1XFAA

Structure of nbd1 from murine cftr- f508r mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
264
Chain Sequence
b'TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
molecule tags Transport protein
source organism Mus musculus
publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
total genus 89
structure length 264
sequence length 281
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xfaA00
2EWVA 1S8FA 2WJYA 2L0XA 1QHSA 1KI7A 1CF4A 4PR0A 1ZM3A 4OYHA 1NSFA 1JAIA 4MYTA 4MKFA 2WSSD 3CWQA 2QMOA 4A4DA 2ZRBA 3K9HA 3T61A 1XF9A 1EESA 2X19A 3U3OA 3CKLA 4M0LA 1DG1G 4G5QA 1Q1BA 5AJWA 2A5FA 3QXJA 4Q19A 1W0JA 2WBLC 3DPUA 1MO6A 1XDBA 3AP2A 4R9UC 1Z22A 3AUYA 3FTQA 2GJAA 4NU0A 3LBNA 4XTRA 2CHQA 2IYQA 4P4UA 1Q1EA 4QC2A 1PUJA 3O8BA 4KBFA 2QUZA 1IAQA 2QI9C 2VF7A 3EC1A 3K9LA 1G21E 4HLUC 2W6JA 4BPBA 3LVQE 5FBVB 4JMPA 1E2PA 2XOKD 3X1WA 2WWWA 1KOFA 1FNNA 1G7SA 4DSNA 4HAWA 1OHHA 1W48A 2J9RA 1G7TA 2FG5A 1GDDA 4KJZA 4TL6A 3PUXA 2IF0A 1SXJD 1G64A 1S3SA 4J0QA 4JZKA 3WRXC 2DPXA 2NZ8A 3TUJC 4ZDJA 1MOZA 2Y8EA 1P61B 1YQTA 5C4MA 3S1AB 2YJTD 2Q3MA 4D0NA 2Z83A 3Q7QA 1IBRA 2R6AA 421PA 4Q4HA 1SZPA 3TRFA 1PUIA 1E79A 3BH6A 4EJSA 5L3QB 1ZINA 2WJVA 5JWOA 3JVVA 5H1YA 4F93B 4RZ2A 5L8VA 1KI6B 5K8UA 1FNMA 1S4QA 4GI7A 4DKXA 5B64A 1BH2A 3SJCA 1XTQA 3SHFA 1XD9A 4TWZA 2QGZA 3PVSA 2QSYA 1NNEA 1DELA 2OO7A 1DVRA 3CF2A 1LF0A 1W0JD 2GJSA 1ZNWA 2V1XA 5EP3A 2J1LA 3CNOA 4C0LA 3DM5A 2ORVA 2KWIA 3LO5A 3U7EB 3KQUA 4KI0A 2C9YA 3F0TA 2BDTA 1NIJA 3CX6A 3AH8A 2VH5R 3DKPA 3K8YA 2CHVA 1U9IC 2YVUA 4B2LA 3B1ZA 2J3EA 5JHGB 3TAUA 1NN0A 5JRZA 3WMGA 2HLDD 1E2HA 3WNDA 3AUXA 4AKEA 2RAPA 2BOVA 3AKEA 5HCIA 4L9SA 4Z8XA 2QAGC 5HR5A 3KQLA 5GVRA 1X6VA 1ZD9A 2XTZA 3ZIAA 3HR7A 4KVGA 3L8ZA 1K5DA 1SVWA 3ZZTA 3CNLA 3CRW1 1JEDA 3I8SA 4GNKA 3EA5A 2QP4A 4EFMA 1CR1A 2H57A 2FV8A 2CVFA 2FEMA 1DBSA 1XEXA 1NP6A 3F3YA 2IBMA 2QPAA 1RZ3A 721PA 5LD2C 5CK5A 3HDTA 3MMPA 3UXMA 4A6XA 4S2EA 1T5LA 1Q20A 2DWPA 4HLDA 3U4QB 1M7BA 2IK8A 2EYUA 4E5UA 2RKOA 4EQ6A 1KSJA 2PMDA 1T6NA 1XZQA 2ZXUA 1Z3IX 1S1CA 1R10A 1RYHA 3PG5A 4LBYA 1G8FA 4B33A 4JVSB 2DB3A 4M1WA 3FKSA 2CDNA 2CL0X 2FPMA 3FHTA 3CX8A 2GK6A 1NLFA 3IPXA 4IDNA 4Q5IA 4UNRA 2GXQA 1ETUA 1KI1A 3GLHE 1EFTA 4JLMA 2WJHA 4UNSA 5ELXA 3IKJA 2AD5A 3IILA 1F48A 3LA6A 5JHHB 2QG6A 2JDIA 2XNDA 2ZUDA 4TMXA 4LYHA 5JCZA 1HTWA 4BQSA 2IYWA 3C5CA 3B1WA 1N5KA 4P4TA 5IK2A 3WMEA 1WP9A 2CK3A 2IX3A 1U0LA 1II8A 2ZVPX 1YU9A 4A0RA 2I3BA 3ZH9B 1AQYA 1T3SA 1CRPA 2JATA 1YJ5A 2VHTA 5DN6A 4JVLA 4NYJQ 3RS5A 4KBGA 4TTPA 4QJ4A 5F98A 2RGEA 1Q21A 1ZC3A 5GVSA 2OFXA 2UKDA 2HYIC 1S0UA 3TAHA 3LX8A 4AG5A 4JT4A 4V0ME 2WJIA 4DLZA 1JJVA 1OLOA 2BJWA 1GL9B 1W36B 1F2UA 2A5JA 5FL7A 1W2GA 2ATVA 2OCYC 1RJ9B 3FYHA 2AD1A 4M1KA 5ANRB 1AK2A 1G20E 1XMIA 1FUUA 2QPTA 5FPYA 1U90A 1XXHE 1E69A 3OZXA 1KK2A 4WZBE 1ELOA 1XTKA 4FCWA 3LLUA 1ZBDA 5FPKA 2D74A 3FKSD 1FP6A 4Q9IA 3HPQA 3VHLB 2CNWA 4G3XA 3T1QA 2QL6A 2ONKA 2WIAA 4AKGA 4QKQA 4HLQB 1UJ2A 1EWRA 2VHCA 2IWRA 1KZGB 1HT2E 3BC1A 3IIJA 2D2FA 4XJXA 3QPUA 5FPTA 1VECA 1WBBA 3DZDA 1MABB 4Q1EA 5FBRB 2OM2A 1KMQA 3HYTA 4IDOA 4MKHA 1GOTA 4BZXA 4CEJB 1OXUA 4B6FA 2EW1A 1H8HD 2P0EA 3UMSA 2O8BA 3CF0A 3QXSA 4MKIA 3TSWA 1R8QA 3SU8A 4L5BA 4LV8B 1ZJ6A 2ZI9A 2ZRLA 3E2IA 1IQPA 4LK2A 2AKYA 1FL9A 5EE9A 3EZ9A 3T12A 4LPSA 1GG2A 3OIVA 2YWHA 4O25A 5FUVA 2R6GA 3GEHA 1EK0A 1NVVR 5E95A 1GM5A 1BKDR 3NG1A 2O8FB 1OH7A 4POAA 4JSTA 4GBMA 3X1YA 2NO0A 3K1JA 4WIAA 3HPRA 4JLPA 1DAHA 1E9RA 5HZHA 4AYTA 1LV7A 4XWOA 1Z6GA 5FI0B 3NDPA 3LWNA 4HEJA 3W6NA 3I32A 1OT3A 2MSEB 3NEJA 1E2LA 1P2UA 4TMKA 1G6OA 2QA5A 4B3BA 3W90A 1P62B 4HAZA 2C95A 4GOJA 2DR3A 3CH5A 4E09A 1OHHD 5DIFA 5LB4A 1U8ZA 3K0AA 3VR5A 3QKSA 1NVXQ 1YRBA 2WKRA 2XJ4A 4IHQA 5UKDA 4TYNA 4Q18A 2J7PA 4EQ6B 3BGWA 2ZSAA 4M9SA 3LNCA 2V54A 4UXJA 1GUAA 2RMKA 1KMHB 3KJEA 2IYYA 3TIFA 2NMVA 5HE9A 1XEFA 2IHBA 1HT1E 2QTFA 2DWOA 2W2VA 5D3QA 5TVKA 3QSYA 3KKOA 3OIWA 2FGJA 4MH0R 5FPHA 5FTKA 3CR7A 3EG5A 4DIEA 2WWYA 1IM2A 1Z6AA 1CTQA 3E70C 1D2EA 1NBMA 2FSIA 3PEUA 5EZ5A 5L3QA 1KSGA 4BZQA 4GP7A 1ZVQA 4MRNA 4KSBA 2EFCB 4P4SB 1NMZA 2BBTA 2DYKA 1HUQA 3RRYA 4EJSC 4BLQA 4W5JA 2R44A 3SQXA 2VLIA 4CEIA 3K0AB 2VHQA 2O8BB 5J47A 2LCFA 3U7FB 4C2TA 4OHYA 2GXAA 3IDQA 3NC1C 4D81A 3FKQA 2H1LA 3LH5A 1NBME 4LV6A 4Q4LA 4ZCLA 1GITA 3DVLA 1US8A 4HUTA 1NN3A 3QF4A 3T1OA 1W36D 1VDZA 2GESA 5K8TA 2FA9A 2ZJOA 2GCOA 5JWRA 3OEHA 4E07A 3CRMA 4G5OA 4DLRA 3P32A 5JEDA 4GP6A 1E2EA 2KBFA 4LJ9A 2NTYC 1I2DA 4B71A 2BV3A 3QNUA 2IS1A 2C9CA 1R4AA 3U60B 2ZI3A 2NO9A 4Q1AA 4QXAA 3FMIA 1E0JA 1OXVA 2ZS9A 1PVOA 3NBFA 4M22A 4PC6A 5KYKA 2FDCA 5DISB 3K9NA 2SHKA 3ZZUA 2G1JA 4RVCA 3MJRA 1OJLA 1ZW6A 3UG7A 4IOJA 4UKDA 2UZIR 2Z43A 1GP2A 1II9A 2YOHA 5CM8B 4D26A 1HY3A 5EP4A 4FMBB 2KB0A 3KKNA 4RFSB 4DHEA 1JQJC 4Q01A 3R9IA 1VYTA 2J0VA 4DDWA 1NKTA 1L7VC 3KKPA 4GSYA 3RRNA 1AS3A 2VIIA 2YWEA 4OK6A 3VR1A 1OFHA 4ZI2A 1G18A 4LJ8A 2CXXA 1C4OA 4LBVA 4C0JA 1YHNA 3N70A 2QZ4A 2RGBA 4LZZA 3TR5A 1AGRA 1NMXA 3BERA 2YC2C 3U6KA 2VQSA 1R0WA 1FP7A 3HU2A 4NCHA 4A2QA 1Q1QA 3Q5EA 3KUDA 2J46A 1BOFA 2IEZA 4IOKA 2ERXA 1NRJB 4IFBA 1HEIA 2JDID 2XNDD 3IGFA 4L9WA 2AXNA 2FNAA 2CMKA 4JIMA 2ZRIA 3SNHA 1S9HA 4V0OA 1EX6A 4C2UA 3JZMA 2JIZD 3AM1A 4HAUA 3MWKA 3LQRA 3THXB 2ZITA 4YXWD 2O8FA 1TU3A 2CK3D 2B7CA 1B0UA 4Q1CA 1XD8A 3O47A 5DN6D 1KJYA 1Z5ZA 2XZPA 4JBYA 1ZUIA 4L15A 4UNQA 1E94E 1E2GA 3Q5DA 4LBZA 3J81k 3LX5A 2YZ2A 4CYMA 5KPJA 1E9DA 4IVPA 3THOA 2IF2A 1NL3A 4A0FA 4OL0A 4B6EA 4F4CA 3GP8A 2GZDA 2OBMA 3TBKA 3ZVNA 2J0UB 1NLZA 2G77B 1XMVA 2F7SA 2IXFA 5BN5A 2PX0A 4JL6A 4MRPA 5EE1A 4V0NA 3UG6A 3O8CA 5CIQA 2XXAB 1G3RA 3HWSA 1BMFA 3VU9B 4JJKA 5C2JB 2O8CB 2NPIA 3CB4A 3RC3A 4HZUA 4B44A 1KY3A 2RHDA 4MDFA 2I1VB 1R6BX 4X8LA 1US8B 3PUYA 4WW0A 4OI4A 3SOPA 4B74A 4DZZA 1E2IA 2OCBA 1VG9B 4TLEA 4EFNA 3Q85A 2GJ9A 5BQ5A 2FWRA 1SVMA 1DADA 3PUVA 4QHYA 1SULA 2ECKA 4M1OA 2V3CC 4PZZA 1RIFA 2VP9A 2F43B 4RKEA 4TMVA 5E3HA 4ASUA 4WZAE 1HQCA 4RCZA 3K09C 1S2MA 5GJWC 1FZQA 2CHGA 5E7JA 1G291 3W3ZB 1HQYE 1CJVC 1G9XA 1KO1A 4I1SA 1X86B 1A5TA 4C0HA 4DSTA 3A1VA 2A9KA 4QGFA 1QF9A 2GVDC 4NPHA 1J7KA 3KZ1E 3PQCA 4M21A 1KYIA 1VHTA 1XMSA 3BB3A 3K70B 1LY1A 1GKIA 2OBLA 5JCPA 2VO1A 4OK3A 3U7GA 2FU5C 1E0SA 2CJWA 1KSHA 1TQ4A 3NH6A 5HE8A 3EZ7A 3VAAA 1YZLA 4JLOA 3KB1A 4HLCA 4WOPA 1RC8A 4JT2A 4F92B 3MWYW 3JZAA 3R8FA 3GLHA 3ZYCA 2NOAA 5AUPB 3QEJA 1OE0A 2CE2X 4LYAA 1KI9A 4R7ZA 5G41A 1M8PA 1BMFD 2OBNA 1E1QD 1LF5A 4P32A 4BASA 1P72A 3H84A 1E9EA 4HDOB 1UBFA 3QF7A 5TARA 1N6OA 2CL7X 2QTHA 3T5DA 5GADl 4TT3A 3U4QA 2AN9A 4B47A 3LLMA 3N2EA 3P20A 1G5RA 1F2TB 2W58A 2WWHA 1DAEA 1OXTA 4UNNA 1TU4A 4I1OA 4DWJA 2ZRNA 4ZI3A 4QNMA 1XD2A 1DARA 3A6PC 1X8JA 2XX3A 4ILEA 1OH6A 4LYJA 5B57C 5P21A 5TMPA 1A82A 3HR8A 4FWTA 1KDOA 1TPZA 3KTAA 2GA8A 4RZUA 3B1XA 1S1MA 4HI0E 4B75A 1XP8A 4ASUD 2O8CA 1IY0A 2TMKA 3SEAA 1Q3TA 4H1UA 1TUIA 4Q7JB 4NH0A 1S9DA 1EFCA 2ZTSA 5TXGA 3T5GA 3WYAA 3QQ5A 4EPYA 3GLIB 4NCNA 4RD1A 1N5LA 3U44B 3ZJYA 4RKFA 3IEVA 1KI4A 4QFMA 5J4VA 1W7AA 1VPLA 2WAYA 4M1YA 3B8HA 4M9QA 4Q7LA 1P73A 4W5WA 2P5TB 5FTJA 1I2MA 5G3ZA 5JFGA 3RSOA 2CLCX 3H1TA 4X8HA 2JLRA 2IYZA 4N0EA 4Q48A 1Q12A 4P33A 3QBVA 1X8KA 5KOYA 1SHZA 3W5JA 1IOZA 2JGNA 2QNRA 4QG7A 3B5JA 4BFXA 1Z0KA 3WMFA 2BCJQ 3C41J 2JJ8A 3EXAA 1G5PA 3QBTA 4TQUS 1TMKA 4PHHA 1A2KC 3EW9A 2IYTA 5HPYB 1QBKC 1G3MA 3DO6A 3CX7A 2WMOB 3KKQA 3L0OA 1U9IA 2QT1A 3TVDA 4F38A 2FFAA 1SHKA 2BWJA 2HEIA 4OI2A 1KI3A 3NDBB 5J40A 3I62A 4BFTA 5KNCA 1AZSC 2F3RA 4OI1A 2O8EB 1KNXA 1O3YA 1XXHB 3RS3A 3UANA 4JLKA 2GTPA 2C8VA 3ND9A 4FIDA 2GF9A 521PA 2A5YB 1LVGA 2QMEA 2QM7A 3OIYA 4LJAA 3GJ7A 3R9XA 1AKYA 4DLXA 1M34E 1SXJC 2EFGA 2HLDA 1N6HA 2OSBA 4RFVA 3P4XA 5JWHA 5EJEA 4B2IA 2IYXA 2R9VA 4C30A 3SR0A 5JJLA 4JKYA 1L4YA 1E4VA 1GRNA 1AJEA 3K0CC 2MMCA 3P27A 4C4PA 2GEVA 2VSXA 3CF6R 4QBIA 4Q9HA 2WHXA 4V03A 5TV2A 1Z0DA 2A2ZA 2JCSA 4URWR 1P5ZB 4BRUA 1E2DA 4XVRA 4JLBA 2NO7A 3RSLA 3FMOB 4DB2A 3IBYA 1WE2A 1R7RA 3WYFA 1E1RD 2V7QA 4XTCS 2G9NA 1GKUB 2ZU6A 2DFTA 5H70A 4NP6A 3IO3A 1E2FA 1RFLA 4NYIQ 3I72A 4RD6A 2VSFA 1ESNA 5H8WA 4UXHA 5F3WB 2JIZA 3KKMA 4B2PA 4LGMA 1XFAA 2WVJA 3AVYA 2D3WA 1L8QA 2GVZC 3A58B 4OQMA 1J2JA 4A36A 3KXLA 3CONA 3C4JA 2ZJZA 1A2BA 2PX3A 1P7CA 3NIBA 3QOFA 3AKDA 4FWIB 3DM9B 3WNBA 3REGA 1WDTA 1CEEA 1KZ7B 2HCBA 2FPLA 3A1WA 4IW3B 2B8TA 3BAFA 3RLFA 2WSMA 2VP6A 3U3MA 4WVFA 4MYCA 1G3QA 3HP1A 2Q3HA 4G5RA 4N3NA 1CXZA 3DOFA 4UJ5A 4LCBA 4DJTA 2VA8A 1GFIA 3AVWA 4YMWA 3A4MA 4KAXA 1G17A 4FMDF 4CEIB 2WWIA 2XEXA 3X1DA 3PUZA 2H18A 1K6MA 1NJFA 3UMFA 2R6CA 3B1YA 3W6OA 1OYYA 2C04A 4RY2A 2ZQ5A 1VMAA 3QF4B 1U0JA 1XPUA 3NTUA 4O2RA 1A1VA 1OW3B 3KQNA 1TF7A 4NYMR 4PSVA 1SQ5A 3GEIA 2XITA 4PO1A 1JBKA 5FR2A 3ZD7A 5AUNB 1DO2A 4QM6A 1ESMA 1E98A 3TW8B 4A1FA 4AG6A 2GJ8A 4IXNA 4B3FX 1E1RA 2V7QD 3KFVA 4JYBA 4Z8YA 3PEWA 5M04A 2O8DA 2W2TA 2ZJ2A 2QMHA 4B76A 4CIDA 1E0AA 1JPJA 2XB2A 1P60A 4P31A 4HB2A 1OIXA 3MG9A 2ZI6A 1U0HC 1DPFA 2BMDA 5EXXA 4D0GA 2ZU0C 4QJ5A 2REBA 2CVHA 3GD7A 2F43A 1PLKA 4D25A 3L82B 1KGDA 4DLWA 1WB9A 2PBRA 3QKSB 4KHZA 4A2WA 3T35A 5CYPA 2G6BA 3IEUA 5C46F 4BEBA 3GJ4A 4TLAA 4GL2A 4LX0A 2BEKA 5CJ2A 4AIIA 1KJZA 4FXPA 1B23P 1V43A 4A82A 1R2QA 3UK6A 2X8AA 1H8HA 2FN4A 4PFSA 1FQKA 3H2YA 4D80A 1Z29A 2X2EA 2HCJB 2W6IA 4PC3A 3QUSA 3ZS8A 4ZCMA 3F5FA 4TL7A 4ON9A 3VR2A 4ACBA 2R62A 2ZJYA 4A8JC 1ODFA 4ITRC 4JL5A 4JLNA 4KV9A 2ZI5A 1KI6A 3P1JA 5KSYA 3VR4A 3VTKA 1TF2A 2F1IA 2WJGA 1D5CA 3OHMA 4HUQA 4Q00A 4DDUA 2V8OA 1AN0A 1ONBA 3THYA 1QHIA 1D8TA 5FUWA 4CDGA 4IVRA 1NG1A 2JLSA 4S35A 2VP0A 1X1SA 2PLRA 4KVAA 1T8UA 2JLQA 4C0QC 2Z5FA 2ZJ5A 3V9PA 3L0SA 3N2IA 3QVVA 1VTKA 3THWB 3LBIA 1RRGA 1A7JA 1COWA 2QN6A 1TQ2A 3I5YA 3R7WA 3H4MA 5KO2A 3GJ0A 1FX0A 2CE7A 4G5GA 2IS2A 4BE7B 3BFVA 1P3JA 1DG3A 3GLGE 2J87A 2ZR9A 1JEEA 1MRNA 3O8RA 3ZD6A 1N3BA 5FOTA 4PO9A 3EIHA 4IOMA 3LY5A 4NBSA 4DIDA 1AM4D 1ZU5A 5HTKA 2ERYA 2PCLA 2BVNA 2WKPA 3VKWA 5L3SA 1KO8A 1MO3A 3OEEA 2IT1A 1GSIA 3PFIA 5CK4A 4X8MA 3ICQB 3WP1B 4EPVA 4JSYA 5IT5A 2GF0A 3GMTA 2RH5A 3QEOA 3OIUA 1KJWA 4BFUA 1CJKC 4RFSA 2D7DA 1VCNA 1EFRD 1G7CA 1WXQA 4CEHA 3WP0A 1JPNA 1KDRA 2GNOA 4BWYA 1IN8A 3QG1A 1IN7A 2HDNB 1SXJE 1W4AA 1ZM2A 3OAAD 1IN5A 2FEOA 2Z0MA 3Q8XB 4H9GA 4R2IA 4ZO4A 5EE5B 3NC0C 1OFUX 2GZHA 4ZKEA 3A1UA 2ORWA 3QKTA 4AC9A 4NCIA 3AGPA 1XTIA 2R6DA 4RD4A 1ZAKA 4GFDA 5G3YA 1TEXA 2F9MA 1SXJA 4DLUA 1G41A 1K5GA 2A3RA 1FW6A 2IYRA 4KSCA 4URYR 1Z63A 1LS6A 1N25A 4IDPA 3SS8A 1ZUNB 3CO5A 5IF9A 2YWGA 1G16A 1ZD8A 1SKYE 4LHWA 4RD0A 5A4JA 3VFDA 2Q9CA 2ZVQX 4CVNA 3DEFA 2GAAA 3LW8A 2QSZA 4DXAA 1SVOA 4JLDA 4AKIA 2QT0A 2V1UA 4PC2A 5CDFA 5JSZB 2XGJA 2HF9A 4PAOA 4URZR 2CCJA 2HJVA 3DOEA 4DBLC 2QBYB 1GTVA 2ZJAA 1N6RA 1E99A 1FUKA 1QHGA 1VKJA 4ZCIA 2NIPA 5HCNA 2WWFA 1XRJA 2C96A 1WQ1R 3RDPA 3VX3A 3EWSA 2JAQA 2ZE7A 2NQ2C 3BFKA 4A0HA 1BIFA 3TMKA 1VYVA 2OCPA 2PJRA 1I4TD 5FOXA 4NTZA 1CP2A 3AP3A 1HE1C 4JVMA 5CB8A 1R5BA 1N5IA 3SJAA 1E3MA 4LY6A 2G3YA 2HXYA 1CIPA 2V6IA 3U2QA 1G5TA 2B7BA 2QROA 4KFSA 3LXRA 3T06B 4AD8A 3HU1A 1DS6A 2JJ2A 4D82A 1AGPA 2WIBA 1IY2A 1TQDA 2B92A 2BMJA 3I92A 1OFIA 1P2TA 4JLAA 4HYYA 1ZNXA 3BK7A 2GXSA 3UKDA 3FGNA 3I3SR 4G0NA 4JJZA 3QPWA 4Q1BA 3U3JA 2DFKB 3GJ8A 3AVVA 2Z6VA 4E22A 3FVQA 3NBYC 4LHXA 4UQOA 4U00A 1JNYA 1RE0A 5JRJA 1KMHA 3M0EA 3M4YA 4MYHA 1UKVY 2YC4C 2ZUCA 2AFIE 1TF5A 3B60A 4CZ2A 3QXXA 1CLUA 5H68A 1T4GA 2P5SA 3K0FA 2VPPA 3QKUA 5EUMA 1JR3E 4YONB 3T34A 4DLSA 4EJSB 4OHWA 3U3RA 4BFZA 1LTQA 2FZLA 3EIEA 2G88A 3V4RA 2FZ4A 2H5EA 3NH9A 1R5OA 2CLSA 2EU8A 3C15C 5FFMA 1HH4A 4Y0VA 2GZAA 4IXMA 5EP1A 4DB4A 1U94A 4C0SA 4EPRA 2ANCA 1SVIA 2AFHE 4ARZB 2A7QA 2WKQA 5B58C 3MRSA 2BC9A 4XOIA 4OJQA 5KU1A 1VCIA 5IK2D 3HJNA 3FB4A 1NY5A 2EYQA 2ZRMA 4KXFB 2JASA 3AVUA 4M4SA 1WF3A 4TYWA 4ZKDA 1T91A 4CT4B 4MGIR 5BYJA 5FBWB 3PXGA 4YMTA 4ZIRA 4F91B 3TK1A 4R98A 3ONWA 1QHNA 4D4LA 1J70A 2G0TA 2Q9AA 4K46A 1FX0B 4Q9KA 4NCKA 1JR3D 4HB4A 1VG0B 1G4AE 2ZS8A 3CUEF 3AVQA 1AKEA 4XVQA 4OKSA 4NYJR 4JBWA 3QENA 2OESA 2ODEA 4ZDIA 3PUWA 1NY6A 3I5XA 2IW3A 3I8XA 1G7RA 5BWMA 4LHYA 3QPVA 2W0SA 2NGRA 1DOAA 1JXOA 4HUQB 3G82C 1E1QA 4QL3A 3W8NA 4TL8A 5L3SB 1OXSC 1T3LA 2QORA 3UATA 4KITB 2D2EA 1MRSA 1II0A 3X1ZA 3TQCA 2ZI7A 1HV8A 1CRQA 1Z06A 3CLVA 3PITA 2ZRGA 4DEXA 1FTNA 2OFWA 4IRUB 3IQWA 2DFNA 3BJIC 3TKLA 2ZS7A 2JEOA 3L43A 5DI3A 2ANBA 5E7IA 2HYDA 3A1TA 3WYGA 4MRRA 2XTNA 2DBYA 3MFYA 1E9FA 3I4LA 3IUYA 4RSGA 2OILA 3WNCA 3O8DA 3U44A 2YOGA 2OLKA 4AKHA 4JBXA 2G83A 3EZFA 3OEED 3K53A 2YV5A 4C7OB 5DI9A 5BXQC 1TX4B 2QQ0A 1NI3A 2RGNA 1U8AA 1XNJA 1IN6A 1SGWA 1Z2AA 1Z8FA 3D7MA 4LHZA 3K0EA 1VCMA 5JEEA 1NN1A 2J7KA 3RS0A 4EPXA 2PCJA 4AI6A 3I1FA 3AF3A 3G5UA 1VHLA 1YZNA 3DKVA 2ZSFA 5JJIA 2CLDX 2ZYWX 2C77A 2ZRHA 5KSZA 3VR6A 5KNBA 3F8TA 3KJHA 2C78A 3UMRA 3Q7PA 2BKUA 4TMTA 4JKIA 1JB1A 5J4LA 1X8LA 2KBEA 2WAXA 4TLDA 2HXSA 4KFUA 1D6JA 1KO7A 4PPNA 3DHWC 4NYMQ 4BEJA 2AK2A 2BHRA 3GLIE 1W36C 4Z1MD 1N0VC 2FSHA 2OE2A 4DT1B 2WTUA 1FFHA 4LWZA 1Q0UA 3IHWA 4PPGA 4RD3A 1UDXA 4V02A 2N1BA 3UIEA 2P65A 1OKKD 2PZEA 1E6CA 1IXZA 4CF7A 1ZIPA 2IYUA 2YWFA 5CLQA 1GNQA 1ZP6A 2PJZA 1XJQA 3JVUA 4PO8A 3U61B 1R0XA 2MSCB 1KNQA 2ZSEA 1Q57A 1ZCBA 3LVRE 3C16C 3GFOA 5B2ZA 2VP4A 2ONJA 3CWZA 2VHUA 1YVDA 2VP5A 2IC5A 2ZYUX 3OF5A 4FD2A 4LDJA 3BD9A 2C98A 1XD2B 5BW8A 1IJFA 1I4DD 2OUKA 4Y0AA 2ODNA 3SHWA 2CBZA 3GQBA 2BBOA 3PEVA 1XEXB 1JXMA 1FQJA 1NIPA 1VIYA 1NBMD 2J0UA 1HYQA 4ZV4A 3KTAB 2QAJA 3CBQA 3W8RA 5CITA 2F9LA 3LV8A 2D62A 4LJ6A 2GXUA 4DSOA 1RRPA 2JLVA 4L4UA 1D9XA 1LW7A 1Z6YA 3T15A 4XD7A 2RGXA 4HAXA 2LKCA 1XPOA 1UFQA 5LB2A 3EA0A 4CRWB 1OIWA 2MSDB 3MWJA 4HZIA 1AS2A 2IYSA 2CJWB 4KCGA 5FUXA 3G0HA 3KX2A 3AKCA 1RVDA 1KDPA 4C9BA 3FMFA 4M1SA 1G4UR 2YNMA 4B73A 2ODBA 4URXR 4OQLA 3K0CA 1D2MA 1CR0A 1U81A 2ZE8A 1N5JA 2NO1A 3NKVA 5KDLA 4A2PA 5DH9A 1H8EA 3EPKA 1ZYUA 1OB5A 5HZKA 4OHZA 1YRAA 4LJYA 1OKKA 1EWQA 2REXB 3U5ZB 2ZIAA 2LKDA 4LSGA 3B82A 2JLZA 2BM0A 1N6IA 5FI1B 2PH1A 1MV5A 1G8PA 2O0HA 2ZR0A 3CH4B 1GL7A 1KTVA 5J4HA 5AR1A 5FH9A 4OJKA 2IUSA 4LC0A 2CCKA 2ZANA 2H8KA 3MSXA 4CEHB 2E1RA 1N0WA 1QRAA 4Q4JA 1GAJA 1JAHA 1OH8A 3CM0A 3E1SA 1XTRA 5FOUA 4U02A 3W9YA 3UWOA 5FTLA 4TZ0A 4XWKA 2XB4A 2FOLA 3LQQA 2E9SA 4TYPA 4ZDWA 1LS1A 1N2CE 1Z0JA 4XD7D 3KB2A 2GBLA 1GIAA 1UBEA 2RHMA 4B32A 4W5HA 1QG4A 2GEUA 2PLFA 1AIPA 1Z0AA 3AQ4A 1XTJA 4GMXA 5AUOB 1NJGA 2W6JD 2H17A 4DC9A 2AL7A 2X2FA 4KYUA 4N1AA 2VBCA 1NVVQ 1M7GA 1KAGA 4A8JA 2AK3A 4X8OA 4EUNA 1W46A 3GLFB 3ZDQA 3EAQA 1M1YE 4YXWA 4B35A 4PZYA 4MUAA 1F60A 1Y63A 3B6EA 1H65A 2P2LA 2VTKA 1KY2A 3PCRB 4PZLA 4MDEA 1L2TA 2OG2A 1CR4A 1N0UA 4I1UA 1QZXA 3C7KA 3FMPB 1E9CA 4F4JA 3AEZA 4GT1A 2ZETA 1OYWA 2JLWA 1E79D 2GILA 2GKSA 3V00A 3U6BA 3AVXA 4DUGA 5JLJA 3ICEA 4NHOA 3K0FB 1P6XA 5DI3B 1XEWY 2H7VA 4XWAA 5LD2B 3ADDA 1YZQA 5DYGA 5FOWA 2IXEA 3NWJA 3N5CA 3AVPA 1MR3F 2RGAA 3D6TB 4Q4AA 2IL1A 1DTSA 2V9PA 4EAQA 1TUEA 1UADA 3NHBA 1RPZA 2D7CA 1T0JB 3ZVRA 5G40A 4M9XA 1EG7A 1QVAA 4ARZA 4PHFA 1PJRA 5SZHB 3SFVA 2GCNA 1E9BA 4RD2A 1MO4A 4W9MC 1FMJA 2QAGB 2PZFA 2JLUA 3BFXA 4US0R 5DE3A 5L3RA 3AVTA 3BE4A 1W5SA 1Z6TA 1XX6A 2AR7A 2ATXA 1QVRA 4JVNA 4C0AC 2FFQA 3AVOA 3NXSA 1GVNB 1CJTC 2BMEA 1E96A 3MUFA 3W34A 2ZM5A 2XZLA 2UVQA 3M6AA 4FCTA 3VR3A 4RZ3A 4F4IA 1QG2A 4A15A 2QBYA 3PJRA 2REOA 1COWD 1ZMXA 3NEYA 4B43A 3QE0A 4FMCB 2ZE5A 3KJIA 1HA3A 1S96A 1Q1ZA 5D3MA 5EZ6B 5E4FA 2KI5A 3ZZ0A 2DHRA 4YDHB 2IWHA 1F6BA 4Q66C 4PPQA 3TSZA 3I73A 4WXRA 4E03A 5EE3A 1KO5A 2ZAOA 2EVWX 2BBSA 3GFPA 4Q7MB 3WBJA 4WA7A 1R0ZA 2R65A 4YDSA 4KFTA 4DCUA 4DVGA 2BKEA 4PAMA 4BLOA 5KDOA 1GKYA 1I4LD 5AWFC 3B2EA 4PANA 1XCMA 4TLBA 3AGQA 4Z1MA 3AF4A 1Q3HA 2IEYA 2ZYVX 4TT3D 4QHSA 2ZRPA 1DE0A 2HF8A 3GJ6A 2HT1A 4A9AA 2VP2A 2VF8A 1T8TA 4XVUA 3K9GA 3BORA 1J8YF 4Q9LA 2AHOA 3CIOA 2IHYA 4FMDB 1M6NA 4GZMA 1Z2CA 3CR8A 4EFLA 2R2AA 2QPOA 4QGHA 1E9AA 3ZQ6A 1E2JA 3GLFE 3SBDA 5DHAA 1Z83A 2JJ1A 4JLVA 2W00A 2ZRAA 2OAQ1 3OESA 3S1AA 2PMKA 1DAMA 3SN6A 2NO6A 3BS4A 2OLJA 5E7MA 4Q4HB 2PT7A 3BB4A 3D31A 1YZGA 3RYTC 1E32A 1NN5A 3SC3A 3AF1A 4ACAA 4Z54A 4DDTA 2QY9A 2FFBA 4F7WA 1C1YA 4Q03A 1ZM9A 1T5IA 2FE4A 3IHLA 3SZRA 4TMWA 4KO8A 2F3TA 4OQNA 3RANA 3GLFA 2F55A 1QHYA 1PV4A 2FJUA 1IJEA 1G8GA 4G1UC 2EFHB 1SVLA 3FFBA 3QY0A 4OI0A 1G8YA 2WWGA 2UZ3A 1XCGB 4HDQB 4LI0A 3EZ6A 2OHFA 4Q02A 2MMGA 3IBGA 3Q9LA 3RRZA 1W2HA 2CNWD 2GK7A 4II7A 3B9QA 4QM7A 2ZRDA 1WRBA 1QDEA 1GNPA 1PZNA 2D06A 4NE2A 3GEEA 4HSEA 621PA 1UKEA 2P6RA 1UKZA 2X1VA 3T1VA 3NBXX 4L16A 2J59A 1CBUA 5EE0A 2OV2A 3AF0A 3IIKA 4KLZA 2EWWA 4NDZA 4Z51A 2BJVA 4U7DA 3CPHA 4BECA 4BFSA 2IXGA 2FPKA 1PLLA 2OZEA 3A36A 4BLSA 1NMYA 1K8RA 4LPKA 3D3QA 2RGDA 4FI3C 2O52A 4HDCA 5AJVB 4DSUA 2K5UA 2ZSDA 2HT6A 1FPMA 4MITA 4ESVA 1GILA 4EKDA 3R20A 4P0TA 2AKAB 2G0NA 4Q47A 3TH5A 2BEJA 5B30A 2JJ2D 1OPXA 2VHJA 1YR9A 4G5SA 4AURA 3PV0A 3TJZA 2HV8A 4KU4A 3PEYA 4GRAA 3ECCA 3ND8A 1W4RA 4PX9A 3FPAA 4JLJA 1MKYA 1T3HA 2Q21A 5SZKB 1CJMA 1SVKA 4UNPA 1BYUA 2N46A 4R2HA 5FL3A 1OSNA 3FFAA 3LBHA 2IYLD 4GDFA 4TSFA 5KPDA 3EWAA 1T9HA 2ZAMA 2QGNA 1TTTA 1TAGA 4BLTA 3WY9A 2QENA 4JL8A 5JBQA 121PA 4QBGB 1GRQA 3A4LA 4PQRA 1E2MA 3W6PA 3MCAA 5FOSA 1A4RA 2WPDD 5IRCD 1KSFX 1XU4A 2A5DA 4IVQA 4C0BA 3B78A 1AQUA 1WBDA 5AJYA 5EXPA 4BUJA 2RGGA 2QP3A 3RNLA 1W5TA 4D4KA 1II8B 221PA 3THYB 2J0SA 1MO5A 3LXXA 1N6PA 2VYFA 4IDHA 4BFWA 1IXSB 5JSZA 5KHOC 5EP2A 1W4CA 1Z6XA 1P9RA 1J8MF 2ODWA 1CU1A 3OFNA 2JLYA 2ZSBA 4D4MA 4JYCA 2H92A 4QBFA 1X1RA 1OB2A 2PT5A 4K8OA 5FUYA 2ZPTX 3K09A 2O8EA 3RWMB 3FHOA 2ZR7A 4LJ7A 1FTSA 1VG8A 2GDJA 2QP9X 4GMDA 4FW9A 2B8WA 2ZROA 3PENA 1BO6A 3BWDD 4B48A 4P4SA 5AK0A 1YR8A 1R0YA 3GLGB 2RGNC 1KKMA 1JR3A 8OHMA 1XCPA 3DMDA 1UBCA 2WWXA 4YMSA 1BS1A 3ZVLA 3CRRA 3FWYA 4IOLA 5LBIA 5EXTA 3SFZA 4TSFD 1G8HA 4A0GA 2XTMA 3AF2A 3PIRA 3SJBA 3OEHD 1J90A 1ANKA 1P4SA 4BZPA 5JMTA 2JLXA 1G3UA 1ZIOA 1KDTA 1M2OB 1MH1A 2ZRKA 4LC1A 2EQBA 1NVUQ 2A30A 2PEYA 4IDQA 4RZXA 3DDCA 1M74A 3TR0A 5LDDC 4MQBA 4CW7A 2F1JA 3MGCA 3NHAA 1P9NA 2F1RA 1Z07A 3WRYC 1GL6A 1G1MA 4LRWA 4PTLA 4CT5A 3VHXA 1UPTA 1ZC4A 1W4BA 2IA5A 4HAYA 1CS4C 2FMXA 2OFOA 2DFLA 3EZ2A 4GOXA 1ZRHA 1GZSA 1V5WA 2CCGA 2OXCA 1L4UA 3D8BA 4D6PA 2QAGA 1G19A 3GJ5A 4HB0A 1F3OA 1YKSA 4MGZR 1EX7A 1HE8B 4M8NE 4AYXA 4WBSA 3B13B 5CM9C 1FOEB 1RYFA 1AS0A 2LWIA 2P3SA 2ZRJA 3VNUA 2IYVA 1XEWX 1OXXK 5KTYA 4B3GA 2W2XA 3Q3JB 4LOAA 4TMZA 1F2TA 1UDWA 4QGGA 4R71A 2GRJA 4O0MA 3BH0A 4DDVA 3KDSE 5JS7A 3SYLA 3KXIA 1U8YA 2YINC 5GJVC 3RAPR 1OH5A 5SZIA 3GCGA 3AKYA 4A92A 3QG5A 3ADBA 1SVSA 4KYIB 1ZCAA 3VNVA 2ZRFA 1SKQA 5C4GB 3CW2A 2JJ1D 4QJ3A 5FTNA 3TGPA 4OHVA 4EPTA 2NZJA 2V55B 4M1MA 1P9WA 3SJZA 1NF3A 1MT0A 1AZTA 4NMMA 3ZIAD 4YC7A 1ZU4A 4MRVA 2XSZD 4YQFA 3H0KA 1JI0A 5DLQC 4BGDA 5FR1A 5A0FA 4LUCA 4PQYA 5DSZA 3MWLA 1M7HA 3CRVA 1DEKA 4C3ZA 2OEPA 4NL4H 1P2SA 4IEEA 3ZLJA 2YHSA 2JA1A 3IO5A 3THXA 4AK9A 1W47A 1N6NA 4C0KA 3L0PA 5KDDA 4W7SA 3P26A 4DCVA 2FFHA 5A5GA 3LRPA 2ZUBA 2J0QA 2WM9B 3QKRB 5JI3E 3QVUA 2VL7A 3FE2A 2A5GA 5AJXA 5EQTA 2B6HA 3EARA 4ZDKA 4LYFA 4EIWA 2QE7A 3GJ3A 5J4KA 2DWQA 3IIMA 4V0MA 3NBZC 2Z4RA 3TQFA 5DNYB 1RJ9A 5IDVA 3VKGA 2XAUA 4TTRA 2J41A 2XNSA 1XWIA 1Y3AA 4TN1A 4ABYA 3GLIA 1TNDA 3K70C 2HJGA 2O5VA 1W1WA 4PC1A 3RC8A 4LBWA 5K8IA 1YE8A 1X3SA 2CL6X 3ETLA 5CLLA 4LJ5A 5FOVA 4TLCA 4M2LA 3RVBA 4CGZA 1EFRA 4UJ3A 5FBLB 5CIWA 5DYIA 3V4FA 1G3IA 1U99A 3OAAA 2QQEA 4DEYA 3EPHA 2H16A 3B7GA 4FN5A 5HKKD 3L2OB 1E2QA 1KKLA 3LAWA 2O8DB 1WA5A 2J45A 4GPTA 3ZGXA 2E87A 5K8LA 1KK0A 1YZUA 4TQAA 1TQ6A 1UM8A 4HAVA 3H86A 4P3YA 3Q72A 2V4ZA 3SYKA 5IHPA 2WOJA 1KHTA 4B3XA 4YMUA 2ZYTX 1DAKA 4I1VA 5KSPA 5KSOA 2ZEJA 2OT3B 3A4NA 3HYRA 3EX7C 4BFVA 2C2HA 3DMNA 1NSTA 5F2EA 5L3VA 2YKGA 1EFHA 1P2VA 1DAIA 5CJPA 2R6FA 4NZYA 1ZM7A 1J99A 3CZQA 3E5HA 4O3MA 1NVWQ 3B9PA 3RS4A 2IS4A 2QE7D 1FMLA 4Q1FA 4YLGA 4DCTA 4LHVA 1BYIA 3OE7A 2Q3FA 4XH9B 4HATA 2KE5A 1WCV1 3UPUA 4DLYA 1CULC 2ZREA 2QRZA 2WPDA 3GLHB 2GCPA 3TW4A 3ADCA 2QRNA 1OIVA 3KQHA 3LD9A 1KI8A 1XB2A 2C9OA 1DAGA 3LDAA 1GWNA 5CB6A 4KLNA 2WV9A 1IXRC 5JZVA 1D2NA 4I81A 4Q1DA 2FH5B 1ZM4A 3KXKA 3UWKA 2BM1A 1Z47A 3HU3A 1W44A 2QTVB 3GLGA 3QI2A 1YZTA 3B85A 3CNNA 1IN4A 4B3DA 3CRQA 3OFND 4D4JA 3WXMA 1YR7A 4WZ6A 4AWXA 4OBEA 4Q9JA 2RCNA 4AYWA 5LPNA 1NLYA 1CR2A 4EPWA 2KJQA 4BFYA 5GJCA 2ORIA 4HZUB 5JECA 4KFRA 2W0MA 3WBKA 5F9FA 2FSGA 2J5XA 4QRHA 3NVAA 4C7OA 1EFUA 2GHIA 4PQFA 4HLUA 5AUQA 4QHTA 5C18A 3RS2A 2IS6A 4Q4AB 3EPJA 4DUGD 1E4YA 4MRSA 4XSGA 5JS8A 3GFTA 2A78A 2IUUA 1XPRA 3AB3A 4D2IA 2VSOA 3WHKA 5D3MB 2G1KA 2ZI4A 3K70D 1E9SA 3OE7D 3TUIC 1Z0IA 1ZNZA 3EASA 3SDZA 3SQWA 4TYYA 2QM8A 5KUTA 1Z0FA 4M9ZA 5J5CA 2J7PD 1JALA 4A8JB 4ZPXA 4MA4A 1ZNYA 2ZJBA 4HB3A 3ADKA 4MUBA 2RGCA 2RB4A 1QHHB 2BIFA 4DT1A 4CEJA 2XXAA 3VKHA 4QBHA 4PPFA 1UKYA 4V0LA 3KUCA 2W83A 1OV4A 2FSFA 5GJBA 2C99A 4G01B 1YR6A 1OFTA 1U98A 1RRFA 2IUTA 4WXPA 2XZOA 1IONA 4LV5B 1O87A 5G53C 4ZIRB 4I4LA 2C5LA 4B3CA 3ZQJA 4M53A 1W0KA 3GPLA 3FOZA 3CZPA 3VU9A 3QXCA 4QGAA 4URUR 1AA9A 1R8SA 4I99A 3TVTA 3R8CA 2Q6TA 3GJXC 1GRRA 4ESHA 4DCNA 3EPLA 3K0SA 2YYZA 5CDFE 3TNFA 2BMFA 4URVR 2FX3A 5CYOA 5C1BA 2VEDA 3QIAA 4Q4JB 1D9ZA 1ZD1A 2BCGY 4Q21A 3RHFA 2CEAA 3U7HB 2F1HA 2DCUA 1TEVA 2EFDB 2X77A 3QJYA 2GEDA 3BRWD 2GETA 2AWOA 3LW7A 4GZLA 3LFUA 3TLXA 1CJUC 4QNRA 2N42A 2V6JA 1UBGA 2WMNB 2XSZA 2GCOB 5EXSA 4O2LA 4MKGA 1HURA 1UAAA 1Q22A 1XXHA 1RW4A 4TYQA 1KK3A 2DY1A 3REFA 3R9WA 4DCSA 1IHUA 3CPJB 4A6PA 5FPSA 3TSOA 3KQKA 3RRMA 3CPEA 1EGAA 4OK5A 3VQTA 2O0JA 6Q21A 4L8GA 2GJKA 4PXAA 2QU8A 3RWOA 4IKEA 3WHLA 1GNRA 1G6HA 4RJLA 3BXZA 2OXRA 1C9KA 4NYIR 1W0KD 3ZS9A 5SZJA 2AWNA 3U3KA 2PL3A 1LB1B 1MABA 1XJCA 2OCAA 2Q9BA 1ZUHA 1QHHA 3SYNA 4PHTA 3THWA 1JJ7A 1UF9A 4V0KA 4DLVA 4ERNA 2GWHA 1RRCA 4TZ6A 2OAP1 4FINA 2XJ9A 1OF1A 1S3GA 1NKSA 4OQXA 5FBQB 5TDHA 3R7WB 3SBEA 1SKYB 3KL4A 1KK1A 1TL7C 2YOFA 1CKEA 4FMCF 4N0DA 5BN3A 4IJMA 2I1QA 1WMSA 3L0IB 4MGYR 5JJKA 3FDIA 1IY1A 3DL0A 4U5XA 1TADA 1P75A 2HUPA 2R8RA 3MAAC 2O0KA 4MYUA 4PSAA 4XIGS 5HKKA 3EIQA 4IEIA 1E0KA 1F2UB 1KI2A 3SI7A 3T1TA 3FHCB 2B21A 3BIFA 2EFEB 4BLRA 3BB1A 2D4HA 4JS0A 3AV0B 3QXHA 2Z4SA 3MLEA 1QHXA 4GOKA 1XMJA 3X2SA 3VX4A 3ZVMA 2I4IA 3IQXA 5JI2E 3B1VA 4NONA 4PSKA 5EUQB 5TY0A 3TUZC 1W49A 1Z08A 2ASEA 2ZE6A 1N6LA 4PC7A 3VMFA 4BLPA 1SXJB 2P6NA 3PR1A 3IPYA 1U2RA 4TTQA 5BYKA 1JECA 1XZPA 1DO0A 3BOSA 4NKRA 2W6ID 4PAQA 2QEQA 821PA 3TE6A 1NG9A 3C5HA 4WAUA 2WOOA 3RABA 5DO9A 5F9HA 2WJJA 2ZJ8A 4M1TA 1KO4A 2WSSA 2NPFA 1JQLB 3DZ8A 1VIAA 2AX4A 1VG1A 4Q7KA 1DAFA 2WICA 1PLJA 4AY2A 3RS7A 3A8TA 4OQFA 4BRWA 1VCOA 2KSQA 3ASZA 3AP1A 4DRZA 1XJ0A 3L8YA 4EDHA 4NCJA 5FL7D 5FTMA 4DLTA 1VYUA 3KFXA 2QMUA 3W5IA 5AJZA 5BN4A 1E2NA 1T0HB 1LNZA 3BBPA 4KODA 3W3AA 2PZGA 2PEZA 3P4YA 4OHXA 1EXMA 1YZKA 4TQ9A 1E2KA 2XOKA 4FCVA 3MJHA 3EC2A 1KAOA 2VRWA 3BH7A 2ZRCA 5TB5A 3ASYA 4K81B 2P67A 4YMVA 1Z28A 4RCYA 3A37A 3KJGA 3QKRA 1LFDB 2Q0HA 3C14C 1XTSA 2FGKA 3M1IA 4US2R 2FF7A 5DGXA 1H8ED 4IFEA 3I61A 4UXIA 3SE0A 4D0LB 5KNDA 1XBTA 2BBWA 4LJ4A 5J4YA 1UEJA 1F5NA 2GBLC 4XSHA 3X1XA 2P6UA 1R5NA 2AXPA 4PHGA 4TL9A 2NG1A 2WZQA 1N6KA 2C03A 4US1R 1Q44A 1JR6A 3A1SA 1KIMA 4B34A 2GAOA 2F6RA 1UEIA 4MGKR 4H1VA 4QOSA 5DHFA 3C8UA 3MD0A 1RKBA
chains in the Genus database with same CATH superfamily
1IM8A 4G0XA 1XAGA 1CF4A 4O29A 5T6MA 2FP4A 4M1EA 1NT4A 1GPAA 4CG1A 4Z7JA 5EY5B 2LE0A 3CJTA 1JAIA 1MJ5A 2ALJA 1C9EA 1P4JA 5EWLA 3RUEA 2QMOA 3K9HA 2ILTA 2F90A 4PG7A 1WZ2A 2F3UA 2NSHA 3WMWA 3CKLA 3KZKA 1RYMA 4M0LA 5HEKA 3WLLA 5EHNA 3AK4A 1A98A 1GSAA 4JZYA 4Q19A 1RKUA 1KZ9A 4G5XA 3P52A 1NGSA 1Z22A 3DC2A 3Q3GE 5IAEA 4B6QA 4LKOA 5JJCA 1QPZA 2UXDB 3LBNA 2HNBA 2C59A 4W82A 1U2SA 5KVAA 1ONOA 4EJ6A 2IPXA 3KIPA 3O8BA 4V1CA 13PKA 1JG1A 1A8UA 2VF7A 3EC1A 3OM8A 3QLVA 1I13A 3RHSA 1NI4A 3TFWA 1QCYA 1GLGA 3LVQE 3HBFA 4JMPA 3VAZA 5A4AA 3X1WA 2LNDA 1FNNA 1DJOA 3DT6A 4H4DA 2X0KA 3VNRA 4BVHA 1R0BA 2F62A 1GUDA 1H5UA 3GV0A 4O4JF 4EJMA 1TA0A 5KMGA 1AQNA 2GN8A 1JTEA 4TL6A 3WBBA 3I01A 1G1AA 4KE7A 1WPXA 2B8EA 1G64A 2P9YA 4HF7A 4ZVSA 3ZHXA 2BLLA 2DPXA 2NZ8A 3WRXC 1MOZA 1NJ5A 2Y8EA 3GVPA 4FFDA 1ODKA 1SRRA 3U7JA 5J1TB 4CN9A 4L50A 4GF5A 4F3RA 1R4NB 3VPFA 3H3FA 4U6SA 2B1GA 3F6BX 3TRFA 2GD0A 1TGVA 1YB5A 4GWGA 1SCDA 2GZMA 1EB9A 3R0XA 2HCFA 3JVVA 1WZIA 1SUBA 5KIAA 4RZ2A 1J5PA 1D2CA 5A7FA 1Q11A 2FN8A 2I4NA 1H1LA 2ZQYA 2RDMA 2M32A 4N8DA 3SK0A 1JPUA 4RJ2A 3MCZA 3QFTA 3SJCA 3RVDA 3SHFA 1XD9A 4BIIA 3HGQA 5TVGA 1SEVA 2JAPA 4Y18A 4DBVO 3PNLA 1FRQA 2FPWA 2BGUA 1CC1S 2QGZA 4ZP1A 3AR8A 5H82A 3WGOA 4CM4B 3ZHUA 2OO7A 3EJWA 3S99A 1TEZA 1DVRA 4D96A 1NMEA 1PFVA 3CSSA 4A5SA 5CDHA 1WUYA 1ZNWA 5EGNA 4AZ0B 1YU6A 1DUVG 3CNOA 4R1UA 3F3MA 3QLUA 5LMNB 3RSSA 2C9YA 2QSUA 4JK3A 2BDTA 4Q9NA 4MQEB 3AH8A 3DKPA 4NI5A 3L4JA 3TCKA 4R7GA 4RPIA 1L5VA 2YVUA 4B2LA 3B1ZA 1RHQA 2HMSA 1WLYA 1NN0A 5F7ZA 5LZ5A 5JHGB 2I62A 1XLUA 3K6SA 2ZXFA 4RZQA 1KYWA 4GL4A 3AKEA 4Z99A 4V24A 4UTVA 4LHEA 5HCIA 1W7AA 4H6WA 1HE4A 2QAGC 5HR5A 3GGPA 5GVRA 3FVWA 5GONA 2XTZA 4CKCB 2Q1SA 3L7KA 4DPLA 4WECA 3TNLA 3CMMA 4WK2B 3ZZTA 2FFJA 4WKCA 3PFGA 4EY4A 3SHTA 4E46A 1J2EA 2FSPA 5EJ4A 3LQFA 1U7OA 1H94A 3EA5A 4W99A 3AIOA 1VLLA 4Q34A 5AK4A 4CV2A 2FV8A 1ZQ9A 2CVFA 1NJSA 1DBSA 1J2TA 1XEXA 2VJYA 3AV3A 4BP3A 2IBMA 4W63A 5AHWA 4HEHA 4A6XA 3MMPA 4C87A 1P8JA 2GVNA 1T5LA 3B48A 4HLDA 2BDUA 2PBZA 5DNVA 3WLQA 1K4KA 4HVTA 4CF4A 4E5UA 2PMDA 3DSRA 1VJCA 3HUFA 2ZXUA 5L3ZA 2PSFA 5B2EA 1AZLA 1JDZA 2X8WA 3NTXA 2COKA 3NTLA 5HF8A 3FKSA 3JD1A 1P1CA 3JQBC 4CQMD 2GPBA 3GNTA 1MJGM 3CX8A 3RF7A 3JTEA 3DP7A 3FHTA 4F3TA 1VI5A 2H59A 3N0VA 3AX6A 1X7DA 2CW5A 4L75A 3HS3A 3OI7A 1MGPA 2ZP1A 4WX2B 3S55A 1UFRA 5ELXA 4CNBA 5FNVB 1NNUA 2AD5A 3DNMA 3LDGA 4GHWA 1KR5A 3KZOA 3VO2A 5JDIA 2HHCA 3SVLA 1JFTA 2JDIA 2XNDA 3GG2A 1E5TA 4JOBA 5IAOA 3QUCA 1ZH4A 1EP1B 2GKOA 4ETMA 1P80A 1SIWA 4F2PA 1MENA 3V8QA 1SA0A 3B1WA 3R7SA 3W05A 5EHZA 1LNSA 2VCEA 3ZK8A 2CK3A 3INRA 2IX3A 4H7PA 1C1XB 2ZVPX 3V97A 1G8MA 1QRTA 2ZJFA 4QUDA 1T3SA 3D5EA 2JATA 4G36A 1X14A 4M7RA 5DN6A 3ROEA 3FOAA 1G55A 2VDKB 2ON6A 4NBVA 3RS5A 2C8LA 2IITA 3ZHTA 2GO1A 1N0HA 3ANMA 4NJEA 4REOA 3ZJ5A 1W34A 2AOTB 4BQIA 2O1WA 2HNKA 4PNPA 1Q21A 3PQFA 1ZC3A 3R23A 2UKDA 3G2JA 3TMAA 2PJUA 1S0UA 1TYZA 3LX8A 5DYTA 5CP8A 3OKFA 3MFQA 4P3PA 4PE5B 4Z1OA 4OHRA 4DLZA 2I34A 4G5YA 4QOIA 3SDBA 1GL9B 4L5AA 4Q05A 1F2UA 2A5JA 1ECPA 1W2GA 3GXOA 3MWEA 2C83A 5FL7A 1NBHA 4IZ6A 4ZZ0A 3O4FA 5JATA 5FPYA 5LXTB 5KQRA 1FP2A 1TTPB 5LP1A 4WZBE 2V65A 4GIBA 3U1BA 1JE1A 2Y77A 3LLUA 2IH5A 4IJ5A 5FPKA 2D74A 4G0OA 4JLSA 4O2BB 1FP6A 3VV3A 2WHPA 1QQ7A 1N2EA 4AKGA 3LT1A 5TEVA 2Q3CA 4HLQB 1UJ2A 1UKAA 4OJNA 5HRCA 2VHCA 3SFTA 1DKUA 3TSAA 3PJGA 2QNBA 2DQ4A 4MCAA 5FPTA 1SG6A 1VECA 4HYEA 3QWHA 2JBAA 4E5VA 5HX7A 3BYZA 3SQMA 4RXUA 1E63A 1MABB 3DV0B 1RQ2A 3OQVA 1MB3A 4J16C 1JDUA 1L6RA 2OM2A 1KMQA 2HIHA 5E9JA 5EKTA 5GWXA 4Z49A 4EW2A 1M2GA 2GS9A 1C8VB 3O3CA 4FDVA 2EW1A 2C0PA 4KG7A 2LIPA 3TSWA 4CMIB 1R8QA 3BWCA 5BWOA 3IOEA 4QRIA 4X7RA 4L5BA 1XK7A 2B61A 4OQQA 4YRBA 4BP1A 2ZI9A 4UBIA 2J3JA 1VLJA 4BV9A 4BWVA 2D0PB 2AG6A 4ZO8A 1ZFNA 4DPMA 2WWYA 4N9WA 2FZWA 2EKLA 3A9UA 2AKYA 2Q5CA 3IAM6 3L05A 1FL9A 4Q16A 3KWLA 5EE9A 1FYWA 1GTZA 3JSAA 4PNZA 3W04A 2RHOA 4UEWA 4YJKA 2CMHA 3F6CA 3OLYA 2R6GA 1PR3A 4TV9F 4X7MA 2FZEA 1YB6A 4AZ3A 4OLBA 4TRMA 4JXXA 2IUFA 3GO4A 2Y0PA 4IZOA 3TQQA 1OH7A 2P1DA 3A3KA 5DM2A 4IMRA 4GBMA 4Z86A 2HJWA 4DJ5X 4OLJA 1XVIA 4WIAA 3PHIA 1GADO 2V7WA 1DAHA 3DE1X 2XV1A 4JLPA 4LF8B 4JXKA 3EN0A 1BXRA 5FI0B 1XQYA 4NLLA 3N74A 5ALOA 3KR9A 2W93A 4WEQA 3LWNA 1DC7A 5FHRA 3NIGB 1H2YA 3W6NA 5IXYA 2GPJA 3NEJA 1E2LA 1QNLA 3VZQA 2QA5A 1OAOA 5ELLA 1V1RA 2C07A 2DR3A 4XDZA 2R85A 5K05A 4L0CA 1QAQA 4DMMA 1VHDA 1Z2DA 5J3JA 3G5TA 3P9IA 1I3NA 2J0EA 2ONYA 4GLOA 3VR5A 2WKRA 4IHQA 4DQVA 4TYNA 1RAHA 3OP4A 4CM6A 4R05A 3AY0A 1I3MA 1LK7A 4EQ6B 4M9SA 1CEQA 5BV2P 3ET4A 1CUVA 2I9PA 3GC6A 1IBKB 2IYYA 1V39A 1GAXA 2VXYA 4QPNA 3MWDB 4CGYA 2ORYA 5BRJA 1OQAA 1ODCA 2NMVA 3UC5A 4ZAXA 3EXEA 2PUDA 2DWOA 5TVKA 2CDBA 1F14A 2R4QA 1FJ2A 3KKOA 1UMCB 1Y6ZA 3M6UA 3OIWA 2PT6A 3MHPA 3R5KA 5ALKA 4ZVPA 4DNQA 4DWWA 5FPHA 3D2AA 3EG5A 2DETA 3SPXA 3HG7A 2ZDGA 3DFZA 2QL7A 2XDWA 2DBVO 3A9TA 2TMDA 1PRYA 2WE8A 3PEUA 4QTUB 2H4JA 3RQSA 5IBQA 4FYPA 5KYYA 4GP7A 4MRNA 4KSBA 4DR6B 2AJ8A 5FWNA 2O59A 4P4SB 2IKSA 2HO5A 4P5EA 3SCZA 5JR3A 4UQPA 4JELA 3RRYA 2QZPA 4JEHA 3I0MA 4ZCSA 4EARA 2HPHA 4BLQA 3AUJB 4W5JA 5KREA 1YS7A 1UINA 2ECOA 3E58A 1TKRA 3NWPA 4CEIA 2VHQA 2BPOA 1VP9A 3P9XA 2PUTA 1IWPB 3FLAA 1GGHA 1VLZA 3P97A 3WR5A 4OHYA 4PZ9A 3FKQA 4TPKA 6NULA 1SCNE 1NBME 1L1RA 1M0WA 1PR2A 2C2WA 1I4WA 4JI5B 5B1YA 3D4NA 2ZYIA 3JYOA 2VS1A 1D1QA 2PL5A 3T1OA 3ETJA 2GESA 5ITVA 5AK6A 2MTBA 2ZCJA 3BTVA 2ZJOA 2QWXA 1IJKA 1GV0A 2W8BA 3UWMA 4E07A 3CRMA 4QBKA 2C42A 4KIUA 3ASUA 4RW0A 5K7SA 4DLRA 1FSZA 3IQHX 5MGNA 1E2EA 1VM6A 4B71A 1I2DA 3BM5A 1L5FA 3EPPA 1ZS9A 2D3TA 4HPWA 2C9CA 3U60B 2D5IA 2NO9A 1GGJA 1LI5A 2OTCA 2YASA 4MPPA 2ZS9A 4O5AA 3NBFA 3UB3A 2WQ7A 4BGVA 3EQZA 4KN5A 1LX7A 2R7MA 4RIEA 5KYKA 3ZWAA 3I42A 2G1JA 2TMGA 3F74A 1AB6A 1AUQA 4J16A 1SZCA 5AKHA 4X71A 3ZW9A 2I3AA 4UTRA 1JR2A 1UXJA 2B2NA 2QLMA 5BWLA 4UKDA 2B4TO 4HPJB 5F9MA 4BNDA 4EG6A 2IDJA 1RM5A 1II9A 2AFHB 2Q49A 3N0XA 3OOEA 4N0QA 4JD5A 4W5TA 1HY3A 4XKJA 4UUPA 5EP4A 4ARVA 2P79A 2R8ZA 5LU9A 1MO2A 2JJYA 2X2OA 4KEAA 3KKNA 4FYMA 1JQJC 2EJVA 3GFFA 3U1TA 2J0VA 4Y1FA 1BW9A 5F2KA 2SBTA 4X7PA 2JB9A 2O1XA 5C1DA 5CDYA 1BXRB 1R8XA 1ZNQO 4RJJA 4GD3Q 4ZI2A 1G18A 1NQ5A 4IIUA 3J81A 4FGWA 3DCIA 4G8DA 1BMTA 3GAFA 1A69A 4IG9A 3UK7A 3TZQA 3N70A 2QZ4A 2RGBA 4G6ZA 4EMTA 2G4VA 1PFUA 2V4MA 5IYZF 2WY2D 1JDTA 1NLUA 1Q1QA 3OQIA 1NM5C 2J46A 3N9IA 2BAGA 5EFZA 4LN1A 5AT1A 4IFBA 1HEIA 2JDID 2XNDD 1E5QA 3WAKA 1R4ZA 1QFXA 1L4KA 3ND6A 3VVBA 1O57A 1UXOA 2XT6A 4KAAA 2Z2KA 3MWKA 4OB7A 4RDCA 3F4LA 5AVRA 3THXB 2ZITA 1NSYA 2CK3D 3H2IA 3QVMA 5EKUA 1KZHA 3SXPA 3WKAA 5L6LB 3G9ZA 1AK9A 1GFZA 1NI5A 1XD8A 3O47A 1GCUA 2CY0A 3ME5A 5DN6D 1Z5ZA 3NVKI 4LY9A 2W4IA 1KVUA 1QWSA 2IXTA 1Y3DE 1ZUIA 2PGDA 2XZPA 1V16B 3D4LA 4UNQA 5REQB 3FTNA 1E2GA 3Q5DA 3TLBA 2Y1DA 4LBZA 1QRDA 4YP5A 2IQ5A 2HQSA 4CYMA 3AEKB 3OECA 4IVPA 4QDJA 4WOKA 1NL3A 3ITKA 4OL0A 4R2KA 3MPUA 5AVVA 2GZDA 5JYBA 3GP8A 4WV3A 3EAFA 4RO0A 4ER7A 3O38A 1YGYA 5C8YF 3CY6A 1GGNA 1UXIA 4JBLA 3SZ3A 3RJTA 1U1DA 4O2AA 2ZUWA 1NUUA 4JJKA 3B6ZA 1X42A 1M8KA 2NPIA 4RPLA 1GZ7A 3DMPA 3HBLA 4HZUA 3H13A 5JJ5A 3IQZA 2VQFB 4MDFA 3AINA 4JGBA 1US8B 4G07A 4IJWA 3CLHA 4WW0A 4B84A 4DNXA 5HS4A 1B7GO 2O1EA 2PH7A 1UZAA 3ABSB 1PZHA 3FX2A 4C05A 1VLMA 2GJ9A 2HQRA 3R40A 2FWRA 3PC2A 2FEXA 5LR6A 3PUVA 1VL6A 2V3CC 2DUJA 2WYOA 4PZZA 4AJ1A 3GMSA 3ZWYA 5K0NA 2OHJA 4J7XA 5KYTA 5I7EA 2F3SA 3RAFC 2YFQA 3ZIDA 2FUCA 2ESRA 4C5AA 2XD4A 1Y9ZA 2G5CA 2P27A 1LSJA 5G0TA 2QIOA 1FQWA 2CHGA 4NCBA 3OG9A 3OX3A 2POCA 1HQYE 3W1VA 1CJVC 3DP9A 4B4VA 3NONA 1G9XA 1T8PA 4XOUA 1X86B 1A5TA 4W9NC 3LPDA 1JHMA 3KFLA 4QGFA 3IBFA 4NPHA 4CTNA 1NJ1A 1NM5A 1NDUA 3PQCA 4FTWA 2HDWA 1KS9A 2ZDQA 3AU8A 5CVUA 2IGBA 1QB7A 4CCYA 3OD5A 1E0SA 1EFVA 2CJWA 5G1OA 3PI7A 1U8EA 1VA5A 3ET5A 3EBLA 3KD2A 3MTEA 3QELB 4GRDA 3DDNA 1KL7A 4PRLA 5A4IS 5B3JA 4GVPA 2VJBA 3V7NA 2ZVDA 3JZAA 1K7YA 3GPCA 5LOVA 4H0CA 4J03A 2Z2YA 3OT4A 3SMVA 3I52A 3QEJA 3THRA 1OE0A 4LYAA 2DT8A 4U8HA 5CVVA 2IKQA 2OBNA 1IL0A 2A67A 1P72A 4PLFA 2VYNA 1H4SA 1ZL2A 1VCHA 3LPNA 3QF7A 2YCBA 4LGYA 1NUTA 3LKDA 2ZBRA 1TM2A 2C9DA 2NU7A 4CKWB 3TI7A 4EHBA 2HHJA 3M89A 3ZNPA 2W58A 2EOAA 2WWHA 4CWAA 1U1EA 3E3AA 4BJ3A 3GFGA 4DQDA 4R8VA 3ABIA 1DKRA 1ZESA 3G5MA 1NMQA 1XD2A 3D81A 4FFVA 5KQGA 2R8OA 1X8JA 2FDXA 3OF2A 5EEGA 4LYJA 3YASA 1OH6A 5L7WA 3A6PC 5TMPA 4ZREA 5CYFA 3A7DA 4RWEA 2UZ4A 4KPYA 3HR8A 4TM7A 2DOKA 5CW2A 1KDOA 1TMGE 5DTMA 5F2OA 3MAGA 5KAPA 3UWPA 3V1YA 1DWPA 4BO0A 2LBPA 2FAXA 3H4VA 2R47A 3WRXA 5JSQA 1FTGA 1UPBA 2C4MA 2OB2A 1BQEA 3MTJA 3N6RA 4YCCA 1Q3TA 1P5JA 2G80A 4Q7JB 1EFCA 1P5HA 2B2XA 1ND5A 4RM3A 2YJNA 1YFLA 1A9OA 2PRIA 3N2GB 4EGSA 4ERXA 4FI3F 3JAMA 2YBEA 3KT8A 3KU4A 1SIUA 4I19A 1VBNA 2W4QA 4RKFA 4K6FA 2PZMA 3B52X 1EWVA 2XVMA 2FR1A 4RE6A 5JDCA 4G1CA 4TT8A 5LA6B 3B8HA 2PZBA 3QVGB 4PBTA 4E5PA 3L0CA 3HCOA 2K87A 2O2ZA 3G02A 2P5TB 5FQOA 3GDGA 4KIFA 2C3UA 2SCUA 3RJ5A 2CLCX 4UMEA 4GPD1 4N0EA 2MJLA 5DM1A 4D8WA 1EIWA 4LXGA 1J7JA 2OQVA 1OFGA 1GNSA 4R1SA 4JLUA 2OOSA 3SG0A 4D8XA 1VRVA 2R5FA 4AXXA 1Z0KA 3GOQA 3TNJA 3R7NA 4FKMA 5IPFA 4R9VA 1OWOA 4UE3S 2BRUA 2LZ0A 4IJQA 3PQ8A 1A2KC 2ZUTA 5I7AA 1GQFA 1Y4SA 1JVBA 1OBFO 1SQGA 2CD7A 2PS9A 3CX7A 1E8NA 3L0OA 2BHLA 4F38A 5CPFA 3TLAA 2ZB3A 3I62A 2G70A 2Z2IA 5KNCA 1LTHR 3RS3A 1G21B 4JLKA 2GTPA 3WIBA 5IAAA 4RIHA 5IUNC 1UJCA 2AOXA 3UY4A 2QMEA 2QM7A 3UN1A 4OQDA 2DFPA 2VP3A 3EMVA 1DC8A 2QRVA 4Y2VA 5ARDA 4CDNA 3LQ2A 4MNTA 3ZY4A 2OSBA 5JDCC 2Q4BA 1ZD3A 4H3HB 1WDWB 1XU7A 3ZGLA 1I8TA 4O4HB 4KMOA 3EGWA 5HQ3A 3OLXA 3OCXA 1R9MA 4J91A 5FV7A 3SR0A 2QYTA 4JKYA 5K4AA 5JJLA 4Q9DA 4YRDA 4ZU3A 5LMCA 1GA1A 3L9XA 3PL5A 4B3IA 7YASA 1PU2A 4M89A 5K5EA 2VSXA 4NENA 3BMQB 4ZODA 2EJTA 4Q9HA 1M1XB 2A2ZA 1Z0DA 2JCSA 3FVTA 4URWR 1E1YA 1E2DA 1MAVA 4BRUA 1KFCB 3FBGA 1WE2A 3WYEA 5FBZA 4UOEA 1K27A 1E1RD 5BT9A 2WINI 3JALA 4CM9A 3JX9A 2ZU6A 3DBRB 1E2FA 5T8KC 2KS6A 3I72A 3T4PA 3B6IA 1UPXA 2VSFA 4AY3A 3DTVA 5BVHB 3K0KA 4LF5B 5F3WB 4RLHA 4B2PA 4R0NA 4LGMA 3AVYA 5ALJA 3RUIA 3MIZA 2GVZC 5ALDA 3A58B 4A36A 1ULSA 2AQHA 3WQHA 4ZVQA 3CONA 2ZG6A 2ZJZA 2PX3A 5LA6A 3QOFA 3NIBA 4FQ5A 3LDFA 2SKCA 3UMJA 1UODA 1WDTA 1F4PA 1KZ7B 1Y3BE 2YV4A 1PG5A 3FFXA 4W1SA 1UM9B 4ZEMA 1A8QA 3BAFA 1NW4A 4J29A 4NBNA 3RLFA 3ZW7A 2ZM6B 1WTCA 3U3MA 2ZZNA 4I4TF 3N2GA 3HP1A 2Q3HA 4IYRA 4UJ5A 4HNQA 1E1DA 3N2KB 5CCDA 1I3LA 1A9RA 2UYQA 2VA8A 1O6GA 5TQ0A 3PEFA 4EDFA 3G13A 3LCVB 3TL6A 3KZVA 4KAXA 1G17A 1YBVA 4N6OA 4QGBA 3S2YA 2WWIA 3JRXA 2XA1A 5DWVA 3HO6A 1YQWA 3PUZA 4XB2A 5A9TA 2H18A 3CJQA 4ARBA 2R6CA 3B1YA 5CTAA 3V3KA 2MSNA 2C04A 4RY2A 2E18A 4PG4A 4TM8A 2ZQ5A 4XIJA 5DNCA 5JALA 1TMYA 4GBED 5I45A 3D7SA 3VYUB 5IVIA 3L8MA 3VR2D 1U0JA 3IAAA 1ZGJA 5IARA 1A1VA 4C3VA 1OW3B 3F6RA 4GX2A 5H9WA 5J2UF 1SQ5A 2XITA 3EG9B 1PSWA 3N76A 3PC3A 2WWVD 5AUNB 4QUBA 4GXNA 1HI9A 4PM4A 3RTGA 2JVJA 1E98A 3WAGA 1I0ZA 4PX3A 4AG6A 1JYFA 3KFVA 3RIYA 3R74A 1TZ2A 2AW5A 5EIBC 1EUDA 5EESA 4B76A 4F45A 1X9GA 4C1BA 1N7IA 1U65A 5BNZA 3OSUA 2XB2A 3B1KA 4PYKA 5CW1A 1KE2A 1TJYA 3E7DA 3OE5A 3K72B 2RSLA 1OIXA 2ZI6A 3GRVA 4HNRA 1SKAA 1XRRA 3Q10A 3GBSA 2CVHA 4BEVA 4DDKA 1PLKA 1ISSA 3L8GA 3ZWCA 1V1RB 3GRZA 4HP8A 5IM4F 5C8YA 4D25A 1LWOA 2BEWA 2HK8A 1ZD2P 4MEAA 5C34B 3OSZA 1NBIA 4DLWA 2E4WA 1R74A 2H3HA 4KHZA 1SXGA 4H3SA 4QTXA 3U62A 2JGDA 1JQ3A 1JMVA 5TV2A 3U7IA 2FPIB 4KV7A 4L0QA 3IIEA 2QTAA 4TTIA 2GFHA 3BL8A 5I8ZA 3PE3A 4BLVA 2BEKA 2Z57A 5CJ2A 4C3OB 2GN2A 3VJRA 1B23P 3MOIA 2XQFA 1OWNA 1V43A 4OB8A 3AEXA 1J23A 1NZDA 3OMXA 2FN4A 3OWXA 4G41A 4PFSA 5EMJA 4AZWA 1AK1A 1T8WA 4MQUA 3E23A 1PJSA 4ALKA 1YQXA 1T9GR 1Z29A 4YV0A 4XB6B 4FX2A 1DMRA 3QUSA 2P4QA 1RQ7A 1ZK4A 4GVXA 3VR2A 1PW7A 4H6PA 2RHBA 4ACBA 5SY6A 1T4CB 3H8VA 1L5QA 3M4NA 3QM1A 4ITRC 4F1WA 2QHXA 4KV9A 3ROMA 2Q1WA 4F4HA 3G1TA 4X20B 1ADJA 4JP3A 4M6WA 3ZE0B 3HCBA 1ABEA 1MU0A 1JDNA 3VTKA 3QVSA 3L6OO 2ZGVA 4YUXA 2F1IA 5ISMA 1D5CA 4ZMSA 2R86A 1XTBA 1ZHFA 1AN0A 2V8OA 3ZG6A 1D2GA 2ACVA 3FMVA 3HFSA 4DDUA 5KYGA 1QHIA 1D8TA 5EXEA 4CDGA 1UK7A 2AX3A 4YR9A 2DQYA 4D44A 5LSAA 1YTUA 1NG1A 2ID9A 2JLSA 4S35A 5DKFA 3TRKA 1T8UA 1E3SA 1T15A 2ICAA 3OE4A 4R8SA 5EWMA 3FNFA 4I1YA 4RU1A 1H2WA 4Y7DA 3TZBA 3W7VA 1DKQA 3V9PA 2UU9B 3QVVA 1VTKA 4QUEA 2H1FA 1WUTA 3WYBA 1WUHS 3FNIA 3LHDA 4AP9A 3K30A 3KB8A 4QDOA 1A7JA 5HW0A 4Y9DA 2AF4C 1WEHA 5LQCA 2VOJA 3D7NA 1OI2A 3DAFA 3LC2O 4NBKA 4RAQA 4EYGA 3I5YA 3REQA 1O54A 1SIBE 3SIXA 3E15A 1P3JA 4TX1A 1AO3A 2VH2A 3ESDA 1KP9A 2JJMA 2EL7A 3AW9A 1XDWA 3OZ7A 1JEEA 3OZSA 4DGQA 4PU0A 1MRNA 3UT5B 5CVJA 1J0EA 1YV9A 2BTQA 3KUUA 1KC1A 4NBSA 4DIDA 1AM4D 4N0PA 1JE0A 1LUAA 3EVBA 4OQPA 5T57A 1IZZA 3GVHA 2PCLA 4L57A 1I4OA 1MO3A 3OEEA 2XE7A 1L7QA 1UPFA 2ADFA 3UK2A 5CCXA 3QU9A 1F0PA 1GNTA 1U7HA 3ICQB 4GYYA 1T9KA 3WP1B 3RO7A 4EPVA 1B8PA 4U7GA 5EQFA 1XQ6A 1PEKE 4FFBB 5IC4A 2Z58A 3EHDA 4X6LA 1UK6A 4BLUA 3PFFA 2JGIA 1EYZA 1TO1E 2MYTA 3UXYA 3FPSA 2AH5A 4JI8B 2WD8A 3PB3A 2TECE 1VCNA 1G7CA 4E2FA 3IR5A 2R66A 1IN8A 1Q83A 1X1EA 4NEQA 5DIZA 3QG1A 3UA3A 1X2BA 5AFSA 3WA7A 2W8BB 4Z3OA 3OAAD 3DVAB 3MXTA 1IN5A 1NNLA 3BMNA 1QS0B 4R2IA 4ZO4A 4DOMA 1U3WA 2HPAA 4C5CA 1U8XX 2HRZA 4FHZA 5CMLA 5L4NA 1VDMA 1KOJA 1OFUX 2GZHA 4WUVA 4Z0HO 3WDMA 2HA2A 2V5UA 3FUWA 2HWXA 4P7GA 4ZQHA 4ZKEA 1ORRA 3V1KA 1QPGA 3ISTA 3DFFA 3P0FA 2IYEA 2PGXA 2HLNA 4NCIA 3AGPA 1R64A 1RP7A 4PXYA 4BNWA 2VOEA 5G3YA 1BJKA 3I09A 4HQKA 4O8CA 1KQ3A 5U4XA 5IJ0B 1XV5A 4NMXB 3V1MA 4B85A 1G41A 1HRDA 1Q1NA 2D1RA 3DULA 4BVGA 3B1JA 3HB9A 3QWBA 4MDYA 4URYR 1N25A 4IDPA 4X60A 4EPYA 3ESQA 3CO5A 6AT1A 3LYLA 2PNJA 2YWGA 1G16A 1ZWKA 3UMVA 1ZD8A 1SKYE 2Q5EA 4Q3OA 2ZTHA 3VFDA 4X85A 3KQWA 1JHYA 2ZUSA 4J0EA 4ZV9A 2CLFB 1NC3A 1TZJA 3ONDA 1IOLA 1ZOLA 3LUJA 3ORSA 4JLDA 1U3DA 1GNLA 3NFYA 5M3BA 2X5NA 1LNQA 1A77A 1N77A 2OXIA 2HF9A 2WAOA 2HJVA 1LH0A 5AESA 3G8DA 1E99A 3TR6A 5K0GA 4P53A 2M6LA 3ITNA 1O8CA 1VKJA 4HS9A 1IQ0A 1RXSA 4HBGA 3V80A 4ZCIA 5K3OA 2WWFA 1XRJA 2C96A 3LT0A 2Z8XA 3RDPA 1P0QA 3VPSA 3H16A 5E6RB 1UT5A 3EWSA 4ZMBA 4JJ8A 1HC7A 4A0HA 3EGDB 2H48A 3NAZA 2WKSA 3WLAA 5C51B 3DCYA 3EH1A 1JUDA 3TMKA 2Q8PA 4MVWA 2W8ZA 5AJUA 4EI7A 5IEJA 2XMPA 4E7OA 3JD2A 1FS5A 3T4UA 3IP7A 3U09A 4PFJA 3EISA 2IXDA 4J4HA 3N6VA 3O84A 5CB8A 1R5BA 1N5IA 2FQ1A 2P7HA 4KYTA 4HX9A 2IEGA 2O2YA 3U2QA 5JPCA 4EZEA 2B7BA 4F0JA 3ZU6A 2PIAA 2JJ2A 4L0MA 2RFLA 2Y2VA 1TZMA 3FUCA 1BCRB 1IY2A 1N2HA 3NP7A 2QD5A 2A1TS 3PJEA 2BMJA 4MR7B 4HYYA 1ZNXA 4CMBA 3HLTA 3OZRA 2WB2A 4F56A 1UMCA 1ZLYA 3C8DA 4JJZA 4D3FA 4Q1BA 2DFKB 2Z6VA 4FGLA 1CUCA 4U00A 3OPVA 1Q6YA 3H1PA 1RE0A 5FAXA 3UEOA 4OV6B 3M0EA 2OZVA 5TJ9A 1AE1A 5LNK6 4B8WA 3ZBUA 4YWJA 3TOVA 2DSNA 1UKVY 2YC4C 2ZUCA 2AFIE 2X4LA 3B60A 1RWOA 5AHOA 5EVJA 4COOA 1RRVA 2ZSJA 1J5XA 4D3YA 1T4GA 3BGIA 4JH0A 2QM3A 3EGXB 3FBTA 4HRYA 5PGMA 3QKUA 5EUMA 1UH5A 3BCUA 4IKOA 3X0DA 3ZWVA 4ZRDA 5JAPA 1ZJJA 3ZR4B 2AG5A 2HOQA 4QEKA 1KEWA 1BEZA 4R83A 3LP5A 3V4RA 5IASA 2CDRA 2CLSA 2P4EA 4QASA 3UUEA 1WPQA 4IXMA 2I55A 5H3HA 4DB4A 3SZOA 4HS4A 1W29A 4N7BA 4X5OA 4ARZB 3IULA 3AFGA 1D07A 2WKQA 3LUDA 1YJ8A 3UFBA 4BU1A 3HJCA 1PV1A 3AEYA 4C43A 5I01A 5B1DA 4YCNA 1NY5A 4WT7A 1BD4A 4MWSA 1BN6A 4WMLA 1SIOA 3RVOA 5LOVF 5JQGA 2AEMA 1A71A 3AHDA 4AULA 5FBWB 4EYSA 2E89A 3A7EA 3DMTA 3NNSA 1KP3A 4R98A 1Z16A 1IEWA 4LYYA 2WF8A 4ZA2A 3RRBA 1HQKA 2YWJA 4O2BA 4CLOA 2A3NA 1FX0B 1R8JA 1RCFA 2YZMA 4NCKA 3GP3A 4Q3AA 2ZZMA 3ZDYB 2QVBA 4HB4A 1VG0B 3C5WP 3EPRA 3NX4A 4MWEA 4OKSA 1EE9A 4JBWA 2ZJ0A 4JB2A 3QX3A 1TCUA 1XZMA 2J3MA 2OESA 1GR0A 3BSWA 3QENA 4LOIA 4ZDIA 3L92A 3FDXA 3I8XA 1G7RA 4UUQA 3PFHA 4QXOA 5BWMA 1JSCA 3IT0A 3QPVA 3QGMA 4BYMA 2GRAA 1EXVA 4I4IA 4C7BA 4IDGA 4MVJH 1JWLA 1JDBB 5DBEX 7REQA 1RCTE 1OXSC 1VPWA 2HR1A 2Z9BA 1MRSA 1IK4A 3G2HA 4JBHA 2YWBA 3CVVA 3X1ZA 1T2DA 1Z13A 1V7CA 1U8CB 3D43A 4G0MA 4WE3A 5KJ1A 2VI5A 4MVJP 1XAHA 2Y4NA 4E5YA 3RSFA 3D4OA 4QX6A 2ZRGA 2OFWA 4IRUB 2O3TA 3QWAA 3BJIC 4P93A 4YJGA 3ZI4A 3ZGZA 2NX2A 1B93A 2B7LA 2I3ZA 2QU7A 4QD3A 2WABA 3V2UA 2HYDA 3A1TA 1PVDA 1JTFA 3M6MD 4MRRA 1Y6QA 1NOKA 3REQB 4D9IA 2D8AA 4AP5A 1USIA 3MFYA 3I4LA 5B2FA 4RELA 5SYNA 1BE1A 3EEQA 3IUYA 2YH2A 1FB5A 4M7PA 1DIGA 1O8BA 4EECA 2C1EA 2F4VB 4GLFA 2H1VA 4MPTA 2QUKA 3K53A 1PJQA 4C7OB 2VYVD 3ZWWA 1J8DA 2ZBGA 3OPQA 1TX4B 2QQ0A 2Q29A 4J76A 3T0FA 5KWEA 1UWCA 1XNJA 3P9YA 2WTUA 3PS9A 2QX9A 1B8VA 3WADA 3WGJA 4EPXA 3PGLA 4M46A 3G5UA 1ORDA 3PQ4A 2QN1A 5HA5A 3DKVA 3FLBA 3X44A 2CLDX 1E3QA 1W87A 4YIHA 3IA7A 2C00A 1EFDN 3DLIA 3K5PA 3SNKA 1TO6A 1WSBA 1Z73A 4N5IX 4FEGA 5KNBA 4O33A 1WU8A 3WQQA 3ILXA 4NAVA 3JATA 1QTIA 2XMDA 3HYSA 1REQB 4JKIA 5CT8A 2BRUC 5JTTA 2UXBB 1J56A 2WAXA 3UAOA 5ADWA 2Q7OE 3RTEA 4P98A 1HYBA 2BONA 1HL7A 2BMWA 2BHRA 3I34X 3PX3A 4K87A 2G9UA 3RJMA 1X39A 3I9LA 2OE2A 4QA9A 4OJMX 4D8UA 4DT1B 3EGEA 2WQ6A 1Q0UA 3HH8A 4J0JA 3IHWA 3EFHA 4K0RA 4OGKA 4UUAA 1PZXA 1NOIA 1UDXA 1W8DA 2AN5A 1CQXA 2QVYX 1PR1A 3KVYA 2N1BA 4MYDA 4N8EA 1MOSA 4PY2A 3G2NA 5TPWB 1CR6A 2FEAA 4CF7A 3OF3A 4IUCS 1A4UA 5A4FS 3N58A 4EOGA 1L0BA 2DR0A 1HSZA 4HDRB 4IZIA 1ZP6A 1ILWA 1XJQA 1ZRMA 4RADA 4PZCA 4RK7A 2YXEA 3FJOA 3KT6A 4PEVA 3HNRA 1MIOA 1PWHA 1GZ6A 3CEPB 1EGHA 1VP3A 1Y8QB 1MEOA 2VHUA 1XT6A 3D0RA 4QDTA 2FR8A 3IXQA 3JQ8A 4CQLA 1JSRA 1Q92A 2XF2A 3G3EA 4G97A 1MT3A 5DK6A 1EJ2A 3HCRA 4IP0A 2OUKA 1UOOA 1QV6A 1H9CA 5KWVA 2JGMA 2PUJA 1XEXB 4IH9A 4OL9A 2J4DA 3WI7A 3KVNA 2IOFA 1P1KA 4Y9SA 5FF9A 3FTFA 1HDYA 3KTAB 3ANYB 2FPPB 4B7AA 4R8LA 5BSHA 1MQ8B 2UDPA 1RRPA 2FX2A 1D9XA 1XZKA 1T5SA 3GEBA 2VN8A 3NV7A 2FP3A 3FDZA 5LOVB 5FJJA 1MNQA 1UFQA 3W06A 4GKKB 4CRWB 2MSDB 3DF9A 4HRXA 4MW7A 4N03A 2I8AA 5ULLA 2GO7A 4Y2HA 1EFVB 2CJWB 2EJUA 1ODSA 5FUXA 3G0HA 4JX9A 2OBXA 1GCGA 3AKCA 1RVDA 1KDPA 4C9BA 1WL8A 3NYWA 4M1SA 4DQUA 4PAGA 3H5AA 2EAUA 2Y05A 3MAJA 1T0IA 2GLXA 1H0SA 3RG8A 2GN9A 2JLAA 3WV4A 1DQRA 1UBOS 2VAMA 4G26A 2II6A 5DH9A 3I05A 1OB5A 5HZKA 4OLFA 4G4JA 2QUJA 4L8FA 1OKKA 1Y1KE 3ZEAA 2REXB 4FHCA 2ZIAA 1EUDB 2X3YA 2LKDA 5TT0A 3TIVA 1D2HA 6LDHA 3MJ4A 3GA0A 1OU4A 4TRJA 4DS3A 5ES4B 1BFUA 2Q5HA 5D1HA 1YBMA 2H2AA 2I6GA 4HNSA 2ZR0A 3CH4B 5BV0A 3RTDA 4BMSA 3GRFA 3WSTA 1PFGA 5DXJA 3O3MB 5FH9A 2JKVA 4R68A 4C6TA 1TKBA 2FUG1 2IUSA 3ND7A 1T0PA 4EMBA 5E8JA 1M76A 3P71T 2H8KA 4KMRA