3IAEA

Structure of benzaldehyde lyase a28s mutant with benzoylphosphonate
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
554
structure length
554
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGSHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Benzaldehyde lyase
publication title Active-site engineering of benzaldehyde lyase shows that a point mutation can confer both new reactivity and susceptibility to mechanism-based inhibition.
pubmed doi rcsb
source organism Pseudomonas fluorescens
total genus 178
structure length 554
sequence length 554
chains with identical sequence B
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iaeA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iaeA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3iaeA02
2IEAA 4TWJA 1Q17A 1OZGA 3UK1A 2BEWB 1V5EA 2BFBB 3EXFB 5AHKA 5EJ8A 2BRUC 4JU8A 1V16B 1U5BB 1T9BA 1YNOA 4BVBA 3D81A 3EXG2 2PDAA 1UPCA 5I4IA 4HDAA 1UM9B 4J1TC 4BVEA 2EZ8A 1DTWA 3PKJA 1OZHA 1PVDA 3EA4A 2G67A 2V3WA 3GLUA 1Z8NA 1YBHA 1Y9DA 2FN3A 2JI6A 1ICIA 3F6BX 1HZZC 5DEIA 5DGTA 4MQ5A 1EFVA 3JWPA 2XT6A 3ZHUA 3RIGA 2JLCA 2H2GA 1S5PA 2Q28A 3ZGVA 1W85A 1TKAA 2FWNA 1DTWB 2NYRA 3AI7A 1YHZA 1YI0A 2BFCB 2W93A 3ZHVA 4BVGA 1V5FA 2AG0A 3LPLA 4QELA 3ZHRA 1M2GA 4RMJA 2VK1A 4ZP1A 2OO5C 3AHDA 2C3YA 2C31A 1OLUA 2NXWA 2OD7A 1MA3A 1PTJC 3FLMA 1PYDA 1POWA 4JU9A 1QS0A 4GP9A 3ZG6A 1M2NA 2H4HA 5I5EA 4IG9A 1UMBB 1MCZA 1OLSA 2E6KA 3EXHA 4K9MA 5EJAA 1RP7A 3HWWA 4FEGA 4D5EA 4Y6QA 2A1UA 1QGDA 1PI3A 1D4OA 4G1CA 4KXYA 4GM1A 2AG1A 4GM4A 4KXWA 4GG1A 3OOYA 1NI4B 4BVHA 5MF6A 2FR8C 1U28C 2QQFA 1OLUB 1TKBA 4ZZIA 2UZAA 1V1RA 4X3PA 2YICA 3EXFA 1T9CA 3AHEA 4R8MA 4Y6OA 1QS0B 3EXIA 1AY0A 1BFDA 1V16A 4L2IA 1Q6ZA 2H2IA 1OLSB 2BEUA 3EXHB 3E9YA 2R8OA 3GLRA 1UM9A 3ZHSA 3EXHC 4V1CA 2XTAA 2OZLA 2Q5JA 3DUFB 1ZPDA 2C3PA 5HYVA 2O1SA 4Y6LA 1JSCA 1J8FA 5ERYA 1OVMA 1XLTC 1V1RB 2EZ4A 2DJIA 3EXIB 4GPEA 5BWNA 2BP7A 1O96B 4RJJA 1PNQA 3HWX1 3CLUD 2BEUB 3AHHA 2O1XA 2EZ9A 3L84A 4K9NA 2VBFA 4QQ8A 4V1CB 1ITZA 3F6EX 4MPPA 1U2DC 2C42A 2G28A 2OZLB 3D7KA 5K2OA 2J9FB 3RIYA 1YI1A 2Q5QA 4C7XA 5K6RA 3CLRD 4MPJA 1X80A 3ZHQA 1UPBA 2EZTA 1L8AA 2A1TR 2BFCA 2YIDA 4JT8A 3M6LA 1W88A 4UUBA 5MFPA 4C7BA 2BP7B 1R9JA 2Q29A 4FEEA 2OORC 2FSVC 5D7NA 1YD7A 4FVTA 4IF6A 4MPRA 2FRDC 3UPTA 2BEVA 1T9DA 5EXDA 2PGOA 1UMBA 5I51A 2IHTA 2H4JA 1X80B 2VBGA 1V1MA 1NI4A 1W88B 3EXG1 4L3OA 1UMCA 1UMDA 2R8PA 5C4IA 3OE1A 3CLSD 2BFFB 3FSJX 3FZNA 1X7YA 5EJ7A 2WVAA 1PO7A 4UTRA 4C78A 3DV0B 2G25A 2BEVB 2X7JA 2VK8A 3ZGOA 4BUZA 4JUCA 4X3OA 4COKA 5EJ4A 2Q5LA 1M2JA 4JSRA 3EXEB 4RMIA 1X7XB 4MZXA 5BWOA 1V1MB 3DUFA 3AHGA 3KOMA 3DVAA 4KGDA 1Q14A 2C3UA 2QTAA 1UMCB 1UMDB 2PGNA 3AHCA 1TRKA 4JUFA 4KXUA 5DGDA 1QPBA 2VK4A 3MOSA 2IHVA 1X7YB 4QPZA 4O8ZA 5EXEA 4XEUA 3AHFA 4V1CI 1M2HA 4BVFA 5K6TA 3U31A 2WVHA 3LQ1A 1X7WA 5FYQA 4RMGA 1NM5C 5EJMA 3PDHA 5EJ5A 2B4YA 4BV3A 4FZ3A 4Q9DA 2J9FA 2PANA 3DVAB 2QTCA 2H2FA 4I5IA 2H2DA 2BFDB 2QQGA 2H4FA 3IAFA 3AHIA 3AHJA 1SZCA 1V5GA 1X7WB 2OD2A 2HJHA 1NGSA 1X7ZB 2C3OA 5BWLA 1U2GC 5EJ6A 1DJLA 4D5GA 2BFEB 4UTZA 5MGNA 4UTNA 1IK6A 1M2KA 4KXVA 5IMSA 2JI7A 4IAOA 3LQ4A 3GLTA 3IAEA 2JIBA 4BN4A 4RJIA 2R5NA 2BFFA 4JUAA 4UUAA 1O97D 4K9PA 4BN5A 4UTVA 1T9AA 1TKCA 3DV0A 1GPUA 4F56A 1N0HA 3EYAA 3M7IA 2UZ1A 2JGDA 2EZUA 2C3MA 3EXEA 5K3SA 3CLTD 1X7XA 4J16C 4UTXA 3JR3A 5HGXA 1Q1AA 1POXA 5HHTA 2JI9A 1B0PA 4UU7A 4BV2A 3RIMA 1YHYA 1YC2A 5I5GA 4UU8A 5HJEA 2JI8A 4WBXC 3M49A 4KXQA 2UZ1B 4K9OA 2JGDB 3GLSA 5MFZA 2WVGA 4TWIA 1V11A 3U3DA 4K9QA 2XT9A 4RJKA 1PT9A 1U31A 4C7VA 2BFDA 1WCIA 3M34A 1YC5A 2JLAA 2H2HA 1W85B 1OZFA 1OLXA 1UPAA 3LQ2A 3K35A 2VBIA 5EJ9A 3EY9A 1S7GA 2OD9A 5ESDA 2Y0PA 1X7ZA 2VJYA 2H59A 4HD8A 5ERXA 4JT9A 3HYLA 2BFEA 3D4BA 2BEWA 4JUDX 4K9LA 3ZHTA 1KEKA 1V11B 2BFBA 1E3TA 4JD5A 4KXXA 5FEMA 2Q5OA 4JUBA 1U5BA 1WCIB 4RMHA 1PNOA 1YTLA 2IHUA 3CF4G 4KPUA 4F4UA 1SZDA 4K9KA 1OLXB 1EFPA 3PKIA 4GM0A 2Q27A
chains in the Genus database with same CATH superfamily
1D0IA 1FU8A 4IR7A 4RV4A 1UBMS 3WMEA 3R3XA 4EH1A 5TX7A 3DQZA 1N1DA 2WZQA 5HUJA 1JNXX 2J0UA 3PIDA 2ODPA 3IQFA 1MAHA 3KT0A 5F5LA 2WHXA 3EB9A 3R4VA 2IL1A 1LGYA 1FP4B 1ZGHA 4RM3A 4MWZA 2ZWVA 4OQLA 1G3MA 1S9HA 3B36A 2JB9A 3SOPA 2CL0X 4DSNA 2AJBA 4Y2SA 3BHJA 4ER5A 2YNMC 3ELWA 2IY7A 4G9GA 4J16A 2RGRA 2PCJA 1Z0KA 1ZIPA 4I19A 3NTQA 1E1KA 1YK0A 1ECLA 1WMEA 3A9UA 4MUHA 1LRJA 1OWNA 2O3TA 2OOKA 1ML4A 5EOVA 3HFJA 1DXHA 2W2LD 3QTBA 4PYIA 4ZGGA 3RRNA 4KDFA 2BCEA 4M36A 2QN2A 1D8TA 4HH4A 4KPUB 4WQMA 3UG7A 3SKYA 4MA5A 1HK7A 4R5HA 3MJEA 2CZQA 2VAXA 3AK4A 4IMPA 4QODA 2PKCA 4Y2JA 4C29A 4CUZA 5F23A 2XH8A 2ONJA 1PZHA 1EJ6A 1NTOA 1TT5B 2YHAA 2XRYA 3N0RA 1TW3A 3JXEA 3OPXA 4GR9A 1DTWA 3KEGA 5REQB 2PYDA 1KSGA 5B58T 3U80A 3ZHCA 3U7FB 2FW6A 2PRSA 3KVOA 2WZDA 1H94A 2PN1A 4FHCA 1BE1A 1L3CA 3IVMA 1DUVG 1MXHA 1LBHA 2QSZA 2QM0A 2C4UA 4DV3B 3C3JA 1YRBA 4GMHA 1DQRA 3WZ2A 4DV0B 3GNTA 1G2OA 1L9XA 3L6BA 4RSHA 5TF0A 1KDYA 2HNBA 1L5NA 1QC5A 3JWPA 3UBMA 2QTTA 1H85A 2R66A 1GAJA 2A94A 2F1IA 1Q19A 4OAPA 5KJEA 2A9OA 2W2OA 1K0FA 5CYFA 2XD9A 2NZJA 5DM4A 3SF0A 1YBVA 3FPCA 1ZZGA 3FLBA 1YHNA 2JGNA 1QG6A 3GJ6A 3H5VA 3S2ZA 3EF3A 2PJRA 5I01A 1E9AA 1ESNA 1XN4A 1L8LA 2YW2A 5KDLA 5TF4A 3U4QA 2N47A 3MWEB 2BD0A 2V7WA 2D59A 1JLLA 2IIVA 3K1JA 1ZISA 2H08A 3E3OA 2E87A 2YQ4A 3PQ2A 2O48X 5LXTA 1GGMA 1XWWA 4G4GA 2VTDA 4HT3B 4DV1B 1V8PA 2H31A 5DNAA 1YMUA 2GEUA 1GXSB 2Q8PA 3RT9A 2WHEA 3KYIB 2EAUA 5HP4A 4GOLD 5GQSA 3UAOA 5CA1F 2BMVA 3O1JC 3OE4A 4LRQA 3OZWA 2IK8A 2VDMB 1G7TA 2JNWA 2JH9A 1W30A 3E3MA 3WHPA 1VYUA 4B3HA 1UXJA 1ZQ9A 3DE2X 2OO3A 2O05A 5LL6P 4IP0A 3K5PA 4M9QA 3USCS 4DPKA 2W98A 3T9AA 5HZGA 3FVVA 3D4OA 1C1XA 2V9PA 1E94E 3BQNB 1F0YA 3JWJA 3MTIA 3ZG6A 1VA4A 3JVIA 1KE2A 1E9VA 2YJ5A 3LQRA 4WN3A 3NT2A 4FGKA 4R8KA 3SIWA 5LYJF 2OHIA 1M8JA 3DKVA 2POQX 4TLAA 1C8VB 3FLAA 4LYYA 2IHNA 2I3ZA 3IFSA 4D5EA 1WPGA 2XCRB 2H5IA 5AM0A 1J23A 4D9HA 4OJMX 3MS2A 4QT0A 5A4MS 4GM1A 1GTSA 3R0VA 5HR5A 2PZJA 4A8PA 3H4IA 4X45A 1GTZA 4GW3A 4BPRA 1NYTA 3WB1A 1YIAA 4CL2A 2WIBA 4C4RA 4JJIA 1LFDB 4Z4EA 3KUUA 4R1QA 4LHXA 5B1IA 1KDPA 4EG4A 1QFXA 1H6CA 4G81A 1EFAA 3DDNA 1W4RA 3C8MA 4IJVA 4XA8A 3WHKA 1H5QA 4A6PA 2IBSA 3P2IA 1T34A 1LS6A 1T1JA 3GRVA 3ZUPA 5KYNA 2IOYA 1X39A 2RHTA 4X85A 4AJEA 3LYLA 1TU4A 2FG7C 1QGUB 1QHHB 1Q6ZA 2GYVA 4TL8A 3QUCA 3GFBA 1UEJA 3DHYA 1BJKA 2O1EA 4OMCA 3SXPA 1ZGJA 1C9NA 3OM8A 3BTUA 3EG9A 3OKFA 1XF1A 1WMSA 2G07A 1XQXA 4Z99A 4PO3X 3F8WA 3NP7A 1RQNA 2Q0SA 1WQ4A 2QZSA 2NO4A 2FGKA 2GXUA 3CPJB 4NKRA 4D9IA 2RHJA 4RHUA 3C7DB 4FD2A 4YJ2B 5G0TA 4G1BA 4YFVA 4UPEA 4FCCA 3EARA 4NDZA 4CIBA 5A4JA 4ZOCA 1BCRB 1MC4A 3GUVA 2P9HA 3ZDRA 5DLEA 1F17A 4DWOA 5HW0A 4HDSB 1PNQA 3TOXA 1C7RA 2GLUA 2WT8A 4H7IA 4Z3KA 4NV1A 1ENOA 5TJHA 3O8RA 5D3QA 1T4BA 3VA7A 5JAHA 3ZCUA 4DMHA 3DEFA 3WLKX 4IQGA 1E18A 3RTCA 4ZIRA 1CFZA 4BKPA 5JAIA 3CVVA 3OFKA 1TUBA 1TF2A 5AD1A 1EJ0A 1DZ3A 2BUAA 2QLNA 1O8BA 3IB6A 5FB3A 5I7OA 1SCBA 1TT7A 3EGVA 1X8LA 2QTHA 3QH4A 3UJ6A 1NXTA 2W2NA 2GM4A 4F9EA 2BEKA 3CTPA 1XKQA 4FFVA 5AKGA 5I45A 3AVQA 1V2HE 3CLKA 3UUFA 2A1TR 3C6KA 1RAGA 2W2MA 4YONB 4A0SA 3GZNA 2HU8A 1PBTA 4UUBA 2QLJA 3LWZA 1Z07A 1PEKE 3MBIA 1I4TD 4JMPA 3WICA 4YA6A 3A6HA 2ERCA 1KY2A 4EGSA 4MW1A 2BT4A 2FSVC 3VI4B 1Y34E 4R1PA 5K9ZA 2P77A 2V96A 3JWHA 4D8XA 2YRFA 1XJWA 2Z1DA 5EKUA 3EGEA 3FIJA 4FMCB 3QXHA 4N7MA 4ECAA 2J59A 5TRTA 4XVCA 1ZUHA 2VYND 3WLNA 5KSPA 1WKVA 4F6RB 3KB6A 2IUFA 1A9ZA 3KAJA 2X2PA 1U63A 3HEBA 2IHBA 1RAEA 3RWBA 2BHTA 3U1BA 3EMKA 1WY7A 3M81A 1R0KA 2ZIEA 5D3ZA 3KYCB 5L53A 4NSNA 1BMFD 5D84A 1Q0RA 4PPFA 3D8BA 1SCJA 3EXG1 1YE8A 2WU8A 5KB3A 4IHJA 1UMCA 3EEFA 4KLCA 4URFA 5GJWC 3MGGA 4LX8A 3RF6A 3O8DA 5IZ4A 3DYIA 2YS7A 4CEJB 4CMHA 1XLUA 5HIAA 1ZH0A 3FR8A 3UB3A 1DQNA 1E60A 1U8AA 1NE7A 2A30A 3NCHA 3TIIA 2FG5A 3KRTA 3TN7A 2CXNA 2ZRPA 1TK9A 2VJPA 4QNNA 3K8QA 1SKAA 1WL8A 5BXYA 1ZU5A 4ZEWA 4EY6A 1YDEA 2FUCA 3KAKA 3NWJA 1U1FA 3QWBA 5EERA 2KWIA 5D51S 2Z5LA 4YO8A 5E6UA 4FSXA 3U17A 5FPKA 5LD2B 4RZHA 1FLAA 4LFBB 2DHQA 3ABZA 2XBUA 5FQNA 4EPRA 1V7PC 2L42A 4M7PA 5EWMA 4PYRA 2JPDA 4FT2A 5EXTA 2C7PA 3HCPA 3ZBUA 1G16A 3KOMA 3RFCA 2VAPA 3Q1KA 2VPWA 3UWSA 1ISIA 1M75A 2GK4A 2L19A 3LFTA 3PUXA 1QUFA 3QWHA 1TW2A 1TRKA 1W1IA 1JR2A 3HUEA 4IDCA 5DGDA 5AM5A 2IS4A 3IIEA 4IQ0A 1I3NA 5I7HA 1YAHA 1XZ8A 2HADA 2WJGA 3R6WA 1VPLA 5EPEA 3Q11A 5B4UA 1H2RS 4XEUA 2AMVA 3R0QA 1QJ4A 1U0LA 5DGHA 4MW5A 3C4JA 4IX1A 4RZIA 4KIUA 3TEMA 3V8NA 1W5SA 3PTLA 3K70C 2XDQB 1NU6A 1WPRA 2DWCA 5GIOE 2OBXA 5A4DA 3KP1A 2HXSA 1DXOA 1VGQA 4X66B 3R3VA 2HA4A 1UJNA 2GWRA 1CY2A 4C0SA 1AN0A 3QFCA 4GKKB 2JIDA 1GNRA 2D00A 1A71A 4HH1A 4UREA 4D96A 1EHCA 1D9XA 1O6ZA 2WYVA 2Q1UA 2WNHA 4IO1A 2QRJA 1J56A 1FNDA 3UAZA 3D4NA 1DV2A 1U4SA 1GV0A 4I1OA 4M37A 2Q2QA 4RHXA 2GFIA 2H2FA 2RBGA 4GVLA 3NQ41 3ZVRA 2I2AA 1L7AA 1Z6GA 3NYRA 5FF9A 3HVUA 3I01M 5JMPA 5A0FA 1EXVA 2R6DA 1JU4A 2RKWA 1N4DA 3B8EA 1JTFA 1UK9A 1KY5A 3GNSA 1N6RA 1QHYA 4FE4A 1BDMA 1E5TA 1WLSA 3B1ZA 3M4JA 2QRVB 1KQNA 1T2DA 2Q3CA 1SZCA 1K08A 1L4HA 3R4CA 5KTTA 3TFQA 5CFLA 3H2SA 3C3MA 1PT8A 4UULA 4KITB 2OD2A 1OJLA 5IDVA 1PHRA 3F1LA 2W2KB 1ZBQA 3TPFA 4U2BA 1LSOA 4DCMA 4QVIA 4Q3LA 1L7VC 1YR8A 4CLEA 4DDHA 5H4HA 1X1BA 4CXMA 1DJLA 3CX7A 4FX5A 2I65A 4KWHA 2XT0A 1DRWA 5KSWB 2HSZA 1DVRA 2Z09A 2ZIWB 1RE1A 4DXHA 4PRLA 2WOOA 2ZJ3A 2A9JA 3VX4A 3OLCX 3ZV6A 4RKFA 3M6FA 4UNIA 4CM7A 1GTL1 3KOWA 1MB4A 1C1DB 4ZDKA 3C45A 4OFZA 4KE6A 2XDYA 3H9BA 5LUBA 5KC9A 2FPIB 3ELDA 1T0PA 2JI7A 2IU4A 2Z08A 1PFYA 4CCYA 2WB2A 1N1EA 5EIAA 1YS1X 4U2GA 3BE6A 1NBMA 1THGA 3HCEA 4AZ3A 2KJQA 5KWJA 1QRSA 4QGBA 4RJIA 2XF2A 1U7OA 5D5PA 4Q4HB 2JBHA 3SDBA 2W2PA 1R00A 3NTUA 1VHWA 3AKYA 5DW3A 2EVWX 2G7ZA 2BSAA 4KTVE 4YLEA 5TV2A 1UR5A 2ADOA 1NYQA 2D06A 3FI0A 3NXKA 4AJLA 4UTVA 4GZLA 4KPEC 4YH1A 1TL7C 2ZG6A 1FUIA 5KNCD 4MA0A 3LXRA 3AJDA 5K0BA 4IQ8A 4G5HA 2BCGY 2ZU6A 3DTNA 1MDBA 3T3OA 4MICA 2O8CB 4TTIA 4QBIA 1M7HA 3CKMA 3H2YA 3K32A 1PE0A 3ZJ5A 3U7HB 2LCFA 1ILWA 1A8PA 2CNBA 3UUEA 1DJMA 4XIIA 2Y77A 1U8UA 1HDCA 4TXHA 5DB4A 2IKQA 1EA5A 1UBTS 4MQFA 3HMKA 3PI6A 4RZXA 1FDRA 3WQQA 3JRNA 2BKEA 5TY0A 4IHAA 4Q9HA 1YE5A 4DT1B 5M7EA 4E5MA 1U98A 2FEKA 1QDUA 4J3NA 4CF4A 2HA6A 4FINA 4BB5A 3TSAA 3QNMA 4C5AA 1K75A 1J06A 4WD3A 1XVUA 4XWTA 3Q7PA 4C4XA 3HB9A 3FFTA 1SUCA 2P5SA 3OF5A 3RIMA 3D1JA 1YC2A 5C8YF 5I5GA 3FPFA 1HE2A 4HOYA 4ZEOA 4X6XA 3ZE8A 4E22A 2H1IA 1YKGA 4LXGA 5CFZA 1E7QA 4Y9SA 3DVLA 1FP7A 3L9XA 4YGXB 3FNBA 3VZSA 3K6SB 1NVKA 4RLHA 3OLYA 4KGXA 3HXQA 2FP3A 4FS3A 4MXDA 4LECA 4B45A 1XZGA 1IXSB 1ZC4A 4DLPA 2OCYC 2G9ZA 2AOWA 2OSBA 2WJ3A 1JG4A 4I55B 3RSZA 2NO9A 1GG5A 3OCWA 4TWIA 3U2QA 3U5ZB 3ZU5A 3VKHA 4ZK2A 1DAOA 4HQRA 5DYNA 1X77A 2PQ2A 2Q2NA 3U4GA 1X1SA 5AKJA 4DIOA 1N5JA 1Z5OA 2AB0A 2I4RA 1REQA 2PHZA 3AEKB 1IYZA 4PAOA 4QXMA 1C41A 2GZRA 1N32B 3HN6A 2JIZA 1GUYA 2CMFA 4PLWA 3V34A 3DKRA 1NF9A 3ORQA 1FF9A 2AG5A 2ZUBA 3GN1A 4MHOA 2JK1A 1QE5A 1UFOA 1C8KA 3P19A 3TINA 4PN3A 1P81A 2F9FA 1IQRA 3H9UA 5HTOA 3TIGA 3G7UA 1CUSA 4JYCA 1JAHA 2XXAA 2X5NA 4OOFA 4PF1A 3WGQA 1TK2A 4HD8A 1W76A 2D4HA 3FCXA 1FRQA 2WSSA 5AKZA 2YNMA 5ICFA 3ZGLA 3G89A 3L4BC 4R9VA 4BUJA 1NV8A 3KR2A 3NNDA 4BECA 4C14A 2P4QA 1GWNA 2IF2A 4FI3F 4R0VA 3RK1A 4B3TB 2CHVA 5A04A 1FVHA 1O94C 1E8NA 1E2FA 3DFIA 2B69A 4KMRA 4RMHA 2EFJA 2GI4A 4F46A 3AL3A 3DLHA 1QIMA 2J6HA 5K3AA 3RIXA 1Z35A 4F2HA 2JC3A 2D1FA 3SF8A 2V7TA 4MYHA 4PX5A 1TF7A 5KQGA 3UAWA 1SMKA 1XZJA 7AT1A 5L3SB 3MB5A 2UZ4A 2VTEA 1UJ2A 2WUEA 3CNBA 3OH8A 3ME5A 4QATA 4QA9A 4O0LA 4HAZA 2QTRA 3HVJA 3ADDA 2DT5A 2XYRA 2WUGA 4NONA 4PIMA 2J0QA 4S12A 2ZK7A 2VYCA 3H83A 3LDAA 4M83A 4QAJA 4UOZA 4BXOA 5FLKA 4KQIA 3E5NA 3ITEA 1FFEA 2GPJA 1J0CA 4G4IA 4Q9IA 2RE8A 2UDPA 3NJ8A 4MS1A 1C2TA 1KU6A 3DAOA 3OPVA 3C15C 4QBTA 2QF7A 4S1VA 2PZGA 4ZAGA 1QP0A 3MAGA 1UBEA 3K3PA 1ID8A 3W8DA 4PCUA 2ZWMA 2DUUA 4IYJA 4JVLA 3UXHA 2J5XA 4C4YA 3V8PA 3DBHA 2QMEA 4EI8A 1MJGA 4INZA 2FDCA 1Z26A 2E4WA 2WHPB 4HDAA 4I3HA 4GMXA 1N8TA 3AMVA 1BJTA 1CULC 2QTBA 1U90A 1GUZA 3ILXA 1O89A 4PFSA 3PEWA 1RKQA 1SURA 4MGYR 1ZICA 1T8PA 2TECE 4WZAA 1X70A 2BI7A 3FR7A 3LPMA 5ALMA 1U8FO 4BLUA 1P7ZA 1XDZA 1YE3A 1WUIS 4IDHA 1IOWA 4YAFA 2NUAB 1Y81A 5CCXA 1I51A 1P61B 3IXMA 4RPIA 1GPWB 4PNZA 1MQSA 2HNAA 2O7VA 1G98A 1VLMA 4AJPA 4JP2A 4JKYA 2KPOA 5IH7A 3M1IA 1PG2A 4LJ4A 4DADA 5IT4A 5L7TA 3CKLA 1MRSA 3PDCA 3DEYX 5DNYB 1Y7HA 3V80A 1R0YA 3B6KA 3T1TA 1JQAA 2VUHB 2WDZA 4US1R 5CUQA 4C0BA 2V6IA 2OG1A 1EFRD 3FMVA 3TM5A 3IAS6 3MB8A 1HNWB 3A6GA 3K6KA 3VOTA 5JV5A 1GZ5A 2AI3A 3DKKA 2AZTA 3MAJA 4YP5A 5A1TA 3CE6A 1O97C 3STHA 4UXJA 3UENA 3W2TA 4AUMA 1YFZA 2EGHA 5ER9A 3WYAA 1P6UA 3UJ7A 3CIOA 4KQJA 2I1VB 3NASA 3L04A 4V39A 5EZSA 4AUEA 1ID1A 4KV7A 3LPAA 4TUYB 5IKPA 3RYCA 2H18A 3OKPA 2P6OA 4EB6A 2K6GA 2Z2JA 1MO3A 1H5NA 2Z0MA 4XSHA 5C7YA 5IM4F 2JAUA 4KAJA 3G1TA 3HEAA 1J8YF 3GT0A 3PQFA 1YS4A 1CNFA 4Y2RA 2G6TA 4KG7A 5UKDA 3WGZA 3WLJA 5A9RA 2W93A 2NVUB 3CISA 1ZSVA 4YXWA 2YHBA 4IH9A 4QUKA 5EHGA 1NBIA 4ZP1A 1Q16A 2RK3A 3H6GA 1E2EA 2K5UA 2RIRA 3AHDA 4WCFC 3TTVA 4EAAA 3WP1B 3G8CA 3JZMA 2C96A 1ZSNA 3QM1A 4CKYA 1MPXA 2FLKA 2PXCA 1GJRA 4UQOA 4GPBA 3QGMA 3LT1A 4XIFA 4RSRA 4ZCLA 1O5IA 4X7PA 3NBZC 1YFLA 3A6KA 1NT4A 1XRMA 4ND3A 4EI2A 2JVJA 2IE0A 2CVOA 2Q1WA 3HI6A 2IYFA 2NVBA 2QW8A 2DG2A 4IS3A 4MUXA 1TADA 2WJYA 1DJPA 1IM2A 1E3JA 4H15A 3O3MB 3LA6A 1ADFA 4ZT6A 3PUVA 1EM8B 4RC9A 3TNLA 3SX0A 4JMLA 1QGDA 1PI3A 5AJZA 2VDOB 1LC0A 2VJNA 4J90A 2OXEA 1W8DA 2ZSDA 4G36A 1JB9A 1SVWA 2D1QA 3AI2A 2GCEA 1WXHA 3P20A 4FFOA 4M7OA 3QUTA 4KAFA 4KXWA 1U7DA 2WKQA 3MJHA 1N6LA 3OOHA 2OXFA 4JL5A 4UNQA 1ULBA 4YAWA 3ZGXA 2J3LA 5ISMA 1M1UA 4TVBA 5EKTA 1U7PA 5CVDA 1P9WA 1L6IA 5DM0A 4S1TA 2YUTA 4KOAA 3PNKA 5M3BA 3PXUA 4AXXA 2QI9C 4QSHA 1AZTA 5KOYA 4LF6B 1CEYA 3SEQA 1GV1A 1AY0A 4L7VA 2FZ5A 2OYRA 2H1VA 2AG6A 4FGZA 3MIZA 4JGGA 3TLGA 3WYEA 3COZA 5LJLA 1CZHA 2JH8A 3FDZA 4O4HF 2OVBA 3M9WA 1LLDA 1YB7A 2HJ9A 4J1TA 4BBJA 4DLXA 4LA4A 5DCWA 3GLRA 3RT7A 2Y1LA 3EVAA 1KJZA 1TYEB 4MLDA 4PLPA 5JEEA 3B1KA 2PG3A 3N2ZB 4PBRA 2I7VA 1U5AA 4RACA 1QYDA 4WKOA 5JAZA 4RHEA 1GQSA 1KMIY 4JITA 3C85A 2L82A 3IILA 5E2IA 2ZRCA 1P4AA 2VSQA 1KYWA 2B9EA 3O4HA 1JFTA 1G20A 4TTTS 4WACA 5I8PA 1H9BA 3LLMA 4L8LA 5DO9A 1XEFA 2RH8A 3QUQA 1R5BA 3CW9A 3EEIA 3OHMA 1R27A 2EQBA 2JA2A 4MGHA 3G6WA 5AKEA 1Z8FA 3OEEA 9MHTA 3WYNA 2NTEA 1B1AA 3V00A 3O1LA 3BQMB 1DWPA 4EG3A 2FMKA 3I2IA 4N40A 3KQPA 4OI0A 4G89A 4AXBA 2VP0A 3F5DA 3EOZA 2P6NA 2MDTA 1F9EA 5EEHA 4X6UA 5SZHB 2IU3A 1ZR4A 1KEEB 2X7XA 2EZ9A 1MW8X 1G59A 3L84A 2B7CA 5FBQB 3ORFA 1ZJZA 4RDHA 3GN2A 1ITZA 3MLBA 3MINA 4Z4CA 1U2DC 2VOJA 3DCIA 2G28A 3BXHA 5LMCA 2I71A 2XNCA 3TSYA 2CNWD 2VF8A 3UYLA 1J0DA 3DZFA 3OBIA 3THRA 1NX9A 1VB3A 3KR0A 3QX9A 4LHEA 5ALKA 4C22A 3THYA 1SXPA 4XM2A 2QV0A 1UBKS 2OO5A 1LX6A 3K96A 3HRIA 3K4QA 3UFBA 4DHWA 1T8SA 1FP2A 2RK6A 1KRXA 1TX4B 4C7BA 4FIDA 2GR9A 2OM6A 4FUQA 5EJGA 2JJMA 4JBYA 4IINA 4KIJA 3GRYA 4C4OA 3DTVD 1XT6A 2W8BB 4C2UA 3HVKA 2IEZA 2VF5X 2O14A 4NEHB 3FOZA 2I3AA 4JI2B 2Z9DA 4ZI7A 13PKA 3TQIA 3T5PA 1GSHA 3QE9Y 4LJLA 5FOVA 1EP2B 2YZNA 4B6OA 4BP3A 2PFGA 2OCLA 2UYCA 3R7FA 4YWHA 4UEJA 3T1QA 1C1YA 1XZFA 4OGGA 1UOQA 4I4TA 5IJ0A 4OH7A 1Y3IA 3N0WA 4US2R 4IIEA 4I2NA 2A5GA 3OLQA 4UVIA 2XQKA 2JRLA 1NVBA 4BMPB 1QYXA 3ITDA 4JENA 1Z6QA 3HJNA 4P7JA 1VFPA 5A5FA 2WZCA 2UZ3A 2GK6A 1XPRA 4D26A 3T9DA 2CE2X 1JIVA 1NJGA 3WGNA 1ZUD1 3IPRA 2FWMX 1WHSB 4DR2B 3FZGA 4LV5B 2C9YA 3GLQA 2V4UA 4D42A 1RIIA 3AY3A 3NMUF 3D2BA 2RJOA 1FMFA 1E63A 3FHTA 4DEXA 4L5CA 3FKSD 3PFNA 4MEAA 4YDSA 4UTRA 3RKSA 2WHYA 3WIVA 1JRLA 1HLPA 3ELBA 3PFHA 1TLTA 2UYQA 2VK8A 5GVSA 4DE5A 4HDKA 3I2KA 4HFNA 4LOKA 4RPKA 3QKSB 4EYQA 4IJUA 4YMTA 2DKOA 5DK6A 1EZ1A 4YCSA 5DIFA 1B42A 4Y2HA 4MQEA 5JASA 1DMSA 1Z62A 5BWBA 3V4FA 4MIEA 1F6DA 1JIQA 2E82A 4G85A 4OQPA 4AFNA 3IHTA 2X8BA 4OYRA 4G0PA 3K73O 2I2XB 3QLTA 4BQNA 2CYCA 1DC7A 1NP7A 2HQBA 4CLOB 2RGBA 4JLUA 3QV2A 1CY7A 2CCJA 1AKNA 4L15A 3R3JA 4BBPA 1KNQA 1CY6A 1U2RA 1Y6JA 4FGSA 1CETA 1WW3A 3GJ8A 4UBOA 1BQEA 2I6XA 4Q19A 5HMLA 4ZYVA 2VK4A 2YX1A 1CQJA 2ID7A 3NPMA 4HDRB 2Q4TA 3RU3A 1ZL2A 2Q7OE 4J29A 2OL4A 1XFDA 3HR8A 1J6UA 1M2HA 2P1DA 1WVGA 2R4UA 3FCOA 3JD1A 5ALRA 4OLHA 1V2GA 1FIUA 1RZVA 4BWGA 3T94A 1NC3A 4TVKA 4OI4A 3P9RA 4KLAA 4P38A 4ZCSA 4YHHB 3N28A 4XR9A 4PYJA 2MSLA 4J1NA 1NM5C 2AE2A 2YVQA 1U4NA 4CV0A 3BRWA 1TJYA 3DDWA 3J7AC 2NAPA 5EJ5A 5CA1B 4BV3A 4RZUA 3QEMB 5JJ5A 4CF7A 5HX7A 3TQFA 2EL9A 2EDAA 3OLVA 4EYGA 1C30A 2QTCA 1L4EA 1NW7A 3GLGA 3PVZA 3LGAA 2FPKA 4OCZA 1R5NA 5DHQA 2IV2X 5JMTA 2OUKA 3UUGA 4JB3A 4BU1A 5LYJB 3MUNA 3IAFA 3JALB 3MBOA 3DAHA 4PWYA 5CBPA 4FN4A 4XVRA 5ICMA 4LFAB 1XEXB 5JEDA 1VRCA 1JU9A 4CGZA 2QPTA 3OTHA 1OTHA 1XRSB 4ZAYA 3SBEA 4CQMB 4DA7A 1H1DA 1IDN1 2HJHA 4L28A 1OI7A 1W5BA 1G5FA 2I4LA 3OZBA 3U39A 3ZE2B 5C5CA 3NC0C 2QEQA 2XAAA 3RJ9A 3CN9A 3WDLA 5B30A 5L3QA 1TPYA 5F2NA 1OBVA 1SG6A 2ID8A 4R9SA 1Q0SA 3AUJB 5AOBA 5HQJA 2B4KA 2AX3A 2QY6A 1B6SA 3BXGA 3NJRA 2YZ7A 4R01A 4Y18A 2PT7A 2ZJ5A 3UT5A 2W6JD 4K40A 4KPFC 4BQEA 2JGKA 2ZYUX 4NDAA 4KXVA 5AM4A 4BMOB 5JCJD 4CCWA 4U0JA 5I4CA 4NENA 3PCTA 1KIFA 3NAGA 2VHCA 4MTCA 1IXKA 1CJMA 1MU0A 3AU8A 5ELXA 3LY9A 4AQYB 1KO5A 1J5PA 3FHCB 4LWQA 3ZWVA 1K63A 3UJ9A 5BOSA 4KR2A 5C5EA 4QD3A 1IATA 3HU5A 5AJXA 4R98A 3T5AA 3SZLA 2O3JA 2VYVD 4ETMA 2J0SA 1YRAA 4LY0A 1OYYA 1H8HD 3C3BA 4MAFA 1UWVA 3GEBA 1A9OA 1KZ9A 4RJLA 2OHOA 2WTNA 4RIGA 3IHKA 2NYVA 4XX0A 1Y6QA 1EUDA 3D3NA 5DNDA 3S44A 2I2WA 4F56A 4B83A 4JEIA 4J0HA 3PHIA 3BKWA 1XZAA 4QE3A 3IEUA 3T1NA 2BMJA 3BWEA 2ZB2A 4K3VA 3GC6A 4L78A 4YFYA 4IOLA 2GBLC 1WDLA 1S3IA 3GRAA 2IUSA 1NMEA 2PX3A 4LXHA 5LXTF 3UKOA 2WJJA 3O21A 4AX4A 4EPWA 4JLOA 2EZUA 3G5LA 4I8IA 1NNLA 3KKLA 2FN8A 3M4XA 2IWRA 4EJSA 3TJRA 4YRGA 3DS8A 1XCPA 2R7NA 1DZIA 1L1RA 3FYSA 1H1TA 5E3JA 1QH8A 4ZQIA 5JW6A 3R6DA 3TW0A 4YMUA 3KQVA 3MM4A 2PU7A 2O2HA 2PUWA 5HHTA 1O9BA 1V4BA 2JI9A 2NLOA 1MV8A 1YR9A 3OZIA 1J1IA 4FFSA 4JODA 2B1IA 3O47A 1PFGA 2E6UX 3G0BA 4LRUA 3VM6A 3EFOB 3QX3A 3DLCA 3E8XA 1YKFA 2QKYA 1QNFA 2BR4A 2KMLA 3N87A 4DLKA 4F96A 1Y8ZA 3PRYA 5HCUA 4P3OA 4YUAA 2OKCA 1L7DA 1U11A 4ZT3A 1YJAA 2IYOA 1U0NA 1WSAA 2JEZA 2WTXA 4X84A 3PQ6A 4JYMA 5CLIA 4R0NA 2V55B 1HX7A 3DE3X 4C4ZA 4CM1A 3HDTA 4F85A 3K1AB 1KZ4A 5J9FA 3W5IA 3GMDA 5ITZB 3KHUA 2W4IA 3H5TA 1CR1A 4EZBA 2YWHA 3ZQUA 1MNQA 1KNXA 4ARCA 1O94A 2EKBA 1ABBA 2R6HA 1GO2A 2R6R1 2JLSA 4L8FA 1C3EA 4R2HA 3HCOA 4TGLA 5D5HA 3CLSC 1CUFA 3O1HB 1JIIA 4JOSA 5FBWB 4XGQA 2ZJBA 1W36B 1QO0D 3AQ4A 1QIFA 2H2AA 1O0SA 4CU5A 1KO7A 2XNDD 4XJVA 4BFYA 5BNFA 4PLYA 2NU6A 2QDKA 1EXNA 1W85B 3FUCA 4M8SA 1NDUA 1GA1A 1RJGA 1OZFA 1XZDA 1U65A 1R50A 4BAUA 4DBZA 4LHWA 4P81A 1W75A 1J0BA 4ZQBA 3PQ8A 5T8KC 1S7GA 2ASVA 1N6IA 1E8MA 4F4HA 2H11A 2GN0A 3ESYA 4RFSB 1J8DA 1J39A 4RDIA 1XRQA 3NT5A 2ZB4A 2M6LA 1C0EA 1LLQA 1XWFA 3NHPA 2QG4A 4FYWA 1QZTA 1ECCA 4KO3S 1NWHA 2I3GA 1CZUA 1LY1A 2CUTA 2NQTA 3P26A 4K87A 4AYWA 5DX8A 2WWRA 4IKOA 1KI6B 4EEKA 1KFCB 1J8QA 1XELA 3WRYA 1KA9H 4KW7A 1T5IA 1O95A 2HMYB 3LWBA 5K1ZA 3TSOA 1QRDA 3GJ4A 4DR4B 4NULA 1YTLA 3HB0A 4LEIA 1F8UA 1DRJA 1E1QD 2W4MA 4AKTA 4B3IA 2KB0A 4DRXA 3NJ4A 2CDNA 1OBCA 1L5LA 2XD4A 1SU6A 3R7WA 1Q1NA 3LU1A 1B93A 1T3GA 1QQAA 1OXKB 3VDRA 1E2DA 1GSAA 1GY8A 4N0MA 3AR5A 3PK0A 1VYVA 4ZCQA 4OHZA 4EG5A 1QG2A 2QX8A 1Y5NA 1EUYA 1KI9A 1L7EA 3TMYA 1K98A 3SZOA 3X1ZA 5FWNA 4MEBA 3JQ9A 2JVIA 4OOEA 4WLEA 4RDXA 3GFGA 4O8CA 3LK7A 1Z2PX 1BWPA 3EXFB 3GJYA 5F51A 4A3SA 3ZQJA 4DAEA 4EL0A 5I8ZA 2QJWA 3KXIA 1A8SA 1EIWA 2WIDA 1CQXA 4PG5A 4N5MA 1DXQA 1X1EA 2HY7A 2H07A 2PT6A 5JZMA 1GZ4A 1SG0A 4AF6A 2BAGA 5LN1A 1FVOA 2ACEA 5A3SA 2CCKA 1PZGA 1OYOA 5TPWA 1QO9A 4F2DA 2FNAA 5BN3A 4RTRA 3WGYA 1E59A 1IBMB 1Y9AA 2IOHA 1M76A 2QX7A 3LX5A 9ABPA 2EV9A 2ZRGA 1XTTA 3AXSA 4BZZA 2A84A 4AT1A 5FFMA 2OKGA 2V98A 4FQ8A 4UCFA 2X7HA 8ADHA 1ZZEA 3VR4A 2JLXA 2GA8A 4YQZA 2BISA 1JFSA 3JV7A 5FH9A 5LZ5A 1ZHFA 2EFHB 5HDQA 1UM8A 2ETXA 1CP3A 1SHLA 2G67A 1JVSA 2V3WA 3E6AA 3KHSA 3NHWA 4KTTE 4OBBA 2BEJA 4CMIA 1S1CA 2MR6A 4OUKX 1T43A 2IZ7A 3ICOA 1BOOA 1RWBA 3BCSA 2X1VA 1ICIA 3I2JA 3PHHA 4L4ZA 4NCKA 4J7CA 4DB4A 1T6NA 3OPYI 2Q6VA 3M6IA 4MAAA 1N6OA 1II8A 1KI7A 5M34A 2JGJA 1OH5A 5DNWA 5L4LA 4LF8B 5FPYA 1Z38A 1W47A 1G8FA 2FI1A 1FTWA 1K3UB 3E3LA 3RGGA 3DMRA 4R16A 3V5NA 2R1TA 4GECA 4IHJF 5TSDA 1MJHA 3AF5A 4EHBA 3ADCA 3T1YB 4BVKA 1E6KA 1JXOA 2QRPA 4U6NA 4AKSA 1XLVA 1JWAB 3UAYA 3P2YA 4M88A 4HFRA 3ZGVA 2O2XA 1CUCA 1EXWA 2AFIA 3EVGA 3FSEA 1AB5A 4R0MA 2KM1A 5ALFA 2TRSB 2B8JA 4MJ7A 3U0VA 1K3TA 3EBOA 4M38A 4OVKA 1LNQA 3LUJA 3GFPA 2CXUA 4MV5A 5ANRB 5BN5A 4X44A 1Z22A 2VWGA 3FB4A 2HREA 1WEHA 2BFCB 1XK6A 1KIAA 2LVBA 2ZAGA 3GFFA 4FFBA 4FYYA 1CF2O 2PZBA 3E4CA 2M2IA 3QBJA 1BDIA 1M6VB 1QR2A 4DCVA 3NOVA 1X6VA 4M3NA 2GFQA 3O7WA 2G40A 1NFFA 2NXWA 2Q6IA 2MMGA 3EDOA 3VR6H 1MA3A 3ZIDA 2CDAA 2ORVA 3K7EA 3LXMA 4FLMA 4LPKA 3QXSA 1Z0SA 4UCWA 3UHAA 2A0XA 1RHRA 1UC4B 3KWFA 1QONA 3NTLA 2OQVA 4Q4AB 1LDMA 1S1MA 1J33A 3HWWA 2D5IA 1AKYA 2PAAA 4LDAA 4BIMA 3PGKA 3ILHA 3G2KA 4A8HA 4MVWA 4ALLA 3G1WA 2RIPA 1JDBC 1XVAA 1T3SA 4ED9A 5H68A 2CHFA 4ZK6A 4MWCA 3CRQA 4WXPA 1KGSA 1A9QA 3Q3HA 1UWLA 1XDWA 2DPMA 1N5DA 2JARA 1U7UA 3OZCA 1MIHA 2Q5EA 1U6KA 4IUYA 4CQLB 5FI3A 2FUNB 4BRWA 2BZSA 4HUQA 4RHCA 3TLMA 1CVIA 3LP8A 2XNJA 4WT7A 1N2CE 2CMGA 3L1JA 4YRMA 5JZOA 2NV6A 1G21A 4GMFA 1NC1A 4ASUA 2IYXA 1YS6A 3TAXA 1SEPA 4JYBA 1P2SA 2VKTA 1AURA 2HF2A 3GUUA 4NESA 4OBEA 5D01A 3CRMA 3EXIA 4N41A 2GZAA 3CJTA 1U02A 3B82A 5JZSA 1VPEA 1COWD 5C8YB 5KQMA 2CBZA 4JLBA 3ZQ4A 4B74A 4CYMA 1MMFB 2B2NA 3EXHB 3PNMA 4BQRA 3E81A 4DQUA 2B8EA 1U2DA 3AUXA 5ULLA 1B41A 4AMUA 4ENQA 3DGEC 1BG6A 3B9BA 1Y37A 1E9CA 3WGVA 5BW8A 3JCZA 3CUKA 3EDYA 3QEOA 3MQ4A 2QLTA 2RGAA 1T2NA 3JTMA 3DUFB 5E0OA 4D9GA 1LSUA 2UUAB 3A4VA 5HBGA 3TECE 2P9YA 3QHAA 3THWA 3QVTA 3PNPA 1NQ5A 1T5LA 2DKFA 5JMWA 3Q4GA 4JLSA 5DBHX 4BO7A 1SUBA 4E0BA 2HLHA 3R0JA 5LNK1 1ACJA 5DTEA 4OHFA 5LQUA 2O5RA 2ISCA 1VG0B 3FXAA 3Q12A 3WWDA 1MC1A 1KMCA 1EP9A 1XWIA 1HSZA 1P91A 3AP1A 4P2GA 4F2PA 4FC7A 2WWTA 1VI2A 1RXVA 3BIWA 4K88A 1D1SA 2J6BA 3BL8A 2H63A 1QVWA 1N9KA 2GEJA 1ZCZA 4KL8S 1HORA 4MJ3A 1TAGA 1SFRA 2DR3A 2O9JA 4GZMA 1NP6A 3TXYA 4C9BA 1YOVB 4V1CB 3EGCA 1EJBA 1TJ5A 2B2XA 2W9XA 2C42A 4IO0A 3GLFB 1COZA 2WYHA 1W46A 1OKKD 2RGNC 4QREA 4YJFA 3IUPA 5IC5A 5I9IA 4C30A 2YYZA 3T9CA 4EGFA 5K0EA 4GWKA 1XNJA 2D5LA 3WX0A 1BN7A 4ZCMA 4C7XA 1FEZA 2WWHA 3INTA 3S70A 3B38A 4MPJA 3KXKA 1Z9BA 5ENVA 3ANXA 4OLJA 4R05A 4IGFA 3QTLA 3MILA 2ONZA 2P30A 1UP7A 1HTWA 1KZ7B 2X8JB 2GA9A 4ZVTA 5BYAA 1VG8A 3OX1A 4Q6BA 4WLNA 5JHHB 4YDQA 1BDBA 4HQLA 1I4EB 5ESXA 2C59A 4R7TA 1SUWA 1ZK0A 5EMJA 3M3DA 4EUFA 5HJ5A 1JX6A 2JEOA 5PGMA 3RUEA 2QN1A 4HMQA 1US8A 5GONB 1QV6A 4W5QA 5JCZA 1BW9A 2P9BA 1JL3A 3JD3A 2FMHA 1HYHA 3Q2OA 2PUBA 4IPTA 4BMSA 4TN5A 4P58A 4P86A 2XPCA 3RAEC 4B6RA 1X0XA 2RARA 3WFIA 2RI6A 1KAGA 1KORA 1TD9A 1TMYA 1EZZA 2Q9CA 3WSTA 3B6ZA 1YZQA 2LE0A 1KP9A 4PBTA 5LFAA 5EUCA 5K0GA 4YDRA 2A5DA 4ATNA 4D79A 5HE9A 5KVSA 1ZD5A 3A8TA 4OJTA 4CEIB 2H1WA 1NI4A 2WSIA 3TQRA 1SB8A 2FX5A 4K2HA 3ZE9A 2FPPB 5E4FA 2C8JA 3X2EA 2XV1A 4MR7B 4RQTA 3JARB 1UIRA 1W94A 4HZGA 1Q0ZA 2OWDA 1T8TA 5AVOA 3PHJA 5GZ6A 4YB8A 4BNDA 3OZUA 3QLUC 4HNHA 1UPUA 3FZNA 4PNHA 1TJNA 3A0UA 3IIMA 1P29A 5TMBA 3RUIA 4UAVA 3AR9A 5CYOA 1ISFA 4KZKA 3SZGA 3ZHBA 3MWFA 1MAUA 2VHJA 3OAAA 1N92A 1Y6RA 3WJ2A 2WA2A 1U8CB 1NM5A 3ZGOA 2VHTA 4QM7A 4X3OA 4CMGA 1FVFA 3U4IA 2W0SA 5KQPA 2IS6A 1HQDA 3K9CA 4XFKA 3B89A 4UE3S 5K05A 2XOEA 4RJTA 3LTEA 4R2XA 2FPGB 1M2JA 3KKEA 5BR8B 3EXEB 4GYYA 4A73A 4BRUA 4I4CA 5J4VA 1YL6A 3OIVA 4HGPA 4MZXA 1AG9A 4BV9A 1XOIA 5AVXA 1ORTA 3ULKA 4P4TA 1E6LA 1UT8A 4P2BA 2X0FA 3TIVA 2QAIA 2DC1A 3IDZA 4C87A 5G3YA 4D4IA 5F52A 4NU6A 3BXPA 3LO8A 3MOSA 1X7YB 5JY6A 3IR7A 4QHSA 3WNBA 1CJVC 4I14A 2CLSA 1D5WA 3M8KA 4MIOA 4R83A 1G2IA 1KTVA 1M10A 1SA0B 4LZNA 5CNKA 2EJBA 5TQ0A 2HU2A 2ZJZA 3MD0A 1X7WA 1J2RA 3LXXA 4MINA 5DHPA 4UTPA 5KS2A 2ZTUA 2Q1SA 2A58A 1WZUA 2EERA 3QF7A 2VRNA 4FSDA 2JJ1A 2NQ8A 2DR0A 2HEGA 1Z5PA 3VRHA 3D6TB 4B44A 1FTYA 3HFSA 1JWBB 1EFTA 2XOKA 3OLWA 3VH3A 3VUFA 2ZRBA 4B6GA 1OVGA 5LB4A 5THQA 4E1VA 3WSWA 2WD7A 1G5QA 1LPAB 4YUXA 1RYBA 4LF5B 4F60A 1SHJA 4EQ6A 1RPNA 2HNKA 1PS9A 4MP8A 5FWYB 5CFMA 1Y6FA 3MC1A 3FPHA 1W0JA 3O03A 5JYDA 4B4DA 1KY4A 4ENTA 2F6RA 1JJVA 3RQSA 4EZEA 4BZXA 3O93A 3LYHA 4NARA 2C1EA 1BEUB 4LDJA 5BV0A 2B4QA 4J7UA 3M6UA 5A05A 3FPJA 1Y63A 4S1NA 3S99A 3IBFA 1KDOA 2PFKA 4ZV7A 2AF4C 3K1YA 5ELLA 5K20A 1USVA 2WG1A 1YAJA 2FSUA 4FYXA 2C2ZA 4N7RA 3AW9A 2ZUCA 3FB1A 3GRCA 2HF9A 1T2EA 1YZKA 2BJVA 4GZ3A 3NVMB 4PANA 3LVRE 5ARCA 4B9AA 1AS2A 2IELA 1SOAA 2D7JA 2J4CA 1QF9A 3WBFA 4RVGA 2O2EA 3KYDA 4UTZA 2HFJA 1UBGA 3RHFA 2AW5A 3OTQA 4UTNA 2WHRA 2V7GA 1XDDA 2ZJYA 3IV6A 4Z54A 4B3GA 2OFOA 1XZHA 4MR8A 3CTMA 3ICVA 5JRDS 3COSA 4DUGD 3ZLVA 4KHPB 1LW7A 2D0OB 3WMXA 1JYFA 2OV2A 1VMIA 1G9TA 4ZAVA 2GGSA 1XRJA 2CJYA 2O8NA 2NUBA 1GCAA 4QDUA 4W1QA 4TKVB 3DMGA 3VNRA 2JDID 2YV5A 4O4HB 1JBQA 2X22A 1AN9A 5K0NA 2D3WA 4CTNA 5LMNB 3HKCA 1MT3A 3G9TA 2R7MA 4GOXA 1RM5A 2OQ2A 2BZ0A 3CH6A 3FTNA 1CUWA 7REQA 4LQ4A 1YRYE 4UUAA 1G3IA 4BCBA 4ZGWA 1Z75A 5BUCA 2I54A 4QUJA 1CJUC 2ZE8A 2SECE 3TBHA 2OSVA 4BLRA 5EJIA 3K9BA 2ID9A 1DTEA 4FLEA 3KOYA 4NBVA 3W5CA 3I04A 3OVMA 4X1KB 3S5UA 1FYXA 1N0HA 1QJCA 4NU0A 1UCFA 2C29D 3BSSA 1QG4A 3TI7A 1LPBB 4U02A 4NFYA 3BX1A 4CHTA 3CLRC 3NHZA 2VJLA 2JAPA 2IYNA 3ED1A 3JAKB 4MV0A 3LUGA 1GKIA 4UFOA 3SR0A 4XWOA 5CLFA 5KYXB 3B9PA 3W78A 1SKMA 4CF3A 2Y0BA 3BZBA 1D8AA 3V8QA 4ZQHA 3HXPA 4LNHA 1JHUA 2K4MA 3B1FA 3DTYA 3FHJA 1FNMA 3IELA 4B9EA 1HL7A 4F3KA 3QKRA 2VTKA 2GXSA 2H0QA 1PW7A 3SZMA 3L6UA 2W6IA 3VPAA 5JYEA 2HSJA 2YYSA 4ZREA 3TZBA 3CF2A 1QYRA 4G97A 1P4SA 1Q20A 1GNTA 2PX6A 2PZMA 2VDLB 4M6WB 1XGKA 2QRUA 3VTAA 4IDDA 4YRCA 3GJRA 1GAWA 2I2DA 3PIRA 1JI3A 4ZYZA 4RAOA 2CLKB 2WYUA 3NB0A 2ZITA 4M0PA 1OXXK 2CFCA 2ZKLA 4CN9A 1N34B 3HJHA 4LRYA 2A6PA 1VLHA 2AC4A 3I2YX 3EF0A 2B82A 1ZESA 4URYR 4YRRA 3WL8A 4CM8B 3H3XA 4UE2A 2YDYA 1JFFA 5ALEA 3DDHA 2CL7X 3GLSA 3L5KA 3K31A 5JATA 3UMMA 4Y2UA 2P9GA 5DHTA 2ZUSA 1NKTA 4CIDA 3Q7TA 3N8DA 1B73A 1L3IA 2HMVA 3HHEA 2CN1A 4GPIB 3RJZA 2QY9A 1E0KA 3U3DA 2V0GA 1NIJA 1Y8QA 4JJ6A 1TD1A 4Z9YA 4MWSA 3IR6A 2VHUA 4TMFA 2GXQA 2AHRA 2BFDA 3H75A 4RZQA 5CXSA 4EUEA 4P3XA 3ZDDA 1KKMA 3MAAC 4UEQA 1LX7A 4DCCA 2VUSA 4QUGA 1ZH4A 1OWPA 3B2NA 1QOZA 2D0PB 2P65A 1F38A 1OLXA 2YV3A 5LC1A 5I7WA 1C0PA 1ZGZA 3JAWB 3L0SA 1AS3A 2J3QA 2PQ0A 3L0YA 4G6ZA 4JJFA 3BFXA 3AM4A 4HLNA 2VNSA 1KTIA 1Y98A 2JJYA 3NI2A 1DIOB 2QPLA 2E55A 1PKEA 2JGLA 5F33A 4D74A 3SX4A 4AMYA 1GUAA 1M67A 5LYYA 1Z45A 2RHMA 3F3MA 2GFHA 1YJBA 2IOFK 5JWHA 1E92A 1NHWA 4L22A 4C7MA 1XPJA 1FFHA 2GHRA 3BWXA 3BMQA 3GUCA 3WHIA 1VG1A 3IDOA 2GZ1A 2X5JO 4J0GA 4Q02A 5F3RA 3ZCVA 2PGXA 5JOQA 1P44A 2BFBA 2C97A 2VUIB 4KR6A 1E3TA 2XXBA 3HY4A 4OXRA 1AX9A 2HKIA 2C5EA 1THTA 1E4OA 2GOYA 4YJHA 4A0HA 4K6CA 1Q50A 4G1MB 3V32A 4ZOAA 1JAYA 2PMEA 2D7CA 3SR3A 1IJEA 4ZOLA 4Z7NB 4MMYB 2NXNA 3MTQA 1YULA 4HGOA 4BLQA 5JCOA 2ZI4A 2XHEA 1TJ3A 4GM0A 3VHXA 2WMNB 3FYUA 3LT5A 1NMZA 3UT0A 1E3IA 2REOA 4MPDA 2AW3A 5TMDA 1JLRA 2ZYIA 4Q66C 1XJ0A 4QU8A 2ATXA 3RYHB 3NAQA 4X1IB 5FL3A 1KQGA 3PTZA 3HP7A 1STOA 3KPYA 1KOGA 1XAIA 4QUDA 1OQAA 2FJUA 2BEWB 1PX2A 3HB1A 4JEHA 3ZWPA 4UTOA 121PA 2XGSA 4YAOA 3O90A 1OASA 1FRNA 2QTGA 1DG9A 3B48A 3C6ZA 4NV0A 1DE0A 5DH9A 3DEJA 5EIEA 2ZS7A 1KKLA 3H17A 3L4JA 4PHHA 2ZVJA 1MQ9A 3DYVA 4GMDA 5IHPA 3IAXA 2QP4A 2JLZA 1BHQ1 2G4LA 3CFYA 3L01A 4BMYA 5CXXA 2MSEB 2EP7A 2RB4A 3LCMA 2H7VA 2PDAA 1E7SA 2OWEA 3Q9UA 3QI7A 1N36B 1JT9A 3FNIA 3OE7D 4JI1B 4ITRC 2FEXA 4MWBA 3MJCA 4LC9A 4MS3B 3W6NA 4ZI7F 1Q3HA 4ITUA 3PP8A 4MW7A 4P3YA 5EIWA 3MUFA 3IJPA 5F1YA 1N3IA 1NVEA 2G4CA 1T0UA 1XP8A 2J0UB 2CDRA 3CH7A 1Q0TA 5AQEA 1BHO1 1KI4A 3AJ8A 4WKCA 4I4TF 1Z8NA 1GTMA 2NXJA 1JB1A 1RPJA 2JLWA 2GYYA 4TTQA 3EAGA 1G8HA 1ZEJA 1ZRHA 1CCWA 1S8AA 2R2AA 3CZAA 4PWZA 1KK0A 1Q1ZA 1PW5A 3D59A 5FUBA 1DWUA 1I2DA 2P0YA 1O08A 2JHGA 1WOYA 5IWAB 4P7KA 3HCNA 3LOPA 2QIOA 2YS6A 3I0MA 4JGBA 3GVPA 3O8QB 3FM9A 4WA8A 1E6WA 1PFVA 2GZHA 4HXYA 2NXCA 1VMKA 3PNSA 3D6UA 4PQEA 4RMNA 2EHJA 5ALOA 2Y1CA 2V6BA 1PJLA 4XAQA 1E2BA 1RHUA 2AMJA 1L5SA 2NU8A 3OP1A 2PIDA 3IQWA 2ENWA 2H8GA 1E4EB 1DTWB 3LG2A 4BP8A 3A3YA 3AP2A 3X1YA 1UC9A 4RPGA 2QVLA 3QITA 1UOPA 2NZ2A 4ZO7A 1Z15A 4B2LA 3E0QA 1DAPA 2DUMA 2X41A 4D3FA 3TXAA 3R3WA 4UJ3A 4MRSA 1V43A 3UVEA 5JNLA 3CVWA 4AY6A 1K6IA 2PT5A 1OV4A 3OQOA 2CSXA 1R4AA 4TYMA 5MHTA 4F84A 2PZEA 3G2QA 4ALNA 2UUOA 2RBEA 1OLUA 3IA7A 4OEHA 4PPYA 5DP1A 2DPXA 1Z16A 3RRYA 3F96A 1AKTA 1KH3A 2B35A 3T7TA 3H1GA 3JQGA 1ORWA 2LPMA 4YRQA 3SFZA 4JC0A 3FLMA 2SHKA 4IIBA 1W96A 3MWGA 3TEFA 2VAMA 3RC1A 3Q0EA 4J0FA 3ZU3A 2PQ6A 5JAMA 1UMBB 1T5DX 2R8EA 4M76B 5HUQA 1AGNA 1OLSA 5DM70 2VQDA 1LKZA 2B25A 1JWLA 1XLWA 5H16A 4FJ2A 4CIYA 1JLLB 1H4SA 3CW2A 3IBYA 4HLCA 4ON9A 4FNOA 4FPXA 3WLEA 4MHSA 3IEKA 3QG1A 3TM4A 1YACA 3ZN2A 5LXTB 3LHIA 4G5SA 4OMDA 4KR0A 3MJSA 2RHBA 3KLMX 3PPWA 2FEPA 1E3SA 3Q3CA 3W06A 3BFKA 3LP5A 5B6JA 3L0IB 4M1TA 3B3JA 4JNKA 1KK2A 5TNXA 2BKVA 5IYZA 1Z4LA 1AHNA 5FTMA 2BSQA 4FFNA 3HJCA 5C9ZA 3L1UA 3QK7A 4HDQB 5DLPA 3TZLA 3MTBA 1EFCA 1T9ZA 3Q6MA 5H83A 3V2IA 1Y89A 3ZD9A 4HWRA 5FV7A 4BJ1A 1U81A 3VKFA 1XD2B 3NAMA 2J3KA 1UIMA 1NZFA 3QEKA 3TXXA 5EQTA 1C1XB 4RM2A 2KBFA 2C5SA 1V16A 1DEOA 2C4NA 3I01A 4CKWB 3OTOB 2H17A 4DILA 3EIFA 5IXJA 5L3ZA 2DULA 3KU4A 4LOHA 3WDSA 2WJ6A 3PD1A 3OBBA 4W6QA 1KSHA 3PNOA 1XQYA 2HD4A 3E9YA 3LF1A 1JMVA 4H3HB 3W04A 4CI9A 4TSFA 3D3KA 2IPNA 3OLZA 3Q2IA 1N0WA 1G8JA 2D13A 4GI5A 1OLOA 2DGDA 1M66A 2ORED 3MWDA 2P8SA 4DPLA 4E09A 4CQMD 1P1IA 2HPZA 4RVOA 2B6NA 1LUAA 5EVJA 3UQZA 3KUKA 1M3SA 2HCFA 2O1SA 3LH5A 4O3MA 1EB8A 4R8VA 1OVMA 1XLTC 1BX1A 3F4LA 4IZ6A 4RY0A 1WDWB 3T4XA 2NZYA 3IUNA 1ZUWA 3QKWA 2GX6A 5ICEA 2AQHA 2A4KA 4U2CA 4DQ0A 2AL7A 4Q7QA 5KWVA 3NC1C 1H0KA 4R6WA 3VR2A 2GLXA 1ZX1A 2H1CA 3FWNA 1ZN8A 2YIVX 3HWX1 3I5MA 1W7AA 1L4FA 3HZHA 3NX4A 3MA0A 3OFND 3D4PA 3EH1A 1P5FA 4HGRA 2W2TA 4EKYA 2D5BA 4DNPA 5A3RA 1HFWA 2OCDA 1M73E 3EG9B 2QS9A 3H86A 1T9KA 1Y1KE 2MR5A 1YJ5A 4ID3A 4QQ8A 4UHDA 2P90A 3DO8A 2J1LA 4M8LA 5AM3A 3HCBA 1XX6A 2RCNA 5JD5A 4AIRA 3PFGA 1ORVA 2PKYX 3TUZC 5BMVA 1NNUA 5GV8A 1V41E 3ACDA 4NJEA 5JYCA 1RZ3A 4OBWA 1ZRMA 4ARBA 2JD0A 2HPAA 1NXOA 2GNAA 1WY5A 5EUBA 2YKGA 1L4UA 2EKZA 2OV8A 2O3RA 1GQQA 2PNFA 3ZLTA 3SCZA 1YQ9A 3MYYA 1VL5A 2FWPA 1Q0QA 1XZIA 1DJQA 3UTDA 4XQGA 1JVBA 1PV1A 1R9JA 3NRCA 4LCBA 3EPKA 2HLPA 2YIMA 2ZBGA 3D5EA 4RKQA 1XTUA 2FEMA 2I2CA 3QPAA 3FVWA 5KHLB 1WMBA 1FDOA 1Q83A 4QFDA 4DCUA 2P68A 1Z2CA 2WV9A 4MPRA 1XEAA 3H97A 4EY3A 1FRFS 3W5HA 1WDTA 1W8IA 4ZIRB 2Q3HA 5JT1A 1ORDA 1Y5MA 2F7SA 1TUBB 2LUOA 3BORA 5C80A 3A31A 4Y0AA 5FIUA 1LDGA 4ML3A 1J24A 1RAAA 3ZWXA 3SXJA 2Z9CA 3F4BA 1XMPA 3JQBC 3ZNQA 4J03A 4EDHA 2JCXA 2HK9A 3LT2A 4CUKA 1VLJA 4QDZA 1RLMA 3ZY4A 5JVDB 4JI3B 1PEDA 5HKOA 3JR7A 2KYRA 2PSEA 1G7RA 3TRIA 3SHVA 3KHKA 2GM3A 3H4MA 4BNYA 3CLHA 3K9FC 3GQBA 1EVZA 3RVOA 2R6JA 1ND5A 3CRNA 3IMFA 1PNRA 3CO0S 3VDXA 1C81A 3AOEA 3BRCA 2Y8EA 1BXZA 3IP5A 3NDPA 2ZUTA 1GPMA 2IX9A 4RD2A 1ST2A 3WY9A 1URPA 2ZIAA 4YMWA 2XCUA 4TMZA 1R3UA 5EJ2A 1E5VA 1J4AA 1P9NA 4YV1A 1N2BA 2C1ZA 4BVAA 3ZVMA 1PZXA 2QAJA 1JUDA 4I9GA 4FHGA 1CPYA 4BUZA 1LQ2A 1PJ2A 2KLBA 4KQFA 3OQJA 3WGHA 4ROSA 4Q0MA 2DVMA 2B20A 1SWVA 4HO1X 1U0TA 4GZ6A 3TDNA 4UNPA 2QD1A 3ZNOA 4XB6B 3TZHA 4PN7A 2WTBA 3P96A 4WZZA 3E5RA 1Y48E 5EZ5A 1RXIA 4DS3A 2BN4A 4PZDA 1H2WA 1K8QA 2MINA 1XVLA 4GC5A 4L27A 4LG1A 1SCNE 4QGGA 4MV4A 1Z17A 2HT1A 2C3UA 3GEDA 4IHJB 1UMCB 2B61A 4NOKA 5BVGA 2H16A 4WE3A 5G0WA 1I1OA 4R7GA 4Z9AA 4FGJA 4ZU1X 4KWIA 3VO2A 1A95A 5EXEA 4MOWA 2HMUA 2ZSEA 4MUNA 4U7DA 4XJSA 5EIHA 1PG5A 1VBKA 2G88A 3KAPA 4GE3A 2QR3A 1O5OA 5DASA 1H2FA 3EJWA 1ACLA 3H9CA 4RMGA 1N7HA 2EJTA 1G5IA 1A98A 3FX2A 4GLFA 4KLNA 3ZKAA 4BGDA 5C1BA 3E7WA 5E6UB 1ULTA 3W3AD 4ZRDA 3BMNA 3OZGA 3H5WA 3QTTA 3HCRA 5CFRA 3R20A 1TXGA 2NZ8A 4D6YA 3RHTA 2P2LA 3VAZA 2XE7A 1G291 1SIUA 1TTHA 1P2VA 4ENSA 4NHEA 4XDHA 3ET4A 5FBZA 4MGZR 1S3FA 4MVJG 2IODA 4I5IA 3ABOB 3KJFA 3TZKA 2RJ3A 1D04A 3AR3A 1Q77A 4ETNA 5H4GA 3WRXC 1V6AA 3KJEA 4KFSA 2NADA 4MIKA 3WFJA 3PGJA 5CNJA 4D56A 2IJGX 3AHIA 4MVJF 3PHLA 3PITA 4JLVA 3QEAZ 5KYGA 2XBMA 4K1LA 4AJIA 1MTOA 5J4YA 3L8GA 4QLAA 4KRFA 4H0FA 1SC9A 5KNBD 1QRUA 3CUTA 2HO5A 3DE6X 2PZKA 4DIMA 1F4VA 4MW4A 3HJFA 1NJ5A 1ZEMA 1V7CA 4HDCA 2QU8A 4JB8A 3PYLA 3RREA 2H4XA 1IHDA 3VU3A 1PUXA 1N0VC 1LNSA 4WGGA 3JQRA 3GP5A 4U39A 5BW5A 5MGNA 3TTSA 4FR5A 4WN9A 4H7EA 1ZN2A 5CD1A 3O6VA 4EI7A 1F7UA 1JA1A 1CR2A 3BGOS 3D2CA 5CNMA 1ZJWA 1KQFA 2WSLA 2XE8A 3GRUA 4L07A 2J07A 4O08A 3BJRA 1YU9A 3AI1A 3ONNA 1QQ7A 4TMKA 4DUZB 3TGWA 4HEJA 1RAFA 3V1KA 3ASYA 2OCKA 1DC6A 4PNPA 2G5PA 4YRLA 4P3KA 1INLA 3FHLA 3R09A 2ECPA 2V9CA 3JX9A 3WGMA 3G1UA 3BCUA 2REQA 1ZOIA 2PMWB 3D2AA 2BFFA 3GXBA 5KVQA 3TTYA 5FBHA 4EHHA 4F71A 4HNVA 2P79A 4YECA 5LJIA 4K9PA 2QE6A 5IVIA 1A8QA 4G8BA 3PC6A 3JZIA 4TYPA 1OA0A 3ZVKA 4KU4A 1GPUA 3H6HA 1P62B 1PSDA 2OBYA 2SBTA 4JELA 5LPNA 4N76A 4OX9Y 5DI3B 1SZJG 2XMDA 2E89A 3HJBA 1JDUA 3QU7A 2D5AA 3OO1A 4D3XA 2FN4A 3RYTC 4Y7DA 4DBLE 4CCYB 4UHCA 4LNUA 3SQWA 2DY0A 4MEJA 1QCYA 4AZ3B 1U0GA 4KCGA 1IVYA 3AEXA 4C3ZA 4CGYA 1O1YA 2QZJA 1S02A 4FCWA 1ONNA 2VT3A 2WE7A 3FWHA 1V7QA 2QI9F 3VH4A 1NVDA 1NUTA 4O1HA 1WKBA 2FK7A 3DBOB 1HT3A 4X60A 4FFWA 1K3FA 2FPMA 1OT5A 4N0QA 3KWLA 1DDOA 3M1LA 1XNGA 3OPYA 4N54A 5FPTA 3R5JA 5KOJA 3ICEA 1OI2A 2UVDA 4UEKA 1AO0A 4RPLA 2OY0A 3FSGD 2VPTA 1M0TA 2X3FA 3FCAA 4LXIA 2XI4A 4QHYA 3VSEA 2BTQA 3CEJA 1ODLA 3OHSX 2OYSA 4BN0A 1ZGAA 4GFDA 2HDWA 2YN4A 2JI8A 3EUFA 4BO4A 2IYYA 3D3QA 5U4QA 1U0RA 3VOAA 2ZR7A 4EGJA 3K71B 1MP0A 1JQ5A 1XKXA 2VHYA 3Q3EA 4E7OA 3EPPA 1ZRSA 4IWYA 3TRHA 1FB5A 5FULA 2NYAA 4ZV9A 1F6BA 2HRRA 2Q3MA 3GELA 1Z6AA 1XPOA 4C2BA 3PRHA 4MQFB 4C0QC 5AW3A 4N82A 1HZJA 1OROA 2O5VA 2NNLD 2QNIA 3DZHA 1SKYB 3VPHA 5HOEA 3DBLA 3IPXA 1K97A 3OZTA 3I34X 2UKDA 1PJAA 3B7GA 3FFAA 3NNSA 1CB0A 1L7NA 4PS1A 5GIPE 4CMEA 3HP1A 2JFGA 3VZQA 2H2HA 1N2GA 2H1FA 3OQIA 1L8QA 3SP1A 4F8YA 2WKSA 2IQIA 2ERYA 4BKRA 3TZ6A 1NDQA 2I4TA 4CKCA 2WPDD 3A1TA 1G55A 3M2TA 3NHLA 1YBFA 2IXFA 3G79A 5ESDA 2PRIA 2BFMA 5CIQA 1PGQA 3CV3A 4JJGA 2Y0PA 6NULA 4XW2A 1DRUA 4DUYB 3FRHA 4JBXA 3KJZA 3DOHA 1SKBA 5LDDC 3BS4A 3CR3C 4LSWA 2C8VA 4TMXA 4FYMA 4ZTZB 3BB1A 3W8FA 2LTAA 1W44A 1IBKB 4PRZA 3AINA 1LDYA 3OPNA 1NQUA 5JXWA 1JSRA 1REQB 3GDOA 1A4XA 2J5QA 3P52A 4QDXA 5IMBA 4BNHA 2PE5A 3A1WA 3AVWA 3ZHYA 3I5AA 4F3CA 4P1ZA 1L1QA 2DUNA 2OG2A 2PA0A 1Y7LA 2PZAA 1OSNA 1DU4A 3ADPA 1DNPA 3L8ZA 3LYAA 4PIPA 1IBLB 3LRTA 3WDMA 3DF9A 3C3KA 1ZOPA 2FPLA 1VPVA 3OCYA 1Q7RA 3PQCA 3TK1A 3S1LA 4LE0A 2XXAB 3BIXA 1YUBA 2IRWA 3IAM6 3NC4A 1YDMA 1RWNA 4N3BA 4GYKA 5WRFA 2IIQA 3UK1A 1PK9A 4C21A 1E2GA 1MX9A 4L1KA 1EK6A 5H70A 3NFYA 5IKEA 3SSMA 4LXQA 1IZYA 5EPUA 4ZMRA 4RPJA 4L0CA 1RLIA 1FX1A 1ZCAA 2VHZA 5AHKA 1XMOB 1ZM2A 1GQYA 4JR2A 1CJCA 1GR0A 4I9UA 4ONEA 2IYTA 1YDGA 1CIJA 2BGMA 2QJTA 3L93A 3HCFA 2R60A 4A2QA 1FS6A 3AIMA 1Z4QA 4C4PA 3O26A 3NV7A 3UWKA 4UMFA 1E3QA 5JR3A 2HIGA 4PLTA 4JIGA 2QMZA 3DC2A 5HS4A 4A9AA 1JGTA 3SF8B 2P27A 3Q1LA 4DDVA 1VZ2A 5FDFA 2G9VA 2HA2A 3N8NA 4GMKA 3E05A 3NCTA 3A4LA 3I05A 2HHJA 3VAYA 2ZLBA 1KYQA 3EGXA 3LUDA 3DKIA 4N5HX 5K99A 1ODSA 1I13A 1R6DA 4D3YA 4BXOB 2G63A 3BILA 1C7IA 1M1XB 1N0UA 5CCEA 2X0IA 1HY3A 2G5GX 1T8RA 2AOTA 3RVKA 5BNTA 4MS1B 5CEFA 1KJYA 4KGZA 2PSFA 1OJ7A 3F6BX 1CVLA 3DHNA 3TD6A 2P2SA 4HH0A 2CB9A 3IT1A 5AOAA 1A7UA 4HRYA 4R2JA 1KYXA 2ZTLA 2DERA 4RELA 1GN9A 1DEHA 4FNAA 4P4UA 2HZBA 3TX6A 2J5RA 3NPAA 2AMLA 4GSKA 3ZS9A 2BUBA 1OTXA 1RCFA 3B53X 4ZDIA 1IM8A 5EINA 1C0LA 4KDEA 5FJIA 2HA0A 4MRPA 3TLEA 4WZAB 3OEHD 3CYFA 4WNIA 3MLEA 4XYGA 3AM3A 5C51B 4C2TA 4N47A 1K7SN 4OSPA 3PG5A 2G17A 2CJWA 3K0AB 4R1NA 5CPFA 1X7DA 2R44A 3IH5A 2BW0A 3HFRA 3AY0A 3NONA 3RVNA 3L8DA 1XD8A 1Q7CA 2WQZA 3HYNA 4XWGA 4E30A 4M1MA 2O7RA 2PD3A 4BVGA 2L69A 1V5FA 3LPLA 4LZOA 3TL2A 1KYVA 2FFBA 3G82C 3QLVA 3LCVB 4JVOA 5GVRA 5AHRA 3V1MA 4K81B 3KKKA 1K8YB 5FLYA 2Z30A 5DDIP 5AK0A 1ZKMA 2OHJA 2BBWA 1MFPA 4AC9A 3LDHA 4YT8A 4AECA 1EE1A 2H57A 5H02A 1XHEA 3BD7A 3NBQA 4LXXA 4U7JA 4CT0A 4YRSA 3WB2A 4PIVA 2XXJA 4RAQA 4ND7A 2QRLA 4OYLA 4NCXA 4EHLA 1SWWA 1MJFA 3JASA 3UB2A 1J90A 4B0OA 1X1DA 3ITNA 3OX4A 3IMEA 4K9MA 1ZSYA 4FEGA 4EB6B 1ENYA 3AKCA 4P3NA 1VM6A 1JEJA 1S2DA 2FWAA 1D4OA 3KHTA 5IN4A 5CDUA 4ZCRA 1VFNA 1WBJB 3DM9B 3ZX4A 4IDGA 1A77A 5IT0A 4JI4B 3UK7A 2BCJQ 2WMOB 1RABA 2RAUA 5IUJC 4KFCA 1U28C 1GIAA 4Y2PA 3Q3JB 4HL6A 4Q3AA 4PM4A 1TKBA 1IWPB 1YFKA 3SJAA 4H7KA 3AEYA 4XLZA 5GJVC 1TIKA 3D6VA 4PSUA 5K8IA 3F71A 5HK8A 4CEHA 2R8BA 2WMYA 3IKVA 1W29A 4ME6A 4AJ1A 4LJRA 2QD5A 3SC6A 3RLIA 3T5GA 1FFBA 3DOEA 3DD5A 2QTFA 2ZQ5A 4KNWA 2FH5B 4B48A 1YSCA 4DZRA 4R8SA 3TVDA 3EODA 3TTWA 1QF7A 1UM9A 1NSFA 4UJ5A 1LZKA 2CC2A 1FE8A 1RXUA 5AR1A 3BXXA 1XTSA 2O59A 3PGVA 5KJCA 4Q93A 4OAQA 1LK0A 3LNTA 3WMGA 4F86A 3PEVA 3QVSA 1OB5A 2XQVA 2XWBF 5ERYA 3ZY3A 4AJKA 1CT9A 3KPJA 1ISMA 3FYCA 3PJGA 4YJGA 1QIDA 1W35A 4P82A 4DJDC 1O7JA 1XVVA 1OFGA 5DE3A 1GGKA 5AXDA 2Q6LA 2J3MA 5A02A 1TFUA 2J4DA 3O4IA 3WGUA 3F7TA 2BP7A 3SFVA 1R0RE 3VZBA 1T6XA 2JS7A 1B43A 1GVHA 3AIIA 3PD7A 3LKBA 4OM7A 4OU5A 4UQPA 4OHKA 3TLGB 3CLUD 4PBSA 4D9CA 4B6EA 5L3VA 4NEQA 1D9ZA 1GZ3A 3DPUA 2O1XA 3FF4A 2G04A 1ADCA 3AEQA 4J3JA 4MZDA 5TC4A 2G3YA 5F64A 5ALXA 1Y5RA 3IX7A 4GR4A 1VE9A 4IF4A 3N5KA 1GAXA 1V5WA 3JQBA 3QVVA 4II7A 4MW0A 3G2LA 1IG0A 2X6QA 1ULZA 2XWSA 3AJ9A 3I83A 4M1KA 5ADVA 5IN5A 1DKMA 2O50A 1E2KA 4I50A 1X42A 3R3HA 4NCAA 1G2QA 4MCHA 5AW8A 3RD5A 3DZCA 4LY6A 1QVAA 2C20A 3Q7IA 1E2MA 1C4WA 5C5IA 3B7PA 2HR1A 5JC1A 1ESDA 5BR4A 1NSTA 1U9YA 1W88A 1ZMTA 3RROA 4TM7A 3B3FA 3KJGA 2GF2A 3ORYA 5HCIA 2XGOA 1QYWA 1CP2A 1TOAA 2X42A 3G0OA 3VYUB 1J22A 4YUYA 5CBKA 2Q29A 3DB1A 3T7AA 2O2CA 3BBLA 3OJ0A 3UCXA 1E2PA 1U0HC 1JS1X 3LLUA 4KN6A 5D7NA 4D3ZA 2CLOB 2IF0A 2FWBA 3LRXA 1KSFX 4UNSA 2ZI7A 3ZS8A 5F9FA 1YJCA 4JX9A 3TUIC 4PPGA 2GJSA 1WDKA 4RLFA 3QBDA 4A6EA 1VBNA 3ZGZA 4CF5A 1TTTA 2VNAA 3W5JA 3L92A 1MEEA 2HIHA 5L6LB 2BF4A 2FSSA 4BMXA 3IMCA 1T2VA 1OFVA 3HA2A 1P7VA 3CNHA 5E7JA 3V1TC 1X94A 3DMDA 4EVQA 3THYB 1ZD3A 1XQ9A 2F1RA 1C3OA 1TKRA 2V8BA 3BF8A 4X3CA 1V1MA 2J7PA 4HQNA 4Z1MA 3SK0A 3D0KA 1AU9A 2JGRA 2DJ5A 2WUWE 3LO5A 3A27A 3KB8A 4UUOA 2J45A 2R8PA 5U4XA 4X1YA 1Z6PA 3MW8A 3OWXA 1D2HA 3SE0A 3LDUA 1YVRA 3VTZA 1HR0B 3WL6A 3ZWDA 1QH9A 1KEZA 2VZLA 4JLAA 4ZI7B 2WVAA 1UADA 5ILQA 1ZCFA 1GL6A 1YFJA 2RHHA 1XL0A 4BNKA 3P0EA 4GOJA 4JOBA 2X8LA 5TQVA 1H0SA 2NTYC 3TCKA 1NR1A 1V35A 4NWIA 2PQMA 3FTCA 4OKIA 3ANSA 4I4TB 4OU4A 2HPHA 2IUYA 4PO1A 3DV2A 3OZVA 1QWOA 2FPXA 4XYBA 1MPTA 1KEWA 2XTJA 3FLEA 1P0QA 1R4MA 5I9MA 4YRAA 4PZUA 5DVZA 2Q8QA 2VEOA 4ZZ3A 1WHTA 3NEAA 3RABA 4YI5A 4CZ2A 1CQZA 4ZJPA 2EG5A 3WRXA 1Y9JA 1PQPA 2VPIA 1ZI9A 4Q1VA 2QTAA 4HNGA 3UMVA 2EBHX 2TMKA 2G7MC 1YVPA 3LT0A 1YR1A 2FHSA 4V0NA 1DUIA 4WUVA 5C34B 3EAQA 1MW9X 1YH3A 4NJMA 3EZXA 1DC4A 5L45A 3K70B 1KS9A 1X9GA 4OSEA 3VUEA 1QIKA 1ZUNA 2XNKA 2Q3EA 2QXUA 3CRRA 1W36C 4KFTA 3HXLA 4Y9DA 1JILA 5JLJA 3Q3IA 1K2VN 1WMFA 2PLWA 4CI0B 5K6TA 1W5TA 1J2UA 2PD4A 4HDKB 1IOZA 2DKNA 5FYQA 2C9OA 4ZOLF 3GGJA 1A9YA 5CB8A 5M04A 5IDQA 3LQQA 4K6HA 2CGEA 4MQEB 3WKCA 1Z18A 2V59A 1UQRA 3ZWWA 1RXWA 3AYXB 1A9PA 3GLHA 4FK8A 5AXBA 3ERCA 1VKJA 1MDFA 3JYPA 2WU3A 1CRLA 3MN1A 4PYOA 1T4CA 4J9UE 2H1OA 2C8KA 2IXGA 3LBHA 4LTNA 4NLLA 3NVDA 1WNTA 3U48A 2BY4A 1SCQA 4MMXB 4OQDA 5K3FB 4FEYA 5LA6A 4AJ2A 2PANA 3EEBA 3H04A 4EGCB 1XCGB 3HFGA 4L5YA 4N0DA 2IV7A 2VZ8A 2UXCB 2ZI9A 4PYQA 3BSYA 4M7RA 2VZ0A 3B7WA 1SXJD 4ZQCB 1HTBA 4G8CA 4RK0A 1Z33A 5JTTA 3PRKE 2UUCB 1W25A 1ZD9A 3ITKA 3U9TA 3Q98A 5FPHA 1R12A 3CC8A 1JDZA 1H6BA 4W5OA 2FE4A 1T2CA 1WCV1 1OFHA 4RJ2A 2A3RA 2WUDA 2VJCA 3W8RA 2GERA 3PJFA 1DO8A 4QDTA 2GARA 1SZPA 1KC1A 2FZ4A 2WRZA 2BKAA 2G0AA 1DKQA 2ZSHA 4M1WA 1U2GC 5THKA 5BWLA 1Z7BA 4AZWA 2X0NA 3PFKA 2BMWA 1Z3IX 5G0UA 5HZKA 3LS2A 1TK3A 4RDCA 5H82A 4NPHA 4DCTA 4UCQA 3TMAA 5C8ZA 2AQKA 1Y4DE 4YRJA 1C30B 2CHEA 1LDEA 1R0ZA 1FMCA 4HXGA 4NBNA 3SG0A 4F3NA 1KMHA 1ZITA 4M21A 3WISA 4MB0A 1P1KA 4RF3A 2YDXA 3UGKA 1OCEA 1QXSA 2YXLA 1P4HA 4MGKR 3OD5A 1RYNA 3BBPA 4JXKA 5P8WA 5I47A 3NO4A 3EISA 4JR0A 3BKXA 5CBPB 3O83A 2QQ5A 6REQA 1ZJJA 3NBFA 4WXRA 1NZDA 1N5MA 2E3JA 2VDWA 1HLGA 3NWBA 4GXNA 4KSBA 4Q3OA 2QJFA 4WY2A 1HH4A 4Q3KA 2JK0A 3VSAA 2R00C 1EBUA 4HLDA 3E9MA 3V7YA 2SCUA 5L3QB 2EXXA 2G70A 4LZLA 4R7ZA 3V8MA 3B85A 2AHOA 4Z4QA 2ZJ0A 3AB8A 3HL4A 2Q41A 4NYMR 3F5MA 2DEUA 3DPIA 2NP6A 4EPYA 1T5OA 1H6DA 2ZRKA 3UT5B 5ARBA 2P4UA 2COKA 3B1XA 5FADA 2UZ1A 2IPAB 3SLGA 1TMGE 1M6YA 3L6OO 2WMDA 2V7PA 4XDGA 1VSTA 3SM9A 4EABA 1BIFA 1NY5A 1X7XA 2C8LA 2AJLI 3C6XA 3G3EA 3L07A 1D2NA 3FFWA 2CZGA 1QWSA 2L2QA 2P7IA 4RVHA 1GD1O 5B3JC 2EL7A 2PXHA 2B94A 3H5RA 2D1SA 5BOSB 3JAMA 4NY1A 1GAEO 2GESA 1JHRA 2VNJA 3DEHA 1WXGA 3GJ5A 5CVJA 3KEQA 5JXJA 4WBNA 2YZ2A 5J63A 1F60A 3WWYA 3E5MA 3U4HA 2OC4A 1RI4A 4BCDA 2XITA 5JAUA 2SICE 2VI5A 2AD5A 4XX0B 1M8GA 4F2WA 1EUDB 4HMPA 4AS1A 3VR0A 4REQB 2F48A 4HK4A 4U2EA 3LX6A 2DBVO 1AQLA 1HDXA 1UODA 3FDIA 3D3EA 4XYLA 3BA6A 2VP9A 3I39X 4OGKA 4P33A 4INJA 1KGDA 2FFQA 1HLDA 2QMOA 1NPDA 3JQEA 2WVGA 3IYLW 3O84A 2WTAA 1JAZA 4EJSB 5JNWA 4DSUA 1JXQA 1SCUA 5ALHA 4XWWA 5IYZF 2RHDA 4WZBA 3TMKA 1YS9A 3JVVA 1QH8B 3B8HA 5DTRA 5E2AA 5IAJA 3NDBB 3DXZA 3CNOA 1EP3B 1NP3A 2DZDA 4DA6A 2R1VA 5CLQA 4JAVC 3OMWA 1P6XA 4P36A 3GVXA 5F1KA 2N0SA 4E11A 5EIXA 3A06A 3RAGA 3FJ1A 2O0KA 5HQTA 1IJKA 2IUUA 2BTOA 1QIJA 2Z3ZA 1PIWA 2FZCA 5JFTA 1TFRA 1TU0A 2XX3A 4V0SA 5IJWA 4KN8A 2ZAMA 1QGZA 1KAEA 1M2OA 1JMKC 1N3LA 2OHHA 3MJ4A 5LR6A