1XFAA

Structure of nbd1 from murine cftr- f508r mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
264
Chain Sequence
TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 89
structure length 264
sequence length 281
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xfaA00
4KAXA 4URYR 3QKUA 4W9MC 1EFRA 1N5LA 2WKRA 2QPAA 1MT0A 3H1TA 2QAGB 3RVBA 3A1SA 2GF9A 3E2IA 5AUPB 1EFUA 4ASUD 2QMOA 3I1FA 2VF7A 4B32A 2VLIA 2VBCA 3M6AA 1KSHA 2IYUA 1F6BA 1KK3A 4JZKA 1W47A 1NMXA 1VMAA 1E9SA 1YZUA 3AF1A 1SXJC 2YNMA 2YWHA 4D0NA 4LI0A 3REFA 5FI1B 3P27A 2EWWA 5G53C 1MO3A 2GESA 4JL6A 1T4GA 2ZRJA 5H1YA 5HR5A 4RFSA 4B3GA 4L9WA 5JWHA 1R8QA 5JRJA 4JSTA 2QTVB 2QRNA 4GPTA 3ZD6A 2X19A 4ZIRA 2GILA 3UWKA 2W0MA 1P3JA 1ZIPA 2HF9A 2I1VB 2K5UA 1XP8A 4YLGA 3R8FA 3FHCB 1G8FA 2AK2A 2AWNA 4KHZA 1N6HA 2IT1A 3RSLA 1TQDA 4QBFA 3U3MA 5JEDA 2QP3A 5FUVA 1FQJA 1WCV1 5CB6A 4HLQB 1IHUA 3NH6A 2RGBA 2BWJA 4U02A 4A0RA 4D4JA 2GK7A 1YRBA 5HTKA 1GVNB 2ZS8A 1ZVQA 3K70B 1G1MA 1VTKA 3EWAA 3FYHA 3UIEA 1HV8A 1JNYA 5HCIA 4FMDF 2DWOA 4E5UA 1FMJA 1NL3A 1OHHA 1T5IA 3RS0A 3FOZA 3IDQA 4GFDA 1XJQA 2W00A 4BLTA 4EPYA 2JJ8A 3KZ1E 4PO8A 1E9EA 2RGNA 3UMFA 3AVWA 1RRGA 2YYZA 4I4LA 5JWRA 1NIPA 4FMCF 2IUUA 3D3QA 2REOA 2XNDA 3KKNA 3T5DA 1OXTA 1DEKA 5TARA 4LYAA 4E22A 1A2BA 5KDOA 3N2IA 5GJWC 1IN8A 3WRXC 2PH1A 1DAKA 2ZSFA 3H86A 4LV5B 2JLZA 1GKIA 3HR8A 1GL7A 1W36D 3DM9B 1VCMA 4OHXA 3B1VA 3AUXA 4MGKR 3AVXA 3CRVA 4I81A 5FL3A 3SC3A 2E1RA 5IDVA 4BASA 1CP2A 2CJWB 4M1KA 2CL0X 3KQKA 3THYB 1KZ7B 4QGFA 3CNNA 1E2NA 3LAWA 4A6PA 1E9BA 2ZVPX 2IYYA 1Q44A 2ZS9A 4FMBB 3F3YA 4A8JC 4BECA 1EFRD 2YOHA 4ACAA 1JECA 2WSSA 4QBHA 1QHHB 4Q01A 2B6HA 1CS4C 1XDBA 1RJ9B 3IBGA 5D3QA 4O3MA 1OT3A 1XMSA 3A1VA 3L2OB 3CRRA 4PZYA 3R9XA 1E2IA 3LVRE 1DOAA 2XSZA 3SHFA 2J3EA 2QSZA 1OH6A 4EPVA 2AR7A 1X1SA 2XITA 4A0HA 2C77A 1E2DA 1JAIA 4Q7MB 3LH5A 1G16A 1YZKA 3J81k 4BFTA 1ZM7A 3WHLA 2ODWA 3I32A 1EWQA 2D4HA 3CUEF 4MDEA 3B85A 4ZPXA 1GRNA 5A5GA 2J0SA 2F3RA 4NCHA 4NYIQ 2HDNB 1W44A 1JB1A 4KLZA 3E5HA 3VU9A 2PZEA 1U99A 1IXZA 2ANBA 4BRUA 2GCOA 3QUSA 1W4RA 4Q5IA 1S1MA 5JWOA 1FMLA 1U94A 4MDFA 4OYHA 1TQ2A 3WMFA 1CULC 1LS6A 3THXA 1E96A 2QAJA 1XPOA 5JSZB 4XD7A 2WMOB 5EE0A 4A2PA 2YKGA 5LDDC 2ZE5A 3VKGA 2OM2A 2I3BA 3IIJA 1UDXA 3QY0A 3SBEA 3IEVA 1DAMA 4XSGA 5G40A 1YQTA 4JLKA 3EPLA 4RY2A 1TL7C 2ZJBA 4DCTA 3IIKA 3NEJA 1N25A 2O5VA 121PA 1G64A 1SKQA 1OHHD 2MMGA 5LB4A 2WWXA 3PEUA 1J99A 5F2EA 5FTNA 2Z6VA 3U3JA 1CR0A 8OHMA 5JCZA 2ERXA 2BBSA 2GVDC 1NSTA 1N0UA 1XXHB 3RS7A 1SVLA 1NRJB 5FBLB 3AVPA 2O8FB 1E9DA 4HAWA 1FTNA 3L82B 1JEEA 3CWQA 3PUVA 5HE9A 4AKEA 2J9RA 2ZAOA 1YZGA 2REXB 2IC5A 2VSXA 1T0JB 3I5XA 3G0HA 1OLOA 4G5GA 1OIXA 1AK2A 1GKYA 3E1SA 3L43A 3W3ZB 4N0EA 1E79A 1SVKA 2OHFA 2CCGA 3KJIA 2KBFA 3M4YA 4JBXA 4KU4A 3SEAA 4YMUA 1NP6A 3EZ2A 1YR8A 3UKDA 2RH5A 1RRPA 2E87A 2GJSA 4AYWA 1NJFA 2CHGA 2W0SA 4JLMA 2IS2A 2IYRA 2ZRGA 4AG6A 1U9IC 1TUEA 3ADKA 4U7DA 3NDBB 1KMQA 4AKIA 3FPAA 3GD7A 3F8TA 1AGRA 4W5HA 2FZLA 1E99A 1D9ZA 4UXJA 2P2LA 2NO7A 1S2MA 2ERYA 4MRRA 4TT3A 1KKLA 1GITA 2XSZD 2GJKA 5DE3A 1E2LA 4URWR 4IKEA 1NN3A 3CF2A 3ZVLA 3CZQA 1PVOA 1KJYA 1EX6A 2QPTA 1EG7A 5FUYA 1HY3A 4KJZA 4NCJA 4PSAA 3K0CC 3ADBA 3B1XA 2CVHA 3FFAA 2P67A 1N6KA 2P65A 4KSCA 4WAUA 2XGJA 1J8YF 5F9FA 1UFQA 2KBEA 1FUKA 3PG5A 4RD0A 2EWVA 2D7DA 1OFHA 3TR0A 2R62A 1UKEA 2OFXA 1HQCA 2ZRHA 4M1OA 1W36B 1KI2A 4DLSA 2WOJA 2V6JA 1IONA 2GRJA 5KSYA 3TW8B 3PEWA 4TSFD 3T1TA 2W2TA 3REGA 2WIAA 1Z0FA 2ASEA 1XCMA 5FPTA 1JR3E 1G18A 1TF5A 4AY2A 4XD7D 1W5SA 2Q21A 1LY1A 2DBYA 1BH2A 4BEJA 1UKVY 1R0ZA 3OF5A 4H1VA 5C46F 1DADA 3ZLJA 4DLWA 1U0LA 4BGDA 3K0SA 2GEUA 4Z1MA 2ZI6A 3G5UA 3BFXA 1TF2A 5JZVA 1KMHB 2R65A 2JDIA 2Q9AA 1NF3A 5B2ZA 2CXXA 2C03A 2F1RA 4HDOB 3ZZUA 4C0AC 4CW7A 4CYMA 4KYIB 1NMZA 1UKZA 1WF3A 3QKTA 4EFMA 1HQYE 3GJ8A 1SGWA 3A4MA 1MABA 3O8BA 3LO5A 4BUJA 5JHHB 2VPPA 4M22A 5DI3B 4WXPA 1BIFA 1GNRA 3B9PA 1S8FA 1Z0AA 3K9HA 2HUPA 3L8ZA 4FIDA 3U2QA 5FBVB 3C4JA 5EUMA 3U4QA 2DYKA 4DDTA 1CF4A 1XFAA 1ZM2A 2CEAA 2J7KA 2A78A 1ZNZA 2ZYUX 2DPXA 3R20A 3WYFA 3LBHA 1Z3IX 1SXJA 3ASZA 5KHOC 2A5YB 4PO9A 2NIPA 3R7WA 2I4IA 3W34A 2PEYA 4GBMA 4KSBA 3U44B 3OEHA 3ZD7A 2QNRA 4CEIB 1KI7A 4IDOA 4BLQA 5E95A 2PT5A 3EC2A 4KVAA 4C2TA 3L0IB 3FHTA 4Q9JA 2PLFA 3FE2A 4Q7LA 3WNDA 5BXQC 2D06A 3GLIE 2GHIA 3SHWA 2J41A 4TWZA 4KFUA 3O8CA 1T91A 3PUWA 5FOXA 3TQFA 3C14C 3EASA 2IEYA 2WBLC 3TE6A 2AWOA 2OV2A 3GEIA 4JJKA 4RSGA 1II9A 3GJ0A 3BB4A 5DHFA 4HAZA 4NU0A 2QUZA 1RE0A 4B35A 4D81A 2P6NA 2XAUA 4A92A 3Q7PA 3X1YA 4JLVA 1IN5A 2V3CC 4TT3D 2C2HA 1B0UA 1FPMA 3G82C 4CEJB 4C0QC 4DEYA 4E09A 2R6AA 1KI8A 2YC4C 4KCGA 4UXHA 4QBIA 1YZLA 2JLUA 5JBQA 4URXR 2DFTA 3ZQ6A 1Z29A 4DIDA 5J4LA 4TL9A 2YWEA 2CHQA 3BD9A 3NBZC 4IVPA 2NZJA 2YVUA 4IOJA 4KYUA 4M4SA 4IHQA 4RZ3A 2OXRA 4A2WA 3UXMA 1JI0A 1RVDA 2VIIA 6Q21A 4A82A 4E07A 2OZEA 3LX5A 1CR2A 3KTAB 2REBA 1UAAA 4XIGS 1GTVA 1IQPA 4PQRA 3LY5A 4P4SA 5L8VA 5EE9A 3VHXA 3W8RA 3DKVA 4D0LB 2XXAB 2BMFA 2AHOA 1O3YA 2FOLA 2JATA 3CPJB 3EIEA 1G291 2F3TA 4B75A 2VSFA 3OEEA 3GLGA 1DAHA 2JDID 1U90A 3MWJA 4YC7A 4TYPA 2WPDA 2DWQA 3WMGA 3GLFE 4C7OB 4KXFB 4KLNA 3U3RA 1EFTA 1YKSA 2V7QD 3OFNA 3TKLA 1XPUA 4DLUA 1ZNWA 2YHSA 5FBQB 1T8UA 2WAYA 4NTZA 3UG6A 1UBFA 4UJ5A 4Q9IA 2IXGA 4A8JA 4KFRA 3DVLA 1Z0IA 2O8BA 3GEEA 4WIAA 2ZU6A 4HUQB 3C41J 5JLJA 2SHKA 1TF7A 5TMPA 3KQLA 4WZ6A 4UKDA 2HCJB 4BEBA 5FTMA 1VHLA 1Q1QA 4LY6A 1OF1A 3X1ZA 1CR1A 1IXSB 3OIVA 4B2PA 4EIWA 2D2FA 3I8SA 2RHDA 2GZDA 1AIPA 1SXJD 4EDHA 1II0A 5JJKA 1N6OA 2A5DA 3OEHD 2Z5FA 4RZUA 4URZR 2PEZA 2LCFA 1YZNA 3NTUA 2X1VA 4ZKDA 3AP2A 2KI5A 3QQ5A 4LC0A 1IOZA 1ZP6A 4M2LA 2XJ4A 3RABA 1D5CA 1KI6B 2ZRFA 1LTQA 2O0JA 3GLHB 4NHOA 4OQLA 1TQ6A 2MSDB 5EZ5A 2CVFA 4Q1BA 4G5SA 3AKDA 2OFWA 4AIIA 3JVUA 3D31A 2OCAA 3CH5A 3GLIA 1K8RA 3RLFA 3RRZA 3AKCA 1AZTA 3MCAA 2DR3A 1J2JA 1KTVA 1W0KA 5LD2C 2WWHA 1RKBA 3HU3A 4HYYA 2ONKA 4TLBA 3QKRA 4TYWA 1DO2A 5FUWA 1JPNA 1D2EA 3PENA 1US8A 3B82A 1E1RA 2JCSA 2OFOA 3MMPA 4DC9A 2PX3A 2H7VA 2UVQA 5SZJA 1W4CA 2VYFA 2Z4SA 2ZYTX 3OAAD 4AKGA 3T61A 5DO9A 4LBWA 5IHPA 1E0JA 4EUNA 1W7AA 1E0AA 2JEOA 3U6BA 1NKSA 3KXKA 3NXSA 3ZVMA 2O8EA 2LWIA 4AC9A 4ILEA 4V0KA 3L8YA 2JLSA 2VL7A 1ZNXA 3HYRA 2QY9A 4D80A 5B57C 1VYUA 1U8AA 2WJYA 1G8GA 2ZJ2A 4Q66C 4MUBA 4QBGB 2R6FA 1ZC4A 4IXNA 4TMVA 1F2TA 3QSYA 1ZIOA 2PMKA 2WIBA 4JLPA 3Q5DA 3CRW1 1SZPA 2D62A 3OEED 3WBJA 2JGNA 3X1DA 4D82A 4K46A 2O8DB 3T1OA 2DWPA 3RNLA 2V4ZA 4LJ4A 4UQOA 1KKMA 1N5IA 2NZ8A 3CLVA 3SFVA 2WTUA 1A82A 4YDSA 1AN0A 1XTRA 1D2NA 3N2EA 3O8RA 3NKVA 1J70A 4GDFA 3TSOA 1MOZA 1U9IA 1NVWQ 1YR6A 4TMWA 4C9BA 2XZOA 1A7JA 4TYNA 5BWMA 1JR6A 1A5TA 2ZYVX 1LW7A 1E9AA 2YOGA 3CB4A 1KO5A 3BJIC 3BERA 5IT5A 2PZFA 4NBSA 1X6VA 2OESA 3AKYA 5AUQA 1ZM4A 3DO6A 3BIFA 3DMNA 1XEFA 4QC2A 1HA3A 1G7CA 3NC0C 1E32A 4IJMA 4H1UA 2OBNA 5TDHA 3V4FA 2XB4A 4L9SA 4ZI2A 3THWB 3QNUA 2D74A 1QHSA 3K0CA 1FNNA 4Q00A 3U7EB 4I99A 4JVLA 2P0EA 2N42A 3QXHA 1AS2A 2XOKA 3AP3A 2QM8A 4LJ8A 2RKOA 4MYTA 2XJ9A 3SQWA 1WQ1R 4RKEA 4B34A 4LGMA 4BLOA 3H4MA 3A37A 1Z08A 2KJQA 2Q3HA 1J90A 3ZYCA 2X2EA 2RGCA 5JHGB 2YWGA 821PA 3S1AA 3W5IA 3F0TA 2IBMA 1NSFA 4C4PA 5FTJA 1QHGA 521PA 4LYHA 3FHOA 3WBKA 2ZRCA 5DYGA 1KIMA 2BDTA 2QBYB 3WP1B 3VAAA 2CLCX 2QMUA 2RGGA 5E3HA 1VG1A 3PV0A 3O47A 5FOVA 3T1VA 3KQUA 3KDSE 5GADl 3AVYA 2A2ZA 2O0HA 5CYPA 2W2XA 2B7CA 3SBDA 2HT6A 2ANCA 1ZUIA 4A6XA 3KQHA 4MRVA 2H16A 1PZNA 2J0UA 5CYOA 4QM6A 1MRNA 4DDUA 4II7A 4GP6A 1W5TA 3BH0A 4LJ5A 1I4LD 2WSMA 3MWYW 5EJEA 4BZQA 1NY5A 4C2UA 1IAQA 1XTQA 1DTSA 1N6PA 3VR3A 3EX7C 4FCVA 1T8TA 4I1UA 3CX7A 1NN0A 1Q20A 5AUOB 2B21A 3PXGA 2BBWA 1LNZA 4BFZA 2GXQA 3TH5A 1G20E 2J59A 1G7SA 2G1KA 2EVWX 2GAOA 4LPKA 1N6RA 2W2VA 1H8HA 3B9QA 3OIWA 1GRQA 4OHVA 4OI2A 2HYDA 2C04A 2QM7A 3I8XA 5HKKA 2FG5A 1WE2A 2HV8A 4TMXA 4CT5A 4QJ4A 1E2EA 5G41A 1P73A 1QZXA 2XEXA 4CEHB 2GDJA 4JL8A 4DLYA 1L7VC 3TSWA 1E0KA 2WWWA 3FVQA 1W46A 4LDJA 3B6EA 1R5OA 1R0XA 4IRUB 4JVSB 4PPQA 1OIWA 3EW9A 3KB1A 2FMXA 1XD2B 4N1AA 5D3MB 3BFVA 2QTHA 2GXSA 1NVUQ 1GDDA 4V0NA 1GG2A 1GZSA 2NO6A 3CF6R 3GLHE 2VTKA 4RD3A 1P6XA 5GJBA 1XJCA 4AI6A 2XOKD 2GF0A 1I2MA 2H18A 4I1VA 4G3XA 4MKGA 4FI3C 5LPNA 3ZQJA 1ESMA 1YZQA 1VKJA 1KI9A 2GJ9A 3TBKA 3PITA 4D26A 3MLEA 3HU2A 1YVDA 5FFMA 1OYWA 3QKSA 2GEDA 1E2FA 2ZSBA 3LNCA 3NIBA 1OV4A 4MQBA 2JAQA 5KSOA 2CNWA 1AJEA 1ZC3A 1ZD1A 1FX0B 3LXXA 4BFYA 1KGDA 1XEXB 4JLJA 2O8CB 3BB3A 2VP6A 3KJGA 2ODNA 5JS8A 1JEDA 2ZJOA 5TVKA 2ZUCA 3W90A 5E7JA 2ZQ5A 4HZUA 1W2HA 5L3SB 2CCKA 4KODA 3ND8A 3CX6A 5KSPA 2OAQ1 4NDZA 4Q4HB 4TQUS 4TTRA 5KO2A 1ZAKA 2TMKA 5JRZA 3CO5A 2P6RA 4B76A 1QG4A 1AGPA 2PL3A 1ZUNB 2OE2A 4BZXA 5KPJA 2ZI4A 1W4BA 3I3SR 4L16A 5HZHA 2QAGC 1BYUA 4RD6A 3SYKA 3TVTA 4NPHA 1H8EA 2GA8A 3IGFA 4URUR 4BFWA 1ZM3A 1UEIA 4PX9A 3HWSA 1GWNA 2WKPA 1MKYA 5DIFA 2D3WA 4EFLA 4GL2A 2W6JD 1N0WA 3HP1A 2BBTA 2J1LA 2OLJA 1ZM9A 4KV9A 4E03A 4BFSA 2A7QA 1BS1A 1ZYUA 2QL6A 3DZ8A 2UZ3A 3FMPB 2ZJYA 3I72A 4KVGA 2WJHA 3M1IA 2V8OA 3ASYA 2QGZA 5HKKD 1SHKA 1VG0B 2WZQA 3AF2A 3KL4A 4PPNA 4LJ6A 1OSNA 4HLUC 4Q4JB 2OLKA 1WA5A 1W2GA 4PSKA 4GNKA 4LJ9A 2N1BA 2Q9BA 4ESHA 5JFGA 2BCGY 2JJ2A 2R2AA 3NHAA 4V0MA 4DB2A 2HXSA 3BWDD 3LDAA 2A9KA 1YZTA 4US2R 2ZJ8A 1CRQA 4CF7A 4GI7A 4ITRC 3RDPA 5F98A 4AG5A 5KTYA 2AXPA 4C0BA 1KY3A 4ESVA 3CPEA 2F43B 3EIHA 1E9CA 4JLAA 1KO4A 4HLDA 2W6IA 5JMTA 1P61B 4JMPA 3K70C 1M6NA 2J5XA 4GMDA 3TVDA 3QIAA 2EYUA 3QEOA 3L0OA 1Q1ZA 3W8NA 3AH8A 4Q1EA 4DCSA 2VO1A 1TEVA 3K9LA 1HE1C 2QTFA 3LX8A 1LV7A 4JYBA 5G3ZA 3ZZ0A 2OO7A 5HCNA 3UATA 2GNOA 2FWRA 4FINA 3EZ6A 3RAPR 3B2EA 2D2EA 3VHLB 3ETLA 2A5GA 1XBTA 4HAXA 4RCYA 2ZM5A 3IO3A 4N0DA 3W5JA 2CNWD 3K53A 5TB5A 2J46A 1EGAA 3NWJA 4B6FA 1E6CA 2QZ4A 3K0FA 2FSHA 5DI9A 2WJIA 1Z0KA 3GLFB 3ICQB 1Q3TA 1Y3AA 2ZI7A 2EFGA 2FPMA 4MGZR 4OK6A 3DL0A 4POAA 4F4CA 1SXJE 1ZCBA 3O8DA 1Q0UA 3N70A 4FD2A 2Z83A 4OJKA 3NBFA 4LBYA 4Q02A 5K8TA 2FV8A 2QA5A 1UDWA 1Z47A 2IXFA 4XVQA 4IOKA 1JAHA 1KY2A 3BBPA 1KOFA 1W1WA 2XNDD 3TAUA 3W6OA 5JJIA 1R4AA 4DT1B 1S96A 1VCOA 1KNXA 3BK7A 3LBNA 4EQ6B 1G5RA 2H92A 1WDTA 3A4NA 3U3KA 1E0SA 3QBVA 3KJHA 4D25A 4UXIA 2QE7A 4GMXA 421PA 4NYIR 3AQ4A 3QXJA 5LBIA 2P5SA 3BGWA 3UPUA 4C0LA 3RRMA 1OPXA 2Y8EA 4DJTA 3BFKA 4CIDA 4EPTA 1OB5A 2XTZA 1E69A 1G3QA 1T5LA 3TGPA 4CT4B 4Y0VA 4PHFA 1XTJA 2ORVA 1NIJA 1UEJA 3KFXA 4A4DA 3I4LA 1TMKA 4JLBA 3DOFA 4PTLA 3SI7A 1TEXA 4PC7A 1N6LA 3CW2A 1JJ7A 3AV0B 3A58B 2GJAA 2WSSD 1DAIA 3D7MA 4D0GA 3IPXA 1Z6TA 4DBLC 3TNFA 1YR7A 2GXUA 2HJVA 2WVJA 3A36A 1KSJA 3IEUA 3NBXX 4KBFA 4LHYA 4EKDA 2C9CA 2ZYWX 1X8KA 1X86B 4XVUA 2GVZC 3VNVA 2ZRDA 2H1LA 4ARZA 2QI9C 1SVOA 3RRNA 4O25A 1LVGA 3RS4A 1IM2A 1OFIA 4LCBA 3B7GA 2ZEJA 1E4YA 1QF9A 2ZROA 3AB3A 3SU8A 3WXMA 5J4HA 5EZ6B 3K09C 2IYTA 2IWHA 1ZRHA 4NP6A 3P20A 2CMKA 3QXXA 1V43A 1CTQA 2HJGA 4H9GA 2IYSA 3HPRA 3TMKA 1Z28A 1AS0A 4EJSB 3GPLA 3B1YA 3CONA 1G7RA 1BKDR 3QXSA 1WBDA 2IXEA 4Q47A 3ZJYA 2GEVA 4DSTA 4TYQA 4M21A 3CX8A 3BH6A 4PANA 1RIFA 3AM1A 3IQXA 5E7MA 2P5TB 1XTKA 2G0TA 2QMHA 3QF4A 2GCPA 2WWIA 5AJWA 3V00A 4OHZA 4OJQA 1VG9B 2QT1A 1B23P 1L8QA 4BE7B 1QHXA 4NKRA 5L3RA 2FFBA 3P1JA 1XCPA 2YOFA 3GJ3A 1DELA 1KK2A 3RC3A 4PQYA 3A1TA 5EE1A 5KNCA 4O2LA 3H2YA 1II8A 4FN5A 3C5CA 4UNNA 4Q9LA 4M1SA 1U81A 2H5EA 4LV8B 1AQUA 4JS0A 3PUYA 1COWA 1SVMA 2GZHA 4RZXA 1P7CA 3TLXA 3AVVA 3L0SA 4WXRA 2BJVA 3RANA 4C3ZA 1NY6A 4TL8A 4DUGA 1TADA 3K0AA 3PUZA 2NPIA 3Q5EA 2RAPA 4UNRA 1PLJA 1KSGA 4MUAA 1CIPA 2C98A 2VSOA 1UM8A 2C99A 4B3CA 4ZKEA 1DO0A 4P0TA 4RFSB 1N5KA 2ZE8A 4BLRA 3MGCA 4A1FA 3KJEA 2ZR0A 1DARA 2JLRA 1P5ZB 1Z07A 3AP1A 2ZIAA 3B8HA 2FE4A 4ZIRB 4Q9HA 1D9XA 1XTSA 2ZANA 2IS4A 1QRAA 5L3QA 1E2KA 1U98A 2R6CA 1E79D 1HEIA 2BMEA 1RW4A 5CM9C 1OFUX 3ADCA 5FPKA 1F48A 2PZGA 4A0GA 4RCZA 4D4MA 4AYTA 2IWRA 1KNQA 4WA7A 1L4UA 1L2TA 3MUFA 5KDLA 1GNQA 3CBQA 3IHLA 1FTSA 3EWSA 1OYYA 5KSZA 1F2UA 1VHTA 4Z51A 4JJZA 2GBLC 1F60A 5KOYA 4A36A 1IY0A 4BPBA 5JECA 1P9NA 3C7KA 4Q4AA 4B44A 1W36C 3CNLA 4HATA 3LBIA 4XSHA 1HTWA 5E4FA 1UBEA 1T3HA 2ZI3A 4YDHB 3LV8A 3RWMB 2AL7A 4NZYA 3LLUA 4M9ZA 3T12A 1KO7A 2BM1A 5CJ2A 5CJPA 3U3OA 2GETA 2J7PA 2DY1A 2QP4A 5BYJA 3MRSA 2HLDA 1N0VC 1JBKA 3CR7A 4G1UC 3MFYA 1VCIA 1G6OA 5SZHB 1S0UA 4A9AA 2NMVA 2ZE7A 2RCNA 2ZSAA 4MRNA 4DCVA 1RC8A 4LYFA 2NO9A 1RYFA 2BMDA 2EFEB 3VR6A 1K5GA 5FOWA 1MO4A 3UG7A 4DRZA 2IYQA 3PUXA 2IL1A 3P4YA 3RS3A 2BEJA 1NG9A 2WAXA 1Z6AA 3Q9LA 2AK3A 4F93B 5CM8B 4OQFA 3LW8A 4M1WA 5B30A 3BRWD 2WKQA 2JLWA 3VR1A 3C16C 2QAGA 3VX4A 2ATXA 2QGNA 3U61B 2QSYA 1DAEA 4DLVA 4XTRA 2H57A 4Z1MD 4YMSA 3AF4A 4YMVA 3PJRA 3QG1A 2MSEB 2G83A 1IJFA 2IYVA 2WM9B 4NE2A 2R9VA 2HEIA 3TQCA 1G3IA 4PC6A 4JVNA 4RZ2A 1W4AA 5P21A 2ZSEA 2OILA 2ZJ5A 1TAGA 2Z0MA 4OBEA 5HZKA 3KUDA 4TQ9A 4DUGD 1NBMA 2QENA 2UZIR 1Q1EA 1KK1A 1NVXQ 2PJRA 3AF0A 1XRJA 3ZGXA 4HLUA 3GFOA 4LRWA 3GJ7A 4B73A 3H84A 4YXWA 4BQSA 1OE0A 4KITB 3V9PA 3A1UA 1Z06A 3VU9B 2EQBA 1CJMA 2GCOB 3KXLA 3FTQA 3V4RA 4OQMA 3OE7A 5EUQB 4F4JA 2QROA 3BS4A 3OIUA 4C30A 5FPHA 4ZI3A 4P32A 3THXB 4JSYA 2OBMA 2GXAA 3CZPA 1G6HA 2ZI9A 3K1JA 1A4RA 1P62B 2J45A 4KFTA 1KI3A 1ZD8A 4K8OA 2F1JA 3LQQA 5EXTA 1XU4A 3GJ5A 2KB0A 4I1SA 1KO1A 4P4UA 2OT3B 1SULA 1D2MA 5FOTA 3T06B 1CBUA 2BOVA 1OXVA 5CB8A 1J7KA 2A5FA 1DPFA 1OXXK 5BW8A 4MH0R 1P60A 1E9RA 1CJTC 1XWIA 4FCWA 1FOEB 1R5BA 2IK8A 4Z54A 2IF2A 3ZIAA 4QKQA 2NTYC 3P26A 5JJLA 3U5ZB 3GFPA 3CM0A 4PSVA 4ZDKA 1QBKC 1CKEA 5FL7A 1X3SA 1ZUHA 1NN5A 3DEFA 3B1WA 3KKQA 1P9WA 4WZBE 1VIYA 2IYWA 4Q18A 4BLSA 5CDFA 1Z2AA 1JXMA 3AVQA 1MO5A 1GIAA 2ZAMA 3IILA 2FSIA 4B3BA 2CJWA 2R8RA 3THYA 4PXAA 2FF7A 3K9NA 1N2CE 1G41A 3TAHA 1LF0A 2E9SA 2WICA 2B7BA 1Q1BA 2WHXA 5GVRA 3KQNA 1QG2A 3MJHA 5EQTA 3AVTA 3I92A 4Q9KA 1AA9A 1QVAA 4DHEA 5DISB 3U7FB 5C18A 3EZ9A 4PC2A 2IA5A 2N46A 1FW6A 1QHHA 1X8JA 1NVVQ 4CDGA 2ZI5A 2C95A 5CLLA 4AK9A 1RJ9A 4GP7A 1SHZA 2C96A 2JIZA 1G19A 4PC3A 2WPDD 1QHYA 1ZNYA 3Q72A 1PUIA 3SDZA 4AKHA 3UMSA 2Z4RA 2G88A 2UKDA 1G3MA 3OFND 2C8VA 2XTNA 3P32A 1OH7A 4LBVA 4GT1A 4PZZA 4TYYA 1GAJA 1EX7A 1NBMD 2FGKA 2JJ1A 1G5TA 1SVSA 4LHZA 4TLEA 1E2HA 3W9YA 2OCBA 2RMKA 1OW3B 4PR0A 4JLOA 2F55A 2VF8A 1Z22A 3TSZA 3FWYA 2KE5A 3BOSA 5FOSA 621PA 1E3MA 4QJ5A 1HT2E 4DDWA 4M1MA 4ZV4A 1P9RA 2Z43A 1KDTA 1OIVA 5JSZA 4TTQA 3D6TB 3K09A 4J0QA 2BV3A 2ZRBA 4NONA 3I5YA 2P3SA 4XWKA 2NGRA 4EPXA 3QENA 4MGYR 2V1XA 3A4LA 2ORWA 1DBSA 1G9XA 4ASUA 4XWOA 1LS1A 4YQFA 2XNSA 4DCNA 1NVVR 1OXSC 4XWAA 1SVIA 1BOFA 2AFIE 2BEKA 4JKIA 2CE7A 1NI3A 4XOIA 1YU9A 2CLSA 1G3UA 1IN4A 1W0KD 1TU3A 1ETUA 1MABB 4FMCB 4OK3A 3FMOB 3QVUA 1MH1A 2BVNA 1XXHA 4Q1CA 5DN6A 1M8PA 1G5PA 3ZIAD 2O8FA 1E1RD 1XEWX 2F9MA 3EA5A 1AKEA 2FJUA 2DFNA 2FGJA 2FFQA 1KDRA 1XZPA 4NCIA 5TV2A 2BIFA 1Q21A 2AN9A 4OK5A 3U4QB 2WOOA 1JJVA 3GP8A 1H65A 1SXJB 4Q1DA 1YJ5A 4LJ7A 3R7WB 2YC2C 2FEOA 4P31A 4S35A 5AUNB 2ZRAA 2IS1A 2VHUA 1G17A 4URVR 3WYAA 4JT2A 2A3RA 1G7TA 4B3XA 1MR3F 1Z83A 1KDOA 3L0PA 4LPSA 2CE2X 3MJRA 3WNBA 2A5JA 2QQEA 1X1RA 4GRAA 4X8LA 4HB4A 1QVRA 2HYIC 2A30A 5AJXA 3GJXC 4RD1A 5IF9A 2QRZA 3GCGA 4MYCA 5KU1A 1Q12A 4LHWA 5J4KA 5K8UA 5H70A 4LYJA 3TUIC 4HDCA 4R2IA 5A4JA 2R44A 3K0EA 1DE0A 1E2PA 1BYIA 2CK3A 4M9QA 4PAOA 4PPFA 2C78A 4MYUA 4CRWB 1IY2A 4F4IA 3OESA 3DMDA 4IVQA 1XMIA 3AGPA 3W6NA 2JJ1D 3AVUA 2ZETA 2RGDA 2GBLA 4B33A 3ICEA 1VYTA 1F3OA 4V02A 1FNMA 3I61A 2ZTSA 1R5NA 2MMCA 4A2QA 5BQ5A 2QEQA 3T5GA 1VCNA 3ZH9B 4B74A 4JKYA 1IBRA 4OL0A 1DG3A 4JVMA 3ZZTA 1MO6A 2LKCA 1CRPA 1UBCA 1TPZA 5C4MA 5IRCD 4Q48A 3AKEA 3VX3A 1OXUA 3SE0A 5K8LA 1S4QA 3KX2A 2JLQA 1TNDA 4P4SB 3SNHA 2AX4A 4JL5A 2WJGA 2FN4A 4NL4H 3RWOA 5HPYB 2ZS7A 3FGNA 5C2JB 3JVVA 1U0HC 1XD9A 2W58A 4R71A 2C5LA 4TL6A 1Q22A 2GZAA 3VR2A 2CL6X 3BXZA 1UADA 1KMHA 1G8HA 4L8GA 4Q7JB 3LW7A 2JASA 3GLGB 1AS3A 4PAQA 1GUAA 1S9DA 1GNPA 3SN6A 4HEJA 4N3NA 2HF8A 2IW3A 2CHVA 1E94E 2FZ4A 4XTCS 1KZGB 5EXXA 4D4KA 3SZRA 3ZVNA 5FH9A 4ZCMA 3LXRA 1HURA 4A8JB 5DN6D 4RKFA 3OZXA 2ODEA 3JZMA 5DI3A 3SQXA 5E7IA 5L3VA 2O8BB 4QHSA 4B47A 4HDQB 3AUYA 4C0HA 1U8ZA 2VHQA 3LA6A 4FW9A 4F7WA 4R9UC 2BMJA 2VH5R 1AQYA 1TU4A 2ODBA 2FNAA 3U44A 3EPKA 4CEIA 4HLCA 1SKYE 3W6PA 2Q3MA 1QHIA 1PLLA 1G21E 3I73A 1FP7A 2F9LA 2FX3A 3BAFA 1FQKA 2BJWA 3BB1A 3CRMA 4GZMA 1ZBDA 1CR4A 4HAVA 3D8BA 2EFHB 4DLXA 1WRBA 2J0QA 3GLIB 4D2IA 3ND9A 1DAGA 3JZAA 2V6IA 4S2EA 4ZCLA 1J8MF 4XJXA 4AD8A 4B2LA 4CEJA 1A1VA 2YWFA 4L15A 1H8HD 3QKRB 2CK3D 4QG7A 5M04A 4IEIA 3NH9A 4IOMA 1US8B 1Z63A 2BKEA 2EW1A 2Q3FA 1RPZA 3KXIA 1KJWA 1VECA 4NCKA 2ZUDA 2IYXA 1KJZA 3SJZA 2ORIA 4MRPA 4W5WA 1R10A 2YINC 3Q85A 1ZINA 1E2GA 3FKQA 2F6RA 5KYKA 2O8EB 2DFKB 3KTAA 1KO8A 1RFLA 2IYLD 2EFDB 4AURA 4W5JA 3FMFA 3WY9A 2GJ8A 2KSQA 1WMSA 2WWFA 3EA0A 2XXAA 4HAYA 3CRQA 3OIYA 1YR9A 4K81B 4AWXA 1VPLA 4LBZA 4OQXA 2AXNA 2VP5A 4FCTA 4OI1A 1FUUA 1F2TB 1M7HA 1T3LA 4QHYA 1JQJC 4QHTA 5H68A 2VQSA 1JXOA 4EFNA 1CJVC 4QGAA 2NQ2C 2R6GA 1ODFA 2OEPA 4LJYA 4C7OA 1NG1A 1M1YE 4NCNA 1IXRC 4GZLA 2OUKA 4PHTA 5TXGA 3U6KA 1M2OB 3U7HB 1VIAA 3GFTA 4TZ0A 2FA9A 1A2KC 1ZD9A 4LV6A 3GEHA 1FFHA 2RHMA 2VP4A 3ZVRA 4IDNA 4C0JA 4Z8YA 1RZ3A 1KYIA 4HUQA 5FUXA 3SJAA 4YMWA 3VQTA 2ZJAA 1JALA 3EC1A 1XNJA 5SZKB 3W3AA 1E1QA 1D8TA 1YHNA 3MWLA 1NKTA 1GSIA 1HH4A 1NJGA 3UK6A 1YRAA 4TSFA 2PLRA 1E4VA 4PAMA 1XF9A 3DDCA 4M1TA 1BO6A 5KUTA 1IY1A 2ZREA 1C4OA 1M34E 5FBRB 3TUZC 1ANKA 2PT7A 3KKOA 1ESNA 4B71A 1P2UA 4QGHA 4OHWA 3BC1A 4PQFA 1LFDB 3FFBA 1KI6A 1KK0A 3GLHA 1XMVA 1G8YA 4LC1A 4QFMA 4TLAA 4F91B 3U7GA 1HUQA 1G4AE 4DEXA 2FPLA 721PA 4B2IA 2DCUA 1XJ0A 1Q57A 3IIMA 2QN6A 5BN3A 2IS6A 1H8ED 2V1UA 5KNBA 5AR1A 3HDTA 1MV5A 1T6NA 2VHTA 4G01B 4AYXA 1VG8A 1CLUA 4UNSA 3H0KA 3PQCA 5EE5B 4OI4A 4GOKA 3S1AB 5CLQA 4NH0A 1N6IA 3I62A 1DS6A 4TMKA 1E2QA 1CJUC 4MA4A 4YONB 4DIEA 5F9HA 2BKUA 2X8AA 5CK4A 2ZRPA 1G3RA 2ZVQX 5FI0B 1Z6YA 5DSZA 1N5JA 4Q4LA 3IUYA 1NLYA 4TN1A 4B6EA 3Q8XB 3RHFA 1WXQA 1RRCA 5DHAA 3SJCA 1U0JA 1G4UR 4KFSA 2B8WA 2H17A 3EARA 2J0UB 3EZFA 2CDNA 3QI2A 2JJ2D 1S3GA 3WMEA 5DGXA 1O87A 5CIQA 1V5WA 4HZIA 3R9IA 4X8MA 2YZ2A 3GQBA 4MKHA 2AKYA 4PC1A 4OHYA 3BORA 3F5FA 2O8DA 3QXCA 1FP6A 3WNCA 2W6ID 3LLMA 3NBYC 3GLGE 2D7CA 1E2MA 3QEJA 4GOXA 4TMZA 4DB4A 1FL9A 5A0FA 1WBBA 3WHKA 3LVQE 4WVFA 3FDIA 4L4UA 1D6JA 3T34A 3PEYA 4QJ3A 3T1QA 5G3YA 4MYHA 3GJ6A 5KPDA 3NVAA 1UPTA 4QNMA 1NBME 4PO1A 4TL7A 4BWYA 4DSNA 1DVRA 1JQLB 4HAUA 3PCRB 1N3BA 1P2VA 3SYLA 1NN1A 1K6MA 1E1QD 2C9YA 1P4SA 1PLKA 3LD9A 3Q3JB 1IN7A 2G0NA 3EPHA 2F1HA 1S3SA 1X8LA 1XMJA 2NO0A 4DKXA 5DH9A 2ZR9A 3RSOA 3T35A 2C9OA 3RS5A 2AKAB 2ATVA 4Y0AA 3THWA 4KBGA 4I1OA 1E9FA 2V9PA 3MSXA 5FPYA 4C0KA 4YMTA 2QG6A 3DKPA 4ZDWA 1UKYA 2XTMA 1IN6A 1ZU5A 3PR1A 2QQ0A 1LB1B 4ACBA 2NPFA 3MG9A 1P75A 5EP2A 1TQ4A 4GOJA 1KI1A 3VKHA 1GFIA 1OKKA 3CIOA 2G3YA 5KNDA 2QE7D 5FTLA 5EXPA 2FFHA 1G8PA 3KUCA 3MWKA 2XX3A 2V7QA 3LQRA 1Y63A 2F1IA 3DZDA 3UANA 5CITA 5JEEA 4QM7A 4LOAA 3VMFA 5GJCA 1Z6GA 2I1QA 4IEEA 4V0LA 2RGAA 4PPGA 2ZUBA 2VEDA 4DSUA 4DXAA 1CEEA 2VP9A 3Q7QA 1KAOA 2VRWA 1AZSC 3VR5A 3ONWA 3WYGA 1VDZA 2FFAA 5FOUA 3VFDA 2BHRA 2QBYA 3A1WA 3QBTA 3BH7A 3QKSB 2HXYA 1HT1E 3NG1A 5JI2E 3NEYA 1PUJA 1GL6A 2V54A 2O0KA 4P4TA 5AJYA 2HT1A 1R0WA 2CL7X 2GK6A 2FSFA 3HR7A 4CVNA 2G6BA 5BN5A 3HYTA 4RVCA 2IUSA 2J0VA 3R9WA 2VP0A 4EJSC 4HZUB 3X2SA 2PMDA 5CDFE 1TTTA 1UF9A 2BCJQ 4X8OA 2OAP1 3CWZA 4D4LA 4LX0A 3WRYC 5CIWA 1R8SA 3SS8A 5JS7A 1GRRA 2GCNA 3AEZA 4JT4A 1L4YA 1BMFA 3SYNA 1P2TA 3AF3A 3QPVA 2NO1A 1GKUB 4TTPA 5AWFC 4A0FA 3LRPA 3NC1C 2QU8A 2RGXA 1EK0A 1Z8FA 4LK2A 3A6PC 2DFLA 2G1JA 1U2RA 3SFZA 1R0YA 2ECKA 3NDPA 3QPUA 4IOLA 3TIFA 1XTIA 3EIQA 1M7BA 4US0R 1I2DA 1PV4A 2OSBA 2GKSA 3AGQA 3U60B 5EXSA 2ZXUA 2AFHE 3QOFA 2MSCB 3FKSA 4CGZA 2IHBA 3TK1A 4ABYA 5B64A 1F5NA 2X2FA 3K8YA 3MAAC 3OAAA 3VR4A 2L0XA 3RRYA 1M7GA 4XH9B 3DM5A 3ZDQA 4Q19A 4TLCA 4DCUA 2ZRMA 3RYTC 4CEHA 1WP9A 2EU8A 4HB0A 5LD2B 4MRSA 1C9KA 4ZCIA 1XX6A 2ZRNA 1XEWY 3K9GA 3KKPA 1T0HB 4QOSA 1XPRA 4IVRA 2JLYA 4NYJQ 1OFTA 4LZZA 1CJKC 1COWD 2ONJA 1WB9A 5IK2A 3FB4A 3X1XA 1XD2A 2X77A 5D3MA 2H8KA 5FTKA 3B60A 4IFEA 3X1WA 3GMTA 1GL9B 4IFBA 4CZ2A 3HU1A 5TY0A 1LF5A 4LHXA 4Q1FA 3PVSA 4P33A 3BE4A 1P2SA 1OKKD 2V55B 4LWZA 4MITA 1S1CA 2WJJA 5DLQC 3IPYA 2FU5C 4QRHA 5F3WB 4JYCA 5C1BA 3EAQA 3UMRA 5UKDA 1Z0JA 4QGGA 1W49A 2GWHA 1JR3A 4UNQA 4DLTA 3EG5A 1AM4D 3PEVA 4GSYA 5GJVC 4BLPA 2EFCB 3PFIA 2DHRA 2RGNC 3IO5A 1XXHE 3TR5A 2OXCA 3HPQA 3WP0A 1P72A 1OH8A 3C15C 3TRFA 4RFVA 4Q03A 1FX0A 1C1YA 4Q7KA 1W0JA 1GP2A 1XEXA 4JIMA 4OI0A 2O8CA 4M1YA 4JLNA 4OKSA 2QORA 2IYZA 4B3FX 3P4XA 3K0FB 2G9NA 4PFSA 1Z6XA 4B48A 5L3SA 2BBOA 4TQAA 1KDPA 4HI0E 4W7SA 2LKDA 2B92A 2FPKA 2ZPTX 3SR0A 4C0SA 5KDDA 4PZLA 4Q4HA 4NYJR 3OHMA 3CR8A 3SJBA 2WMNB 4WZAE 3QPWA 1TX4B 1UBGA 1BMFD 2WWYA 1I4TD 1T3SA 1K5DA 2ZRKA 1UJ2A 2CCJA 3A8TA 1R6BX 4ZDIA 2J7PD 2WV9A 1S9HA 1IJEA 2CBZA 2JA1A 3IQWA 2HLDD 3N5CA 3QE0A 1TUIA 3UWOA 3AVOA 1GM5A 1EWRA 3T15A 3QVVA 3PIRA 4DDVA 4G5OA 2J87A 3C5HA 1XCGB 4EAQA 1SKYB 2EYQA 4FWIB 3CKLA 2IX3A 2DB3A 2P6UA 3VTKA 4DLRA 4Z8XA 3FKSD 4BFUA 3DHWC 5J47A 3LWNA 1ZJ6A 1EFHA 4HB3A 5HE8A 3GJ4A 1DG1G 2QPOA 4IDQA 5BYKA 3TJZA 3IKJA 2NOAA 2XB2A 2BC9A 2ZRLA 4G0NA 4R2HA 2WJVA 1M74A 3ECCA 4M9SA 1E2JA 4Q4JA 5LB2A 1KAGA 4RJLA 3DOEA 4US1R 4NMMA 4KO8A 5AJVB 1OB2A 1CXZA 1MRSA 2RGEA 2ZR7A 1EFCA 4ARZB 4MKFA 4Q1AA 4F38A 1ZW6A 2OCPA 4ON9A 4DZZA 2IEZA 1VYVA 3B5JA 5IK2D 2ZSDA 4F92B 3CPHA 1I4DD 4M0LA 4V03A 2W83A 4D6PA 2PJZA 4LHVA 4JBYA 5FR2A 1Z2CA 5K8IA 1QDEA 2F43A 3QJYA 4HUTA 4WBSA 2IF0A 3LFUA 5ELXA 4YXWD 2NG1A 2OCYC 4LSGA 5SZIA 1YE8A 221PA 4V0OA 3CH4B 2FEMA 2OG2A 3OE7D 2YV5A 4RD4A 4DVGA 2QMEA 1T9HA 2VA8A 5FBWB 2FH5B 1JR3D 1ELOA 4U00A 1R7RA 1NLZA 1SQ5A 4MGIR 4NYMQ 4XVRA 4KI0A 3R8CA 2Q6TA 3ZS9A 3QF4B 4IDPA 3MD0A 3QG5A 4O0MA 4JBWA 1JPJA 1SVWA 4LUCA 4QNRA 5J4YA 3B1ZA 3IBYA 1ZU4A 4R7ZA 2O52A 5JI3E 1W0JD 4FMDB 4A15A 3K70D 1AKYA 5CK5A 3ADDA 5EP3A 3SOPA 1ZCAA 4MKIA 4HB2A 2ZJZA 3M0EA 3GLFA 2JLXA 4G5RA 1NNEA 1II8B 4JLDA 3TUJC 3DPUA 2ZITA 2VHCA 5FR1A 2HCBA 4QL3A 4PHGA 2F7SA 4QXAA 4IDHA 5B58C 2AD1A 4M9XA 1RYHA 4R98A 2FDCA 1Z5ZA 3K0AB 2WWGA 3VKWA 1FZQA 2Q0HA 4DT1A 2ZRIA 3THOA 4EQ6A 5DYIA 5FL7D 1PJRA 4P3YA 2R6DA 3ZS8A 1Z0DA 1KHTA 4EPWA 5J40A 1KI4A 1XZQA 2ZE6A 3KKMA 4L5BA 5C4GB 1NLFA 2VP2A 1RRFA 4LJAA 5EE3A 3EPJA 1Q3HA 1XD8A 2PBRA 3B13B 1HYQA 4WW0A 4EPRA 1EESA 3VNUA 5L3QB 5BN4A 4U5XA 3C8UA 1GILA 4X8HA 4ZO4A 4NYMR 2AD5A 5EP1A 2ZU0C 4DLZA 1NMYA 2PCJA 2G77B 2Q9CA 1XB2A 1ZMXA 1F2UB 4ZDJA 4Q21A 1QHNA 2QT0A 2FSGA 3QF7A 2YJTD 5JCPA 4M53A 2XZPA 3CF0A 3RS2A 4DSOA 2JIZD 5J4VA 1OH5A 2IUTA 5J5CA 5DNYB 3KFVA 4Q4AB 4BFVA 4BZPA 4TMTA 3B78A 4WOPA 2VHJA 3E70C 4UJ3A 3RC8A 3NHBA 1W48A 4BRWA 1HE8B 4ERNA 4B3DA 4M8NE 4V0ME 1GOTA 2XZLA 2GTPA 4BFXA 1CU1A 5FPSA 4RD2A 1DAFA 4HSEA 1R2QA 2PX0A 3KB2A 2OBLA 4B43A 2B8TA 1N6NA 4TLDA 1EXMA 4IW3B 4PHHA 3FMIA 3HJNA 1OJLA 4G5QA 3TW4A 5GVSA 5EP4A 4UNPA 4EJSA 2CLDX 4IXMA 2BM0A 3EZ7A 3CNOA 4FWTA 4DWJA 2KWIA 4OQNA 2RB4A 4O2RA 2JLVA 1U8YA 4FXPA 2QP9X 4TZ6A 3EXAA 2PCLA 1KSFX 2W6JA 5AK0A 5H8WA 3IHWA 2IHYA 2GAAA 1ONBA 5ANRB 5AJZA 1E98A
chains in the Genus database with same CATH superfamily
1E5TA 3W1WA 3ZWBA 3KOXA 4Q39A 4B4KA 4ZK6A 1A2OA 1MT0A 3FPCA 4G5FA 4RVGA 1Y1RA 3PWZA 4EZEA 1JZSA 5TPZA 4ASUD 3I1FA 4QBKA 2VF7A 3MPOA 1KMCA 3NHRA 2DPYA 3M6AA 5ERGB 5HMLA 4DMLA 5IFLA 1F6BA 1U3WA 3NHMA 1KK3A 3RTGA 5EY5B 3O4FA 4H27A 4AZ3B 5JH7B 4AZSA 2YNMA 4UULA 4F3YA 3ZV3A 4LI0A 3LPCA 3N05A 5FI1B 1OGYA 4QYMA 1C50A 2Y93A 4KN9S 2RG1A 3P9ZA 3NHSA 1T4GA 1JLLA 4KWHA 5TPWA 1QRRA 5LZ2A 1I7DA 3AR7A 3BICA 5C5EA 5FAKA 4QUBA 3GMIA 1R8QA 4HEHA 5JRJA 5TR9A 1JAZA 3B1KA 2QRNA 4GPTA 2J33A 1GTSA 4W9NC 3ENNA 3CVWA 1P3JA 2I1VB 5B7GA 5LLDA 1HDYA 4XX0B 2PA3A 2AK2A 4QODA 3RROA 1PJ8A 1TQDA 5KNCH 1Y9EA 2GPSA 2FG7C 3DTYA 3TL2A 5JEDA 2UVDA 3O92A 2CMGA 3V42A 1NNUA 3RJZA 5CB6A 2L69A 4HLQB 4GRDA 2BWJA 4E33A 2AG0A 4D4JA 1FTQA 1YRBA 1O89A 2DAPA 5KVQA 4JWTA 2VT3A 3F6EX 3ZUPA 1TM1E 1KQGA 1G1MA 2ZJ7A 1HV8A 2WTAA 5HCIA 1ZMBA 1SBCA 3JQDA 2DWOA 1QMGA 2X6RA 1FMJA 1PGPA 4LNHA 4QULA 2A1UB 2MIIA 3T9CA 1OHHA 1T5IA 2GN6A 3FOZA 1PE0A 3WJ2A 1XJQA 2FW9A 2NNLD 4LGCA 2PRZA 2JJ8A 4EPYA 4RTOA 1Y9JA 5CD9A 3ILVA 5EMMA 5FAXA 4OLAA 3LPLA 1N8TA 3R4VA 2PUHA 2QE6A 3FNBA 3M34A 1N1GA 4FXOA 3ELUA 4FMCF 2HCTA 2IUUA 4ZOLB 1SR8A 3BXPA 1NVDA 3KAPA 1ZVMA 2WF8A 2V5VA 4CV0A 1N0IA 4XDYA 5LBTA 3A3OA 5GJWC 1IN8A 2IFTA 1NT4A 1XTVA 2EIHA 4D3XA 2GNAA 4LV5B 1V3UA 2DTEA 5HA5A 4WBNF 2PT9A 2O2HA 3RC1A 4Q0MA 2ODPA 2I4OA 4G0QA 4OHXA 4P7JA 4R69A 5B1DA 5CAEA 1ZJWA 3C3KA 1U28A 1X80A 4RSMA 4XGIA 2NZUG 3SC3A 3IP9A 1HDRA 2E1RA 2Q5HA 4RK5A 3TN7A 2PH3A 1MV8A 2JGKA 5EHXA 3KQKA 3R0JA 2FPWA 2C5HA 2VUIB 4MHTA 1AKRA 1KR2A 2R25B 2IPMA 3LAWA 5IX8A 1DO8A 4UASA 3ZHZA 4NEQA 1I7LA 1NUQA 1BXGA 5DHQA 4BECA 1H5UA 3DAYA 4CR7A 1SEVA 4RZSA 3ZU3A 4D9BA 4WNAB 1JECA 2J6CA 4QBHA 1W59A 4FT4A 1EEHA 3MTQA 4WUVA 4ZYUA 1SKAA 3L0BA 4Q01A 2WB4A 3QXGA 3HKEB 1GZDA 1EFPB 4MTLA 5DT9A 3OBIA 3IBGA 1A9TA 3WL7A 1RWKA 4O3MA 4JI6B 4C87A 3ZI7A 4AO7A 3LVRE 3KTOA 3PNQA 2XSZA 1U5BB 1XU9A 3DMTC 4RMJA 3SHFA 5HRUA 1PSWA 2FJPA 1YR2A 2C77A 4X00A 2A84A 5I8ZA 1K3TA 5ITZB 3I12A 1OLSA 1G16A 1PVVA 1QLHA 1ZITA 1SXGA 3Q7SA 4HH3C 1I01A 3GGGA 4UREA 5TEWA 3WHLA 1EWQA 1T9ZA 2X15A 4YIKA 2ZYDA 3HB4X 3OQ6A 4H3VA 4CM4A 3PQEA 3B85A 4HOYA 4ZPXA 3UTDA 1GRNA 5A5GA 3B9BA 4BRUA 1JB1A 4KLZA 2LNDA 4FHGA 4EY8A 1Y3CE 2YJZA 3ZDEA 3HBAA 4OHOA 2WUDA 1WPQA 4PLYA 2HPZA 3V8BA 1TFUA 3WO1A 3UOAB 5JWOA 1E5DA 3P9XA 4LXIA 3TXXA 1ATIA 1DEXA 5K20A 4M6WB 4OYHA 3FOEC 1CULC 2C5BA 1JL3A 1DRJA 2QN3A 3O38A 4E08A 2QAJA 1BQ3A 3IT3A 4COOA 4E5DA 1UPCA 2NNWB 2CW5A 4W8OA 1XPOA 5JSZB 1W1UA 3HCAA 2QQFA 4JC5A 2ZTHA 1R8YA 4I3FA 2ZE5A 2IE0A 3N7UA 4KR7A 1WB6A 4KWIA 5C8VA 4JJAA 4YEDA 3IEVA 2UYOA 3T3PB 2HHJA 1K92A 1QIMA 5J58A 5BV0A 1XZMA 4IDBA 5DRYA 3KTFA 4RY2A 2ZJBA 3NX4A 4JJFA 4N54A 3WDKA 4CETA 4FGSA 4JCCA 2YRXA 1NQWA 5DGHA 2QLLA 5EESA 5T41A 1KRXA 1LI7A 2H11A 1O5IA 3ZGVA 2MMGA 1E3DA 2PS9A 5EERA 2JLBA 3V97A 2FX2A 3PEUA 3JD4A 5JLAA 1C7EA 1UFVA 2Z6VA 1XELA 2RI0A 3JATA 3ORQA 2BAGA 3OT1B 4ONEA 4R1TA 4WXYB 3S68A 1N0UA 3Q0IA 4G1MB 5A04A 1N92A 5AKJA 3V8PA 1NMEA 3S4YA 3RS7A 2Y05A 4DJJA 5E3JA 2IZOA 2H9AA 3ZKAA 2XVZA 2Q07A 4LCEA 1PYOA 2VWGA 3KLMX 1ZBQA 5EKSA 3L82B 5KYWB 3OC6A 3TLZA 5HE9A 2JVIA 2VNIA 4FW8A 4KK4A 2ZAOA 1ST2A 3V7FA 2QR3A 2IC5A 2VSXA 4AF6A 2LD4A 4S0ZA 3G0HA 3JQFC 1OLOA 1KMMA 3I5UA 4P3OA 5A4MS 5C52B 3K4QA 1OIXA 4I9GA 3E58A 1AK2A 1JHAA 2AMFA 3MELA 1LV8A 5HQ3A 3AYXB 4CMCA 4O4HF 5IMBA 2CCGA 4JBXA 3JYHA 3EF3A 4BGEA 1PW7A 1L5YA 4UBLA 1KDVA 1ULAA 2RH5A 1RRPA 4KXWA 2H52A 4TV9B 1NJFA 2P75A 4WD3A 2QAIA 4WQMA 5ETJA 4RL4A 4BMZA 4W4TA 1K7YA 1XE3A 1FB5A 4DABA 3RVSA 1VLQA 4KO1S 3NDBB 1TAUA 1JKJA 4YCLA 4MGEA 4IR7A 3FPHA 1JG7A 4PAWA 3AZPA 2FZLA 1NULA 1Y80A 4JXKA 1VIDA 4QSMA 4UXJA 4DC0A 5CYFA 2VRNA 1VFPA 1GT6A 3DPSA 4U8HA 3WWZA 3INTA 4QDXA 4BYMA 8LDHA 5JXWA 1ZIXA 3IMCA 4QU9A 5JMPA 1Z6QA 1X7XB 1M1UA 2CHUA 3IBTA 5DOZA 1YFJA 1TC1A 1E2LA 3C5WP 3K35A 1QK4A 2NV2B 3OOYA 1YA8A 1CQIB 3CZQA 3FFXA 2QPTA 3T95A 1Q0HA 3V80A 3WTBA 3UHFA 1G9TA 1HY3A 2H54A 2O2CA 3IUJA 3K0CC 4RTJA 2N0SA 5ECYA 2ZAGA 2CVHA 2WU1A 3VTFA 3I2YX 2P67A 4EY6A 3D4NA 5H9WA 3RVNA 1SKUA 4MHSA 1J8YF 5F9FA 3CUWA 2AKEA 1O95D 2EWVA 3JQAA 3ZZNA 3TR0A 4RTLA 1UKEA 2IY8A 4FYYA 4M1OA 4YASA 4ZQEA 3O31A 1NI5A 2J9XB 1IONA 3LOUA 2GRJA 5A2GA 2B2CA 3T1TA 1V1JA 1SC9A 3ONDA 1R6XA 2W2TA 4Y9SA 3DBLB 4DGQA 1KQNA 2WIAA 1Z0FA 1YCGA 2YBEA 1SNYA 3EWIA 2WVGA 3CQ9A 4UBIA 1BVHA 3P9NA 2VJOA 3NUGA 1T2EA 2ORYA 4BEJA 2V7VA 1I5EA 2FWMX 5LZ4A 3ZLJA 2PQMA 2YIVX 1U0LA 4HRYA 3TZ6A 3K0SA 2W4MA 3HZHA 5E6UB 2Z8YM 2Q6IA 3E7XA 2NADA 1IG3A 3OE5A 4Z1MA 2DPMA 4FEGA 5AIAA 1KMHB 2ZM6B 2A33A 1WZNA 5FPPA 5IXSA 2CXXA 3OD5A 3ZZUA 4C0AC 4C6RA 1JVNA 2XYVA 4CW7A 5DXFA 4CYMA 1HR0B 1Q83A 4XM2A 4D9MA 2Z30A 3QKTA 2GPNA 1EXWA 1LFAA 4UATA 5FWYB 5HBRA 1MABA 1ZLXA 1RTKA 2C9DA 2NVUA 4YXFA 2JAHA 2BZSA 1ZVVA 1U8XX 2QL9A 3GROA 1Y5NA 1RMTA 4BUJA 1FEZA 1E7SA 3DNPA 4NZPA 4YAWA 4DQVA 1OYVA 2I2FA 2FJ0A 4I2NA 1W87A 3FYUA 2FZVA 3B9PA 3LP5A 4FNGA 4MW2A 3U2QA 3LUGA 3A0UA 4H3KB 3ZK9A 4KDEA 4AY3A 2O07A 4JK3A 3RK4A 1R9GA 4UE3S 1BQEA 2DYKA 5JD3A 1RRVA 1XFAA 1ZM2A 4YAIA 5EEHA 2J7KA 3U4QA 1V37A 2A78A 3DBVO 3PZRA 3OZDA 3QU7A 5AKYA 2EW2A 1Z34A 3WYFA 4BV3A 3EXFB 3QFRA 4X20B 3IB6A 1Z3IX 3ASZA 5FHQA 3DCNA 4PO9A 3EZXA 1DBWA 4KSBA 1CUJA 3HH8A 2A7XA 2AE1A 1VMEA 2QNRA 4FDMA 4JGGA 1BU8A 3ONVA 1PJCA 4PZ9A 5H82A 1A5SB 5BQPA 4BLQA 3NFYA 4GS5A 4C2TA 1DQZA 4J0FA 4P5DA 4Q9JA 5BXQC 2DU8A 4CCWA 1ORHA 1S6YA 2D06A 2AN4A 3MTGA 1XPJA 2JIPA 2YWJA 1T91A 3FFWA 1RKVA 4HH4A 2R8OA 4HTFA 4BC0A 1EB9A 1UM9B 1GPDG 2WBLC 3OKPA 2AWOA 2RHJA 4IIXA 4JJKA 4RSGA 1NQVA 2AYYA 4WKOA 5F33A 5F5XA 1NXQA 1P7VA 1U7PA 5C80A 2XIQA 3PF8A 4DV7B 3PDIA 4B35A 1T6XA 3RUIA 4D81A 2IJGX 4JH0A 1G60A 1UKCA 3HFGA 1J39A 1T1IA 1IN5A 2BJHA 3FYCA 3H3FA 3KDPA 4TT3D 2HDOA 2QWXA 5LQSA 2MYNA 2G6TA 4YJDA 2B4TO 2R6AA 1KI8A 2YHUA 2QLNA 3S8MA 1L4NA 1G2QA 4X41A 2JLUA 4ISCA 3NWEA 1BC5A 5JBQA 1K3FA 2I67A 2VJBA 1UK8A 5JALA 1P4HA 1HT0A 4EYOA 4DIDA 2YBDA 3QA3E 4GC9A 1TKAA 3CIFA 2I3DA 3MINA 1NNI1 4KYUA 3PXEA 1SC3A 2DQZA 1FYXA 2H1WA 2HRQA 1J8DA 2NZJA 1NBHA 1UH5A 2QV7A 3B3QA 3B52X 4M4SA 5HQJA 1JI0A 3NO4A 4K9PA 1YI8A 4A82A 1PQWA 3R6DA 2ZK7A 5CAEB 2R6R1 3VC3A 5FWXB 3Q10A 3NDRA 1UAAA 4KQXA 3ZE2B 4PQRA 7GPBA 1YSCA 1YKGA 1ZX1A 1XTTA 3VC1A 3W8RA 5LDHA 3IAUA 2PBFA 3HFSA 2QJFA 3N2LA 3NYQA 5JAUA 5DHUA 3MTBA 3LZCA 4J2TA 3CPJB 2JATA 3WRWA 1L5QA 2F3TA 4CQMA 3KG2A 3SGLA 4HQ0A 3OEEA 4B75A 4BUZA 4O4IF 1R0CA 2OGUA 4FJ1A 3T7JA 4YMGA 3O4VA 5C5IA 3WLNA 5KVCA 2C1EA 4R83A 2WNHA 1GV1A 1GFWA 1U90A 3MWJA 4H4CA 4HMOA 1NXXA 2BF4A 1F1BA 3IMEA 1SZDA 4KLNA 3U3RA 2WA2A 1EFTA 1X7GA 3U9LA 3OFNA 2WFAA 3TKLA 3ZPXA 3D6JA 3DYBA 5FBQB 1DXOA 1ZNWA 3UG6A 1XPUA 4NTZA 3DFUA 5C34B 3WL8A 5I7OA 1XTPA 2IXGA 5IUJC 4KFRA 3V32A 3VR5D 1P9LA 2B83A 4JLUA 3NWPA 4X65B 1CETA 1EUCB 3GP5A 4XAQA 4PR3A 4HQRA 4XLLA 3ZN2A 2JGEA 3E81A 3BCHA 1O97C 5LXTF 4N6OA 2LW7A 3KQLA 2VDNB 4C0WA 1AUXA 1Z4MA 5AVOA 2CUNA 3L8HA 1VHLA 1D2GA 3PC7A 1OF1A 4RXUA 2NV6A 3DUFB 2DFVA 2BFEA 4EIWA 1QAOA 2D2FA 3GEBA 2RHDA 3KYJB 2GZDA 3CLTC 4LJSA 1THTA 2GZ3A 4B2YA 1O6BA 1O1YA 1OX5A 1N6OA 3AWDA 4NESA 1UZNA 3OEHD 3CN7A 2PEZA 1Z68A 1QOQB 3NTUA 1ZHOA 4PYRA 1V2HE 1TCUA 1ZN8A 2X1VA 2FK7A 2D5BA 1HFKA 2R0QC 4IS2A 1TK3A 1ZP6A 2NO5A 3NR2A 3GLHB 3RODA 1LTQA 4NHOA 4EA9A 2VRCA 3I9NA 2MSDB 3MILA 2FEWB 2X76A 4KAFA 2QVGA 3L8EA 3L7DA 3SF8A 4BAZA 4XD2A 3JVUA 3KVOA 1CF2O 2YHIB 3GWZA 3N07A 5CT8A 1Q17A 3CH5A 4MVJF 4B82A 3T4EA 3TQRA 3WA6A 1K8RA 2NSJA 1EP1B 3PQ6A 4F1WA 5AVYA 3BJEA 2AG8A 3CX3A 2R84A 1X2EA 1AZTA 3LYLA 1PD1A 2DR3A 1E89A 1KTVA 2B36A 1F4VA 3IUQA 3PIIA 4GR5A 4M37A 4Q3NA 5LZ5A 3C3XA 1OZ0A 4HYYA 1Z18A 3N59A 2H0AA 2Y3IA 4Z99A 4TYWA 2NYVA 2I6FA 3TEMA 1JPNA 1R88A 2YH2A 4H6VA 1D2RA 3PENA 2FQXA 1E1RA 1YJXA 2OFOA 2X8LA 4FT2A 5AKHA 4D98A 1TAQA 5FUQA 2H7VA 2IYEA 2UVQA 1GUFA 1LSJA 4MJ7A 4CIAA 2Z4SA 3DF9A 4ARIA 1OI3A 5GINE 4UUMA 1RYDA 1XIVA 2PS3A 1JNXX 4MIEA 1E0JA 1E5QA 3SS7X 3P2IA 5F7XA 1T0PA 3C6YA 3KXKA 3DMRA 3H5WA 5BUSA 3KPJA 3ZVMA 1JA9A 5JXGA 1TKBA 1VIMA 1CERA 3CTMA 3E6AA 2O8EA 1LLCA 2TSYB 4M54A 3ZDRA 2KLHA 4OKNA 1R6DA 4ILEA 4L75A 3WVNA 4PFKA 4PONA 2I3ZA 3HYRA 7ABPA 4EG7A 1ZA1A 2QZSA 2WJYA 6CHYA 2ZJ2A 3D6NB 1XVVA 1JHZA 4MJLA 2PH5A 3Q9UA 4LYDA 5DTMA 2R6FA 4CM8A 1V5FA 1Z7EA 4WJKB 5E0KB 5EJ8A 2HU8A 4IXNA 1NU6A 5ILQA 1K8ZB 1FJ2A 3EXEB 4ENUA 3GQBB 1U3FA 3CRW1 4KQGA 2D62A 5DCYA 1YC2A 2COKA 2JGNA 4D82A 3FDFA 1VE1A 3T3HA 3T1OA 2O8DB 1FY2A 2P5YA 5AFSA 2E5LB 2YZMA 3DONA 2V9CA 1KKMA 1TRKA 3NHJA 3OZGA 3QW2A 4INZA 1A7AA 1N5IA 2NZ8A 4K9QA 4FDLA 3KJZA 4WNYA 4IGFA 3SFVA 1W2WB 2MOKA 2CXQA 1A82A 1CQZA 1XKXA 3EH1A 4JB0A 4F97A 3G1UA 2NQTA 1XTRA 4PG6A 1Y1TA 4ZYVA 5AK6A 3N2EA 1YRHA 3FRJA 2HSWA 1J70A 3NKVA 4MQLA 5BW6B 8AT1A 4EMTA 1U9IA 3G79A 4HNSA 4TMWA 1X7WB 3P0JA 4C9BA 4BKUA 4ZEWA 1A5TA 2ZYVX 1POWA 1E9AA 3RFTA 2YOGA 2Z58A 5GQSA 3RADC 1WV1A 1UZLA 1UAGA 2FZEA 2QIOA 3BJIC 3PQ2A 2I4MA 3QOWA 2AQKA 5K3FA 1KC3A 4EI8A 1AOXA 1GSAA 4UHJA 4IKOA 1ZM4A 3DO6A 3SC2B 4IQGA 4MICA 4J90A 1URPA 4HDNB 1G7CA 1VRWA 1MMFB 3ITEA 3OX1A 3PL1A 4UTOA 3ZKWA 4FC7A 2R7NA 4A73A 1UBTS 4TTIA 2GPAA 3M6UA 4KRYA 1L7BA 4MCHA 4E6EA 1YGYA 1WQ3A 1K6IA 2M6RA 1SOWA 1V71A 3MOSA 2Z09A 3KC2A 4LX8A 1DJQA 1G5IA 3U7EB 2P0EA 2N42A 3NHLA 1WVGA 1OWNA 2P3QA 3BD7A 4I9UA 4F0JA 4ETNA 5F1KA 5BSEA 3IKMB 3D6HA 4BQRA 3W5CA 3KEFA 1DLIA 2RKOA 4RWEA 1FRZA 3JQ9A 3OCYA 1Y3BE 1UXJA 2BELA 2P9YA 2ZVDA 4LGMA 1L1EA 2P8JA 4RLQA 5CGQB 1J90A 1VHJA 2I7CA 3GCZA 3OY2A 4U4AA 5GM2A 1MOSA 2CBXA 2WSIA 2YWGA 4I55B 3ZWYA 3F0TA 2WTXA 1BEEA 2QL5A 4Q3EA 1E3TA 1NSFA 521PA 2BFDA 2WUVA 1PK8A 4LYHA 2XQIA 1EJ0A 1OBFO 2YS6A 3WBKA 4BFLA 2BDTA 3DH0A 4JYZA 5K3BA 2CLCX 2QMUA 1MJFA 2F1KA 2G40A 1UWVA 2RGGA 4O2BB 3SJUA 3WZ2A 4G56A 2CXOA 2EJUA 4HXGA 1D2HA 4PS1A 4L72A 3RBXA 4J43A 5IT9A 4GUAA 4HFJA 5CYPA 1MENA 2FLVA 3IUSA 5BN5B 2B7CA 2QD3A 2HPAA 3LUHA 1ZUIA 3WADA 4DMMA 3UHOA 2FUG1 3NGLA 4I08A 1KORA 3ZE8A 2J0UA 4Y7DA 5CYOA 3K9BA 4DDUA 5K2MA 3ZW7A 4D9HA 5DBHX 5LFAA 3U4GA 1DUVG 3D59A 3OJ0A 4GP6A 5ALVA 3KSBC 2PIDA 1JN0A 4KACA 1B73A 3MWYW 4P4LA 4CDMA 1UDAA 3FCUB 1X70A 1U65A 4QE3A 1XXLA 5IC4A 2QZZA 5ESWA 3V9AA 2DT8A 3JR3A 5A3QA 2FRXA 1IFXA 5IPFA 4M98A 1EFDN 1BCRA 3F71A 3PXGA 1D1SA 1K8YB 1LNZA 2GXQA 2NSHA 3TH5A 2J59A 3TO5A 4BFZA 3PDHA 2PUGA 4WX2B 1GNTA 3EVBA 3PFNA 2XF8A 4FFLA 2ZIZA 3H42B 2B37A 2HA2A 3U19A 1GRQA 1MP0A 2E85A 4BP9A 4OHVA 2FWAA 4OI2A 4FLEA 4AO6A 3LKDA 4EUSA 1TVEA 1IRIA 2HYDA 4PU0A 4WKCA 4MW7A 4X1YA 1QH9A 2QM7A 3A2KA 3HLKA 3RF7A 3ETCA 3D4IA 4OAOA 1SXPA 4RTKA 4CT5A 4Y6OA 4DG8A 3ZI0A 2ZT7A 1T35A 1QIGA 1XN4A 5G41A 1P73A 2NTJA 2XWPA 2HRRA 3UFBA 3NAZA 2FEXA 4CEHB 1B42A 5D85A 4ZCTA 1CDDA 1S3IA 2I65A 2BMWA 3G59A 4DLYA 5B36A 2ISSD 1HZZA 1QFSA 3JW8A 4XE5A 3SKVA 5C8DA 6ADHA 3R7FA 2V03A 1R5OA 5FB3A 2EERA 5EPOA 1R0XA 4JVSB 3ZWKA 3EW9A 3MS2A 4U2GA 4IFTA 1XZGA 1CB0A 5K0JA 2G9ZA 2FMXA 5D3MB 2XQKA 4KAAA 4Z2AA 2GXSA 2J3DA 1L5RA 4CTKA 1XVTA 4V0NA 2UAGA 4E14A 3JWPA 1HORA 1K2WA 3GLHE 1JDZA 5CIYA 4DBZA 2B1QA 2ZATA 4LQCA 3AUSA 1HRKA 5IXYA 3HVJA 2XOKD 5GJBA 2PKEA 3W04A 1ARZA 4RDIA 5U4QA 5A0TA 3PGJA 2WWVD 5IVKA 2P11A 4F06A 3D3KA 1YDEA 2GTIA 4V3CA 2Z08A 3VYWA 2XTAA 1WBJB 4MKGA 4NXNB 1XC7A 4WKNA 4WLEA 3ZLUA 1ESMA 1MFZA 1YF3A 1VKJA 1ORWA 1GTZA 1H42A 1ODLA 4XJTA 5E6RA 5G4LA 1U4OA 1CT9A 1HG0A 5K8JB 5J2UA 1OYWA 4UE2A 4N76A 4OGFA 3HVHA 4UCWA 2VNHA 3J7AC 3H87A 3M6MD 2Z3WA 1AJEA 4EW3A 3T7KA 2JAQA 3UM9A 4IIGA 4JBNA 4R40A 2MJLA 4OGWA 4YA6A 1FX0B 5H83A 3RASA 3QJ5A 4P5PA 4N6NA 2JCYA 2AFIA 4JLJA 2O8CB 2VP6A 3P0RA 3VOBA 4L4ZA 3NIWA 1Q5PA 1YAJA 2C07A 1JEDA 3PE6A 4GYWA 5EINA 1GLGA 3U13A 1NXWA 3P19A 1JG2A 1ENPA 3QVGA 3IAM6 3ORYA 4HZUA 3L8CA 2ZUEA 5FT9A 1ZVJA 5K0FA 4LAFA 4ZMRA 3FGZA 3KXDA 4HJXA 2CCKA 3IEXA 3PX2A 4UEWA 1IEQA 1N5RA 2P8SA 3A4TA 4B5KA 3ENKA 4XA8A 5T6BA 5KSPA 4D1YA 3G3EA 4TQUS 2VQ3A 3DOUA 3UT5A 4OMDA 5AQ1A 3DTVA 2QR2A 3D5QA 3P0FA 3TLGB 4B76A 2RE8A 1TYBE 4EGCB 1QLJA 3PZBA 4QYSA 5L6LB 2M9MA 2OE2A 4Y98A 2PANA 2BDEA 3NNNA 2ZYIA 3WIUA 4ALNA 2Q5QA 2CWDA 5HXAA 2GSWA 1PDOA 2Z9CA 4L16A 2DFPA 4OOFA 5DW0A 5HZHA 1DXHA 1L3IA 2AC7A 2FRDA 3SYKA 1UJBA 2NWQA 1WOMA 4JELA 4CQLB 3FGPA 2V98A 3IYLW 4Q3DA 4ALIA 1FDWA 1A5BB 1JVBA 2FRVA 1RBYA 2PL9A 3MAJA 4NAVA 3W7VA 4BFWA 1CY0A 4BO5A 2NVWA 1JKIA 1ZM3A 4KIFA 2H0RA 4NS4A 2F64A 3Q3EA 3AEQA 4PX9A 2IPAB 3FB1A 2I4RA 1DWOA 2WKPA 3HBLA 3B2QA 3F98A 4WOCA 3L3BA 4R3NA 5EHNA 4I19A 3FDJA 2W6JD 2J31A 1N0WA 2BBTA 4A0SA 3H13A 4UOZA 4KN5A 2FXVA 2QD4A 4ZAGA 4KV9A 3ST7A 3ZWCA 4G26A 4BMDA 4E03A 4BFSA 3K20A 3JYNA 1ZYUA 2UZ3A 3KVYA 1WS6A 2ZJYA 3ZOKA 2WJHA 1OWMA 5HKKD 1QQAA 2PK3A 2QGZA 2A0YA 3FNHA 3I0MA 2H4YA 4LXTA 2HA0A 5ARDA 4C76A 3LY8A 5IYZB 5BSTA 2XQJA 1H9BA 4HLUC 2OLKA 3RSHA 4AS2A 2W70A 4E2WA 2Q2QA 2AHRA 4FOLA 5KTNA 1KEKA 3JPWA 5JYBA 2Q9BA 1AXEA 1T4CA 4DUZB 4FI3F 5K8VA 4WWHA 4KXXA 3O1IC 3T0FA 4CLDA 5KQLA 4MULA 2MU1A 3LDAA 4CM9D 1SOMA 4RNDB 3DMPA 4LGVA 4L02A 2IZZA 3E7FA 2TYSB 4CF7A 4GI7A 1F2VA 1N3IA 1QFMA 1WCWA 2EZ4A 4C0BA 5L6MB 1MEEA 4DARA 4HNAA 5ILGA 3V8MA 3UJ7A 2IPLA 3P5SA 2ZQYA 3TVDA 4AF7A 3QEOA 1C3JA 1Q1ZA 1QQ7A 2E21A 3AH8A 3I2HA 3SLKA 3L84A 1GLNA 2VO1A 4PGMA 3W06A 2NZWA 4CMAA 3K9LA 3MGBA 4YYEA 3UBMA 3K05A 2HEGA 4KNYA 5H80A 3MNFA 4ISBA 2XUZA 2EOAA 5ALDA 3RAPR 1QP0A 1N32B 2D2EA 3ETLA 5B3KA 2G7ZA 1XBTA 4HAXA 1OC2A 5CVEA 2OBYA 4RCYA 4ETWA 1JW9B 2XWQA 3IO3A 4N0DA 2CNWD 2ZKIA 1M8JA 3PNBA 1DTWA 1JEQA 4PBTA 3IJPA 4B6FA 5IAOA 3TXAA 4BQIA 4ERXA 3ZNNA 1R3DA 2X4LA 3RRBA 5IKEA 3K0FA 1Z0KA 1VIVA 2C4MA 4BV9A 3EUFA 2IHNA 5IAKA 2HU5A 3VJMA 3SD7A 1DCFA 3DG9A 3O8DA 1XAHA 2AS0A 1GG5A 2R47A 4OJKA 3GFSA 5C1DA 2IOQA 4Q02A 3PQ3A 2O50A 5TLSA 2W8BB 5EUCA 4ATNA 4BB5A 3DNMA 2YV4A 3R41A 4WLFA 4IOKA 1H2ZA 1K06A 1O97D 3TAUA 5KKAA 1S96A 2Y2VA 3P9IA 4K2HA 3DDWA 2H92A 4W1RA 2PWPA 5LXTA 1XN1A 1PS0A 1F5SA 3F7TA 3GRUA 2QE7A 2ZWIA 3KHKA 3GJRA 4GMXA 4DC1A 4CKCA 3CLTD 3AQ4A 3O73A 1OAKA 4M8KA 1Q77A 5ICEA 5DGTA 3BGWA 2OAEA 3TRJA 3UJBA 2X1MA 2ZIUB 3IQZA 3RRMA 5KU7A 4CIDA 1MX9A 3UA3A 3VPFA 4LDNA 3LL4A 4YP5A 1T5LA 3H2KA 2O4UX 5BN4B 3TZEA 3UFXA 3WLJA 4CT4B 1WHSA 3QUTA 1RHKA 1C80A 4PHFA 5B3JC 2IIBA 1T1GA 1NIJA 2ORVA 3GFFA 3JQPA 4JXJA 4PFJA 4A4DA 4BKRA 4C78A 5A3JA 5DNUA 1TMKA 4Y9UA 4JLBA 4AY6A 1TEXA 3V33A 3I2FA 1DWQA 3A58B 5AKLA 3N9IA 1L8XA 3HRHA 3UAVA 1TCAA 4E94A 3KR9A 4YAGA 1NSYA 2JB9A 3A10A 4FFMA 2FHSA 3SR4A 5BP7A 3ELBA 4D5GA 5JSUA 1FFXA 2XADA 3IPXA 2GLUA 1J42A 3TNFA 3NBXX 1PAUA 5KC8A 1KSJA 1WQ4A 4LHYA 1A8QA 1GQFA 4KQ2A 5EIHA 1X86B 3FUVA 3VNVA 2C4VA 3J81k 2H1LA 4HQ6A 2QI9C 4R6XA 3RRNA 4O25A 3MLAA 5BYAA 1LVGA 1Q50A 3O2JA 4ZCRA 4LDPA 2PBLA 1T5DX 1IM2A 2BUBA 3BL5A 3B7GA 4Q3LA 5TMEA 1QF9A 2ZROA 3RS4A 1IRXA 1HI9A 2D2VA 2OHJA 1QIIA 2G5TA 1Y8CA 3ANTA 3L0CA 3H11B 4INPA 4D9CA 1WTCA 1ZLYA 1L7RA 2H2DA 3K09C 4FOTA 4TKUB 3AJAA 1D2CA 1ZRHA 3GDWA 3P20A 2CMKA 3M6VA 4CL0A 1GCOA 1QIKA 2GRUA 5DVZA 2Q7DA 2HJGA 1D3AA 4K88A 3PNSA 3LDFA 2XDWA 5D01A 2XVMA 3GPLA 2DSTA 4DJDC 1G7RA 2OCIA 2EATA 1F12A 5K5EA 1WBDA 3NV9A 2R8ZA 3ZJYA 2BYTA 2BEUA 4TYQA 4WKPA 1KFBB 2COUA 4XR9A 3CX8A 3W6UA 5ALIA 1N2CB 4PANA 1RIFA 4JNCA 4LRXA 3E4DA 4WADA 5E7MA 3JAWA 1AQJA 4GPD1 1MOPA 3V00A 2Z9BA 1NXVA 3UGJA 1B8OA 4H4EA 1DWUA 2QT1A 3C3PA 1L8QA 3BT7A 1QHXA 1WDMA 3QOYA 4NKRA 3W8DA 1KJ9A 4ESOA 2YOFA 1CB7A 3OURA 3GJ3A 4BC1A 5LQUA 1N77A 1DQRA 1X13A 3AWIA 1VSUA 2FW6A 3KXPA 3QV1A 5DX1A 3A04A 1X38A 2LXNA 2Z6QA 2QRLA 3H2YA 3MJSA 2P5UA 4FN5A 1W93A 1EXDA 1WNFA 4UNNA 3RNOA 4M1SA 3I09A 2LUOA 4LV8B 1HDZA 3T5CA 3LCRA 5K09A 1COWA 1OBOA 1S2OA 1XHFA 3NGMA 4FDTA 1NY6A 4DUGA 3I2GA 2C59A 3OCXA 2DHDA 5FNVF 1TADA 4YFVA 1PR6A 4YH1A 4EMBA 4BXOA 3T3EA 3PUZA 2NPIA 4UNRA 2RAPA 2EP5A 1PLJA 1KSGA 2WNSA 1V3VA 4WBNA 5LM3A 4OQ4A 4L0DA 4ZKEA 3ROPA 1H5QA 4P0TA 4BLRA 3KJEA 4YP9A 1FTWA 1R9MA 1JLHA 1P5ZB 2R7LA 4LEIA 4MPJA 1XMOB 5CFZA 2C83A 1UINA 1E64A 5H7XA 2WE8A 2BGTA 1EJ2A 3JR7A 3UAXA 1D9XA 2ZANA 2O2XA 1T29A 5I9IA 4WASA 1PFKA 1THGA 3RUHA 3TBHA 1XG5A 3L0YA 1SD5A 4FFWA 2BMEA 4LWOA 3IP7A 4LRTB 5CM9C 2XMZA 3U80A 5EWLA 4EG0A 3ADCA 2PZGA 3PQ7A 4D4MA 4H1TA 2H3HA 1KNQA 2CYAA 4HGQA 1GKKA 4X6LA 1WZIA 4QSHA 1GNQA 1EP9A 2RJOA 2V9ZA 3TD6A 1OYYA 4DW8A 4PYJA 4RV5A 2EEZA 3B51X 2J3KA 4JJZA 4RDXA 1TUBA 1B41A 3DV2A 1WETA 2H5IA 3HB5X 2TMGA 2YXDA 3HJTA 3KQTA 3N3AC 3HSKA 4PCAA 5I7RA 3MN1A 3MWEB 3C7KA 2D7JA 4I4IA 5EJ2A 3CNLA 4EVQA 1B1CA 1C0IA 1U1FA 2OMEA 5AM0A 1V8OA 2ZB8A 2XPCA 1GAEO 1T3HA 1Z7YA 2BP7B 4JHLA 3R6GA 2C8KA 2B4YA 4O29A 1FYWA 1NI4A 1V6AA 2WABA 4NZYA 3CNBA 4FFRA 2EX1A 4MVXA 2BM1A 5ALTA 4BAGA 1OI4A 3IR6A 5HF5A 1FFSA 4J16A 4JQZA 2Q2OA 3STWA 2B4RO 1YDWA 2JIOA 1QZ3A 4ZT3A 3UHPA 3MRSA 1VKHA 4MZDA 3A06A 3IXMA 4WXHA 4G1UC 5AO9A 1BCSB 4Q82A 1YBAA 1DIHA 1IHYA 2WD8A 4LOKA 2ZE7A 4DCVA 4MRNA 3TAXA 4F85A 1V47A 4LYFA 4HGZA 1PZGA 2FVYA 2IHJA 2NO9A 1BXZA 3LCVB 3VR6A 4AXXA 1KJIA 2HLHA 3RRXA 4DRZA 3JASA 3I2IA 4CLRB 1YRQA 4YPFA 1NG9A 1HKUA 3F7OA 1SCAA 1RC0A 4A6DA 2J07A 3JQRA 4Z9XA 4QXRA 5CM8B 4E7PA 4OQFA 4XIFA 4E88A 5CVVA 2OBBA 3BRWD 3ZH2A 1CUIA 2JLWA 1PR0A 3C16C 4QTYA 1RQ2A 1SHUX 2NXNA 4BNKA 2ATXA 4R8RA 3HM9A 2I87A 3M3PA 3U61B 1DAEA 1ZJ5A 1LC0A 4XTRA 4DLVA 1SU6A 5C5CA 4YMSA 3DE7X 1FXWF 3R4CA 1B2RA 4YMVA 1LPPA 1IJFA 1G2OA 1SCIA 2IYVA 5EL0A 3HJGA 5T4HA 3GP3A 5BOSB 2C7BA 2WIJA 2R9VA 4Q16A 1ISMA 1E3IA 2HEIA 5LLTA 1G3IA 2AJDA 1ISIA 2OLEA 3KLNA 5LMNB 4EATA 5BSUA 2ZJ5A 3W9UA 3AM3A 5A7HA 1WXEA 1KJQA 3U3ZA 1C41A 3N53A 3WGTA 1IQRA 1LTHR 2QD5A 3E2PA 4FJ2A 5EQFA 1D0VA 3VNSA 1SQ0A 1XRJA 5AXCA 2ZSHA 3GJ7A 4IIBA 4AZ0B 1VL0A 2PMCA 4RKYA 4BQSA 2C20A 1Z06A 4IJ6A 4XB2A 3RIYA 1I4EB 3WFIA 3QFSA 2V7PA 2A0KA 3V8EA 1ZK0A 4GGMX 4FOOA 1ECJA 2YZKA 3OZIA 1YVEI 2VJYA 1LX6A 5EUQB 1KH1A 3BS4A 4KKVA 1Y6ZA 2HNBA 4FHCA 4NFSA 5I3ZA 3P9PA 2IH5A 2AQ8A 3NPAA 2OXEA 2P90A 1T0IA 2GM5A 2VJNA 1KY4A 2X2OA 4ZC8A 3F4KA 3ETEA 3PGXA 1SOUA 4R5HA 3DYVA 3K1JA 2JGAA 3BJMA 3HMQA 4KO4S 3V2GA 4YS6A 2PXAA 1MZVA 2EZ9A 4W6ZA 3ANNA 3NB0A 1IQ0A 4MLZA 1T2DA 3VGPA 1KI3A 4K8OA 3GPDG 4RHCA 4V24A 1LDYA 2F1JA 3LQQA 2M6LA 4C7XA 1F6DA 4XARA 1MHTA 1MJGA 3GJ5A 1X7YA 4P4UA 2G0AA 1SULA 3L1KA 1V4VA 4LZWA 1CBUA 1OY1A 5CB8A 2A5FA 2Y1EA 1NPYA 4KX3A 5BW8A 3W5AA 2CT8A 4TUYF 4M99A 2XYGA