3IAEA

Structure of benzaldehyde lyase a28s mutant with benzoylphosphonate
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
554
structure length
554
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGSHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Benzaldehyde lyase
publication title Active-site engineering of benzaldehyde lyase shows that a point mutation can confer both new reactivity and susceptibility to mechanism-based inhibition.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 178
structure length 554
sequence length 554
chains with identical sequence B
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iaeA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iaeA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3iaeA02
2AG0A 2EZTA 1YI0A 2BFBB 4MPRA 3M6LA 5ERYA 3ZGVA 2Q29A 2UZ1B 3U3DA 5I5GA 2BEVB 2VK1A 2H2DA 1YD7A 3EXHA 4IF6A 3KOMA 1HZZC 1S5PA 4BVEA 4JU9A 1YBHA 5MGNA 4K9OA 1WCIB 3ZHRA 2FSVC 4UU7A 1OZGA 3AHIA 4QELA 1OLSB 1M2KA 5D7NA 3PKJA 1OZHA 4G1CA 4BV3A 2BFCA 4TWIA 1QS0A 1NI4B 3FZNA 2JLAA 1U5BA 4D5EA 1UMBB 1X7YA 1O96B 1XLTC 1X7WA 2JIBA 1YHZA 2FRDC 3ZHQA 5ERXA 3LQ4A 1EFVA 1YNOA 2X7JA 1M2JA 1W85A 3ZHTA 2H4HA 4QQ8A 3EYAA 1V16A 3GLUA 4JT8A 4BN5A 5EJ9A 4R8MA 1NM5C 4UUBA 3DVAB 2UZAA 4J16C 3LQ1A 3DUFB 4BVBA 4GM0A 1V5GA 1POWA 3D4BA 3ZG6A 2FN3A 1DTWB 4O8ZA 2YIDA 3EXG1 3GLTA 4ZP1A 4UTZA 4I5IA 2JGDB 4RJKA 3DV0A 2H4JA 3EXEB 5IMSA 1U2GC 1E3TA 3HWX1 2C3PA 4JUCA 2EZ4A 2O1SA 3AHHA 1TKCA 4MQ5A 2FWNA 3FSJX 1UMCB 2AG1A 4Y6LA 2BP7B 4C78A 1OVMA 1V1RA 2VBIA 3EXFB 1NGSA 2BEWB 4UUAA 4GPEA 5I51A 4X3PA 2BFEA 5C4IA 2BFDB 2IHVA 4D5GA 2H4FA 4JUFA 4KXQA 3MOSA 1W88A 2WVAA 2NXWA 4MZXA 2J9FB 1X80A 1TKAA 1UPCA 4JUDX 5EJ7A 1T9BA 3RIGA 3EY9A 1R9JA 1V1MB 5HHTA 2BFBA 4RMJA 4MPJA 2DJIA 1YC2A 2VK4A 4QPZA 4Q9DA 2IHTA 2UZ1A 2Q28A 1X7XB 3F6BX 4F56A 2OZLB 2BEVA 4KXVA 1PVDA 5AHKA 4L3OA 5MF6A 1M2NA 5FEMA 2YICA 2OD2A 2E6KA 2QQFA 2BFFB 2V3WA 1Y9DA 1U2DC 1ITZA 5EJ6A 1V11B 3GLRA 1WCIA 2R8OA 2H2HA 1T9CA 1OLSA 2VK8A 2BRUC 2Q5JA 2FR8C 3CLSD 1ZPDA 4RMHA 4V1CB 1PI3A 2B4YA 2QTCA 4Y6OA 1DJLA 1NI4A 2H2GA 2QQGA 1RP7A 4K9PA 4RMGA 1UPAA 2Q5QA 3PDHA 1YC5A 3CLUD 1OLXB 4KXUA 1V5FA 3UPTA 4WBXC 4ZZIA 2G28A 2G67A 4UTNA 2JLCA 5BWLA 1AY0A 2PGOA 2JI9A 3F6EX 4RJJA 1UM9B 1JSCA 2OD7A 2A1TR 2IEAA 3DVAA 1M2GA 1POXA 3K35A 1OLUB 4C7VA 4V1CI 4KPUA 3AHFA 3DUFA 2BEUB 4UTXA 2Q27A 1B0PA 3UK1A 4UTRA 4RJIA 1U5BB 4FVTA 5HYVA 3OE1A 5BWNA 1L8AA 3ZHSA 4KXYA 2JGDA 4JSRA 3EXEA 4F4UA 4JUAA 1J8FA 1UMDB 4GP9A 4TWJA 4FEGA 2C31A 1KEKA 4J1TC 1YHYA 1UMCA 1Z8NA 2EZUA 3D81A 2BP7A 2BEWA 3ZHUA 2C42A 5EJ5A 2EZ9A 3JWPA 3AHEA 1Q17A 4IAOA 3AHCA 4BVHA 2WVHA 4C7XA 3EXHC 5EJ4A 3CLTD 5DGDA 1YI1A 1TKBA 2J9FA 2VBGA 2OO5C 1X7ZB 5HJEA 3EXIB 2JI6A 2Q5LA 2OD9A 5EXDA 1V1MA 3LPLA 2JI7A 4X3OA 5EJAA 1Q1AA 2VJYA 1PNQA 1X7XA 3U31A 1MCZA 4HD8A 1U28C 2OZLA 3RIYA 1PTJC 3M49A 1UPBA 2C3OA 1OZFA 2C3UA 1MA3A 4GM4A 2BFFA 1PYDA 4BV2A 4JUBA 1T9DA 1W88B 2IHUA 1V11A 2R5NA 5K6RA 4BVFA 1IK6A 5BWOA 2EZ8A 1PNOA 4C7BA 3CLRD 3HYLA 4V1CA 1SZDA 2A1UA 2W93A 3ZGOA 2C3YA 3CF4G 3HWWA 3M7IA 2R8PA 4BN4A 3EXHB 2XTAA 4RMIA 1OLXA 1UMBA 2H2FA 5I4IA 4KXWA 2NYRA 2PANA 4JT9A 2O1XA 1Q14A 5EJMA 2Q5OA 4BVGA 5K6TA 3GLSA 1UM9A 1U31A 2WVGA 5DEIA 3D7KA 3IAFA 4MPPA 4K9QA 3IAEA 1OLUA 2BEUA 2HJHA 3OOYA 3RIMA 2BFCB 1QS0B 4JD5A 1O97D 3EA4A 1ICIA 4K9LA 1X7YB 4K9MA 1X7WB 1DTWA 5I5EA 3AHGA 2Y0PA 3JR3A 2XT6A 1UMDA 1W85B 4GM1A 1EFPA 3LQ2A 1V16B 1QGDA 4KXXA 3M34A 5HGXA 1BFDA 2XT9A 4JU8A 5K3SA 4FZ3A 3EXFA 1GPUA 3E9YA 4FEEA 4BUZA 5MFZA 5ESDA 4K9NA 1S7GA 2BFDA 4UU8A 4UTVA 5EXEA 5EJ8A 5K2OA 3DV0B 3FLMA 2C3MA 1X7ZA 2JI8A 3EXIA 2OORC 1Q6ZA 4GG1A 5FYQA 1V5EA 1N0HA 2PDAA 1D4OA 3ZHVA 3L84A 1PO7A 2H2IA 1YTLA 1SZCA 4KGDA 2H59A 1V1RB 1T9AA 1QPBA 2PGNA 4K9KA 4XEUA 4L2IA 3PKIA 2BFEB 2G25A 2VBFA 3AI7A 1PT9A 4IG9A 4Y6QA 3AHDA 3EXG2 3AHJA 1M2HA 4COKA 1X80B 5DGTA 5MFPA 1TRKA 2QTAA 4HDAA
chains in the Genus database with same CATH superfamily
5F9MA 3SJBA 1PLJA 3PP8A 3WGVA 3FPSA 3UMVA 2OLJA 3JRXA 3I09A 3RSHA 3ZX5A 1OBCA 3PNMA 2X8LA 1PYGA 2AA3A 3KZXA 1B6GA 4FT4A 2GPNA 3WLFA 1KAMA 3FD8A 1FQWA 1YKFA 2HCTA 5T6BA 4OAOA 1KHHA 3GZNA 3NEPX 1H9CA 3MS7A 4C0HA 8GPBA 2O48X 1LS6A 1SB8A 1TVKA 4RUKA 1NUAA 3ETLA 4KN5A 4MB6A 4Y1RA 1EFRD 3C3MA 3PFCA 4HNAA 3P7MA 2V6FA 2QTVB 3W5IA 3PNSA 5KJFA 5JOQA 2AEMA 3W5CA 2P2DA 1N2OA 2HO4A 4S1OA 5THQA 3TLEA 1G19A 2ZTLA 4ZT3A 4QELA 2GZAA 1U1GA 2QD1A 1JDVA 2YNMA 1Q3HA 3U48A 2P9CA 3H2GA 5TQVA 4P7KA 1FYXA 4PPGA 3KAKA 4R05A 2WE8A 5BP7A 4I3FA 1QR2A 2HDNB 4S2EA 2FCRA 1S2IA 2DVMA 2EGUA 4QOGA 1R0RE 4RNCA 5IUNC 1NJ8A 2WKWA 3ME5A 9GPBA 3TGPA 2LR0A 4G84A 5AIAA 3P9KA 1ZNQO 2ACKA 3OIFA 3C14C 2XCIA 5FPPA 5IAEA 1HEIA 2WQ7A 5JATA 4D8VA 1F06A 1QAOA 3PRHA 4S1VA 1KIFA 1OFTA 2HA2A 2OV4A 3F5SA 3Q3HA 1JAHA 3M4NA 2C4NA 3CZAA 6ADHA 1E7QA 3DF7A 3CUTA 3OM8A 5CVCA 1G17A 3D1LA 1QRAA 3N5KA 4YGYA 3GRFA 1E6WA 2XEXA 4MARA 1EK6A 4RHYA 4BQNA 1MQ9A 1ULTA 2XUHA 3A3OA 4IWXA 1VMEA 5A9RA 1D4AA 3WB2A 1SVMA 2DKOA 2YC2C 3L18A 4LFCB 3UJNA 2GZSA 4GXNA 2ZU0C 3ZUPA 4PIVA 1D8TA 1P2BA 2I76A 2DWPA 2H1VA 1MO3A 4LHEA 3OAAD 1TYAE 2FFAA 3DVAB 4MKZA 4ECAA 2HWYA 4AXBA 4ENWA 2EX4A 2OXEA 2W83A 1CFZA 5LMZA 1HZZA 3BD6A 3ISJA 4DJEC 4OJYA 3AEUA 1HMYA 4UHBA 1JR3E 1VRWA 2SKDA 4INZA 2RHDA 4EYQA 2IK8A 3EIEA 5DLDA 5E4YA 3GEBA 2P91A 3PXCX 4YYEA 1CF9A 5CA0B 2ZI7A 4PZZA 5A9SB 4NJOA 3LPDA 1N3BA 2K4MA 1JU9A 4MYRA 3HBFA 3NDBB 1E3IA 3KFVA 1K92A 1LV7A 4LZNA 1EVQA 5KVQA 4UEOA 4RVCA 2AEJA 1O87A 2GA8A 1WW3A 2FWAA 3KB2A 3RVOA 4P7GA 1FB5A 1NFFA 4PRKA 4B33A 3BWDD 4DDTA 3FTNA 1PSZA 1UBLS 2C3PA 1QHGA 2VF2A 2G4CA 1Q3KA 2PZBA 1VPWA 2Q1UA 4R7ZA 1G60A 3FBGA 3TR5A 2FI1A 2O1SA 2B8TA 1ZNXA 1N3LA 4HH3C 1EPUA 2GFQA 1TGVA 1FDOA 3TLZA 5BVHB 2NNWB 3ORYA 3G02A 3T3OA 3TI9A 4ZV7A 4LVCA 3UHOA 1A5BB 2IOHA 4C7JA 4A5SA 4Q4HA 2D7JA 4X1IA 1RPNA 4LF9B 4ZVMA 5ESRA 4G89A 4IJMA 2BF7A 4M1QA 2NUBA 4N54A 1DQRA 1K8ZB 4OUDA 3FOWA 4Q4AA 4X61A 4WA7A 3WY9A 4KPYA 5GZ6A 2ZYAA 4LX0A 2ZOSA 4GT1A 3GLIB 4GRAA 3JASB 1L7AA 2LDBA 4MVJD 3KT6A 1REQB 1RABA 4N0EA 2AOXA 2WJ4A 5SYAA 2NXWA 1V3TA 1EBBA 1FQKA 1ZONA 3EG9A 2XECA 2PKRA 2XWQA 3VR4H 2VPYA 4Y2XA 3EPKA 1NNEA 1AKUA 4Y9TA 5IULC 3RIGA 2VDWA 2E0IA 5ELXA 1BD4A 3SEZA 2H6EA 4UASA 1FP1D 3LX8A 1NW3A 2GXAA 3J7AC 3W5AA 3VV2A 3PQ5A 4OKNA 5T41A 4PZAA 5KIAA 5LMUB 2J9YB 2NZ8A 5G4KB 3EX7C 1QU2A 4DLSA 5HFJA 2QR2A 3Q7SA 3A3KA 4BKOA 5D51S 2UZ1A 4NEQA 1X7XB 1CJVC 3WICA 2GNAA 2Q3MA 4WACA 1SO8A 1G3UA 4U63A 1HF3A 2GFIA 3RIEA 2J5XA 1P80A 1U0FA 3FH0A 3AFGA 4BOYA 5JMTA 1Z68A 3EFBA 1V45E 2DZDA 2ZTVA 3H18A 3ULKA 1UJ4A 3EODA 4H1TA 4A7PA 3MOIA 4B80A 1FNCA 3UOWA 3IS3A 2DHQA 2BFFB 4FMPA 1P0CA 3PBKA 4QYIA 3TFOA 2ZATA 2XMPA 1VJTA 1HG1A 4JR1A 2A4KA 4OBWA 2C5HA 4QM6A 2VDLB 2OC4A 3OFJA 3BILA 4I50A 3KJFA 3UANA 1KEUA 4LTNA 3FOFC 3SP1A 1C3LA 4JI2B 4OA8A 4OX9Y 4UVGA 1G2PA 1Z7EA 2B0CA 2I7XA 5CFNA 2QN8A 3RS2A 1JTEA 1IPEA 3NH9A 1DQPA 2BRUC 3JZMA 3I5UA 3JQ8A 4WY5A 2IY8A 4M76B 3RC8A 2QWXA 1KO1A 1ORTA 4ISBA 4KE8A 3RS5A 4ZEVA 1E18A 3QUSA 4QLBA 4EB6B 3T5CA 3RF6A 4QBIA 4P36A 3AF3A 5H4HA 4M0DA 4RQAA 4NBWA 3KLNA 5F64A 4EEZA 4LZJA 2IXFA 3NU1A 1U0LA 4JP5A 2WD7A 1E4VA 2FCAA 9LDTA 5LSAA 1CD5A 2PMWB 4AX8A 4B4OA 5LD2C 3QOXA 3AY0A 3DO8A 1AN9A 2ZJ3A 4G5SA 5D2CA 5FQOA 2V7PA 2CUNA 3E05A 4ZOEA 3SJZA 1IXYA 4G9BA 4LE0A 4CL8A 2ZE6A 1ZCBA 4YAKA 4KBGA 2BMVA 2IZZA 3F6EX 3ZHYA 2ZCVA 4QLAA 4J8PA 3LIPA 3M70A 3OP1A 4UNIA 3E1KA 1DEHA 5AHRA 3WV4A 1NVWQ 1GQSA 1JNXX 1M2GA 2A58A 4PQYA 3UNXA 5CVVA 5TE9A 3RADC 3KEGA 3S1AB 4ZTZB 2JGEA 3VKHA 3U3RA 5EPEA 1XNQB 2OXRA 2X1LA 4GH5A 3N28A 3QE4A 2XBLA 3JATA 4HNSA 2IUYA 2O5RA 2Z1DA 4IHAA 4NL4H 3OLCX 4DM7A 2DP4E 5FV4A 1SCUB 2Q3BA 4KGZA 4HO1X 5L4SA 4HI0E 1W35A 4P86A 5HYVA 3JQ9C 2CHQA 4Q1AA 1CQIB 3SHTA 3AM1A 1KDOA 3TXXA 1PT8A 1R88A 2VXBA 4MDYA 5KJEA 1LWOA 5BN3B 1Z7WA 3UV3A 3C39A 4NPCA 3KU4A 1NVGA 3IELA 4FDUA 5CRIA 3K4PA 4JUAA 4OFXA 3RS8A 2CXTA 5FLXA 4KODA 4DLVA 3HM2A 3HSSA 4TTVA 4EVQA 5KTKA 1RAGA 2R3SA 2ZRJA 3X2FA 3I83A 3OSZA 3JD2A 1XZIA 1B8OA 2WU1A 3MD9A 3PDIB 2QLLA 3TSAA 1WV1A 3KWLA 4RPJA 1F51E 3BIFA 3KFLA 3VOSA 3KD3A 1J0EA 2P41A 4CUZA 2CSUA 2NUTB 4PYQA 1RZRA 1YRHA 1PFWA 5CCDA 2BEWA 1W1IA 2JHPA 2VPXA 1M10A 4RSHA 3TXAA 3UUEA 3DEHA 4ED9A 5EJ5A 3A04A 3BS4A 4HWSA 1ELOA 5FOQA 3AHEA 3PQ8A 1QJ4A 2YQ5A 3KKLA 1H4TA 2PJRA 3CEAA 1WO8A 3AEKB 2C96A 4I3GA 2D7DA 3QZUA 1GXSA 4PF1A 3WLIA 4BVHA 1RYEA 3OF3A 5A2QA 1XZNA 1Z25A 5CDYA 3ZEAA 1LK5A 4JBXA 4B6QA 3RTDA 1SQ6A 5LXTA 4CMEA 3TUJC 5TGTA 1XCPA 5DISB 5A6SB 5IK2D 1IBCA 1TTQB 1R27A 1YO6A 1DCTA 2BMJA 1AKQA 2WHYA 1J2TA 5T6MA 2AXEA 4EG5A 2QN3A 1Z5WA 1MVNA 4KTTE 2C7GA 2CNOA 2WWHA 5C4GB 5J5AA 2GMWA 1C4WA 4J0IA 1ADJA 2RKBA 4WXMA 2J4CA 4BE7B 1PHRA 1SZJG 3U6KA 3BQNB 4HKTA 3E5HA 3OX1A 3GLHA 3DAFA 3E35A 3CEMA 2FFBA 4ZHSA 4JBNA 1XZCA 1FFGA 2B1GA 2BGRA 3DBHB 3NAGA 3LMKA 3R1IA 2J6IA 5BQFA 2ZIVB 4YALA 4BHTA 5FWNA 1TIPA 4M9CA 5FBWB 1E2UA 4GC9A 4MP3A 3RYIB 2F4VB 1QZUA 1GFZA 2AIRA 3GB9A 2CXRA 1G59A 3LCJA 2NV0A 3OCCA 5C37A 4UE6A 4U2KA 6REQB 5CT4A 3ST7A 2YFQA 1GGFA 4J9UE 4HX9A 4XWGA 3VU3A 2GZ3A 4JI1B 1ABFA 4GI7A 1QTIA 2A9JA 4N3GA 4OMDA 5KQSA 3HPQA 3V7NA 4UHHA 2BI7A 3X1YA 3KLPX 1FNDA 1BHJA 5IP5A 1OREA 2XTZA 3HEAA 4MHSA 3WRXC 3JW8A 2O7NA 3FTCA 3DD1A 5EZ6B 3BD8A 1BQEA 1SXJB 3UMMA 4R1PA 3RVKA 1P5RA 3FN4A 3DLTA 3G8BA 3V48A 4WWHA 4XIIA 3GGGA 1F6DA 3VH4A 4BFCA 1GPH1 3BGOS 1I01A 3PQ6A 5JVDA 4XAQA 5L7TA 4R2HA 1LNZA 3SJCA 3WIDA 2HN9A 4HADA 4B3XA 2QN2A 1WM1A 5I45A 1M75A 1QKKA 2A35A 1G8SA 2CMGA 2R25B 3K9LA 5EXSA 4YXWA 3MT8A 3ROFA 4ZV4A 5KWVA 4RY8A 1VP9A 2G1KA 4ZO7A 3PQEA 3LC1O 5EPOA 3S40A 4L9WA 1Y6ZA 2NU7B 5HFNA 1A9XA 2C5LA 2PA3A 2Q2NA 4QUEA 3EC1A 2FW0A 3EWSA 3OP4A 3GA0A 2JGIA 2O3TA 4RYLA 3DZ8A 3EIQA 2IU3A 3LT0A 5H81A 4Q3EA 3LGSA 1T8RA 4ABYA 4AAYA 5BYBA 4TLLB 1XT6A 3NWBA 1UPUA 3A6LA 5L3QA 4YRRA 4TQAA 4WY8A 4BQFA 5B58C 4KLCA 3JZIA 1DC3A 4RZUA 4FHZA 4HGYA 4RK0A 4B74A 2B9VA 2GZDA 3GJSA 3KTAB 3UWPA 4FNOA 2AS0A 3IMEA 1XPOA 5KOHA 5ES3A 2FEOA 2PKYX 1VMIA 3GMDA 1JQEA 4JGIA 4KIUA 2RGCA 4TKVB 2O19A 3V5NA 1O97D 4H16A 1CJSA 1R8SA 3C85A 2X23A 4EI7A 3UB4A 2WIBA 1RYFA 3HB0A 1DTWA 1TM5E 5JARA 3EQ2A 3ZIUA 1QLWA 1UBTS 4TKMA 1DJOA 1SHKA 2O8EB 2RCNA 2Y0PA 3QLVC 3R77A 3LK6A 4A91A 3VH1A 1JDSA 1L9KA 3AM3A 4NU0A 5IDYA 2CNNA 3INTA 2UYYA 4GSKA 1W85B 2GZ2A 3DTVA 1X9IA 2D74A 5FO1A 3WXBA 1T1IA 4KUEA 4J7XA 4F11A 2ID4A 4RIHA 3ZJYA 4BN4A 5BNWA 5H82A 2O8BB 1Z18A 3VNAA 4GPD1 4B3IA 5CK5A 1T2AA 2ZRHA 4MKFA 1QIJA 1QOZA 3CUUA 2ZI9A 1L8XA 1COWA 1TQ8A 2P5SA 3DM5A 4J90A 5F33A 3H99A 3VNVA 1UP6A 3TL3A 3ZIAA 4YAOA 9MHTA 1MD9A 2AR0A 1ONNA 4Q1EA 5JZOA 1N0WA 1ZMXA 2J0QA 3BH6A 3GDGA 5KINB 1XZPA 4JGGA 2FXVA 1DRKA 2AOUA 2XGGA 4IX1A 4DT1B 5JS8A 1II8B 1TZJA 1X1BA 1KEEA 3QBDA 3WYGA 2NSJA 5FOUA 1VZ3A 2YVLA 1T5BA 1XTZA 1P0FA 1ESCA 2CC2A 3DV0B 2HK7A 4CLDA 2E82A 3D8TA 3B3FA 1AURA 4L75A 1OYVA 2Q9AA 1RRCA 2XOKD 3VDXA 3O83A 1M5UA 3EXIA 3KFXA 1BS2A 3Q2IA 4O25A 1Q6ZA 5BUCA 1TCAA 2G1JA 5DLEA 1QHHB 1L4YA 5EUMA 1THTA 4K8OA 5FWAA 1USWA 1WXQA 4UFPA 3DDOA 3KNZA 2X0IA 4LOJA 2H2IA 2HXGA 1FXWA 1YTLA 3RH0A 1YJCA 4P2BA 3W6UA 1T36B 2ZI5A 3O8LA 3OO1A 1KI4A 1N57A 2I2DA 3EHEA 2P9YA 3GLGB 1B0UA 4JN6B 4QXOA 5ALYA 2VRNA 1EWRA 4RA9A 4RDIA 4TM7A 4RF5A 3AR3A 3AQIA 5CH5A 1G3RA 2FWBA 2QZZA 2I87A 4RS3A 1K8QA 1ZK1A 1FXWF 1RI3A 3D7SA 3FNGA 1GRCA 2VL7A 3ESXA 4PNPA 5LU8A 4MUJA 4NZPA 3CSSA 3DCIA 3RARA 1NAHA 1PW7A 1P7CA 1LBEA 3ND9A 2ZB2A 5K3CA 2BMDA 3AHDA 4GXQA 3R5KA 3CGWA 4LZWA 5TGZA 4DLYA 1JIXA 4NCAA 2XYQA 3L0OA 3Q88A 4QXQA 1KZHA 4DN6A 2AFHE 4EH1A 1X7HA 1KH3A 2IUTA 2Y1EA 4EJMA 4J3NA 3G59A 5DGTA 4ZYLA 2TYSB 4QDTA 1I10A 4R8RA 5DYIA 4E07A 1EG2A 4PCVA 3COPA 4JOCA 1XEXA 1QHFA 1Z3IX 3NVAA 1JW9B 5D87A 1BEZA 3JYOA 1W0JD 3QEMB 3DAYA 2G36A 2HNBA 2Q41A 4LXYA 4QDUA 4UD6A 5FA8A 3LXUX 3ZNQA 1GYRA 2PT5A 4ZTUB 1U8ZA 2VBCA 1E79D 3VSAA 3HE3A 1IUOA 3SICE 4CNQA 1MMFB 3BX1A 4LVNA 2FP4B 5HG0A 5IVIA 2GVNA 1PWYE 4EABA 3UGJA 3DE4X 1X19A 1DHRA 2IZ5A 3AOEC 3AUAA 3NGMA 1CZNA 4Y18A 3UM9A 3CF2A 1NLMA 3GUCA 4IKOA 5KKNB 3QMWA 1B76A 1WMFA 2HC9A 2V7UA 4ZAVA 4EPRA 4NABA 4US2R 3HP1A 3V6LA 2QY6A 5ITZB 3HU5A 5C8YA 5E9WA 4I4TA 4IFIA 1W4AA 5LUAA 1OLSB 1XP8A 4M1TA 3WOHA 1I6KA 1XFAA 2VP3A 4R3UC 2V4ZA 3CW9A 7ABPA 3INRA 1GU1A 5F98A 3IMCA 3OE5A 1GAEO 2P4SA 4JI5B 3PTAA 1ZK4A 3MS2A 3K1YA 1M0WA 3IT2A 4MR9B 1H2XA 4GZ6A 4X92A 5GV8A 1Y7LA 1X42A 2P3QA 1I80A 1A9TA 1IOVA 1RBYA 1WPXA 3HRIA 2R8EA 3FHOA 4UM7A 5CUQA 3T7IA 2P6NA 3MFQA 1FS6A 2H1CA 4M55A 4XGKA 3KYCB 3ZJ4A 4FQ8A 3VPDA 2CDCA 5DNUA 1A5TA 3PDCA 4D3SA 2PXHA 4RXTA 1O4VA 4UMFA 4C0BA 2GEVA 3BFXA 2OR3A 3CR7A 2Q8NA 1IZ7A 3BJMA 1K06A 2YZ2A 4EYOA 3ZHTA 2I9KA 1QRUA 1S96A 3RGGA 3QWBA 3FBTA 5DM0A 2BKLA 1TQDA 4XYBA 3DF9A 3I32A 1PKXA 3D0OA 1WBJB 1CUUA 1F1BA 2P65A 1Z9BA 2ODTX 4IDBA 5EKXA 3IP1A 2HMSA 4RPKA 1SBZA 2MSLA 3WL7A 1E5XA 1ZJ6A 2I55A 3GUYA 1G4AE 2F1KA 2J41A 4PW0A 3PHCA 5F2OA 5KHLB 4HP8A 4YV1A 3NX4A 2B98A 3CN9A 3KD2A 5BW4A 1LVHA 1YZ3A 3L06A 1XA4A 4O8ZA 4FXPA 3N3AC 2Y9PB 5E6RA 2BMFA 4C76A 2B4QA 1XQVA 1ZLXA 2JBAB 2VJCA 3L7NA 4N0PA 4W1QA 3UJDA 3G0GA 3OPYA 4MA5A 5HM8A 5JCZA 2CLEB 4D45A 4F3NA 1SC1A 1FTSA 4IGFA 4YUVA 5A5VA 5K0NA 2Q1SA 1TA0A 1QE3A 2Y1CA 2XGJA 4F1WA 2XW6A 4IVQA 1ZHFA 2JDID 1NQOA 3KUUA 4TWBA 4XM2A 5CGQB 4A2QA 2PX4A 3L6BA 5BNZA 8ATCA 2Q50A 5JAHA 1FNBA 4MQ5A 4OPMA 1E3SA 3W3AH 3ZR4B 5KO2A 2G71A 1KO5A 5D3MA 3GUUA 3ITEA 1J8DA 5E95A 2OKCA 2OYRA 2XGMA 3W4JA 4FW8A 1OAOA 4BRSA 1QZ3A 3IEMA 1VI5A 3PS9A 2W4IA 5HF5A 1CUVA 1N6IA 1BEEA 3VGJA 3IAM1 4MLPA 3L8DA 3EMBA 1QQTA 3SVZA 2P2NA 1IIBA 5K0TA 2VTVA 5DMHA 1YJXA 4RV5A 1Y5MA 4X3CA 1Q7TA 3UJ7A 2WEKA 5HIAA 1EZ1A 1U3UA 2JRLA 2R7NA 3E48A 4KSBA 5BSMA 3GRZA 3COZA 4FMCF 2FFJA 3E9MA 4RCYA 3C41J 3FLAA 1H42A 1N2EA 1UBNA 3O7MA 4YJGB 3WLMA 4Y2VA 3JV7A 5AW2A 1WVIA 3D2CA 4YLYA 1KIMA 3EVGA 1E5QA 1D9ZA 4LVOA 4MW1A 2QVXX 2YJZA 4BC0A 4QGHA 1Q0RA 1U2TA 1QZZA 3DOOA 4HPXB 3U49A 2J4FA 1F8XA 4Q3DA 4AG5A 1X80A 4FYVA 1PT6A 3TLCA 4GX5A 1DP4A 2GFHA 3ZXXA 4DVGA 1EAMA 3RJZA 5KNCH 2YWJA 1P6QA 2WRZA 3KG2A 2IITA 2B2XA 4NLLA 3URKA 3R74A 3DW1X 5H16A 4BNXA 3ONWA 3GLFB 1SUFA 2AB0A 5DH9A 1R37A 5DI9A 4FYMA 1SBQA 4M0PA 1ETHA 3HLKA 3E9NA 4C7KA 1XVTA 3M81A 1B6SA 5IAAA 1RTTA 4R7GA 4Q1FA 3ENWA 2JGFA 3HZOA 4QSHA 2P2LA 3E58A 3OFND 4H7IA 2GK4A 4AF8A 2RHGB 5B2FA 3ESBA 2WF5A 1JTVA 1MV5A 2UAGA 4IDHA 1E3WB 4YNBA 2FGKA 4O2BB 5I47A 2XQFA 1SXQA 2R00A 1XRSB 3ROKA 1SVUA 2DPYA 1KDPA 2Z5VA 2W9XA 2X6TA 4IRXA 4LRTB 4BNWA 4Q21A 3KO8A 4PG5A 4LS3A 4DKXA 1SNYA 2ZP1A 3F49S 5EQFA 3G1WA 4DBVO 3WNBA 2PSSA 1N5OX 4IIYA 1RLJA 1U3TA 4QIHA 1I3CA 3Q7QA 5B7GA 4ER0A 3WTCA 1N1DA 5D85A 5JBIA 2PYZA 2QB5A 4JJZA 1X92A 5H1YA 2P1ZA 4G1EB 4C20A 4JI6B 4IMPA 4ZAFA 1MQAA 3A6PC 3B1WA 3SBOA 3K71B 1KAQA 1GSIA 3H3XA 3IOCA 1TYBE 4CIDA 1PJAA 4XI9A 4BZPA 2F8LA 1D0VA 4MV3A 4EKGA 2PZJA 1U7WA 2BZSA 3I6IA 3ONEA 4NOLA 1E6LA 1BKDR 1LZKA 4FLMA 1E2JA 4RABA 3F3MA 1E92A 4BNVA 2M98A 4GR5A 4AN1A 4CCYA 4XYEA 4COOA 1O1YA 2VPIA 4KO3S 3WL4A 1CIVA 3I52A 5HTKA 3OAAA 1ZCFA 1RKVA 5HQTA 2L42A 2RH8A 4EF5A 1JDUA 1P4HA 1H0SA 3A7DA 4ODIA 1AY0A 5AUNB 2HHCA 2A9FA 4QBGB 1ZHHA 1NW8A 1X15A 5C81A 3TQCA 4DYVA 2O7VA 4P4LA 3RTEA 2P8JA 5IZCA 5IBQA 1XTUA 2Q0SA 2GCIA 3A10A 3IAM6 4PTLA 4E4RA 3QFTA 3HB5X 2RJNA 1KJ9A 3KK0A 2WMDA 3LFTA 3HXMA 4V1CI 4MYCA 1KPIA 5BR4A 4FFPA 4S2UA 2NADA 4EHNA 3ZV5A 1D5CA 1U2DA 1GRVA 2O2HA 1Z17A 3H6GA 2DKFA 3LXXA 2G3YA 3N7TA 1Z0DA 3QUTA 4DPKA 4YDSA 4R68A 2XCOA 4XW2A 5FTNA 1UR5A 3BWCA 5I48A 2OQVA 5KYWA 4IHJA 4QZVA 2XCSB 3BZBA 2GYUA 4H2DA 4C5AA 1GL7A 1G64A 1QPZA 3AR8A 3E3LA 3TNDA 4KBYA 4JSRA 1XI2A 2WF7A 3MPOA 3SG0A 5E2BA 4RGYA 5AW0A 5JU6A 3U19A 3GJZA 2OO7A 2Q2QA 3S2FA 3X43A 4YH1A 1RMQA 2D1SA 5U1PA 4YQYA 4CQLB 3T4PA 5IBCA 2QW0X 3LLCA 3TVYA 4P92A 4EJ0A 2HWKA 4HPWA 4QICA 4EJSA 4NYJQ 1IYZA 4YB8A 3I5YA 4IH1A 3PLNA 1IRXA 1O9BA 3E22B 3HCRA 4XE5A 1JPVA 2PPLA 5TEWA 4E22A 5BXYA 2CV0A 4LA4A 1N6RA 5TVGA 3OTOB 1RE1A 1XPJA 3EF1A 3N86A 1MOZA 2NPOA 2JJ2D 5GM1A 3WA6A 4MVJA 3E2IA 4E14A 2UUBB 2WWIA 4FYHA 4Z8YA 2LBPA 5J2UB 3TE6A 3QW4B 1GLVA 3OTIA 4NENA 2NO5A 3BORA 3P96A 1SULA 2FUG1 2GDZA 3GGCA 3F2IA 1Q0LA 4G4IA 5F1PA 5IJ9A 3UMSA 3Q9SA 1KOJA 1E4YA 1M5TA 4NYJR 4Q7QA 2QX4A 2ZIUB 4D3YA 3EIWA 1BU5A 4AVYA 5ES4B 5CFMA 7REQA 1SU6A 4EGAA 3K2QA 2QMQA 2XR1A 1A7AA 3JVUA 3LRXA 3WZMA 1I30A 4DV1B 1NN1A 4WNCA 3ZS9A 3ACBA 3DTNA 3IAUA 2SKEA 3WISA 1M2EA 4AIRA 5KB3A 1U8XX 1SCAA 1K66A 2FJ0A 3H5OA 3QU5A 2A88A 3FPHA 3N0RA 2CLCX 4O4IB 1D07A 1HUQA 2EF1A 3PQ4A 4EPYA 1EK1A 3T9BA 4DDKA 5LQCA 4UU0A 2NU8B 1A8SA 2HH9A 1LQTA 1XDBA 3M1YA 3BGWA 3G2HA 4G23A 4B9AA 1S2DA 3N3BC 4CL3A 3CWCA 3G0OA 4A8TA 1T2NA 3IA7A 2Q5IA 3NHRA 4YN3A 3E9EA 3TFWA 2ZJ7A 4KQFA 3T3EA 3D6TB 3M49A 3EEFA 1FS4A 1NOKA 2DR3A 1WEKA 4Z7QB 4KREA 4MV9A 2R48A 4E46A 4TV8F 1JJIA 1U11A 2VQDA 3L7AA 4YLGA 2DWCA 2LCQA 1A9PA 1BNCA 3IQIX 3NKVA 4MMXB 4WBNF 5A06A 3VR4A 3L4EA 1PS8A 5DSZA 5LQNA 3T41A 4O3FA 4DCGA 5HS4A 4IUBS 5FBHA 1D0IA 3I62A 4M1KA 2W71A 4YRPA 3OFSA 1DLIA 3B60A 2P4QA 5J4LA 1IHOA 3BJZA 1QIDA 3FSEA 3EOAI 4KU4A 4K6FA 2VCEA 2YY7A 4G5QA 3HUDA 2WJ3A 4I9FA 1KO8A 2IYRA 3N2EA 4JLKA 2NQ8A 3OKAA 1R4MB 4UFNA 6NULA 4OXQA 3E7FA 5H68A 4UTPA 2TECE 2X9QA 1YJQA 3I5MA 3S2YA 2CUKA 1H3EA 1O6ZA 3B1KA 3K0FA 1J2JA 2P78A 4I55B 4LRXA 3DFIA 1OASA 3ILHA 1QV9A 521PA 3R7LA 1WHTB 3IPRA 1GITA 5DIFA 1U4SA 5AR1A 2FMXA 4OK3A 2OWEA 3G8CA 4LRYA 4OMUA 4CWAA 4JXJA 6GPBA 3ZDXB 3ICEA 4Q7JB 5I7EA 5I4IA 5HXAA 1YMUA 4FZVA 3S81A 3DQZA 2Z8ZA 3M1LA 3MEQA 2PANA 2GBLA 3RBVA 4JXXA 3U17A 3K9GA 4J2OA 3U40A 2YQ4A 1Z5OA 5E6SB 5GOZA 1RXWA 4ABTA 2RH9B 1VKRA 4Q9AA 1DUIA 4B3CA 1FSZA 1Q7EA 1KZYC 3AP2A 2WABA 2VKTA 4WXYB 5KYUB 1EHCA 3GJ3A 4OI1A 3OVMA 3N07A 4MQFB 2CMFA 3AJRA 1NMXA 1XRLA 2VQ3A 1G21E 3NTLA 3PJGA 4MIEA 5DMXA 3GYGA 4DMKA 1L7RA 1IZ0A 3WADA 3E9RA 1UADA 3PG5A 2ZJYA 4WN9A 4W9MC 1IEQA 4IOKA 2BUAA 2PFGA 1SU4A 4D8YA 3NHLA 4EARA 3GYBA 1FDWA 2ZRKA 3ANTA 1CJBA 1PBNA 4GF5A 3FCEA 4XYMA 4MMYB 3LKDA 5B4TA 4QUBA 2G77B 4G0OA 3DOCA 3UMJA 2G5TA 3CXRA 1XWIA 2I2AA 3GQVA 5AJZA 2IC5A 5FR2A 3FTEA 3QYJA 2VHZA 1EK0A 1D6NA 1MC8A 2FZLA 3PF8A 4QGBA 4B31A 2COKA 1X2EA 3DEKA 3PGLA 5D1HA 4NXMB 1C8BA 2OMKA 4YV0A 2PS0A 4FEYA 2B4RO 1PUIA 3SR0A 1L4BA 2PGDA 1QGDA 2AJLI 4EVIA 4DJ5X 2O0MA 2FEMA 2IOFK 3OPVA 3U7QB 1OPRA 1PWZA 2BKVA 2FN4A 2IYSA 2V0CA 2GBGA 3BC1A 1ZOLA 4GYKA 4QKQA 3TEMA 3ZY3A 1FRQA 2NP7A 2H5EA 2I2BA 1CDOA 1LA2A 1Q1QA 3B38A 3CH4B 4RNDB 3BCSA 3L9XA 3TTUA 4A1FA 3ICWA 4N7BA 4AKEA 4C21A 4D81A 1W46A 2C88A 3PUJA 2CL7X 3Q3VA 3OPXA 4YJFB 4CTNA 2QXTA 1ZVKA 5HMMA 4LZOA 3ZVNA 3CUKA 3K5PA 4U7JA 4FFBA 4ZK2A 3T99A 4K88A 2Q6VA 1MRNA 2HIAA 1M2VA 2DOKA 3F8WA 2Z30A 3AM4A 3BMXA 3L02A 4YHBA 4UTVA 1X70A 2P69A 2FX2A 2X3YA 3G5MA 1M2OA 3KQQA 1YR2A 4MLZA 2YHIA 3ETJA 3LUFA 3MA0A 4MZDA 4R3WA 3U7EB 2FPPA 4BO2A 4GWGA 1KS2A 4R2XA 4PYRA 3TG8A 1SCJA 3BREA 4LC9A 1CZOA 3IO3A 2VYVD 3WGHA 1NA5A 1YWGO 3MTGA 4NEGA 4DADA 4UFOA 1D4OA 1QHSA 3OMWA 4RFVA 3SBEA 5LDDC 1F38A 4LK3A 3HMQA 1I33A 1V2GA 3INGA 1RRMA 2XD9A 1MENA 1KP9A 1T8UA 2EP7A 1R0XA 4ARSA 4K9DA 3L7IA 4H17A 2REBA 3W4IA 3PUXA 4K9KA 1JGTA 1LRLA 2V5VA 2FWPA 4MPTA 4MWOA 4UZSA 4Y9UA 3RKRA 4V03A 1OYOA 1IWOA 4B3DA 1J1UA 1KL7A 5L95A 4YMHA 4QTTB 4CKBA 2AJTA 2VBFA 1C7IA 3I8XA 1SVNA 2Q4BA 5JWHA 4HH4A 3K70B 1RHQA 3O8BA 1VL5A 4XTRA 3VZPA 1VE6A 4F85A 1HLDA 2F1IA 2MINA 3AINA 3DFKA 2YWCA 3DO6A 1UBEA 5AJXA 5BMVA 2O7RA 3IBSA 1JDBC 4YRZA 1Q20A 1TRKA 1VJ1A 1GCIA 4II3A 4RL4A 4DIEA 5DHSA 2Z1MA 4KO1S 3RIXA 4DM4A 4BJ5A 4G5XA 1FPMA 4BKMA 3M6LA 3K0BA 2FPGB 1QH8B 4UM5A 5GMOA 3U3DA 1GU7A 2YOFA 5JRZA 2W2QA 4BLUA 1P7VA 1D0SA 3D8NA 3N6RA 3R3VA 1ZRMA 2IHJA 1AM4D 3BAZA 1CVRA 2I1WA 3EVTA 3EXHA 1NMZA 2Y8EA 4U7FA 3I45A 5C18A 4MRRA 5BW6B 5FUQA 4RQTA 3I4FA 4K6KA 4BP8A 4FKBA 1PQ4A 2PAFA 1KXZA 3Q3JB 3CCBA 3JQ6A 4H4CA 4DJTA 4JC8A 3N2GA 4TWZA 5C46F 3IIIA 1XCBA 1JQDA 5DBFA 2GD1O 5ALHA 4A5OA 1QQ5A 4D56A 1DSSG 1E4EA 3R0ZA 1MJHA 5B55A 4ZGBA 1KJQA 2LPMA 4LXUA 4B0OA 5CR9A 4F96A 4ERXA 4XTCS 3VTKA 5KHOC 2ZJBA 4EGSA 5JDCC 4B4WA 1B43A 1RCFA 3B78A 3SDSA 1RLTA 5LYJF 1JNYA 2LNDA 3Q7IA 1ADCA 2AYYA 4FOOA 1KA9H 1DHTA 2ACVA 3G79A 1NONA 3G2OA 4RVNA 4KUHA 5CGZA 5BPHA 4L22A 5T4EA 1K1EA 2QL5A 3A6ZA 1PNVA 4KR0A 1AS2A 1KMHA 4R2KA 1VHDA 2WG2A 3JD4A 5AVOA 1OILA 3RS4A 2XA1A 5HP4A 3ZVLA 2OGSA 2QAJA 1NV8A 1Z16A 1J0CA 1X87A 2G1UA 3AETB 2CMHA 3DJFA 1S9DA 1XKQA 1S0UA 1TGYA 5EJ9A 3LOQA 4EX7A 3QXHA 3EARA 3RBXA 4CMEC 4RTOA 2ZS8A 2KBFA 2HSZA 5IDWA 5HCUA 1A8HA 1SOAA 1L4MA 5L4NA 3CVVA 1MUUA 1KQNA 1G3IA 5HJ5A 2GLUA 2XUDA 2CK3A 2AFIB 4KPUB 2ZIXA 2J3EA 2ALJA 3AUXA 5DRYA 3COVA 5P21A 1JKMA 1J9EA 4N12A 1NFQA 1QIIA 1V5GA 4NG5A 1POWA 4BTEA 5JXHA 4JVLA 3S8MA 3TGLA 4CCAA 3B82A 3NHSA 2XOKA 2Y68A 2BDUA 3LX6A 4FNGA 4QOJA 4QTZA 4Q9IA 4BVKA 5KSOA 1KOGA 3U4MA 2WUGA 4L02A 3T4UA 1Z75A 3WK4A 4ZP1A 1B2LA 4IJVA 5BSUA 3TZ6A 4DDMA 2ZDHA 2PRJA 1M76A 2D5CA 3EXEB 3GROA 1IG3A 4LKRA 2WJZB 2HXSA 2PX3A 3R7WA 4D43A 4L0MA 3VDNB 3LYAA 3P9ZA 3PFGA 1YCDA 4M7RA 3WNQA 1UMKA 3ZX4A 2VPTA 4OSOA 2I0FA 1M3SA 2J7PD 3EAGA 5F12A 1O0BA 1VPTA 1CY0A 3FYDA 2BCGY 4JLDA 1UFVA 3Q12A 3TRFA 2GM4A 4ER6A 2BKEA 3I1FA 1WULS 1XLTA 3HVIA 2GCOA 5CNIA 2XZLA 4QUGA 1V1RA 4BJ1A 3ZN2A 1GR1A 1P1FA 1N2XA 1X7GA 2WJ6A 1U63A 4OHVA 1R5BA 1NYTA 1O8CA 4IL5A 5ICFA 2O8DB 4TS9A 3FVVA 4HC4A 4WFJA 1A77A 2D0PB 4GPEA 1C8LA 2NZ2A 2RGXA 1RWPA 1Y0BA 1PLKA 2W6NA 2PIAA 4D5GA 4GBJA 821PA 2PRYA 5BWBA 4C5BA 2WWRA 4HR7A 1E7SA 4X7BA 2E2WA 5E8JA 4AJEA 3B7WA 3D3KA 2MDTA 3CA8A 1UAYA 1TKAA 1UPCA 1W0JA 4LFBB 4AO7A 4PIMA 2DBYA 2F7SA 4IQGA 1QRTA 1T4GA 1GV1A 4ZMSA 3O1HB 3JRWA 5ENZA 2JC3A 2XA2A 3LUGA 1B7GO 2JH3A 3O0TA 1I7QB 4ENSA 4EJ2A 3M2PA 2CT8A 4BLQA 3OZRA 3LPNA 3GGPA 3NOQA 1Z62A 2PS1A 3DZCA 4LSZA 3AF6A 2DJIA 3ZKAA 1P1BA 2RBGA 3FCOA 3GF4A 5EMHA 2OV8A 4MKHA 1JJBA 4MGZR 2RI6A 1ZGHA 2BEVA 2C92A 3TLGB 3DCNA 3E8SA 1SVOA 3GEIA 1DEXA 1SCNE 4OHRA 4YFYA 3I9NA 3I2HA 3RYCB 3NWJA 2B2CA 3SQOA 1QAMA 4KO2S 4YBRA 4UAVA 1W94A 5EKTA 2N0SA 3NHZA 4O1MA 4BCBA 1XD2B 2YWBA 3TFQA 4G2NA 1VGRA 4Q1VA 5ALOA 4BXOB 1J06A 1ZUD1 4B9EA 3DZKA 1RQPA 1HORA 4BTLA 3BIJA 2C2KA 3U3OA 3VR6H 1Q2XA 2J3LA 3SHQA 4KO4S 5ALWA 3LPMA 3WLJA 4UAGA 3HTXA 5DOZA 1P9LA 2FMUA 1Z29A 1PI3A 2VT2A 4MV7A 5FTMA 1CU1A 5H80A 1Z38A 721PA 4Y6RA 2R7AA 4Y6OA 1TYZA 1ZVJA 1QJCA 2Z4TA 3KLMX 2B4TO 4LBZA 5IXYA 2QEQA 5K03A 3K31A 3C4QA 1SXJD 2VHQA 1RDFA 1VLJA 2YBDA 5AUPB 2FFQA 2X3UA 1T0PA 3AEQB 1O96A 1R16A 1K6IA 2OGZA 2Q6OA 3GAAA 5DGXA 2QQ5A 3FVTA 2XUAA 5DKFA 2JFPA 3G7SA 5LJLA 1CX9B 2G28A 5I9IA 4X62B 1CRPA 2BJVA 1X38A 4KSCA 4JI4B 3GP3A 4DQLA 3BUSA 2A6PA 1AOXA 1LK0A 1Z2AA 3OIVA 2CLFB 3JAKB 4NBTA 3ZGYA 3SSAA 4BO4A 1WA5A 4UBLA 2QU7A 5J2TA 1VKOA 1QVZA 2HJVA 2C83A 3IBFA 1V3QE 3ICOA 5C1OA 1QX4A 2QVLA 5J2TF 1LBTA 4NCJA 3OI7A 1Y6GA 2DETA 5ADHA 4EW3A 2BKXA 3T4XA 4CIBA 3WO1A 4EL0A 3K8YA 4KITB 3GFBA 4PN3A 1RHMA 1U5BB 2NM0A 5ALMA 5TMEA 5LIRA 3T3NA 4LJRA 1RPAA 1SRQA 3PPYA 4Z7JA 4AMBA 4EVRA 3W6NA 4JYPA 3A14A 2VP4A 5CM2Z 2V1UA 1JG4A 4INOA 4J0JA 3RROA 1ZGGA 1GQFA 4LOHA 3RSCA 4AJJA 5CB4F 5I9NA 3WMGA 2B5WA 1AQJA 5LQRA 1EESA 1LVGA 3HI4A 2CJWB 4HN4B 2Z4RA 4YAFA 5AI5A 3VO1A 4DLRA 3BD9A 4GOLD 2XT0A 2QG6A 4TTQA 4F9TA 2NTVA 4IJUA 1PRYA 2O0LA 2YMPA 5H70A 5L3VA 3VR2A 1BCSB 2H7XA 3PR3A 1D2CA 2FZEA 4MCJA 2XUIA 1FLDA 2JFNA 2ORVA 4Q7KA 3AP3A 1GUBA 3NP7A 4P38A 1AZSC 4RSMA 5K6AC 3LZ6A 2GN6A 2GPBA 3Q41A 5F9FA 1S3GA 4KKXB 3HCNA 5IARA 3TR6A 2J5RA 2OO3A 3D81A 2WA1A 3BT7A 4AZVA 5LM3A 1DOZA 3UWOA 4RA6B 4Z2AA 4ZOAA 4MUXA 4KCGA 4F1KA 2AFHA 3CX3A 4PBRA 4QT4A 1HR0B 3MGBA 5LA6A 5F3WB 4RSGA 4P5DA 3VO8A 5BRNA 1E9AA 1IN5A 2DFTA 2QN1A 4JEMA 3Q0EA 4NJEB 4PC2A 1AH2A 2AQKA 2NVUA 4YMGA 2XNHA 4UHEA 1QH1B 2QTRA 4NCNA 1YOBA 4A82A 1P4AA 2D62A 5LA6F 3ADOA 2X8AA 3BHNA 4TUYF 3BB1A 3VDMA 2D1FA 3RKUA 1YI1A 4PFJA 2I67A 4RD0A 4F86A 1Q1BA 2QN7A 2PBFA 4KWIA 3N2KB 4ALJA 4J94A 5A5EA 1FUYB 4ADSG 1J23A 3W3AA 4D74A 2V03A 3I37X 1X3LA 1XAJA 1GL9B 1U3FA 3KJEA 1IXSB 2ZVPX 3LLSA 4JLNA 4ZYYA 3PI7A 2O0HA 1YIAA 3OLYA 3HJAA 1JI0A 3SIWA 2WB4A 3NG1A 4D3ZA 1C7JA 1XTQA 3OC6A 3GFTA 2L18A 4E6EA 1T25A 4EA9A 3N2YA 1NJ2A 1GKIA 1RI5A 4XQ0A 2MYNA 3JWIA 4E21A 1GPAA 2H18A 1N7JA 3KJXA 2CNLA 4E5DA 1L7QA 1G291 1RFLA 1BXGA 5TDHA 4WESB 1AGNA 4CE6A 3KCNA 5LWQA 3O8DA 4ARZB 4C29A 5JAPA 2BDEA 2E87A 2FZ5A 1I3KA 2VZ0A 2JZOA 3SYRA 2ZW9A 4IFBA 5KTSA 1DPFA 5JJ5A 4QD3A 4LI0A 5B3LA 2ZRQA 5EJGA 5KNCA 5E3HA 3BF8A 2C2ZA 2H3EA 3SC4A 3ORRA 5A4AA 1XU9A 2GRAA 4RH1A 2WSBA 5HKOA 1Y9JA 4P5EA 2CLIB 1JHAA 5E6UA 2JLSA 3ZW7A 2QENA 4AMZA 3OEED 2I3GA 2VEDA 2CL5A 1PEDA 1F6WA 2Q0HA 2I4TA 1Z3CA 3KEOA 3RU3A 2XXAB 1NWHA 1SVLA 3VDQA 3G85A 4Q1CA 3DKRA 1T3ZA 3W5VA 4MCIA 3R40A 1XHLA 4OJMX 3HADA 4WA8A 2Q4EA 3HWWA 2J0SA 2EARA 2BFNA 4L73A 2WKRA 1UKEA 3LBIA 1PFUA 3O3NB 3WL3A 3ZJVA 3RVMA 1C0PA 1Z28A 2GAAA 2AG6A 2XTAA 3QVTA 4NBLA 1Z73A 1QFYA 2OCAA 1C9DB 5FLEX 2A0YA 3TD6A 4CG1A 1AMUA 1TJ4A 5FFFA 2CLKB 3D3EA 4M0MA 1UK9A 1GPDG 2P11A 3ZWQA 2E4YA 1FLNA 3IQXA 4E08A 3V3KA 4GMFA 3AY3A 3L05A 3KXPA 2PUVA 2HLDA 1UM9A 3P0EA 5I9SA 2RGAA 3ETNA 1CIJA 4AJ2A 3U5TA 1L4GA 1SWVA 2XD4A 4IR7A 3U62A 5J59A 2P5TB 3D7KA 5ALLA 3S29A 3BSWA 3IVCA 4U39A 4MO2A 1DIAA 4QOHA 4A3SA 3UCXA 1ZG3A 2ZVQX 1C4KA 2C78A 4FCCA 4YDHB 1UL1X 4NBRA 1JZTA 1XRJA 3H9CA 4I9GA 3U39A 1OAOC 3P5BA 4CEJA 4CU2A 3EA4A 2CLOB 2EQ5A 5F1KA 1TK3A 4OL9A 2IXAA 1ICIA 4XPIB 1BWRA 1TYDE 1X7YB 2QD5A 2H11A 3OJ0A 4B76A 1X7WB 1VIAA 5K4AA 2BWJA 3V6MA 5KKCA 1OT5A 1Q22A 1EXWA 1SXGA 4DWOA 1NPTO 3CWQA 5BVGA 2LV8A 2DQYA 1ECGA 2Z6QA 2HUPA 2FAXA 3QVMA 1R2QA 3W5BA 1X1AA 5KREA 3EWNA 4PVCA 1QE5A 2Y99A 2YYYA 2C7OA 3V42A 4KXXA 2A3NA 2J45A 2JS7A 3AUUA 3MTIA 4L57A 5EGSA 3KSUA 3SZGA 1GCGA 4N8EA 1RRVA 2Z8YM 1MJFA 2MYTA 1KSHA 1YFLA 3DULA 3SIXA 2Y4OA 1MO2A 3PXXA 1R8XA 3FMIA 3Q0IA 1VCHA 4AZ0A 1EI9A 1FJXA 1Z15A 3BL6A 1DIOB 1R1DA 2G08A 3CSUA 4FZ3A 4PONA 3WGYA 3T1NA 4DIOA 3WNDA 4LJ7A 4FCWA 4IIDA 2ACWA 3UXHA 1L8OA 5DASA 2P6PA 1FRVA 3VC2A 2J9XB 2FZKA 4FM9A 4O29A 1L1RA 1GKYA 2XHEA 3LTEA 1ZXXA 1VJDA 1MIOB 5JCJD 1JALA 4U7HA 1ZD2P 2XNKA 3CEHA 2RD2A 2XADA 4TKUB 3U61B 4QRHA 2IV3A 4IVNA 5H83A 4FGZA 4RIEA 2HT1A 4KQJA 4PV7A 4Q00A 1YB4A 5E2IA 3NEJA 4BFTA 3SC3A 3BL5A 3I04A 2R00C 3PXBA 3M9LA 5CIYA 4PGGA 4D44A 1Z7GA 2FSHA 2Y0CA 5HR5A 4CBVA 3AC0A 3FFWA 4AWAA 2GBCA 4XUDA 1KEWA 4DHWA 4TYQA 1WEHA 1W36B 4RK7A 3KEQA 1OFUX 1KBOA 3FUTA 4KFSA 3HL0A 4WY2A 4YP0A 2V55B 5ALFA 4B82A 4L15A 3DSRA 1OYYA 2H4ZA 2J8ZA 3M6AA 3M9WA 1TF2A 4TTIA 3N74A 1DMRA 4UDYX 5ALDA 5I8ZA 2RSLA 3KR2A 4JEIA 2P2GA 4D57A 3CNHA 3UW1A 1JB9A 5ANRB 1HFEL 5DM1A 1CZUA 2APJA 5TQJA 3P2MA 4AWXA 4Z9YA 5BSVA 3U1BA 2V8BA 4L4XA 4ND3A 4RKEA 1I13A 2H2AA 4DA0A 4YRGA 3KHUA 5MDHA 3FCSB 2LZ0A 4G09A 3ZYZA 2GUWA 3DEYX 1H69A 4AN0A 5AICA 3X0DA 3QVVA 1ADFA 3IUMA 4MXDA 2EJTA 1SUSA 2H0RA 4MJXA 1WDWB 3VYUB 3ZV3A 1D4FA 5CM9C 4EUHA 2LDXA 5EKDA 1K7FB 4DZRA 3OKFA 3H3FA 2IEYA 5TARA 2Z6AA 2V5UA 1U8CB 3KPUA 5E7MA 4G8JA 4PC7A 4BBJA 4BQEA 1ECPA 4AY5A 4UUQA 3GRCA 3JY6A 1KSFX 1JDNA 2PGLA 3QVOA 4OG2A 1TADA 2K5UA 3SF0A 3WSVA 1E62A 1CR2A 4HQ0A 4PPFA 2DAPA 4PS0A 2HU5A 1GADO 5I9MA 4HDKA 5KCMA 3LPCA 4QAQA 2EC5A 3BULA 1IPFA 5BNTA 3RSLA 4BWGA 1WXIA 4QAJA 4LTMA 4QREA 3IOBA 3P9NA 5IM4F 4KR3A 1VOTA 3L04A 3HRHA 2E7ZA 4G56A 2VKQA 3UK0A 3ZLBA 4BECA 4BY9E 4BGIA 5C80A 3H4VA 4V38A 4H7FA 3WKEA 1CDDA 2E48A 2JFQA 3LA8A 1L2TA 4I5GA 2GJSA 1LJUA 4KG7A 4UPDA 1K5GA 1T3HA 4QPDA 5C5EA 5JI3E 1MQ8B 2FKNA 1E7YA 4FQ7A 4U6QA 2L17A 3FIJA 2YY6A 4WKPA 3DE5X 4ZQCB 5L3ZA 3B6JA 5MN5A 3FDXA 4D6YA 3AEZA 3S4YA 3HA5A 4P31A 4CN8A 3ZHRA 4MKXA 1ZLYA 1AXEA 2GR9A 4GWKA 3EFEA 2NN3C 1J22A 3WNZA 2DQSA 1K98A 3G2NA 2IV2X 2H7VA 3PDJA 1G6HA 1LDBA 3L7BA 2PLAA 4PSCA 5M29A 3I9MA 2EL9A 3DE2X 3IP5A 3N0XA 5F73A 5AT1A 4EJSC 2I1LA 3EEQA 4F2GA 2QVCA 1UZAA 3Q9LA 1Z4QA 3F0TA 3OOSA 3VPBA 5EPUA 4RHEA 4V3BA 4Y2JA 8LDHA 1UQRA 3G1TA 2FQYA 1KQ3A 2JCBA 3UH1A 2ETVA 3WLRA 3N2ZB 4MJ3A 5KJCA 4HWOA 3H75A 1EFVA 2EJUA 2HADA 2BYTA 3T5TA 3T1YB 4Z51A 5B1SA 4QFDA 4ACAA 4QG3A 3O38A 1DKPA 1HLFA 3H8JA 1QB8A 3HBJA 2AKEA 1KYXA 1EVZA 2WIFA 3D6NB 4FLEA 1DG1G 5EZYA 3GAMA 3S1LA 1E63A 1JKIA 3KKZA 1ZH6A 2PU7A 3PNVA 3QLEA 1ULZA 4PCUA 2NO7A 2WI8A 4Q4LA 3VR3A 1JN0A 1H4VB 4FONA 1NXOA 3D8SA 5LOVA 3NVKI 3GN1A 3MWGA 3KIPA 1DELA 1UT8A 2PX5A 3L4SO 2F90A 4EY6A 3DOEA 3JZDA 3CVXA 3R9WA 4PEVA 3WLAA 2FW8A 2YASA 4HYYA 3DUFB 2C7RA 1VG8A 1TMKA 1ZITA 2L19A 2PJUA 2VOJA 2ATXA 3EBOA 3QG1A 3H1EA 1V4NA 1RBQA 1NT4A 2FSPA 1GPLA 2GILA 2J46A 2HA0A 3PQFA 3PWZA 5K3DA 4DIKA 3N70A 1IMOA 3IMFA 5FUBA 2TSYB 1EH5A 4CLHA 2ODEA 2YWRA 3IPXA 5D3QA 3ECCA 2ZRNA 1FMJA 2BSQA 2GPAA 3L7CA 2I33A 1MJNA 2QPLA 1S1MA 4MYDA 3R8FA 2Q4OA 2V7XA 3QE3A 3T7DA 2RDMA 2X4GA 4HEHA 1E3TA 1UP7A 1WS6A 4PYIA 4DLPA 3S28A 4DIBA 4JYZA 2AEFA 1ES9A 5IFLA 1KZ7B 2PH1A 2XF2A 3EGEA 3AVVA 1SPBS 1DGQA 2VJAA 1VC2A 5KX5F 1TE2A 1M34E 3ZVRA 2RCYA 2MCFA 4EQ6B 4ZYTA 4E5SA 5CYGA 1M5RA 2HU7A 2VHXA 2AG1A 1TT7A 4W1PA 3SEQA 5IRCD 4QJBA 2RI1A 3MWDB 4FINA 3QTBA 4UUAA 1A9ZA 1O3YA 4M37A 4OGWA 5DV9A 2CW5A 2C04A 5G40A 4O4LA 5BN5B 4KQGA 3C3CA 2ATEA 2HEGA 4RDXA 5JW6A 4U2GA 1SUWA 2PV0A 2JFYA 4X3PA 3O4VA 5FUXA 4ZAZA 3KYDA 3WQBA 2ZJ5A 4UEKA 3A58B 3L0CA 4Z8XA 4B2YA 5A7HA 1JKJB 2YHUA 4XQEA 1KWKA 4US1R 3E23A 3B53X 4TLDA 5D00A 2VXOA 3VR5H 4XB1A 4HH0A 3V4ZA 4YCMA 4EY3A 2IEGA 2GBLC 1I0LA 5BQ3A 2YZNA 1T9BA 4RORA 1HSOA 1I8TA 4TT3A 5A9SA 1CS0A 3SZMA 4BQRA 2DECA 1S3IA 1UEXC 3CRNA 3Q9NA 1VQ1A 3LBAA 1F4LA 2RJOA 3AG6A 3SKYA 1Y4AE 4Q18A 5I6DA 2FMIA 1UBGA 2ZTSA 2AN1A 3I58A 4FFRA 2J3MA 4LC0A 5DXAA 1IXKA 1IH8A 1MKYA 2X4LA 2Y1GA 2Q8PA 1NJ5A 3CRMA 3G49A 1EM8B 4PYKA 3LPAA 4HV4A 1D1QA 2AL7A 2VP0A 2OZLB 3WGKA 1SMKA 2NU9B 1DZ3A 1OIXA 1ZCJA 5JCXA 4QXPA 1DC6A 2H1LA 5E7IA 4I1OA 3NI2A 3NBXX 2WYOA 3I28A 5GGYA 2ENUA 1SKBA 3NANA 4ZCMA 1TMYA 2VSQA 2V3WA 1HEUA 3NHKA 1O95D 3VHQA 4YUYA 2VRCA 5CA1F 1T4CB 1RXUA 5CPFA 1J2UA 4HATA 4C6HA 3CCFA 3UY4A 1ITZA 1F8FA 1U2ZA 5K0BA 4BGEA 3C43A 5J23A 2EL7A 4KRGA 2Q5FA 1V11B 4NMLA 2LIVA 2NO0A 3QU2A 1LLFA 1KDZA 1WBBA 1CY7A 1T2DA 4BQQA 4C0JA 4XVHA 5T8KA 1AG9A 1YQTA 1A82A 2EG9A 5B1HA 1CJCA 2J31A 1DB3A 1QCYA 3BTOA 4PC6A 1YH3A 2OXIA 4EKNB 5JPDA 2CVPA 4XFKA 4F2PA 4O2AF 3AVQA 1H65A 2C9MA 2W6IA 1EX6A 2IPAB 1HRDA 3R6LA 1P6XA 3L6CA 2EIXA 5DNWA 4Z4CA 1NURA 2QYHA 2YCBA 3GGOA 3FAZA 3G0IA 3WFJA 1RP7A 4JQCA 1P5JA 3LH5A 3LVQE 5LC1A 1EWTA 1AB5A 2C5FA 4ETMA 1VMKA 4M60A 2Q5QA 4AWBA 3ZZTA 1U7OA 2FSFA 2O2GA 3PFHA 3IJRA 4F7WA 1H23A 1M8PA 2Z0MA 1WPGA 5FRDA 4ZZIA 4AY6A 2Z2IA 2GYYA 1EFAA 3ZGZA 3EGXB 3GWZA 5FAKA 1SUAA 1F2UA 4MA4A 3CW8X 5EI5A 5JAZA 5JWOA 1EUYA 3IT1A 5SZHB 1GGNA 1PEAA 2PZEA 3VX3A 4AQDA 1RJ9B 1SUIA 4JC4A 4D4JA 1RBMA 3HJFA 5DK6A 4KI7A 1I32A 2VAWA 4B45A 4H7HA 4R16A 3HDGA 3KSBC 3B5JA 4BX2A 4ZJYA 4HDMB 4WLNA 1WR8A 3N1UA 4ZRMA 3W8RA 1OLUB 1FUUA 2JAXA 4HVTA 3ZVKA 4W5OA 1K6JA 1XA0A 1M7GA 3AR6A 4JL8A 4AURA 4A36A 2RMKA 4R83A 3IXMA 2VZ9A 1EIWA 1IEVA 4Z99A 4G37A 4IMRA 1CEEA 4BFXA 4XCQA 5BXQC 5AVXA 3ZK7A 3QXJA 3F5MA 3MJVA 5BWNA 3WB9A 1YCFA 3ZHSA 4GNRA 3B3JA 1JFTA 2O54A 1B2RA 3ZV4A 1JLRA 4RHXA 4FJ0A 3BXGA 4NONA 16PKA 4HZIA 2WNIA 2UXBB 3W4KA 2XB4A 2XNDD 4DUGA 5KDOA 2JKYA 4GOJA 2HKIA 1UF9A 5JJIA 4EWLA 2A30A 1JVSA 5B30A 2XCRB 4ONEA 2XYVA 2X1HA 1PEYA 1S2GA 1YHYA 2FG5A 4J4BA 3JQBC 4IWNA 1L5KA 5J1SB 1M1UA 2EFHB 3E18A 3S2EA 2O5VA 4DIFA 2GAOA 3OPNA 4ZZ1A 1PBTA 3QJGA 4DC9A 4WD3A 3ADCA 3U9LA 1W6UA 5L7WA 2JJ1D 1DAMA 3A3PA 4DNOA 3F9IA 4RX1A 3TEJA 1AZWA 1O5OA 1Q17A 3AJDA 3RW9A 3TZLA 3V1TC 2B25A 4OVKA 4QXRA 5GONF 2ZBGA 3MOGA 2YJNA 1W73A 3OM1A 1GL6A 4TL7A 2N46A 1I5EA 3HVJA 4DABA 1PX2A 3QVLA 4MS4A 3EXHC 3CXUA 1XZMA 3O8OB 3FXAA 5AVTA 1E2HA 1KI9A 4H0CA 1CTQA 2J9FA 3JWJA 2G9ZA 2YIJA 3QKSA 3R3JA 2B9EA 2OO5C 3HHEA 3NWEA 5KSZA 4M38A 2AZMA 5AP9A 4CM3A 2AE2A 1DIHA 3IKVA 4ZO6A 5EXDA 3RSZA 2BMAA 3T06B 3TOZA 5LZ4A 1E2DA 1LRJA 1NBEA 2SCUA 3ESRA 4REQB 3N59A 4LMAA 1QXSA 1PK8A 4NCBA 4F6CA 4WGFA 3BZWA 4F91B 5KNDH 4MTCA 4OKSA 4BV9A 2BGJA 1LS1A 2QT0A 4IINA 2RHOA 4CFSA 2QRNA 2XXBA 3AZOA 1YB2A 3KWJA 5DPMA 2W2XA 1TCUA 2IYQA 3ADPA 3E4DA 4G0QA 4J29A 3V2HA 2O3JA 2HMUA 3H5AA 2BSAA 1WF3A 3IH5A 4IXMA 1T6YA 5CTJA 3VOAA 1N5LA 4BYGA 4DJDC 2ZZMA 2CVQA 4S1WA 4AYWA 3E3NA 4JV5B 1W5SA 5BQOA 1CERA 3PCTA 4X7MA 4BEJA 1KGDA 1ZH8A 2R5NA 3GHHA 2OOSA 3K70D 4UNSA 4BKUA 4N48A 2O8CB 3UAYA 1ZGCA 2AI3A 3IP9A 1FX0A 1TLLA 4C7BA 2IBTA 4UZEA 2HBQA 2HXYA 4B5LA 1U3DA 4E1AA 3PUHA 4HLDA 2ECFA 3ZDYB 1MEEA 3TTSA 5F5NA 1O9HA 1NLZA 1RLIA 3HUFA 3UB2A 1Z2PX 3TUIC 1J56A 5CVEA 2O5CA 2RI0A 3HCWA 3ZGOA 3EAQA 2IOFA 1CR6A 5J4YA 8MHTA 3M7IA 3H8VA 4C2BA 4EDFA 5ETJA 4A6PA 5LPNA 1OXMA 1DO8A 1GUAA 3A4LA 3EGOA 1MO6A 3JS5A 2FRVA 4FHGA 4KQKA 3ZW8A 1C81A 3AY6A 3QF4B 3O8RA 2VAVA 4RD6A 1QUEA 1T2EA 2L82A 3CY6A 1VE3A 3AKZA 4MDFA 3NIFB 3GZNB 4I6EA 2PMDA 5AHXA 4OBBA 4BWFB 1TVKB 4BKRA 3TPZA 1XDGA 4YUXA 5KYUA 2WWGA 2B99A 2R6JA 4Y1RB 1U4OA 3DZDA 4KMMA 3FJOA 4HNAB 2GVDC 1AHIA 2XKAA 3VR6A 4QDKA 4CJXA 4DA7A 1FP4A 4JMPA 5DGHA 1UDXA 1HTWA 3PNPA 3OQMA 1XMQB 3DOIA 5AW6A 5A9TA 1H2HA 1JPNA 1OWLA 1JA1A 2TMGA 4KE7A 2RGDA 3IKMB 4OXRA 1CK4A 2Q9BA 5HQJA 1U2SA 1EM6A 1JQ5A 2FK8A 3KL2A 4HLNA 3RWMB 2AOTA 1HLGA 1BJRE 1T91A 5DX0A 3RRXA 3M6WA 2XSZD 4I36A 5FEUA 4HDSA 4DWVA 2PYDA 2O2ZA 2PUTA 1KXJA 1M6HA 2Y0EA 3DBRA 1B74A 3N05A 4MVXA 2QLFA 2Y71A 3PXAA 5E7JA 2UVPA 2EFEB 4F60A 4K2AA 2O3RA 4NVRA 4CMHA 3ILYA 1ACJA 1KI1A 4PVDA 3D7RA 4IH4A 1ZEMA 3PLRA 4G0ZA 4AT1A 1ATIA 3J7TA 4UUPA 1R7RA 1Q0SA 4MPDA 4GM1A 2DWUA 4NAUA 1Z5UA 3RVSA 2O2SA 3TRIA 4JT2A 4OP1A 1RR6A 3HJNA 1Z82A 1K8YB 5EHGA 3SLGA 1OV4A 2I34A 3TB4A 4YASA 3F8TA 3B51X 2QZPA 1GFIA 4KBFA 2X7HA 1IY8A 4M22A 5TR9A 3T7CA 3IQZA 4WW0A 1BJTA 5HGXA 1I7LA 1SUBA 1W5BA 1XCGB 1PJRA 1E59A 2Q1YA 2Q2VA 3OE4A 1VSVA 3AEUB 4G26A 4LJ6A 4BNJA 1YDFA 2ONJA 1GPUA 3R4CA 3V7UA 5LNK6 1Y9AA 1OXVA 4AJPA 3DZHA 3L01A 2GPSA 1N2IA 2ZYIA 5CLHA 1SIUA 3U7FB 1MX1A 1PD0A 1VPLA 2PZMA 2EW8A 1SOMA 2XB2A 3BMCA 1DZIA 1TK9A 2ZYTX 1RYHA 3JAMA 1OZ0A 1T9ZA 3MJCA 2CNKA 3GEPA 1UJ2A 4PYOA 5DM2A 1O77A 5DYNA 2HI0A 3ZLUA 4XDYA 1R12A 4H77A 3TNJA 1QHNA 2EVWX 2LWIA 3RYHA 4DYDA 3T1TA 3FVRA 3ZI0A 4R51A 1Z37A 3FSGD 4TZTA 2C1EA 3GI1A 2X14A 1OX6A 3C1TA 4HQNA 2C7PA 1X2BA 1Y5RA 1VSBA 2J0VA 1JVBA 1G5RA 3PZRA 2IKQA 1OLOA 1W5AA 4MGIR 1OJ7A 1T0IA 3YASA 3ZHOA 5JO0A 4YRBA 3SZ3A 4F5ZA 2BGWA 2HIGA 2JANA 1YU6A 1U3CA 1T9AA 1JI3A 3DBOB 3WWCA 1GGHA 4IDFA 1DV1A 1QPBA 3NXSA 4Q4HB 2NZYA 4X1IB 4BIMA 3CE6A 5JR3A 1QYVA 1K4KA 5FBVB 3TECE 2P2SA 2BBWA 3AV0B 3PKIA 4OUDB 4KJXA 5AKGA 1R6DA 4Q4AB 4AF6A 1IIRA 2YCLA 3ESCA 3RUEA 3QLTA 4RV4A 4YC7A 1LD3A 2ZUCA 5FWXA 3TAXA 4K6CA 1B0ZA 1YOVA 3OLQA 3STHA 1XP5A 4WLFA 1M2HA 3EG9B 2D1TA 3TW8A 4JEHA 4DEYA 4EVSA 3WAGA 1WPQA 2VJMA 3CTPA 4IJQA 5JNLA 5DDIP 4HWTA 2Q7XA 5FI0B 2VDWB 2FW7A 1TTHA 2W0SA 3FPLA 1QWOA 4HDAA 3ZWCA 3K8ZA 1RKXA 1G2QA 1NUPA 4DVJA 4XWWA 1UP4A 1G38A 2CHEA 2UZ1B 2ZIZA 2EKPA 3CO5A 3FMVA 1L1EA 1XHFA 1PJZA 4OB8A 2D2VA 2QG9A 4XA8A 4MYSA 4BFSA 2YXPX 3HZHA 3LHFA 4TMVA 4EI2A 5IG2A 2DWQA 1P0QA 3UHFA 5M2QA 4MMZB 4WZAE 3PR2B 3VC7A 1OXSC 4CT5A 3KR0A 4GAEA 4Q1DA 2C54A 3UKOA 2AN5A 4ZCPA 4QYIB 2HBZA 4UDXX 2GCPA 3VKUA 3PXEA 4EPWA 1GDTA 3G89A 3RUPA 3QEOA 4K0KB 4I50B 2OPHA 5ALZA 2I71A 2PWYA 3HJTA 4YMUA 1J24A 1G1MA 3KOUA 1K08A 4O5OA 2OBXA 2JAQA 4BNGA 4RHFA 4DC0A 5B7PA 2G82A 3IIKA 2IP4A 1IFXA 3FIUA 4M9ZA 1OAKA 4GRIA 2CHUA 3OLZA 1MH1A 4D4MA 3JQ8B 2W42A 2Q0XA 2UKDA 3F74A 3JARA 5AHOA 5LB4A 3SOZA 3CZQA 3RK1A 1I0IA 1DDOA 2O6HA 1ISIA 3KVYA 2GF2A 1C4OA 5CNMA 1M6YA 2X0DA 2Z83A 1E5TA 2DUNA 3H5TA 4PLPA 3QVUA 3SQNA 1OTHA 3BK1A 3H5NA 1H2WA 2OMEA 4ZYWA 3T9AA 2ZT5A 1OW3B 3IUNA 1UMBB 3LG2A 1KSJA 4MULA 3VNQA 1WABA 4DYHA 2WD7B 5F2NA 2UYGA 3RVDA 4EHKA 2JIBA 4IDPA 3IESA 4G0PA 3PUYA 2DPGA 4LMRA 1EJ0A 3E8XA 3F67A 2BZ1A 4M49A 3RVNA 5CBPA 1U94A 3BK7A 1G4HA 1OY1A 1JDBB 3D8UA 3DXXA 4PFQA 5GJVC 5GZ1A 3GD7A 3GR6A 4W63A 5CFLA 1F2DA 4V2UA 3AF0A 3BPSA 3N6VA 4C1BA 4QECA 1U9IA 1N1GA 4TSFD 2PMEA 3TZBA 4C2UA 5DLPA 2FEXA 5E1MA 4R54A 4H1UA 2H2WA 1J0XO 3IQDB 3KJZA 4WINA 1I6MA 4QBHA 1H5NA 4NBKA 1T1EA 4HVAA 3E5NA 1T5IA 2B36A 2Q7OE 3VOBA 3JATB 1E1DA 4KR2A 2FQQA 1XG5A 4UEJA 3PPVA 3D4BA 1Z5GA 2Q6LA 2QTFA 3UJ8A 5EHXA 4KDEA 2AI1A 4ZHQF 1CT9A 1KRXA 3DQQA 5EXPA 1GGMA 3C4VA 1ULUA 1NF8A 1VECA 2JFFA 2IHNA 1IN8A 1P1IA 3PUKA 1QU3A 2WAAA 1M2FA 3I92A 3TN7A 1XYYA 4ISCA 5HKLA 5MN4A 3K3PA 2OWDA 4EY7A 3HJHA 1UWKA 2XWJI 3KL4A 5AUOB 3AHHA 2CWDA 4KHZA 1K4YA 3UEOA 2EKLA 4RYDA 2XWPA 1VXOA 1WCYA 3FR7A 4F84A 2V3CC 1ZR2A 2G80A 4HGOA 1CQJA 3W5SA 2CJYA 2JLBA 4LE1A 1Z35A 3S68A 4C78A 2NPIA 1M8JA 2BEWB 4TWRA 4KHPB 4ZICA 5BYJA 4U2BA 2GHQA 3TBHA 2OILA 1SVKA 1THGA 2WUVA 5A71A 5F7OA 1PR4A 5IAOA 1UBJS 3QMMA 5AW5A 4LBVA 3S6JA 4GRDA 1X77A 1GXSB 1ZNZA 3HN6A 5EY5B 3VZCA 4E3ZA 1NPDA 5THXA 4TTTS 2DQZA 1Z6QA 3RFUA 5AFSA 1Y8RA 2E21A 1NP3A 3ICCA 3ZHCA 3RLFA 2QDXA 5LXTB 3D43A 2EJBA 3EVCA 2EFGA 2X2PA 2AOVA 2IKSA 3Q6MA 1JJAA 4HEQA 3GJ5A 1II0A 1VLZA 1R0ZA 1EUDA 3OD1A 2IQ5A 3QWHA 2PX2A 3ZU4A 4BQSA 2ZDQA 3ZVMA 1ZRSA 3BJEA 5ECGC 3EY9A 1E9EA 3LUAA 4EUEA 2BM9A 4C30A 1IZZA 4C88A 3N87A 2X1VA 1K5HA 1NY5A 3DDZX 2QD3A 3OTHA 4QPZA 2D5AA 3QQPA 3I9KA 2QGZA 5CPBA 1WSWA 2P68A 3FDZA 1EK5A 4KO8A 3ECAA 5BYKA 2EBFX 4GKKB 1Y82A 1C0EA 1NR7A 2GEFA 4GMXA 4Q9KA 3TSYA 5LP6F 2ILTA 3W5DA 3WB0A 4XB2A 5FEMA 1L5SA 3GVXA 1JA0A 5G0TA 2YC4C 3B2QA 4UREA 2JEOA 3M5WA 4CETA 3CH7A 4D3XA 4CGYA 1XU4A 1M54A 3PI6A 2Q99A 3QX9A 1N6LA 1K0UA 1YQQA 2R1ZA 4AMGA 3MGCA 5JD4A 4DV0B 3N8KA 2EGHA 1V9CA 4E2ZA 3H9GA 3MWFA 2VK8A 1PL7A 1YR3A 3C48A 1SIOA 2J6CA 1BGXT 1V7ZA 4FE4A 2J7KA 2R60A 2B4YA 1JBQA 2EDAA 2YJ3A 2BM0A 4NMHA 2Q6IA 3GBSA 5JVDB 5AJWA 2ZDGA 2A86A 3KZKA 1ISJA 3WWEA 2FEAA 4NU5A 3PDHA 3CT6A 4OK5A 2PBLA 2HPZA 1E20A 2JI4A 3UMYA 3QE0A 1XUOA 4I1UA 2OAGA 5FHRA 2W2TA 4CM5A 4RTPA 3ZU2A 1GN8A 4YRTA 3B3AA 3V46A 1LBSA 2E4AA 3K6SA 1A9XB 3WL5A 2PE5A 1ZOPA 1BX3A 3L4BC 3DTYA 3PR1A 2X0FA 4JZYA 2VJKA 4IICA 4PG6A 3D6VA 1FMTA 4KSYA 1PG2A 3E53A 3T9DA 4D9MA 1DKNA 1A5SB 1U0EA 4LJKA 3ZXUB 3K9FC 2C2WA 1P2TA 4HNQA 2COUA 1YR9A 2PL1A 1A9RA 1IHYA 1KEVA 3AYZB 1AXGA 4BZWA 1WUYA 4RANA 2QM7A 3VV3A 1BDBA 3R5TA 3MRXA 4V0RA 3SX4A 1B0PA 1GZVA 4TN5A 3RG8A 3W5JA 4DFDA 5KOHB 3MTDA 1SKYB 4M54A 1CY8A 1NVVQ 1OIWA 2O2XA 3TW4A 1AT1A 5I7UA 2JLWA 1VJGA 2JAHA 3UATA 3O2NA 1M73E 3IOMA 4OXIA 4X8OA 3T1HB 3PNLA 1G66A 2QM3A 1NU6A 1H85A 2AV6A 2RGNA 3GFOA 4GSLA 4RSRA 4BNTA 5L6MB 3K73O 1EAYA 1X7DA 1HE8B 3ML1A 5IN5A 5FUWA 1QWSA 2I4OA 4CIYA 3EPLA 5GOTA 4RCZA 4AFNA 2WWTA 2RJ3A 4WASA 3PICA 1MOSA 1T9GR 3EH1A 3K2EA 4R40A 1NVVR 1DAFA 2PL9A 2BDTA 1GNVA 4B6OA 1GZSA 1K2VN 4QOIA 4JC5A 1ECCA 4U2EA 1N9GB 1NKTA 2W7TA 3M89A 4W4TA 1RKBA 5B3KA 2W8ZA 3LS2A 1Z8NA 2LKCA 3PT5A 4A0FA 4BGDA 1FSSA 4O4HA 2EW2A 1I3NA 2R2AA 1H2AS 4TL9A 1RAFA 2R6AA 2V3VA 3B5IA 2OEPA 4R1NA 1ZVMA 2F59A 3EPJA 1JDJA 2ZTMA 3FPEA 2ZAIA 3WYEA 2HV9A 1NL3A 3HDJA 4JP3A 5A0TA 1MTOA 3K9NA 3FF1A 2AOUB 1N5MA 4ASUA 5CYOA 3ZLTA 3U0BA 2P7IA 2I2XB 3JQDA 1KEEB 1YCHA 2PKWA 3TB6A 1J0DA 5JZSA 2B4AA 4BLPA 2QXUA 1CBUA 1XLUA 5CFZA 2BGIA 3LW7A 1TKBA 2E4WA 5LLTA 3GMIA 1Z12A 1DI0A 5LZ5A 1AQIA 3NKFA 3SQLA 1BROA 3EXIB 2C9YA 1GU0A 5HZKA 1AVTA 3BTSA 5ER6A 2FPXA 2J3IA 2JGLA 1CS4C 1V1MA 3C3DA 2OQ2A 3EW9A 2P90A 4Q15A 5KDDA 4AULA 3VU9A 2RAFA 1JFLA 2YW2A 4PX5A 3QEAZ 1WB6A 5JEEA 1O95A 4E13A 1TXGA 1APBA 1H2BA 3WP1B 4CHTA 2VDMB 3M3PA 3W1WA 4KQXA 2FPUA 4K2HA 1DNPA 1U2RA 4R7TA 2HMAA 4RA9B 3UAZA 4ALIA 2K7FA 1RJGA 1VKJA 4YCAA 3T3MB 3GEMA 5HPYB 5JNUA 3DP7A 4LG1A 1MA3A 3RUAA 4D2IA 2F4NA 4QX6A 4TV9A 2YINC 5FCDA 3I76A 3TIXB 1T2FA 4DSOA 5CD9A 1UKVY 1HT1E 1JX6A 4K87A 5BSGA 3VR5A 3ZWNA 4GOKA 4YJ2F 4O0MA 4J2TA 1VA4A 4N9QA 4E94A 2KQUA 4IYRA 4DSTA 3C3AA 5C5DA 3ZWVA 5K6RA 4EUNA 1HKUA 1MJGM 5JQGA 5AOCA 2ZJFA 5FJIA 3ESDA 4AP9A 4I1PA 1ZK0A 2YN0A 4XGRA 5AYVA 3ERCA 1A8UA 4JNCA 1ZQ1A 3A1SA 4LDRA 5E4TA 1S8FA 4HUQA 1R15A 1WOMA 3MCAA 2EKZA 3GRYA 4WXPA 1XEXB 5E9QA 3MZ0A 4S04A 1U99A 2POQX 2ERXA 1L5HA 4L7QA 4TVOA 4ARVA 5CJ2A 2Q5EA 4RACA 5K8TA 5JANA 4ZARA 4TKZA 1WKCA 5B7NA 2NTNA 3KV1A 4DSZA 3L5KA 3RHSA 3BIXA 3I0NA 4Q9JA 1FX1A 1U0OC 2QX8A 3WLQA 3ONFA 1UPFA 3GIWA 1JYSA 4H9GA 4RH0A 1YZFA 4IFTA 2HQBA 5IHPA 3CLTC 4WPGA 1B8UA 3HSKA 2FG6C 2Q5OA 2WYHA 1U90A 4LRQA 1PZHA 1OX4A 4D9HA 3DL4A 1U31A 5C8YB 1U8EA 1X14A 1HH4A 4I4TB 5DTIA 4CEHB 3Q1KA 4B73A 4HQKA 4MPPA 4RLHA 3C7AA 1WXDA 1EA5A 4MKGA 1XVLA 3UQZA 3JSAA 3EDRA 1BDHA 4JMLA 1KAHA 2VA8A 2RGGA 5A4FS 4GLLA 4C3OB 2BVNA 2DWOA 2YJTD 1KDRA 2WJIA 1KE2A 2ZBVA 3G2MA 4JP2A 4YROA 1M34A 4JD5A 3FGPA 2WZBA 4P82A 1UPTA 3H8SA 3OKCA 1F2VA 3T34A 4DXHA 4P4GA 3H2KA 5BUZA 3RRJA 3L93A 1T15A 3UT6A 1OOEA 2LKDA 3U6BA 5AM1A 3FYSA 4B87A 3LQKA 3DDUA 3QFSA 1GEGA 5I5EA 3IE1A 3BICA 3MJHA 4LDQA 5E4FA 2R79A 2ZBQA 3DBLA 2FVXA 3JCZA 4ZCQA 3RS0A 1G0OA 1N8KA 4UCQA 2XNJA 3ACCA 2YUTA 3AG5A 3Q98A 4L8WB 2I1QA 3AI1A 3DE3X 2QLNA 2JJ1A 3K72B 2PLFA 4RIGA 4LYYA 1DAIA 4TVBA 2HYDA 1TEVA 1DFIA 1YULA 2ZJAA 3H9QA 2F3SA 3UFBA 3K05A 4L6CA 1DWPA 3PHIA 2WQZA 3M34A 4S12A 2OFFA 4OAPA 3C3XA 3MJFA 4KDFA 2ZR7A 2XMSA 4KQMA 4BO0A 5HZHA 2F64A 1PJCA 3ROXA 3KXKA 3LOPA 3AI2A 4HVLA 3DFUA 2JLUA 1QR6A 4HQFA 4WEQA 1G7RA 3JQGA 4ARIA 2Y67A 3W9SA 4GQIA 5MFZA 3IT3A 1FK8A 1K3UB 1ZDMA 4JWKA 2OA0A 3CLUC 3ZDBA 5E6RB 1ZA1A 4IJWA 1PS0A 2LCFA 3F97A 4OBEA 3OIYA 3SS7X 3OPYB 2J9GA 2WHQA 1NZDA 1K8XB 1GLNA 1O89A 2BBTA 3NHPA 3UMCA 5EJ8A 3FLMA 1GPKA 3NNNA 1OI4A 1VKHA 2VWGA 1P2DA 4N7RA 3T52A 4YJ3F 1YNSA 2GOYA 4FGKA 3WWOA 3ISTA 5ALGA 5JQWA 1ORWA 4IZIA 4MUMA 3O9ZA 2AKYA 2XQKA 3IC5A 2YZGA 4C0LA 3MHTA 1XCMA 4Q4CA 3KZCA 2IJGX 3DBVO 5D3MB 4FK8A 3K2IA 1RXYA 4KMSA 3V4FA 2ZS9A 2NQTA 5BV0A 4KVZA 3D5TA