3IAEA

Structure of benzaldehyde lyase a28s mutant with benzoylphosphonate
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
554
structure length
554
Chain Sequence
AMITGGELVVRTLIKAGVEHLFGLHGSHIDTIFQACLDHDVPIIDTRHEAAAGHAAEGYARAGAKLGVALVTAGGGFTNAVTPIANAWLDRTPVLFLTGSGALRDDETNTLQAGIDQVAMAAPITKWAHRVMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQIDEDSVIIPDLVLSAHGARPDPADLDQALALLRKAERPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGLPDAMRGGLVQNLYSFAKADAAPDLVLMLGARFGLNTGHGSGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEALAQATAQDAAWPDRGDWCAKVTDLAQERYASIAAKSSSEHALHPFHASQVIAKHVDAGVTVVADGALTYLWLSEVMSRVKPGGFLCHGYLGSMGVGFGTALGAQVADLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNRVTGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Benzaldehyde lyase
publication title Active-site engineering of benzaldehyde lyase shows that a point mutation can confer both new reactivity and susceptibility to mechanism-based inhibition.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 178
structure length 554
sequence length 554
chains with identical sequence B
ec nomenclature ec 4.1.2.38: Benzoin aldolase.
pdb deposition date 2009-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iaeA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iaeA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 3iaeA02
2VJYA 3EXHB 2BEWB 2R8OA 1U2DC 1L8AA 1MCZA 4C7BA 3M7IA 4TWJA 1YTLA 1S7GA 2XTAA 2XT9A 3GLSA 4JUDX 5FYQA 4KGDA 4UUBA 4K9QA 1E3TA 5IMSA 2C3OA 4Q9DA 4FEGA 1OZGA 3OOYA 3OE1A 4JD5A 4V1CA 2EZ9A 5D7NA 4C7VA 1T9CA 1UMBB 4K9LA 1O97D 4GM0A 3KOMA 4BN4A 3EXFA 4GG1A 5ESDA 3FSJX 3RIMA 3EXHA 2BEWA 1PTJC 5EJAA 1D4OA 1V1MB 4KXUA 3AHIA 4JT8A 4UTXA 1EFVA 3AHGA 1U31A 5C4IA 3CLRD 4Y6OA 5K6RA 3CLSD 1YD7A 3LPLA 2IEAA 3EYAA 1B0PA 2WVGA 1UM9B 1WCIA 4HD8A 4BVHA 3F6BX 4KXVA 1OLUB 4BN5A 4J1TC 1T9AA 1UMBA 4UTVA 3CLUD 5EJMA 2Q5OA 3FLMA 4JUCA 4G1CA 4JSRA 4KXQA 1PYDA 1YC2A 4HDAA 4K9OA 1V1MA 2EZ4A 4UTZA 2IHUA 2H2FA 2VBGA 3UPTA 1R9JA 3CLTD 2BFCB 1M2HA 2PGNA 3HWX1 2OZLB 4COKA 1UM9A 1Z8NA 1U2GC 3AHHA 4BVBA 1V11B 3M34A 2R8PA 4D5GA 3IAFA 3LQ4A 1T9BA 4MPRA 1OLUA 5MF6A 1BFDA 3ZHUA 4IF6A 3EA4A 3PKJA 2FRDC 4MPJA 2H4FA 2Q5LA 3M49A 2QTAA 2PGOA 3EXG2 4D5EA 5MGNA 1Q6ZA 2C31A 2JIBA 5EXEA 2C3UA 3JWPA 1OLSB 5DGDA 5EJ8A 2AG1A 2Q29A 4RJJA 2Y0PA 1Y9DA 3MOSA 2YIDA 3D4BA 1UPBA 2BFCA 2C3YA 4QQ8A 3HWWA 1OLXB 1T9DA 1TKBA 2OZLA 1X7WA 2O1XA 3EXHC 2BP7B 1V11A 4K9KA 2BEUB 2PANA 1O96B 1QPBA 1M2KA 4K9PA 1NI4B 3DVAB 5K6TA 5MFPA 1V1RB 1WCIB 5EJ6A 4MPPA 3UK1A 4K9MA 2A1UA 3JR3A 2JGDB 3E9YA 1ICIA 1UPAA 1OLSA 4RMGA 1PNQA 2IHVA 2VBIA 2H4HA 1YC5A 3EXEB 2VK1A 4BVFA 2FR8C 5BWLA 5DGTA 4C78A 3ZHSA 1YI0A 4L2IA 1OLXA 2OO5C 2H2GA 2V3WA 3ZHQA 3ZHRA 2BP7A 1M2GA 3FZNA 3AHJA 2BEUA 4KXXA 5EXDA 4O8ZA 4RMJA 1POXA 2R5NA 3ZGOA 1V5GA 4ZZIA 1NI4A 3DVAA 1U5BB 1V1RA 2AG0A 1V5FA 3D7KA 4GM4A 2QQFA 2JGDA 2Q28A 4KXWA 1JSCA 2FN3A 2UZAA 3PKIA 5I51A 2BRUC 4F4UA 3EXEA 2DJIA 2H4JA 2OD9A 3ZHVA 1X80A 2J9FB 2O1SA 1HZZC 3ZGVA 1PT9A 1IK6A 2X7JA 2H2HA 4C7XA 4UUAA 5BWOA 4BV2A 2VK4A 3EXIA 5FEMA 1X7WB 1NM5C 1YNOA 1U5BA 1Q17A 2OD2A 4UTRA 4ZP1A 2JLAA 5EJ9A 3AI7A 4GM1A 1DTWB 1ZPDA 1NGSA 3RIGA 4RJIA 3AHFA 2WVAA 3K35A 2G67A 1Q1AA 2G25A 2A1TR 2EZUA 4XEUA 1PO7A 4BVEA 2FSVC 1X7YB 3LQ1A 4BVGA 2YICA 2JI8A 1V16B 1DJLA 1TKAA 2J9FA 2Q5JA 2C3PA 4FEEA 3HYLA 5AHKA 1UMCB 2H2DA 3ZG6A 3DV0B 2E6KA 1MA3A 1KEKA 2H2IA 4IG9A 3EY9A 3AHCA 1X7XB 2JI6A 1S5PA 2BFDB 5MFZA 2BFEB 1OVMA 5I5EA 4UU8A 4UU7A 3DUFB 2C3MA 4JUAA 1DTWA 2OD7A 2OORC 4KXYA 2BFBB 1QGDA 2JI9A 1EFPA 5EJ4A 2UZ1B 2EZ8A 1X7ZB 5K2OA 1X7YA 1XLTC 5I4IA 1GPUA 1V16A 4Y6LA 2EZTA 4I5IA 2XT6A 1PI3A 4QELA 4KPUA 3U3DA 4UTNA 1UMCA 1M2JA 3DV0A 3ZHTA 2NYRA 2HJHA 1Q14A 1W88B 1X80B 4JU9A 1RP7A 2H59A 5HGXA 1POWA 5ERYA 1X7XA 2C42A 2JI7A 2B4YA 2BFDA 4GP9A 2Q27A 1YHYA 2BFEA 5EJ7A 3EXIB 3EXG1 3DUFA 4BUZA 3M6LA 1V5EA 1SZCA 2BFBA 1U28C 1PNOA 4RJKA 4Y6QA 1TRKA 2UZ1A 4K9NA 1UPCA 4WBXC 3CF4G 4BV3A 1X7ZA 4V1CI 4FVTA 3D81A 5EJ5A 1TKCA 2JLCA 4X3OA 5HJEA 1W85B 4MQ5A 1OZHA 4X3PA 1W88A 2Q5QA 1PVDA 2BEVB 5K3SA 1M2NA 2W93A 3F6EX 5I5GA 3L84A 5DEIA 1UMDB 2G28A 5ERXA 1YI1A 1QS0B 5HHTA 3GLTA 4JU8A 4TWIA 2BFFB 4QPZA 3AHDA 2WVHA 4FZ3A 5BWNA 3GLUA 1J8FA 3RIYA 4RMHA 4J16C 1YHZA 4JT9A 1AY0A 4F56A 1OZFA 2NXWA 4GPEA 1N0HA 3PDHA 1W85A 1ITZA 3GLRA 4R8MA 4RMIA 2QTCA 2IHTA 4JUBA 2PDAA 2BEVA 2VK8A 4IAOA 3AHEA 3LQ2A 3U31A 4L3OA 2QQGA 1UMDA 1YBHA 4JUFA 4V1CB 1QS0A 4MZXA 5HYVA 3IAEA 2FWNA 2BFFA 1SZDA 2VBFA 3EXFB
chains in the Genus database with same CATH superfamily
3V4FA 4KIWA 1KTIA 2VJYA 3COYA 3TCKA 4P0QB 3K9FC 4W5JA 3N39C 5BXYA 2G5PA 2O50A 5IXSA 4UOEA 3I5AA 1GPJA 2GBPA 4OOFA 1ZOIA 2GM5A 3DV9A 4M60A 4QYTA 4C7BA 2RHDA 3T3GA 2J4DA 2AFRA 1EFVB 1W4ZA 2JK1A 3FR8A 1U5CA 2ZOSA 3N7AA 1HF3A 1F6DA 1MAWA 5EJGA 1EIWA 1H0HA 2PPVA 1YA4A 4JUDX 4P3OA 3UUGA 3LGXA 3NM4A 2UUAB 4G1VA 1RQLA 1KAOA 2CCKA 5F5XA 5B1DA 3RV4A 5AWFC 3TEJA 4D96A 4ZJUA 1RRFA 4NONA 1FK8A 2HLNA 2O2YA 1TM5E 3HA5A 4KPGA 2IEBA 5FOWA 4P7KA 1W36C 3G2PA 4IDNA 5H16A 1TTTA 1YRYE 3ERCA 3W5AA 5GJBA 1PZXA 3H9GA 5TR9A 3O8NA 4TYMA 3R74A 2AN9A 2WMNB 4JFAA 3LP6A 3RNLA 4B82A 3AI1A 4HDNB 4WJLA 1QZUA 1XR3A 2VRCD 3SX2A 2YS6A 4MVJM 2G1AA 3O31A 4CKCB 4DIDA 4C7VA 1SMKA 3LX6A 2XXAB 1AKRA 1G63A 1O5TA 1YR2A 2WTXA 5H83A 5CG2A 3L7MA 1EWVA 2VSYA 4YWHA 1HXHA 4CEJA 2BGMA 5GQSA 2HC9A 1YZUA 3L1KA 1ISMA 1DEXA 4WA8A 5U1PA 1G18A 2ZULA 1X70A 3L07A 3SPXA 2D59A 4OJMX 4ZYUA 3BRWD 5H3LA 2IW1A 4LHSA 3PNVA 4P7FA 1YZGA 3GZTB 3FX2A 5F1OA 1FFEA 3LWNA 5KVAA 1M1NA 2FP4A 2PGLA 1ZIDA 2E55A 2XMQA 1CVRA 2IPOA 3TXYA 1YZNA 1VJTA 4DL9A 3CW2A 3FGZA 1V9LA 2X4LA 3LUPA 4DV6B 1CUAA 1RQ2A 1HYGA 4KMRA 2YXDA 1RYNA 3KTOA 4TQAA 2DSNA 1Z0KA 1W5FA 3QPVA 4LNAA 4PQEA 3IUSA 1DFGA 5HS6A 5I7FA 5LWHA 1SKMA 3CPJB 2FSSA 3HTXA 4AZ3B 1QGUA 3GRYA 3JATA 2O4UX 3KB1A 1JFLA 2GJKA 1VP3A 2OECA 3CLUD 3DAFA 4XM2A 2A14A 3O8DA 3PVCA 4BBPA 2PBZA 2CYAA 3JAKB 3CNOA 1F2TB 1HE4A 1PLJA 1UFVA 3B5JA 4BO6A 2HZBA 4C7JA 4NK4A 2R8EA 1QKKA 2ZR7A 4KXQA 4JWKA 3OKPA 2F2TA 2WSBA 3DT9A 3QH4A 3MINB 2AWNA 5I7OA 4K46A 4PFSA 2AKAB 1TRHA 2B9VA 2NVBA 1JVSA 3BTUA 1HYEA 1RU3A 1VIYA 2VZ8A 1PKXA 3SJZA 5IKPA 2AOWA 5ALTA 3WWPA 3VRHA 2LCIA 4BPBA 3JVUA 3L7KA 2GEBA 4OCZA 1SH7A 2ATIA 2XA9A 4GMDA 4AURA 5AW3A 1ZQ1A 1UBFA 2NXNA 2GEJA 5AIAA 2WTBA 4M0LA 3LUBA 1V5WA 1LSJA 2Z4TA 3AR7A 1EE9A 1MLDA 1UKBA 3L1JA 4L73A 4RZHA 4DMFA 4YV0A 3TTUA 1NJ6A 1JKXA 1N1DA 1QVZA 1RKQA 1N2OA 2E4WA 4DCUA 5I3CA 1K4YA 1TVKB 1UOOA 4D56A 1G66A 1F51E 5KYKA 3KJGA 4D4IA 1DWOA 4A92A 2VHTA 4PPYA 4IIJF 1COZA 5KBYA 3TK1A 4IHQA 3JZIA 1TC1A 5LB2A 2Q2WA 3B1WA 4Z5XA 4LJ5A 2UYQA 2GCPA 4LDPA 4L4SA 1GCAA 1TKRA 3AF5A 2AVDA 1G8AA 3EFOB 4FGLA 2C03A 5KVQA 4BKPA 4PTZA 1C8BA 4ZQBA 5T7BA 1ZNYA 1E9VA 3SEZA 1T9GR 3NGMA 4ZI7A 2VTBA 1X7DA 3E05A 1X8LA 4R5HA 3SI7A 1G5FA 1AKUA 4WCVA 3UOWA 1H1LB 3OJOA 3GLIA 2ZYRA 1NM5A 1QG4A 2AG1A 1XU4A 1PJSA 3HVKA 1U94A 2CL6X 2Q29A 5J1SB 1U0NA 4H77A 2G7MC 2HNAA 4JR0A 1LTHR 4MULA 5F51A 2OQRA 5C46F 4YAIA 4K86A 3NI2A 1BTOA 1P45A 3EHEA 3KQVA 3R3HA 5KYUA 3KAJA 1Z12A 4Z4GA 4QZVA 2RH5A 3H5IA 5HXAA 4TQGA 3DOJA 3FNHA 4EKNB 3DE5X 4L5BA 2RFLA 3HHEA 2FRDA 3DXXA 4RBNA 4BVJA 3BMCA 2QD3A 1OXUA 2D2VA 4G1UC 5A0TA 2Q3CA 2VLIA 1AV7A 4X44A 3V3KA 3VO8A 3MRXA 2G04A 4RFVA 4R6XA 3DKVA 2XZPA 5EP4A 2YW2A 1OIWA 4O4IF 5LKRA 4OUKX 1VPEA 3CH7A 2Q9CA 1GGKA 1WCV1 3S4YA 3P27A 5D86A 4FOLA 4KZPA 1DC4A 2XRYA 1IM5A 4ZU1X 5LFAA 1A72A 2PKRA 1V45E 1XCPA 3IP9A 3FCXA 3IQIX 3FKSA 4LNUB 3Q8LA 3M9WA 1LZKA 4ZAWA 2D0DA 3FWKA 3TL3A 2CKMA 3SIRA 2K5UA 2FTKE 2JHCA 1QYXA 1S6YA 3GUCA 3IBTA 3ET4A 3WL7A 4F9EA 1ZRNA 1WETA 1RJFA 1ZN8A 4RL4A 4ZK6A 2AR9A 5CHYA 4KR3A 8ATCA 2VATA 3HNOA 3TRKA 2VBIA 5LZ7A 2Y6VA 4RETA 1W5TA 2O8DB 2YKGA 2BJVA 5D87A 4TWBA 4MYHA 1KIMA 2W6JD 3PJDA 4RNDB 4WOPA 3OCJA 2IXBA 5CB0A 2HA5A 3BL6A 1FUKA 4JQCA 3T52A 2GO7A 1FOEB 2ZAMA 4O08A 4UDOA 1V2GA 3VV3A 4PPFA 1E77A 1YDHA 4EO4A 4CKYA 4DDWA 4W1QA 2L0XA 3I53A 3MCZA 4LBYA 5LXTA 1H2FA 2QN1A 2ZJFA 2R87A 1PUJA 1GL9B 1XVVA 2GBLA 3IHWA 4OJYA 1K0UA 3B85A 4OQYA 1YUMA 3SZGA 4D9NA 4JB2A 4JEUA 3CG4A 4UHKA 2XWPA 3JWIA 3F3KA 3RUHA 1EUDA 4DLZA 1J9GA 4ZZIA 3TSZA 1OXXK 1XZFA 1DDOA 3AEKA 4FYHA 5D1HA 5EHNA 1Z0FA 1NJ5A 2CLIB 2YHIB 5J40A 1H2XA 1T4DA 4IIUA 3UOAB 1FNSA 2WLTA 3AZPA 5EERA 2B1IA 3PD0A 2WM9B 3UT6A 1WB6A 4TXMA 3EGXB 4C0XA 4M9XA 3WK4A 2KQUA 4AUKA 1GLVA 4UJ3A 1MU0A 3LY5A 2FN3A 3GLGE 2FPSA 3FGOA 3PXBA 4UM9D 3IR5A 3OF3A 5J59A 5C53B 2DECA 2OXRA 1DRWA 1UZMA 2D2FA 2V9ZA 2W2XA 3PIIA 5AKXA 3A1DA 2A8YA 5CA1B 2QQEA 5EE1A 4JI8B 1YQUA 4HDSA 1PJBA 3VR3A 4W82A 1BXRB 5JDCA 3GGSA 3Q0IA 3CLUC 5AHXA 3D2BA 2YVQA 3FOWA 4Z1MA 4H7IA 4P5EA 4LWPA 3QHPA 4RFSA 3M3DA 3RAEC 4FEYA 1HSOA 2HR1A 3SEAA 1IRIA 3CX7A 2PXXA 2ZAGA 5HSGA 3IAXA 4UMDA 3BRSA 1DXOA 4JNKA 5KKNB 2VRBA 3D7MA 2BKVA 3NDJA 1ZK3A 5EC8A 4KFUA 1ZA2A 2HADA 3LUGA 4HAUA 4KOEC 2C7RA 1Q17A 4UTRA 2W2KB 1AX9A 1YJ8A 3UHPA 4DR3B 5IC4A 2P4EA 3ON5A 4GM1A 1IY0A 4O4LB 2H65A 4D02A 4OYLA 1EZZA 1TJPB 1AM4D 2H0QA 2HUPA 1CYDA 4KBYA 4H1TA 3WL4A 4A5OA 3WL3A 4LJLA 5ALIA 5ITSA 1Z0IA 5CR9A 2RHOA 2X42A 1T91A 3ZQJA 1A97A 1FZQA 4AB1A 2HT1A 5ECWA 1Y1RA 3B3FA 2PX4A 2ETXA 4JVOA 2I6FA 4XEUA 4M6WA 3RVNA 3K96A 1JALA 3ONFA 4AFNA 2VEOA 2ZIZA 3ZVNA 1YR8A 3QOFA 4ES6A 1PW5A 2BSQA 3B1KA 1GL6A 4ABYA 4LJ7A 3ILVA 4OIFA 4MYUA 1FTQA 2M6SA 4OP1A 6AT1A 2IZ0A 1QRUA 1NMXA 2BMVA 1RBYA 2VSQA 3HA7A 2FW9A 2CHQA 2D7CA 2NQ8A 3EVTA 5EPEA 1AQ6A 1CQIB 4ZHQA 3ELBA 1E1RA 1LKZA 4XX1A 3FI0A 1LLFA 2Z3WA 1D6JA 3HDVA 3LX5A 2JLQA 3SM3A 3FZYA 1G9TA 3I6QA 4WT7A 2IU6A 3DWFA 5F2NA 2BI8A 1DKOA 3OPYI 1E89A 4QUIA 2XOXA 1S2GA 1J2TA 1V3QE 3U7QB 5EP2A 4INZA 2XWQA 3GDWA 4P3YA 3FH0A 3AY6A 3C45A 3GFSA 1LQUA 3KDPA 3QJYA 4IDQA 4BFZA 4Y7CA 5TDHA 1ODSA 4BY9E 1QGDA 3FVVA 3SDBA 1VB3A 1B8UA 4PG6A 3PZRA 3W5BA 5FH9A 1U8UA 2DG2A 3AIKA 1DINA 1L5VA 2HK6A 3MA0A 3PSAA 4M0UA 3TX2A 7AT1A 4OAPA 1DC7A 1X7YA 5A9RA 3H3XA 4L6AA 2ZYIA 3A26A 3NLLA 1ZGJA 3QKSB 4XB2A 3RASA 1T2AA 4ERNA 2GPYA 5TEVA 1I4WA 1CQJA 1J8MF 3QZUA 1EFUA 2ZUFA 1FJGB 3R5SA 4WNCA 3NOVA 3TOXA 2JS7A 2YFKA 2NYRA 3ZHTA 2NUAB 1W88B 2GD2A 4P4SA 4EB6B 4JDUA 1ZSVA 1G8JA 3IIMA 4RPHA 4ZN6A 3KUCA 4HSEA 3L8GA 2IYNA 3OQPA 1CEQA 2Z09A 2AFIA 2QRVB 4U9IS 1YZHA 3UJHA 4Z1OA 1IAVA 1V3VA 2AMYA 5JAQA 1N5DA 2HWWA 3SFTA 1N2IA 2QX6A 4DWWA 1DS6A 1JT9A 1M34A 3QEMB 5MGBA 3KETA 3ST7A 1W1WA 1ADYA 3I09A 2ZQYA 3L7YA 4QGGA 4QBTA 1J56A 1SQ5A 1M76A 5AVUA 2QLMA 4FFPA 4V0MA 1TECE 1M7BA 4KODA 1KEPA 3Q12A 1AUVA 2A88A 2DEUA 1WM1A 5J63A 3VVLA 1PP4A 1SCBA 3FOBA 1TRKA 4GVLA 3VNSA 1EDDA 3MCTA 2A0FA 3QE4A 1KU0A 1WOMA 2V7WA 1WLSA 2I87A 5DX0A 2YWXA 1EFHA 3RC2A 3ZXYA 3LVQE 3ZE2B 3FNFA 3SXUB 4TSKA 5AD1A 3WAJA 2JHGA 4MJ7A 1W4AA 1B42A 1O95D 2VNAA 4OEHA 1U0EA 1SBZA 3OLVA 1ES9A 1FRVA 1DZIA 3P9YA 3JALB 1ZEMA 1TYZA 4X3PA 1SUDA 2P4QA 3KJNA 4AF6A 4KAAA 4WKCA 4RK7A 3TQTA 3DWIA 1PVDA 5SYAA 2UUCB 3D6NB 1U2RA 5AK6A 2ILVA 3MRTA 2R7AA 1A9SA 1KO4A 1M2NA 1U0TA 4TLDA 4TS3A 2BR3A 5FFFA 1OASA 5FFNA 4JYZA 3GN2A 4OV6B 5JLAA 1Z9BA 4F60A 1HFWA 2C20A 4J0DA 3FMGA 4QXRA 1ZOSA 1CZUA 1XL0A 1QK5A 4TXLA 4WZBE 3RF6A 1OKKD 4OQLA 2C5BA 5K0NA 1CUBA 2WWXA 4A6EA 4BKQA 1WV1A 1JDBC 4GQBA 1A0OA 4G2NA 1OPRA 4Q3CA 3TNFA 1IN7A 1KI1A 3R3JA 2Y71A 5FDFA 2YH2A 4ND8B 2PD3A 4URUR 1F38A 1E94E 1F0KA 4BYMA 3EJWA 3PFHA 4YYEA 1EJBA 3JQGB 2HPHA 2XE8A 1A96A 2EQAA 4HWGA 3MTIA 1PT5A 1R6AA 2CB9A 2OBYA 3ASUA 3QVJA 4KQ2A 4OGLA 4U2FA 4WEOA 2JBAA 4W5QA 4JT9A 4B3FX 4NCKA 1ZCBA 4NYMQ 1MGOA 1BG6A 1EK2A 2ILTA 3T06B 2WD7B 4A0HA 1MUUA 1T34A 4HX2A 2GTHA 3BVPA 2NO4A 4IV5A 1H3FA 4HR7A 1BGXT 1C50A 1JZSA 4XX0A 5DWDA 3M89A 5I7EA 5FR2A 4KNWA 1SCKA 4HNRA 4LX0A 4AICA 3FB1A 4U2DA 1KDRA 4Y2HA 4EBBA 4UQLA 2WF9A 2ZSIA 1U2TA 2EATA 3IILA 2FWRA 1NPTO 3HWRA 4LTMA 4R1NA 3BQ9A 4RC9A 4K6CA 3QWIA 1HT0A 1N8NA 2Y6UA 4OD0A 5A9SA 4WXRA 4Q9IA 4KR6A 2YN2A 5T8KC 1YE8A 1YBHA 5E2BA 3VR5D 1TT7A 1DQYA 1M1UA 1VL8A 4HRXA 4V02A 1CJCA 3Q3JB 5HYVA 4I0WB 5FLKA 1U7XA 2CLCX 2WE7A 1B2RA 2NO6A 3A3OA 4AJHA 1YMQA 1BA2A 3WK8A 5CFRA 4QEDA 4B34A 1TDJA 2PLAA 2ZLBA 3T7JA 1IONA 1I51A 1T36B 4JOSA 1JJBA 2ZJ4A 3L01A 2B25A 4ZEOA 5I3ZA 1XKTA 2N3ZA 4UEJA 4NCXA 5I9BA 3R09A 4QXMA 5AKEA 3ZV6A 1W5BA 3JSXA 4R7TA 3RODA 4FFBB 2NO5A 3F7NA 3JYPA 3FJYA 3MGCA 4TWJA 3ZOZA 3OZVA 3A58B 3I2KA 4RIFA 2PMCA 2IWRA 5AW0A 3IPYA 3CU5A 4EX6A 3NYRA 5HJ7A 4NR0A 1Z0ZA 3P9IA 3QOYA 1G20A 3W77A 4ZOLF 1G8MA 3AW8A 5FYQA 4MNTA 4BE9A 4Q47A 1P9RA 2P2DA 4OQXA 1VSBA 2ZRPA 1JIVA 1PWXA 1RJ9A 2BT4A 4PFQA 4AG5A 2AW3A 3QKUA 2C3OA 3TD9A 4DA9A 2JFVA 7ADHA 2YJNA 2GJ8A 2OV3A 5B6PA 1TMKA 2Z9DA 3C5VA 4OQPA 1FE8A 3O0DA 5B1EA 2OK7A 3X2FA 2GARA 3KLNA 3E84A 4QDUA 5EEGA 4XUGB 3W5JA 3V8PA 4J1NA 4QLAA 2YFHA 2P2ZA 4I6EA 1YCGA 4XJTA 3I9MA 2YWGA 2P69A 2VA9A 2DFPA 1MO2A 1OX6A 4QXAA 2HCBA 3DDHA 5I7SA 4X6UA 5SZIA 2Q3DA 1CNEA 1EFCA 3HN6A 3KOMA 4GM0A 4GG1A 1WF3A 3RW9A 3WLHA 5L8VA 2XMDA 5FULA 3KYDA 3S2YA 1ECGA 3HCOA 4MUEA 3K0BA 4MJLA 4BXOB 5LC1A 1KPGA 4QIHA 5TT1A 1WSDA 2Z2YA 4LYJA 4F3NA 1W5SA 3SBEA 3ICQB 1DBPA 2IYZA 2W6OA 4XTCS 1SEPA 2VP3A 4B3SB 2CHGA 4OH7A 1ZN2A 1XQ6A 2C94A 2JF0A 5EN4A 2YWFA 3L7BA 4MQFA 1FFDA 2GDZA 1VIAA 5JISA 4FYXA 4RZXA 3TZBA 4P2BA 1IMOA 1JXMA 4PGGA 2GM4A 1B0PA 3X0DA 5DN6D 1J0DA 1TF5A 2LDBA 2PWAA 1UM9B 2A9JA 2R85A 1A1VA 1UZNA 3RG8A 1Z5ZA 2Q1TA 2HPVA 5IJ0B 2A1TS 2FWBA 2SCUB 3KC2A 1TQ6A 5BSTA 2CV0A 3F6BX 2R97A 2BN4A 1E4YA 1OIVA 2AFHB 5TQ0A 2PFSA 3WK6A 1MENA 1R88A 1PL8A 3B70A 1YU9A 3P0FA 4QICA 1TJ3A 2DKOA 1FFAA 1O95C 1VJCA 3FYUB 4Q93A 5CVVA 5JUWA 5F9HA 4RDHA 3R7WB 4BZQA 4EFDA 3O82A 2OO5A 3WISA 1ECFA 4TRJA 3JZMA 1PZGA 4HDAA 4MPDA 1F14A 3SU8A 1ZJ6A 5HKKD 3AR6A 4OHKA 4CG1A 4YXFA 3BCUA 4RXTA 4ATNA 4CLXA 2ZBQA 1XFAA 3B1JA 2R7KA 3NH6A 3PSHA 2H2FA 3E7FA 5IX8A 3SBXA 1FW8A 2XT0A 1XJCA 2B1RA 2BM9A 2GCEA 1SU7A 2AZDA 2EJVA 3Q40A 1VQ1A 3OT4A 1L5HA 4AZTA 2ZIEA 4WRRA 4OQNA 3L18A 5D7BA 5TSDA 4C4SA 1MRNA 5I4KA 2P2GA 5ITVA 5K3OA 3VFDA 2IFTA 5D6NA 4MLCA 1D1QA 2PX2A 4OVKA 1KIFA 3U26A 4BBAA 1MD9A 3PHIA 1QHYA 2P3QA 4DNOA 1EK1A 3C8MA 3UAZA 2H31A 5TLSA 3FMIA 1DP4A 3W34A 2B98A 2EFEB 5DKFA 3S3TA 1D1TA 4L6CA 4P92A 3ZY6A 3IAFA 1H22A 1ZGAA 1AXGA 1EWKA 2VJMB 2Z9CA 5LP6F 1C9MA 2NVUA 1WDKA 5DM2A 2AXEA 3P9RA 1JXQA 3ZWQA 4I4CA 3GX1A 3N2EA 4YROA 4PR3A 1B3RA 5FUWA 2H4FA 5IZ4A 3UB4A 3VZQA 5T41A 4D74A 4CNBA 3C6MA 1F2UA 2FFAA 2XTNA 1NVKA 1WXFA 4FI3C 4HHEA 1KDVA 5LQJA 3UAOA 2C2OA 4IIFA 3AR5A 4D5EA 1S89A 1LI7A 5JPDA 2V7PA 3VDRA 1A4IA 4BEBA 2OCGA 3OLWA 1B1CA 2KW5A 4F46A 1AURA 5BQ3A 3WLLA 4AJ4A 1Z6AA 3RC8A 3HR8A 2C4WA 3NUZA 2B1GA 5HE8A 1DBQA 3O2SB 1IWPB 4N8EA 1NOJA 4N01A 4Y18A 4A2PA 1W73A 1FDTA 1Z8FA 4LA4A 4LCEA 3DB2A 5EZQA 3ZPXA 3NNSA 3PHBE 2ZDHA 4H1VA 1O0BA 1G2PA 1UBNA 3D4BA 4W6ZA 3RKRA 1LFDB 4WOKA 5TJHA 4ENVA 5JFGA 4IOKA 1RBZA 3Q7TA 2QRMA 2ZQZA 1JAHA 1T6XA 5CLFA 1W48A 2OZLA 4IH4A 4BKUA 2W98A 2ZSEA 3HYTA 1Z26A 2HBRA 4HNGA 2C7OA 1M2FA 4HEQA 2VSFA 3Q6NA 4U8HA 3BKWA 2AEEA 4YUAA 1MOSA 1NR5A 1ZAKA 2PEZA 3FM9A 4UHHA 4QGSA 4Q1BA 2QLNA 1X6VA 3H9JA 4DA7A 2XV1A 4AY6A 2MU1A 3E61A 1PHPA 1R15A 4K9PA 1GWNA 1GU0A 5JCJA 1N7HA 5CURA 3FMPB 4DWVA 3FJOA 5TS3A 1J23A 3FUVA 3NTRA 3KXLA 4K9MA 4G4IA 3PHCA 1AKTA 3AO0B 2DR3A 3E9YA 4E07A 1YFLA 3PPYA 5JMOA 2XODA 1EPUA 1T1SA 2XY4A 2W4IA 3ZDYB 5IBCA 1BVHA 3H6KA 4Z0TA 5DBOA 1XD2A 4ZRDA 4G5GA 2YN4A 1N75A 1JFVA 2CMFA 5B1IA 1OWLA 4BWYA 5AIBA 4ISBA 2J33A 3FTPA 4RZSA 2YJGA 2VK1A 4UBLA 2FR8C 5BWLA 2WDPA 1OI7A 2DP4E 4CM9D 2IHZA 5DGTA 1EGAA 3GDFA 3M6FA 3KUUA 2JFPA 5JSZB 1OLXA 3H11A 5F21A 4ZVKA 2XIJA 2HT6A 3ZR4B 1DFHA 3CNNA 1VE5A 4Y9SA 1H8HA 1YTUA 3UXMA 2EFYA 1XGKA 2QL5A 3JASB 4FEAA 4GU5A 4QUJA 1C2YA 3NVKI 5F1YA 1SBNE 1KI6B 3KJEA 1ZKDA 2AG6A 2Q8QA 3R6DA 4NZNA 5A6VA 2ALJA 2V7UA 4IGAA 5IK2A 1J5XA 1JJVA 4YP9A 4LGCA 3UJAA 3HCBA 1XRPA 1EI9A 2FMIA 2WYOA 4NU6A 1NBEA 1DBVO 1OFVA 1XA3A 3KHUA 1SUSA 1I6LA 1PZHA 2DJ5A 3NETA 4PSVA 5CNKA 5FORA 1E61A 1WA5A 1XA4A 1KJ8A 3JQ9C 4G86A 3ZJYA 3AXTA 4IUBS 4X64B 3MC1A 4PN3A 1JIKA 4KRYA 2F8LA 3GLIE 4RFLA 3PEEA 1JAZA 1NOKA 3QA3E 2P7IA 1YCHA 4P3XA 4Q4LA 1THMA 5K6AA 3W78A 3ZHVA 3TIIA 1ENPA 1NLUA 1JQDA 3D6HA 2V1UA 2R0QC 5HF6A 1XZKA 3LCVB 4D3FA 3ZGVA 2HF8A 3QWFA 1QGAA 4Z0PA 2I6SA 1BD3A 1XEAA 3AW9A 1T8WA 4Y1RA 3OU6A 3VPBA 4EYOA 5H9WA 2I67A 1KGDA 3RUIA 5TQ2B 3K6SA 1ZSYA 2DFTA 1I3OA 1ZK4A 3AP2A 3NHSA 4ZQGA 3CQ9A 1ZD4A 4WN3A 1AN0A 3WQSB 2HHJA 2OP0A 5HKAA 5IVHA 3QX9A 4JJAA 4UVIA 4EY8A 1N2XA 1WAMA 1MTZA 4G97A 4KWIA 1U2ZA 3RKSA 2PFKA 3BD8A 2OD2A 1ANKA 4JI5B 1N3BA 1K6MA 2CXNA 3WWZA 3MD9A 3E7XA 2P8SA 1LLQA 2QZJA 2Z98A 2REOA 3I4CA 4O1MA 3NBQA 1E9BA 2AIRA 1YJQA 2B4RO 2RCNA 3DFUA 3SZMA 3MWEB 3GGGA 3ZCXA 3B3QA 3UWKA 3LCCA 3AHFA 3S29A 3THRA 4BASA 3ICWA 3PE4A 2OO7A 3GW8A 1L1EA 4E94A 2D2XA 3ZJVA 1K2WA 3TW8B 5FOQA 3CCCA 2B0JA 3CUSA 1NW8A 2IYYA 3V9PA 4B6OA 4LQLA 2FSVC 3UPDA 3OZCA 5CJPA 2HLDA 5B58T 1BEEA 2PKQO 5IC5A 2FJUA 1ZNQO 2C3PA 2JLBA 1I9CA 3COSA 4C08A 2UUPA 5FEUA 2Z6AA 5FPPA 1VFNA 3B8EA 3Q9LA 5ICCA 1QM5A 3GO4A 2RHMA 3FPJA 5IAEA 1BHQ1 4MUMA 2XVYA 4HDMB 4IJQA 4RPKA 5MHTA 2RGXA 3A3YA 4C0JA 5AVVA 4V0KA 1J39A 2X40A 4B6FA 3KV1A 4R8LA 1DIAA 1N9GB 4U8GA 3REQA 4Q3DA 4BNDB 2C77A 3LFTA 1IG3A 1RWMA 3KYCA 4FHDA 3UJ3X 4DCCA 2G77B 1U1EA 3FTDA 2PUTA 3ZDFA 1JGTA 1SK8A 1UPFA 2C8VA 2XX3A 3F5MA 3TUZC 2VQDA 1OCEA 1G1MA 3IJEB 3TJZA 3B20A 1DTWA 4LY9A 2JVIA 3AETA 4M49A 1JI0A 1TJ5A 2PY6A 2AJ8A 3PNQA 2CJYA 1ZNXA 4P82A 1I32A 2QAIA 5G0WA 3T0GA 4BNWA 4HNUA 2XBUA 2L82A 4FCTA 4F5WA 2D13A 3E5NA 2A67A 3GDOA 4NYIR 4HAYA 5E7MA 4XYEA 4EY6A 4IHKA 3ZD9A 3SQWA 4C2TA 3PRJA 4LS3A 4LNHA 4BO8A 2RAFA 1XLTC 1SKYB 1OXSC 3BEDA 3G9XA 2JD1A 1CZLA 1USVA 3H1GA 3LT5A 2V7QD 3TLYA 3ZTTA 4HWSA 5AI8A 1I7LA 1L4FA 2JIDA 2R751 1NR1A 2OHHA 2B7CA 4N41A 5DGHA 1E2DA 2PMBA 3R9KA 4QYXA 1HNWB 1GFIA 2RGWA 4B6RA 3A1WA 2HJHA 2WIKA 3M4XA 4NE2A 1GYQA 3NKFA 1RWPA 5JZOA 2WFMA 3M33A 3U3KA 1V6SA 2QIOA 3ASVA 4WCDA 2IIVA 4TMVA 3S70A 5L45A 3HCEA 4R9UC 1UL1X 2RBGA 2HWUA 3CZPA 1PSDA 3SK0A 2X0JA 4FUTA 2BFDA 3KZXA 4Z8XA 5H1YA 4CMEA 2LE0A 2R47A 1K86A 2Z83A 3BM5A 2X23A 3V1LA 3W4JA 4P4TA 4YAOA 2BR4A 3HV2A 4E09A 3HJBA 3K9GA 4R0MA 4PG8A 2JEZA 4CEIB 3BL5A 2WKPA 2CLDX 3ILSA 5KNCA 5JSFA 1ZIOA 1AB5A 2WW8A 4TYYA 3R6GA 4F96A 1O94A 3DTNA 3STYA 3LTNC 1RWBA 5B30A 2X8LA 3I9NA 4UW9A 3T1QA 3LA8A 3SXPA 1U3WA 3ZWXA 3FBGA 3BJMA 3NFRA 3U17A 5FO1A 4Q4AA 1H6CA 4OQEA 4RSMA 5JATA 1VGVA 5DCWA 4BECA 3EEYA 4L7QA 3VAYA 5ICGA 1U2QA 4BQEA 1QIKA 2KM1A 4GSLA 2J7PA 4E70A 2IW3A 4QX6A 4TVBA 3JQBA 4HYEA 5DSZA 1SVKA 3M6VA 3Q8KA 1VKOA 3HG7A 3R7NA 1NA5A 2O3RA 3KE8A 3C8UA 1XPJA 3DFZA 1AD2A 1F17A 4DA6A 4DRZA 1HT1E 4CIXA 5B55A 1E1CA 1NVXQ 3NWBA 1HGXA 3OJEA 4DIBA 2WUGA 2R6AA 2VPXA 1KYIA 4TLAA 3DM9B 3ETLA 4B4DA 4E5KA 1L1RA 3N6RA 1NI5A 2YS7A 1BGVA 1OWPA 2JIOA 1QH8B 3I2JA 4FFNA 4FZVA 4NU0A 4E2ZA 3KVRA 4BWGA 3SHWA 4V0SA 2Z0MA 3WMEA 4D3ZA 3NOQA 1JMYA 3BWBA 1E8NA 3PXCX 5HOEA 4OFWA 2W00A 2GPJA 3L0YA 3ZW9A 4J90A 1UMDB 1SRQA 1XQ9A 4X1YB 2VHXA 9LDTA 1IEVA 2NMVA 1C1XB 3A25A 2G28A 1BVYF 1QIEA 2YQ4A 1Z08A 3C5EA 5KKCA 3QENA 2JRLA 2F43A 4JZYA 3TLGB 3BSSA 1R0CA 3YASA 5DNUA 3GB9A 3OM8A 3RT7A 5E6SA 5ALLA 2XUIA 3Q7EA 4FDUA 1MJGA 3QMMA 1CY1A 2NUTB 1D2RA 5KJEA 2ZAIA 4FFMA 3RS3A 1NFFA 2JZNA 1K7YA 2A5FA 3ZHXA 2CUZA 1CB0A 5ALXA 1Z18A 2Z2ZA 3CURA 5GP1A 3O7WA 4J49A 4F85A 1QCZA 4O4HB 5EIBD 4CKBB 3KUXA 5B3JC 1TA9A 1W46A 2WD9A 1YB6A 4KIGA 5B4VA 4DJJA 3OPVA 3FJ1A 3WGNA 2XRFA 1QE5A 5E3IA 3OESA 2X4DA 5TRTA 3BFXA 4MMXB 3VU1A 5BSHA 1CY4A 1WV0A 3BMOB 3DMTC 5DRYA 2XOKA 4G0MA 1DG9A 4TGLA 4M88A 1XCGB 4OMFG 2Q07A 1JJ7A 4MGKR 2AFIE 4D3DA 1M6VA 1DBWA 1M74A 5A4IS 1VE1A 3SC3A 1YZTA 1I2ZA 3IKTA 2ZCJA 4JEMA 3BMNA 1Y9JA 3NWEA 1SGWA 4R41A 2QQGA 4U2EA 3ZJUA 3K32A 4GL2A 2EHDA 1M34E 4Y6GB 5HA5A 1VKJA 2BHLA 3R6LA 1NAHA 3TZKA 1F7VA 4V0ME 1WVIA 4TROA 4FSDA 1JEOA 5FNVF 2CFSA 2JA2A 3O0TA 4Q6BA 3ZIAD 1DKLA 1AVTA 4Q3AA 2BGUA 3RVKA 4TZKA 4EPWA 1XNGA 3ND7A 2P6UA 1X1CA 2V45A 4XM1A 3DBLB 2J4CA 3RI3A 2WU1A 3A0RB 1KFCB 2GZSA 2BEWB 4RVOA 3KNZA 4PZLA 3PC2A 1L5ZA 1W0JA 3RSSA 4ZMSA 4MGHA 4B81A 3OY2A 4C29A 3C15C 3K8ZA 1P3DA 2A9KA 2IHYA 4LXXA 4XCXA 1E1LA 1FVHA 2G8LA 2CWWA 4KPEC 1I0IA 1A9OA 1BXGA 3BWYA 1KHHA 1FRQA 3A04A 2QPOA 3OX4A 1D4ZA 1M1ZA 4UAJA 5B4UA 2EVWX 4XTRA 5CB4F 2B7LA 2H51A 4R31A 1U4NA 1YIDA 3MUEA 5IMSA 4N12A 5CXUA 1LDBA 3G9QA 3OMWA 3MGGA 4BKOA 1BWRA 1MO6A 2F62A 3BB4A 2BI4A 3O83A 4DYDA 2H8GA 3WWDA 1U7ZA 2F55A 3RJMA 4CU5A 1A2BA 3D6TB 5EUCA 2QRGA 2A6PA 1XCJA 5BR4A 2Y05A 2DBYA 1SXJA 2W4QA 4ER3A 1T4CB 3QNMA 1OGJA 1QCCA 1JYFA 4BTEA 1QPZA 2FEWB 1UKVY 1Y7IA 5ALDA 4A2CA 4L9RA 2PZ8A 4MR7B 3WMXA 4JELA 3OD1A 3PZBA 2XUAA 3UK0A 4ZYTA 1KFJB 3FCSB 4N8DA 4FWIB 2AH5A 5AP9A 5BMOA 3FSJX 1QP0A 4WHMA 3K30A 4CQJA 3AOEA 2ZR9A 1MBZA 1P4HA 3GVCA 4HLNA 3S2SA 1V1MB 2IXAA 2RHCA 1XUOA 3IIEA 1DKPA 2YFYA 3WIDA 1ILEA 1SCDA 3AVOA 3QX7A 3P9KA 4MYSA 4LMBA 4CV0A 5JASA 1A9XA 5FHQA 2BFPA 2RHLA 2QK4A 1TO1E 3EVGA 5C8XA 1PT6A 3MLAA 4L15A 3GFVA 2WQ7A 4BLOA 1FVFA 1A8IA 3U49A 2XITA 2PH7A 4R8KA 4ECAA 5ALPA 2G9ZA 1H0RA 1AA9A 5C52B 3BE4A 3AT1A 4BTVA 1KZ4A 2HF2A 4AKEA 1QTQA 3GARA 3EYAA 3RVOA 1E3EA 1EDBA 4PHHA 2PAFA 4I1YA 4DUZB 2UYCA 4NU5A 1H0SA 1Q2UA 2IYOA 2XZLA 4W5WA 3L46A 2YFQA 1FUUA 4KLAA 2L42A 4XQEA 2PT6A 3TN7A 4J43A 1EDEA 1U7PA 2HZ7A 1JF8A 3WG9A 2VDWB 3EAQA 3ZQ4A 3GDHA 1NBIA 3SZOA 4FSXA 4GPTA 3KZCA 3G5UA 4BEWA 3PYLA 2OY0A 3SHOA 3WP1B 2FXIA 3BJEA 2V74B 3G82C 2FHSA 4HQLA 3R2JA 4HDRB 2RCYA 4ZVRA 4NCHA 4DRXB 1R3UA 2IZ5A 3W05A 3A6JA 4UBMA 3ACDA 4JSRA 4YJ3F 3OPXA 1PYDA 3I76A 3DMRA 4IVQA 3KOXA 4K9OA 1JWLA 1TB4A 2VYNA 3AL2A 3STXA 3CX8A 1IBSA 1BCRB 1XRQA 4I2VA 4MCIA 2AA3A 3M2TA 3MS7A 2OGUA 1SOMA 1Y3FE 4QYMA 4DUGA 5SY9A 1RTTA 2P6MA 1JN0A 2EG9A 2TMGA 2IZZA 2PT7A 3BILA 4M53A 2LGJA 2HN9A 2VBGA 4TLEA 3BORA 2ZS7A 3T7TA 2LNDA 1G20E 2DT5A 2R60A 4YRIA 3UA4A 4EM6A 5HOQA 5KOYA 1XTBA 1C8VB 2BFCB 1FTYA 1JRLA 3MIIA 5H7XA 4J1TA 5JD6A 2Y76A 4FCCA 1BMTA 4R7GA 2BKEA 1QE0A 3P5SA 4QG7A 2CJXA 5CVEA 1O6ZA 5A6SA 5A62A 3LC7O 3R5FA 4FE3A 4TV9F 3HO6A 3SC2B 4OH1A 4Q3KA 1PK9A 5EIBC 3B7WA 4FDAA 3KLMX 3EUAA 3OZTA 1P0QA 4GBED 3HABA 3Q3HA 3CUVA 2ORWA 2WJGA 1ISHA 5KX5B 1W30A 3TEMA 4KE8A 1ODIA 4JP5A 4EYKA 2HDHA 3TE6A 5DM70 1ZRMA 5SV2A 2QAGA 4EEZA 3JWPA 3D8SA 2WI8A 2B2NA 1EINA 4WNYA 4HOYA 4M83A 1ZUD1 2AQKA 2C1XA 2EGGA 5LQUA 2VZ0A 3QGMA 3R7LA 1Z7GA 2J6HA 3STVA 1O4WA 5IH3A 1RABA 3G7UA 3HKCB 4G6ZA 2I2BA 4IDCA 4E2WA 3ESAA 1P6QA 1M1YB 1URPA 1V4BA 2VP0A 521PA 2WLSA 3UB2A 1WB9A 2BTEA 4ESOA 2WJPA 4WBSA 4CLRA 2CF5A 2PUAA 2C4MA 3AERB 4CG3A 1Z7YA 3IKMB 3QOXA 3A3KA 3F1KA 3RSCA 1LA2A 4EUEA 3CXUA 3ORSA 2LPMA 5JD4A 1ZLXA 4I4TA 5EUMA 3RK0A 3RVBA 2XH8A 1DWQA 4X8OA 4ZGGA 2A9QA 2PQ0A 1UFKA 1BIFA 2OESA 2Y9PB 3ORYA 1KE2A 3RSFA 3ZTWA 3T3MB 5IANA 3O3MB 4NCAA 1FDOA 2DKNA 1K3FA 1PJ4A 3I34X 1HM5A 1KMQA 4WFJA 4HAWA 3TR6A 2ZAYA 1Q57A 1HDGO 2O8CA 3B5IA 1YBAA 1X38A 2BKXA 3Q15C 3F5FA 2O57A 2F1IA 1EEXB 5EJ6A 1IWBB 4MA0A 5AW4A 3TNYA 2ZWIA 4U7TB 2A1UA 1N0VC 4ALMA 3B5EA 5G1PA 3N59A 1JAYA 4ETMA 5BP7A 2XR1A 2H5JA 1E3MA 1EXVA 3LPNA 2AK3A 3K2BA 2P6RA 1Q91A 5EOVA 1RXVA 4MMZB 4A0QA 5GWXA 4CMKA 2ZSFA 4ZVNA 3T0FA 1SUFA 4WXMA 2O06A 5LWQA 1TF7A 2ZT5A 4G4GA 2GHQA 1MJ5A 3ZC3A 4BMZA 2QTZA 5GJCA 4H3VA 3RYFA 3MJ4A 1FFXB 1IZ7A 2FEKA 2QLFA 5I45A 2Q41A 2WYHA 2JFYA 4L2IA 3QHQA 5LLSA 3RK1A 2F1RA 3SEQA 1Z2NX 2PX6A 5K3DA 3KHTA 4W7IA 4E7PA 3N8KA 1U7OA 5FT9A 3IUJA 5D3MA 4NJMA 4IG4A 4HRAA 4PPQA 4CT0A 1IRXA 2OXEA 4UAUA 3O1HB 3ISTA 3RJ9A 4DLRA 3AIMA 5FTWA 3IV9A 1PVVA 4J4TA 5IN4A 1MJGM 2FFRA 2LRHA 1Y6ZA 1Z2CA 2NU6A 3ITEA 3T7DA 4DGQA 4P08A 1I1NA 4IO0A 2ZWOA 3OCYA 4MWCA 1O8CA 2AN3A 1H4VB 2SBTA 1YUNA 3NHWA 3VR4A 1Z22A 3T1OA 4OM8A 1E5LA 2E49A 2GK7A 4LJRA 2PZEA 2QXYA 4UCFA 5T67A 3U81A 3VR6D 3BHNA 1GAWA 3FSRA 4M9QA 4CQLB 5IABA 1R0LA 1D5WA 2GI4A 3AEUA 1SD2A 4CTNA 3KZVA 1H05A 2FSPA 3CVWA 3P45A 1YQ9A 2Q0XA 3DTVB 3UK6A 3PKIA 4QGBA 5DB4A 1P5JA 1VP9A 3FVRA 4P32A 3TGPA 4MCJA 1JQKA 2HSWA 2VLBA 4Y0AA 3BX1A 5GGXA 4BQNA 3RYIB 4BTLA 5BN3B 1QOZA 5BR7A 5TGZA 3DBHA 3VKFA 5LNK6 2B1JA 1U9YA 4IILA 4QQKA 3DP9A 4BO2A 1OT5A 4W1PA 5BQXA 1P1IA 3CX4A 3TZLA 1IOLA 1EWQA 3BGOS 2VIIA 5LDHA 4UUAA 2C2GA 1P0IA 1JX6A 1QANA 1LLDA 3B13B 2PSEA 1FYFA 3VSAA 1ZUNA 1J2JA 4C6TA 4F06A 3GOQA 2Z4SA 5TMPA 2GAOA 1P8AA 2HJ9A 3AINA 2QI9C 3ZK8A 1KAGA 4PZAA 3JQAD 2R7MA 5I7RA 1NIPA 1FDVA 1E2KA 1W2WB 3RC3A 3O73A 1TTQB 4B0OA 4D9JA 3LLCA 1GL7A 1PFYA 4FJ0A 5HZKA 3HVJA 4B6JA 4PC6A 4DV4B 2ACVA 4FS3A 4TWAA 1XTJA 4JQYA 1NNEA 5HBGA 4HXGA 3QE0A 2YV4A 4HATA 4KB5A 3UUEA 4XVCA 1Z33A 3VR1A 4Q1FA 1WCXA 1G17A 1T6NA 4X6LA 3PL5A 2XOEA 1OUMA 3ND9A 4FYMA 1TMOA 1MJHA 4HAVA 2BKUA 2WU4A 4CE6A 4YRBA 4MW5A 1Z2OX 3AR2A 3VPCA 5GTDA 1CUXA 3TLEA 1VA4A 1MXFA 4XI9A 2P2NA 2RH4A 4HB2A 2E18A 1H66A 3FIJA 1XX6A 2J9FA 4XWAA 2VTKA 3LE8A 2VJQA 4MRVA 5KTNA 3H18A 3S8MA 5HCUA 1IZ0A 4KDEA 5L51A 2YY7A 1P8JA 3RVDA 1WG8A 2JFXA 1ZL2A 2H2DA 4HLDA 2DBVO 1Q7GA 3SJAA 3GRZA 3PEWA 3C1TA 4JQZA 5T3YA 1KWGA 2CFCA 1ECBA 1XXHB 2QNIA 2DFKB 3E2MA 3TQRA 3OZDA 4PG4A 2CCGA 5BYKA 3FYCA 4GT1A 3LQYA 4ENRA 1Q77A 5CAEA 3G1TA 2B94A 1Q16A 4Q00A 1QCYA 5C1PA 1SUWA 1OGYA 1WSWA 2W7TA 5KB3A 5LU9A 4D25A 1KJ9A 3E03A 1ZITA 4P33A 1E1YA 1FB5A 1KMHA 1R4MA 1FP4B 1IHOA 1B6GA 1NSTA 3D1JA 3GF4A 3H9QA 2XTJA 3MJSA 4BV9A 2OHFA 4HBGA 5L3QB 5CGQB 4RKRA 3TNDA 3U4QA 3DJYA 4UUOA 3UWSA 4HJRA 4BNMA 3WC4A 2B37A 4BB5A 4FBGA 2ZPTX 2AKYA 3K0AA 4YUYA 2A2ZA 2WTAA 3DOEA 5DRTA 4DILA 1Y8RA 4JXJA 4A6DA 1SU4A 2Z1MA 4D92A 4NAUA 2QL9A 1G6KA 1UC8A 1YZYA 1TTHA 2Y1CA 5KYXB 2ZBVA 3JVIA 3TZQA 3U4IA 2ODTX 3NCHA 3QVUA 1IG0A 3FMFA 3QI2A 3Q87B 4QT0A 4N5DA 1G5IA 4E4TA 1FCJA 3RCBA 3WNCA 5BVGB 2YYZA 1T8TA 2O2EA 4UCWA 2NVOA 3B51X 1OXMA 1S8NA 3PCRB 4KXFB 2O7SA 1VYUA 1ZVQA 4WPGA 3W06A 5JYCA 5BORA 3BXHA 2AF3C 2Q8PA 4B79A 4DCNA 2IE8A 4L8LA 5BUQA 4IKEA 3FPAA 1X80B 1UT8A 1E5VA 2XNKA 4ZOLA 2UUOA 4DFDA 4OA8A 3ZYCA 3VYWA 3DDNA 3D02A 4C3UA 5F12A 3OE5A 1HTWA 1G5RA 4P5DA 2PLNA 1WXHA 4UBJA 4BC0A 2HJSA 2FPWA 3EEFA 1JKIA 2IUSA 3GCZA 1JU9A 2G76A 1N5JA 1NUAA 2JFUA 2JBWA 2Q3FA 2IP1A 1YVEI 2WP8J 4IRMA 4ERXA 4O2RA 4QASA 2GF9A 1Z7WA 4UBIA 3LUFA 2QIPA 1I5RA 1JE0A 1PWEA 3SIPA 4B17A 1FYXA 4KG7A 2QX7A 4M9SA 1WZEA 4AXBA 2I3BA 5FIUA 1T1EA 5H80A 4R1PA 4I9HA 4OHOA 5KTTA 1KEEA 3LM8A 3MW8A 3TLCA 1HDRA 2VF8A 4EG3A 1FXWF 5LNK1 3NKVA 4P6VF 1CUZA 1GUZA 2J9YB 4NABA 3OEED 2JCBA 1QLJA 1G7SA 1N6RA 1YGPA 2H18A 2KBEA 1KKUA 3PJFA 5SY6A 5ULLA 1R0KA 1KYTA 3I12A 1KQGA 3CONA 4RKEA 2XZOA 1MOQA 4X5OA 1T43A 1HFKA 3EPJA 3CWCA 3U19A 4DCVA 5J2TB 3OZSA 4QUGA 1KI8A 3PXXA 3E9CA 5J9FA 3OZ7A 3UBMA 4R05A 1QDEA 4LQCA 2G4CA 5FKJA 5SZJA 5LP1A 1QZTA 2IC5A 3K0KA 1GSHA 1U81A 1LDEA 4G8JA 1B3BA 4U7FA 4XGQA 3AEZA 1E5QA 1NWHA 3BGWA 3DAHA 4EFNA 2PX5A 3A6FA 2QR5A 3WYEA 3KOZA 5AUPB 4L0CA 1Y8AA 1SC1A 3AONB 4RTOA 2D4HA 3NRJA 5CRIA 5DVZA 3IQWA 1CZHA 1W52X 5A06A 5A4DA 3IKJA 4M1OA 3DEKA 2DPLA 5J5AA 4C87A 3L2OB 3QI7A 2EKQA 1SY7A 5B12A 1VJ5A 4LYFA 1X14A 2H52A 1JG6A 1DUSA 3CVJA 3C98A 1JSRA 3T5TA 1E6MA 3UFXA 1UJ4A 4HI0E 3LVRE 3DXZA 2PV7A 2YWCA 3W04A 2C0QA 1GU7A 2CVOA 4F45A 3ZLVA 4GNRA 1W19A 4RHXA 3NJ4A 2C2MA 5AVTA 4PFKA 4E1BA 4Z2AA 2ODEA 3EFHA 4M54A 3TSCA 3BJIC 4HRYA 1APBA 2NTJA 2W2PA 3CX3A 3RWBA 4B3MB 1OZFA 2NXWA 2QRLA 2J3DA 4G36A 4YQZA 2KSQA 3WBJA 2O19A 4PLTA 3HRHA 2EX4A 3N3BC 3UJ7A 1OGIA 4R8RA 1GT6A 4TMTA 4GC5A 5DBHX 1Z4PX 2JNWA 1ZGCA 3WQHA 1SHKA 1LDMA 1EFTA 4HGQA 4PO3X 1NUQA 3T99A 3ZWVA 1T5HX 1BVRA 1YBVA 1PFUA 1SC9A 2GOYA 3ML1A 1E98A 3RR2A 3QX3A 1A9QA 4L08A 4PF1A 1GR1A 4RZUA 2YWEA 2IP4A 3A4TA 4TMZA 1YS9A 1O8BA 2B92A 2PX0A 3B9QA 3MN1A 5BN5B 4BO1A 3SKXA 1GTVA 3BD6A 4BQPA 3CIFA 4ZKDA 1N0WA 1RI4A 3LGSA 3RSOA 4C21A 1XRLA 1WWKA 2XPCA 3PT9A 1NG9A 1IXSB 4F4FA 2XRZA 3K15A 3PA8A 4WBNA 1L5WA 3HGTA 3LBIA 1UF9A 1L3BA 2AR7A 1IJBA 1ZY2A 2X6RA 4IWYA 4NATA 3GCXA 1UDRA 1Z6YA 3EDYA 5AMXA 4ENQA 5KYTA 1T5BA 1PZNA 5CDSA 1OFTA 1YQGA 5AHOA 4EH1A 4BAUA 3RUDA 3ZHOA 1WNFA 1G9SA 1XVIA 4HMPA 3VZCA 8LDHA 4ZVPA 1L8AA 4JJKA 1NVAA 1MA0A 4B6EA 5K01A 3U6KA 4PE5B 1DTSA 4GF5A 3VUFA 1RC8A 2XTAA 1IVNA 4XB1A 3WK5A 2OXFA 4A0FA 4L5CA 2DM6A 4KHPB 3ANSA 1ZS9A 4NECA 4N9QA 1E79D 4EUNA 3HB5X 2UZ0A 3QEBZ 1XK6A 3OOHA 1VJGA 4WTOA 3H4IA 4MV0A 1PJTA 3TMYA 2ID7A 4F21A 1QB8A 1NL3A 1QE3A 4NHOA 1TNDA 3OZIA 4TKUB 2PMEA 5BV0A 2VQFB 1XMSA 4K2AA 4MV6A 3SSOA 1ODLA 2BV3A 3HEAA 1QX3A 3GZNB 1CYEA 2CEAA 3GFGA 4MHTA 2HDWA 5AJXA 5DNYB 1WVMA 2P1RA 3L93A 3TSWA 3R5XA 4DHWA 3FFTA 3O75A 2IYSA 4YJDA 4FFOA 3DYVA 2NTNA 4NZ9A 4EEKA 3HNPA 2ZRMA 3CUWA 3EGVA 2GBIA 3G85A 4TKLA 5HBRA 3WDMA 5EMKA 4B4OA 3LLSA 3MWDB 2VHQA 4XUDA 3B38A 4CCSA 1U9CA 2O0KA 2ROQA 2FAXA 1E9FA 1B73A 2RI0A 2A9FA 3G9UA 4I46A 1DAMA 4IYRA 3VNVA 1JR6A 5J4KA 4BDTA 1NXWA 4YJKA 3T4EA 1VG8A 5AYVA 5C4IA 1TU3A 2EWMA 4IIXA 3IUYA 4Q9AA 1LUAA 4Y6OA 4EQ6A 4Q37A 2OV4A 1DU4A 3IVAA 4OHMA 1V4NA 4Y2SA 1GDTA 1UINA 4LOIA 3ZX4A 4IFEA 3ABIA 2ZFUA 2HBZA 3IEXA 2WVGA 4UJ5A 3W90A 2YVKA 2Q2OA 4DCOA 3CBQA 5A4FS 3N2NA 4OL0A 4EW2A 2WNHA 5CX4A 4UARA 2MHCA 1G6HA 2QD5A 2YZKA 2LWIA 5IAJA 3N58A 4ZALA 1S1CA 5G0TA 3U61B 1VL1A 4A8JB 4QA9A 3WGMA 3L0CA 4CQMB 1TFRA 3AL3A 1H9AA 3NTQA 5IKOA 4QFDA 4ACBA 4EMSA 3BZUA 4PZ0A 3F71A 3F74A 2JJQA 4QU9A 5E9WA 1AKWA 1J33A 2ENUA 2MDTA 3LZDA 2IY8A 3CW9A 1GGNA 3EZ6A 5K3AA 5D01A 1DEKA 3OO0A 4JGGA 1G5QA 3WNQA 1N1MA 1B14A 4UTZA 5DHUA 1ZNZA 2OUIA 9MHTA 4JB3A 1GUDA 4KVFA 2JGFA 5FAKA 1KHTA 4FHGA 3QV2A 5EWJB 3KKZA 1DRVA 3VOSA 4LF8B 5F2KA 1GV1A 3NBXX 1R4NA 2OCPA 4RV5A 1R2QA 4FP9A 1Y8QB 2P9FA 1M0EA 1X2EA 3VVCA 3IUEA 1Y81A 1G5TA 2CKDA 1EXWA 4K1XA 4E22A 5I9NA 1SQSA 5A3VA 3EE6A 4COKA 2CK3A 2Z5LA 4DA8A 1OA0A 3ED1A 2C4VA 4WCFA 4QOGA 3KB6A 1WUJS 1PFWA 3M3PA 5KOHB 3EQ9A 2EU8A 4AG6A 1NSYA 3T3OA 1SXJE 5DSTA 4B8WA 4ZZ3A 4JQOA 5IH7A 3ZHUA 1EVKA 4Z4EA 4G0NA 1NW6A 5CDGA 3QLVA 4RTJA 2BKLA 4CL2A 2GK4A 4ZT7A 1KEZA 3UMGA 5A7FA 3DHVA 1UKYA 2JD2A 4R2WA 5MN5A 1BOFA 3U4AA 4QU5A 2P9EA 2ZRGA 3T5DA 4RJTA 1NRIA 4OHCA 1OLOA 4BFVA 1T5OA 4ONEA 1OX4A 1Y0BA 3LT4A 5C1IA 4S05A 3JQ7A 3GJXC 1EFAA 4JOCA 1WKCA 1U1DA 1P91A 2P9JA 4N9WA 4OA5A 1Y9DA 3VH1A 1PZMA 1XZAA 4GLJA 1U9IC 4E5YA 4FFVA 1SBYA 4NV1A 1XZ8A 3KXIA 4G0UA 1TK2A 1TAQA 1JQ5A 2B4AA 3DOCA 4L0QA 5DHQA 4LIPD 5AXDA 2XSZD 5HM6A 1MB9A 5CXSA 3OT5A 2GZMA 3VO2A 2OLEA 2O1XA 4HVTA 3KWJA 2FPPB 3K53A 3AKZA 1IPFA 3JTEA 3OIYA 5DXFA 2AX4A 2FOLA 5TX7A 4NFSA 1S4MA 1ZJ5A 1ZDMA 3SSNA 3H84A 1DBIA 1E7MA 2WMOB 3BGIA 4PQYA 5LU8A 5C18A 5C5EA 2NSYA 1LPAB 1Y37A 3HY4A 4WESB 3SG0A 5J47A 3ESQA 2FYTA 3T9FA 1S8FA 1PR5A 1UP6A 1I1HA 2J85A 2QM3A 1L9KA 4JDPA 4DANA 2DFDA 3FAKA 2JGDB 1NZDA 1JQJC 2IEIA 1XTZA 3I1IA 1QK4A 3OFND 4HAXA 4NFHA 5J5VA 3L1VA 5JCPA 3BTOA 2W42A 3ED5A 1GG2A 1JLLB 2W2MA 4DAOA 1RI5A 1NQVA 2PS1A 3AJAA 3F4LA 4FOOA 1FU8A 4J29A 2I33A 4KWEA 4LDQA 4MW1A 4UUQA 5AM1A 4DC0A 3U5ZB 1Q44A 1TM2A 2UYYA 3A9SA 4C22A 2J41A 4IV0A 3LK6A 5EZSA 1QIGA 1R74A 3AUXA 2J0QA 2PWPA 2XUJA 2W2OA 3LRXA 3R9XA 3IO5A 3OFJA 1DMSA 4LK2A 1Z0UA 3JAMA 1RTKA 2PCLA 5KHLB 3HH8A 2V3WA 3IEVA 3RUFA 1NW5A 3BFJA 1VLLA 1CVIA 3AHJA 1H85A 3WXBA 1L8QA 1KH2A 3T54A 4B45A 4RMJA 3DQZA 3QY0A 4TQUS 3UYKA 1JG3A 2XZTA 2GUWA 2QMHA 2JCGA 3BGDA 4LZNA 5IDQA 1VIMA 1LNZA 2DAPA 1F1BA 1U1FA 2VDLB 3DVRX 4NBVA 4X20A 1N5OX 1O6GA 4UMFA 4A6PA 3R6WA 3OX3A 5GAJA 4GM4A 3LPDA 2I1LA 2IF2A 2I5PO 1C7RA 1K7CA 4MR9B 4QDZA 4ZI5A 1STOA 1F6BA 3SS8A 1ZYUA 3OKAA 4ZVVA 4EP1A 2BHNA 4J2OA 4B0PA 2N47A 1XHLA 3BQNB 4OB6A 2EIXA 4JBWA 2XGGA 1XF9A 2HUNA 3GD5A 1KL7A 1NYTA 3HKEB 3BB1A 3K05A 4X7PA 3X2EA 1DXHA 3IIKA 4HZIA 3FUCA 1L7BA 3NHRA 3QJ5A 3RAFC 4F72A 4BNGA 4ZI2A 2H4JA 2HGZA 3GLVA 4H35A 3D3JA 2QTFA 1Z5UA 2IHBA 3R0QA 3E8XA 3HI4A 3G49A 5COAA 4DJDC 2CW5A 2W2LA 3ZVRA 3BRWA 1G3MA 2QN9A 2FQYA 2H6EA 2KLHA 1ULAA 1ZJJA 3VO9A 4F6LA 1YK1A 3TQCA 1JHRA 2Y68A 3M3HA 1GNVA 1Q3HA 1TI7A 3A1NA 2VK4A 1QU3A 2GZDA 4A0SA 3D4NA 4PZCA 1LLCA 3NGLA 4QJ5A 4QOJA 4QUBA 3T34A 1W93A 2KHZA 3A4NA 2RHWA 3QFCA 4JLVA 4YV2A 3MJRA 5E8RA 3CXRA 1JMKC 1U5BA 1W1UA 1NQOA 4OXYA 3VXKA 2J3HA 1CR1A 1OILA 2BF7A 2YOFA 2Y1LA 4TRNA 5K03A 4KIFA 3VI3B 4QKQA 4TZ0A 1HLDA 1U4OA 1U8TA 2C9ZA 5H82A 2Q1YA 1QHGA 5G2OA 4CKEA 4F6RB 4MGIR 1J25A 4XRGA 3ZNOA 4EGSA 3AF3A 2QZ9A 3AEYA 4X93A 1FFBA 3HFGA 5KYNA 2QZZA 2PNFA 2WSSD 2BZGA 1JP7A 5BUCA 1KZHA 2XE4A 2BFAA 4OQDA 4JBLA 3RJ5A 2NZXA 1TYAE 3CH6A 4DBLE 2ZT6A 5JBIA 3DH0A 1T9KA 3PUHA 1US8B 2ZTHA 3DOIA 3E1GA 3LXXA 5I8PA 1B8NA 4NOMA 1V1JA 3WE7A 2BONA 2G3YA 2V1XA 2ORVA 5IF3A 3OF2A 4XYGA 5AHKA 4G01B 3G5MA 1CJBA 1T15A 2VAMA 4N6GA 3SOPA 1LDGA 2E48A 3LLVA 3I62A 2FMFA 3Q7QA 3W5VA 4URWR 2J3LA 1IJEA 1Q22A 2ONZA 2QWXA 4KQ6A 3KIPA 4H0FA 1AJEA 2J67A 2NIPA 4D45A 5EYPB 1G3QA 1KAMA 1GA4A 2QD1A 2WRZA 4LSGA 2YWHA 4PSDA 1YCFA 5DJ5A 1FFCA 4I8XA 1FUEA 2B36A 2MMGA 5D5QA 4MLDA 3T9DA 3D1VA 2TMDA 4PAWA 2BFBB 2HQSA 1F06A 3M5CA 3SNKA 3MB8A 1DIGA 1H6DA 4DSOA 3IE2A 1Z3IX 3MAGA 2G40A 1W35A 1A5BB 2EYQA 4GZ6A 4IFTA 1MTOA 1RWOA 1U2SA 4OB7A 4RIIA 1Z3CA 1IK4A 1BWSA 3GJYA 1W36B 1CB7A 1YA8A 3FSGA 4HFNA 4HNAA 5C7OO 3IVGA 4BAGA 2FETA 2IGBA 4F4IA 2W11A 4UU0A 2PUGA 1BU5A 2DUWA 5EZYF 1IDN1 1Q95A 1CUEA 1SQGA 3KHSA 1QHHA 5DTRA 3ZZ1A 4X9XA 1HTTA 5B3AA 1VG1A 3CF2A 2XDAA 5HIJA 4ENSA 4DMHA 5BWCA 5KYWA 4YLGA 1B23P 2FRVA 2QUZA 3SLRA 121PA 3WLKX 2BMEA 3PDCA 1Q14A 3QTTA 4ZJPA 1OA1A 2QMQA 2E37A 3MSXA 4FMCB 4EGAA 5CB4A 1J70A 2ZR0A 5I9MA 3COPA 1TEZA 5CGZA 4DJAA 4OXNA 2C42A 1C30B 2GESA 2XB4A 5JJ5A 1MJNA 1KJZA 2BZ0A 4OAQA 5F77A 2HSJA 3CJRA 2A30A 4WNAB 5CA0B 2DCUA 1GGVA 5LA6B 2G5GX 3UXYA 2BH9A 5KZMB 3S8EA 1G3IA 1NVEA 1P2GA 1TVEA 4OXKA 2F17A 2UVDA 4RKQA 2I4RA 2IIPA 3U3RA 3OKCA 2FSFA 2Y67A 1REQB 4CMBA 1IH8A 1Z8DA 4QBGB 2JKVA 3FDZB 2IYQA 3LKBA 4WECA 1KVUA 1VI5A 5GZ1A 1EGVB 5KDLA 5HNKA 2VAXA 4BV3A 1VE3A 3RIHA 4U0KA 4YMIA 3GYGA 5DIFA 4LJ9A 2E1PA 3L40A 3ZCSA 3WV5A 4MI9A 4O2LA 1YL6A 3GLFA 4LOHA 5EXTA 2PGXA 3P26A 5GPBA 4UATA 4HZGA 3G23A 4HDKB 4W1RA 5T4BA 3F78A 4D81A 2X5XA 2Z6VA 5EVJA 1NVBA 4MP8A 3W5UA 3C0KA 3GPBA 1U80A 3VTFA 2DTEA 1XL1A 3B6IA 4LMRA 3UT5A 5EEHA 3WOVA 3HSYA 2BEVB 2EP5A 2P5TB 2ACWA 2LXNA 3QMWA 4IH9A 5KC8A 2W6JA 4GI1A 2CDNA 1GCIA 3NHYA 4EG4A 3V5NA 2P35A 1DIOB 3DGEC 3KKKA 3LT2A 4WV3A 1X3LA 2FN7A 4NV0A 4EJSC 1SA0A 3GEBA 1VJRA 5ICFA 4KLZA 3JTMA 1GPWB 3PTLA 1PNVA 3OZEA 3DONA 1P4SA 1FLVA 3FMVA 3VHXB 4AMYA 1EBBA 4TWIA 2O0JA 4CXMA 3P0IA 3W4IA 2ECKA 1P2BA 3ER9A 4RU1A 2GPSA 4JXXA 1VSUA 3GRKA 3Q9SA 4HPJB 1J8FA 4FHEA 1CJTC 4YJ3A 5EESA 3BPSA 3HU1A 3L7CA 3O2QB 1NLMA 1VMAA 2ZJYA 4ZAYA 1GAQA 1Z5NA 3BMXA 5DHAA 1ADBA 1CW2B 1XWFA 2FEXA 3Q7RA 3LBFA 2RHHA 3S1SA 1ZOOA 4DSTA 2ZIVB 3HJTA 1BJRE 2VQ3A 3LOPA 3M82A 4XD2A 3ONWA 1KZ6A 2GCOB 2ZI6A 3CWZA 1NZFA 2PDAA 4N3BA 5ILGA 4AY3A 4EW3A 5C81A 1YR6A 3IAUA 3G89A 1MHTA 1GIAA 1Z6QA 2ZBFA 3C8DA 3JQRA 4MUJA 1ZH4A 1NNSA 2AD5A 2O4CA 3OQIB 4P22A 3U31A 4AF8A 1XZMA 4D4MA 3MGAA 4XAQA 2GK3A 1T3LA 2EIHA 1FPMA 1AB6A 3IEIA 3MMZA 4Z86A 3UHJA 4AD8A 3W2FA 3ESBA 5IWAB 1YQTA 5IYZA 2H2AA 2OGSA 4OGKA 3EQ2A 2JLXA 1KZ9A 4D43A 2IODA 3VC2A 2AZ4A 4MXDA 4F2HA 2DWCA 1T2NA 4R1LA 2C98A 2A9RA 1M54A 3DLCA 2PGJA 1IN4A 2PMFA 1ESMA 5JT1A 4YPOA 1XALA 1E3WA 1T1RA 4TL7A 4A8TA 1NJ8A 4CQNA 3O5AA 3B2NA 4YMSA 2R8OA 1K3UB 1HLPA 1U2DC 1DO0A 1TOAA 2HLHA 1KKMA 2WVJA 1CCWA 5F33A 2ZPUA 3P5BA 1BMQA 1CQZA 1I33A 2OCXA 4XDYA 3U4HA 3UKOA 1L4KA 4ARCA 5T8KA 1FFYA 3SOZA 3WHPA 1DX4A 3MF4A 1JSXA 3IVCA 1H5NA 3JX9A 2FMKA 1Z15A 3Q7SA 3LUCA 1FW6A 4YO7A 4HZUA 4Q9DA 5C4MA 2HMTA 2DPMA 2WTNA 4N7BA 2CCJA 2VYFA 2XB6A 4ITRC 3H2IA 3BICA 2V6MA 3QPWA 1SKUA 3R44A 4WGGA 2OYCA 4F11A 1GG5A 4LF6B 3GFQA 3NHPA 5D7NA 4L4XA 4HSGA 4PC2A 2XIQA 5DBFA 3WJAA 4B7AA 3ZZNA 3DGFC 1DC3A 4QOIA 3W1WA 5C3MA 2QR3A 3QIAA 4PRYA 4C4PA 1O97D 5D51S 4DV0B 2CNKA 3N28A 2G07A 1XK7A 4TV8F 4IH1A 1BEZA 1MVLA 2FCAA 3GEEA 4U9HS 1XCMA 2DE0X 2EOAA 3L8ZA 2X22A 4DARA 5HKLA 4DR2B 2ZVJA 3UH0A 5A2GA 4AMVA 4IWXA 2UVPA 3GQBB 4ZOBA 3SR4A 3PITA 3ZCTA 3OQHA 2F7SA 3ONNA 3PPVA 4JLNA 2XE6A 5T5QA 3U2QA 2J3KA 4ER7A 5K9ZA 4BFCA 5A1JA 2PD6A 7MHTA 3WYGA 3AEXA 3CCFA 3GELA 1CS4C 1FSPA 1PN3A 2MIIA 3G8YA 2QMOA 4JY7A 4FMDF 3PT5A 5AK5A 4BN0A 1S7CA 2VDPB 3HM2A 2XUQA 1FLAA 1QVRA 4H7JA 3V46A 1ZM4A 4QUEA 1ZGBA 3TI9A 1F3OA 5KNBD 3T3NA 2BGJA 1F6WA 2G09A 2O1WA 4QC2A 3ANLA 3N0RA 2HV9A 5LQKA 4CM7A 2PZGA 2EC5A 3F98A 1M66A 1YJ5A 3AM5A 3L7DA 4O2BF 3E9RA 2CJWB 4UVHA 5JNSA 2HQ1A 1BDHA 1E4EB 1KMIY 1MG0A 4EMUA 4JVSB 3Q3VA 3G3EA 3CEJA 3G5AA 3FY4A 4GLFA 4FBMA 2BPOA 4N5MA 3QPDA 4OY3A 3C5CA 2HRRA 4DT1A 5LMCA 4C89A 2A9VA 3LKDA 4YV1A 2ZUBA 2WJVA 3KSDO 3RQSA 4FC7A 2CXHA 3G2HA 1N77A 3TDKA 1JFSA 4HGPA 4DV5B 3EZGA 1WUYA 2JHPA 2Z58A 3A7EA 3L7LA 4IZOA 3VNAA 3D9QX 3N5CA 4EOGA 1EHIA 3LYLA 1DKRA 1J8DA 1WPGA 2O2SA 2PO5A 4FFWA 3O84A 4Q4HB 4DM4A 1SXHA 4NS1A 4ITVA 1WS6A 4OSPA 3WZ2A 2IHUA 3FYUC 5KTPA 2HX1A 2QA5A 3TWOA 3VPGA 4MGZR 4AJLA 2D8AA 2OM6A 4DV3B 3ZWNA 3CZCA 3DL0A 2ADOA 4NCJA 4ZWNA 1VI2A 2LCFA 5TS2A 4R3UC 2XMPA 3AI3A 3INYA 1F7UA 3QVLA 3I9KA 4MYTA 1PWHA 2PGNA 3LC1O 1HRKA 4E1VA 1M2VA 4J9UE 1BE8A 3AJRA 3H6HA 5FWXA 2CUKA 3EPLA 1V11B 2DUJA 3FNEA 2E2WA 3WO0A 1NU6A 2H4YA 1ZM2A 2QMEA 3M9XA 1MXHA 1TD1A 1W34A 4JL5A 4RZ3A 3X1KA 2ZQ5A 4H18A 4IF6A 1EU1A 4FW8A 3K09C 4EATA 5G4KA 3QJGA 2DWPA 1RWVA 1FU7A 1P1CA 1SELA 5AJUA 1XJ5A 5BO5A 2AT1A 1RC0A 3LUDA 5F98A 2F3TA 1VKHA 3ABQB 2QTAA 3WRXA 3IR6A 2PHZA 2OENG 3H2HA 2AC7A 4H2DA 4PTLA 1KK3A 2AJBA 4L07A 1LBEA 1T2CA 2VRWA 1OKKA 4RH1A 5KSZA 4OX9Y 3ZI7A 1PR2A 1T0IA 3EHDA 2J6BA 1BOOA 2GPAA 2P9TA 4GUAA 4RANA 2K6GA 5EFOA 5SY4A 1GKLA 3RU3A 3LXRA 4DVJA 2G1JA 1VIDA 2JAXA 2JFNA 2RONA 5F2OA 5K8LA 2XJ9A 2VHZA 3RYHB 3UJDA 6REQB 2SNIE 3U48A 1O1YA 1FJXA 1XSEA 1CDOA 5BVHA 2C3YA 1PDVA 3G0BA 3KU4A 3N0WA 5M29A 1SIWA 2QRUA 5IS2A 4ZTZB 1II9A 3WSVA 4BNFA 2W6ZA 1X7WA 2LR0A 2JASA 3VR0A 3EXHC 1MAAA 3CH5A 3LLMA 1VL5A 1JILA 2VP2A 4YJFA 1S2NA 2HJGA 3TRJA 5A03A 3UENA 4C3VA 3U56A 4N7RA 3EPRA 4IR7A 1AUXA 3JVVA 4MYRA 5DBIA 2VHWA 1OFUX 4DG9A 1CLEA 2N75A 3WLOA 2XUOA 1R50A 3FHTA 2Z5FA 3E8SA 3NW9A 1E2MA 4GKBA 3STTA 4D9GA 5JNRA 4W7HA 3DE7X 5T3UA 5CHEA 1I5EA 3CUYA 4N3AA 2XUHA 4GBMA 1TIBA 2R8YA 3FCEA 3V7WA 1RHRA 4XQGA 4GOXA 4PYMA 4YP5A 4MS3A 5C34B 3VR5A 4GHWA 2QXUA 1P18A 2UZ4A 3KSZO 2VWQA 1A5AB 3HACA 5FOUA 1CULC 2R7NA 2RH9B 4PRKA 3KYBA 3AUAA 3I30X 2JCSA 3RYTC 5BUSA 5LZ2A 4FM9A 2NUPB 3IERA 4R2HA 5CB6A 1Y7LA 2P4SA 1CS0B 3ZUGA 4XR4A 3FCOA 3I37X 1NAIA 1LTQA 3MRVA 3L4BC 4Q1EA 1EAMA 1JAXA 1CPYA 4E14A 1DHRA 4IGEA 3R3VA 1D03A 4ER0A 4GQAA 1X1RA 1BQEA 4GZ5A 1BS9A 4POAA 3EH2A 1HZJA 3LOQA 1O97C 2BP7A 1THGA 3EFEA 2J5XA 1CQWA 3HA2A 3L05A 4MI1A 1EWTA 5AH0A 4Z54A 4U2BA 4EHJA 1RYMA 3E4CA 3FFXA 2BEUA 2FKAA 2OFPA 4GWGA 2UXDB 4DR4B 4FDTA 2V6FA 2FZ4A 1UBOS 4PAGA 1RW4A 2Z08A 2PKXA 4JCCA 3SR0A 2FQWA 4JP3A 4G9EA 1SURA 4EHNA 1YXMA 2VDKB 3WL6A 4YI3A 5G02A 2Z1NA 5JZMA 3E15A 5CX1A 4D9CA 4ZGWA 3E82A 3OIDA 3D7KA 3HNRA 4G0WA 3D4OA 3LW8A 4JHXA 3AVVA 5G3YA 1AHNA 1FUYB 3TSAA 5FI3A 3E23A 4M46A 2Q28A 4LVNA 1SVSA 5KU1A 4TQ9A 3GPCA 5FPQA 1JU3A 3WGKA 2PMDA 3WY9A 3ZE8A 2Q4OA 4XFDA 2ZUUA 1R0ZA 2MJLA 4BU0A 1L4HA 3SF8A 4BX9A 5H3CA 3HQ4O 3IBCA 2DJIA 3IULA 3I01M 3PDIA 2HMAA 1FXWA 3JD3A 3PC4A 3PNMA 3W2EA 4B74A 2P3OA 3BWMA 4L3VA 4DXHA 1PU2A 4M9CA 2HCRA 3GUVA 1U11A 2AEFA 4OKNA 1P44A 2BC9A 2GCNA 1MABA 3O4IA 1RM4A 1Z28A 1W76A 1MP0A 2H2HA 2WYIA 4L9AA 1EVQA 1FYEA 1JDBB 1U9JA 1XRMA 3CZQA 3HZHA 2ZITA 1N5KA 3KKOA 3RS4A 2QQ0A 1AF4A 2RKWA 4JEIA 4N7JA 2DUUA 4KXLA 1SCJA 3TOCA 4ALIA 4RPCA 4CFSA 3GEPA 3GQVA 1YQQA 2FPIA 2FR1A 3D3EA 3E9NA 5E0OA 4JJ8A 5BSWA 3WSWA 4EQ6B 3I72A 3TXXA 4NJEB 1MX1A 2CNWD 2HIMA 2BE7A 3WRWA 1VXRA 1RCUA 3K94A 1DJMA 2N1BA 3AUYA 4BMOB 1G2IA 4M0KA 1MNQA 2JLAA 3MYRA 5DN6A 1BGWA 2JLVA 4B76A 2AWOA 3PENA 5DN9A 5I9IA 5AI9A 4BGDA 2GGSA 1GOTA 4KBGA 4BWVA 5JR3A 3DKKA 3RIGA 3KSUA 1WW3A 4YXWD 4JASB 4JYPA 3WK7A 5AQ1A 6ABPA 5LOVA 1JL3A 2I2DA 2MINA 3EDQA 2O05A 1JS1X 4MUGA 4YJFB 4YRGA 3KYJB 4EG8A 1RDFA 3K3PA 3OT1A 4A1FA 5EIOA 4QVKA 3B3AA 1MIHA 4HLCA 4KC0A 4C4TA 2BKAA 3PGJA 4A15A 3CFYA 3DMPA 1I5OA 4LRSB 1QFJA 3OIFA 4KDRA 4QFBA 1F0PA 1P4GA 1OSNA 3E0QA 3P96A 3PUJA 5CYOA 1QHEA 2C96A 2PSFA 5JO9A 4B8ZA 4KVGA 1OBFO 1UBHS 3TBFA 1ESCA 3WB2A 1HYQA 2I4LA 2E6KA 2JANA 1QV7A 2X4GA 2X9VA 4OQZA 4UUNA 4ANFA 2FG5A 3AB7A 4FIZA 4J91A 4DCMA 3HSSA 4RYDA 1FS6A 2WDZA 4UVEA 2JHAA 4AKSA 2OHVA 1HNXB 2ZUEA 4L3WA 2VZLA 5ABPA 3L0SA 3M0EA 5ALSA 2OUKA 3AH8A 3VDNB 1ML4A 2O54A 5MFZA 1NQXA 2C0PA 4HLUA 3TPFA 5HZHA 4B46A 5HR5A 3CSUA 2BFEB 1P2UA 1YVRA 1UPTA 4H7KA 4B48A 4CTKA 2A58A 2WT8A 1TZKA 5CDTA 2FE1A 3E4DA 3MHTA 1QSGA 2L2QA 2PT5A 2PUVA 4GXQA 1JR4A 2FSVA 4YP7A 3H17A 2IE0A 4XDZA 1L5RA 1XC7A 2WAOA 4L8WB 1DKNA 1M8JA 3GAFA 5EMJA 5AVJA 4MW2A 3ROTA 3QITA 4V1CA 2UZ1B 1GGFA 3PHGA 4BMPB 4ND3A 4BL5A 1X7ZB 4KRFA 3QXJA 1PFQA 1NN1A 1PUXA 4G56A 5E2AA 2XCIA 4MVYA 5FPTA 2CXXA 1YIAA 3LVBA 2EJUA 2IYWA 5JG7A 3WFIA 4CUZA 1V16A 5HM8A 1X2BA 5HZMA 2NTYC 5D3KA 1JQLB 5KO2A 2OG2A 4KPFC 2IYFA 1A8QA 4UTNA 1UMCA 1K6IA 3K0CC 1CETA 4BEJA 2Q9AA 3DV0A 2AMVA 2YBEA 3K0FB 3AEQA 3A14A 1P0PA 2JDID 2JEYA 1QMGA 2CNNA 3C6XA 4F2PA 1FFSA 1PBTA 4TSFD 3TM5A 2IPXA 2DH6A 3DLAA 4Y1RB 2A92A 2NG1A 1P39A 1ZICA 1Z38A 3LZ6A 4IIDA 3L0OA 4QPPA 3ZOKA 4LJ4A 2JGJA 1DC6A 2X4IA 2XYPA 1ZZGA 1YONA 2RJ3A 5EQFA 2AD1A 3WDLA 1R0XA 4HFMA 3HKDA 1VIVA 3JYOA 1KRWA 3M6LA 3GHHA 1CZKA 1SZCA 3EGCA 1XLTA 1ZM7A 4LXYA 3UHFA 1NRWA 1EX7A 1U28C 4XQ0A 4IMIB 4RJKA 4RDIA 1MHPA 2F3UA 1L7AA 3IQGX 2IHNA 5ANRB 1P5ZB 1ZQ9A 1EFDN 2DT8A 5HMMA 5I6DA 2ZZMA 1HDEA 4KQKA 2I55A 4X6YA 3KFXA 5EJ5A 3U39A 3V1TC 4LZAA 4YMVA 3QKWA 1W4BA 4ZO6A 3ZD6A 3ENQA 1XVTA 3VKUA 2E4ZA 4Y2TA 5E95A 2OCBA 4JI6B 1OZHA 3BMQA 1N4DA 3BD7A 5EKSA 3GUZA 4LF9B 2XDWA 1RLMA 4CIWA 4NRDA 4DMCA 1THZA 2OILA 3BXXA 3REFA 4G4JA 4RA9B 1XKQA 1P2FA 1TMGE 1TZCA 2HREA 2J0UA 2F9MA 2PS0A 2VDJA 4JGBA 4M1SA 1Y33E 5GM1A 4OJQA 1UAGA 2I2CA 4LXIA 3R7AA 3F6EX 1P80A 2DH5A 1VL2A 2QV7A 3E9EA 5AUOB 3ILYA 4FLEA 1V7PC 1SCIA 1XYYA 2WG2A 2Z04A 3F90A 4RL6A 1EP9A 3LBHA 1ISGA 1TQ4A 4RW0A 1AE1A 2QUAA 2WWTA 3ONEA 3WOHA 1NF3A 2KB0A 2NO0A 4MIYA 4E0BA 1OXTA 1QTRA 3IOMA 3VGPA 3MS4A 4KWHA 5BNTA 3P94A 1I3CA 4YONB 2FA9A 2V6JA 1CT9A 1BQ3A 1KSGA 2ZIXA 1ZVMA 4KVAA 4A1OA 1WMFA 3KZ1E 1L5FA 1KETA 2WFLA 4W9NC 3AHDA 4BBJA 2WVHA 4Q7LA 1YS7A 1B1AA 1CIJA 2HWXA 2JFWA 1NNLA