRA 5H1YA 3KL4A 1X1RA 1W36B 1DE0A 2BWJA 4A82A 4FIDA 1AS3A 2ATXA 2W0MA 4LX0A 2YKGA 3QXJA 5CK5A 4OQMA 3FTQA 3L82B 3U44A 4OQLA 2CVHA 3TGPA 5FTMA 5FL3A 1IN5A 1NBMD 2JJ1D 3IEUA 3SYLA 1NP6A 1FMLA 4OK6A 3B1YA 3IHLA 2PMKA 1GNRA 1E2FA 2IW3A 3GLFB 2F43A 4P4UA 2UZ3A 2WWXA 2AFIE 2AD1A 4UJ5A 4F7WA 1KI6A 5AUQA 4CYMA 3MAAC 1EXMA 2ZROA 4AYXA 1OFUX 4Z1MD 4O3MA 3D8BA 4ZDWA 3NHBA 3THXB 2GESA 1Z5ZA 3RWMB 3TNFA 2WWWA 1EX7A 1V43A 4S2EA 4A8JA 3UMRA 2P3SA 4LSGA 2JLYA 1N2CE 3GP8A 1F6BA 1Z47A 3NBYC 3MRSA 4QJ5A 4L16A 1E2KA 4YMWA 1JAIA 4C0HA 5FPYA 1K5DA 1VG1A 3O8CA 5ANRB 2PLFA 4TMKA 4R9UC 1Y63A 5A0FA 3PUXA 4JLAA 2ZU0C 3M6AA 1SVOA 1YR9A 2I1VB 1G5TA 2EFDB 1U0LA 4HLDA 5DHAA 4D0LB 3SJCA 2F3RA 4W5HA 1SXJA 4C0JA 1Q1ZA 1XCMA 3ADKA 5FOTA 3G5UA 2WOOA 2FNAA 1ZUHA 4D4KA 1XMJA 3KUDA 4MGYR 1RYFA 3SOPA 4Q01A 3EZ9A 3CNOA 1VG8A 1XMVA 1E2JA 3AF4A 3BGWA 4DUGA 3THOA 3U7FB 5FBRB 3CF6R 4HAUA 1Q3HA 4BFYA 1G1MA 3KQUA 4PPQA 4C3ZA 5JWHA 1U98A 2C9YA 2FOLA 1UAAA 4FMBB 2O8CA 3ZYCA 1JQLB 4DRZA 4GBMA 1PZNA 1PLLA 2IF0A 2PZFA 2EQBA 3P4YA 3R9XA 1AS0A 1HYQA 2YWHA 3AKEA 5TV2A 3T35A 5BWMA 2V1UA 3CWZA 1VDZA 1GNQA 2PX0A 1XU4A 1DADA 2OCBA 5AJWA 2VP5A 4B73A 1ZNZA 3WXMA 4IRUB 4TMTA 3ECCA 1U2RA 1K6MA 1LF5A 2CCGA 4RVCA 2SHKA 5JFGA 1XJ0A 4BFTA 2GNOA 3I8XA 3TQFA 1KI4A 4MKHA 3FMIA 1W47A 4OK3A 5AK0A 5EE0A 2QSYA 4UXIA 3FE2A 2PZGA 4JT2A 4TLDA 1YZQA 4P4TA 4URWR 4PAOA 1ZM7A 1MKYA 2A5GA 1FMJA 4KVAA 2V3CC 4Q1AA 4ZIRB 1OT3A 3SR0A 1QG4A 1TQ4A 3DVLA 5B58C 2C99A 1EWQA 2ZI3A 3GLHA 4GOXA 4JSYA 1T0JB 2IYZA 4DUGD 2O0JA 3QVVA 4N0EA 1TADA 2BJVA 2ZS8A 3RRZA 4DCNA 4RFSA 5G41A 1GRQA 3CR7A 2JEOA 3DM9B 2OXRA 5CLQA 3RS2A 1NI3A 3U2QA 4LDJA 5A5GA 4QC2A 5JWRA 1TF7A 3NXSA 1N0VC 2FGJA 4PZLA 4LV8B 1UEIA 1OIVA 1ZM2A 2CHVA 1XWIA 1N5LA 2TMKA 1LVGA 3QKRB 4MDFA 3FWYA 4FMDF 3IIMA 2W2XA 4US1R 4HAXA 1OB5A 2CK3D 2AK3A 2QL6A 4JLJA 2ZRBA 3ZVNA 5AR1A 3ZIAD 4TN1A 2ZRJA 5EXTA 4E07A 1Z06A 3QF4B 1KJYA 3IQXA 4QHYA 1KOFA 3B8HA 3M0EA 2WOJA 3BOSA 4PANA 1EG7A 4BFSA 4AURA 3A4LA 3MLEA 1E3MA 1BMFD 3AUXA 4JMPA 1KJZA 1BS1A 1FUUA 5GVSA 2RGDA 1BMFA 4BQSA 4HLUA 5EP1A 3M1IA 4IHQA 5TDHA 1NNEA 3L2OB 2FSIA 2ZTSA 2FEOA 3DHWC 3B7GA 4DB2A 4C7OB 3BIFA 1I4DD 1Z22A 3L8ZA 2IYQA 1KNQA 1E2QA 2W6JA 2QAJA 2WJIA 2ZRNA 5M04A 3EZ6A 3GJ4A 2ZI4A 4II7A 3W90A 3W8NA 1W5SA 5JEDA 4IDQA 4MGKR 1ZD9A 2BIFA 4RZXA 2LWIA 3LA6A 3RWOA 1RC8A 4ZO4A 2BVNA 3CPHA 2H18A 2IHYA 4BPBA 3A1WA 2ZU6A 5KUTA 2RCNA 4MYUA 3ZD7A 3BBPA 1G7CA 1GDDA 4HEJA 5BN5A 1US8A 4KFRA 3GFTA 3U60B 2ZIAA 3U7GA 3Q9LA 4KJZA 4E09A 2WKPA 1E69A 1VYUA 4F4IA 1A1VA 2GCPA 1BYUA 4A8JC 4ZDKA 4B3CA 3IKJA 3THXA 1AA9A 1Z8FA 1TU4A 2J3EA 4C0KA 1Z28A 3VR3A 3Q5DA 3CX6A 4JL8A 2AKAB 1DG3A 4P31A 4TMZA 5AUOB 3EX7C 5AJVB 3DO6A 2NIPA 3V4RA 3GPLA 3LBHA 1W4CA 3CRQA 2Z4SA 1PV4A 3W3AA 2Q9AA 3ZQJA 2F9LA 1OSNA 2ZSEA 3T5DA 3B78A 5DYIA 5FFMA 4TYPA 3CR8A 2GZHA 1EWRA 2IX3A 3FFBA 4JBYA 3WMFA 1R7RA 1RVDA 2FF7A 4NCHA 1X8LA 2YYZA 2G0TA 5EZ6B 1VHTA 2IYWA 3W6OA 2QE7A 4G0NA 1UFQA 1W5TA 4M1YA 1FPMA 2NO0A 4FD2A 1XTKA 1G3QA 2V55B 1SXJB 1E2EA 4QL3A 2MMGA 3NDPA 1ZD8A 1OXUA 1Q12A 5FPHA 5JHGB 3CW2A 3C15C 4A2PA 1MR3F 4Q1BA 1E0AA 2XTZA 3LXRA 3RLFA 4XTCS 3SS8A 5C46F 1GKUB 2O8BB 4KSCA 2J9RA 3WMGA 5KNCA 4ZCMA 1KKMA 3OFND 4DSNA 4LJ7A 2IYSA 4POAA 3VHLB 3EW9A 3L0IB 2YOHA 4XH9B 2VSXA 1XFAA 2V4ZA 2FZLA 4DVGA 4V0KA 4OQFA 2WSSD 2RGGA 3K0FB 2BJWA 2WWGA 1KK3A 4BE7B 4PHTA 1EX6A 5F98A 4IOJA 2XJ9A 1N5KA 5KDOA 1Y3AA 1FTNA 3VKHA 2GKSA 4CEIB 5CIWA 4HLQB 4UNRA 4QXAA 2GK7A 5DLQC 721PA 4D4LA 4B75A 1R10A 1KK0A 1XRJA 3T5GA 4LHYA 1GSIA 1YZGA 1D6JA 1GL9B 4GMDA 1W0JD 5CK4A 4B44A 4GOKA 4A0GA 3L0SA 2GILA 1W4AA 4PSVA 2CL7X 2ZJ2A 1WP9A 2QTFA 2CLSA 2VYFA 2NO6A 4I1VA 4LJ9A 3GLGB 4DLRA 2W2TA 3IDQA 1RKBA 2QP9X 2QM8A 4PFSA 4HLUC 1LV7A 1UBCA 4HAWA 1WMSA 1VMAA 4IKEA 1G19A 2PZEA 3VR2A 4AI6A 2C98A 5TY0A 2AHOA 4XJXA 1IAQA 4HZUB 1DS6A 2AK2A 1OFHA 1NJGA 5JCZA 3TUZC 2QPAA 2ZEJA 3Q7QA 2FFAA 1Q1QA 4URVR 5L8VA 2YZ2A 3UWOA 1BOFA 4A1FA 1NKSA 4DC9A 2VHQA 5LB2A 2C2HA 1UKEA 1E2HA 2OBLA 1BYIA 2AD5A 5HZHA 3WRXC 2XTNA 1N0WA 5DH9A 2KE5A 3MJHA 1F2TA 2QROA 2DYKA 3SHWA 1N6NA 2HEIA 1C4OA 1IXRC 5J4KA 4B2LA 1FX0B 5F3WB 2FFBA 2QY9A 1VECA 1W2GA 3BRWD 3FHTA 4Q1FA 3HR8A 4ZCIA 4LGMA 821PA 2CL0X 1CXZA 2FMXA 4P4SB 5EUQB 4IXMA 3RRNA 3EZ2A 4MRVA 3SDZA 1XMIA 3BWDD 2XITA 3TR5A 2BHRA 2CE2X 2K5UA 3C41J 2REXB 3ZZ0A 3QPUA 2ANBA 2GJAA 5H68A 1VKJA 4EIWA 5KPJA 3KQNA 1PJRA 2WWYA 4AKGA 4HLCA 2ZITA 4OL0A 2FG5A 2X8AA 4R2HA 5BXQC 3AGQA 5J4YA 4GL2A 2BEKA 421PA 3IBYA 1KMHB 3BJIC 5L3SA 4QGFA 4F91B 1NIJA 2ZVQX 3CUEF 1E1RA 2NTYC 1H8HA 1W4BA 1OV4A 5AJYA 3PVSA 1CEEA 3P20A 1XCGB 1U94A 2VSFA 2W0SA 1XXHB 3BFKA 3LWNA 4G3XA 5FOWA 3C7KA 5KSOA 5B57C 5EXXA 2P6UA 4OYHA 4JS0A 5LB4A 4DSOA 2OILA 1JJVA 1AKYA 2J0UB 4OHVA 4WAUA 2QI9C 3FVQA 5HZKA 1CRPA 1IN4A 4BFUA 4PZZA 1XD9A 3K70D 1TQDA 2JLUA 4V0LA 1W44A 2G83A 1HQCA 4Y0VA 3NIBA 1DG1G 1G3IA 2YINC 4RD3A 3BERA 5JHHB 4PR0A 5LD2C 3RS0A 4M9ZA 1ZCAA 2QU8A 3PV0A 2ZR9A 3OIWA 4C0QC 4QBFA 2QRNA 3VHXA 4JYBA 5TMPA 2C96A 2OBMA 1ZNWA 3KFVA 4Q02A 4ESHA 3EWAA 2IC5A 4R98A 4IVQA 2JLWA 3VNUA 4LYFA 1ZP6A 3BK7A 3T1OA 1ZVQA 3NKVA 5CDFE 5JEEA 1FP6A 4ZDIA 2FPMA 1G291 3P26A 5DNYB 1M7HA 2A5DA 1U0JA 3RSOA 3U6KA 1P6XA 1YZLA 3ZS9A 3TIFA 2ZAOA 1GM5A 2O8DB 2FX3A 4YLGA 1W36D 1OH8A 3ONWA 5FUWA 1XDBA 2KBFA 3NC1C 4QHTA 4RKEA 3K9GA 1MT0A 1QVRA 4Q03A 1IM2A 4DB4A 2XJ4A 4ZKEA 4LHWA 1OYYA 4MYCA 2R2AA 3RS4A 1SHZA 4JJZA 2YOFA 3A1TA 2NG1A 4PO1A 2EWWA 4EJSA 4O2LA 3CX8A 1YRBA 2E9SA 1U90A 3FGNA 4G5QA 4CT4B 1OLOA 1OJLA 5HE9A 3C5CA 1EFRA 1SVMA 4M1SA 4ON9A 3B2EA 1VYTA 4B3DA 1A4RA 2ZJOA 2DCUA 3BH6A 1OH5A 2JLSA 1HV8A 2YVUA 3A36A 3LH5A 1QF9A 1QHYA 1OHHA 4C4PA 2V7QA 4LJYA 1GOTA 4RD1A 5CJPA 2LKDA 4DLXA 2CNWD 3CZQA 1KI3A 2QTVB 1VIYA 6Q21A 4MKFA 2PBRA 1KIMA 2D2FA 4GPTA 1E2PA 2F1RA 2V1XA 3GJ8A 2ZRAA 3NVAA 4MDEA 4LYHA 2CLCX 3FYHA 4QJ4A 3X1YA 5LD2B 2C03A 3GQBA 4PO9A 2ZRCA 4N1AA 5F2EA 2QT0A 2DPXA 2OE2A 3FMFA 3FKSD 1F3OA 2GRJA 2FWRA 3OIVA 3AVUA 3TBKA 3VU9B 4FWIB 121PA 1P9RA 4H1VA 5JLJA 2ZS7A 1N6RA 1NSFA 3A1SA 4YDSA 1NN0A 2WICA 2BCGY 4HB4A 2ERXA 4BASA 3IBGA 4ITRC 4EQ6A 2ZRGA 2XXAA 4JVNA 4PC7A 3W6PA 5JJLA 1OH7A 1GUAA 1WBBA 4Q47A 1M34E 1OFIA 2F7SA 5JRZA 2OHFA 1J8YF 2H8KA 1W0KA 1XD8A 4US0R 3E70C 3B1ZA 4RZ3A 4EQ6B 4D80A 1Z2CA 3X1ZA 1JBKA 3VNVA 3NHAA 3AF2A 1ELOA 3QVUA 4M21A 3MWJA 1IJEA 3AF1A 5FTLA 5BQ5A 3QNUA 1RJ9A 4DCUA 4RCZA 4EJSC 3K8YA 2ZUBA 2W6ID 1OPXA 2GJKA 1S3SA 2C8VA 2KB0A 8OHMA 1RRPA 4TLCA 2ZSDA 4QM7A 3RSLA 1SZPA 4HZUA 5GJBA 2R62A 5FUYA 2XEXA 3KKNA 3QY0A 2J1LA 1Z6GA 4KFSA 4DWJA 4DLVA 1R0XA 1Z0JA 2VF8A 1XNJA 3DOFA 3IO5A 3MUFA 2D62A 2J45A 2ODWA 2MMCA 2BCJQ 2VA8A 3AVOA 3KTAA 3MGCA 4M53A 2H7VA 4A36A 1H8ED 3AGPA 4LI0A 2W6JD 5KOYA 3BFXA 3TUJC 1P2UA 2LKCA 4DHEA 4ESVA 1G41A 2HXSA 2ZI6A 4HSEA 1P60A 4XD7D 3OE7D 1CKEA 1ZYUA 4KI0A 4YXWA 4LBZA 1Z0AA 4AG5A 1UKZA 2QAGB 2YWFA 1G18A 1F48A 2ZI5A 1E1RD 3PUYA 1DAMA 1X86B 2YV5A 2G1KA 5FR1A 4OQXA 4Q9KA 2IK8A 2XGJA 4ZV4A 4GMXA 3BORA 2A9KA 3REGA 1E98A 1NY6A 1TQ6A 2QZ4A 3ZLJA 4LJ5A 4B76A 1ODFA 2O0HA 4OI2A 5HKKD 3GCGA 4LHXA 5EP2A 3V4FA 4BZQA 3DM5A 4JLNA 3TJZA 2OCAA 4NE2A 1R5NA 3BXZA 2O8FA 1NBME 5K8UA 4KSBA 4NYIR 2JGNA 1SHKA 4UNPA 5FH9A 4MGIR 3QXSA 5KYKA 3ICEA 2ORIA 2RGNC 4Z54A 1GNPA 2H57A 2RAPA 3KUCA 3MCAA 1U81A 4M9QA 4OK5A 2OXCA 4Q4AB 4RSGA 3QKRA 1ZM9A 2GZAA 4ARZA 3DEFA 4LUCA 1CJTC 4YMUA 4B3GA 4ZCLA 1ZM3A 3CWQA 4ABYA 5CM8B 5KO2A 3F0TA 1T5LA 3BS4A 4Q21A 4KLNA 2OBNA 1GRRA 1CJKC 3K9HA 4IDPA 4OHXA 1D9ZA 3K9NA 1T4GA 2O0KA 4Q7MB 1JEDA 1Z3IX 4BZPA 2FSGA 2CK3A 3I32A 5FBVB 1G4UR 1XMSA 2EFHB 1XTIA 2OCYC 4Q9LA 3TQCA 5BW8A 2WZQA 2GEVA 1T8TA 1SKYB 1E79A 1VTKA 2ANCA 4KYIB 3K0AB 1P7CA 4G01B 1Z6YA 1G8YA 3Q72A 5EZ5A 4IOKA 4D4MA 3CB4A 5L3VA 1G8PA 1E6CA 3T1QA 1GVNB 2WJYA 1DOAA 4B35A 3AVWA 1XXHE 3V00A 3K1JA 3SEAA 1QVAA 1X3SA 1HT2E 3OHMA 3AP2A 2DR3A 3WMEA 1VIAA 1L2TA 2GXUA 2R6CA 2ZRIA 3LBNA 1S4QA 2JATA 2IYYA 1GWNA 1FQKA 1ZINA 2N46A 5KU1A 3CKLA 2DY1A 1YKSA 2JDID 1UBGA 5ELXA 4FCTA 2NOAA 3WP0A 4RD2A 1W4RA 1OB2A 4MKIA 1Q57A 2A7QA 4LPSA 2A78A 4PC3A 4P33A 1NL3A 3OZXA 1Z0IA 4D2IA 1MOZA 2ZREA 3SBEA 5KSYA 3U4QB 3GMTA 4HAZA 3OE7A 4E03A 4A6XA 1KK1A 3O47A 5DO9A 2XZOA 5JS7A 1KSGA 4MA4A 4C2UA 2O8EA 2QBYA 4PZYA 2QGZA 1E0JA 2QORA 3ZS8A 4HDQB 4A0RA 4JYCA 1UF9A 1DBSA 1CJVC 2NGRA 3LO5A 4DKXA 2KBEA 5CITA 5KSPA 2JJ8A 1NLYA 4B3FX 2R65A 2UVQA 4L5BA 4BGDA 5JI3E 2J0SA 4PX9A 4B48A 1FTSA 4WZ6A 4UXHA 4B3XA 4G1UC 1LY1A 5H8WA 2NMVA 3B1WA 4MH0R 2VHJA 2W58A 3R8CA 1VCMA 3H86A 1VHLA 2ODNA 2ZJYA 3BB4A 4PQYA 1XEXA 5C4MA 3M4YA 4G5RA 4GP7A 3AVTA 1R8QA 2ZE5A 1F2UA 2RGCA 3VX3A 1TEXA 1YZKA 4M1KA 1E9CA 1KO5A 1HQYE 3GLFE 3BC1A 2C78A 3ZJYA 4CGZA 2ZR0A 4K81B 1E9SA 1G5PA 4GOJA 3MD0A 2O8EB 3GJXC 2Q0HA 2L0XA 4QNMA 1RRFA 2BM1A 3QPWA 3IIJA 3IQWA 4D82A 3EC1A 2V8OA 2OZEA 3SNHA 1DAHA 2I3BA 5UKDA 2OUKA 1J99A 4LPKA 3THYA 1IHUA 1XP8A 3RC3A 2J7PD 3DMDA 1SVLA 4TWZA 3SHFA 4NYIQ 1H8HD 3AKDA 3U5ZB 5KNBA 3KTAB 3OESA 1YHNA 2VP9A 4JLVA 1KO8A 1R4AA 2VRWA 4PO8A 4BECA 3RDPA 2VH5R 4B33A 3I62A 1II0A 2G6BA 1DO2A 3DZDA 3RS5A 3X1WA 5JBQA 1GL6A 2NO9A 2MSEB 1XTRA 1KO1A 1T6NA 4OBEA 3B9PA 1KI7A 5HTKA 2KJQA 1M2OB 2GTPA 4XSGA 4TQ9A 3F5FA 5FBQB 3RNLA 3ADBA 4C2TA 3UMFA 2IS2A 1CIPA 1WE2A 1SXJE 2CDNA 5L3RA 3DOEA 2B7BA 1AS2A 2Z43A 3T12A 1MRSA 4DEXA 4TZ6A 1KI6B 2PT5A 3TSZA 3LRPA 5K8IA 5DGXA 1E2IA 4IXNA 4L8GA 3E2IA 4OQNA 4AG6A 4DT1B 2H5EA 4PQFA 4C30A 4NH0A 3ZGXA 4DSTA 3MG9A 4DEYA 2QGNA 1VYVA 5KDDA 2QT1A 1TX4B 5GJVC 1T5IA 3Q7PA 3KXIA 1LFDB 3P27A 4KFUA 1WB9A 3EXAA 2IS6A 2RGEA 3B85A 1II8B 3N2EA 4L4UA 4QBGB 1R5OA 3A37A 3VQTA 4F4CA 3CRVA 2B6HA 4KBGA 3C4JA 5HPYB 3OFNA 4K8OA 1E96A 1GRNA 1SKYE 2D3WA 3VR1A 1Q1BA 4DLYA 1M1YE 4TL6A 1IJFA 5JCPA 3ADDA 4RCYA 1WQ1R 1K5GA 4O0MA 4OJKA 1NLZA 1QHNA 3F3YA 2WAXA 4JL5A 2REOA 1FUKA 4PC2A 1KY2A 1P73A 4CRWB 3AUYA 1A2BA 3BFVA 4AD8A 1LNZA 1T3LA 4NCKA 3SJAA 5D3MA 1EFTA 3TKLA 1WXQA 4ARZB 1S96A 2ZSAA 2H1LA 2NQ2C 2ZJ5A 1GITA 4AC9A 3NBFA 3T06B 2AWOA 4CIDA 4NKRA 4WW0A 2QEQA 1ZMXA 2OESA 1P75A 1I4TD 4JLMA 4TL7A 4OI4A 4XVQA 3LV8A 3OF5A 5FBWB 3C5HA 3LFUA 3IGFA 3I61A 3UANA 1GFIA 3J81k 2Y8EA 2ZS9A 4TQAA 3ZQ6A 4BWYA 2GJSA 4HB0A 5SZKB 2O8FB 5IDVA 5DHFA 1Q21A 4JJKA 5IF9A 2O8BA 4X8MA 1G4AE 2VIIA 2A2ZA 1T8UA 1YZNA 2XTMA 3QKSB 1QDEA 3EA0A 3CRMA 4B74A 1XPOA 5F9FA 1XJCA 3H84A 3SFVA 4CEHB 2D06A 1FFHA 4EPVA 3KKQA 2F1JA 3U44B 5EP3A 3H1TA 3AV0B
chains in the Genus database with same CATH superfamily
4QWMA 1RYMA 2YJTD 1WKCA 2RHHA 3CRRA 3HCNA 3PRHA 5IBPA 3SMQA 3I4CA 5KNCD 2B4KA 2VAXA 1DX4A 4IJVA 5JVDB 2XQGA 3AY3A 1U28A 1HOXA 4GRDA 2JCVA 3GAAA 3P9PA 4CFZA 1LA2A 1N25A 2AOXA 2II6A 5JXWA 1E32A 3BIXA 3OZ7A 1QHHB 2XSZD 3RYCB 1LSOA 3L0YA 3B82A 2YV2A 4C3VA 2IXBA 4MIKA 3MWGA 3NFYA 1A3CA 3ER6A 4QXMA 1VJDA 2NUBA 3NC0C 3EOBI 3P9RA 2BGIA 2I4OA 4L3VA 1NVWQ 1TCBA 2G6TA 4OY3A 2VAPA 2WTUA 4H3HB 3PEYA 3ABQB 1KS9A 2CD9A 4I66A 2G9NA 4RSRA 3RAPR 4C04A 4UU8A 5LNK6 4PHGA 1RM3A 1QR2A 3NHSA 2XT0A 4YALA 3TVDA 1FOEB 4V39A 2WJ4A 4H3KB 5HMLA 3ZGYA 4AJEA 1F6DA 2AHRA 2F3UA 3UJ7A 4E5KA 1VHDA 4ILEA 1R6UA 2WUVA 2XY4A 3QSYA 3AI7A 5CA1F 1LSJA 4YCSA 3KJEA 2CYBA 1ZZEA 4BV8A 4EPXA 5LD2C 2IUFA 1AGPA 2ZI7A 2W8ZA 3A6EA 3GFPA 3WS7A 3QA9A 4TZ0A 3VR5D 1E0KA 2EIHA 1U3WA 2Z57A 3N2NA 4QJIA 4OV6B 1I1HA 1UJ2A 2NSYA 2V6IA 1EDBA 4RO0A 5KNDH 3GROA 3V6LA 5IT5A 1L8AA 3DTVA 1V8OA 4IQ0A 1ZVMA 4I1SA 3O1IC 4NYJQ 4RJLA 3QFTA 3VKGA 4LOJA 1U7HA 2I8AA 3VR6H 2BTQB 1KMNA 4V2IA 4DR1B 5LOVB 1EIZA 2DAPA 5KEIA 1TK9A 4JDPA 3OUUA 4AZ0B 3UK2A 4UM5A 4U2BA 2H3EA 4K9LA 1GN8A 2QP4A 3M1AA 1DKQA 1Z6PA 4XCQA 1JEQB 3C2QA 4HATA 1NY5A 4Q24A 2VJCA 4U6SA 2B36A 2MYTA 4YV1A 4A16A 2R9VA 2JCSA 3I8OA 5E3HA 2A9RA 2BE7A 1I3OA 1SKAA 2F17A 3ITEA 1AK2A 3PHLA 3ND6A 4PCAA 4XYGA 1UCFA 2H4ZA 3DMRA 3HP4A 5BP7A 2FR8C 3WAGA 2I6TA 2RHOA 3AF0A 1TCCA 1JXMA 4WTOA 3IBSA 2AKEA 3C5VA 4Q05A 5G2OA 2I87A 4IXDA 3WK4A 4TTSA 3OTWA 4XVUA 2QRVA 4YRTA 3V6MA 2CXXA 1QSGA 1Y42X 4PFQA 4L9RA 5KYUA 1YQQA 3DT8A 1VXOA 3KTFA 3WDSA 5EHQA 1XK6A 1T4BA 4CLXA 1XDDA 4V1CB 4N12A 5L3ZA 3WK6A 3OIGA 4F3KA 4CFYA 1WULS 1KE2A 1DCKA 4GICA 4BO3A 4ZARA 5SYNA 1QKKA 3BGVA 2BCEA 2WNHA 4LNHA 5KREA 1NI5A 1Z6AA 1QVVA 5DVZA 4E5DA 2XMZA 1JR2A 4LMAA 4QGAA 1ECFA 1W1WA 3G2JA 4RA6A 4KX3A 4MEBA 1T9ZA 4NCJA 3ZU6A 4YR7A 3M4ZA 3WBBA 1G8AA 1ZJYA 2EAUA 1I3LA 1UJNA 1VQ1A 3K15A 3PNPA 3IQEA 1T3SA 1Z8DA 4OGFA 1QYVA 4XFDA 2V7EA 2AN1A 3ICWA 1H2EA 3FN4A 2B8TA 1QCZA 2QMUA 3M9XA 4I81A 5FP0A 3TW4A 4B6FA 2Y0PA 4F1KA 4CIWA 1SH7A 1ST2A 3KZKA 1XRMA 3L4SO 5FTNA 1L7OA 3ZBPA 1R4NB 2YDYA 1N6PA 1VG0B 3NNSA 2XCSB 5IAKA 1OILA 1GV0A 4D8VA 4PGFA 2FI1A 1MX5A 1D2NA 3CTMA 4PQRA 5CIQA 5JTUA 1QNFA 1GQOA 4WXMA 4BMPB 4U0JA 2PDAA 1WNTA 1DIBA 1G6HA 2B82A 4RANA 1TYAE 4I46A 4QFMA 3HEBA 2X9NA 4OYYA 3UWDA 4UE6A 3RUPA 1OLXA 3B52X 2UYQA 4CXMA 5CX1A 4U7DA 1GQ2A 4BP1A 5HOEA 3FETA 5AM0A 3RVBA 4A4DA 4QPPA 4F12A 4YRMA 1FK8A 3FDIA 5HM6A 2Q5CA 3V4ZA 3P9CA 3CRNA 3DUFB 2QMHA 2ZAGA 2GKGA 1CR0A 2O07A 2FLKA 2Y27A 3ND8A 4MWEA 1RAEA 1JMYA 3A4NA 4IKPA 4PGGA 5CPBA 2YWGA 5K3FB 2PX2A 1TMKA 1WCIA 3PXXA 4NU5A 2V5UA 1XKXA 2P0AA 3C24A 2YZNA 1YCDA 3BDIA 4NZOA 3Q2OA 3WLOA 1WZUA 2WI8A 1E9BA 3IESA 4OF4A 5JZVA 4OSPA 1VI5A 3PT5A 2FLVA 1OKKD 3E9EA 2FH5B 4HX2A 5EXEA 1OE0A 3KB1A 5LZ8A 1KOLA 1NAHA 3DOCA 3BH7A 1NJ1A 4KE6A 2C9CA 5THQA 1OC2A 1T5OA 5FR2A 3VAAA 1ZH4A 3PIRA 4AIRA 3ZBTA 1WU7A 3VSAA 5TMDA 4ER5A 2RB5A 1N2EA 4JWKA 1BDMA 3K0CA 4G0OA 1C1XA 4DV1B 5LZ4A 2OBXA 5AI4A 1VG9B 3O8BA 1NM5C 4LRYA 1JFVA 4XQGA 4R0VA 1UJ4A 4RF2A 4CHGA 4DR6B 3JWIA 1I14A 4NBRA 1MAHA 3F6EX 4DM3A 3OC6A 5L6LB 2HMWA 1E5DA 1OX4A 1J0AA 3EARA 3RYHA 1IH8A 3DNMA 4MKXA 3T9AA 4YV0A 3SQWA 1QCDA 3AEUB 1L0BA 1EG2A 3WIDA 4QICA 1KEEB 3W4JA 4BVAA 1Q0PA 5B30A 5CCBA 2AZMA 2LE0A 3BWVA 4KLCA 4LW8A 3L92A 2H08A 3PYXA 1DTWA 2HUNA 3JALB 2GK3A 4M0DA 1CR1A 3IHWA 3MOIA 1ZH2A 4NY1A 4OTZA 1AK9A 1PHPA 2A9PA 2O05A 4PLHA 2QQEA 4WKGA 5F5NA 4ENRA 4IVPA 1V9SA 1COWD 1DJQA 3QFRA 2BFDB 3IX7A 3TAHA 4EUSA 5T7BA 1PP4A 3N53A 1W48A 2VXBA 1R0ZA 3MTJA 4JBWA 3OC0A 4RPKA 2R6HA 4RAQA 2NXWA 1AG9A 3AILA 1P1FA 3REOA 5DLYA 1XZGA 2IY8A 5C1IA 4PRYA 3AT1A 4ENWA 4J0EA 3SR3A 5TQ2A 1DGQA 1JSRA 4ZGWA 1NX6A 2Q1YA 1BE8A 1T9GR 2XQIA 4UNQA 4NG5A 3LLMA 4RL6A 3M6UA 3QVTA 1YDWA 4N49A 1FYWA 4YAFA 1XX6A 1ZJJA 2GPYA 1YAJA 4J76A 5DULA 4MRRA 1AO3A 2HHJA 2C54A 3D5TA 2Y99A 5DEIA 3ZGLA 1G21A 1YT5A 1PR0A 3Q11A 4MULA 4XVRA 5CX4A 1A4XA 2GYUA 5EWMA 3TTSA 2C94A 4F8EA 3E15A 3L8YA 5ULLA 5I9MA 1GA4A 4M83A 1SFRA 1VJTA 1R0BA 4MROA 4RCVA 1NXOA 3EUAA 4QXQA 4C3OB 5LDHA 3AL0C 3DBRA 4FW9A 3C16C 2C7VA 3VZQA 4QUDA 4DDTA 3ZKWB 2QN8A 2VP2A 3MIIA 5A5EA 2RB4A 1ZCFA 2HHAA 4LC0A 1IK6A 2GKOA 4MB6A 3S29A 2W11A 5JC8A 2B8WA 2EX0A 1P77A 4QGGA 3M5CA 3M8KA 1Z6XA 2VRCA 5DWQA 5HS4A 4J8PA 1SGWA 2RGAA 2IF2A 1X7GA 3DXZA 2UYOA 5FWNA 2PV7A 2HSGA 3E9DA 4E2WA 3OLCX 2AF3C 2BT4A 4H1HA 2H9YA 4M22A 2WMOB 2DWOA 3MHTA 2JGRA 1PLKA 2GUGA 1HR0B 2JIZD 1NULA 3G0OA 5TMEA 3BH0A 1ULUA 3O4HA 1G8FA 2H9AA 2I8CA 4L9SA 1U0BB 4P7KA 1ANKA 2C2OA 4G0YA 1EB9A 1SCNE 4B3HA 2O14A 4ZT5A 5K3OA 4JI2B 1F38A 1QC5A 1YS7A 2W2VA 3FNFA 2HV9A 4JUDX 2DB3A 3OPQA 1LDBA 3MJFA 3D6MA 1PO7A 5K5EA 2XTAA 4J16C 1W5FA 5J4LA 4OHZA 3BHIA 2H1OA 1CUIA 2GASA 1U9IA 3DBHA 4HH4A 5L7YA 3UTDA 4I50F 3DP9A 2BPOA 4EGQA 2DH5A 3ZUGA 5EWJA 4Q9JA 2JD0A 4C0WA 1IHOA 1HQDA 1Q0UA 4X94A 3IT0A 2XVXA 3GAZA 3T1HB 1ZRHA 3CLHA 1CSEE 3OZIA 1RXYA 2ZUFA 1QZXA 4G5SA 4UHJA 3MVEA 4J4HA 4RM3A 2GYVA 1ZGHA 1AJEA 2PSJA 2BGLA 2XA1A 4FWTA 2IEGA 1JDJA 1MPTA 4FUTA 1R37A 1ZKMA 4TTAA 3WNBA 1CP2A 4N39A 2C2MA 2EFCB 2QN2A 3HB9A 3LO8A 3JVDA 3HHPA 2ECOA 4R2LA 1MA3A 1S2DA 2FE4A 3IUNA 4F0JA 3QUAA 3W2TA 1E3SA 1F0PA 2R1TB 3F6PA 1DC6A 2BFDA 3OIUA 4CF4A 2B61A 4M0LA 2Y0BA 5DBOA 5HXAA 4BXOB 3WDKA 1IY8A 2FSHA 1J8MF 4RA9A 3MNFA 3X2SA 2PGJA 1AUVA 4NMLA 1YR3A 1N77A 3NTLA 4GNKA 4IZOA 3OT4A 4M1TA 3VU3A 1AHIA 5LP6B 2GVZC 3ITKA 1ZG3A 3FUXA 1KJ9A 1F0YA 2AL7A 5BPFA 1FXSA 4FDAA 4ESEA 3ORYA 2P67A 3K8ZA 3HUTA 2WKQA 4BZXA 2CV2A 2FEPA 3QELB 2HHCA 3QW4B 1VHJA 3K9CA 1IY1A 4DQLA 5J23A 4I5GA 3RU9A 3BF7A 4J0QA 2IYOA 1QORA 3KOYA 3WI7A 3ZDYB 4I5FA 3HXPA 5DN9A 2NZYA 2VCEA 3H05A 1U2SA 5EYPB 4R2JA 4KOEC 4NJEB 1QIMA 4GP9A 3EIQA 2JJ1A 4WASA 3EB9A 3IPXA 4RGQA 5AXAA 3OH8A 4HBZA 3L6EA 1DAEA 2VLIA 3D3QA 4TKZA 1IBRA 4MGHA 2VCYA 3B6EA 1SWVA 3RUAA 2BHTA 5JDIC 5LQCA 4X90A 1E9DA 1PLJA 3MJCA 4ZVNA 3FB1A 3GJ5A 1WG8A 2ZGVA 5FHRA 2Y05A 2RCYA 2ASVA 3I9MA 3UC9A 1N2XA 4KDFA 1IXZA 2Q1SA 2WYIA 1OA0A 3EK2A 1HH4A 1MZVA 3RC2A 4JVSB 2I7CA 4B3RB 4N65A 3MW8A 5J63A 2DM6A 2OPBA 5BWOA 1DEKA 2PPLA 2TYSB 4OVKA 5LM3A 3TECE 4JBIA 3U1BA 2P9TA 3VZBA 4BBZA 1Z0KA 3NWPA 4UM9D 1EK2A 5E6SB 5GV7A 2FFJA 2ZBRA 3W5UA 2W70A 2QMOA 1PK9A 1XIVA 2P6PA 2W8BB 1AMOA 4L6CA 1EFVB 4J6EA 4ZYZA 1WA5A 1ATIA 3RVSA 3OJ0A 1L7QA 1UM9B 4UJ3A 3OU2A 4BEVA 1XKLA 2PMDA 4HJRA 1P1IA 2C7RA 1B8UA 2EHDA 4FS3A 3AUUA 2VUTA 4MKGA 1S9DA 5FUBA 3WNCA 1OWNA 4XSVA 3SXUB 4GBGA 1EMDA 2P2GA 2DKOA 3N74A 2B99A 2XYPA 3RYIB 3NBKA 3NHLA 4L4ZA 4NYJR 1RZVA 2NSJA 1I4LD 1R9JA 4HMQA 3E3LA 3SEFA 4OXQA 4NEGA 1F9AA 3DKVA 3FWHA 1ZUD1 1T2FA 3NYQA 4DA6A 3U49A 1AM4D 1MDBA 1FRZA 4X66B 2X9QA 4NBKA 3FTPA 1LSSA 4KWTA 3RKSA 3NBUA 4EHKA 3RIGA 1RT9A 4BB9A 1C9JA 1ZC4A 2DG2A 1ESNA 1Z5PA 3VPDA 4RE6A 1CZLA 1GGJA 2L69A 2VP0A 3AO0B 2QTZA 2Z5GA 4GGMX 4Y2YA 1JRLA 2XE4A 5AVKA 1E64A 1UM8A 4BQPA 2TS1A 5JPCA 1BS9A 3HKEB 4UNSA 4ASUA 3KETA 1C3VA 2EFJA 1AO0A 1U6JA 2FEXA 1D2MA 4JZYA 4N3CA 1FFBA 5AW9A 2VJAA 4HB2A 1TJYA 4MX8A 3O94A 3I1FA 5LYJB 4XR9A 1DAKA 2XQKA 3NBQA 5B1YA 5CFQA 4EHJA 3QOFA 2FPKA 4L4XA 4D5GA 1FDTA 4Q7KA 3CKKA 1BW9B 4GLOA 2D0DA 4A6EA 2WTAA 1J9EA 3DD1A 2R8RA 3H1FA 5DISB 5GWXA 2WV9A 1YQTA 2DLCX 3LVRE 5JMPA 2GDJA 2P75A 2B3DA 4FKMA 3LHKA 1JIIA 4LC1A 4MWOA 4DLSA 5FOSA 2CJFA 1XU9A 3B6IA 1H3FA 1N5RA 2GEJA 3DJYA 3ZY2A 2JFVA 1SUSA 2Z5FA 3ZXYA 1RW4A 3EEBA 8GPBA 5KQMA 2HPAA 1Z4KA 2WILA 3KXKA 1MFPA 1HLGA 3BRCA 1GU1A 4IDAA 3RHSA 3SX4A 5LZ9A 1QH1B 3H2IA 3UYKA 3T15A 2JD2A 1EHYA 1K0UA 4YJHA 3SVTA 3R0VA 1QGUB 3PTZA 1R1DA 4PSUA 4EI9A 1GEGA 2HA0A 3E9NA 4OJQA 1EQAA 1EFLA 3UJ9A 4C87A 4AIIA 4ZI7B 1MPXA 1VE3A 4XGIA 2KWIA 4KN8A 4WNAB 3Q7TA 3HUEA 1NVGA 1O96B 1WQ4A 5E8RA 2LV8A 4PCVA 3BGOS 1ZXLA 3IOEA 4DW8A 1Q16A 2UU9B 1Z8HA 3I2IA 1QE3A 1YQXA 1I2DA 2VNIA 4YGXB 2AXNA 3UEOA 5MN6A 1RHUA 2R6FA 3SYNA 1A1SA 3C8UA 4LZJA 1LPPA 4Z9AA 3ZE8A 4E15A 4P0PB 4NNPA 1U9ZA 4NQRA 5AQEA 4XRGA 3AEQB 4TV9A 5BUSA 3Q6IA 5SZJA 2VHUA 1JR3D 3T8YA 5KYXB 2GZ3A 4KRYA 1FNNA 2X8BA 4MUYA 1LK0A 1IVYA 4M8NE 1G3RA 1QH8A 3RRBA 4Z7OB 4CKZA 3R3XA 3VFDA 1KE1A 2WUWE 4KHZA 3EODA 3PK0A 3R44A 4V3CA 1DHTA 1DAOA 2AOTA 1GTMA 2Q6KA 2R2GA 3MWEA 4MTLA 4LYJA 5AKGA 4CHTA 2FN7A 2X9LA 1J2UA 2IXAA 1GAJA 3W79A 4X95A 4BO4A 1MRNA 1L4GA 1F12A 2OEPA 1O3YA 4L2IA 1G59A 1HE8B 2QG9A 5FNVB 2Q8PA 1E77A 4HYYA 5JQGF 4O2AB 1MG0A 4HVTA 1T2UA 2QXYA 2R00C 1Z16A 4K5QA 3S68A 3ZWWA 2VSOA 3GIDA 4NX2A 1U80A 3LKDA 2XA9A 4BV9A 1X7YA 2VJOA 4I1RA 4XGKA 4GSLA 4IV5A 5JJ5A 4L8WB 3TUIC 2AYXA 5J2TB 2HT6A 3TDKA 4IKOA 2C1ZA 4B3BA 2QE6A 1PVOA 3CF2A 1A0OA 2XW6A 4ZVKA 2XCIA 2ZXUA 3K4QA 4O59O 1U2EA 4DLUA 4RYLA 4LSZA 1AE1A 1LPBB 2HWKA 3H65A 3IEXA 4F11A 1U0OC 2D2VA 3KS9A 3VR2D 4DMKA 4WXHA 5AVYA 1L5RA 5DHSA 3UMCA 4DQVA 3FPLA 4EGFA 4QPNA 5E4FA 5KDLA 4BFZA 3SM9A 3USES 3W77A 1FFDA 4UZEA 3D3JA 3MJSA 4K0KB 5FJJA 1IEQA 1L5SA 2R6AA 3LA8A 3ONEA 1D9XA 3JWEA 2HYIC 3RK1A 1MO5A 2ZKLA 3I5YA 5TGTA 3ASYA 2FWMX 4X8LA 3UN1A 3V8RA 1TDJA 2CJYA 4DDVA 2EKLA 3ELYA 5CVDA 3GB9A 4JKIA 3S2GA 3SF8A 4C6RA 2WR8A 1CTQA 2SICE 2G25A 5BY2A 4BY9E 4CEHA 1PWXA 1TVMA 2ENUA 2D7CA 3UK7A 3WMWA 4C78A 4RADA 1PW5A 1LUAA 2WJZB 2KMLA 3O9MA 1KJNA 3UICA 2ZBUA 1NU6A 3RTBA 3W5JA 1Z7EA 4E1VA 4YX9A 1ID8A 2VP4A 2ERCA 1HLFA 3GRFA 1ZIPA 3A9CA 3S5UA 3X43A 1XZJA 3HKEA 3ZH9B 4EG6A 1NLUA 2BW0A 5E9WA 1XDUA 2I6UA 2WUFA 3T3IA 1O6ZA 3R7NA 1P9NA 2P2CA 3QWHA 1KU6A 3A2MA 3KXDA 4HZGA 2A0XA 1M2HA 3TI7A 1N78A 3IQGX 5LBIA 2DFPA 1TM7E 4K9QA 3VR5H 1EXWA 3B9BA 4LXIA 1GLVA 3ROGA 4YMSA 4RQBA 3K72B 3QHAA 2AEEA 4DLWA 4EMSA 1C9KA 1RLIA 5T64A 4Y9DA 4TLLB 4HPJB 3QE3A 2OFFA 3VGJA 5C32A 4Z1MA 3WTCA 4BNJA 6REQB 1PWHA 3PE4A 4JI8B 1Q74A 3WXBA 1RXSA 4HGYA 1M1ZA 4QJ3A 5K2OA 4GI5A 1UDXA 4PSKA 3L0DA 3NWJA 1P44A 3QITA 1FQWA 2IXFA 3L5OA 2EW2A 1LU9A 4QLBA 4ACAA 2H2WA 2FW6A 2FQXA 1FRQA 2H16A 4BE9A 1GYRA 1WP4A 1DRWA 4EY3A 3P19A 4MW2A 4QOJA 3VNQA 5C35A 4MW6A 2FUCA 3GJ3A 1ESMA 1YMQA 5FAXA 3MCUA 1P3JA 2A0FA 3CX4A 5ER6A 3ET5A 1CVRA 1JZQA 2LCFA 4XM2A 4CUZA 2I66A 2OO7A 3M3PA 5HHTA 4D81A 3QMVA 4DXAA 3RIXA 1QH0A 4Y2UA 3LYUA 2CSUA 2IP1A 2Q4EA 3LCRA 4NP6A 5E7JA 1ZKDA 4K9PA 4H1UA 2O0LA 1JIQA 4XWKA 2I4IA 5K8TA 4YJ2A 3EZ7A 4IGKA 4ALMA 2GJ8A 4G5GA 2RBEA 3K6SB 1YXMA 2IELA 1P4SA 4GMFA 3HJFA 3QXHA 1RPTA 2AG5A 3WNQA 1O4VA 2W48A 4IGFA 4FT2A 2QB5A 1I5RA 3R6DA 3SQDA 4LGVA 1I01A 3BZUA 3VGPA 5IZCC 4GX5A 4LEIA 4UD6A 4A5OA 3R6TA 4CPDA 4TWIA 2A0KA 1ZSNA 2BRUC 4I36A 4DRXB 1KKLA 2P6NA 4MW0A 1V6SA 5J47A 1AN0A 1OYOA 3PJRA 4B43A 1O77A 3MS4A 3FDXA 5T4FA 4H7JA 4BUZA 2C2ZA 5HK8A 5BYKA 4C08A 4UEJA 3EA5A 1VL6A 5E38A 4CDMA 4BAGA 3LAWA 2HCBA 3FNBA 1TF5A 3AB3A 3LU1A 1U7PA 1ZHHA 3D2LA 5C1BA 1E9EA 5C5IA 3F73A 1VZ2A 3A04A 3QEOA 3RYIA 3SJZA 4ZKDA 2DPLA 3IC5A 3ZXUB 4GBJA 1ODIA 3ZZTA 2RHLA 4O2AF 4UBKA 5FV4A 2Y77A 3NWEA 3PUWA 2WDZA 5LMZA 4I3FA 1P18A 1X7YB 2H00A 3ND9A 1G3UA 3KJHA 5JPDA 2WSSA 3OPXA 1E6LA 1JKIA 1HYHA 2FFHA 1XTUA 3KVVA 5EEGA 2PJZA 1JIVA 1QHGA 1L1FA 3VYVA 1YRYE 1P31A 3IRVA 1NUAA 4CKWA 1DRVA 2H4XA 2IZOA 2YY5A 2EF1A 3F47A 3PL5A 4HF7A 4I8IA 3A32A 4NZMA 4B34A 3MFYA 4U8HA 5DHRA 2G77B 4URYR 3WLNA 1H4VB 1U8XX 1X8KA 4FOPA 1XNHA 3DBOB 4ZU1X 1E4YA 4GR5A 4YS6A 4E2FA 1QU3A 2JAXA 1E1CA 2JBAA 4KPYA 3GC6A 1OKKA 1F2DA 3R0XA 4DIDA 3VA7A 4IPTA 4NECA 2TMDA 2HF9A 4F45A 2PX4A 2FSUA 3O6VA 2HREA 3EUWA 2QE7D 3VTKA 5I7HA 2G9QA 1YE8A 4HB3A 1J8DA 2TECE 1XNGA 2ZRFA 3IDFA 4HO1X 4KN6A 5I51A 1TAUA 2B37A 5I7WA 2C2KA 2F2TA 1FYDA 1K7SN 3IP5A 4NBUA 1UXHA 2G36A 4G63A 4TT3A 4YT4A 3MCTA 3R9WA 1O54A 4BN4A 3QEKA 4JBGA 1V8FA 4YRNA 3QVXA 7REQB 5CM9C 5KQSA 2Q6IA 2EATA 1NZDA 2D59A 1J70A 4FXOA 1I5OA 1D8AA 2EVWX 3ONNA 3PUIA 3UKDA 5LSAA 4MQBA 1U9JA 2PRYA 4ZVMA 1G8HA 2RG7A 5T6MA 3CM0A 4K6HA 3JZIA 3TIGA 1CVIA 4LXGA 1GPAA 1QYCA 1UPAA 3D3EA 5JI2E 3T7KA 1QGUA 5ADUS 4OHUA 3A9VA 3CJRA 3RFUA 4M1WA 4ER3A 5DE3A 3UFXA 1US8B 4CMHA 1QTNA 2HCFA 3AFGA 4MV5A 5IKOA 1F17A 2P90A 1D3AA 4ERNA 3MPUA 3G2PA 1DFIA 1BA2A 5B2ZA 1OYWA 3HCPA 1A9PA 2QYOA 2QTCA 3UT6A 3WHIA 4YCLA 2CJWA 5DLPA 2NAFA 4IH4A 3T7TA 4CTKA 3KKMA 2ZVPX 1KI9A 2IV7A 2FSSA 5C7LO 3LP6A 3QLVA 3S55A 1PR1A 5K8CA 3R0JA 2C7GA 1D2EA 3OICA 1FP7A 3ZKWA 1C30B 3VYSB 2K4MA 1JEYA 1X1SA 2A0YA 4NMHA 1E7WA 1VL2A 1MH9A 3UZUA 4FHGA 3ZHYA 4ZFNA 1SZDA 3TG8A 3H18A 3PXEA 5CFNA 2YHSA 1KGDA 1QQ7A 1WDTA 3PFNA 3B53X 3VDRA 4M4SA 3TKAA 3IE1A 4RAOA 1YFLA 4MQEA 1W9MA 1WSAA 4IILA 3VDMA 1FEZA 3CWCA 4WCFB 1U6KA 3WLMA 2ZYVX 1P2BA 5MGNA 3LPLA 4PHHA 2JIMA 1KBZA 3CVXA 2F55A 5F2KA 1L7MA 4OUKX 1NBIA 1G9SA 2MHCA 2GA8A 3MMSA 4WKBA 3E81A 2RKWA 3D59A 4J3NA 3LPMA 1NFRA 3EVNA 3KPJA 3ORSA 1T15A 1HL3A 3X3HA 2PL3A 1J24A 2NPOA 3UUFA 3ZHRA 2RH4A 1H05A 2CUZA 3QG5A 3SIXA 3KZNA 3TMYA 3LLVA 5FBLB 3S2ZA 3WL8A 1L5FA 3M82A 1YQUA 3JVIA 1FFCA 2QVYX 4YUYA 4R9NA 3RVQA 4H0NA 5IHXA 5IKXA 5KVCA 1ESZA 5E7IA 1PYDA 4G4SO 1DTWB 4INOA 1SCBA 2VK1A 4PFJA 1K86A 2B4TO 1NBOA 1C50A 3AFOA 1IU9A 3L7CA 4W99A 4YJ3F 5C3UA 1A95A 4UQOA 5TXGA 3R8XA 1EUCB 4O25A 4JL6A 1U3FA 1JBQA 3HVIA 3OUTA 4WZAB 2NU8A 1UC8A 4WNCA 4DIEA 1LDMA 1Y5IA 1A2KC 5ADVA 5HJEA 5ITVA 4LVOA 4Y2GA 5FI3A 3KRTA 4KREA 3BCUA 4H27A 4C1BA 4KAAA 3NRCA 4GT1A 3W9YA 1C9EA 2ZJFA 3K31A 1IONA 1A9RA 1D2GA 2AVDA 1E2DA 3WO1A 3GCXA 3ZKAA 4AZTA 1WAMA 4I9GA 4AF7A 4JLOA 5LU9A 3TR0A 3W06A 4W7SA 4N01A 3QNWA 5F7ZA 3WL7A 2X6QA 3LBAA 1M0WA 1XL1A 2B2XA 1ZW6A 2FG6C 2YZKA 3H0EA 3N0VA 4HX9A 1J42A 2GFQA 4OBXA 4JY7A 1XE3A 1L4HA 3PQEA 1N1EA 4M9SA 4ENPA 5FIUA 2BBWA 1E5TA 1UOOA 2RDMA 2WFMA 2ZE7A 4ZCPA 1CETA 4MVWA 3A6KA 4MGZR 3TOZA 3N87A 5ALJA 1VJ5A 2FP3A 2INGX 2R96A 5JECA 1P6QA 2OHXA 3HVRA 4W9NC 3SVZA 2GAAA 1JEYB 4IQ8A 2ZT8A 1H0SA 1HFWA 5EE1A 4RDXA 4C0SA 3ANYB 3I39X 4FVTA 1UPTA 2P5TB 4MRSA 1JJBA 3HDQA 2EGGA 2QLNA 4NENA 2GEDA 3RC1A 3SC4A 3WBKA 1IIRA 1UK6A 2ID8A 2IPMA 2Q1XA 4G9BA 1P3Y1 3VOBA 3N8KA 5D1NA 1GIAA 1WMDA 2X0RA 3PQ5A 4NYMR 5H83A 2RHBA 5DV9A 2G80A 1X9GA 1BGWA 1J25A 3FZEA 2X0EA 1QANA 3OCWA 4LJ6A 1D2HA 4I4IA 4X8HA 1U65A 1ISSA 2ZRPA 6GPBA 1W46A 1ND5A 1V16A 1ZESA 3C97A 4R2IA 5BSUA 5F1PA 1Y3HA 5TQ0B 1COZA 3K9LA 3Q7RA 3ZZUA 1DAIA 3K1AA 4FTWA 1P0IA 3D4BA 3DFKA 3IV7A 5ICMA 1WMBA 4EAQA 2JCGA 2Y9MB 5FBZA 3RF7A 1R4NA 5JRDS 3PXCX 3SYMA 1JJ7A 5DCWA 1QMPA 1EXNA 3I09A 4JK3A 4BLPA 4EO7A 2GBFA 3DV2A 2X4LA 4Q1CA 2I67A 2XRMA 2OXTA 1ABFA 3O4GA 1QK4A 1RHKA 5A3JA 4XUGB 1HA3A 2V6MA 2PVPA 1O87A 1M73E 3B1VA 4KZPA 1X92A 5CVVA 1C14A 2YJ3A 4ENTA 3FOEC 1BO6A 5HZMA 5IRCD 3KPUA 4EENA 2QI9F 4GECA 4JLKA 1C8VB 2IUTA 1M2EA 2C3UA 4PLFA 4URUR 3URMA 4BX9A 3QPVA 4MAAA 4RHXA 1IIBA 1TK3A 3DOHA 4FFNA 5EP4A 3UG7A 1GV1A 2W2LA 3EG5A 3GRUA 3W0LB 2RBKA 4RVUA 5CDFA 1ACJA 4TYNA 2AI3A 3RBVA 2EJVA 4NV0A 4JBHA 4D1YA 1U7DA 5BRNA 1K06A 1KZ7B 2HBYA 3FAKA 4HOYA 3ZDFA 5FEUA 2GCOA 1NSYA 3DUFA 2QN7A 1WUHS 3GA7A 3MJTA 4FCWA 2X9GA 4IQFA 2OYRA 4JR2A 1K88A 2EFEB 1TEVA 4X62B 3FZNA 3SU8A 3WIEA 4FEAA 2N1BA 2Y67A 2P78A 3HS3A 5DI3A 5DDIP 3QMPA 1DC4A 2RMKA 1Q15A 4CLEA 2BKUA 3K1YA 3VO9A 2CNWA 2RGWA 4RGVA 4X91A 2WAMA 4BKRA 1CZRA 3GXBA 1A8QA 1O1YA 3MB8A 1ZVVA 3LY8A 1JKFA 4ZXPA 5M5BA 4PS1A 4R1SA 4X1YA 1V96A 5J2UF 1T1GA 2Q3MA 2W83A 5J9FA 5LDDC 2JGFA 2CMFA 4P36A 4GWLA 2XNSA 1SD5A 3C4QA 2VN8A 3O26A 3ZTWA 2DWUA 2WU8A 2X4DA 3IJEB 4JNCA 3E4CA 3K2QA 5LP6C 4YMVA 4UPEA 4JI7B 1OI7A 1KHTA 2Y1GA 1J90A 1IMOA 1CC1S 3G5LA 4KN5A 4PIPA 3ORRA 1AZTA 4XARA 2GCNA 4BLUA 1NMSA 1C7QA 3W5DA 3RSHA 5P21A 4DCVA 4M7OA 4YXWD 2WKSA 4G89A 1CT9A 3W5CA 1R0KA 5ECYA 1Z0FA 1BKDR 4ZRMA 5FTKA 2I1QA 1K6IA 1H0KA 2P9GA 1SULA 3VPCA 4M8IA 1SUFA 4WY5A 3B5JA 4BS9A 2GAJA 4Q5IA 4QOSA 2DFTA 1G16A 3MMPA 5FPPA 2A84A 5JLAA 4HDRA 2PCLA 3KYBA 3N2KB 4OL9A 4DDUA 4N5MA 3K20A 2X6TA 4CF7A 5ICGA 1YR6A 5KCZA 4MJLA 1N5JA 3QYPA 4DLTA 4XDYA 2E1RA 2GGSA 2QAGC 1HDIA 3NXKA 4MARA 1Y9JA 2FW8A 2LW7A 1OMOA 1KFCB 3KEFA 4HUQA 1BH2A 4TS9A 5DSZA 3VO2A 5AKKA 2XZDA 3BBLA 4WXPA 4ZA2A 2D1RA 1M2VA 5DYNA 4TMXA 4OKSA 3TYXA 3TPFA 4HDCA 3SI7A 5CG1A 4LBYA 4V24A 4QAQA 4HNUA 1NUUA 1NIPA 3SM3A 2QG6A 4N0DA 1T4DA 1HQKA 2X76A 3BYZA 3ME5A 4Y6LA 2IY9A 3SC2A 1RYEA 4QHSA 5E6RB 3SXJA 3OCJA 5C8YB 1TKAA 2C4KA 4L8YA 4ML3A 3U7IA 2HRRA 5AI6A 3I72A 4Y7CA 4B46A 4CG0A 2XE8A 2OM6A 3STXA 3B51X 4U2DA 4IIUA 4GC5A 1F4LA 2OFXA 1CR2A 2QX7A 3VHXB 4X1IA 4HDNB 3ZWMA 2BMDA 3EC2A 2R85A 3TRFA 4GKAA 4BWVA 5JXHA 5G4KB 1V8DA 5BN4A 2CEAA 3WLRA 2XV1A 4X93A 5B3LA 2B2NA 1N4AA 1RCUA 2QZPA 5H82A 3VPFA 1E99A 4YMTA 5KNCH 1SG9A 1XJQA 3O8RA 1A7JA 3EIEA 3IO3A 3ZE1B 4A5SA 1B23P 2XI4A 2NZWA 5D87A 3BEDA 3C3DA 3BGSA 3PENA 4G37A 1YL7A 4FZ5A 2XYRA 4W7HA 3O4RA 4COOA 1JDUA 1KY3A 4PSAA 3C7CB 3PCTA 1TFRA 3E9ZA 2QUZA 4ZREA 4B3TB 1M74A 5ALWA 3LY5A 4RPJA 4YAUA 4I1YA 1TUIA 3QK7A 3QJYA 4R2XA 3OBBA 2Y2UA 3T9BA 1O0CA 1FYVA 1PNQA 1YA8A 4KQ6A 2YWRA 1HOTA 2BFBB 3N2YA 5IJAA 5HKLA 3AVVA 3R6WA 3OJEA 4QNNA 4TOIA 3ZI0A 2REBA 2AFHE 1TU3A 2G9ZA 2QKYA 3GEEA 3PITA 1QZUA 4D92A 3D6NB 1L8OA 1PJCA 1X1RA 3KL4A 3ONFA 5DGDA 1SQGA 5JVDA 1AU9A 4NEQA 3SF8B 4B1FA 2W0MA 4EEKA 4QODA 5EI5A 3UGJA 1SA0B 1ULAA 5ALXA 5BWNA 1OWPA 4BO5A 1RJGA 3RF6A 5FWXB 1MT3A 3JQCA 4A0SA 3NAGA 5ESWA 4MP3A 3CSDA 1WOMA 1YFKA 1FMLA 1GGVA 4MLZA 2FMIA 4EKYA 4EJFA 3LHFA 4UHKA 3LPNA 1YIDA 4NV1A 2DHEA 3BG5A 4MPJA 2HI0A 4R8KA 5ES3A 4ZO8A 1Q0LA 3KWLA 3EY4A 3HUDA 4F7WA 4YV7A 1EXMA 2V9CA 4BP8A 3WV4A 4AYXA 1Y7HA 2PUJA 3OZFA 1G98A 5BW6B 4I3HA 5J5VA 4BX8A 3FI9A 3N2LA 3FSEA 2BHSA 3ODGA 2FPSA 3TLBA 4Y2PA 4BU1A 3COWA 2FQYA 5FF9A 4Q4DA 3NHBA 3MGKA 4DS3A 2VQFB 3TNFA 2ZTUA 1IHYA 2VRCD 1OA1A 1EJ6A 2J6CA 2WWWA 1GCIA 3UMRA 2F3QA 4QOIA 3RUCA 1IUKA 3GP8A 4JUAA 2AMJA 5AW3A 5IEJA 3C3YA 4FYXA 4K9NA 5CT9A 1ORHA 2XUQA 3VU8A 1YS1X 2I4LA 2V7UA 4J2HA 4RF5A 1K5DA 2IUEA 2ZIWB 5DRTA 2PLFA 2PYZA 3IAFA 1BWPA 1IATA 1Z5VA 2VDOB 3AJDA 3PHIA 3HB1A 4MVJD 4FONA 4TKMA 1WM1A 1G5TA 1YS6A 5KX5B 1ZUWA 4EBFA 4HLDA 1C4XA 3NHMA 1CUFA 2F3RA 2GB4A 3DTTA 1SIOA 4WACA 3SJCA 3FYUC 4CMEA 5I4KA 5H3CA 2AOTB 13PKA 2WOOA 1ZUHA 4D4KA 5K0JA 1XAJA 3QEMB 5DNDA 1RYFA 4MYSA 3H0CA 1N8TA 4ZRDA 3VJMA 2ZIXB 1E66A 4YLEA 2C8LA 1JH8A 1XMVA 4XEUA 4C5AA 3BGWA 4MV4A 3ABIA 2Q2QA 4GX2A 1GTJ1 4MQFB 5IH7A 1KVSA 1PJQA 3HWX1 5J2TF 4ES6A 5C7YA 3QW2A 1PR4