4M1WA

Crystal structure of small molecule vinylsulfonamide covalently bound to k-ras g12c
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
160
Chain Sequence
b'MTEYKLVVVGACGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETSLLDILDTAGQESAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords K-Ras GTPase
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
total genus 62
structure length 160
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1wA00
2OHFA 2RKOA 2AKAB 1HQYE 4B71A 4HDOB 2IW3A 3FMOB 3OE7A 3LFUA 3RRMA 1H8ED 3P4XA 3FDIA 3IIJA 1ZP6A 3AGPA 4QFMA 3I32A 1W1WA 5L3RA 1NNEA 4QXAA 2OFXA 2QSZA 3VHXA 4LJ6A 1TQ2A 4H9GA 2XNSA 5GJCA 1F3OA 1DAFA 1GRNA 1P9NA 1VHLA 4XSGA 5FL3A 2RGCA 4B3XA 4P32A 1DAHA 5H8WA 1QHGA 4RD3A 4QRHA 2HF9A 3BH0A 1NVVQ 1W4RA 1VDZA 3NG1A 4TN1A 3L8YA 2OBNA 4LC0A 2RCNA 5BWMA 3AEZA 2WHXA 2OCPA 1RVDA 5FTKA 2Q0HA 3TUIC 2QI9C 2ZEJA 5C1BA 1CBUA 1UBGA 4E07A 4C0SA 2QBYA 2IYXA 2AN9A 5CK5A 3CPJB 1VMAA 2ANCA 1CEEA 1E0KA 3GFTA 4JLAA 2OT3B 1YZKA 1Q3TA 1E2LA 4RFSA 5G40A 4A6PA 3E1SA 1RC8A 2J0UB 3VFDA 3VAAA 1X8LA 3HPQA 4KSBA 4C0BA 3QI2A 3K70B 2CVFA 3T5GA 3GLGE 1BO6A 4V02A 1I4DD 3IQXA 3EPKA 1E3MA 2W2XA 1XZPA 2HJGA 3HR7A 3VR2A 4B48A 2J1LA 2QORA 1E9CA 4C7OA 1NSTA 1NP6A 2V4ZA 4NBSA 4Q4JB 4POAA 2ZI6A 1WB9A 2RB4A 1E2HA 3D31A 1KDOA 4DSOA 2HXSA 3A1WA 3SJBA 1SXJC 1WRBA 3TAUA 4IDPA 5EP1A 2G6BA 4B44A 2BC9A 1OFHA 2ORWA 1G1MA 4CDGA 1T8TA 2C2HA 2QT0A 1GKUB 4X8HA 1COWD 1X86B 4JBXA 2Q9BA 1MABA 4Q1AA 2OV2A 2IYQA 1IXRC 2G0NA 4NDZA 4OK6A 3KKPA 4A2WA 4F92B 5JHGB 1M7HA 2A5GA 3I73A 1G4AE 3B1YA 3QQ5A 4PHGA 3SNHA 2Q3MA 1XXHB 3GCGA 5IK2D 3W5IA 2W6JD 2JEOA 3NC0C 3A4LA 3A4NA 5FH9A 1G7TA 5A4JA 1NVWQ 3BFKA 2VTKA 4TMXA 5CK4A 3I61A 2WJVA 3EPJA 4N1AA 2OXRA 3R7WB 2HT1A 1LF0A 1E1RA 3FMIA 3B78A 3HDTA 2PX0A 4M8NE 2C9CA 1MKYA 5D3MB 2WWHA 3AVQA 1E9RA 1GILA 4KYUA 4MDEA 1RYHA 2H8KA 4PTLA 3T1OA 5JSZB 4C0JA 3SDZA 2JLVA 5JJIA 1M74A 2DFTA 2F6RA 2AHOA 3OHMA 4LHWA 4ASUD 5LB4A 2ODWA 2Q6TA 1BMFD 2PEYA 3LX5A 2J7PA 4JMPA 4U5XA 3FMPB 3FVQA 3VR3A 2BM0A 3C4JA 2IBMA 3RS2A 3UK6A 3UPUA 1LFDB 1P72A 2GAOA 4D80A 4PQYA 4GZMA 2IF2A 4NCJA 3U3MA 5B58C 3W8NA 2GEVA 5P21A 2NZ8A 4K46A 2QRZA 1S4QA 3KTAA 4LV6A 121PA 1P9WA 2HEIA 4Z8YA 1OH7A 4XD7D 3CNOA 1CS4C 4CEJA 4NU0A 2VP2A 4KXFB 3GJ7A 1Q20A 2RGBA 2JLYA 5FTNA 2PJZA 2QEQA 4HAUA 5HKKA 1OLOA 4AWXA 5KUTA 3MWJA 2QU8A 1TUEA 1ZNYA 2XGJA 3X1DA 2EYUA 4M1TA 1GZSA 4BASA 5CM9C 1I4LD 4XVUA 2C95A 5EZ5A 5L3QB 1E2GA 1AGPA 4G3XA 1U94A 2XTZA 1KNXA 4YMWA 3OIYA 4WBSA 3REGA 1GL9B 2IUSA 3G0HA 2IS1A 2G83A 1E0SA 4HUQB 2P67A 1YR9A 2OCBA 4Z54A 5LBIA 1VPLA 1WQ1R 2A7QA 3THXA 3NWJA 3EX7C 1EX7A 5SZIA 3I8XA 4Q1BA 1N0WA 5DHAA 3WYAA 2NTYC 1NMYA 3IHLA 3L0PA 5DH9A 3HJNA 1QVAA 2H57A 2CLSA 3SJCA 1I4TD 1OIXA 5FPYA 3CO5A 4GDFA 2FOLA 3DDCA 5JZVA 3WP0A 4TL9A 4LJYA 1OW3B 3DKPA 3RS0A 5CIQA 4DCTA 2QPOA 3THYA 2V7QD 4JVSB 1W36C 3LVRE 2CMKA 2EW1A 1BOFA 1E2JA 1TEVA 2BBWA 2EYQA 5HCIA 1N5KA 5J4VA 3CWZA 2O8DB 4LBVA 2H92A 3L0IB 1LNZA 3TR0A 1JR3A 4JLMA 1YR8A 3I1FA 3LBNA 5B64A 3GLHB 3HU2A 5EXTA 4B3GA 4JZKA 1H8EA 1SVLA 5K8TA 4WOPA 2DFNA 4OL0A 4A0GA 1KSJA 5BN4A 1Z6TA 3UG7A 1Z0IA 3H4MA 4W7SA 4BE7B 5F9FA 1MO4A 5LDDC 3ZQJA 4NH0A 5EP3A 4HEJA 4LYHA 4D4MA 2V3CC 4V03A 4BZPA 3U44A 2FZ4A 1E2NA 2W0SA 1W2HA 2IC5A 2Z4RA 2ZRLA 2BKUA 1K8RA 4HUTA 3AVXA 1II9A 2Q9AA 3M0EA 2BEKA 2CK3D 3FGNA 4HAXA 4MYTA 2HDNB 1OT3A 1DAIA 1KYIA 4JL5A 3WRXC 4B35A 1DAGA 3WNCA 1N6NA 1KO7A 2ZS7A 2BBOA 3F8TA 4OK5A 4DT1B 2FU5C 2J7KA 3RSOA 1T0JB 2FDCA 4PZYA 2J0SA 2ERYA 4PZLA 1KO1A 2A5YB 4FN5A 3PEWA 3Q8XB 2OFOA 3RLFA 4AYXA 2ONJA 1VTKA 2QQ0A 3D3QA 2DR3A 4Q18A 2CXXA 4ABYA 4G1UC 5TARA 1P3JA 4F4JA 5TVKA 1XNJA 4A1FA 5IF9A 1S3SA 4MYHA 5FOVA 3K09A 2JASA 4EQ6B 4CT4B 2ZRBA 4JLNA 3R9XA 4TYNA 2F43B 3R20A 1OH8A 1FX0A 3PUVA 3N70A 1ZNZA 3M6AA 1EFRA 3SQWA 4OQFA 2DWOA 1QVRA 2WSSD 2RHDA 1COWA 2VP6A 2CHVA 4LZZA 2FGKA 4K81B 1XDBA 4Q48A 3ZZUA 4CVNA 2SHKA 3DL0A 1KZ7B 3MCAA 1U81A 1W44A 2BOVA 1NBMD 1FUKA 3MAAC 5EP2A 4A8JC 4BWYA 3K0AA 3T1VA 5IK2A 2W6JA 1KJYA 3MGCA 4JLJA 4OYHA 2PLFA 1JXOA 1X1RA 4IFBA 4P4TA 2ZJAA 4UNQA 1S1MA 1M7GA 2G1JA 4BLPA 1XEFA 1OXSC 2AD5A 1DARA 3EC2A 2HCJB 2ZJ8A 1G3QA 2YHSA 1IHUA 4M1WA 1VHTA 1XU4A 2GDJA 2WAYA 2IYLD 2F1IA 4XJXA 1FQKA 5E7MA 4YQFA 4OHZA 3K0CC 1G64A 4IRUB 3LQRA 3PUZA 2IUUA 1LTQA 3CZPA 1KO4A 4M53A 1VG9B 2IS2A 1NN3A 4XOIA 5FOXA 3RRNA 1QZXA 3Q7QA 1OFUX 1W5SA 1W0JD 1WDTA 1BYIA 4ASUA 4DVGA 2X19A 1GFIA 3BE4A 2DCUA 3ZJYA 2J59A 3B60A 2VRWA 3OFND 3SBEA 4RSGA 2L0XA 2ORIA 4LWZA 3HWSA 3QVUA 2QM8A 1P5ZB 1NN1A 4NMMA 4C2TA 3FHTA 1N6KA 2ZSFA 3SZRA 1G7SA 2KBFA 4FMBB 2QM7A 2C9YA 1NF3A 2P5TB 1E2EA 1OF1A 2QZ4A 3BORA 3F3YA 5DYGA 1NG9A 3N5CA 1KY3A 3IBYA 4KODA 4M9QA 2XB2A 3DKVA 4BQSA 2JJ8A 3U3OA 2CHQA 1UDWA 4PO1A 3W34A 5C2JB 4XD7A 5JCZA 5JS7A 5SZHB 4U02A 5JCPA 3BXZA 3U3JA 5CITA 4NP6A 4PC2A 3U60B 4ARZB 2JLWA 1L4YA 2CHGA 5CYPA 1M6NA 2IHBA 2PLRA 3B1WA 3BJIC 2JCSA 1XPOA 2CL6X 3NVAA 3K70C 4RJLA 1ZUNB 3WHKA 5AJYA 1XRJA 3SYLA 3A1VA 5KNCA 2UVQA 3SOPA 5A5GA 2GAAA 1KK2A 2XITA 2R6AA 1OIVA 4GOKA 1WCV1 2BBTA 1Z06A 1UDXA 1K5DA 2O8CB 2GZHA 3D6TB 2XZOA 3QIAA 3I92A 3ZZTA 4ZV4A 3VTKA 1CF4A 4C3ZA 1T6NA 1G8FA 2AL7A 2WZQA 1DELA 4DEXA 4KBFA 4G0NA 4RD4A 4I81A 1Z6XA 5HPYB 1FP7A 1RJ9A 2ZE8A 1D5CA 2A2ZA 4RZ2A 5DGXA 1E2QA 3UWOA 1Z0KA 1QRAA 4QKQA 4P4UA 5JWHA 4DCSA 5DLQC 3W6PA 4BECA 3U4QA 2J41A 3RABA 2LCFA 1C9KA 2WWFA 1E9SA 1KAGA 5HE9A 1GL7A 821PA 4BFVA 1Z6GA 2DHRA 4E03A 1YJ5A 1CR1A 1ZYUA 4TT3D 2RGGA 2V7QA 2WM9B 2JA1A 5AUNB 3WNDA 1OJLA 2FMXA 4GSYA 3X1XA 2UZ3A 3W3ZB 3QXCA 4YLGA 3LRPA 1CJVC 2NPIA 1XD2A 2WKQA 3L8ZA 5L3VA 2VHTA 1L4UA 4EFLA 3OZXA 1XFAA 3LV8A 2F1RA 2R6GA 2A30A 2ZJOA 3T15A 3TQCA 3I4LA 1U8ZA 4DRZA 3QY0A 2WMNB 3NH6A 3T12A 1N0VC 1MT0A 2JLRA 2WKRA 1W36D 2IWHA 4O0MA 3ADKA 3BH7A 4V0OA 4DBLC 2PEZA 3FHCB 5C18A 2XZLA 1T3LA 3CM0A 2CL0X 2J3EA 3Q9LA 4R2HA 4MYUA 4D81A 1E9BA 1E9AA 4GFDA 3GLIA 1U8YA 2RH5A 5CYOA 2W0MA 1ZD1A 2BVNA 3LNCA 4RZXA 4JLKA 2OG2A 2CK3A 4I1SA 1F48A 5EE0A 2AFIE 2FNAA 1QHHA 2B6HA 1JEEA 1E2KA 4DJTA 1NKTA 1XEXB 2XTMA 4LYJA 3WNBA 1N2CE 2QMHA 2H17A 4Q19A 4Q4HB 5DI3A 5J4LA 3M4YA 2J0VA 4D4JA 2WOOA 3CKLA 2F9MA 3KKMA 1T9HA 3LBIA 4LJAA 3THOA 5KPDA 3RS7A 3VR1A 1T5IA 4BPBA 4M1KA 1F2UB 1GNRA 2J5XA 2V1XA 3B7GA 2BCGY 4TLDA 5B2ZA 3ZH9B 4JJZA 4KO8A 1FNMA 2WKPA 1J8YF 4B2PA 2QT1A 1IM2A 1XCPA 1KSHA 3KXKA 4CGZA 4PPGA 1E2MA 1OKKA 1VG1A 3GEHA 1HT1E 2WTUA 1CRPA 1I2DA 4NYMR 2CEAA 4FMDB 3MWKA 1BYUA 2V55B 5FL7D 4TTQA 4QJ4A 1HEIA 3BBPA 4A4DA 2KJQA 2KI5A 4P31A 1F6BA 2W83A 1P2TA 3P4YA 1U0JA 4H1VA 1X8JA 1GITA 2TMKA 2VLIA 3MD0A 4V0MA 3U2QA 2Z83A 3UATA 4ZI3A 2EWVA 2I4IA 4WIAA 3ADCA 4AG6A 4RZUA 4U00A 3MFYA 2WSSA 3OEEA 4JSTA 1NVXQ 2FF7A 3QKRA 3QKUA 4MRSA 2O0JA 4JJKA 4YMUA 3SR0A 1Q12A 2O0KA 3CPHA 1NI3A 5EXXA 3QEJA 4IOMA 1E9FA 2WV9A 4ZDIA 4DIEA 4HYYA 2B7BA 4Q00A 3AVVA 1W49A 2VIIA 3W9YA 4AY2A 1GG2A 3KUDA 4DIDA 4FXPA 2CJWB 2QP9X 1P75A 4U7DA 3SQXA 4A2QA 1GOTA 3CW2A 3LVQE 1NLFA 4KI0A 3KB2A 1II8A 3U7EB 3K9LA 4NYMQ 1OXTA 2QTFA 4MGZR 4Q1DA 3UWKA 2A5FA 2CVHA 4PPQA 2C9OA 4TQUS 3DOEA 1NY5A 2WVJA 1QBKC 1KHTA 1S2MA 4LPSA 2ZI3A 4V0LA 3DMNA 3OFNA 1Z07A 2D2FA 1EK0A 4LJ8A 3TGPA 4EIWA 2PBRA 5TY0A 1FZQA 4QHYA 3T1TA 3G5UA 2HYIC 4A0FA 3HYTA 5FBRB 2XOKD 5K8LA 1SVIA 3UG6A 3SS8A 2B21A 3UMFA 1WBDA 4GMDA 1AGRA 4F7WA 1R5OA 3GLFA 4B2LA 4OI0A 1F60A 3WMEA 1KY2A 2LWIA 4OKSA 1NIPA 2XNDD 2G88A 2ZJZA 1YZLA 1JQLB 2WAXA 1KI6A 4NONA 3THWA 5FI1B 3LLUA 4F38A 4WA7A 4LSGA 5HE8A 1PLJA 3A1UA 3B9PA 3RRZA 3HR8A 3MG9A 2JJ2D 4QBFA 2P65A 4TTPA 3AF3A 4OQMA 2IEZA 4QGFA 1P61B 1R8QA 5HTKA 1IJEA 4XIGS 3QKSB 3TSZA 2HLDA 2X1VA 4E5UA 1NVVR 1A2KC 3GJ8A 4M1MA 1G291 1VCOA 2BJVA 2VEDA 2ZPTX 2GJAA 1JR3E 1RZ3A 4JYCA 4QBIA 1J8MF 1HQCA 1E9DA 1XTRA 2C98A 3KX2A 1AA9A 2WIBA 1SVMA 1JBKA 3WBKA 2VSFA 4NHOA 1U9IC 3TQFA 1JXMA 2CLCX 3FMFA 1G9XA 1OXXK 3EW9A 1P2VA 3B5JA 3FE2A 3LH5A 3CR7A 4DSTA 3EZFA 3K70D 4YDSA 5LD2C 4LHVA 4QNRA 3VHLB 5KO2A 4WW0A 2VH5R 1YU9A 1XF9A 3MWLA 1Z8FA 4TYPA 3BB4A 3WMFA 5FBLB 2N46A 2PT7A 2AKYA 1RIFA 4XSHA 3F5FA 4DEYA 2PZGA 2RGNC 3KFXA 1N6LA 2IYSA 3NIBA 4I4LA 2G0TA 3B9QA 2ZYVX 1E2PA 4RD0A 1Z29A 1ZU5A 2VP9A 4TQ9A 1R7RA 3I72A 3IEUA 1DTSA 1HT2E 4XTCS 1FUUA 1KMHB 4PXAA 4TZ0A 4NCIA 5BW8A 2B7CA 4RZ3A 4NCKA 3V4RA 3PJRA 4MITA 3H2YA 4TT3A 4MRPA 2IHYA 3VU9B 3KKNA 4AD8A 4K8OA 1KSGA 3BS4A 1CJMA 4B73A 4Q7JB 2AR7A 1G5RA 3C7KA 1DVRA 2X2FA 2X2EA 4G5OA 1OHHD 2ZYTX 3TH5A 4DLYA 1ESMA 1NIJA 2VHQA 3K0FB 4DDWA 3REFA 3CF6R 4CYMA 4RY2A 2D3WA 1D2EA 2GA8A 5JBQA 4MUBA 5CLLA 3UMSA 2HYDA 4E09A 1HV8A 4MDFA 3UKDA 3AVOA 3CRMA 1ELOA 5HR5A 4WXRA 1GDDA 4RKFA 5AUOB 1Z5ZA 1PVOA 5KPJA 1SKYB 2CE2X 2ZREA 4LYFA 4MA4A 1U90A 1U99A 2EVWX 4JLOA 4L5BA 4IXNA 3FFBA 5E4FA 4ESVA 2P6RA 4FCWA 1OPXA 5L3SA 2QROA 3KQHA 2H7VA 2QGNA 2ZRJA 2KB0A 3CB4A 4US0R 2ZSDA 4RD6A 5FUXA 4BGDA 4P4SA 3EA5A 4HI0E 1XTIA 4HLUC 2WSMA 3CNLA 1GWNA 2JAQA 2FEOA 3QF4A 4NTZA 1G4UR 2YOFA 1YE8A 1UBEA 5C46F 2GZDA 3NBZC 3SU8A 3H1TA 2A3RA 4OHVA 1KOFA 1JNYA 2OCYC 3A37A 5UKDA 4DSNA 1UBFA 4AKEA 2P6NA 2ZXUA 4TQAA 4Q7KA 3CF0A 4FMCF 4GOXA 2NG1A 4KFRA 5B30A 1EFTA 1LW7A 5FL7A 3VQTA 4B34A 3ZDQA 1Q44A 1KK3A 3O47A 1V5WA 1XB2A 1OFTA 3UIEA 2K5UA 4R7ZA 3RC8A 1QG2A 4BLOA 1ZC3A 1A7JA 3N2EA 3B2EA 3QE0A 4GZLA 4RKEA 4EJSB 1AKEA 3X2SA 2ZRDA 2P2LA 2O8BA 5CDFA 2GK7A 3WBJA 1UFQA 3DM5A 4QJ3A 4LBWA 3ZLJA 2D7CA 4MGKR 3QEOA 1TF7A 4R9UC 2ODEA 3MUFA 2OLKA 4TMWA 4WXPA 1Q57A 5FUYA 1X8KA 2NQ2C 2LKCA 5FPTA 5L8VA 2QMOA 2WJIA 2IF0A 2ONKA 4A8JA 2JLZA 3BFXA 1OSNA 4TLBA 3VNVA 2ZANA 2HXYA 2ZE5A 3NBXX 1NL3A 4IDQA 4KU4A 1EWRA 4LHZA 5FUWA 2ZQ5A 1XWIA 3B13B 2BKEA 2OUKA 4DUGD 5FI0B 1E69A 4US1R 421PA 3K0CA 4AKGA 4LCBA 1Q1ZA 1R5BA 4EAQA 2IK8A 3DHWC 3WY9A 4D25A 3WXMA 3IGFA 2J87A 3GLGB 1WP9A 2D74A 5GJWC 1SVSA 4EFNA 5KSOA 1IQPA 2XOKA 2ZS9A 2FFBA 5J4KA 3D8BA 4NL4H 2LKDA 1FL9A 3TR5A 1LV7A 1CR0A 3BC1A 4ESHA 3K0AB 1KDPA 2MMCA 3BRWD 3MRSA 1Z6AA 3GJXC 4N3NA 5FOUA 3Q72A 2G9NA 1G5TA 2XNDA 4URYR 2OO7A 2PL3A 1G8YA 3PEUA 4LJ5A 2V8OA 2YYZA 2PMKA 4LDJA 2HF8A 3AF1A 1XD8A 3ASYA 2JJ2A 1FNNA 2JGNA 4M4SA 5AUPB 5K8IA 3ASZA 2QMUA 2GJSA 1G16A 3FFAA 3MSXA 1RE0A 3DVLA 4V0KA 5E3HA 2WWGA 1NSFA 2C77A 1E99A 4Q1EA 5FPSA 2NOAA 1S8FA 2EFGA 2YV5A 2QA5A 3ZYCA 1TADA 1A2BA 2EFHB 2IYVA 4L16A 4KLNA 4DCVA 1M8PA 1G20E 4DSUA 1G8HA 4B43A 2KWIA 3L2OB 3T5DA 2REXB 3EIEA 3LXRA 3ZVLA 1T8UA 3NHBA 2ZAMA 2RAPA 1CRQA 1MR3F 2XTNA 4FINA 1XJCA 4TLEA 1IXZA 2VHUA 1S3GA 4P3YA 2OFWA 2FE4A 3IIKA 4BUJA 3H84A 1DO0A 3KJIA 3GLIE 1XTKA 3GFPA 4CEHB 4HZUB 4Q4JA 5DHFA 1AN0A 5JS8A 3VKHA 2FSHA 3B1VA 5J40A 4M1OA 3ZD6A 4PHHA 3KL4A 2ZITA 4RD1A 3FB4A 3EZ2A 1DAKA 3SC3A 2QL6A 5BXQC 1QF9A 3EZ6A 3FKSD 4TL8A 4PHTA 3TK1A 3CONA 4WZBE 1YZUA 4C0AC 5KDLA 5TV2A 3RSLA 3LLMA 5J47A 5KNDA 4F93B 5JJKA 5DI9A 4KFSA 4CW7A 5HCNA 2VL7A 4D6PA 1XXHA 4A0HA 2Z43A 4M0LA 4IJMA 1KI1A 1JR6A 2EFDB 1KSFX 2ATXA 2ERXA 3NBFA 4TL6A 1IN6A 4RD2A 4PO9A 2XZPA 2QPTA 1OHHA 4HLDA 3R7WA 4AURA 3ZVNA 1XMVA 5KDOA 4L4UA 2OE2A 5EE5B 3AKYA 4FW9A 1NKSA 2WWYA 1AK2A 1N3BA 1ZUIA 4LY6A 5D3MA 4Q1CA 4B2IA 3NH9A 4UJ5A 1VYUA 1R0YA 2AFHE 3NBYC 3CF2A 5FTMA 3IO3A 5JSZA 4V0ME 1J99A 1KJWA 3T35A 1GL6A 2FX3A 3AKDA 4C30A 3OESA 4I1UA 1HUQA 3B1XA 3PV0A 1L8QA 2MSEB 4JL6A 5FBVB 4OHWA 4DCUA 4Q4AB 3L82B 1Z0FA 5LB2A 4R71A 3BWDD 1ZCBA 3VNUA 1W7AA 4N0DA 4GT1A 1J7KA 1JECA 5A0FA 2GWHA 3NDPA 2Z4SA 1SXJE 1Z0DA 4L15A 3SBDA 1S1CA 5E95A 3C8UA 3KXLA 3F0TA 4TYQA 1M1YE 2QAGB 4PFSA 3W90A 2CCGA 3EA0A 1PUIA 1A4RA 2ZR0A 3LA6A 1XD9A 5IT5A 3I5YA 3EZ7A 2FJUA 3QG5A 2ZYUX 3GJ0A 4A6XA 2VP5A 1US8B 3HP1A 2ZTSA 2B8TA 3EPLA 2W2TA 2H1LA 3CRVA 2J0QA 1DG3A 1VCMA 1MRNA 4KV9A 2IS6A 1N6OA 2J46A 1G21E 1OYWA 2ODNA 3ND9A 2GILA 1W2GA 4C2UA 1Z0AA 1AJEA 1UKEA 4IVRA 2BEJA 4LX0A 4URVR 1UEIA 2CE7A 4US2R 3A1SA 1CJUC 4QM7A 3MMPA 1K6MA 2F3TA 2BIFA 3GP8A 3ZIAD 2V6JA 5FR1A 5JFGA 5L3QA 3VKGA 5FBWB 4B3DA 4LC1A 1GVNB 4HB3A 2OZEA 3CX8A 3GLFE 2WPDD 3IKJA 1TAGA 2ZRHA 2GKSA 1BMFA 4HUQA 2CLDX 2GEUA 4A36A 4IVPA 2YWEA 3EXAA 3OAAD 4RCZA 4OHYA 3EASA 1BIFA 2OAP1 4TMZA 1Z63A 4LRWA 5KSZA 3L0OA 4BLRA 4UQOA 1SGWA 1W4AA 4B3CA 2NO9A 1SHKA 1U0LA 2MMGA 4S35A 2AD1A 2ZU6A 4A82A 4PPNA 1SKQA 3SE0A 2IXEA 3PXGA 4TYYA 2ZE7A 5J4HA 5DE3A 4C0LA 4URXR 4F4CA 1F2TB 3ZVMA 3B85A 1S96A 2BJWA 2NPFA 1ZD9A 3SHFA 4DDTA 8OHMA 2FEMA 4FCTA 2NGRA 3IPYA 4KFUA 3R9WA 3R8FA 1XJQA 2YWGA 1RRPA 3AUYA 4DUGA 5KU1A 3L0SA 2O8DA 3HU1A 3QPUA 1A5TA 3VR5A 1DEKA 2WWIA 1MO6A 5F3WB 4BFTA 1MO5A 2BMFA 5FBQB 4MGIR 4UXHA 3AP2A 521PA 1VCIA 2O5VA 4LHXA 3GLHA 4D4KA 3C5CA 3QKRB 4YMSA 3IUYA 1CKEA 1XBTA 1T4GA 1LS1A 2WWWA 3ETLA 4HB0A 4PC3A 5EXSA 1SXJB 3U3RA 1O3YA 4G5RA 4LI0A 4PQFA 4TMVA 4B32A 4G5SA 1GTVA 1Z08A 4A0RA 5GVRA 2C04A 4IHQA 3SHWA 2NO1A 4LOAA 5H1YA 5AWFC 2ECKA 3VKWA 1S9DA 1EFHA 4DLXA 3CH5A 1XEWX 2FZLA 1YRAA 2ZE6A 1KI3A 4EPXA 1J2JA 2W2VA 5HZHA 5H70A 2IYYA 4DT1A 4ITRC 4Q03A 3TUJC 2QY9A 2ZROA 3SN6A 1E0AA 4EPVA 3DZDA 5J4YA 5BYKA 2P5SA 4WZ6A 1ZJ6A 1GP2A 4ZCMA 2IXGA 1TQ4A 1OIWA 3P32A 3BOSA 2BM1A 3K9NA 1Z6YA 4F91B 1ZNWA 2ZRPA 1Y3AA 1NRJB 3IO5A 4JYBA 4MKIA 4ZO4A 1BH2A 1UF9A 4YC7A 5FPKA 1OXVA 2JDID 2VP4A 3FYHA 5DSZA 4R2IA 4ZIRB 1AQYA 2F9LA 2BWJA 2N1BA 5H68A 3U6BA 1ONBA 4EPRA 3EG5A 4ERNA 1T3SA 3FWYA 2VA8A 5JRZA 2JATA 1U9IA 3RWOA 1SVOA 4BRWA 4EJSC 4EQ6A 3I62A 2RGEA 1P2SA 4PZZA 1H8HD 2F43A 1XMIA 2A5JA 1P73A 3OF5A 3ZS8A 1PUJA 1TQDA 3O8BA 2ZUBA 4QGAA 3BAFA 2D62A 3FKSA 2GXUA 1YR6A 2IWRA 5JJLA 2GCOB 4JVLA 5D3QA 5FFMA 4CEIB 2DBYA 3TW4A 4MQBA 3HPRA 3JVUA 2RGNA 2GBLC 1OV4A 3CX7A 4IVQA 4PAQA 3B6EA 4XVRA 1UPTA 4DWJA 2ZJYA 5G53C 1E32A 721PA 1WMSA 1UBCA 4LV8B 2GHIA 1MV5A 2D06A 2O8FB 2PT5A 4OQLA 1AS0A 1FOEB 1E9EA 2NO0A 3A4MA 3CIOA 2XAUA 1XP8A 1EG7A 4IDOA 3PENA 3GPLA 2QPAA 2GTPA 1P6XA 2ZSAA 2VF8A 2ZR9A 1MO3A 1V43A 3WMGA 2IYWA 1E94E 1BS1A 1H65A 2AWOA 4EPTA 1Q1EA 4DLUA 1E1QD 4LHYA 1Z22A 5DO9A 3ZS9A 2QENA 4XWAA 1D6JA 4NCHA 1G7CA 5BYJA 1N5JA 2PH1A 4NYJQ 1JAHA 4P0TA 1UADA 3X1ZA 1FMJA 3HYRA 4ZKEA 2VP0A 1RRGA 3U7HB 1YZNA 2BMDA 2JJ1D 1G6HA 1R0XA 3E5HA 5EUQB 5ELXA 2PX3A 3S1AA 2F1JA 4I1VA 4B6FA 5CDFE 1XPRA 1C4OA 3OEHD 4GP6A 2REOA 3OIWA 4MKGA 1KKMA 2NO7A 3MJRA 1KDRA 4YONB 1M7BA 2CDNA 5JLJA 2BCJQ 2QGZA 4LBYA 2BMJA 3PIRA 1NBMA 1Z0JA 5FUVA 4NCNA 2QBYB 1W5TA 1KK1A 2XSZD 4ARZA 2GETA 2X77A 4HLUA 5AJXA 1IOZA 4ZKDA 4FI3C 2WJHA 3EWAA 3PVSA 2RGAA 4O25A 1EXMA 3AVYA 3U61B 2VSOA 4RFSB 1X1SA 3QSYA 1GUAA 1CJTC 4EDHA 1JB1A 3TSWA 1RW4A 4KSCA 1YZTA 2FFQA 3IHWA 4LJ9A 4H1UA 4HSEA 1P7CA 1ZIOA 3U7GA 3AVWA 3PR1A 3TUZC 2QE7D 2QRNA 3ZIAA 2GESA 2O8CA 4ZI2A 4G5QA 2FFAA 4C7OB 5FR2A 4IOLA 5EP4A 1W0JA 2GVZC 1AKYA 1Q21A 2Z0MA 2WPDA 3KQUA 3RRYA 3B8HA 4HAZA 1OB5A 1AIPA 2DB3A 3TAHA 3OAAA 1FP6A 2ZSBA 3GEIA 1P60A 3SFZA 4Z1MD 4B74A 2WJJA 1YZGA 2CCKA 1EWQA 1ZM9A 5AJVB 2ZM5A 4Q9LA 3QPVA 1MABB 1KKLA 1FW6A 4W5JA 4GL2A 4QJ5A 4BLQA 3A6PC 4V0NA 2HV8A 3EPHA 1GRQA 5SZKB 4Q7MB 1QG4A 2HJVA 1T0HB 4AKIA 1N25A 3NKVA 3Q5DA 5CB8A 1CU1A 3U7FB 3AB3A 3QG1A 2ANBA 4WVFA 3FOZA 1II0A 3CR8A 2W00A 1DPFA 4O3MA 1QDEA 3IPXA 2EQBA 1YKSA 3L43A 1IAQA 1WXQA 1ODFA 1NLYA 5F98A 4KVAA 1JJ7A 1HA3A 2MSDB 1VECA 4JLDA 1KI9A 4AKHA 3AP1A 1XZQA 2X8AA 2RGDA 3RVBA 2OAQ1 4D26A 2GXQA 2ATVA 4UXIA 621PA 4DC9A 4PSVA 4IEEA 2E1RA 1UAAA 1ZIPA 1VIYA 2C99A 4LGMA 3LAWA 3DO6A 4KLZA 3B82A 3VMFA 1DE0A 2BV3A 1TTTA 2FA9A 3BFVA 3RANA 2VSXA 5SZJA 2AX4A 2PCJA 2QAGC 2XX3A 3O8CA 1G5PA 3V00A 1TF5A 4ZDKA 1G19A 2QAJA 4EKDA 1TF2A 1E2DA 2E87A 2H16A 2ZU0C 4JBYA 4OI4A 1XEXA 3TJZA 4D0NA 3KTAB 5JEDA 3ADBA 1HE8B 4Q66C 1XXHE 4II7A 1TQ6A 4Q4HA 3H86A 3LBHA 4HAVA 2R6DA 2QP4A 3LY5A 4CEJB 4FD2A 2O8EA 2F3RA 2N42A 1CR2A 1AQUA 5KDDA 1YRBA 3KUCA 2Q9CA 1G41A 1GAJA 1F2UA 3HU3A 2PZEA 3DM9B 3RHFA 3GEEA 5G41A 2GXAA 3VX4A 4BLSA 4R98A 2I1QA 5IDVA 3AVPA 3ZZ0A 2MSCB 4YMTA 1R0ZA 2JDIA 1N5LA 1SHZA 5KYKA 1L2TA 3GJ4A 3OIVA 2VHJA 1RKBA 1G3IA 4I99A 1VIAA 2V9PA 3LXXA 2FPLA 3GJ3A 4OI2A 4S2EA 4TMKA 3TVDA 1TPZA 2AK3A 1SULA 2XEXA 4J0QA 1ZRHA 4WZAE 1H8HA 4C9BA 4YDHB 2GJ8A 2F7SA 1CULC 1G3UA 2F1HA 4D2IA 1GKYA 4AC9A 3T06B 2EFEB 4IDHA 5EE1A 3THXB 1IY1A 1TL7C 1NMXA 4O2RA 2GEDA 2WIAA 4D4LA 4X8MA 5IRCD 2IS4A 1G3MA 4OQXA 1JJVA 1QHYA 5CM8B 4KAXA 4DLVA 2EU8A 2PJRA 3EWSA 2YJTD 2C8VA 4HDCA 3AKCA 5B57C 3WYGA 5DN6D 1UJ2A 4ZCLA 3GMTA 1CIPA 1OFIA 3TVTA 5E7IA 1Q1QA 1ZM3A 2GCPA 5LPNA 2CJWA 4HAYA 3CH4B 4QBGB 1DS6A 4G5GA 3THYB 4IEIA 5AJWA 4A9AA 1GIAA 1D8TA 2VHCA 2F55A 2WMOB 2YWFA 1TMKA 3C15C 3H0KA 3IILA 4EUNA 1E1QA 4JSYA 1MRSA 4IW3B 2YKGA 2BMEA 3E70C 4EFMA 1RRCA 4MRVA 2GJ9A 4FMDF 1UM8A 2I3BA 2IEYA 4PX9A 4N0EA 3AP3A 3ZQ6A 3TBKA 2JJ1A 1EFRD 2R65A 2O0HA 5M04A 1J70A 3U44B 1WF3A 3TLXA 3OEHA 1CJKC 3QBVA 4IKEA 1XMJA 5CJPA 4GMXA 3CZQA 5CLQA 2P3SA 4C0QC 3CRRA 1KDTA 2D2EA 2IXFA 2Q3FA 2OBMA 2ZETA 2ZRIA 4ZCIA 4UNPA 4XWKA 1D9XA 1JQJC 1BKDR 5EJEA 2R8RA 2XSZA 2ZRAA 4B75A 4GRAA 4OK3A 4W9MC 1WBBA 4TLCA 2NIPA 1OE0A 2QSYA 3QKSA 1IN4A 4HLQB 4I1OA 3KQKA 2I1VB 1W4CA 1RFLA 4DLZA 2ZJ2A 1UKYA 3VX3A 4DDVA 2PZFA 4BZQA 2YWHA 5TB5A 2ODBA 3KXIA 1JALA 1SVWA 2QE7A 3GLHE 4KITB 5GVSA 5BN3A 3CX6A 1XEWY 2DWPA 3QXJA 5EE9A 1SVKA 3KDSE 3M1IA 3NC1C 3ZGXA 1OB2A 2ZVPX 5JWOA 2OM2A 1FFHA 1FX0B 1JPNA 4Q9KA 4MH0R 2C96A 1Z3IX 5TXGA 3VR6A 4AYTA 1Z28A 4Z1MA 3ADDA 1UKZA 3TIFA 1RYFA 3UMRA 2GXSA 3AF0A 5CB6A 6Q21A 4TTRA 2IUTA 3AF4A 4ILEA 4A15A 1Z47A 3TSOA 2V6IA 1XCMA 2ZI9A 4LUCA 4GBMA 3RNLA 2QTVB 3PFIA 5DIFA 3WHLA 3JZAA 1YR7A 5FOTA 3W8RA 4PQRA 1GM5A 3QNUA 2IX3A 3AVUA 3P27A 4Y0VA 3RYTC 1KMHA 3R9IA 2ZRFA 4Q9JA 4YMVA 1EX6A 3A8TA 4Q9HA 3RS4A 1AM4D 4JLVA 1U8AA 1VYVA 2GF9A 2R6FA 3O8DA 4PAOA 2ZRCA 3CBQA 3T34A 3VU9A 3DEFA 1ZNXA 2YOHA 1AS3A 2A5DA 4JT4A 4Q47A 1ANKA 3TE6A 4TLAA 2NZJA 2V1UA 2RGXA 1E79D 4TSFD 1FTSA 2HT6A 3NXSA 4M9SA 4W5HA 4JKIA 2UKDA 3ZD7A 2ZYWX 4UXJA 5JHHB 3K0FA 2RHMA 2YZ2A 4DHEA 2GZAA 4PO8A 1XPUA 2A78A 2B92A 1FTNA 5E7JA 1EGAA 2J0UA 4DXAA 1R4AA 3RS5A 2P6UA 2ZIAA 4ACBA 4CRWB 3LW8A 1X6VA 1GSIA 4ZPXA 4TMTA 1P4SA 5TMPA 5JI3E 3CRW1 1EESA 4Q4LA 3NHAA 2WWXA 1LF5A 4BFSA 2ASEA 1R5NA 4BRUA 3C41J 1ZAKA 1XX6A 3K9GA 3PCRB 3U6KA 1CTQA 2Y8EA 1KIMA 1OYYA 2JLXA 4PC7A 2FPKA 4LK2A 1IN8A 4D82A 1HURA 1W0KD 3QXXA 4B6EA 4DZZA 2KBEA 3A58B 5FTJA 4B47A 3O8RA 2FSIA 2R62A 4UNNA 5HZKA 3FPAA 1M2OB 1S0UA 4UJ3A 4UNSA 1KI4A 4BFYA 4PR0A 3EIQA 3CUEF 1ZC4A 4GP7A 4KJZA 3TNFA 2WJGA 3MWYW 2Q21A 3GJ6A 2FN4A 1TEXA 2B8WA 1JI0A 1CLUA 1WE2A 3DOFA 1S9HA 2XB4A 5TDHA 1XTQA 1KNQA 1DO2A 1T3HA 4LJ4A 4DDUA 1KGDA 1QHNA 1R8SA 3QUSA 3ZVRA 4P33A 5KSYA 3LD9A 1RJ9B 4CIDA 4C0KA 5KNBA 2OCAA 1KO8A 1G7RA 4PSKA 1NJGA 3LQQA 4PAMA 2NO6A 4DKXA 4EJSA 2OBLA 2YOGA 1NMZA 5EUMA 5KSPA 4PSAA 1I2MA 3KB1A 2ZSEA 4NKRA 2OEPA 4QHSA 1NN5A 3W6NA 1W4BA 1ZM7A 5DN6A 1NBME 5KHOC 3DMDA 1D9ZA 3LWNA 4LV5B 4L8GA 3U4QB 1G17A 4A92A 2GF0A 5F9HA 1CP2A 3QJYA 2ZJBA 2Z6VA 3SYKA 2FGJA 2GBLA 1OKKD 1PLKA 2FFHA 4GI7A 4M2LA 1O87A 4XWOA 2E9SA 1KJZA 2AXNA 3TRFA 3PUYA 1P2UA 1XD2B 4XH9B 2G1KA 4FCVA 4RCYA 3WRYC 3Q3JB 4Q9IA 4Q5IA 3EC1A 2IT1A 2QN6A 3BERA 1AS2A 4BZXA 2IYRA 2VQSA 3IDQA 3NEJA 2J9RA 2O52A 2JIZD 3C16C 1U0HC 4DLWA 1KI8A 3X1YA 3PUWA 5C4MA 5LD2B 4L9SA 3U3KA 1IN5A 1MOZA 3QOFA 1AZTA 5G3ZA 2D7DA 3GLGA 3OEED 1OH6A 1UEJA 4EPYA 2HCBA 5JECA 1ZVQA 4YXWD 3C5HA 4HAWA 3AH8A 3GLIB 1HYQA 2D4HA 2IYTA 2Z5FA 1UKVY 3KKQA 3BB3A 3N2IA 4KHZA 2OESA 1L7VC 1SXJD 3Q7PA 3T1QA 3SYNA 1G8PA 1QHHB 2R2AA 5JRJA 5F2EA 3CNNA 4OBEA 1W48A 3CWQA 4MYCA 2J45A 1VKJA 5DI3B 5JMTA 4HZIA 4MGYR 5EE3A 4Q21A 4JLPA 1OH5A 1N5IA 4M1YA 2ZAOA 2ZS8A 1GKIA 2WBLC 2OSBA 4TWZA 4KYIB 5FPHA 1R0WA 4URZR 1N6IA 4EPWA 1ZBDA 1Y63A 3AVTA 3CRQA 4ZDJA 1FQJA 1WA5A 5AUQA 3TMKA 1HTWA 1KI2A 1U2RA 3EAQA 3ECCA 1VCNA 4NZYA 4JL8A 3BH6A 3KZ1E 1ZMXA 4E22A 1HH4A 4AI6A 4LBZA 3P20A 4URWR 4AG5A 1W46A 5J5CA 1DG1G 3OIUA 3S1AB 5GJVC 4AYWA 3J81k 1XJ0A 5AR1A 3AUXA 3BD9A 3PUXA 2YINC 4OI1A 2ZRMA 1ZUHA 4Q02A 3Q85A 1G8GA 1NY6A 4KBGA 1F5NA 3VR4A 4CEHA 1ESNA 2QG6A 2CNWD 4HZUA 3SJZA 3IBGA 1P62B 3TW8B 3V4FA 3AF2A 2FPMA 5CJ2A 2PCLA 4L9WA 5G3YA 2YVUA 4BFUA 3A36A 3QPWA 2G77B 5K8UA 1IONA 2IL1A 1ZD8A 2IA5A 2ZUCA 2AK2A 4FWIB 2W6ID 3NEYA 5BQ5A 1M34E 3KKOA 1Q22A 4QNMA 3FTQA 1KO5A 2HLDD 2VBCA 4OJQA 5KTYA 2PMDA 4C4PA 3QKTA 2REBA 2FG5A 4FWTA 4F4IA 4BFWA 1C1YA 4HB2A 3RC3A 1Z2CA 2IYUA 1II8B 3ICQB 4JS0A 4TSFA 1E79A 3TKLA 4HDQB 2DFKB 1IN7A 4NYIR 4DB4A 1P9RA 1YHNA 3D7MA 4RFVA 3NTUA 2OXCA 2UZIR 3ONWA 4Y0AA 2CBZA 4Z8XA 1N0UA 4BFXA 1D2NA 2YC2C 4MUAA 4JLBA 3RS3A 1YZQA 3SFVA 3K0SA 4LPKA 2DFLA 3B1ZA 4M22A 2EFCB 3AGQA 2HUPA 4QGHA 1RPZA 3OE7D 2CCJA 1B23P 4QOSA 1VG0B 2Q3HA 2EWWA 4Q4AA 3K0EA 2RMKA 1ZCAA 4NPHA 3GLFB 1T91A 1TUIA 1SQ5A 4FIDA 2GNOA 1DOAA 4NYJR 4LYAA 1PLLA 1VG8A 2ZRGA 1QHXA 4D0LB 1Z2AA 1KI6B 3THWB 1CR4A 2YC4C 3GFOA 5ANRB 2WOJA 3FKQA 3T61A 1E96A 2VF7A 2QP3A 4JBWA 4B76A 2QAGA 4MRRA 1Z83A 1GNQA 3KJGA 3KQLA 4IOKA 1W0KA 5JWRA 221PA 4UKDA 1LY1A 3I3SR 1VYTA 3GJ5A 1EFCA 1US8A 3LW7A 2QTHA 2ZRNA 3W6OA 4NYIQ 1TU4A 4DB2A 3KFVA 4JVNA 1T5LA 1R2QA 3K09C 1IJFA 4WAUA 4BLTA 4M9XA 3K8YA 5CIWA 1E2IA 2FV8A 3QXHA 4PC1A 2AXPA 1G3RA 3EZ9A 3I8SA 4DLRA 2FSGA 2ZI5A 1N6PA 3Q5EA 4IFEA 4M9ZA 3W3AA 4DCNA 2BBSA 2AWNA 3GQBA 2A9KA 1GNPA 5JEEA 1K5GA 4QHTA 1A82A 3BB1A 3DZ8A 2OLJA 3EIHA 3K1JA 3PEYA 4W5WA 2BDTA 1E4YA 2R9VA 3LO5A 1YVDA 2C03A 1N6RA 2ZI7A 3KJHA 4MKFA 4O2LA 1U98A 4Q1FA 5C4GB 3KQNA 3U5ZB 4TYWA 5FTLA 1GRRA 1Q0UA 3BIFA 2O8EB 3BGWA 2P0EA 1LVGA 3PQCA 3QBTA 3A1TA 1KMQA 4IXMA 1Q1BA 3RWMB 1E2FA 4OJKA 1KAOA 1DAEA 2XJ4A 3KJEA 3P1JA 3PG5A 4FMCB 1PV4A 3MLEA 4CZ2A 3AKEA 1IY0A 1R6BX 1D2MA 4JT2A 1F2TA 1SZPA 4HATA 4QL3A 1NLZA 4RVCA 2JLSA 4Z51A 1ZU4A 2DWQA 2GRJA 4GPTA 4LJ7A 5EQTA 2R44A 1FMLA 3K9HA 1E1RD 3RDPA 2JIZA 1TX4B 4QGGA 3UANA 4B3FX 1W36B 5BN5A 3JZMA 3ND8A 4XVQA 1LB1B 3LX8A 1RRFA 1OXUA 2C5LA 3G82C 1JEDA 1R10A 3V9PA 4YXWA 1E0JA 4A2PA 2DYKA 2XXAA 3I5XA 2H5EA 5GADl 1XMSA 2KSQA 1ZW6A 1QHIA 4UNRA 2J7PD 2FWRA 1SXJA 3GD7A 4M21A 2VYFA 4QBHA 3FHOA 1G18A 2XXAB 5L3SB 3MJHA 2ZUDA 1CXZA 4GOJA 5FOWA 4B33A 5GJBA 4HB4A 2NMVA 1NN0A 3PITA 5JI2E 4P4SB 3SI7A 3P26A 4QG7A 1AZSC 4ACAA 1J90A 4AIIA 3AM1A 2GCNA 3QF4B 1IXSB 3IIMA 5EZ6B 1MH1A 5DISB 1KZGB 1B0UA 2ZJ5A 3DPUA 2DY1A 2C78A 1TNDA 4GNKA 2XJ9A 3QF7A 1X3SA 3AQ4A 1IY2A 2OILA 2QUZA 1PZNA 1LS6A 5AJZA 2JLUA 4B3BA 4DLSA 5AK0A 3QXSA 3X1WA 1A1VA 1XTSA 2GVDC 4BFZA 5FOSA 1QHSA 4D0GA 3CLVA 4CF7A 4PC6A 4QC2A 2G3YA 2DPXA 4X8LA 3QVVA 1ZM4A 2BHRA 2QMEA 2FH5B 1E98A 4G01B 3JVVA 4KVGA 4AK9A 4BEJA 5HKKD 3IEVA 2WICA 4KFTA 1ZINA 2CL7X 4TL7A 3IQWA 4X8OA 1NJFA 1JAIA 3EARA 4ZIRA 3E2IA 2IYZA 1DADA 4XTRA 2V54A 2CNWA 2WJYA 2ZI4A 1KK0A 3WP1B 2KE5A 1SKYE 4CT5A 2QNRA 1JPJA 1XTJA 3LDAA 3PEVA 4JVMA 4URUR 3R8CA 2QQEA 3W5JA 2GK6A 2ORVA 1IBRA 1TU3A 1YQTA 3NDBB 1HE1C 1KTVA 2VPPA 1E4VA 5EXPA 1ETUA 2FSFA 4DLTA 4PHFA 5DNYB 3ICEA 2O8BB 2R6CA 4MKHA 4OHXA 1EFUA 4ZDWA 1DAMA 4ON9A 2JLQA 4QM6A 3SEAA 2W6IA 1Q3HA 2GCOA 1HY3A 4BEBA 5IHPA 3AV0B 4CEIA 1KI7A 3SJAA 2ZVQX 4M1SA 4PANA 2ZRKA 4JIMA 3C14C 2VO1A 4JKYA 3K53A 1NG1A 3QENA 4A8JB 4Q7LA 4MRNA 4IDNA 4OQNA 2W58A 1DBSA 2ZR7A 4KCGA 3RAPR 2O8FA 4IOJA 1N6HA 1W47A 4HLCA 3BK7A 4C0HA 3CPEA 1XCGB 1E6CA 4PPFA 3UXMA 1ZM2A 2H18A 4NE2A 5DYIA 1PJRA 1NVUQ 2YNMA 4TZ6A 4Q01A 5KOYA 1FPMA 3WYFA 2GJKA 1JR3D 1G6OA
chains in the Genus database with same CATH superfamily
1ORIA 4YPVA 4E7OA 3D0KA 3IUJA 2I91A 4HDOB 2FSUA 2IW3A 4WL0A 1X94A 3C3WA 2PKYX 4Z9BA 3LFUA 1GL3A 1PGQA 2M6LA 3P4XA 2PUHA 3RVRA 5A1JA 1ZP6A 3AGPA 5KVSA 5ALFA 1NW7A 1NNEA 4QXAA 2IIVA 4OUDA 4RIHA 4WLUA 1NV8A 1I9CA 3X0DA 1JH9A 1XRMA 2YW9A 2O48X 4R9SA 4U7JA 2WIFA 4MIEA 5JQGF 1GRNA 5FL3A 1VHLA 1NJSA 4XSGA 5K6AA 5L4LA 3R3XA 4M46A 2VT2A 4RD3A 1EUCB 5LOVB 4Y2XA 3JATA 3F6CA 3BH0A 3O21A 1C7IA 4R05A 2OBNA 1H23A 4BTLA 2IZ0A 1V96A 5FTKA 5LQRA 5JS1A 4E5PA 2QI9C 4RJTA 3DZFA 4C08A 4F9GA 4MW7A 1NC3A 4Z9XA 2CLMB 4C0SA 2QBYA 2TMDA 4MW0A 3GYBA 4GMGA 1N4DA 5FWYA 5D5HA 1VMAA 2ANCA 3JAWB 1E0KA 1RYNA 4FHDA 2I78A 4JLAA 5EJ5A 1D4OA 1VLQA 5AVUA 3NIWA 2Y6UA 5HM8A 2R6HA 4RFSA 4A6PA 1NDUA 2D59A 4JSRA 1AN9A 1RC8A 2MSKA 4XUDA 1SCKA 3HXKA 3MJFA 1X8LA 3HPQA 4KSBA 3Q3CA 3G2PA 4L28A 3IUNA 2JGDB 1H1LB 2CVFA 2JRLA 2I6QA 4YGYA 5TC4A 4I4TB 1PQWA 3T5GA 1IPEA 2H48A 3HADA 4V02A 3GLGE 1L7OA 2QLJA 5AD1A 2WFLA 4RCVA 1FBNA 1T0UA 4RVSA 5D1HA 4B6GA 2H5LA 3VR2A 2QORA 1YXMA 4MVJF 5AOCA 2PAAA 4EABA 1PYGA 2A9FA 4AULA 1E2HA 4BNWA 4D9FA 1BN7A 1WW2A 3OBBA 3TAUA 2YVQA 3D1JA 4IDPA 1P33A 2G6BA 2Y1XA 4JDPA 4OSEA 4M8IA 2QT0A 2JIQA 2QNBA 4X8HA 2BKVA 3GN2A 4LZJA 2IXAA 1COWD 4PLPA 4Z0NA 4I55A 4B5KA 1SQGA 4Q1AA 4F8EA 2G0NA 3HYCA 5EPEA 2CGEA 2IZ1A 2QV0A 4OK6A 3HCFA 2I3DA 3TM5A 4A2WA 4E3WA 1M7HA 1FMTA 4YV7A 1QU3A 2LV8A 3QQ5A 4EY3A 1EIWA 1XYGA 1TCBA 1XXHB 2P2DA 2AT1A 2EL9A 2JEOA 1YCDA 3A4NA 2PUWA 3BQNB 1R74A 1G7TA 2FR8A 4TV8B 5AVVA 4IVNA 3ETNA 1JPUA 4D42A 3H5RA 4HPXB 3S2GA 1PG5A 1D07A 4OYYA 1V8ZA 1VI2A 3I61A 3EPJA 1LDBA 2AI2A 1N1EA 2OXRA 4N1AA 4UDOA 3EZGA 3R7WB 3NIGB 4QELA 1LF0A 2YY5A 1KYXA 3FMIA 3L4KA 1SWVA 5DM2A 3VR4H 1E6WA 5JDCA 2FDRA 3A6FA 3AVQA 3EUAA 4NAHA 1GILA 1NLMA 1I0ZA 1X42A 2Z2KA 2BEUA 1LBIA 1J8DA 4R6XA 5ALLA 5AK4A 4DBVO 2RHLA 2JLVA 4N3CA 5JJIA 3TWOA 1G4HA 5E3JA 2DFTA 1ICEA 2P90A 4EF6A 4EG4A 3RC1A 1YRWA 4C4RA 1OX4B 2JFWA 4I0WB 5JAZA 3F4BA 1K3TA 2ZJFA 2IRWA 2J3LA 4WZAB 1QCDA 1FIUA 4EZEA 1WXEA 1KZ6A 2QVBA 3FVQA 3OZSA 4HY3A 4H15A 4YALA 1FPQA 2ILVA 3C4JA 3RS2A 3UK6A 4CMEA 3UPUA 1KU0A 3GRZA 2F4NA 2GAOA 2MT9A 3NNDA 4H7JA 4ZAWA 3QYAA 4PQYA 4RKQA 4ZWNA 1UDBA 1KPHA 3U81A 3PQ5A 3VKUA 2G76A 1K7CA 1LVUA 2GEVA 4KXVA 3W8NA 5P21A 2XVAA 4K46A 2QRZA 3R3SA 2IPNA 4KQIA 4WJKB 5IN5A 4CT0A 4QXOA 2P78A 3ENVA 1ZVVA 2QR5A 4LV6A 121PA 1XKQA 2HEIA 3M70A 3FYUA 4GQBA 4XOUA 2HTEA 4RDXA 1GPMA 2C3PA 2GNAA 2QTRA 4CM8B 3ZHUA 2ODTX 4AXXA 4DR4B 2EKPA 3DTVD 2ZWMA 4KXFB 1M2FA 1EGVB 3MTQA 1RXSA 2Q7DA 4Q05A 4HAUA 1E6UA 2EG5A 3MOSA 4E51A 1OLOA 1U0GA 4HNUA 2OCXA 2IE8A 4KQ9A 5TJHA 1EZZA 1G5HA 3H4IA 3MGKA 1DKQA 5BR8B 4ROSA 2QU8A 2V96A 5AKXA 3TKYA 2VCYA 1BE1A 4MS3B 5KNCD 3Q4GA 3D4BA 3EG9A 4ZU3A 4DA6A 3C48A 1QU2A 1E3SA 1ESCA 1DCMA 1QBGA 1V16B 2UDPA 2V0NA 2IV7A 1URPA 1Y3IA 5BV8A 4G3XA 1QOQB 1ADJA 1U94A 4TRRA 1KNXA 4WLFA 2ZIVB 4WBSA 3REGA 4ENRA 3FUUA 2IUSA 1OBHA 1E0SA 4MV6A 4HUQB 3UJ3X 1H5UA 4ZALA 1XVVA 1YR9A 3PDCA 4HFJA 1U7HA 3NFYA 4II3A 4Z54A 2X7HA 1WB5A 2OVBA 3U7IA 3RYCA 4OXKA 5SZIA 5K6AC 3NALA 5DHAA 2NTYC 3FNRA 3BGDA 4PYOA 4C7XA 2H57A 5KWJA 3QBEA 3RODA 2CLSA 2EL7A 2V7BA 3RHTA 1U1CA 2ACEA 2JHAA 2O2EA 1I4TD 1OIXA 4QODA 2C2KA 3CO5A 3DNFA 3DZHA 3JQ7A 2YV1A 1B0PA 3ME5A 1Y4ZA 3PNVA 3WP0A 1BQ3A 4TL9A 2HDHA 4LJYA 5HNKA 3LVBA 2CJYA 5JMWA 3RS0A 5FEUA 1IBMB 3T4EA 4EVQA 2INGX 4HSGA 4K9QA 5CIQA 3BGVA 4JVSB 4ZHQA 2CMKA 1KC3A 3I04M 2EYQA 2JW5A 2BBWA 3I6BA 5KJ6A 1N5KA 3PD1A 3N2NA 4OHKA 4K9NA 3WLLA 1NVFA 3KKLA 5B64A 1LRJA 3HU2A 1H0HA 4TWAA 1H8EA 4RH1A 2WFZA 4G2NA 1Y9ZA 1KSJA 5BN4A 3CVWA 2QRKA 5A7GA 1Z6TA 1Z0IA 4YRJA 4TPKA 5THQA 3TTTA 1TD1A 1YUMA 1MO4A 2B2CA 5IVDA 4BE7B 1DQRA 2CXQA 1G2IA 3QVSA 3VBEA 5AVQA 4P83A 4GPAA 4M37A 4K6HA 4QUJA 1ILEA 3TDKA 3BL8A 3M6VA 2W0SA 1BMTA 2I1LA 5T7BA 5SY9A 3K92A 2BKUA 3QLUC 3T38A 3TLMA 2Q9AA 2AA3A 3M0EA 4EEXA 2BEKA 2CK3D 4ESEA 4KO4S 4J76A 4P0TA 3MMXA 1C1HA 1M6VA 2HQOA 4MYTA 2XE8A 2H06A 1O9BA 1OT3A 3E9MA 2CB9A 3KXPA 1KAQA 2PUCA 4AWAA 4RQTA 2LW7A 4N7MA 2BFMA 2DQKA 2OZVA 2ZS7A 4HN4B 2H07A 1TRHA 5D01A 2OXIA 3JRNA 1T0JB 3MLBA 3KSMA 1U2EA 5DU2A 5FPQA 4FILA 1FK8A 3SHQA 1K0FA 4QREA 1PT6A 3RT7A 5KQSA 3QTTA 1GG5A 3UMCA 6CHYA 1M6WA 2WQZA 3NUZA 4XWYA 5K3OA 1KO1A 4WLNA 1TJYA 4FN5A 1E9VA 4LMBA 1N9GB 5ENZA 2H2FA 5FQOA 4D99A 3F1LA 1PGJA 5AI0A 1XRNA 5D85A 5JDCC 5BV1A 4HFMA 1NQAO 1VTKA 2HH9A 3LCVB 3PIIA 1GG8A 3FLEA 4NX2A 4Y67A 5DWQA 3JQDA 4F9FA 3J80A 4N3BA 1BX3A 4AJLA 4DN6A 2PZLA 4DREA 3V34A 2NPOA 1RBZA 5TARA 4P5PA 1P3JA 2EHDA 2N9UA 5TVKA 4F4JA 4OHCA 2ETXA 4DEVA 1NJ1A 5FOVA 2JASA 3R5FA 5EN4A 4X91A 4CT4B 3AR5A 4EQ6B 1JZTA 1EEXB 2ZRBA 4TYNA 3F96A 2W42A 2F43B 1IEXA 4KQKA 4RY0A 4HT3B 4TTJA 5DRYA 1UT8A 3N70A 1O97D 1ZNZA 4YWJA 4PIPA 5H4GA 4DCPA 2O3TA 1BJKA 1VLJA 2AZXA 3LHIA 1KRWA 2HDOA 3TDNA 2EZUA 2RHDA 2VP6A 2CHVA 1MMFB 3AYZB 2MYTA 3IKVA 3FOEC 1IWOA 2HN9A 1DAPA 2DBQA 3DL0A 1YA4A 4GOND 1U81A 1YU6A 4QOJA 4U9HS 2XMCA 2GFQA 1FUKA 4UHJA 1PWHA 4WDRA 5EP2A 1JSXA 1YOVB 4WN9A 5BOSA 4JLJA 2JH9A 4MCJA 4R1NA 1B3RA 1JXOA 3R7NA 4P4TA 3GZNA 1P7WA 1PK8A 2ZCUA 5KAMA 4J3NA 4UNQA 1M7GA 1D6MA 3ELDA 1P9OA 4BO9A 1OXSC 1DARA 2ZJ8A 2FZ5A 2OHGA 4MEAA 1IHUA 5DHRA 5FLYA 5CIYA 5E7MA 5ECGC 5FHQA 1FQKA 1W88A 2B5OA 3P45A 1S89A 4JQSA 4QPZA 1G64A 3BMXA 2OAEA 2IOHA 5JAPA 3ZVKA 3CXRA 1LTQA 2IUUA 2B37A 2R3SA 4OPMA 4ZVRA 4JYAB 4IS3A 4JJIA 4XQCA 4MYSA 1S2LA 5FOXA 4CKCA 5DWVA 2EXXA 2I7VA 3C6QA 1OFUX 1E61A 1WDTA 2NZVG 2PFSA 3RTAA 3LL7A 4PM4A 1WUJS 5CD1A 2DCUA 1K7YA 4LGYA 2YQ4A 2HGSA 5KX5B 1I5EA 4HK4A 1HG1A 3G9TA 4HMQA 1UBLS 4ZMBA 4F4DA 1TJ4A 3H65A 4J0GA 1P5ZB 3TD6A 3Q9SA 2ZSFA 2ZUTA 4Y30A 5EL0A 2KBFA 4Y6SA 3S5UA 4XYMA 2FWIA 2WYIA 3LFHA 4TS1A 4FM9A 1K7EB 7ADHA 5JU6A 2ZB3A 2ZDQA 1P1KA 4JUAA 3BORA 2GM9A 4BBJA 4BMXA 5K03A 1NG9A 3UB2A 1T13A 1OGIA 4OMFG 3QNWA 1QWSA 3KUXA 3N8KA 4H0NA 4IDDA 4L4SA 3W34A 4AFNA 2RE8A 4B6PA 4BWFB 5JCZA 3VU0A 3AL2A 1DFGA 3HXTA 4KNWA 3SCZA 5J3JA 2VNAA 4LYYA 4K9MA 1ESEA 1IM8A 4P4NA 1RWXA 1OA0A 1WD7A 5BWCA 4JZYA 1CUGA 3G2MA 4M0UA 1ECPA 1TT5B 2IHBA 3FI9A 4RU1A 2HK8A 3QA3E 4LS3A 2Y1OA 3HYNA 1N75A 2JCSA 3U0BA 2B34A 1KMIY 1M2OA 2MYNA 3K70C 3B6MA 4KPUA 5JNRA 3E81A 3SYLA 2NT3A 3A1VA 3C3DA 3AFGA 3QQPA 1N1GA 3SOPA 4DIMA 3ESZA 5A5GA 2ZWVA 1CSEE 2GCGA 3DEJA 3WGUA 2QUBA 3ZDCA 3C5EA 3ZN2A 4GECA 2YDYA 4F7DA 1Z06A 1UDXA 1K5DA 1J0AA 3NHLA 4J7XA 3ZZTA 4ZV4A 3VTKA 3BM5A 2C5HA 1CF4A 1T6NA 2AL7A 3OOYA 1IRXA 1HYHA 1Q95A 2JANA 1DELA 3NHZA 2XGOA 1G2OA 4KBFA 5B3JA 1CYEA 4I81A 2X9VA 1XA3A 5J5VA 2FMHA 2NTJA 3WLIA 4C03A 1N8SA 2ZE8A 4Y2RA 1OA1A 1D5CA 4EOGA 3AEYA 4RANA 3JQBC 2A2ZA 1ZHHA 2D00A 5DGXA 5JAIA 4OY3A 4R16A 2P9HA 1KC1A 3V2GA 4TRMA 5GAJA 3AOEA 2WWRA 3UOWA 3C7AA 2ZWAA 4DCSA 5K01A 2NU8A 2B8EA 2O2ZA 3DAYA 4GGOA 4HDRB 4ESOA 4XJVA 1F7UA 2FDXA 4BECA 2AKEA 5IN4A 3NATA 3B9RA 2BLLA 2HJRA 1DIAA 1KAGA 2WWFA 3E53A 1FDWA 1UT5A 2ZPUA 1GL7A 3MT9A 3B52X 4R31A 1WPGA 6REQA 4PYKA 5CA1F 2OO3A 2DHRA 4IMPA 1YJ5A 5T6BA 1R15A 1P5FA 2HCFA 2XH8A 4OJYA 3LDFA 1SN7A 1ZYUA 1XTVA 2P4UA 3QH4A 2PKEA 2V7QA 4PIMA 4TT3D 1CETA 3WNDA 1OJLA 1C3XA 3X1XA 3R0VA 5FO1A 4ZQBA 1PT7A 4M1EA 3LRPA 1NVTA 1XL1A 2VHTA 1L4UA 2BISA 5K45A 2Q0QA 5A9SA 2JGLA 3JV7A 1JPVA 4C87A 1SCUB 2IX9A 2F1RA 3LV8A 1TA4A 4PHCA 3H8VA 4YRCA 4DRZA 5JNLA 4UCFA 1C50A 1P4JA 1UMDB 2DZDA 3L8GA 3BA1A 5ALMA 1RJDA 4C5BA 3UC9A 1U1EA 4Q15A 3SVTA 4DBLC 3HDHA 3VTAA 1BMQA 2WUEA 1QV9A 2XZLA 4DJDC 1T3LA 4QQRA 4UEQA 5BSHA 4BHTA 3CM0A 1UXGA 4PIVA 2PZJA 1PDWA 1TTQB 3ITDA 4CF6A 1P1FA 4YUVA 4CKXA 2J32A 4X85A 4CQJA 3RGGA 1SO8A 4I1SA 5EE0A 1QHHA 2OV3A 2V65A 4DJTA 4DJEC 4Z0PA 4GX0A 3T1YB 2XYRA 1XEXB 2QF7A 4PRYA 2JI6A 4N03A 1TYEB 3WNBA 4LOIA 4O1HA 4A27A 4U39A 2VYCA 5JCXA 5E2AA 2QMHA 3USZA 4Q19A 3WS7A 4C05A 5J4LA 2NO4A 2QSJA 3M4YA 4KDRA 4G9EA 1Y3BE 2AI3A 3CKLA 3KKMA 4LJAA 4B7AA 1JTVA 1DBPA 2EZ9A 3VR1A 1T5IA 3E3AA 1GNRA 5U9CA 2V1XA 3B7GA 4GAEA 1EVIA 1UBTS 4JC4A 5B2ZA 4FX5A 4UM7A 3ZE0B 2WKPA 3GT4A 2AEMA 2Q27A 1KSHA 4ZT2A 1BDHA 4CGZA 2BEVB 1CRPA 3GEHA 2D1FA 1VGRA 4RGVA 3CNHA 1KZ1A 2CEAA 3MWKA 4WINA 3ROKA 3AUSA 3NIFB 4UBJA 5IT5A 4TTQA 5F64A 4EO4A 2QLBA 1JQEA 3E22A 2E1PA 1K75A 5K3DA 2YV3A 1X8JA 5BSEA 3B89A 5AVRA 1NGSA 5FJIA 1VHJA 1X7WA 4AS3A 5AKEA 2VLIA 1G6Q1 3U2QA 3H9JA 4CI0B 2EWVA 4LYEA 2C9MA 5T6MA 3T3PB 2O3JA 4B83A 4BNKA 4DA9A 1PR4A 2E48A 3A05A 4B6RA 3CEPB 3QKUA 4MRSA 1N32B 3QEMB 1I51A 1YJAA 3C3PA 1N2GA 3CPHA 1NR5A 3QPBA 5JLAA 2EJTA 3QEJA 1R6VA 3H8JA 9MHTA 1NDQA 2JFBA 5DHUA 3WAKA 4ZDIA 1K06A 1RWVA 2Z5GA 1AX9A 4DIEA 2Y1FA 1RCTE 1W49A 2AFRA 2AMJA 3ILYA 3IJEB 3NV9A 2IVFA 4H7KA 4Y7DA 3KUDA 3L6UA 5EFOA 3A0RB 4L8FA 2FPPB 2QP9X 3EEFA 4WKCA 1P75A 4UAJA 1CY0A 4A2QA 4D46A 4U7DA 2BZ0A 3GVIA 4PQEA 3JQFC 1ZD3A 3WDLA 3X1MA 1EFKA 3BWEA 3LVQE 4GF5A 1MTZA 1NLFA 4QYMA 1YC5A 2HRBA 4CQLA 4D02A 3TRHA 4KI0A 3LVFO 5CUQA 1II8A 4RM2A 3K9LA 4NYMQ 3PFWO 4ZGBA 4Q1DA 4G1MB 3UWKA 4MDFA 2A1TR 3HI4A 3ZOKA 1SFRA 4FOPA 1SD2A 4MINA 1RQXA 2UUPA 3I58A 4RK4A 2FRXA 4W5TA 5DPMA 3CN9A 3AEQB 4DCOA 1QBKC 1RHRA 3FHLA 2EKDA 2DFDA 1KHTA 4CTNA 3E9NA 3Q7EA 5JEDA 3OFNA 3G5AA 2W70A 1EK0A 3O4VA 4ZOLB 3WJAA 3TGPA 3LK6A 2PBRA 1PS8A 4QHYA 1QQ5A 3G5UA 3HB5X 5A3VA 3HYTA 3MB8A 3FB1A 3AM4A 4KQGA 4RVHA 5B3JC 5ITZA 2PR2A 2CWWA 1OFGA 2B36A 3LS2A 1SVIA 3ZD8A 1S02A 4NDAA 1PNTA 3UMFA 3E0XA 1A50B 1WETA 3IIIA 4F7WA 3HR4A 2P5UA 3SR4A 4HAOA 1R6AA 4CTMA 1DDGA 1VI6A 2X5XA 3TOVA 5CFNA 3LP8A 2QYSA 1P1BA 3RQIA 1PDVA 1DPGA 3R74A 5HHTA 4LSGA 4MUGA 1A7AA 3A1UA 2FMIA 3B9PA 5JFOA 3MG9A 1GXSA 1YVRA 2ASVA 3AW9A 2IYFA 4PNHA 4PZAA 4QBFA 3AF3A 4OQMA 2IEZA 3BWBA 1P61B 4QGFA 4RSHA 5HTKA 2OYRA 4FGJA 3TSZA 5HKBA 3TZQA 1JR4A 2X1VA 1MOPA 4TXNA 1CPYA 4BVBA 2ZPTX 4YJGA 1LPPA 4JYCA 3CLUD 3B8EA 1XTRA 3OO0A 1Q0RA 2PIDA 1R0RE 3KX2A 1JBKA 1NW4A 4GBGA 5P8WA 3LT5A 4XYEA 5DBIA 1CUFA 1SQSA 3P2YA 2NZXA 2I76A 3ZHSA 1G9XA 1QK5A 2IUFA 1N0HA 1TMYA 2WFAA 3P97A 1VJ5A 5BN3B 2W2KA 4YN3A 1T8WA 3B5JA 3FE2A 3CR7A 3ONEA 1SIWA 1I0LA 3WFJA 3GRFA 3DT6A 4ECAA 2UV8A 1G0NA 4QXRA 3USCS 5KO2A 5JNTA 4LG1A 4WW0A 5JNVA 2VH5R 1WSDA 3E82A 1RHQA 4PQGA 3WO1A 5CFZA 4HFNA 1K4MA 3MWLA 4TYPA 4ZODA 1X7DA 3RRJA 4KVFA 5FBLB 3TTWA 2N46A 4Z4HA 4B3RB 1RIFA 4OGKA 3F5FA 2B3DA 1DX9A 2PSDA 1N6LA 1I0IA 2RGNC 4IJUA 4WBXC 1AVTA 2IYSA 4ZICA 3N28A 3STVA 5B6IA 1A95A 3B9QA 5WRFA 1CT9A 5I9BA 2I1WA 1OLSB 3EXEA 4DWOA 3O95A 2VP9A 1Y4DE 4NK5A 3I72A 5ILQA 1DTSA 5I7HA 1R0BA 3LTEA 3R75A 3EGDB 3UK1A 4ER5A 4WY2A 2AFVA 2VDWA 3UNXA 1IUOA 3AETB 3JQ8B 1SUFA 1Y9JA 2XADA 1FDVA 3WHIA 5BQPA 4MRPA 1EWYA 3TYXA 2P5YA 2Q6KA 5D87A 1KSGA 2HNKA 2X5NA 1LDEA 1CJMA 2WB4A 3SZUA 4Q7JB 4MS1B 2AR7A 3EG9B 1KJJA 2X2FA 2O5EA 4OU5A 3IDAA 1S01A 4M8SA 1ESMA 3GP3A 3PHLA 4KOAA 4UASA 2H9YA 3ZWQA 3IBCA 2VHQA 2X4LA 4EKEA 5A03A 1QGYA 3AG5A 2QR3A 2XMQA 4N9WA 4YH1A 2NVUB 1V0JA 4CYMA 4RY2A 1B4DA 4C6SA 1O94C 2NUTB 4LXIA 4YCCA 1D2EA 1GKLA 1B6RA 2IY7A 4QUEA 4XGNA 4TKVA 1UC9A 2HYDA 2FUNB 3I2KA 3A14A 2X0FA 2P62A 3UKDA 4CI9A 3AVOA 4E09A 3HFSA 1Z38A 4UAGA 4BN4A 1JAZA 3CNEA 1E5QA 2DUMA 2RBKA 3IPCA 4FLMA 3PB3A 4CHGA 5I01A 1DSSG 2RGUA 4HGYA 1UPBA 4C78A 3T5BA 5JFTA 3BK1A 1U99A 4L5BA 5AQEA 2XXAA 4KK3A 3BF7A 4M1ZA 4FCWA 3HCNA 4K2AA 2P2ZA 4CLOA 2H7VA 2QGNA 4US0R 1UPUA 2A35A 5C52B 5G2OA 3RUIA 1BSVA 1N8NA 5CB4B 2AVNA 2I8CA 2QYTA 2GSDA 2O2JA 1X1CA 2WSMA 3K2EA 4UM8B 3T41A 1GWNA 4C5CA 4EZBA 5BV7A 2FEOA 2Z6QA 4CKEA 3QF4A 1JJAA 1R12A 4GQAA 2Q50A 1CUXA 1YE8A 3HCDA 3ZNNA 3ZWMA 4PWZA 1YJBA 2GZDA 4FSHA 4A6DA 4A0QA 3K2QA 4AJNA 3KETA 1I1NA 1QOPB 3PQ6A 4G4SO 4OHVA 1KOFA 4Y2YA 4DSNA 1KY4A 2D5BA 3WRXA 4TQAA 3ORQA 4FMCF 2NG1A 2P9YA 2Q3JA 4HWTA 4Y1RA 4J2TA 1EFTA 1USWA 2BFOA 2FEPA 1N5RA 2FHSA 5IPFA 1O96B 2JBWA 1T24A 1U28C 2QK4A 3Q8KA 2XCUA 3P0IA 1R9MA 5DM0A 1XTPA 4RZSA 3UJNA 4EITA 2JI8A 4NFYA 3BFJA 1X1DA 1NYQA 4OGFA 3BVPA 4R7ZA 1QIEA 1A8PA 2G71A 2WF5A 3TAXA 1SXQA 3RC8A 1ZRNA 3QUQA 2IIBA 3UA4A 5BNTA 4KQFA 4RYDA 2JFVA 2VXCA 5CLIA 4EGCB 2FWNA 3N2EA 1Z5VA 4OGGA 1L1QA 3LBFA 5J2UA 1UZLA 4QUHA 1Q0LA 4GZLA 4Z7OB 4FR5A 3TQSA 4Z7NB 2PGLA 2VTEA 2ZRQA 3QLJA 3UAVA 4CIYA 4C07A 2NT4A 3PNBA 2ZRDA 4KWTA 1YR2A 3FIUA 3ROXA 4CM9D 1MT3A 2M1ZA 1UFQA 3WBJA 4BPRA 4QJ3A 3AR3A 4NEGA 4ZARA 2QN9A 3HKEB 3FWZA 4MGKR 4YP7A 1TF7A 4BVFA 4C14A 2VHVA 1GD1O 1I7LA 4WXPA 5JAQA 1Q57A 3KJFA 2PRSA 2NQ2C 2A0YA 1MB3A 1OPRA 2V7EA 4NBTA 5FAXA 2PUEA 4JT8A 2WJIA 2IF0A 4DAEA 5ALWA 4BRZA 5LZ2A 2CN1A 1E64A 1YWGO 3BMQB 1JDPA 3GEBA 3LCJA 4TLBA 2HXYA 4FKMA 2VPXA 1OZAA 1G6KA 2OUIA 2QWXA 4LHZA 3VJKA 2W2PA 4Z2AA 4ZVQA 4AXBA 2ZKIA 3RFTA 1CZNA 3AY3A 2ZQ5A 5IH3A 4KKXB 5JT1A 2MHCA 2ZBVA 4NU8X 3DGEC 2J4DA 2OHIA 3VPHA 3T52A 3B13B 2HFJA 1JT9A 3QPAA 2EFYA 1DC3A 4CV3A 1FP1D 4US1R 4UBKA 3K0CA 4AKGA 4LCBA 5CPBA 4YAGA 4QUDA 4FGSA 3ESYA 5TGTA 3IGFA 1V11B 4LZLA 1QQBA 4K9LA 4MZDA 5JQWA 4FLEA 3NYWA 1SVSA 2KHZA 4LAFA 3H8SA 2QRVB 2YCBA 1IQPA 2XOKA 2Y1KA 1X19A 5AHWA 5L40A 1NBEA 2FFBA 5CLFA 1GFZA 2QD5A 5J4KA 1UFRA 3R6LA 5LQJA 2E6KA 4O4LA 4URHA 3LZ6A 4Z9YA 3MRSA 2XVMA 3BRWD 3IPLA 3L5KA 1ZIYA 4IO1A 4KR3A 4B3HA 1G5TA 1Z8NA 2XNDA 3JZDA 4TXMA 2WM8A 2VK2A 3OZFA 2OO7A 3ZWPA 1G1AA 1XYYA 4BXOA 4DPKA 4MTCA 1KKUA 3OCWA 4YIHA 2YYZA 1X7ZB 3JYPA 4IIJA 2FUG1 1M66A 3ET5A 4TV9A 1GTMA 3LOUA 4K03A 5DK4A 2EFJA 2DRIA 4QAJA 3V4PB 2FWAA 1U0TA 2JGNA 3GRCA 2X76A 3DFMA 3FW1A 3OUUA 4NR0A 2Q8NA 5K3SA 2GJSA 3MSXA 3R6GA 3GGJA 3AHEA 2HHJA 1XLUA 4KYVA 4V3CA 3SM9A 4EB8A 1ISRA 3L7NA 2CJFA 1E99A 1DEHA 3MIIA 5I7RA 3ERCA 4I5FA 1Z88A 1HDRA 4NAVA 4L16A 3M4NA 3N1UA 1PD0A 5HJ7A 3VC7A 2Q6LA 2X1HA 3IKMB 3I6MA 5CXXA 5DSXA 4WDQA 3ZXIA 2ZCJA 4U0JA 4YRKA 3FYCA 2JCYA 2O50A 1JI3A 2REXB 1A69A 3ZVLA 2P41A 3AQIA 5K4AA 3KK0A 1F0NA 2AX3A 1KZ9A 1V9CA 1XJCA 2WP0A 4OLJA 1S3GA 3N6RA 1ZZEA 1DO0A 3KCQA 3QVXA 3KYCA 3HFRA 1XTKA 4CEHB 1N1MA 4Q4JA 1AN0A 1VRCA 1MA0A 1L7EA 2FSHA 2HU2A 3VGPA 4MV7A 4ZHSA 4AJ9A 5FWXB 4D57A 3PQ3A 2UVDA 4EBBA 3LC7O 3KUUA 1P8JA 1TFRA 3CZCA 3QYPA 2QYOA 2CHEA 2Z2ZA 5FV4A 1TLTA 3C6XA 2WG0A 4PN7A 1JMYA 3TGLA 3AI2A 1YZUA 2HQRA 1YUBA 2PL5A 3MMSA 1MX1A 4C0AC 5HF6A 5IZ4A 1ZVJA 7YASA 5IBCA 5KNDA 3PD0A 2HMSA 5DI9A 2RDMA 5ETJA 4I7EA 5HCNA 1BWPA 3FWPA 4M0LA 4I9FA 1KI1A 3DEAA 5TE9A 4UVEA 1F3LA 1JEQA 2NO5A 4PO9A 1OXKB 3DPIA 2PWPA 2XZPA 2VH2A 1RLIA 1PX0A 2F2TA 4HFRA 2Z9BA 4LFCB 3I04A 5I3CA 3TW6A 3OIDA 2I66A 4KIJA 5EE5B 2PH5A 3CC8A 3M9WA 3OETA 1N3BA 5DOZA 1I80A 1DRJA 5D3MA 1ZGBA 3D8RA 4B2IA 2G1PA 5HQJA 1L4MA 4YACA 1G9TA 3CF2A 2FLWA 3LUFA 3UH1A 1LSSA 1VE1A 3ZHBA 2PGIA 1D2CA 4XCVA 4C30A 3HA3A 3ORSA 1HUQA 3BXOA 3LWZA 3B1XA 3TI9A 2BFCA 1Q91A 4F2DA 4PLWA 1FLNA 4YHHB 4DCUA 5H81A 1Z0FA 3BWDD 1XQ1A 1ZCBA 2IUEA 3RTEA 3VNUA 2UVPA 4R0MA 2NU8B 4QTUB 1U1DA 1J7KA 3RFXA 3ICOA 4CU2A 3DKRA 3DV2A 1SXJE 1Z0DA 4L15A 5DT2A 1TK2A 2GKGA 3SBDA 2QRLA 3LGXA 3VBCA 4DQUA 2RHJA 2NU6A 2DWUA 4B31A 3WOHA 2MTBA 3F0TA 5DW0A 1E3JA 2VFAA 1PV1A 1JLMA 2QAGB 3W90A 4V0RA 1X77A 3ZQ4A 5A2GA 4RTOA 4O8CA 1QB7A 2CCGA 2NU9A 3LSTA 3T5TA 2A88A 1AKVA 1HDZA 1QZUA 3VZSA 4BZWA 3PU6A 2FJUA 3QLVC 2ZYUX 1KDVA 2NXJA 2M98A 3HP1A 2A1IA 4ZQGA 1EHCA 3SBXA 5CT8A 1ADCA 4XASA 3CMMA 4RS3A 3O75A 5E8RA 5JAUA 3LG2A 1HE3A 5AW7A 1KBZA 1TVKB 4BMDA 2J0QA 5CFLA 3ZDYB 5AXCA 1MRNA 4KV9A 4HNVA 2IS6A 4EECA 3KKZA 1KE1A 4TV8F 1OYWA 2BM8A 4LY3A 3DWGA 3L8EA 3VYTB 4ND8B 3HMQA 1VL8A 2V6GA 1FFGA 3IMGA 1W2GA 3KSUA 3PUHA 3SQMA 1THGA 2WF9A 1FNDA 4HNQA 4PLHA 4A23A 4ALLA 5B1YA 5KYNA 1LX7A 2K7FA 1I10A 4DTIA 4HWKA 4IDCA 3GP8A 1RQRA 2UZ4A 1QIMA 1XDDA 1PJ8A 2HA5A 3C43A 1MUUA 4DQKA 1BDMA 5L3QA 5CDUA 1FVHA 2BN4A 1GVNB 1IOWA 3CX8A 4IZOA 2WDZA 1TAGA 3IKJA 2ZRHA 4RADA 4TXLA 3PGVA 1GSAA 1K8ZB 3R76A 4UZSA 1DTEA 3IODA 2CMGA 3ZGYA 1EA7A 4B3TB 4A36A 2QTZA 4OBBA 3STUA 5DM70 3EXAA 5LIRA 1XC7A 4ZFNA 1FY2A 2XCSB 1NQTA 2QT9A 4MWOA 3GRVA 2Z1DA 5AVJA 5AXBA 3IP8A 2BHSA 1FXWA 1ZMRA 3JWJA 2NO9A 1SHKA 1PR6A 1U0LA 3O8NA 5JMOA 5KU7A 3HYLA 4HQRA 4PPNA 2YW2A 3UJ6A 3EOAI 2DHDA 1XZHA 2QLTA 3OTGA 5AOAA 3PXGA 1FNCA 4TYYA 3KQTA 3NQ41 5DE3A 4KLRA 2G08A 1NQUA 3INNA 4H3VA 1DLIA 2XT9A 3C2QA 5CBKA 2EC5A 4URXR 3I9LA 3VVLA 3NWPA 1S96A 1U8CB 2BJWA 3H6HA 2UYGA 4DDTA 8OHMA 2FPRA 4X60A 1N2EA 1ZONA 3D7SA 2VWQA 5DJ5A 5E0KB 2VF4X 5DNWA 1EJ2A 3ZE9A 4E2ZA 1MAAA 3ZDDA 3QPUA 3OTIA 1A5TA 3WGJA 1UXJA 1HT0A 2WWIA 1TK9A 1SIUA 1B14A 1MO5A 1VXOA 4UXHA 3COVA 1XTBA 2RC6A 3AP2A 4LKOA 1Y82A 2DQZA 4YP5A 3C5CA 4RMJA 4D9NA 2IHJA 3KWLA 4CL8A 4KE7A 3U1BA 2AIRA 1J0EA 4H08A 1F2DA 4QA9A 1XBTA 5EIWA 4TM8A 2ZM6B 5LZ5A 4HB0A 1YAHA 1QVWA 4PC3A 1SXJB 3LPCA 1J7JA 3L07A 4WPGA 3SR3A 3L0BA 4BVAA 3KFLA 1ORDA 4B4UA 2RK4A 4DLAA 3T9CA 4TMVA 3GRAA 1MB9A 1Z08A 5JATA 2M2IA 4W4TA 3SY8A 3RWBA 1P44A 5K9ZA 3A31A 4LOAA 5AWFC 3GZJA 1EFHA 5BV0A 5IXSA 4N7RA 3KVVA 3CH5A 4MWGA 1YL6A 3TX6A 1WCWA 4I50A 2W11A 1J2JA 3MF4A 5HZHA 2HLHA 5H70A 4DT1A 3GLVA 4QUKA 4Q03A 1E8MA 2GX6A 2E7ZA 3KPWA 3PFKA 4G84A 2IHNA 1CQPA 3AFOA 4M55A 1CCWA 3V7FA 5J4YA 3A6JA 2P5SA 3HJCA 1XMQB 2DQ4A 2YNMD 2ZDGA 4BJHB 4ZXFA 2ET6A 4CCSA 4ETNA 3RRXA 5HQ3B 2I2BA 1OIWA 1NYLA 2D0OB 2LIPA 3DR5A 4GMFA 2ZZNA 1GARA 3G0CA 3JQRA 2XUIA 5EMMA 5J2TA 1NRJB 1BROA 3Q1LA 3Q11A 4EY4A 4I1PA 3LBAA 4ZO4A 3N2KA 1UF9A 1FSFA 3ROGA 3I5AA 3FYHA 2VP4A 3UVEA 4HO1X 4WTOA 4IZ6A 4GS5A 4GYJA 4DSZA 3WG9A 4ERNA 1T3SA 1QGOA 2JATA 1EXWA 1K9SA 1U9IA 1SVOA 2RGWA 2H08A 2O7QA 2RIRA 2ZXEA 5SY6A 3RWOA 4EJSC 4PZZA 5KTNA 1EA5A 3ZNOA 2OCKA 4X1KB 2O23A 2A5JA 2R4QA 3CKYA 3GJQA 3HNPA 3KB6A 3VZRA 2DSNA 5LWHA 2ZUBA 4QGAA 2HWYA 2D62A 3BAFA 5CNIA 1FFWA 5HBRA 2IZ6A 4OOFA 2MIIA 3V1YA 2POCA 1FW8A 1KS2A 1Z4QA 2WHQA 4JVLA 3ZDRA 4CMJA 3DO8A 3TW4A 1A8SA 4MQBA 1E3WA 4CEIB 1M76A 5JS2A 1C3OB 3QU7A 1BMDA 1OV4A 1TUBB 4IVQA 4ZOQI 5FFFA 2FZGA 4HQLA 2Q1UA 2DBVO 5JSFA 2OBBA 3L8FA 4EJ2A 1HF3A 4MUXA 2QRQA 3X43A 4LV8B 2BLNA 1RJGA 4N8EA 1NSYA 2QN1A 3H7IA 1QCCA 3SS7X 4DTCA 1QQAA 1AS0A 1FOEB 1E9EA 1SCJA 4ZAVA 4LDZA 3GX1A 4MI1A 5EWMB 5A4DA 2I5PO 1EG7A 3ZK8A 2BEWB 1IUKA 3RRBA 4U7PB 2QPAA 2CLHB 4ND3A 2ZR9A 2NSHA 2PKCA 2BD0A 2PMEA 3PNLA 5B3KA 3DULA 3HVKA 3SMQA 2AWOA 1JYEA 1K7SN 5DO9A 4LHYA 2DT8A 2QENA 4JH0A 4XWAA 3ES9A 4LOHA 1KP9A 1ODJA 3CBGA 1N5JA 1Q7TA 3GDFA 2PH1A 2ZIXB 2CDBA 3R4VA 4GM0A 4H1TA 4KL8S 4NYJQ 1PBNA