4M1WA

Crystal structure of small molecule vinylsulfonamide covalently bound to k-ras g12c
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
168
structure length
160
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEDSYRKQVVIDGETSLLDILDTAGQESAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords K-Ras GTPase
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 160
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4m1wA00
2QTFA 4LHYA 5H8WA 2E9SA 4QGHA 2Q9BA 2W83A 1L4UA 2ZJBA 2R44A 3QENA 3SJZA 1HE8B 2OLKA 1W46A 2X2EA 3ZIAA 3IO5A 1F6BA 5JJLA 2BM1A 4A0FA 1Q20A 4RKEA 1KMHA 4GRAA 4NH0A 1VYUA 2DPXA 2IX3A 1T9HA 4KFRA 3IO3A 3NDPA 1GSIA 4Q4JB 3TKLA 3FHCB 4Q9LA 2GXAA 1KY2A 3NTUA 1G21E 3UMRA 3C14C 4KSBA 1WP9A 2VP2A 4QM6A 2IXFA 3B7GA 1E2QA 2ZRPA 3IDQA 2FSHA 3PUXA 1D9ZA 1GTVA 2PX3A 4JSTA 2C04A 2GZHA 4G5OA 4XSGA 5DI3B 2JJ8A 5EP2A 2ORWA 3VR3A 4XJXA 3I5XA 2PT7A 4M8NE 4TYPA 2XOKD 5EE5B 5J4KA 2IBMA 4DCVA 1R5NA 1NVVR 3QVVA 3THWB 5JJKA 1N6KA 3HR8A 4E07A 3M4YA 1ZINA 2OESA 2YINC 3C5HA 2D3WA 4M0LA 2V1UA 3TH5A 2O0HA 2MMCA 1E0JA 2F9MA 3W6OA 2XTZA 2FWRA 2IC5A 4GNKA 2J1LA 2RGCA 4Z54A 3JZAA 2DBYA 1ODFA 4HDOB 2QP4A 4GOJA 3B85A 4J0QA 3VX4A 5EXSA 2OAP1 3H0KA 4YMUA 1D2EA 4ZDKA 5KNBA 1NSFA 1DVRA 1TAGA 4P4SA 4TLDA 1EESA 1S3SA 2WJHA 4DCUA 1PVOA 3KKOA 2PEYA 2DFNA 4HZUA 1XB2A 1Z0IA 2P2LA 3QQ5A 1H8EA 3TNFA 1XFAA 4LPKA 4ABYA 2O8CB 3VHLB 2EFCB 4AC9A 4DT1A 2JLXA 2QEQA 3SBEA 3CWQA 2WICA 1NMZA 4DLRA 2ODEA 4MDFA 3EIHA 4PZZA 1W1WA 1XXHE 2JATA 4L9WA 1YKSA 2OFOA 2ERYA 2H5EA 2IA5A 2DWQA 3PEVA 2DR3A 3G5UA 1SVWA 1TF2A 3HP1A 4QGFA 3DEFA 4HUQB 2ZRHA 4QJ4A 3RHFA 1Y63A 2R6CA 4R2HA 1HT2E 4MRNA 4E5UA 5F98A 3KDSE 5FUXA 1P2SA 3OIUA 4KFUA 1N6PA 2FSIA 3PCRB 2XOKA 1RE0A 3EWSA 4U02A 4V0ME 4WAUA 1ZNXA 5EP4A 3IEUA 3FMPB 5TY0A 4RD0A 1S2MA 5E95A 2ZYTX 4CRWB 3TIFA 2BCGY 5L3QA 3SQXA 3KKNA 4JS0A 4P0TA 4BLQA 1QF9A 3BRWD 2I3BA 3F5FA 1P62B 4EIWA 1QHHB 1WA5A 4BEJA 1RZ3A 4HZIA 1UFQA 2Q3MA 2ONKA 1U2RA 3PEYA 5JBQA 4K46A 2I4IA 2P65A 2YWHA 5KTYA 2IEYA 4DWJA 2AR7A 2VP5A 1MH1A 2GCNA 4WXRA 2LKCA 3DM9B 1T5LA 4EQ6A 3I92A 1XMJA 1G5RA 1SVSA 4URUR 3A6PC 3A1SA 3TK1A 4D6PA 3ASZA 3WHKA 3HR7A 5F2EA 4OI1A 1OLOA 1AQYA 2E87A 3FWYA 3GLGE 1E9SA 2FFHA 3GJ5A 2C78A 4KLZA 4Q4HB 2GJAA 5G3YA 4QGAA 4QG7A 3SQWA 2O52A 3KXLA 4L9SA 1Q12A 4HDCA 5TB5A 4LHWA 2MMGA 2F1IA 2H1LA 1W47A 1OHHD 1SVLA 1XZPA 1Z22A 2JJ1D 2ZRBA 1T8TA 3TSOA 4ESVA 4V0LA 4M53A 2VLIA 2GJ9A 4A15A 1P75A 5GJCA 1RYHA 2RH5A 2W0SA 1HQCA 1R5BA 1XJQA 1I2MA 2FX3A 2VF7A 3EIEA 3SI7A 3WNCA 1NBMD 1U0HC 1T0HB 4LC0A 1NSTA 1T8UA 1YZKA 2CNWA 3IGFA 5EUQB 5FTKA 4V02A 5FTNA 1MO6A 5BQ5A 4DDTA 3GJ8A 4KVAA 2VEDA 2YVUA 2QY9A 3T1TA 2O8DB 4O2RA 3BOSA 4O2LA 4ZCMA 1G19A 1Z6XA 4LX0A 2VP0A 4TL7A 1E9RA 1G5PA 3DOEA 4G5QA 4UNPA 1KI8A 3UWOA 4HAXA 2ZSEA 3R9WA 2EQBA 2ZRKA 4KFSA 3ZZUA 5HCIA 3SN6A 4G0NA 4HAVA 4DCTA 3THYB 2AHOA 1E2NA 3LWNA 1TF7A 4Q7LA 1N5IA 3W3AA 2FEOA 1OXTA 4AYXA 1HY3A 1OIWA 4LBYA 3NBFA 4PPFA 3VR2A 1EX7A 3AVQA 1MKYA 4JT4A 1X8JA 4PPQA 3ZQJA 2P5SA 3W9YA 1G4UR 3NWJA 2QSYA 2BBOA 2ZR0A 2P3SA 3FVQA 2ANCA 4P33A 3BFKA 1ZM4A 3PUZA 4RD6A 5HKKA 4GZLA 2WJVA 3ZGXA 2FPKA 2JCSA 1GKIA 3LDAA 5A5GA 3O47A 2C98A 2VHUA 1Z83A 4BE7B 5BW8A 1CRPA 3JVVA 2R6AA 3A1VA 3EXAA 4Q1FA 3K70B 4QRHA 1OHHA 2JJ1A 3B1WA 1KO5A 2D06A 2IYQA 3EZ6A 4DDVA 3DO6A 4TL9A 3QF7A 5J40A 1RC8A 5FPKA 2OM2A 3NBYC 3OE7D 2BV3A 2QBYA 2QU8A 1G6HA 2CLDX 2YC4C 1NBMA 1ZRHA 2PCJA 2IXEA 4GOKA 4CEJB 3U3OA 3P20A 1GRNA 1XCPA 4FCTA 1G291 4LJ5A 2VP6A 3QPVA 2CLSA 1D5CA 1UDXA 4TMXA 3U61B 4LUCA 2KB0A 2XB4A 1N6IA 5AJWA 1W49A 2B8WA 1G8PA 1XP8A 2QGZA 1FQJA 2C9YA 4KCGA 4CEHB 2DFTA 2GJ8A 2KE5A 2ORIA 4P32A 221PA 3A1WA 2CVFA 2KBFA 1YZQA 4V0KA 3EG5A 2NO0A 1J70A 4GMDA 5HE8A 3LNCA 1PV4A 2VHCA 4HB0A 4F92B 3MCAA 1ZD1A 3BS4A 3LW7A 3AKEA 1G17A 1AA9A 4B3GA 2A2ZA 3WNBA 2J0UB 3KQLA 2BOVA 3REFA 1CULC 3RANA 5GJBA 4DLWA 1BS1A 1U94A 3I73A 3IPYA 1VG9B 2JGNA 3F3YA 3O8BA 1G3UA 4D4KA 2EYQA 3U4QB 4Q7KA 2QL6A 2F1HA 3VQTA 1LV7A 3UKDA 2VIIA 5CJPA 2VHQA 2HT1A 2WMOB 3EPHA 2WKPA 1TNDA 1VYVA 3U3KA 2N42A 1G16A 1XTSA 1II9A 1PLJA 2J3EA 3VAAA 4B44A 3CB4A 2QP9X 2CDNA 3M0EA 1ZUNB 4MYTA 1UEIA 4TTQA 2QE7A 3DDCA 3KUCA 1Z3IX 2ZANA 4PFSA 4X8OA 3W6NA 4Z51A 1QVAA 2UKDA 2QT1A 3RRZA 2O8EA 1RJ9A 2DWPA 1XPUA 3NKVA 4JLPA 1UKYA 1QHXA 2HCBA 2YOHA 3OE7A 2V9PA 4G5RA 4TN1A 1VMAA 2WJIA 4HEJA 4MKGA 2JLYA 5DO9A 3SDZA 3K0SA 1NRJB 5KDLA 2OT3B 2Q21A 4TLCA 2UZIR 4I1VA 5FL7A 1FW6A 4KBFA 4MKIA 5HPYB 1SVKA 3B9PA 5EXPA 4A9AA 2RCNA 4M22A 1T3LA 2PH1A 3NVAA 1RRPA 2XX3A 2ZEJA 4NYMR 3R20A 1NVUQ 1YE8A 2QT0A 3AM1A 1A7JA 2QA5A 3QF4A 3PJRA 4I81A 3CUEF 2OCPA 3TGPA 3GLFB 4JBWA 1TUEA 3OEED 3LLMA 5JWRA 2ODNA 1J99A 4YLGA 3QKSA 3UK6A 1KDOA 2GK6A 4D0NA 4RZUA 4HLCA 4OI4A 2UVQA 2MSEB 2FN4A 1G4AE 2QPTA 3ADBA 2WOJA 4JZKA 2QRZA 4DEYA 4E03A 3IPXA 3ZVLA 2RHDA 5EQTA 4GSYA 3HDTA 2CE7A 3A37A 4RD4A 2N46A 1GNRA 3QKTA 3AGPA 4DBLC 2PEZA 1FZQA 4TTPA 5CIQA 1XD2B 4EPTA 2J0SA 1Q3TA 4EUNA 1JI0A 3IIMA 3ZS9A 2J5XA 4Z1MD 1XF9A 2IEZA 3B78A 2DHRA 4OK6A 2QTVB 1NF3A 1GL7A 1CJMA 3MWYW 3DZ8A 4RZ3A 3U7EB 1MRSA 1LFDB 1XXHB 2X8AA 5EJEA 3AF4A 4O3MA 1BMFA 1XCMA 2Q0HA 4LJYA 3AP2A 3KKMA 2JJ2D 4B3FX 4FMCB 3KB1A 3ADKA 1WB9A 1Z0AA 2VYFA 3D31A 4XD7D 3LBNA 3U7FB 4MRRA 1KI2A 2A7QA 4DCSA 4N0EA 2FOLA 1FOEB 2RB4A 2HV8A 5HCNA 1L7VC 4BUJA 1E2DA 4Y0VA 1KO1A 5FOXA 4MYUA 4QXAA 4Q1AA 4A6PA 5JHHB 1DELA 4PSVA 3MMPA 5KSYA 2F6RA 2ZI4A 1S9HA 3TSZA 2O8BB 4UXHA 4CIDA 4PO8A 3P26A 5GADl 4BGDA 2NMVA 2WKQA 5D3QA 2FA9A 2VP9A 1KI6A 5JEEA 4ZCIA 4D4JA 5IF9A 1JJVA 3LQQA 4XWKA 4OHWA 4PQRA 3U44B 1ZIPA 1P7CA 3W6PA 3AB3A 2QZ4A 3W34A 3GLHA 2WWHA 2IS4A 4DLYA 4AKHA 5A0FA 4XIGS 2HLDA 3H2YA 3QVUA 2HT6A 2CCGA 1M6NA 1P2TA 4DSNA 2WAYA 2R8RA 4RSGA 5D3MB 3NEJA 4Q4AB 1XDBA 5DI9A 5L3VA 1AZTA 4US1R 3KZ1E 4B34A 5B58C 2Q3HA 5JSZB 1U8ZA 8OHMA 1E2PA 3PXGA 3N2EA 3TQFA 2QRNA 1EGAA 1II0A 3LY5A 2VL7A 2QG6A 5F9FA 1TQ4A 2DFLA 3Q7QA 2XXAB 1XEXA 4KXFB 1D2NA 1WXQA 2YOGA 3KJGA 3SJCA 1W4RA 2JJ2A 1H8HD 1OXSC 2OFXA 3A1UA 3GJ7A 1E2HA 3QEOA 3RAPR 1M8PA 1E1QD 5FTLA 5C2JB 1RRCA 4D82A 1MT0A 2NZJA 3TE6A 1B23P 1HT1E 1W4BA 2ZITA 4BLTA 4BZPA 1ZIOA 3AF3A 1ZP6A 3AKCA 2EFGA 2D7DA 3UIEA 4PTLA 3KFXA 4MYCA 4C0KA 3GFTA 1R8QA 3K70C 4FMDF 4JVSB 3Q8XB 3CM0A 3ONWA 121PA 2ZAOA 1FMJA 3DOFA 1OSNA 1ZC4A 3A58B 5BYJA 4AKEA 1YHNA 3ZQ6A 2IYTA 3DM5A 5E7MA 4PHHA 4KSCA 3PR1A 4QJ5A 2XZOA 2J0QA 2RGAA 2ZI7A 2WWWA 1G8FA 4OQLA 1OV4A 1GITA 3VR6A 5BYKA 3W5IA 1NMXA 5EE1A 1SHKA 4Q03A 2YZ2A 4Q9HA 3EW9A 3MGCA 4LJ6A 2YYZA 4XH9B 1W4AA 1WCV1 2LKDA 2C2HA 1CR2A 4BFVA 4XVQA 1UKVY 3LXRA 1XTKA 5DE3A 4X8LA 3O8RA 4LV8B 4C7OB 2O5VA 3TW8B 3K9LA 4BFWA 3PEWA 2GRJA 2GVZC 3GEEA 3I61A 1XTIA 4LRWA 3FFAA 3LD9A 1IN5A 4B43A 4IXNA 2DCUA 4UKDA 1X6VA 3L8YA 1EFHA 1XTRA 4B74A 4EPRA 3LH5A 1YZLA 2ZE8A 4ASUA 1L2TA 2OHFA 5CK4A 3ZLJA 1H8HA 5CLLA 4JIMA 4AG6A 4BRUA 1JAHA 4HATA 2AFIE 1E1QA 2G88A 4FINA 1F3OA 3DMNA 1IJFA 1KSJA 4Q4JA 5BXQC 5AJYA 1OH7A 2WVJA 4WXPA 4PO1A 4A2WA 5SZIA 4DVGA 2VSOA 4NCKA 1OXVA 1NG9A 2NTYC 3UANA 3GP8A 1R0YA 1U9IA 2WAXA 1Z0FA 1CR1A 2RGNC 4Q21A 3WP1B 1IXSB 1SKYE 2B7CA 5CDFE 2C99A 4TLBA 1P60A 1SVMA 5J4YA 1PLKA 4IDNA 2F3TA 3THWA 3ADDA 2QPAA 3CIOA 4Q1CA 4QHTA 4L16A 2TMKA 5AUOB 1E9AA 3F0TA 2PL3A 2FU5C 3BXZA 4A1FA 3FOZA 2F7SA 4IFBA 2P67A 1WBDA 2W0MA 1Y3AA 2AFHE 1XBTA 2C8VA 1DADA 3X2SA 5TMPA 4DDWA 4RCZA 1RRGA 3RRYA 2ORVA 1N2CE 1MV5A 3AP3A 4UQOA 1Z5ZA 3BJIC 4IVRA 1N0WA 1NP6A 3WRXC 1M1YE 1NLFA 5CYOA 1BH2A 2E1RA 3WHLA 1JQLB 4JYBA 4P4UA 1KI7A 3K0AB 4GFDA 4B75A 4UNSA 4F4IA 1UPTA 4ARZA 3B5JA 1G1MA 2O8CA 1KI1A 2OG2A 3IQXA 3HPQA 1GNQA 1OFHA 2N1BA 2PLRA 4HLUA 4BFYA 3SR0A 5FPYA 1VCOA 2SHKA 1DAIA 1G8HA 2OCYC 1LS6A 3C7KA 2B21A 1DO2A 1KZGB 1OFIA 5J4HA 1LF5A 4NTZA 3AKYA 1H8ED 2BJWA 2BEKA 4HUQA 4AKGA 2V6IA 5GJWC 2EFDB 3TQCA 2A5YB 4K81B 1Q0UA 3MUFA 3V9PA 3T35A 3PG5A 2NO9A 2V8OA 3GEIA 3N5CA 1VG0B 3FMOB 1SHZA 1ZM9A 2ZI5A 2FZLA 4RKFA 3RC3A 5JFGA 3VKHA 2WWIA 3FKSD 4BASA 4LYJA 1KK2A 1ZVQA 4C0BA 3ZD7A 2KJQA 3QY0A 1W36B 2XTNA 4AY2A 3I3SR 2VRWA 1DTSA 4NCJA 1R7RA 3KUDA 1ZU4A 5B30A 2J7KA 1E2MA 3EA5A 3I32A 1CF4A 1HH4A 2XEXA 4WVFA 1XEWY 4M1MA 2IYZA 3GLFE 4LJ7A 1OH5A 1CR4A 1D6JA 4MUBA 3R8FA 4B48A 1OFUX 1QHHA 2PJRA 1JJ7A 2Q9AA 2O0KA 3NBZC 4OQXA 3RS4A 3WRYC 2H8KA 1FP7A 3CONA 3C5CA 4JKYA 5KUTA 3UMSA 3R7WB 2MSCB 3Q72A 1NIJA 4LJAA 2CK3D 4RD3A 1UEJA 5JEDA 2QAGB 1Z29A 1A2BA 1TQDA 2VSFA 4TYQA 3BH6A 1XZQA 2J46A 1G9XA 4EFNA 1XWIA 3GD7A 1G7CA 5TV2A 2H16A 3HWSA 5KSOA 2R2AA 5JZVA 1VG8A 4XTCS 4EFMA 1YZUA 3OIYA 1E2GA 1HA3A 1TUIA 1Z2AA 4EPVA 1QRAA 2BCJQ 3B1XA 3BORA 4Q4HA 3MWKA 4IDOA 2ZI6A 4I1OA 4WZAE 2PT5A 1N0UA 2CMKA 1QVRA 1KMQA 4BFZA 1PLLA 4JJKA 1U0LA 2A5FA 1KTVA 1GG2A 1SXJB 2G83A 3CR8A 3RYTC 3FYHA 3T5GA 2WJJA 3ZH9B 2ZR7A 5SZKB 2H17A 3FKSA 3TAHA 2NZ8A 2AWOA 3I62A 4EJSB 2FDCA 3UWKA 2C9OA 4XWAA 2K5UA 1FTNA 4RJLA 4ZCLA 2CL6X 5E4FA 5FBVB 4M4SA 4X8HA 5C1BA 1E0AA 4Q5IA 4D81A 1WE2A 3FHTA 4XOIA 1HE1C 5LPNA 4XWOA 2C96A 5H1YA 1CTQA 3HU1A 2FZ4A 1TEVA 3BGWA 4EPYA 4R9UC 1GL9B 1UBEA 2BEJA 5KPJA 2CNWD 1G8GA 2PJZA 3OIWA 1FX0B 4MYHA 4OJKA 3THYA 2GZAA 2CK3A 3ZYCA 3ZZTA 1Q1EA 1YU9A 2W2VA 4B2IA 2BVNA 2G3YA 4C4PA 5FL3A 5JWHA 3M1IA 4YMWA 4MGZR 1IM2A 3BFXA 3THXB 2ZRIA 4OQMA 1J90A 3W8NA 1GRQA 4IDPA 4NBSA 4BFUA 1OE0A 3QJYA 3TAUA 3VR4A 4AIIA 1W44A 5K8IA 3UG6A 1E2KA 5L8VA 3AVTA 2GF0A 1AS3A 2R9VA 2JAQA 2PZFA 4Y0AA 4FD2A 2EWVA 4LHXA 2BKEA 4QBHA 2IXGA 4UNQA 5FOUA 5J5CA 5ELXA 2ODBA 3BB1A 1GM5A 2FFAA 2IS2A 1DARA 5BN3A 4EDHA 1NN3A 4LJ8A 2P5TB 5UKDA 4NMMA 5HKKD 2GETA 1S4QA 5CYPA 1X8LA 1UBFA 4BEBA 3L82B 3ZVMA 2WM9B 4L8GA 4LPSA 4LBWA 2OO7A 3DMDA 3RVBA 4JL8A 4CEJA 1NMYA 4A0HA 2QM7A 2ZM5A 1WDTA 3U6BA 4NCNA 5EP1A 3P4YA 1G8YA 2CBZA 5FI0B 4BFSA 1GRRA 4JT2A 4NCHA 2FFBA 3S1AB 1YZNA 1FNNA 3TBKA 2REOA 3LX5A 1JR3E 1Z2CA 2HJVA 5JMTA 4AURA 4JL5A 3WBJA 4NDZA 4OL0A 1LS1A 2WJYA 3C8UA 4HZUB 3BERA 4FW9A 1KO4A 3P27A 4OHYA 4LHVA 2VSXA 3E5HA 1HUQA 3A8TA 1VPLA 4DT1B 5FI1B 1TQ6A 1CS4C 1OJLA 1NY6A 1IN4A 2CJWB 4YMVA 2ZRDA 4LV6A 1S3GA 1KSGA 3GJ3A 1EFTA 1ANKA 1QG4A 2D62A 4QHSA 5G40A 1OH6A 5AUPB 3H84A 3KQKA 3U4QA 5C4GB 4TZ6A 2AXNA 4PC7A 4ZDWA 4CYMA 4AK9A 2ZSDA 1OFTA 1F2TB 1FFHA 3RNLA 1R0ZA 2GESA 4TQUS 1UKZA 1ZNWA 2FE4A 1ZCBA 3A4NA 3CZPA 3QPWA 4KVGA 2J45A 5DNYB 1U8YA 1NN1A 3B8HA 5CM8B 4B73A 3FTQA 5L3SB 2PX0A 1U98A 5SZHB 1UADA 3NIBA 4QNMA 4B35A 2AD5A 2OSBA 4D80A 3ZZ0A 4TL6A 1GP2A 5EE3A 1SQ5A 1ZYUA 2ZRCA 4OQFA 5CJ2A 2BC9A 4NPHA 4MITA 4F91B 5L3QB 5KPDA 2QM8A 4Q48A 1K5GA 3AUXA 1AN0A 2DB3A 3GLIE 4ZI3A 2WIAA 3CRRA 1E2IA 1U8AA 4KFTA 5E7IA 3DL0A 2QE7D 3KB2A 3AP1A 3MWJA 4IOMA 3BAFA 2QUZA 2GAOA 4PAMA 1AGRA 2AKYA 4NONA 1YJ5A 4LJ4A 3AUYA 4M1OA 4B2PA 2QQEA 1OT3A 4IEEA 3AVUA 5B57C 3AF1A 4KV9A 2YJTD 5DSZA 4A36A 3M6AA 2NG1A 2Z6VA 2ZVQX 4GI7A 1FMLA 3HPRA 1SKYB 1JQJC 3CPEA 4R2IA 5FL7D 3FHOA 3BB3A 2REXB 3GFOA 2OBMA 2IW3A 2GKSA 4Q9JA 1DOAA 1G20E 3ND8A 4JLOA 3SE0A 1OB5A 2JLWA 4AI6A 2G9NA 1E9DA 4NKRA 4QM7A 1D2MA 3Q9LA 3SFZA 1GVNB 3SBDA 4AD8A 1QHGA 2QSZA 4IFEA 3K9GA 2IWRA 2F1JA 3X1XA 1W36C 4XVUA 1B0UA 4C9BA 621PA 4A2QA 2F43A 1CEEA 3U2QA 3PFIA 1PJRA 2BIFA 3ETLA 3QOFA 3PUWA 4IVQA 1DG3A 2D7CA 4HLQB 3KTAB 3TSWA 5KO2A 4TT3D 5FOWA 3FGNA 4UXIA 4TLEA 1XD2A 4GP7A 4ILEA 1Z63A 3K8YA 4DRZA 2HEIA 3HYRA 1ZM2A 2VF8A 5DYGA 1GNPA 2EWWA 1K8RA 3X1YA 1KSHA 2AN9A 1E6CA 3RDPA 3RWMB 3NBXX 1G3MA 1MABB 2C77A 2QAGC 3FMIA 3K0FA 2JLQA 4US0R 3DKPA 3UPUA 1YR9A 1E9FA 1XXHA 4PSAA 5G53C 2JLVA 4D0LB 3T12A 1ZW6A 2BMJA 3SJBA 2CCJA 3QKUA 4W7SA 1SGWA 2V7QD 4LHZA 4RFSB 1NKTA 3T1OA 4E09A 4DKXA 2V6JA 3Q3JB 1U99A 2EVWX 1E9EA 4N0DA 4JL6A 1F2UB 1BMFD 1JBKA 4AYTA 4FIDA 3IQWA 2ZRAA 5JWOA 3EX7C 2CE2X 4FMDB 1E99A 1AZSC 4V0MA 3RABA 1I4LD 1SXJC 2B92A 1JXOA 2ZU6A 1SZPA 5CITA 3KQUA 1ZAKA 5F3WB 4C2TA 4YMTA 1FNMA 2XJ9A 2GWHA 4M9XA 4EJSC 4LOAA 1E2LA 2L0XA 4IOKA 4FWIB 2JASA 3U44A 2P6RA 2XB2A 2LWIA 2GJSA 4PX9A 4M9SA 2G1KA 2AXPA 1IQPA 2HF9A 2BJVA 1Z6GA 1T0JB 2QN6A 4TT3A 3KXIA 2VHTA 2ZI9A 4Q18A 3VU9B 5JLJA 4ON9A 2QBYB 3FE2A 5D3MA 4YXWD 3GJ0A 4II7A 2GNOA 4DIEA 1II8B 2W2XA 1W4CA 1G3RA 3ZVRA 4A82A 5HZHA 5FUYA 3LRPA 4M1WA 1XTJA 4KYIB 2ZS8A 1Z47A 2HLDD 1MOZA 4LI0A 2YV5A 2XZPA 2QENA 2ZUCA 3CNLA 2XXAA 2EFEB 1IONA 1Z6AA 1YR7A 3BD9A 4KU4A 1Q3HA 5IDVA 2QPOA 1US8A 2V7QA 3GLGA 2QAJA 2EFHB 1CJVC 1KDPA 1CP2A 3K53A 3FFBA 1S1CA 1SXJE 4KITB 4FWTA 1AS0A 1IXZA 3B60A 4BRWA 3LA6A 4Q7JB 4LK2A 4TLAA 4A8JB 3A36A 4G5SA 1F48A 4ASUD 4L15A 4PAOA 3BE4A 4MKFA 3BB4A 4DLSA 3EC1A 3QXJA 1XEWX 4Q9IA 2H18A 2V3CC 5FTJA 1SKQA 1OXXK 1IY2A 2WWFA 3I5YA 3CRW1 2BM0A 1IXRC 2F9LA 5J4LA 1T3HA 3OHMA 4BLPA 2ODWA 1LW7A 1JR6A 2I1QA 1FUKA 2GCOB 1G7TA 4OBEA 1Q44A 3L0SA 4GT1A 4WZ6A 2YC2C 4ZPXA 2OZEA 1LTQA 3EZ2A 2EYUA 4KO8A 2O8EB 1RJ9B 4C2UA 1Z0DA 4CW7A 3RSLA 5FBQB 3U3RA 1NG1A 4C7OA 2RGGA 1DAFA 2YKGA 2WJGA 4ZO4A 4BZXA 1ZMXA 1DO0A 4YXWA 4URXR 3WNDA 3IEVA 3K0CC 1W5SA 1G3QA 1A1VA 2J0VA 2JLSA 4HYYA 4PC3A 4EKDA 2B7BA 1J8MF 3LO5A 2IS1A 1NLZA 1JAIA 2AK3A 3CX6A 1TF5A 3TLXA 3A1TA 4Q66C 1Q1BA 1N6LA 4XVRA 3UATA 3BC1A 3GJ6A 2GVDC 1WBBA 3QF4B 1JEEA 2D4HA 4LDJA 3NXSA 4H1UA 4NYJQ 2ZI3A 1N5JA 2A9KA 3QNUA 4DB2A 5AJXA 3AVYA 3TR5A 2NIPA 4A92A 5FBLB 5GVRA 3QKSB 2CCKA 3D3QA 1E9BA 1L4YA 2QMOA 2ONJA 1UM8A 4PAQA 5HZKA 3AVWA 2IHBA 2PCLA 1ZU5A 2FSFA 4NU0A 1BO6A 1UBCA 4URVR 2QMHA 3U3MA 4DSTA 1AK2A 4OI2A 5KU1A 2QTHA 3C41J 2Q3FA 4JVMA 1GFIA 3EZ9A 3AH8A 5LDDC 3CH4B 5KDOA 1XPOA 1T6NA 1CIPA 2JDID 1FL9A 1W36D 2C95A 1S0UA 4JLKA 2WBLC 1AKEA 5JJIA 1J7KA 1UJ2A 2ZRLA 3DKVA 2WMNB 2ZR9A 3CLVA 4OYHA 5CLQA 1SULA 2CL7X 1Z0KA 4GP6A 2GTPA 3WYAA 4B3CA 2AD1A 4B3DA 4AWXA 1CBUA 1GZSA 3RRNA 3X1WA 1O87A 4I4LA 1GILA 4KYUA 2QNRA 5IK2A 3P4XA 1G7SA 2C9CA 3RS2A 3QPUA 3TUZC 5DISB 4D0GA 2IUUA 421PA 2GBLC 1VIAA 4JMPA 5A4JA 3FPAA 4M21A 1E32A 1KI3A 4LBVA 3TRFA 1HV8A 2ECKA 4ITRC 2IYSA 5GVSA 1QHNA 4LV5B 1VKJA 2OCAA 4FCVA 4LYHA 4M1TA 3SYNA 2YNMA 2GEUA 2R62A 4DHEA 2YOFA 3FDIA 4LJ9A 1P5ZB 4CEIB 4HUTA 1W2GA 1EWRA 2YWGA 2ZRNA 5H68A 4GBMA 2FPMA 4PXAA 3TVTA 3HYTA 3SNHA 3IKJA 3KFVA 4OHZA 3T1VA 3PITA 4QC2A 3GEHA 2AX4A 4BQSA 4UXJA 4Q1BA 2CXXA 2ZJYA 4BLRA 1KJWA 2BBTA 3IBYA 3AVVA 4B47A 1VECA 1ESNA 5DN6A 1UBGA 3IIJA 1AGPA 2PZEA 2PLFA 4JLMA 3GLIB 2KBEA 2ATVA 1O3YA 3T15A 4C0HA 1TADA 4IRUB 2P6UA 4JYCA 4KJZA 5M04A 1ZM7A 2JDIA 4D25A 2XGJA 2CVHA 1GOTA 2Z43A 1XEFA 3QXCA 2ZRFA 2NPFA 2GDJA 3B1VA 3NEYA 4G3XA 3U3JA 2G77B 4MKHA 1R6BX 1XJCA 1M7BA 2B8TA 5DI3A 4B3BA 3LLUA 4YDHB 1JEDA 3K9HA 4IHQA 2BWJA 1CJUC 2OILA 3QBVA 5KYKA 5JCPA 4G1UC 3LVQE 4CDGA 2A30A 2REBA 3L2OB 4OQNA 3V4FA 4YC7A 4DDUA 4HI0E 2WTUA 1R0WA 1R8SA 1NI3A 1I2DA 1DE0A 4CT5A 3R7WA 2J7PD 4Z8YA 3LQRA 3KQNA 2QAGA 4L4UA 5FOVA 1AJEA 2ANBA 2XNDD 1BOFA 4PC1A 4FMCF 1EK0A 3I1FA 2V54A 1RYFA 3AVOA 3PVSA 2W6ID 2ZREA 1W0KD 1QHSA 2ZUDA 2WIBA 3IUYA 5EE9A 3MD0A 2PBRA 2J59A 2I1VB 4G5GA 2JLZA 1CU1A 2YWFA 4LSGA 2ZJ5A 1IHUA 2X1VA 4IJMA 3VKGA 4N1AA 3KJEA 2BMDA 3KL4A 3QI2A 1ZCAA 2RKOA 4DLTA 3OIVA 3GPLA 4M9QA 1KY3A 1XNJA 1KAOA 3QKRB 1YRBA 3OAAD 3RLFA 2JIZD 2X2FA 5KNCA 4BPBA 1QHYA 4RD2A 3CKLA 1E1RD 2IYXA 2RGDA 1P2VA 2AWNA 4TYWA 2OBLA 2HJGA 5JCZA 3WMFA 4RZ2A 3ICEA 1S1MA 3BK7A 5AK0A 2CEAA 5FUVA 1KIMA 4YDSA 2ZSAA 1X86B 4V03A 1G7RA 4OKSA 1YR6A 4TSFD 3AF2A 3CH5A 3NC0C 4IEIA 4W5WA 3J81k 2PMKA 2BDTA 2GXSA 3VFDA 2ZRJA 4RCYA 4K8OA 3QXXA 4HAWA 4OHXA 1H65A 2PMDA 3FMFA 1FX0A 1EG7A 4WA7A 3LAWA 2ZSFA 2J7PA 2GHIA 4FN5A 1EFRD 4A8JC 3PEUA 1P73A 1VHTA 4RY2A 2ATXA 3WYFA 2XNDA 1NJFA 3VR1A 5EUMA 1SVIA 2D74A 1E4YA 1TPZA 1ZUIA 5FOTA 1N6OA 1A2KC 1IY1A 4PPGA 2V55B 1A5TA 4W9MC 1N0VC 2W6IA 2J87A 1W0KA 1X1RA 3FKQA 4IDQA 4WIAA 5G3ZA 3THXA 1Z0JA 2IF2A 2XTMA 1KK0A 3GJXC 3QEJA 1RIFA 4TMVA 2GAAA 1TQ2A 4Q02A 4QHYA 5DYIA 4RFVA 4IKEA 1XTQA 3WXMA 5C4MA 1Q22A 1P9NA 1NBME 4BWYA 4DLZA 1U81A 2Y8EA 4DJTA 3TUIC 3BH0A 1P3JA 2GXQA 2C03A 1HEIA 1V43A 4OHVA 3F8TA 3T61A 3P32A 2CHQA 2CHGA 2JIZA 3OAAA 5LB4A 4ZIRB 3VKWA 3OFNA 3AVPA 5JS7A 2ZE6A 5BN4A 1E1RA 1Z08A 2JLRA 4P4TA 4R71A 1DAHA 2WV9A 4JLJA 3H4MA 4DSUA 3ND9A 1MO4A 3ZVNA 1M74A 1KKLA 3GFPA 3TVDA 3K70D 1AS2A 4GZMA 3ZS8A 2GA8A 1Z6YA 3CZQA 2IYUA 2WSMA 5BN5A 3QBTA 4QKQA 2DFKB 4O25A 3S1AA 4TSFA 5TVKA 1XPRA 2NPIA 4TQ9A 5EZ5A 3GJ4A 5FOSA 2O8FB 2IUTA 4DEXA 5EXTA 1LY1A 3IIKA 3IILA 4KBGA 4C0LA 3OESA 4YMSA 5BWMA 5L3RA 3K0CA 1WMSA 4X8MA 1E0SA 1KNQA 2MSDB 2ZXUA 1G6OA 4ARZB 1QBKC 1EFRA 4DZZA 2OFWA 1IOZA 4M1KA 2XITA 4MA4A 2O8DA 3CF0A 3W3ZB 4JKIA 3LW8A 2OUKA 2CJWA 3D7MA 3NDBB 3L0IB 5FPSA 3QE0A 1KI4A 1JECA 3RSOA 1CKEA 1E2FA 3T06B 3QG1A 2ZJZA 1A82A 2IS6A 2QMUA 1ZNYA 1S9DA 4NE2A 4OK3A 1GIAA 2LCFA 1F2TA 3UMFA 4ZV4A 1KMHB 4JLAA 4JLVA 2J9RA 4KI0A 2NGRA 1IN6A 1WF3A 2RMKA 3MLEA 1MR3F 2HUPA 3SU8A 3JVUA 4R7ZA 3MG9A 4ACAA 5DHAA 4U00A 4PHTA 2A78A 1ESMA 4QGGA 5L3SA 2ZUBA 3NC1C 3WBKA 5KSZA 1T4GA 3V4RA 4CVNA 4C3ZA 1XMSA 1YZGA 2X77A 1N3BA 3BIFA 3O8DA 4M2LA 3C4JA 5KDDA 3U7HB 3RS7A 4M9ZA 1EX6A 1VTKA 5ANRB 4URZR 4C0JA 1PUJA 4YQFA 4MRPA 1ETUA 3R9XA 3IHLA 1T3SA 1YVDA 2P0EA 4G01B 4OK5A 1E96A 3CRVA 3CF6R 4NYIR 3SHFA 2BBSA 1RW4A 3HU3A 5JS8A 4B6EA 2GBLA 1R10A 1EXMA 1EFCA 4UNRA 5F9HA 3NG1A 5CDFA 5KHOC 1EWQA 2CL0X 1IAQA 2ZJAA 4JBYA 5E3HA 5EP3A 5AUNB 3L0PA 4HLDA 3MJHA 4JSYA 2FJUA 4P4SB 3UG7A 1BYUA 3B6EA 2OXCA 3W5JA 4US2R 4QL3A 1W5TA 4CEHA 4EFLA 4Q1DA 4JLDA 1W48A 2Q9CA 2YWEA 3DHWC 5FR1A 2GEDA 1S96A 1JALA 1TU4A 4TMKA 2FMXA 2FG5A 2GK7A 4PHGA 4DUGD 1TU3A 5P21A 2QORA 2G0NA 1KAGA 4JJZA 1P9RA 3RS3A 2QP3A 1NKSA 1ZNZA 3ECCA 3PV0A 4FI3C 4NL4H 2ZPTX 3PUYA 2J0UA 2NO1A 5DIFA 3MJRA 4JBXA 1RKBA 3AF0A 4HAZA 4JLBA 4NHOA 4NYJR 4A0GA 1WRBA 4CZ2A 1YQTA 3LXXA 3LBIA 5AWFC 4QJ3A 2XJ4A 2ZE7A 3KTAA 4ACBA 4H9GA 3ADCA 1FPMA 3EIQA 4ZKEA 3KKQA 4DLVA 3SZRA 2HYIC 4LBZA 4TMZA 5B2ZA 1VYTA 4BECA 4GDFA 1TTTA 1IJEA 1QDEA 2QROA 5FBRB 1IBRA 3CX7A 2KWIA 4ZDIA 3VX3A 5LD2B 2D2FA 2DWOA 5AJVB 4ZKDA 1KJZA 4FMBB 1QG2A 5HR5A 2D2EA 4C0AC 1MO5A 1MABA 3EWAA 1NN5A 1M7HA 2AKAB 2ZIAA 2RGNA 4BZQA 3BBPA 4Q00A 3G0HA 2FH5B 1R4AA 2G6BA 1CRQA 4TWZA 3DZDA 3PUVA 3K09C 1ELOA 4RFSA 2ZYWX 4B32A 3EPKA 1E9CA 4LC1A 4PZLA 1XMVA 4R98A 721PA 2OBNA 3ZD6A 4LCBA 2GCPA 1TEXA 3SYLA 2W00A 2JA1A 5KOYA 1F2UA 3NHBA 1LNZA 4UNNA 1KI9A 1GKUB 3GLHE 1ZBDA 1ZJ6A 5E7JA 4OJQA 3B1YA 1BIFA 2HXSA 1D8TA 1ZD9A 4TL8A 3DPUA 1CLUA 1KK1A 1COWD 1GL6A 4B3XA 1VG1A 5CK5A 2ZYVX 5JRJA 1HQYE 4B71A 3TUJC 3CX8A 2DY1A 3KX2A 3CPHA 4XSHA 2W6JD 4DUGA 2RHMA 1KDTA 4B33A 1QZXA 4V0OA 1JPJA 4HB4A 4WZBE 3B13B 3CRQA 3GLFA 1XCGB 4GL2A 4EQ6B 2WOOA 1RFLA 4LY6A 2QMEA 4DCNA 2WKRA 3GMTA 2IYVA 1W2HA 1GWNA 4AG5A 5GJVC 3B2EA 4MQBA 2WSSD 3PENA 5EXXA 3LFUA 1X8KA 1KYIA 3VU9A 1ZC3A 4Q9KA 3X1ZA 3E1SA 3SS8A 1TX4B 1II8A 4MRSA 5K8TA 1G18A 4H1VA 3TJZA 3FB4A 1JB1A 4PSKA 3SYKA 3EA0A 5J4VA 2FSGA 3IBGA 4HB2A 5H70A 1DAGA 1X3SA 5FTMA 3WYGA 2A5GA 3VR5A 5DLQC 2V1XA 3OZXA 3LBHA 5IHPA 4GPTA 3I8XA 1K5DA 3EARA 2FEMA 2Z0MA 4BFXA 4TYYA 821PA 1V5WA 3QIAA 4W5JA 1Q57A 1CJTC 1GAJA 4L5BA 5FPTA 1OF1A 1U9IC 1Q21A 3ICQB 4I1UA 3CBQA 5K8UA 2Z5FA 3EC2A 4LYFA 1CJKC 1IN7A 4A8JA 4IW3B 3D6TB 3H1TA 4BLSA 3EPJA 2ZETA 5B64A 4NCIA 1P4SA 1KZ7B 1COWA 4EPXA 3REGA 2P6NA 1KDRA 3D8BA 2F3RA 4MH0R 2JLUA 5TDHA 1XD8A 1DAMA 1G5TA 1HYQA 1R5OA 2W6JA 3AQ4A 3CO5A 2HXYA 1NN0A 4IOJA 4W5HA 1KNXA 4B6FA 4XTRA 4C0SA 1NVVQ 1MRNA 2ZJOA 4QBIA 4LZZA 3CNOA 1JR3D 2GCOA 4PHFA 3W8RA 4FCWA 1F5NA 4MGKR 4Z8XA 4CT4B 2ZS7A 4IVPA 1OKKD 2O8BA 4ZDJA 1UAAA 3QSYA 4DLUA 1E98A 1UKEA 3QG5A 3EZ7A 1Z07A 4Q7MB 4B2LA 3L8ZA 1C1YA 2WSSA 2FPLA 3Q5DA 3AVXA 4NP6A 1E2JA 3W90A 1TL7C 4EAQA 3RC8A 3P1JA 1DBSA 1VIYA 1C9KA 1BKDR 3U5ZB 1WQ1R 1RPZA 4URWR 1NIPA 521PA 4GOXA 4Q19A 3KXKA 4JVLA 2BBWA 4HDQB 4CGZA 2NO6A 3ASYA 4HLUC 1NY5A 1T5IA 1Z06A 4FXPA 4I99A 4S35A 4TYNA 1XMIA 2JEOA 3E70C 3VTKA 4TQAA 5CIWA 3MAAC 1VDZA 4O0MA 4Q4AA 2VHJA 4HSEA 1KO8A 3BWDD 5JSZA 3VMFA 1LF0A 3L43A 1Q1ZA 1U90A 3CWZA 2R6FA 3CF2A 3B82A 1FTSA 4DC9A 3T5DA 2WPDD 2XNSA 5EE0A 2GILA 1JPNA 1SVOA 2BMFA 3EZFA 1PUIA 4QBGB 2Z4SA 1HTWA 2AK2A 4A0RA 1G41A 2A5DA 5FFMA 2BKUA 3O8CA 2HDNB 1E79D 3GQBA 4A2PA 1GKYA 4D4MA 2R6DA 6Q21A 3T34A 3LVRE 2OE2A 2F43B 4U5XA 1P2UA 5LBIA 1DEKA 1KOFA 1IY0A 1U0JA 2R6GA 1DPFA 2B6HA 1AIPA 1JR3A 2WWYA 3I72A 3NH6A 1E94E 1G64A 2A3RA 1OKKA 3QXSA 4P31A 2EU8A 4QNRA 3R9IA 3AGQA 3CW2A 2XAUA 2ZROA 4JVNA 4E22A 1AKYA 1Z6TA 2ASEA 4N3NA 1XX6A 1NVWQ 3TR0A 2EW1A 1T91A 1J8YF 4D26A 3K0FB 1D9XA 4F7WA 5FPHA 3G82C 3NHAA 2OEPA 3Q85A 1JXMA 4HAYA 1P6XA 4NYIQ 2A5JA 1AQUA 1P61B 2F1RA 1E4VA 2ZRMA 2H92A 4MDEA 3HU2A 4PPNA 5IK2D 1BYIA 4EPWA 1ONBA 5AJZA 5IT5A 3TW4A 4CEIA 5TARA 5TXGA 4JLNA 1E69A 1VCMA 2PZGA 2GXUA 2ZJ8A 1KO7A 1OH8A 4LYAA 2GZDA 2GF9A 2VBCA 3KJHA 2IF0A 1YRAA 4MGYR 4M1SA 1J2JA 3EPLA 4IOLA 3BH7A 2ZS9A 4PO9A 3RS0A 3OEEA 1KSFX 3HJNA 4PQFA 5CB8A 4CF7A 1N6HA 4Q01A 1TMKA 2WPDA 2OXRA 2G1JA 3CPJB 2H57A 2ZRGA 5HTKA 4DXAA 4Q4LA 4WW0A 3KQHA 1R2QA 1DAKA 4ESHA 4PC2A 1N6RA 2VQSA 3X1DA 3GLIA 1E79A 1OYYA 3UXMA 4TZ0A 4M1YA 2WZQA 2OV2A 4URYR 1GDDA 1Z28A 1FQKA 4ERNA 5LD2C 4U7DA 2WWXA 1NJGA 4Q47A 5JECA 4KAXA 1IN8A 3LV8A 4DB4A 1PZNA 3A4LA 3ZDQA 3OEHD 4AKIA 2VTKA 5DN6D 2IK8A 1OPXA 4AYWA 3U60B 2XSZD 2VA8A 2ZTSA 2CLCX 4Z1MA 2Z4RA 2ZU0C 2BMEA 1M2OB 4LGMA 4KHZA 4TTRA 4C30A 2FNAA 4PR0A 2X19A 2WHXA 3LX8A 1KKMA 4KODA 5CM9C 1W0JD 4YONB 3SJAA 1CXZA 5AUQA 1LB1B 1X1SA 4MGIR 1E3MA 4PC6A 2GJKA 4MUAA 3T1QA 2HCJB 4I1SA 2IYRA 3GLGB 1US8B 5IRCD 1XD9A 4TMTA 4C0QC 4TMWA 4XD7A 3SHWA 1RVDA 1ZUHA 2IUSA 2NOAA 2OCBA 4RZXA 3WMEA 1N5LA 4PQYA 4PZYA 4F38A 2W58A 2NO7A 3K09A 4P3YA 4WBSA 1NLYA 2IYLD 2H7VA 2J41A 5EZ6B 2G0TA 1NL3A 5HE9A 1OB2A 2VH5R 1A4RA 1DS6A 1MO3A 1N6NA 3K0AA 2IYYA 4V0NA 5DGXA 4ZI2A 2IWHA 1GUAA 5KSPA 4RD1A 3DVLA 3SEAA 1I4DD 3OF5A 4S2EA 3Q5EA 2BHRA 2KI5A 1RRFA 2FF7A 1XJ0A 1OYWA 3QKRA 4QOSA 3WP0A 1JNYA 3NH9A 2QQ0A 1QHIA 3MSXA 1NNEA 5FUWA 4LWZA 3C15C 4F93B 4KLNA 2W2TA 4A4DA 2ERXA 4DIDA 1K6MA 4PANA 5SZJA 2F55A 2AL7A 1YR8A 2Q6TA 5LB2A 1E2EA 3VNUA 3MWLA 3WY9A 2VO1A 1C4OA 2QGNA 1KI6B 2VPPA 3OEHA 3AKDA 3I4LA 1UDWA 3BFVA 1SXJD 3SC3A 3THOA 1DG1G 3K9NA 3CRMA 4IDHA 1M34E 4BFTA 1N5KA 1ZM3A 2XSZA 3EAQA 2ZAMA 4F4CA 4QBFA 5DH9A 2WWGA 3GLHB 5DHFA 2RGBA 3RRMA 4Q1EA 2FFQA 1KK3A 2IL1A 5K8LA 4OI0A 2FGJA 5FR2A 1W0JA 2VP4A 1NVXQ 5JI3E 2DYKA 4UJ5A 5CB6A 2HF8A 5G41A 1VCIA 3JZMA 2IYWA 2O0JA 4DSOA 1OW3B 3IHWA 2NQ2C 3RS5A 3CR7A 4A6XA 5FH9A 1FP6A 3MRSA 5JHGB 3KKPA 2C5LA 3EASA 4MRVA 3N2IA 1VHLA 4NZYA 2V4ZA 5C18A 1KGDA 1LVGA 2XZLA 2FGKA 5JI2E 1XEXB 2CHVA 3SFVA 1OIVA 1UF9A 3ZIAD 1HURA 1AM4D 2ZSBA 3VHXA 1XRJA 3WMGA 1N25A 2IT1A 1Q1QA 2GEVA 3B1ZA 5KNDA 1G3IA 1M7GA 1P72A 3H86A 2ZQ5A 4DLXA 1KJYA 2KSQA 2OAQ1 3VNVA 2RGXA 2ZE5A 4D4LA 1OXUA 2ZYUX 4HAUA 3K0EA 4ZIRA 1R0XA 2IHYA 2QI9C 2R65A 3L0OA 3RWOA 4B76A 3MFYA 1FUUA 1YZTA 2ZJ2A 3I8SA 3N70A 2FV8A 3QUSA 3PIRA 4F4JA 3V00A 3E2IA 4D2IA 3TMKA 1XU4A 4WOPA 5C46F 1SXJA 2RAPA 5AR1A 2RGEA 3AEZA 4HB3A 3U7GA 3OFND 3Q7PA 1S8FA 4IXMA 2O8FA 2UZ3A 1ZD8A 1E0KA 3R8CA 4EJSA 1KHTA 1Z8FA 3C16C 3GCGA 4NYMQ 4QFMA 2HYDA 3ZJYA 1OIXA 1P9WA 3PQCA 4GMXA 3U6KA 1F60A 3K1JA 4POAA 2ZVPX 3B9QA 4BLOA 1DAEA 2OLJA 5FBWB 1L8QA 2YHSA 1CR0A 3KJIA 1W7AA 2Z83A 3QXHA 3CNNA 1I4TD 4UJ3A 4RVCA 5J47A 5JRZA 3SOPA 1VCNA 1EFUA 3AV0B 3A4MA
chains in the Genus database with same CATH superfamily
5IAEA 3P97A 2J3IA 2AJBA 4JHXA 1L1QA 4LHYA 1A4XA 3V8BA 1ZD4A 1L8LA 1SUEA 4O8ZA 3W5BA 4DMRA 2PS0A 2ZJBA 1FDRA 4E0BA 4AWBA 2VJKA 3KSMA 2ADMA 2C3PA 2OLKA 3EXFA 3QLVA 3PT9A 5DWDA 3IO5A 2GN9A 4J07A 1RHJA 4F6RB 1EDZA 1Q5PA 2BM1A 2HK7A 4R51A 1M5UA 1Q20A 4RKEA 1VYUA 3OCCA 1C7RA 2DR2A 4IGKA 3VHRA 4L22A 4AJIA 4H59A 1GTG1 1XELA 5CB4A 2ZZMA 2XGGA 3D6AA 5HDBB 3ENQA 3UMRA 3C14C 3WV4A 1NZJA 1TK3A 3ANLA 3GUCA 3QIVA 1GZHB 1HLDA 4WBNA 3U56A 1UBUS 2W6CX 1E77A 3B7GA 1FYEA 3BIXA 3U4IA 3STYA 1PL6A 2QV7A 1BHQ1 4O1HA 4UBKA 4IJUA 5CXQA 1GTVA 5I9BA 2FMIA 1G1AA 4G5OA 5DI3B 4Q0MA 2OHVA 2JJ8A 1ZK0A 2X4DA 5AKYA 2ORWA 1DCMA 3EGCA 3R75A 3IUSA 5IKEA 3I5XA 1C9EA 2YZNA 3GP3A 2GLTA 3R3UA 4TYPA 1KDVA 3SZLA 4ALJA 2JHGA 2IBMA 2QRKA 1EVQA 3BXFA 4WHMA 1NVVR 5ALPA 5ES3A 3HR8A 3PHLA 5THXA 1D6MA 3M4YA 1AHIA 1MF7A 1L1RA 2QE6A 3A7DA 4JU9A 5A6SB 3C5HA 3JVDA 5LP6C 4KRXA 3EF0A 3QVWA 1XRLA 4PYRA 1F8YA 5BSMA 4C7XA 4ZYXA 3JTEA 3BWBA 1UXJA 1FS4A 2XTZA 2IC5A 3EEQA 4G2NA 1VLQA 5JDCC 2R25B 1H1LB 3L1JA 1RWOA 3JZAA 4BVJA 1SCJA 3AONB 2BR5A 4S24A 3R0QA 3B85A 4J0QA 5F9MA 5LZ9A 4HWSA 3L4BA 3OLZA 5EXSA 5KNBA 2ZVJA 4TLDA 4CF5A 3NAGA 1B26A 2VPIA 5FT9A 5CLHA 4Z53A 1JAYA 2ST1A 2AOUA 2X5JO 3DTVD 4IX9A 3WSVA 2H5JA 2JFZA 4HZUA 1JHYA 4KR0A 4X3OA 3S2FA 2UUOA 4BBAA 4H1HA 5I7EA 3RC9A 1CFZA 1GNVA 1V8DA 3GLVA 3I42A 3IXMA 3QQ5A 4FZJA 5KYXB 3VHLB 1JLKA 4DT1A 3C3XA 2PMFA 2XE4A 3M3DA 2EW8A 5DHTA 4AJNA 2R7KA 1O58A 4MDFA 3EDYA 3EIHA 2VYQA 1W1WA 3H6HA 5GY7A 2O59A 1V2GA 1XRMA 1XRRA 2AJCA 2OFOA 2ERYA 2DWQA 1MGPA 3TNDA 2ZYHA 2VA9A 2DHEA 3NWPA 1VRWA 3WIBA 1HDEA 2HQBA 1QYCA 5EMNA 4TVSA 4EW1A 2WVHA 3KSRA 5FULA 5GGYA 3AY6A 5CURA 2C2KA 1JPUA 1PR2A 2WYUA 1VJTA 4IJ5A 3PJEA 1ZIYA 3TDNA 4BV9A 4OV6B 3DXYA 2W8BB 3S29A 4E5UA 5LZ4A 1GRVA 4PM4A 1U0RA 1PR6A 3AUTA 5FUXA 1MEOA 4AM8A 5JXWA 5CNJA 2WIFA 2NV2B 1LLQA 1B14A 3QXGA 1QANA 2GM9A 4F6CA 3AOEC 1ZNXA 1OYVA 3HA5A 3G59A 3FMPB 5TY0A 4RD0A 3SC6A 2HR1A 2DTDA 5CVUA 3MUNA 2B0JA 2VK2A 3CXRA 2NSDA 3MQFA 1B6SA 1LD3A 3M5WA 5L3QA 4XXHA 2JKYA 4I8IA 2XUZA 4JS0A 4BLQA 2VWHA 1X7WA 3BRWD 4QXOA 4CNQA 1CZRA 2VZ8A 4Y18A 4DHWA 2KLHA 1XRPA 3LSTA 1N5RA 1WA5A 4BPRA 3PNQA 3CUKA 4U6SA 4HZIA 4GWKA 4P7KA 4GZ5A 3SQLA 4NIMA 4QFCA 2P65A 2QD3A 1R27A 3GCXA 3ACDA 5KTYA 2O5EA 3DTVA 4DWJA 4RVNA 3KV3O 2YWDA 3AR9A 1CX9B 1I0LA 2VTEA 3W3AD 1MH1A 1EBBA 1IBMB 2G6TA 2WTEA 3L49A 3R3YA 2LKCA 1JMVA 4B3JA 3RQSA 1T5LA 4RIFA 4YEDA 4IWNA 5DBFA 4EQ6A 1ZG3A 4H1TA 1BXKA 3TZCA 1VSQA 3GIDA 1G98A 4FX5A 3I92A 3OZCA 5BMVF 5EZYF 3VZPA 4C29A 1GCAA 4F5EA 1TT7A 5LBTA 1VE7A 1QZTA 3GI1A 5E4TA 4LXYA 3A9VA 2MIIA 2OL4A 1IY9A 1C3EA 5BN4B 5I8PA 3DPSA 1EBFA 4RO0A 5L3ZA 1ZXXA 3GLGE 2W6NA 1FYFA 5IMSA 5ILGA 1G38A 1PNQA 1MB4A 1SKUA 2GJAA 4Q4HB 1YT5A 5AJUA 1NW9B 5G3YA 4QG7A 5F1OA 2YV2A 5IAKA 2VNAA 2CNNA 3LCRA 4HDCA 1NTRA 2D13A 3I2HA 4ZU3A 1KYWA 4QLOA 3EIUA 5EUCA 5AW9A 2B20A 4A10A 2PX4A 1BJRE 4C03A 2BR4A 4DNOA 4JELA 1GNSA 3HZHA 4KXYA 4E30A 1E1YA 1NR5A 2W0SA 1PZXA 1R5BA 3SI7A 4FSHA 4GM0A 3WK7A 1TGVA 1XZ8A 1U0HC 4LC0A 3UENA 5EUQB 1HOXA 5FTKA 4EQZA 3RFXA 4BL5A 1U2EA 2QS9A 2IEIA 4V0RA 3OBBA 4KQEA 1DIOB 5IM4F 3T3IA 1J07A 4JK3A 3E22A 2GD2A 3BRWA 1KMNA 3BOSA 4O2RA 2R87A 1G19A 2HMAA 1Z7WA 1OXMA 4TL7A 3VR5D 2WKSA 5JNWA 4G5QA 4UNPA 4UTZA 3RC1A 4RELA 1CNEA 1IDOA 3NONA 2OYRA 2ZSEA 2JRLA 2ZRKA 4KFSA 1YA8A 2DLDA 3ZZUA 4MULA 1EJBA 2VATA 4G0NA 4MUKA 4P0PB 3NU1A 4WRRA 1E2NA 2O7QA 3GGJA 3HGMA 1J24A 1IM5A 2RI1A 5BWOA 3W3AA 4NF2A 1OXTA 2GBCA 4CL0A 1M34B 2DT5A 3NBFA 1ARZA 3IR5A 4CLXA 1EX7A 1ILWA 4L7VA 1MKYA 2QRPA 1X8JA 1JS1X 4XWWA 3HCEA 3VUEA 1WDKA 2E4WA 2OY0A 1TQ8A 1WO8A 2R5FA 1Z18A 5AFSA 2ON6A 2ZR0A 2HHJA 5FV7A 4HDKB 4N48A 2FZEA 4IH4A 1O6ZA 1ZM4A 2ZQZA 5AI8A 3F73A 4FFBB 1QMGA 2PDAA 1W93A 1GTJ1 3ZGXA 4RU1A 4C7BA 3LDAA 5JY1A 5A5GA 1IJKA 3K31A 1RI3A 2C98A 5BW8A 2R6AA 1YS1X 3TFQA 3EXAA 4L75A 4Q1FA 5A05A 3K70B 5AK6A 1G8JA 3OU2A 5BN3B 3T5AA 1L5HA 2WHYA 1I2BA 1O54A 2GWRA 2IYQA 3OCWA 1YQEA 2QZ9A 4IDBA 3L8EA 5FNVA 4DDVA 2QVGA 4JUDX 1TM4E 3FA2A 4K9DA 4RY0A 4TL9A 3GROA 1ITZA 5J40A 2OM2A 3NBYC 3PIDA 4UDNA 3SX4A 4G36A 4GYYA 3K6SA 1U5AA 5JH7F 3N9IA 1SG9A 1CYDA 1VRVA 1GR0A 2NUTA 1QG6A 2QU8A 2PCJA 1GPAA 3VYVA 1PGPA 1RXUA 3ZV4A 1G291 2W37A 1ZD2P 4LJ5A 4CFYA 5JD4A 3V8NA 2AE1A 3JWHA 1GLGA 2F64A 3IS3A 3U61B 2ZWVA 4PWZA 2Q1SA 3BAZA 1XWWA 3DEJA 2XB4A 3WJ7A 1FPQA 1UFRA 2V7EA 1W49A 3EGDB 4QYTA 3TI9A 1G8PA 2BEUB 2QGZA 2WJAA 4AU1A 3UGQA 4CEHB 4YMLA 4IQ4A 2AW3A 2ORIA 3UMGA 1IUPA 1CEXA 3F6SA 4MYDA 221PA 2CVPA 2CVFA 2KBFA 3H2BA 4NE7A 3V6LA 4DC0A 1CF9A 2NO0A 4GMDA 1P1FA 5DM1A 5AOBA 5K3FB 4X65B 3GR6A 4C6RA 3FJOA 4IIEA 4XOUA 2D5IA 4ZAVA 1ZD1A 3BS4A 2QXUA 3UWMA 5EJFA 1G17A 4HADA 1P7WA 4H7KA 2BGLA 3L18A 2A2ZA 2PM8A 3LQ4A 4UZSA 1RWQA 1ZW1A 2BOVA 2JFGA 4JJAA 1BS1A 2PSJA 2Q07A 2YHAA 3I73A 3KT0A 1ZN8A 3HB4X 3F3YA 3WDSA 1VBNA 4FYIA 4BKUA 3TCKA 3ORFA 3DAHA 3HUUA 3CUSA 2QL6A 4TUYB 3FTEA 5A3RA 2YMPA 3U31A 5B1SA 1NYLA 4MWBA 2J31A 2EC5A 1ZGBA 3KJNA 1DUIA 2WKPA 5G4LA 3KVOA 4PF1A 3KKEA 3DKKA 4WBNF 1NVAA 4L4XA 2N42A 1II9A 3CB4A 4TS4A 1YBHA 2QP9X 2LTAA 4MYTA 4YJ3B 3WGTA 4NZPA 1C2TA 4OXXA 2LNDA 1VPTA 2QE7A 3ENZA 3KUCA 4X8OA 1LLFA 4PFSA 8MHTA 3DL2A 1IHXA 2CMDA 4O33A 4RL4A 2IELA 3FUWA 4WA8A 1RJ9A 3WJAA 4XGKA 1SOAA 3TMYA 3WLIA 2QTLA 5C1DA 5CH5A 2OENG 4G5RA 4QOJA 4TN1A 3ISJA 3ZX5A 2ZT6A 3HP4A 1VMAA 3IP3A 3OETA 1XC7A 4NECA 1K0UA 4JCOA 1BRMA 4X9XA 4YDRA 1NRJB 3D6UA 4PAWA 2Q21A 3HADA 5D1NA 4EZBA 2D7JA 3JQGA 1DMSA 1HE2A 1JKFA 3A32A 4JQZA 3TLZA 1RI2A 5MHTA 3CVJA 3IAFA 4JAVC 3VNBA 4M22A 4QREA 1KMIY 3GVPA 1V8BA 1A7JA 4MRMB 1SOUA 3QF4A 1UWCA 3F7MA 3HHEA 2JL1A 3A9RA 3PJRA 2AH5A 2G28A 3BJMA 3QTLA 2OCPA 3LT0A 1YO6A 2VPTA 4OX9B 1AC5A 4ALNA 4G97A 1UC5B 3OEED 4WPGA 1TOAA 2OD9A 3DP7A 4YLGA 5TF4A 2PXAA 3EBLA 4UTOA 3HXPA 4HLCA 3SHOA 4QOGA 4LI3X 1C7IA 4YQEA 2CWDA 3UV7A 1KMCA 4OI4A 2ACKA 2UVQA 1ZITA 2MSEB 2YBDA 3AL3A 1XF1A 3ZWYA 4DZTA 1KDYA 5EIXA 2PZAA 1IBSA 1HM5A 2PLAA 3D8NA 3IDOA 1TFUA 1X1TA 1LUAA 2QRZA 3K20A 4QPJC 3RUIA 4BBZA 5JVDB 4WEOA 2IYOA 4FE4A 2RG1A 4IGFA 3UCFA 2D1RA 1U8XX 3ZVLA 1M2OA 5T6BA 1SA0B 5EQTA 3TOXA 4K9LA 5AVXA 2O2CA 3B48A 4B8ZA 3ETGA 2Y0BA 4CFSA 3IQIX 5KQGA 2N46A 4B4KA 1XOIA 1BQ4A 4DBLC 5KS2A 4RK1A 3OM0A 4TMFA 4TTPA 4YR7A 1XD2B 4HN2A 2JS7A 4ZMSA 3TXYA 2HH9A 3LWDA 2HNBA 5HXAA 3UGJA 1CQJB 2J85A 4CG1A 1PQYA 4EUNA 1ODSA 3EQ8A 4Z1MD 1XF9A 3IP8A 4WERA 1WEKA 4EI7A 1E7WA 1GV1A 1XDUA 4UD6A 4CM9D 2H2FA 1L5SA 1KEEB 1DX4A 1LVUA 2I65A 3R5JA 4W8HA 1EB9A 1OZ0A 5J2UA 2G07A 2BI7A 2P9JA 4O3MA 1WL8A 2C5GA 3OT4A 5HIMA 3TCXB 4BO4A 3MJDA 5DPMA 1EX9A 3V42A 1PT9A 2PYDA 3ADKA 3IVRA 3LF2A 4KTVE 2R7MA 1Z0AA 3ZTTA 1TYCA 2TECE 4XD7D 2WW8A 5F3RA 4JHLA 2H1CA 1KI2A 5M3BA 2PVCA 1U0EA 6REQA 4N0EA 2YFKA 1XVVA 3C43A 1BW9B 1FOEB 2ID4A 5IULC 4NZNA 3GGSA 4LOJA 1L7VC 4YTEA 2OKCA 2PUBA 1E2DA 1JVNA 1SY7A 4Y67A 4YCBA 1S6YA 1SD2A 4OP1A 4QXAA 1A9OA 2IZ7A 5JHHB 3N86A 2LD4A 1DELA 3I6QA 4OGFA 4WH0A 3VGJA 4B09A 3Q9UA 4U9IS 4YREA 2VYCA 4FFSA 5AMXA 4R5HA 5HKAA 3EXHB 1YSCA 4R68A 5AKHA 4F06A 4FPXA 1DC5A 3GLFA 3NORA 2WF8A 4KI7A 4FYXA 1YJBA 2FA9A 5DHRA 4CCYB 3EZXA 2VDPB 4YQZA 1JYSA 1GV0A 3LQQA 4XWKA 4L6AA 4LNUB 4OHWA 4PQRA 3KZVA 2PH5A 4D8TA 1SCDA 1I80A 2F59A 2OKGA 2QZ4A 4C14A 5KYNA 1XT6A 2ALJA 3GLHA 2DRIA 1YJXA 2XCLA 2HLDA 2HT6A 2CCGA 3VPAA 3QOXA 3S81A 1RQGA 4TVOA 5FRDA 4MV1A 3LKBA 4DSNA 1CS0A 3E81A 1Z39A 1A98A 1FNSA 2H0QA 3BN3A 3PFBA 1L5NA 3HDJA 1LX7A 4FYWA 1NVKA 1W5BA 3NEJA 4IY1A 1J1ZA 5DI9A 5FD8A 4AIRA 4B34A 4IHJB 2G5GX 2H2AA 1AUOA 2GOYA 3V8EA 4FJ1A 2G5CA 2NZWA 4Q3DA 5JSZB 4F2PA 3RB8A 3DDZX 3D6VA 3N2EA 3I6BA 4IUDS 1EGAA 1II0A 3QFFA 2OO3A 3ROPA 2A0FA 2VL7A 5DT9A 1YB7A 5HF9A 1XEXA 4JD5A 4QFDA 2V7WA 2YOGA 5BO5A 1Y42X 1OXSC 2OFXA 4EW2A 1E2HA 2AVDA 3O92A 1R0RE 3U9LA 3I39X 3WZ2A 3QLUA 4HOYA 2FVXA 3EBOA 3HO8A 4N65A 3SIPA 1NU8A 2X58A 4BLTA 4BZPA 1Z12A 5GWXA 4A8HA 1HEUA 4FLFA 3O3OB 4X90A 3PC2A 1OASA 1AHPA 2O5RA 4BDSA 1ZUWA 4FBGA 3UHPA 4BTEA 3N59A 3FNGA 5DXFA 4UEWA 5AXBA 5BSTA 1GUZA 3K70C 3H9CA 4RORA 1OTHA 5KEIA 1N1EA 2R8ZA 5DZSA 2B36A 1LK5A 2A0UA 5ALFA 121PA 2NVOA 5FKJA 2ZAOA 5HM8A 2WB4A 3KJXA 1E6KA 4PNPA 4AKEA 1WHTA 1YHNA 3WO1A 2QZPA 5K6RA 3Q8MA 3HN2A 5E7MA 1KVUA 2PV0A 4ZXFA 3G49A 1PP4A 3BILA 2QZZA 4ZVSA 3LZCA 4XWTA 8GPBA 1N9GB 1UK9A 2WIDA 5JRDS 1OV4A 3DTNA 1MLDA 1DC3A 4HVCA 5JXJA 3FHJA 1ABFA 4RQAA 3ESRA 4H6VA 2YZ2A 3TSCA 4COKA 4XH9B 1E5DA 2LKDA 5A0TA 3IJRA 3KP1A 3EXG1 2OYSA 3LIIA 4HGQA 1UKVY 5JADA 3EUAA 3T7AA 3V4ZA 5DE3A 3VNQA 3T1YB 4LV8B 3F7OA 4BB5A 2O5VA 2CUTA 2ACEA 1Z4OA 2EZTA 2O48X 3ESYA 2X2OA 2ZBEA 3JAKB 5E2BA 3TW8B 3C3YA 4NFSA 1YVEI 2V65A 3I61A 1DGQA 3G5LA 3W5CA 3H17A 3P5BA 2DQSA 3HMQA 1P39A 2B3TA 3FFAA 4K6CA 4WNYA 4CCSA 4G2TA 1V95A 3DL7A 1FUYB 3RTAA 4KRFA 3WQQA 2XT0A 3L7AA 2J07A 4G5YA 2H2GA 4U7GA 4UKDA 3PP8A 1X6VA 3OTIA 4LWQA 3RREA 5LWHA 2GK4A 5AXDA 4CIAA 4QICA 1IK6A 5F5NA 5JY6A 2O3SA 4IMPA 4R1PA 4H7HA 5CK4A 1BQ3A 5FTWA 5HUHA 1VB3A 4A0SA 2Z2IA 4K05A 2Z8YA 1OZFA 2L2QA 5IARA 4LYEA 2F90A 4AG6A 3FSGD 4HATA 3W5DA 1F3OA 4MS4A 3I52A 3OT5A 2HWYA 1KSJA 4PTYA 1GCOA 4Y7DA 4KK3A 4IO0A 1BU8A 2WVJA 2XNJA 3RJZA 4NI5A 1DCFA 4MI1A 3E6AA 4HL6A 2FPSA 4PYKA 5SZIA 4A2WA 4DVGA 1KQFA 2NTYC 2FEPA 4IH9A 4IQ8A 1R0YA 1DB3A 5LLTA 2WAXA 4WEQA 3WWCA 4KVFA 1ZSVA 2I6TA 4QUIA 1Z0FA 1CR1A 1M6VA 1AXGA 5I9NA 1QMPA 3PGA1 3ZWCA 3OQMA 1NG9A 3AUAA 1Y7PA 5CDFE 4D8WA 1Q16A 1AY0A 1UMDB 4TLBA 5BUCA 2XUKA 2CDRA 1PLKA 3JAMA 1KEZA 4XUCA 2F3TA 4HR7A 3B12A 3RFVA 4NDNE 2EOAA 2G1AA 3CIOA 3K1YA 2BGNA 3L6BA 2OCLA 3PE3A 1J2RA 4YNBA 1JLSA 3RTBA 3NFYA 1PS0A 3DZKA 3OOWA 5CLJA 4FX2A 4FBMA 3S2ZA 5DHUA 3UMYA 1VE5A 1XZJA 3WGLA 3QV1A 1QF6A 3LCMA 4HS9A 4CF6A 3OTHA 1HWYA 3VR3D 2ORED 1KA9H 2AFHE 1XBTA 2QHXA 4E4RA 5TMPA 3OURA 1A7UA 1KP2A 2BFCB 3KPUA 3RFFA 1N2CE 2A9JA 2XZDA 1Z5ZA 1OFUA 4IVRA 1NPDA 5D5QA 1M1YE 1IZ7A 1NLFA 1FA9A 1RBZA 5CYOA 4NZ9A 5EKTA 1JQLB 2B1RA 5C32A 5IG2A 1TU0A 4B75A 5I4KA 4UNSA 2HRCA 1QM5A 2RB5A 5HILA 2IFTA 3LUAA 5HF6A 5LYYA 4LS3A 3T4XA 2O8CA 4F9FA 3HPQA 3BTVA 4FU0A 3SCZA 3L4JA 1GNQA 1RYBA 1OR8A 2DM6A 4EY7A 3I5UA 1OFHA 3DYIA 2PLRA 4BFYA 1T1SA 1Z4LA 1VCOA 3OQ6A 4Y6GB 4AJOA 1IRXA 4F6LA 1N77A 4HV4A 3LL7A 5IN5A 3LT2A 4DIKA 3C7KA 1JHDA 1OFIA 1PHRA 4O4HB 1LF5A 4L27A 4NTZA 3AEUB 3SZOA 5LQCA 3HJBA 2Z9CA 1X39A 2FZVA 3NLLA 2A5YB 3GA7A 4UVHA 4WWHA 5AQ1A 4WNIA 1W581 3SC4A 3MQ2A 1QCDA 4KC0A 3W9BA 3FLAA 4N3BA 4EUSA 3Q0IA 1A77A 1SHZA 2Y1CA 3VKHA 2F2TA 2BFBA 4Q37A 1KK2A 1JJBA 4CLEA 4F0JA 2A9FA 4UC0A 4C0BA 1G5IA 1FVOA 1YDHA 2ID9A 3IUQA 1QNFA 3SS9X 5B7GA 3IR6A 4X20B 1V16B 3C7AA 3DA8A 3D8TA 4FOOA 4ZVMA 2W70A 1W36B 2GZ3A 2OHGA 2P9TA 1WX1A 1UC4B 2VHYA 5ER6A 3S44A 3I3SR 3TDMA 5I4CA 1T5OA 5FADA 2Q5LA 3WKEA 3KUDA 4GKBA 2QRJA 1R9NA 1FBTA 2GUGA 2J7KA 4PQEA 4GO1A 5L7TA 3I32A 3OZGA 1XAJA 5CIYA 1C3VA 1JJFA 4WVFA 1LLUA 3W05A 4M1MA 3L6UA 3SSOA 3WWDA 5IXYA 2PZLA 5T5QA 1JSXA 4LF5B 1AA6A 2EZ4A 2OWEA 1D6JA 4BVLA 2H9YA 4DJFC 3R8FA 2VJQA 4B48A 1QHHA 3VSBA 4O2AA 2FQXA 2VQFB 3I23A 2WHPB 1WS6A 2D5LA 2NZ2A 1C8BA 4DCCA 2O0KA 5IKOA 2XCTB 1MTZA 3RS4A 4WT7A 4PRKA 4JKYA 1XKXA 5EWJA 3PXEA 2JIMA 2JARA 3D3WB 4DM7A 3PXAA 4ESOA 1UEJA 5AHXA 5DK6A 5T4HA 1NI4B 4AN4A 3VHXB 4CMIB 1SXPA 1TQDA 3OX4A 2VSFA 4TYQA 1GZ6A 2M2IA 3BH6A 3PQDA 4JNCA 3WLNA 3EXHC 4NBWA 5AKLA 1DQSA 4I6JA 2B4RO 1JHAA 2CFSA 5TV2A 2D0DA 5JS2A 1UR5A 3NUZA 5JZVA 1IZ0A 3MMXA 4XTCS 2HIGA 4G65A 3LSYA 4JEMA 2RAFA 4MA0A 2QK4A 3FGZA 2CUKA 1RWMA 3AJRA 1GY8A 4ZN6A 4M7RA 5EG5A 3KJFA 1H85A 4IDOA 2FMHA 1MOSA 5IBRA 3T3PB 1I0IA 4BFZA 5K7SA 3E9DA 1S2DA 1J09A 2PWPA 4JJKA 2G83A 1SXJB 4C0KA 3JQ9C 3C3MA 1Y3HA 3ZV5A 4D9HA 1SHUX 3QWIA 4QGBA 4R3NA 4EJSB 3KC2A 2ZAIA 3UWKA 3ZZ1A 3K8ZA 2FDCA 2K5UA 4U4AA 1QRDA 4BO2A 1FQWA 4AJ2A 3VC3A 1TA0A 4ZCLA 3SKVA 5K5EA 5FBVB 3MA0A 1HLGA 1IM8A 1SFRA 4IZOA 4M4SA 4DN6A 3LUCA 1T9AA 1E0AA 3ZQ4A 4RHEA 1R00A 4QYIA 1RPNA 1PW5A 3AXTA 4I0WB 3MF4A 4XWOA 4I55A 3AERB 3KZMA 3I0MA 4LF4B 1M0WA 1OU4A 5BV2P 1QP0A 3K1ZA 4PZ0A 4Z99A 4ARCA 2FPUA 3SDBA 1B3BA 1YR3A 2XMCA 1GL9B 4TV9B 2ISQA 2Q2NA 1QIIA 5BNIA 2A5LA 3VDRA 4BMZA 2QTAA 2CNWD 3S2GA 5A3VA 3OIWA 2QDXA 1P4HA 3GNTA 3WSTA 2W11A 1QYRA 4TKMA 1OILA 1JQKA 5EJ8A 3H8JA 3THYA 1SOMA 1YU9A 4KG7A 2XWJI 3ELBA 4NZZA 2VT2A 1JDVA 4P36A 5FL3A 5JWHA 1ISGA 3G2KA 5D2CA 4YMWA 1QDLB 3GRKA 2F8SA 4EYGA 1GRQA 1A5SB 1J0EA 1E3TA 1UMCA 2HXGA 2P8JA 3HKDA 3PFFA 3QJYA 3G3EA 3ST7A 3I9MA 4EY8A 2RK4A 2BI8A 1U7TA 2NXWA 3VOSA 3PRJA 1CT9A 4RZQA 1TPYA 3JRNA 2FXIA 3UG6A 5K0EA 3AVTA 2GF0A 4G1VA 1C0PA 1SQ0A 2BKEA 1T1RA 4PCUA 2NO5A 3BCUA 5KQPA 1VPWA 4NX2A 5E6SB 3MFQA 2EJVA 1VDMA 3ONFA 2YIMA 1LEHA 1WKVA 1WDLA 2ODBA 1D1TA 3BB1A 2CXHA 5KYGA 2IS2A 2Q41A 3RVSA 4RVGA 1QFZA 4Z4CA 4LJ8A 3CC8A 2KQUA 2P5TB 4AZSA 3T0FA 5MFPA 2HU8A 5UKDA 3DVRX 1P80A 5CT5A 5KYUB 4NMMA 1OX4A 1FTWA 1K4YA 4DA7A 1RSZA 4M88A 2OO7A 4OLHA 1NXOA 3INGA 2DSTA 1Y6RA 1PSDA 3LA8A 1NNI1 3ETHA 3FDFA 4CTNA 1E7SA 2DPLA 5EP1A 4G4IA 1G8YA 5KC9A 1DZIA 3S1AB 1VGVA 3G8DA 1O9GA 2I4TA 4BNJA 5I8WA 4TYMA 5JMTA 2HJVA 4YRGA 2N75A 4NVRA 3VYRB 1F8FA 4AURA 3GEGA 1QS0B 3AIKA 4NDZA 3TLEA 2MYNA 4XPZA 1Q0QA 4A1OA 4EENA 4BX0A 5FPPA 1R15A 4BNUA 4C6TB 2C57A 1DKUA 1TLLA 3ZJTA 2RI6A 3E5HA 3A8TA 1V48A 1VPLA 5IKPA 3JATB 3LTEA 4JLUA 4YJ2F 3UGTA 1YCDA 3O91A 4LZWA 4JXZA 4MW1A 1C7EA 2XUPA 2ZT8A 5ALGA 1IN4A 1RRVA 1MCZA 4A6EA 4CM7A 1WU7A 2Y1FA 2P4HX 2H00A 4AJPA 4HYTA 1ANKA 2D62A 3OY7A 2YQ5A 1MA3A 4XGQA 3LKDA 4RNCA 1E3WA 4OMUA 3VKVA 4R1SA 2BSXA 2AG5A 2ZSDA 3AIIA 5FQOA 5T6MA 3U7QA 3WLFA 3GQVA 1Y1KE 3Q5GA 4S04A 4IQFA 1R0ZA 2GESA 4TQUS 1JJAA 1XMXA 1ZNWA 3A4NA 3CZPA 4MVJM 5K0JA 4FW8A 4WCVA 2J45A 3WADA 1T25A 5DNYB 1TM7E 4NPCA 4Z9AA 1NN1A 1HORA 3K30A 5LZ2A 4UARA 3AF6A 4JYAB 3ZXYA 1E8MA 5L4LA 2NP7A 5L3SB 4E31A 5KHAA 3NBAA 2OBFA 1KP9A 1QTNA 4GZ3A 5ALUA 4B35A 5AHOA 2OSBA 3ZCSA 4RMJA 2A6PA 2I6GA 4TL6A 5DRTA 3ZZ0A 1TYDE 3H6KA 3C8HA 3UHFA 1R6VA 3OT1A 1B0ZA 5D5PA 1MVNA 2BC9A 4ZVNA 4E5NA 4L2IA 4NPHA 5WRFA 3VJKA 4XZ3A 2CUZA 5KYWA 3K15A 3K4PA 3CMCO 2WMDA 1FNDA 1UOQA 3ANTA 5DIZA 2WIAA 3CRRA 3ROXA 1AKWA 4WLUA 3VPFA 4ZI3A 1U8AA 2FYTA 2J33A 4KFTA 1DKMA 3KB2A 3MWJA 4I50B 1PTKA 3BAFA 4W1QA 3JX9A 4EJ0A 4PAMA 1E1KA 1G21A 3BMQA 2ZJFA 3IB6A 2Y71A 4NONA 1YJ5A 5CCDA 2HGZA 4DMMA 1J8DA 1EM6A 3KELA 3ORYA 1TKAA 2G06A 2QQEA 1MD9A 1OT3A 4IEEA 4JQSA 1B2RA 3HRIA 5DSZA 3WE7A 4A36A 3PQFA 1R8YA 3M6AA 3U5TA 4NSNA 4LEIA 3WRXA 1MGOA 1V37A 4Z2YA 1MVLA 2C2ZA 4R2IA 5FL7D 4DBZA 3U16A 2OYCA 1FUEA 3GFOA 2IW3A 1IWPB 3QPAA 3F4KA 2CT8A 2A67A 2CV1A 1KBQA 1JFLA 4OHOA 4CTJA 5FUQA 5CCBA 4AMZA 3N7AA 3HFSA 3ROTA 3TFOA 2QF7A 3FETA 2O8FA 1WLYA 2JJMA 4HCJA 3RH0A 4AD8A 4H77A 1P6UA 4WN9B 1QHGA 2DZDA 2Z30A 3S40A 3WICA 3FVRA 1GGKA 4WFJA 1W36C 4OLFA 1Y3BE 3RTDA 4GMGA 2VXOA 2C7BA 1L5MA 3HCOA 5K20A 1NBOA 1JA1A 3RTEA 1CEEA 5DU2A 3U2QA 3ZDEA 4G84A 3HFGA 4IVQA 3ETLA 4KO2S 4HQLA 2CN1A 1PGOA 4WOBA 2D7CA 4XD2A 5L4NA 2I54A 3IAM1 4CV1A 5FOWA 1QGDA 3RYHA 4UXIA 3UAWA 3CZRA 4GP7A 4KKXB 5CTAA 4B8WA 1N78A 4NHEA 4O4LA 4D9FA 1ZM2A 4KYTA 3ZW9A 4ZOCA 2ZXEA 4JDUA 4QTUB 1VI2A 1WOYA 4ZEWA 3LDUA 1KORA 1SPBS 2H3HA 1IQUA 4MO2A 3S7ZA 3TD2A 4Y30A 1V6SA 3RDPA 3SS7X 4FIZA 1OI7A 2VAWA 4RAQA 4EABA 1G3MA 3FN4A 2AZDA 3NIWA 4JBGA 3K0FA 2D3TA 5EQDA 1E9FA 1RJGA 3O93A 2JLVA 1A88A 4D0LB 4J4TA 3T12A 3SJBA 1TW2A 5KMGB 1SGWA 3U4DA 1THZA 2PFKA 4RFSB 2ZJ4A 1NKTA 4O2AF 3RVDA 1V11A 3H9JA 1R4ZA 3OHSX 3ABZA 4D5EA 2MSNA 4LZOA 4DKXA 1JQDA 4N8DA 1EP9A 1AQIA 2OWDA 3H5OA 3DVQX 8ADHA 2EVWX 2GCEA 4HDMB 4P58A 4ARUA 3CVYA 2WFZA 3QOWA 5LP6A 1F2UB 3QEMB 3CUWA 4FIDA 4Z7NB 1KVQA 1VBFA 1P0CA 2XT6A 3BTOA 3FOCA 4RJJA 3RUAA 3D6HA 2X1MA 2CE2X 1PKXA 3EAFA 4FMDB 4MLCA 5JDCA 3I6MA 4TM8A 3RABA 2RKBA 1I4LD 1SXJC 2B92A 3ICVA 3E3AA 1P3Y1 3WQSB 5BURA 1KP3A 1GXSA 2V7UA 2NW6A 2FRVA 4X7BA 4RF5A 5HFAA 4LOAA 4EJSC 4B3MB 3SQOA 1C8LA 2IPNA 4IOKA 5DTJA 3HCBA 1KAMA 4QDOA 4Q05A 2J3JA 3C3EA 3U44A 2P6RA 3MJEA 2R00C 4L72A 1D7AA 1W94A 1Z16A 4PYNA 1H6DA 3F49S 4M9SA 3FNQA 2F4NA 2G1KA 3M6IA 4DR3B 3AZPA 1X1CA 4ZOEA 4JA2A 1K8ZB 2EF0A 5I8ZA 1C0EA 2VHZA 2QN6A 3CLUD 4D9NA 3KXIA 2ZI9A 3DVSX 1LLCA 2Z57A 3DBOB 5HA5A 3AUFA 1ULAA 4HDSA 1PR1A 3IT3A 3HKCB 4ETWA 5KOIA 1M5RA 1Y9ZA 3E61A 1JKJA 1F9AA 4NMHA 5HZHA 4DKJA 5FUYA 3LRPA 4KBYA 1XTJA 2ZIZA 5ARBA 1MOZA 2YV5A 1B42A 1MDFA 2ZUCA 4I55F 2P90A 2WIKA 5IBCA 1TZ2A 3PHGA 3AHJA 3ZZNA 5ITWA 5LSAA 4O4IB 4MVJP 3TZLA 3W2FA 5F1KA 4JOBA 5L9AA 3BREA 4W8OA 2EFHB 1CG6A 2WKWA 1HDXA 2A0WA 3E8XA 3NUGA 3TW0A 1CP2A 3VM6A 3FFBA 4KITB 1C1XA 3I9JA 1W87A 2C8LA 2WV7A 4GPAA 1L8XA 2NSLA 4XGIA 1VXOA 3O82A 1MAAA 3IQZA 3BHMA 2AEEA 4LK2A 4TLAA 4JV5B 2PX6A 4O5OA 1HO3A 5LYJB 1F9EA 5BUQA 2PL9A 4J3FA 4PAOA 1JW9B 1U8CB 1ECPA 2AVNA 1IC6A 2G36A 3M5PA 3EF3A 4QPPA 3G0OA 5E3JA 4F46A 3HL0A 4JYZA 3HBMA 4PLPA 1I0ZA 3PWTA 4LKOA 4Q9IA 1HG1A 4RMGA 1QQAA 4OLAA 4KXUA 5FTJA 1IY2A 1UJ6A 7REQA 1O0SA 3IKMB 4ZTUB 1OZAA 3BQMB 4TXLA 2VP3A 3CRW1 2JBAA 2F9LA 2I55A 4HMQA 1D6SA 3OHMA 3V55A 4BLPA 4OKIA 2QIPA 3ZWWA 1LW7A 2OV6A 1CUBA 1GPMA 1JR6A 1FUKA 4W7IA 5FA5A 3UZUA 3VPDA 3TXAA 4AZ0B 3DOJA 5I7RA 1Q44A 3NHJA 4PLGA 5IT9A 4KR6A 2YC2C 3C3WA 1YQQA 2YRWA 3T52A 3H11B 1MX9A 2EYUA 3E9MA 4KO8A 5CDHA 4CW7A 4LF7B 4K0KB 2MHCA 3SKYA 3U3RA 1NG1A 1PQ4A 3O4GA 1IG3A 4C7OA 2ATEA 2YV3A 4URXR 4WOJA 1BXZA 3N28A 5HP4A 3WNDA 4KFCA 1I24A 2VDUE 2RONA 4B0OA 3V3TA 3U7RA 2XRZA 5EVCA 4EKDA 2C59A 4LJRA 4ZYWA 3LO5A 3LUHA 2X23A 3IKTA 5YASA 1HQDA 4ZGWA 1JSRA 3DZIA 1B2LA 4ZQEA 1MV8A 2O2SA 4TXHA 3VC7A 1N6LA 4XVRA 2O54A 4ALIA 5DW3A 4AZWA 3GJ6A 3K0BA 4FWBA 3W4KA 3PQ4A 2X0FA 1JEEA 1U28A 2I34A 3CHYA 2D4HA 2JK1A 3IOMA 3GG2A 5F5XA 5LMCA 1PJ2A 4KB5A 4RV9A 3S7TA 2BDEA 4YO7A 3Q10A 4YP6A 5H3CA 1YS2X 3BMOA 4F2GA 2AHRA 2H2WA 3AEKB 3KDAA 2IBSA 3WB1A 3JSAA 3RNOA 4A92A 5FBLB 4BB6A 5EMHA 4V0QA 1E9BA 5A9RA 2ZB2A 3V4SA 3V2UA 1K9VF 4FFRA 5IJWA 2BGIA 4K9NA 4PLTA 5IWAB 1D2AA 4G09A 3HO1A 4EA9A 4OQQA 2IHBA 5A3SA 4NNOA 1ZU5A 4B87A 1S2LA 3NVMB 1CUIA 2P6OA 4ROTA 5CYFA 4DSTA 4URVR 2WB2A 3IE2A 3RQIA 4G0XA 3MPOA 2I3DA 4ZTZB 2JVKA 3C41J 4EA8A 1ZVVA 5HOEA 2EDCA 2ID8A 1GADO 1HYGA 2NXCA 2R751 2BMVA 2FZGA 3BQ9A