1XFAA

Structure of nbd1 from murine cftr- f508r mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
264
Chain Sequence
b'TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 89
structure length 264
sequence length 281
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xfaA00
5LBIA 4IOLA 2F9LA 1OYYA 1G6HA 3EW9A 5HZKA 4IXMA 3RYTC 3PUVA 3AVVA 2IYTA 4FXPA 4G5GA 2ZRGA 4QHYA 4GMXA 1D9ZA 1CRPA 2QG6A 3ASYA 2BBWA 1Z28A 2REOA 3RS2A 3MSXA 4V03A 1Y63A 4WXPA 2VP2A 4PO1A 3AF4A 2HCBA 2NQ2C 1OFHA 1N6PA 1ZIPA 2CNWA 1NBMA 2RAPA 3CWZA 3DDCA 4QXAA 2RH5A 4RCYA 5C4MA 3IHWA 5KSZA 5BN4A 3K0CC 4CVNA 5CJ2A 3RRYA 1QG4A 3EPHA 3OIWA 3U60B 4W5JA 1TF7A 3RLFA 1KIMA 4JT4A 2ZI9A 5HTKA 2XOKA 4N0EA 1GG2A 1MO3A 2WKPA 5TB5A 3B1VA 1Z0JA 1J8MF 3VKGA 1JEDA 3SZRA 3KX2A 1PJRA 3U3RA 3U6KA 4DLSA 4PQFA 5EUMA 2WJHA 1WA5A 3FFAA 2F55A 1XP8A 3TSWA 2H8KA 4ARZA 4ESVA 1G4UR 3BGWA 1X6VA 4HB2A 1IBRA 1OB2A 2Q3MA 3W8NA 3TK1A 1TUEA 1FMJA 3ZGXA 1R8SA 3LXXA 2AXNA 1ZNXA 1GSIA 2A5YB 4E22A 1RPZA 5CLQA 1COWA 4PC2A 3CPEA 4OQNA 1DO2A 2GCOB 2OESA 3I1FA 4TMVA 3SS8A 3QVUA 1KO8A 1TF5A 2B21A 2WWXA 4GP7A 4MRRA 5EZ5A 4TYYA 5JBQA 4NHOA 2OO7A 1FFHA 1G8HA 4PPFA 1E2LA 4DVGA 3GLGE 3PXGA 1AS3A 3LX5A 2F1HA 2C9YA 3CUEF 1MV5A 1GNQA 2BM0A 3NKVA 3AV0B 4HAUA 4URWR 1G64A 1QBKC 3GJ8A 4I1VA 4OK5A 1LTQA 1KO5A 3BB1A 1D5CA 1GWNA 4GZMA 1G3UA 4DLVA 1G291 1ZVQA 4AWXA 1YZTA 2CXXA 2F1RA 2W2XA 3CM0A 3HPQA 4JVNA 3N5CA 621PA 4JLAA 3N2IA 2C77A 3MD0A 2GA8A 2RGNA 4LJ9A 5GJBA 2WJIA 4Y0AA 3UMRA 4RZ3A 3GLIA 4LJYA 2VF8A 4M53A 4Q1FA 4HAXA 4QG7A 3BS4A 5FOSA 2VLIA 1AK2A 4FMDF 3HPRA 3KUCA 3RABA 1DTSA 4KFSA 2CLDX 2GJAA 3HR8A 5AUOB 3ZH9B 4U02A 2H16A 1WCV1 2VBCA 2F3TA 4QBHA 4CEIA 5F3WB 4V0LA 1E9EA 3N70A 5FUXA 4BLPA 2NIPA 2WTUA 4AD8A 2HF9A 3E70C 3W9YA 2QQEA 1M7HA 1DBSA 4Q7LA 2CMKA 4KSCA 1P72A 2A9KA 1YZNA 5JJLA 1KYIA 1DPFA 3GJ4A 1XTJA 1JAIA 2VP0A 4LC0A 4ARZB 3IDQA 1YRAA 2ERXA 3FMPB 4IEEA 1G7SA 1Z0IA 1KAGA 1X1SA 2HJVA 2IEYA 3B1WA 2JLVA 4GOXA 2HXSA 2QMHA 1GRNA 4HLUC 2EFGA 2Z0MA 1X8JA 2OG2A 3PEWA 2IYZA 4E03A 3PG5A 4WIAA 2UZIR 2PZGA 2PT5A 2DCUA 3EXAA 4U5XA 1DEKA 3CRRA 1U9IA 4LV6A 3SR0A 4KITB 4ZV4A 1JQJC 2AN9A 2PL3A 4DT1A 5HPYB 2CL0X 3PQCA 1P5ZB 3KDSE 2F43B 4LV8B 4XWOA 5D3QA 1MRNA 2NO0A 1G3IA 4BRWA 1U0HC 1Z07A 3CWQA 4LHVA 4RFSA 3LBIA 4LHWA 2IYWA 3TLXA 4AYWA 2XZOA 3CLVA 1EESA 3AM1A 3NIBA 1Q1ZA 3EWSA 4OHVA 4HB0A 3GLFE 3AF0A 5KOYA 3BAFA 2KSQA 3ZJYA 1E2KA 1GIAA 1OXVA 3MLEA 2ZRNA 4JYCA 3X1XA 2H92A 2ZREA 4CW7A 4YMUA 3GLIB 3AVTA 1CXZA 2QAGA 2JJ2A 3D7MA 3RS7A 4FMDB 5AJVB 2QL6A 4G3XA 3B1YA 4S2EA 2VYFA 1YKSA 2GF0A 3WXMA 2JLXA 2XITA 1CEEA 1CJUC 2ZRPA 4GNKA 4CEIB 4Q1DA 1ANKA 4IVPA 2VP9A 4PSVA 1CJMA 1UAAA 2VQSA 1FQJA 4IOKA 2GEUA 1G8FA 4CT4B 3W6NA 3FPAA 1C9KA 3NVAA 4Q1CA 3HYRA 421PA 3FOZA 1M74A 1T3SA 5TMPA 1L2TA 3P26A 2IUUA 4P4SA 1N6NA 4RD3A 5FOVA 3FHCB 3Q7QA 1IJFA 3PR1A 1GZSA 4TQUS 1KMHA 3GPLA 3QVVA 4KU4A 2G9NA 3SFZA 1QVRA 4TSFA 1SXJD 3QENA 4P0TA 4B44A 4JLNA 1NBME 3T35A 1BIFA 4PHFA 2AKYA 1I4DD 2ZR9A 1QVAA 2ZSAA 3C4JA 3D31A 1BOFA 2WWIA 1LFDB 2EW1A 3SYKA 3DZ8A 1DG3A 3SHFA 4NYJQ 1SVWA 4DDUA 3IUYA 1DADA 4ASUD 4DT1B 4KYUA 2YOHA 1BKDR 1E2PA 1KDPA 3UMFA 5J4YA 1DARA 1UF9A 5IHPA 2XJ4A 4LYAA 4DIEA 1ZMXA 4RFSB 1A1VA 3PVSA 1OFUX 1NMYA 4OHXA 4WZAE 4Y0VA 1XBTA 3SHWA 1Q3HA 3LNCA 4URZR 4LBWA 4NYJR 1C1YA 1G16A 3M0EA 1AS0A 3DPUA 2GDJA 2GTPA 1E1RA 2EWVA 3CB4A 2IYVA 1M2OB 3EZ2A 2QAGB 2WWYA 2ZRJA 4F4CA 1H8EA 1Q3TA 2A5DA 4DLTA 1NF3A 1UKEA 2RMKA 3MFYA 3P27A 4EPXA 3SYLA 3MJRA 1OH8A 4A36A 1D2EA 4TYPA 3RNLA 5JCZA 1E2IA 3BK7A 1XD2A 1OIVA 4RVCA 5AUPB 2WJGA 3R7WB 4BEJA 3OZXA 1T91A 3S1AA 4LHYA 4PAOA 1F2TA 3OEHA 3NG1A 5FOWA 2ANCA 1W5SA 4JJZA 5JI3E 1ZM7A 1Z2CA 3I73A 1XEWY 1KNQA 4TLBA 4AYTA 4TQAA 3HU1A 4Q48A 1E9FA 1FNNA 4AC9A 2YC2C 4J0QA 2JEOA 2WPDA 1Z63A 4PFSA 3HYTA 3K70D 1UBCA 4PHTA 3GLIE 1S4QA 1M1YE 2ZYTX 5BYKA 3KKNA 3KTAA 3LBHA 2JLSA 3UPUA 3W8RA 3UWKA 1UKZA 821PA 2F9MA 2ZI5A 2YVUA 1GL7A 2HXYA 1KY2A 1Z5ZA 3QEOA 4OHZA 2O0KA 3UIEA 3EA5A 4BFTA 2GEVA 5F98A 1EWQA 2VHCA 3LV8A 1PZNA 2PX0A 2ZRFA 3A8TA 3Q5DA 4FWIB 2GBLA 1GRRA 4TLCA 2AFHE 4D82A 5K8TA 5D3MA 5EP4A 3PV0A 5DH9A 2WZQA 1DAMA 3W6PA 5BXQC 2YWHA 4DIDA 1VYTA 4LYHA 5E7IA 1JB1A 1EXMA 4PTLA 5FL3A 2AFIE 5DYIA 2ODEA 2ZROA 4KSBA 5LB4A 2WWHA 2Q9CA 3I62A 2JATA 2GHIA 1NJFA 5KTYA 1YJ5A 3A4LA 4IOMA 3ZIAA 4O25A 3VNUA 3C5HA 3Q5EA 1U8YA 1E2GA 3ND9A 1V43A 4DCNA 5EXSA 3I8XA 2QM8A 1XD2B 2QMEA 2D7CA 2VSXA 2ZJZA 3MWYW 3CH4B 4A1FA 4DLYA 2NZ8A 4QL3A 2GESA 3S1AB 1F2TB 2ZYVX 4LDJA 4JKYA 3KFVA 3LFUA 5CIWA 3EASA 4JLMA 2G6BA 3Q3JB 4Z1MD 2CLSA 1US8B 3SC3A 2JIZA 3C5CA 4LJ8A 4L8GA 3WMEA 5A0FA 4LBVA 1CIPA 3P20A 5EXTA 3RC3A 5G3YA 1E0SA 3K0CA 3Q72A 4OJKA 3T61A 8OHMA 2IUSA 2QN6A 5JHGB 3KTAB 1LS1A 1UBEA 4C9BA 1UKVY 3UMSA 3NH9A 5LB2A 4Q47A 4F7WA 4FI3C 4ITRC 3B82A 1AKEA 2WBLC 4X8MA 1OLOA 4D0LB 3OAAD 2FZ4A 1UEJA 2HCJB 1U90A 1JJ7A 4G5QA 2XXAA 4CEJA 3ICQB 1K5DA 1OV4A 2WKRA 4TT3D 2ANBA 4BZXA 4PQRA 5FUYA 3GLHA 1U8ZA 2ZQ5A 4YMWA 2H57A 3KXLA 1LF0A 1H8HA 1K5GA 1UFQA 4M1OA 3P4YA 3I72A 4TLAA 3TW8B 2B6HA 1MABA 2R6AA 1Z08A 3C16C 4MUAA 1R8QA 4DDTA 1F48A 3MG9A 4OKSA 1NY6A 2B7CA 4BPBA 2NOAA 1ZNYA 3U7FB 2ZU0C 4HLDA 3REFA 2QP9X 3SJBA 3CZPA 1WE2A 4MKHA 4ABYA 721PA 3KKOA 3TW4A 3ZLJA 1CR2A 1Q1BA 1XXHE 3KB2A 3QE0A 2CL6X 5G53C 1JECA 3KFXA 1HE8B 4JT2A 4M21A 4YDHB 3HR7A 4B2IA 3AUYA 3A37A 3THWA 2X19A 1QHIA 1IXSB 5J5CA 4QHSA 3TR5A 3TR0A 5TY0A 3GQBA 4WZBE 1ZD1A 1CBUA 3V4FA 1KSHA 2OBNA 3BD9A 1EWRA 1NN1A 3DO6A 1W36D 2JIZD 5DE3A 4HYYA 1G17A 4NYIQ 4TYWA 3GEIA 5AJWA 2W6JD 4A0FA 3P4XA 4PC1A 3FMOB 3F8TA 5CJPA 3K0SA 1OJLA 4AKGA 2MSDB 3AGPA 5F9FA 4GZLA 1KO4A 1Q1EA 3I5XA 5EP3A 5FL7A 2RCNA 2CBZA 2ZS7A 4QJ5A 2V55B 1YR6A 3GD7A 3GEEA 4MKIA 4BLTA 4AI6A 4NCJA 4D25A 1ZNZA 1SXJC 1W4AA 2N46A 2Q0HA 2J87A 5G41A 1JXOA 1MRSA 1UPTA 2EVWX 2XXAB 3REGA 3WBKA 4CEJB 3I4LA 2B92A 4CF7A 1OHHA 1TNDA 2IHBA 3RS4A 3FKSA 4DEYA 3GLHB 4HLUA 4EQ6A 1G8YA 3AKEA 4B2PA 4RD2A 4JLJA 3JZAA 2PZEA 1ZBDA 1FUKA 1MABB 4DBLC 5CITA 1X86B 1XMJA 4JVLA 3RHFA 3UG6A 3QXCA 3CX8A 2QRNA 2WJVA 1EG7A 5IRCD 3KJEA 4QM7A 2NPFA 3ADCA 4RFVA 1OSNA 2GXQA 3QKUA 3WYFA 2GCNA 3WYGA 1CKEA 3ZZ0A 1RRFA 3F0TA 4TL7A 4UKDA 1G5RA 3QSYA 2ODWA 4ZDKA 1E9BA 4GOKA 2NZJA 3X1YA 1MO5A 1HE1C 1IJEA 3PUYA 5CYPA 5JJKA 3IBGA 2FZLA 4XIGS 3EG5A 4JVMA 3IGFA 3KQUA 2OM2A 2REXB 1HA3A 4DWJA 3WYAA 3ADDA 3PENA 1N6LA 4QNRA 2FA9A 1U2RA 3MMPA 2LKDA 3GLGA 3FGNA 4IKEA 3FMFA 1A2BA 3WHKA 1NVXQ 3IILA 3FMIA 2XZLA 4DUGD 4JJKA 2RGXA 4F4IA 1EFRD 2BWJA 2BBTA 2HT6A 2Z5FA 5B30A 2ZM5A 5LD2C 1VIYA 2FG5A 5GJWC 3ZS9A 4EPRA 1AJEA 3I5YA 4GRAA 3O8CA 1BYUA 1II0A 4RZXA 1TL7C 2W83A 2BJWA 1SULA 5SZJA 4M1SA 1B0UA 4ZKEA 2ZETA 4Q9IA 3CIOA 1DAGA 1AGRA 5HKKA 5JS7A 4F93B 4EQ6B 1NG1A 2QMUA 2DYKA 4G5SA 1MKYA 1W0JD 2FMXA 2CHVA 2IF2A 3QI2A 2GZDA 3KQLA 1TQ6A 1VPLA 3THYA 2F6RA 1EGAA 3BH6A 2J7PA 3FHOA 3EPJA 1DAKA 1DAFA 4AKIA 2QPAA 3K0AA 4BWYA 1NLYA 3UATA 4XJXA 3FTQA 4D4JA 1RVDA 2BM1A 1M7BA 1JPNA 2J59A 2JA1A 4AY2A 4M1MA 1T6NA 2HYIC 2O8CA 3ZVRA 2O5VA 3RRMA 4YC7A 3QF4A 2QE7A 4TQ9A 5C46F 2GKSA 2ASEA 2ZJYA 3GLHE 3UG7A 2QBYB 3Q7PA 5DSZA 1NNEA 5BW8A 3SN6A 1QHYA 4A4DA 3QXJA 1E32A 1U81A 3GLGB 2GJSA 3D6TB 2OCPA 4X8LA 1I2DA 4P4UA 2ZYUX 3LVRE 3EARA 1E99A 1DE0A 2MMCA 3T34A 5LPNA 4XTRA 1U94A 4M9SA 1Z0FA 1FNMA 3NEJA 1NIJA 3GLFA 2V7QA 2BEKA 1AQUA 1G1MA 4IW3B 1MO4A 4X8OA 3CZQA 4GDFA 4YDSA 4LYFA 2ONJA 4OHWA 2CCKA 2GXSA 1VTKA 1YHNA 4HAWA 5HE8A 1YR9A 4TL9A 2WV9A 1J2JA 4NCIA 2GETA 3U61B 4KFTA 2IXEA 1R6BX 2AKAB 1FL9A 4KFUA 4LSGA 3G5UA 4A8JA 2W0MA 3VKWA 4D6PA 4W7SA 3ZVMA 2OFWA 3U44B 2I4IA 3BFVA 1EFHA 4PXAA 1IN5A 2CCGA 1VG0B 3THYB 1FP6A 3CRMA 3NXSA 3OF5A 4TL8A 1Q0UA 3K09C 4LJ5A 2CE7A 2IC5A 2D2FA 2FF7A 5DN6A 3U7GA 2D62A 2XAUA 3W90A 2WSMA 3VTKA 2ZUCA 4HDCA 4ZIRA 1P62B 2A5FA 4RSGA 2WWGA 1OXTA 3AH8A 3DM5A 5FPHA 3IPXA 4G5RA 2YOGA 4D80A 2O8EA 1CJKC 1DVRA 1KK0A 5CK4A 4Z51A 2HUPA 1G18A 4PZLA 3QF4B 2ZANA 4PZYA 1YVDA 4NTZA 4NCKA 1XTRA 1SVSA 2NO7A 3PFIA 4S35A 1QDEA 1NMXA 1FTNA 2QROA 2QT1A 4LJ7A 1E9DA 3WNBA 4YMTA 2VP6A 1XB2A 4ZDIA 3SJCA 3B85A 2D06A 3T1TA 1D9XA 1IN4A 1HT1E 2WHXA 3ADBA 1JJVA 2JLQA 3A1WA 3GMTA 2R65A 4KODA 2XTZA 1NG9A 3GCGA 2I3BA 2BBOA 1W36C 1Q12A 1KZ7B 3KJIA 4LZZA 4N1AA 4PO8A 4WAUA 3T1OA 4B3GA 3UXMA 4B73A 1J99A 1RZ3A 3BFKA 4K46A 3LLUA 3IPYA 4PR0A 3GLFB 1D6JA 3D3QA 2BEJA 1U98A 1FMLA 5GJVC 1IAQA 4B3XA 4BUJA 2OUKA 1HUQA 1P9NA 2RHMA 5EE3A 3VR2A 4B43A 1ZM2A 3GJ6A 3EZ7A 3PJRA 4KAXA 4M9ZA 5HCNA 1YRBA 3V00A 4A8JB 1G20E 1HEIA 1OXSC 3QKRA 2JCSA 1R0YA 1HY3A 1P3JA 2FEOA 1FQKA 4FD2A 3BE4A 2WWWA 3TVDA 2GZHA 4GP6A 1S9DA 4F4JA 2J46A 5HZHA 3CBQA 4GT1A 2QI9C 2JGNA 1Z47A 4MRVA 2GZAA 4C30A 4JS0A 4MH0R 1UDWA 5IT5A 2PJZA 1CR1A 1L8QA 1XCGB 3B2EA 3C41J 4R7ZA 3EIQA 4ZIRB 5DNYB 5DGXA 4L5BA 1E4YA 3WBJA 2YZ2A 2RGDA 5CB8A 2ZI7A 4GPTA 2V54A 1QG2A 2AWOA 3BOSA 5DI3A 1N6OA 2O8EB 4NBSA 1P2TA 3CF6R 1NN3A 4JLKA 4TLEA 3THXA 5L3RA 4XWAA 1SGWA 1W48A 4M9QA 4NZYA 3VR1A 1YR7A 2YWGA 3HDTA 4PSKA 5EP1A 4F92B 1ONBA 1XTKA 4CGZA 2XEXA 2D74A 4O0MA 3EAQA 2CNWD 1NBMD 4A0HA 1R2QA 1E96A 1E2MA 3K9HA 3KXKA 3VU9A 1P60A 3BRWD 5J40A 2ZRHA 1JALA 3CRQA 4IVRA 3VNVA 1OKKA 4B48A 1CR0A 4DB4A 1JAHA 2V3CC 4PSAA 1IN7A 2XOKD 4A0GA 4ZDJA 5FTNA 1VCMA 1W2HA 5C18A 1J90A 1XF9A 2OEPA 3MGCA 3L0SA 3MCAA 1PLJA 3RAPR 1JXMA 2BMDA 4C0AC 2JASA 2IL1A 1KSFX 4KLZA 1YZUA 2QNRA 2WJJA 1VIAA 2F1JA 1OH5A 2WOJA 1HT2E 3QKRB 5JCPA 1COWD 1TEVA 3TRFA 1N0VC 3OE7A 4BFSA 3OEEA 5TARA 4IDPA 4LRWA 3VR3A 4NKRA 1Z6YA 2PZFA 4URYR 1Z8FA 5E95A 1ZC3A 1ZD9A 1HYQA 2MSCB 1GOTA 1SVMA 2PJRA 1LV7A 1GRQA 1T8UA 3WNCA 5AR1A 4LPKA 2BIFA 3ZZTA 3DMDA 3K70C 2LCFA 3P1JA 1N25A 2OSBA 1QRAA 2EFDB 5DI3B 3B8HA 1M34E 4Q21A 5DO9A 3T1QA 3X1WA 2HDNB 4ZI2A 3FFBA 3THXB 1KJZA 1GL9B 4LUCA 1IHUA 3LX8A 2YKGA 2F1IA 3LBNA 2XX3A 2Z43A 3I92A 4LV5B 2ODBA 4QBGB 4Q4JA 1FW6A 3D8BA 2ZYWX 3KL4A 2FE4A 1W1WA 1LY1A 2VPPA 5SZIA 1CS4C 1R0WA 2YJTD 2VSFA 2E9SA 2JLRA 4PC3A 1E6CA 1KI9A 5CLLA 3VU9B 2F7SA 4BFVA 2UKDA 1D2NA 3IQXA 5LDDC 1E4VA 2ZS8A 3U3KA 1Z6TA 1MO6A 3NC1C 2OLKA 3ZVLA 4JZKA 4B6FA 2ZJBA 2B8WA 2FGJA 1AN0A 4JBXA 4TWZA 2ZVPX 5GADl 2JJ1A 4AKHA 4YONB 1AGPA 1N5JA 2IYQA 4B32A 4TTRA 4EJSA 2W0SA 2YNMA 1Z2AA 2FV8A 4A2PA 1R5NA 2IYUA 1F2UA 2ZJOA 1HQYE 1KJWA 2W2VA 5C1BA 3QIAA 3U5ZB 1N3BA 2ZI6A 4FWTA 4QBIA 4V0MA 3FHTA 1E2NA 221PA 3LRPA 3AGQA 5FPYA 3VMFA 3QPUA 3VFDA 3T12A 4PAQA 4TMXA 2R62A 4IOJA 2WJYA 3FWYA 4IDHA 1G7CA 1XMIA 1KI2A 1XXHA 2PH1A 3C7KA 3NEYA 2CEAA 1F3OA 3QXSA 2J41A 4IJMA 4OK6A 3F3YA 3AUXA 3K0FA 3VX4A 2X8AA 3ASZA 5FR2A 5FH9A 2YWFA 3M1IA 2BMJA 4BLRA 4NYMQ 2C03A 5J4LA 2K5UA 3AVUA 5FOXA 1X1RA 3ECCA 2P6RA 2G83A 1A4RA 3MWJA 3U6BA 3IO5A 3E1SA 4BE7B 1VCOA 4EIWA 5CIQA 4JBWA 3CR7A 2FOLA 3E2IA 1XJ0A 2ZI4A 3OIUA 1Z6AA 4FW9A 2R6GA 4EPYA 2JJ2D 4NYMR 1XD8A 2J1LA 3ADKA 4JL5A 4NP6A 6Q21A 1CULC 2TMKA 3RS5A 3AVXA 1NVWQ 2QSZA 3AVOA 4YMSA 4HB3A 2GK6A 1CP2A 4RY2A 3SYNA 1YU9A 1G21E 5JEEA 4A15A 4DB2A 4ILEA 4L9WA 4JIMA 1HH4A 2ORWA 4Q19A 3RS0A 3O47A 4ZI3A 1A2KC 5JZVA 1ZIOA 2ERYA 4O3MA 4DCSA 1HV8A 4P4SB 3QG1A 4EJSB 3NHAA 2OT3B 5FOTA 3SJAA 3VR4A 1GILA 1KMHB 1TU4A 4V0KA 4JYBA 4V0OA 1D8TA 4FCWA 1P7CA 1Q22A 3TQCA 2CL7X 3W3ZB 5H8WA 1ESMA 1IM2A 2GJ8A 1F2UB 3IKJA 3FE2A 5AJYA 2OXRA 4W5HA 2VIIA 5GJCA 3QXXA 1H65A 2C9OA 4TSFD 3TQFA 5EE0A 4DRZA 3ZDQA 2Q3HA 1KDTA 2XSZA 4L4UA 3ICEA 1SVKA 4B33A 5ELXA 1EX7A 1KHTA 3EPKA 1W4BA 4ZCIA 1XXHB 2W6IA 3NH6A 5F2EA 1N0UA 4BFZA 3ND8A 3WP1B 2VH5R 3K0FB 1TAGA 1U0LA 1CTQA 2BCGY 3TBKA 1E3MA 4OI2A 4US1R 1SHKA 4UNRA 4L9SA 4RKFA 4TTPA 1WB9A 1O3YA 3TVTA 2FN4A 2VO1A 3W3AA 1NRJB 3UKDA 4CDGA 1P73A 3L43A 3LAWA 2H7VA 3IIMA 5FPSA 4DHEA 1E1RD 3EC1A 4MGKR 1S3SA 4P4TA 4F38A 1IY0A 3BH7A 1H8ED 4PC6A 1GM5A 1XRJA 4WA7A 4O2LA 3A1TA 3NBXX 2C9CA 1RRPA 4ZO4A 5AUQA 4CT5A 2X77A 2LKCA 1E79A 3FKQA 4LC1A 4LHZA 3SJZA 2FH5B 1KI1A 3SFVA 2DHRA 1E1QA 5HR5A 4HI0E 3RSLA 1JEEA 3OEHD 2QP3A 5GVSA 5DLQC 1TMKA 1XCMA 4I1UA 1XTSA 3DM9B 3GJ5A 2ZUBA 2GXUA 3KQHA 2G1KA 3EZFA 4Q02A 5HCIA 5DIFA 2V1UA 4RD4A 3LW8A 5EXPA 3X2SA 1QHNA 2HT1A 1Y3AA 5EZ6B 1ZYUA 2WPDD 4A2WA 2FSHA 1BMFA 3BJIC 1S1CA 4N0DA 5CDFA 5JMTA 4EPTA 1CJTC 2R44A 2BJVA 3EPLA 2FSFA 4TZ6A 2VEDA 2OILA 1DAEA 3VX3A 1R4AA 4XSGA 4DSUA 2IS1A 4Q03A 3SNHA 3OFNA 1YZLA 4DSOA 1CF4A 3OHMA 4Q7JB 4Q1EA 4BLOA 4D4LA 2GEDA 3RDPA 1DG1G 3BORA 3SI7A 1P61B 2KE5A 5D3MB 2A5GA 4HZIA 3WMFA 2QU8A 4CIDA 3A1VA 2ZE6A 2C96A 1NI3A 2PX3A 5TV2A 4ESHA 2V4ZA 4ERNA 4C0KA 1S1MA 3VKHA 2AXPA 3EIEA 1AZTA 2O8BA 1Z0AA 3TUZC 1VHTA 4MDEA 2E1RA 3SBDA 4LHXA 2ZAOA 3AP3A 1YZQA 1N0WA 1DOAA 5FR1A 5K8IA 1LVGA 2XJ9A 3PUZA 3SDZA 2ZRMA 2ZJ8A 4TN1A 4C0BA 1TPZA 2ZE7A 1VKJA 3QJYA 3EZ6A 4R2IA 4HUTA 2DFLA 4WBSA 1KMQA 2DFTA 2L0XA 3ZIAD 4V0ME 4C3ZA 4LBYA 1OFIA 2JDIA 2ZVQX 4V02A 2YV5A 5K8LA 4NE2A 3BC1A 3KQNA 1NVVR 1N5IA 2WOOA 2ZXUA 2RGNC 2DPXA 2XNDA 5KSOA 1JBKA 3AEZA 2GRJA 1GITA 1SKQA 1P2SA 3B78A 1VCNA 5FI0B 1ZINA 1E1QD 3TUIC 3AP2A 4KO8A 2BKUA 4BZQA 4JVSB 4BLSA 5L3SA 3QNUA 4D4KA 1X8LA 4C2TA 5H1YA 3RWOA 3B60A 4M22A 4DC9A 4EAQA 2P2LA 1GVNB 4Z54A 1VG9B 1T9HA 2GAAA 1UKYA 4URUR 3LQQA 2WWFA 3RANA 4DEXA 1IOZA 2GAOA 4H1VA 4K81B 1Q1QA 1TQ4A 5E7MA 5KDDA 1JR3A 4HZUA 3CH5A 4G01B 2Q9AA 3L0OA 4M0LA 5FTJA 5FUWA 4BQSA 2KWIA 4JKIA 1BH2A 2ZRLA 5CM8B 2FSGA 3NWJA 5KPDA 2ONKA 1E2FA 1BS1A 4TTQA 1JR6A 4I1OA 3NHBA 1OW3B 2OBMA 3PITA 4KBGA 4Q1BA 3W5JA 4P31A 2DFNA 2WSSA 1VECA 5FTMA 1P75A 3O8BA 3PEVA 4Q4HA 3IBYA 2ZRAA 1HURA 1M7GA 1U9IC 2ZTSA 1LB1B 5F9HA 5FBRB 4XTCS 2O8BB 1RIFA 2QPOA 1CR4A 3SE0A 1DELA 1XMVA 1H8HD 5FPKA 2D2EA 2CK3A 2QENA 2Y8EA 2N42A 4QM6A 2Z4SA 3VR6A 5EUQB 1N6RA 2VF7A 4GFDA 2CVHA 4KHZA 5B64A 4DLWA 4EFLA 1F6BA 1L7VC 2QRZA 2J45A 3EA0A 1P9WA 1SKYB 1XPUA 4LJ4A 3W34A 2IT1A 4JSYA 3NBYC 1KI3A 4POAA 2QAGC 2PBRA 4LOAA 4ZDWA 5H68A 3Q8XB 1VG1A 3TAUA 5KNCA 2ORVA 3THWB 2J5XA 2FFQA 3MWKA 1W0KA 2R6CA 2QTHA 4RD0A 4C0LA 2A2ZA 3QBVA 4Q9KA 2FFBA 3KB1A 2RGAA 4GBMA 2BDTA 2ATXA 4MUBA 3I3SR 3Q85A 2X1VA 2BV3A 4HSEA 3ZS8A 4TMZA 4Q01A 4QGFA 1XWIA 1ZCBA 2VHJA 4MYHA 1ZCAA 4KI0A 4D2IA 2OCYC 3AB3A 4LGMA 3I32A 2QY9A 1JQLB 2ZU6A 4DDVA 3B5JA 4LK2A 1XJCA 2RGCA 2Z83A 5FL7D 3TNFA 2ZSFA 3TE6A 4QNMA 2WVJA 3VHXA 4U7DA 4LBZA 3HU2A 3U7EB 2FFAA 2O52A 2G0TA 3R9WA 2QQ0A 2G0NA 2VHUA 3R8CA 3RSOA 3O8RA 3GP8A 4RCZA 4EUNA 4DDWA 3U2QA 2PT7A 4QGAA 1WXQA 4DKXA 3DHWC 3ONWA 3IQWA 4AG6A 1GFIA 4D0NA 4Q4HB 4I81A 4BFYA 1LNZA 2QAJA 2FJUA 2ZEJA 2P3SA 1OHHD 1GKYA 1II8A 1WP9A 2KBFA 3FKSD 3K0EA 4GI7A 4LPSA 3VQTA 2HV8A 2YINC 4Z8YA 2D7DA 3GJ0A 1GKUB 2NPIA 5FBVB 3LY5A 1E98A 2HLDA 1QF9A 2V1XA 4IEIA 5IK2A 4OK3A 4URVR 2IYLD 4H1UA 4XD7A 5SZKB 2ATVA 5CDFE 2AL7A 4MDFA 3H84A 3FVQA 5B2ZA 1NL3A 1A82A 3IO3A 3IIJA 1P2UA 4UJ3A 4TL6A 4QJ3A 2IA5A 2ODNA 1R5BA 4R9UC 5IDVA 2G77B 3VHLB 1E9CA 4HLCA 4XOIA 3CONA 4MITA 2PLRA 2D4HA 4E07A 2PCJA 4R2HA 3BB3A 4HATA 2Z4RA 4M8NE 1A7JA 4KCGA 2DWPA 4JBYA 1VDZA 4W5WA 2VHQA 4A2QA 1EX6A 2QUZA 3K53A 4B3FX 2G88A 4ZKDA 4MYUA 4OL0A 2Z6VA 3WP0A 4KLNA 3ZVNA 3R8FA 2VTKA 4B35A 2IUTA 3T5DA 4DZZA 3G0HA 1Z29A 2ZAMA 3CF2A 4US0R 4UNQA 1JI0A 2G3YA 1OXUA 2AX4A 3C8UA 1Z6GA 5EE5B 4YXWA 5TVKA 2BKEA 3WRXC 2RGBA 3TMKA 4Q4LA 4ZPXA 3M6AA 2QGNA 4QHTA 1G5PA 4JLOA 1UBGA 1XX6A 1SKYE 3B7GA 3B9PA 4HUQA 2QORA 3WY9A 5FBLB 5GVRA 1FPMA 2PCLA 2VSOA 4II7A 3V4RA 1QHXA 1XZQA 1AKYA 1E0KA 4M2LA 4L16A 3TAHA 3U4QA 1GAJA 4FCVA 1A5TA 1OIWA 1EFCA 1MT0A 3LQRA 4NCNA 1II8B 4PC7A 1TF2A 2OXCA 2PMDA 5HKKD 4AIIA 2SHKA 3B13B 2GXAA 3NDPA 1QHGA 1NN0A 4XVQA 3PUWA 5AK0A 5A5GA 2C04A 1KZGB 1N6IA 2WICA 3AVYA 2GBLC 2PLFA 4N3NA 2XZPA 1KO7A 4XD7D 1KSJA 4WVFA 2H5EA 1KY3A 3K0AB 1JR3E 1RKBA 3AF3A 2PEZA 4ON9A 2QTVB 2J7PD 4MQBA 3R9IA 1Q21A 2B8TA 2KBEA 4NONA 3RRZA 4CEHA 5JWHA 4OI1A 2IWHA 1ODFA 3P32A 4OBEA 4DLZA 2EFEB 2O8CB 2P0EA 2FPLA 4GL2A 3FB4A 5AWFC 2OHFA 4PQYA 4R71A 4URXR 5DI9A 3DOEA 5J4HA 2FPMA 2NO1A 2IXFA 4E09A 3PIRA 4B3BA 1KI7A 2F3RA 1GKIA 2QA5A 1S96A 2QE7D 3L0PA 4Q9LA 4DJTA 1EFTA 3AF2A 3QBTA 1L4YA 5JRJA 2ORIA 1EFUA 1W46A 4OHYA 4B74A 1O87A 5UKDA 4XSHA 2RKOA 1E2EA 2NGRA 1ZM9A 3DMNA 1Q44A 2EU8A 1VHLA 3EC2A 1ZUNB 4IFBA 2VA8A 2FFHA 5BYJA 4B75A 3DOFA 4PX9A 1AM4D 1OXXK 4KVAA 4YXWD 3QPVA 3GFPA 5JI2E 1ZJ6A 3NDBB 5IF9A 121PA 4HUQB 3LO5A 3A58B 2NMVA 4JL8A 4HB4A 1MH1A 4MA4A 1JNYA 4A0RA 3B1ZA 2V7QD 3H86A 2GNOA 1Z22A 2CDNA 1E0JA 2FGKA 3RWMB 1XZPA 2BCJQ 5JSZA 4Q18A 1R0XA 3A4MA 3U4QB 4MYTA 3W6OA 1CJVC 3H1TA 3LXRA 3H0KA 2OAQ1 4DLXA 2JLWA 4TZ0A 1TU3A 4KV9A 4OJQA 1ZU5A 1ZP6A 4QBFA 3T1VA 5BN5A 2J0QA 5FUVA 3ZYCA 1WRBA 3M4YA 2IS6A 5G3ZA 5EXXA 1VYVA 3BERA 1GNRA 3CRW1 3QOFA 4I99A 4EPWA 2REBA 5EE9A 1YZGA 2IXGA 4YQFA 4HDOB 4LWZA 2R6FA 5L3VA 5DN6D 4CEHB 3ZD6A 4PHGA 1XDBA 1S0UA 5ANRB 1PLLA 3U7HB 1P2VA 1W44A 1YQTA 2KJQA 2QZ4A 2RB4A 1P6XA 2MSEB 2YHSA 3CPJB 1T5LA 1P4SA 5KSPA 1HTWA 3KKQA 2ZJAA 2CJWA 2F43A 4DCVA 4TYNA 1DAIA 1XEWX 3FDIA 3DZDA 2ZJ2A 1TTTA 1LF5A 4DSTA 4IRUB 5H70A 3PUXA 1T8TA 2IYXA 5JJIA 2EYUA 1U99A 2P6NA 5B57C 1RRGA 1DS6A 3A1SA 2Q21A 3MAAC 4JLPA 2ZIAA 5P21A 1I4LD 2CE2X 1ZW6A 4B34A 4DCTA 1G5TA 4LY6A 1T4GA 3LW7A 4M1YA 3CX7A 1J8YF 2HJGA 2YOFA 4LI0A 2VHTA 4ACBA 4BRUA 2CCJA 2ZRKA 3HU3A 5JSZB 5JECA 1AIPA 4A82A 1ZM4A 4Q4AA 2AK3A 1YE8A 4HDQB 5E4FA 2YWEA 4DLUA 1NY5A 1WQ1R 1FTSA 3K9NA 1ZD8A 2IK8A 3AKYA 3K9GA 5EP2A 4LJAA 3ZQ6A 5TXGA 2WIAA 1SZPA 4O2RA 5C4GB 4BECA 3LLMA 3NBFA 4YLGA 1T3LA 3SBEA 1SXJA 3QF7A 1KAOA 1E9SA 4C0SA 2IW3A 3R20A 5EJEA 2C8VA 1IXZA 4JL6A 4MRSA 3BBPA 1IY2A 1MR3F 1T0JB 3A36A 2W00A 3HP1A 3N2EA 2QSYA 4PPQA 4HAVA 2WIBA 1N6HA 3K1JA 4FINA 1K6MA 5G40A 4EFNA 1XFAA 1VMAA 2O8DA 5J47A 5KO2A 1KDRA 4RD6A 4ASUA 4IDNA 3WRYC 1KOFA 5KNDA 4K8OA 5HE9A 3ZZUA 2RHDA 2BC9A 4AYXA 5FPTA 4UNPA 4B76A 2IX3A 2CJWB 3EIHA 1FOEB 3BFXA 1KI8A 4B6EA 5DISB 3KQKA 3AKDA 2C2HA 2O0HA 3WHLA 2H1LA 4XH9B 3OESA 1R7RA 1E9RA 3C15C 4HEJA 1OH7A 1UBFA 5C2JB 2NTYC 3MJHA 4MGZR 5KU1A 4JMPA 2ZE8A 1U8AA 3EX7C 1G19A 2P6UA 3GEHA 1K8RA 1KK2A 1OKKD 3C14C 2IYYA 3OIVA 3EZ9A 4UJ5A 1WDTA 3RC8A 2E87A 4LCBA 3B1XA 1G3MA 4DCUA 2VP4A 3R9XA 1QZXA 2CHQA 2O8FA 3NBZC 1M6NA 4DXAA 4EPVA 2V6IA 3R7WA 3CF0A 4BFXA 1IXRC 5KDOA 4Q4AB 1ZAKA 3DKVA 1WBDA 3X1DA 3JZMA 1CRQA 2CLCX 5JS8A 3SEAA 1D2MA 2DWQA 3KXIA 1C4OA 2J3EA 2ZRBA 5EE1A 3OE7D 2XB2A 1W4CA 3OEED 1YZKA 4D0GA 4ZCLA 3SQWA 5FTKA 4HLQB 4LX0A 3L82B 4FMBB 1SXJB 1WBBA 5KUTA 3A6PC 4MRNA 4BASA 5FTLA 4W9MC 1B23P 3FYHA 1E69A 2MMGA 2XGJA 1IN8A 2OFOA 1OE0A 4JLVA 3ZQJA 1G8PA 2O8DB 2A7QA 5AUNB 4US2R 3AKCA 1WF3A 2QMOA 3BXZA 1U0JA 1XD9A 4KFRA 3J81k 4Q4JB 4QFMA 2NG1A 4UNSA 1IONA 1KJYA 3L0IB 2GWHA 3V9PA 1E2JA 2BOVA 4OQXA 1ZM3A 1NVUQ 4Z8XA 4AURA 1V5WA 2OCAA 4Q9JA 5K8UA 1Q20A 2ZE5A 4FCTA 4B3DA 1KDOA 2QM7A 3WNDA 3A4NA 4GOJA 1XCPA 4DSNA 3CRVA 1EK0A 1TQDA 1VCIA 4P33A 1GTVA 5FFMA 1KKMA 4I1SA 2ZPTX 3JVUA 5JLJA 1G3QA 1N5KA 2DFKB 2P65A 2FNAA 1E94E 2ZR0A 2JJ1D 2ZRIA 1ZUIA 2FU5C 1E2HA 1Z0KA 2O8FB 3CNOA 3VAAA 4C0QC 3AVPA 4M9XA 2I1QA 4B3CA 1UM8A 5B58C 1Z6XA 2JJ8A 1Z83A 4Z1MA 1XPOA 1TQ2A 1XEXA 4A9AA 3L8ZA 3L2OB 3MUFA 2XNSA 4R98A 1NIPA 3KKPA 2WMOB 1US8A 5FOUA 3MRSA 2DR3A 4UNNA 2WM9B 4H9GA 2A78A 3TH5A 5LD2B 4M1WA 5KSYA 5M04A 2R8RA 4IHQA 1KI6A 4QGHA 2BMFA 1GL6A 1HQCA 1NN5A 4FMCF 1VG8A 3TSZA 1OT3A 4A8JC 4PPGA 3QKSA 2VP5A 4TMKA 3TGPA 2JLYA 2GJ9A 2DB3A 1SVOA 1N6KA 4EFMA 2O0JA 1OPXA 4XVUA 4IXNA 2AR7A 3I61A 1X8KA 1PV4A 4Q7KA 4B71A 2IEZA 2OBLA 3OAAA 1W2GA 1S2MA 4XVRA 2C98A 3GFTA 2ZUDA 4G5OA 5KYKA 4BEBA 3BH0A 5EQTA 1AZSC 3LVQE 4TT3A 3LA6A 1G7TA 1L4UA 1G8GA 3SOPA 4B47A 2QT0A 1E2QA 4E5UA 1FP7A 5KPJA 2HF8A 1CU1A 2XTMA 2ZSEA 3K09A 1ZNWA 4IDQA 2P5TB 2QPTA 4YMVA 3NTUA 5AJZA 3WMGA 3U3OA 2OAP1 1FX0A 3H2YA 2JLZA 4TMTA 4D81A 3RS3A 4DLRA 1W4RA 1SXJE 4Q9HA 1MOZA 4JLBA 3TIFA 2BVNA 2ZRDA 3ZD7A 1R0ZA 4M1TA 4NPHA 3QXHA 1J7KA 2FX3A 5CK5A 1FUUA 2AD5A 4FIDA 4X8HA 1KK3A 1N2CE 3F5FA 4LYJA 4AG5A 1CLUA 2J7KA 3QPWA 5FBWB 2YYZA 2WAXA 1XEXB 3PCRB 2BBSA 3G82C 3THOA 1Z0DA 3W5IA 4GMDA 3U3JA 3KJHA 2XSZD 3HJNA 2OLJA 5JFGA 4TMWA 2IS2A 1RJ9A 3E5HA 1G9XA 2W6JA 4BLQA 1PUJA 1KK1A 1KI6B 4F91B 1GNPA 3UWOA 3KZ1E 2A5JA 2W6ID 1OH6A 3PEYA 1NMZA 2ZSBA 4G0NA 4P32A 4FMCB 4D4MA 5KHOC 2FWRA 3L8YA 3QKSB 3BIFA 2OE2A 1NKSA 1GDDA 3I8SA 3NC0C 4OQFA 3CNLA 3RRNA 2QGZA 2AHOA 4Q1AA 4CRWB 1NVVQ 1KI4A 1NJGA 2HYDA 2EWWA 4MRPA 4IDOA 4U00A 4ACAA 1G41A 2GCPA 2C5LA 4BFUA 4C0JA 3BB4A 3T5GA 1OF1A 3GJ3A 2LWIA 1Q57A 4BGDA 1SHZA 1PLKA 1FZQA 2EFHB 1S8FA 5JWRA 4A6PA 5L8VA 2ZI3A 2WMNB 3QY0A 2ZR7A 5DYGA 4OI4A 3ETLA 5TDHA 2GVDC 4KYIB 1SVLA 3LH5A 2ZS9A 1ELOA 1FX0B 1TADA 3B6EA 2GILA 5J4VA 1E79D 5AJXA 3DVLA 1ESNA 5KNBA 2A30A 4M1KA 1N5LA 3GJ7A 1AA9A 1R10A 1NSTA 2ECKA 1NP6A 2V6JA 3DEFA 2G1JA 5SZHB 3U3MA 1R5OA 2WAYA 2J0SA 5CYOA 1OFTA 4NH0A 5BN3A 1KKLA 2YC4C 5L3QA 2IYSA 4QGGA 3IEVA 1W5TA 3CX6A 1T3HA 1G3RA 3MWLA 5CB6A 3T15A 3VR5A 2J0UA 3Q9LA 1SQ5A 1S9HA 4PANA 3BWDD 4D26A 4C4PA 1ZC4A 3IIKA 2BHRA 2IF0A 3AP1A 1GUAA 4XWKA 4RZ2A 1BMFD 2DBYA 4TLDA 2C99A 1X3SA 3QUSA 1RE0A 1IN6A 1IQPA 3QG5A 1W36B 2OZEA 3OFND 1RJ9B 1E0AA 2V8OA 4QOSA 1VYUA 2EFCB 3GJXC 5JWOA 4DUGA 4M4SA 1OIXA 2AD1A 1EFRA 1NKTA 1RFLA 2BMEA 4MYCA 2ZJ5A 3K9LA 1W49A 4HAZA 4Q66C 1SVIA 2NO6A 2X2FA 2GK7A 2Q6TA 2J9RA 2UVQA 2DWOA 3TSOA 1RC8A 2JAQA 1LW7A 5CM9C 4NYIR 3QEJA 3OIYA 4NU0A 2V9PA 4NL4H 1XTQA 3O8DA 4UXIA 1S3GA 5JRZA 2OCBA 2JLUA 3HWSA 5FI1B 1W0JA 2ZSDA 2JDID 1T0HB 4EKDA 1KGDA 4WW0A 3SU8A 2J0VA 2CHGA 2XNDD 2R2AA 1G7RA 1UDXA 1UJ2A 4QC2A 3AQ4A 2EQBA 4OQLA 4WZ6A 1UADA 1KO1A 4P3YA 3KUDA 3CKLA 1XEFA 5L3SB 1I2MA 4BFWA 1RRCA 4KBFA 2UZ3A 5L3QB 4OQMA 2X2EA 4JSTA 1ZUHA 4BZPA 3B9QA 3A1UA 3K8YA 2J0UB 3LD9A 4KXFB 4Q00A 3KJGA 3DL0A 4G1UC 4GSYA 2NO9A 3IHLA 4L15A 4V0NA 4PHHA 2OFXA 4HZUB 5J4KA 4C7OA 4C0HA 3QKTA 4RD1A 4EDHA 1JR3D 2OV2A 2VL7A 1II9A 3CO5A 1G4AE 4EJSC 1E2DA 2KB0A 1QHHA 2W2TA 1M8PA 2C95A 2QBYA 4CZ2A 4Q7MB 4IVQA 2C78A 2N1BA 1UEIA 3LWNA 4UQOA 3AF1A 3UK6A 2XB4A 1TUIA 4I4LA 1TEXA 2P5SA 4NDZA 3TJZA 3PEUA 1NLFA 2WSSD 1XTIA 4OI0A 2IHYA 1YR8A 1ETUA 3H4MA 2IS4A 1G6OA 1T5IA 4PZZA 3TKLA 2AK2A 1XMSA 3EWAA 1QHSA 4NMMA 1RW4A 3LDAA 1AS2A 2PMKA 4AKEA 3CNNA 2CK3D 1OYWA 4C2UA 2IWRA 2RGEA 4QRHA 4A92A 4WOPA 5BQ5A 1GP2A 4MKFA 2IBMA 1PUIA 1JPJA 2FSIA 1P9RA 1DO0A 5KDLA 3K70B 4OYHA 1PVOA 1Z06A 1E9AA 2A3RA 3U44A 2QEQA 2ZRCA 4A6XA 2FPKA 4HAYA 4WXRA 4PPNA 2QP4A 1DAHA 3JVVA 4PO9A 3QQ5A 3AVQA 5JEDA 4NCHA 3X1ZA 1XPRA 1W0KD 3KKMA 4AK9A 1IY1A 4IFEA 1F5NA 4JLDA 4UXJA 1LS6A 2KI5A 3IEUA 4UXHA 2VRWA 1XNJA 4QJ4A 2FDCA 3TUJC 2ZITA 2D3WA 2WKQA 2GJKA 1W47A 1WMSA 2R6DA 4KJZA 1Z3IX 4C7OB 1RYHA 3CW2A 1KSGA 3T06B 3CPHA 2RGGA 3SQXA 1F60A 1QHHB 1XJQA 5DHFA 3AVWA 2GVZC 1BO6A 1J70A 4KVGA 1XU4A 4MGYR 2XTNA 4RJLA 2IYRA 2H18A 2W58A 2PEYA 2I1VB 2EYQA 2FEMA 4PAMA 1NSFA 5A4JA 1AQYA 1ZRHA 1RYFA 5DHAA 4Q5IA 5BWMA 2AWNA 2HEIA 2Q9BA 4ZCMA 1BYIA 2B7BA 1TX4B 3DKPA 4TYQA 2CVFA 2P67A 2H17A 4MKGA 1KNXA 2QTFA 4RZUA 4LJ6A 3RVBA 2HLDD 4FN5A 5IK2D 1OB5A 3CR8A 521PA 2R9VA 2Q3FA 1I4TD 4B2LA 4RKEA 1NLZA 4QKQA 2DY1A 1KTVA 5E3HA 4MGIR 4CYMA 5FBQB 5JHHB 1W7AA 2GF9A 2GCOA 3GFOA 5E7JA 3UANA 1ZU4A
chains in the Genus database with same CATH superfamily
3GLSA 2WYUA 4RY0A 4EGSA 4HXEB 1XA3A 3TQSA 1YRHA 3TO5A 1MN6A 1O6GA 1GG8A 4Q37A 1WZEA 3QX3A 2P9CA 4FXPA 3R0JA 4F7DA 4YP7A 2EOAA 3ELUA 1T43A 4OA8A 3AKZA 2P2NA 1ZR4A 4H3HB 7ADHA 2R47A 5CBPA 3PQ3A 2WYIA 1SK9A 1SUSA 4ARIA 1W8DA 4ECEA 2XLBA 3R7LA 2C8LA 3AT1A 1Y63A 1ODLA 1ZOSA 3AIOA 4L8VA 3QHPA 5B7QA 2HCBA 2HL6A 3GCZA 2E82A 1JDPA 1P19A 1K4KA 1ZL2A 2GRUA 3OPVA 2PHZA 4JY7A 2CNWA 1NBMA 1GSHA 1ZJ5A 3KAJA 4V1CA 4QXAA 4N5LA 4RCYA 4RTNA 4LK3A 3KU4A 3ZCUA 4FBLA 5C4MA 1E58A 3K0CC 2H59A 5L40A 1QK4A 3C7CB 1QG4A 5JNWA 1W96A 1R12A 2Q4DA 3JQEA 4LF7B 1UZLA 3PGMA 2FFJA 5A1TA 1POWA 1TF7A 3N2YA 2QKYA 4BXOA 2XA1A 2I67A 3RLFA 3EDRA 4R01A 1XZLA 3VVCA 2PD3A 3M5PA 2VDUE 5TB5A 2WKPA 1MO3A 2BGMA 4GWKA 2G8LA 1V6AA 1Z0JA 3VKGA 4CV3A 1HDGO 3H1AA 5G2OA 5KQGA 1M6EX 2BUCA 1AXEA 1PJRA 3NRCA 4B6QA 1W34A 3S29A 3H3JA 4PQFA 1WA5A 2OHVA 1QM5A 1LBTA 3FFAA 1F4PA 5A5FA 2C7OA 3PA6A 4W8HA 4GVXA 1EEXB 3K9WA 4XIFA 4YACA 1LPPA 5BVGA 1X6VA 1OB2A 1IBRA 1BA3A 5GV8A 2H2GA 2Q3MA 4Q34A 4NG5A 4TKVB 4B6JA 1TUEA 3PGXA 5D84A 3UXEA 4R2MA 4FGZA 3TB6A 4MCHA 1ORWA 2K2QB 5C1IA 5K0EA 2A5YB 2EW2A 1QQ6A 3AJEA 4PC2A 3SLGA 3CPEA 3F47A 1DO2A 2PSSA 4JCCA 4RV4A 2DKNA 2ZVDA 3I1FA 4HTFA 4TMVA 3PHHA 4XX0B 3SS8A 3ER8A 4GP7A 4MRRA 4ZFNA 3DFFA 5IASA 3HCWA 5JBQA 1F1BA 1OTXA 1EXDA 1Q0SA 5KTRA 4KOAA 1TM7E 4CKCA 5C3MA 4V2UA 2BCEA 1FFWA 1FFHA 4PPFA 4RK5A 3GLGE 2VUHB 2F9FA 1F8YA 2R8BA 1ZMOA 2C9YA 1XAIA 4TGLA 3NKVA 1GNQA 5ESRA 1OBVA 1MB9A 5U4XA 4FC7A 3UFXA 4C2BA 1JDBC 4R7GA 1SG9A 1XVAA 5CBPB 1Y7LA 5JU6A 1G60A 4IQ0A 1MNQA 3LUAA 1JQKA 1RHQA 3I9MA 1ZVQA 8ADHA 1YZTA 1YV9A 2CXXA 1PGQA 1Y3IA 2RKBA 2W2XA 3C97A 1H23A 3HPQA 3N5CA 3G6KA 3PD1A 4JVNA 4YP0A 5AKGA 3DDUA 4JLAA 3RM3A 1IBKB 1U0GA 4QQKA 3ERCA 5ALOA 1F4VA 1YCDA 2GA8A 2X3FA 3N7AA 4ID9A 2Z98A 3UMRA 3SXUA 4DARA 4MWEA 3GLIA 4IDDA 3GLQA 4Q1FA 3MWEA 3CG4A 1S3FA 1UAYA 4HXFB 1AK2A 2O14A 3PNVA 3KUCA 3DCYA 4BU1A 2DUUA 5LYYA 5BR7A 1GEEA 4PYOA 2JJYA 4J03A 1XHEA 2OCDA 4R0VA 5DT9A 4DY4A 4UMDA 5JDIA 4BXOB 2VDMB 5KCZA 4QBHA 2B8NA 4BLPA 3THSA 2NIPA 3QP9A 4JX8A 3ZZMA 1P91A 2AOUA 3EUEA 4H7FA 3NNDA 3W9YA 1QGUA 1M7HA 1QO0A 1V3VA 4Q7LA 1ADFA 3ZGOA 1PJAA 3C6XA 3FF1A 4S04A 1H2WA 3INTA 1P72A 2E49A 2OHGA 3CMMA 3IXLA 3JQ9C 5JVDF 1DQRA 5EFOA 2HRZA 3IDQA 2EZ9A 2AW5A 2ERXA 3FMPB 3VJMA 4IEEA 1PJQA 1NBIA 3S2IA 5BVGB 1KAGA 1NNUA 3N0WA 1K27A 4LNUA 3H16A 2EX0A 4GOXA 4HX5A 2BP7A 5KWSA 4R5MA 2H1IA 2A35A 3KEQA 2G76A 3LSTA 4E03A 3PG5A 1DAPA 4RETA 4HTFB 3UT0A 1D4FA 2PZGA 3E3AA 1XA4A 5B3AA 3VDRA 4U5XA 1DEKA 3CRRA 3TW6A 2QVGA 1X7XA 4YV0A 1KWGA 2ARKA 1RIIA 3O7MA 4CKCB 3D7KA 3ZWPA 1MX9A 2NZVG 4J16C 2PL3A 2ZJ0A 1PGOA 2WUEA 1EX1A 3UOGA 3KT3A 5HPYB 4M0PA 2CL0X 4Z4CA 5C34B 4R1PA 4MW6A 3NAGA 5U1PA 5HW0A 5IAJA 1KZ6A 1R0SA 5IJ0A 1M8JA 5D3QA 4CDMA 2NO0A 4RFSA 4YRBA 2HMWA 3D5EA 3DV9A 4AKSA 3WYEA 2CUTA 5F77A 3NIFB 2QXYA 3TLXA 3MAGA 4AYWA 1FNCA 3CLVA 4LSMA 2O7SA 4MX8A 5DFAA 2JVJA 1IUNA 1OZFA 1X80A 2VJDA 3AF0A 4I55F 4RKQA 5KOYA 2D6FA 1NXQA 2KSQA 2Q8PA 4JN6B 2DPLA 2P68A 3K0KA 3IAEA 3MLEA 2HDHA 2ZRNA 4Y6QA 4ZO8A 3SXUB 3G5AA 1XMPA 4KXMA 3CNQS 4Y1FA 3GLIB 3MWEB 1RI4A 2QAGA 5FF9A 1K3TA 1BMTA 3UC5A 1T25A 1BAPA 2Y6VA 3FPFA 3OD1A 1GLVA 2WDZA 5T6BA 2YJ6A 3OQNA 2FZWA 1MQSA 4L78A 2VYFA 3WXMA 4FNMA 3ZCXA 3ZWMA 5CDUA 2JLXA 2WB2A 4NDNE 2C5BA 2WYOA 4XDZA 3G8CA 3U13A 4YCJA 3D8HA 1CZOA 4ARAA 2AOUB 2H4FA 2IEDA 3DAOA 2H9YA 5BW6B 1QGUB 5IFLA 4QX6A 4IOKA 2GEUA 4OHCA 3MGKA 3T9DA 4BIIA 3M83A 1DKOA 4Q1CA 3UV3A 3R3VA 4CJXA 2SNIE 1T3SA 5GONF 5TMPA 3WHPA 5EKDA 4GLFA 3OIDA 2FK8A 2AC7A 4P4SA 3N8GA 3AESA 2JF0A 2QB5A 3AILA 3FHCB 1IJFA 3Q7QA 4LNUB 4RD3A 5AVJA 3ZHUA 1KMHA 2FRDA 2HIMA 4PU0A 2BP7B 5C81A 3GPLA 5ITZA 1UBKS 1SUPA 1SXJD 3KSZO 3V4OA 3OKCA 4P86A 1NBME 4MVJD 2VHVA 3K1AA 1I51A 4GICA 3MS2A 2F8LA 4GKVA 2PX5A 2VRCA 2ZR9A 4CKXA 4JI7B 4XGIA 1QVAA 2G4CA 4Z4IA 1X7XB 3SPXA 2PGAA 3QUQA 1MP0A 4NYJQ 3IUYA 3N6XA 3QOWA 1DADA 1XQVA 3GARA 4JBGA 4ASUD 2GERA 1AURA 5BV1A 5CA1A 2FUG6 2Z5LA 5J2UA 3JD4A 2NTJA 2WFMA 2WYHA 4GDMA 1P4AA 1QGED 4I4TF 4MEBA 4QEZA 2OOKA 3ONNA 3BTSA 1Q7BA 2D1YA 4LYAA 3TOVA 4WL0A 1GDHA 4RFSB 4FS8A 1B15A 1EA5A 1CHNA 2QNBA 4OHXA 4LY3A 4B09A 4Y0VA 3UJHA 3PFKA 5F7OA 1O94C 1X80B 3I9LA 4NYJR 1JFLA 3D7RA 1XR3A 1X38A 3M0EA 4S05A 2RJ3A 1SQSA 4UVDA 1KP3A 2GTPA 1UPAA 2CV1A 3BN3A 4IJ5A 3L7AA 3O3MB 2CVZA 1RBZA 2QAGB 3DL4A 2Q3CA 2V0NA 4X0EA 3ZLVA 1H8EA 3Q8WA 1UM9A 1EVLA 2QLBA 1UC9A 4FFDA 1VMIA 4YCBA 2DU8A 2BGWA 1UKEA 3MFYA 3P27A 1QK5A 1Z9BA 3SR4A 1PL6A 1ZK0A 1ATZA 2FR1A 2FTKE 2FZCA 2IUFA 4OHOA 5T4FA 4UE3S 3RNLA 2A14A 4YMHA 2D2XA 3CV3A 3R7WB 4BEJA 3OZXA 4YUYA 3V4SA 1CEXA 4CMEC 4M6WA 1POXA 2PU7A 1E89A 2XF8A 4LHYA 5AHRA 1QF7A 3VSAA 5FOWA 2ANCA 2VDPB 3SR3A 4ZVRA 4EB6A 2P9EA 3RC2A 2V59A 4UOQA 2IHVA 3IH5A 4EY8A 4YREA 1KNQA 3TINA 4TQAA 4JQOA 3WWPA 2QL5A 1FNNA 3P2KA 4I8IA 4AC9A 2YC2C 4QLAA 4BEVA 2JEOA 2WPDA 2JCXA 3V4ZA 4DLAA 4Q4DA 3DE2X 3KVOA 4RJJA 1ZHOA 1P17A 1USGA 3ROQA 1AHPA 3N7UA 1UBCA 2UDPA 5ITZB 1P0PA 3GLIE 4TM8A 4GKKB 3D5QA 4UZSA 5JNSA 1UDRA 3H9UA 3K1AB 2CD9A 2A9QA 4CIWA 1VA5A 5IZCC 3VPCA 1LVUA 3EOBI 3KTAA 3LBHA 5IM4A 3UPUA 3FB1A 1TC2A 5LLDA 2F9MA 2ZI5A 3QEOA 2HXYA 4EB8A 1Z5ZA 3KU1A 4RENA 5F98A 2O0KA 3IBTA 4INPA 1OTYA 1GR1A 1B43A 4X9XA 3J81A 1XMQB 1QE0A 3HFGA 2HZBA 4BBAA 5CA1B 3AOGA 5ECYA 1MMFB 1PZNA 3OCUA 3UAYA 2ZRFA 3DLHA 1I2AA 3AU9A 2LDXA 2GBLA 4M7RA 1S7CA 3H1GA 2PWBA 1SOVA 2UYHA 1YRWA 4X61A 5EP4A 1MTZA 1XWFA 4HYEA 1L7XA 5HIIA 3CCCA 4UHHA 4OFZA 4ZYZA 1VIDA 1WCWA 2CNNA 3GVXA 3RFTA 4GI1A 1AMNA 1LKZA 3EMDA 5E7IA 5L6MB 1NJ5A 1JB1A 2RCYA 1EXMA 4E1BA 5FL3A 1PQWA 2AFIE 3CUUA 2ZROA 1E1CA 1RXCA 3WV5A 2WWHA 3TW8A 3V7NA 4CF6A 1UM9B 1JAYA 2IP4A 4EO4A 3A4LA 4II3A 4BP8A 4F9EA 1E2GA 1C3VA 3ND9A 1V43A 3ZDEA 5D5PA 1WXHA 2QMEA 2VSXA 5AW5A 9LDTA 3MWYW 4A1FA 1QO7A 2UYOA 4M6WB 2GESA 1M9NA 4KXNA 1FFBA 4R8RA 4LWPA 4CHGA 2R6ZA 1EVEA 4QSHA 4EF6A 2ONCA 1PFWA 1ODCA 5CMLA 4FFVA 3EASA 4LAFA 5DHUA 1I4OA 5HFJA 1VJTA 3TPZA 2WKWA 2A8YA 4FGKA 4I08A 5T3UA 1PR9A 3MLBA 2A33A 4L8GA 2F8MA 3K30A 3LT0A 3ZR4B 3L06A 2PKEA 4IPTA 2J3MA 1NE2A 3BGOS 4K2HA 5KVAA 4L5IA 3RC3A 2IOQA 3K0CA 3T61A 1PEAA 1CUHA 1ZGBA 2CNLA 1JHPA 4EF4A 1SOWA 2HFKA 1TO1E 3H97A 4RPIA 4DLPA 5A6SA 2QN6A 3P94A 2KS6A 3KTAB 1GCOA 4C9BA 5AI6A 3PTAA 1DI0A 3UMSA 3NH9A 3F96A 4BU0A 3EW7A 4ITRC 5MN4A 2EATA 1TJPB 1J56A 2ZT8A 4RTPA 4X8MA 3IBCA 5ECGC 1LPMA 3H6KA 3OAAD 4UBLA 3S2EA 4XPZA 3PXXA 5BNWA 3TD2A 1RDFA 1JG6A 1QUEA 2QRVB 3AFHA 4G5QA 1O2DA 3ZX4A 4P0QB 4CEJA 3OX2A 3ICQB 1S3IA 1K5DA 1U0OC 2WKRA 5CDTA 4BZXA 2A9VA 4E4YA 4NU6A 4Y6PA 3UB4A 1YT5A 2YHIA 4EY6A 1JQDA 4BBJA 3TLBA 1H8HA 1UFQA 4MA0A 5EWLA 4EG6A 3OP1A 1E1CB 1HKHA 2LP4Y 5EMJA 1MV8A 1D6NA 4Y6LA 3TW8B 4NAUA 1OT5A 4EBBA 2BHLA 1EP3B 4C4SA 3H5TA 3UKJA 3LP8A 3NC4A 3OLVA 4R3UC 3PPVA 1FTWA 3ENKA 4BPBA 4KFCA 2NOAA 2R7NA 3BGIA 1FFGA 3CLRC 1UDCA 3CEMA 4UHDA 3QKWA 3REFA 3VPDA 5I51A 3U7FB 4ZEOA 3TSAA 1AB5A 3EQ2A 4ARBA 3GBVA 1KMIY 3HCOA 3V8BA 3W7AA 2HJSA 4MKHA 2ZYSA 2VTDA 1Q1BA 5L4LA 3T3OA 4GVPA 2CL6X 3KFXA 4B2IA 4M21A 5I47A 3V2HA 3NDIA 4ZMRA 3BJZA 3CVUA 4UFNA 1V3QE 1DB3A 3GQBA 1XCJA 1ZD1A 1DV1A 5ALEA 3E2PA 4G0QA 3GNSA 1YTUA 3DO6A 1MZVA 3NORA 1W36D 4RS3A 1CB7A 2NUAA 2RK6A 4HYYA 4LZNA 5DE3A 2XD9A 3ND6A 1W5FA 3F3MA 4A0FA 4PC1A 2JZCA 3FMOB 2X0DA 4HVLA 5A6SB 3TD6A 3R6TA 2X58A 4XWTA 3L0DA 1KO4A 3DBVO 3DGFC 4FP9A 2CBZA 4C1NA 2IPAB 3A2KA 3HL0A 5JXGA 2PZBA 3P5SA 4PZDA 3GEEA 4YTEA 5A2QA 3H75A 4HMQA 4ER0A 2ZT5A 1DXQA 3L7CA 1EH5A 1NF9A 2O2EA 2Z2JA 3AWIA 3E7FA 1I30A 1JXOA 2JW5A 4OJTA 4F8EA 2EVWX 3QPBA 1TJNA 5G1PA 3V8MA 4B4UA 1EGQA 1R8JA 1YK1A 2H2AA 3WDMA 4CEJB 3DEYX 2B92A 1SCIA 4CF7A 1NNSA 5BV0A 3T5CA 4LQ4A 2W48A 3SIXA 2B82A 4NJEA 1X7GA 4J0FA 1J1UA 1G8YA 2ZKLA 5EWLB 4C4TA 3AKEA 1C9YA 1Z6QA 2O3TA 3HY6A 3E9MA 4JLJA 3JZAA 2J5BA 5CVCA 4ZD6A 1FUKA 3U7RA 4WBNF 3TGLA 4LF8B 2OBYA 4NEQA 5JDCC 1JMKC 1ZJJA 1CWUA 1E63A 1JKJA 1R0KA 2VFAA 4ZT6A 3HDHA 2IYPA 2WJVA 2Z9BA 1YQGA 4D42A 5IRCD 2B5WA 5FCDA 1CRLA 4D41A 1VP9A 2RARA 2H2HA 2I03A 4GMGA 3VH1A 2EIXA 2IGTA 5NULA 3QKUA 2GCNA 1CKEA 5CVUA 1PQPA 3F0TA 5FWYB 5AW2A 1G5RA 4WOCA 1KRWA 4J1TC 1WVIA 5BMVF 2Y27A 4XX1A 3WYCA 4OTZA 1WHSA 3CTMA 1WDWB 2JIRA 1HE1C 1EB9A 3PUYA 5JJKA 4QUBA 3TI7A 2FZLA 1ISHA 1FDUA 4UHFA 4EI9A 3VDQA 4BWFB 4JVMA 3AL0C 1UC4B 3GQBB 3KQUA 3UW3A 1I80A 1XRNA 2IEIA 1G20A 1QX3A 3W1VA 2C2ZA 2REXB 1HA3A 3H2GA 2NUAB 3WYAA 3W7BA 2C0PA 1H05A 1PVVA 3A3NA 3PENA 4MLCA 4BKOA 1N6LA 1BD3A 5JQGA 2I91A 3C7DB 3PSAA 1Y5NA 2JFQA 1XF1A 2VF4X 4ZI7B 4JOSA 1HDOA 2O7QA 1W29A 2J09A 3FMIA 3HXTA 4F4IA 4TVSA 3RSGA 4QJIA 1D7OA 1L5YA 3DH0A 4WXHA 1OCEA 3RAGA 2YJGA 3ZHTA 5LD2C 5TS3A 2VNAA 4FHEA 3RODA 3UUEA 4EPRA 5IVHA 4BAZA 4RL6A 1W87A 2B8EA 4GRAA 1T1RA 3RW9A 3OLZA 3TL6A 1CVLA 3O8CA 4MVWA 2Z8YA 1II0A 1R16A 4QSMA 4R2LA 2PRSA 3KS9A 2W83A 4RZXA 2BJWA 5CXSA 5AI4A 4M1SA 1B0UA 4ZKEA 1OGJA 4A16A 1PZEA 3K8OE 1AGRA 1UMCA 5BMOA 1HLDA 1J06A 3KZKA 4KNWA 5IMSA 4ER5A 2VTBA 4F93B 4NJEB 1BRTA 2VAXA 5AOAA 4CMIA 1C0PA 1UEXC 3U3XA 3WOVA 4K87A 2XBMA 4TVBA 1T36B 4P5EA 1UBLS 1JPUA 4YRKA 1Y6GA 4MO2A 2PUJA 3V8PA 5LQRA 4I50A 4CIAA 2E5WA 4W6QA 4F4FA 4KQ9A 4JYZA 3PXAA 5L45A 1JKJB 1Q1GA 4XOUA 3ZWAA 5L4NA 4PZPA 2BSAA 1YL6A 4AKIA 4E1AA 2HMUA 1IEQA 3QV1A 3WWEA 1U9ZA 1HLFA 4HWOA 4Z3KA 3LQYA 1XLWA 4AULA 4D4JA 5HKLA 1S2DA 2F59A 2O1WA 2O6HA 2W6MA 1K68A 3FXAA 2PPVA 3IMCA 3OPYA 3U9SA 4DDMA 5KTNA 3RRJA 4E08A 1AG9A 1WHSB 3QGMA 4GR9A 2CYBA 1YA6A 1YJCA 1L1EA 2I3DA 5H83A 4C4OA 4BX8A 5K0FA 1UIRA 2ASEA 4NARA 2ZJYA 2AG6A 4KMOA 3Q7PA 2AJTA 2QTCA 1NNEA 1HORA 2C9ZA 1GKKA 1ODIA 1CNEA 1NE7A 1QHYA 2Q6OA 5C80A 1YZHA 2AG5A 3HRIA 1TE2A 3CXUA 3CZAA 1E32A 1U81A 2VQ3A 4DTIA 1JIUA 2GJSA 3OF3A 1P2FA 3R40A 3UMVA 2OCPA 4YQEA 4D46A 5E6SB 2YYYA 1I2DA 4C5AA 4P4UA 1HEUA 2BH2A 1A1SA 5K6AC 8ATCA 5TX7A 2WLSA 1E99A 1ZUNA 4LNAA 4U5QA 3FPLA 1NVTA 2JAXA 2XYQA 4XTRA 5GAJA 1P1HA 1RPTA 3L6OO 3KO8A 4NZPA 5MN6A 3NEJA 2SICE 4JP1A 4GD3Q 3M4ZA 1XZ8A 1M34A 4GPZA 4Y6GB 3VC2A 4X64B 3FPJA 4NLLA 1LRKA 5LP6F 4GDFA 1MO4A 4X8OA 4WRRA 3NJ8A 2ONJA 4EYGA 1MT3A 3ZNPA 2CCKA 3ZYZA 1UMCB 5J2TB 1VDMA 5F5NA 1OMOA 2JAPA 4W8OA 2VTBB 2VBIA 2ID7A 4X97A 3UPDA 4LSGA 3T3DA 3HCNA 3GRPA 2W0MA 3IAHA 1TGVA 4JK3A 3ANNA 2H2DA 4S1TA 2Z3WA 3SJUA 3MGAA 4PN7A 2EKBA 1FRVA 3BFVA 4U2GA 2AOTA 4ETWA 4PXAA 2CCGA 1NQ5A 2ON6A 2VWGA 4IP0A 3TL3A 2IEGA 1NKVA 4X60A 4UCQA 3HB7A 3TS1A 4QYIA 1FLNA 3K9FC 3OPXA 4JC5A 3K09C 4BJ6A 4LJ5A 1MEJA 1I7PA 1SO8A 2Q3BA 4J7AA 1PJTA 3L46A 3BQMB 4LTMA 4HDCA 4ZEVA 3OPYB 2PKWA 4G5RA 4I3FA 1C3LA 4IIFA 4OPMA 2HSGA 2O1XA 3FLMA 5E2AA 2O8EA 5CK4A 1PL7A 1C3OA 4UTPA 3E8MA 4QPCA 5CJJA 4Z51A 3AUKA 1SPBS 1V1MA 1G18A 2OD9A 4IMPA 3RYCA 4D79A 3NM5A 1A5BB 1FYVA 1XTRA 3KE8A 1HDEA 1IG3A 3PFIA 1ZEJA 1QDEA 4P92A 2WJZB 2XY4A 1NMXA 1FTNA 1MPXA 3F7NA 4LJLA 4ZU6X 3TKAA 2ZIEA 1LRJA 4U7TB 3RREA 3BDAA 2OSVA 2VP6A 1O03A 3WMWA 3O2SB 3LUFA 1PG2A 3B85A 2D06A 3OTQA 1QAMA 4UE2A 4IIXA 1YBVA 1IN4A 3WGTA 3O74A 3N2KA 3A1WA 4I9UA 4RJTA 2XTZA 3WQSB 1C30A 1GQOA 2ADMA 2WM3A 3P9QA 4UCFA 1Q12A 5DB4A 5CFZA 1ZN2A 4RNDB 3T1OA 4B3GA 4QTUB 4K46A 4PR0A 3IPYA 1ADGA 2CHUA 3KKKA 3L3BA 4MS1A 3CRZA 4ZT7A 3UHAA 4HQ6A 1U98A 1N0IA 3DSRA 4KVFA 1XTZA 2BELA 4DABA 4DBVO 5BUQA 1FIUA 4P7KA 5AVTA 4F60A 3A1DA 5AKEA 1ZM2A 4Q4CA 3KJNA 2XKBA 4A0QA 4KAXA 1YRBA 1G20E 1JHMA 3Q9SA 3QKRA 3EPRA 3LK6A 4R5HA 1HYBA 1WCYA 1HY3A 1H1DA 1X1BA 2HQOA 2MSNA 4MROA 2V03A 2FEOA 1J2TA 2AOTB 2I80A 3I76A 3TVDA 2V8BA 1Q16A 4F4JA 3NVKI 2QI9C 4QBTA 2JGNA 3U0BA 4QYIB 3U7QA 2AI1A 1BROA 1ZA1A 1ZI6A 4HN9A 2ZZNA 1X87A 3WZ2A 1YZ3A 4X65B 5M7EA 4JS0A 1TK9A 1MFPA 1S6YA 1UDWA 1UAGA 4PQEA 2PMEA 2PJZA 3PTZA 1L8QA 3B2EA 3UMJA 1UBUS 4R7ZA 5DNYB 4HTAA 4IRXA 1T9ZA 2PBZA 1CUEA 2YZ2A 2RGDA 4L5BA 1AQJA 4HNHA 1CJBA 1FSGA 2V54A 3BOSA 2IRWA 3UM9A 4Z1OA 2XMQA 4Z6KA 5JAIA 2O8EB 3CF6R 4Y1GA 1CNFA 5EJ4A 3THXA 1C3OB 1GSOA 2VUTA 4XWAA 1MJHA 4BJHB 5HM6A 4GPEA 1V1MB 3A4VA 4G2TA 3LYUA 3H65A 5A3VA 1YR7A 2HPHA 3NQ41 4GYWA 4PSKA 1RWMA 2AE1A 2I3GA 1QGOA 1ONBA 4XJTA 2VXOA 3ZGNA 2UXDB 3MGBA 2WF8A 1TFUA 1F8XA 1NBMD 2CNWD 5K09A 3RASA 1PZFA 1E2MA 4EW2A 3B7WA 3FIJA 3MTIA 4JMLA 3MVEA 3VU9A 2V7GA 4PLZA 2FN8A 4AJEA 1ZH8A 2ZBQA 5J40A 3G2OA 2ZRHA 1JALA 3VNVA 4IVRA 1OKKA 1FLDA 1WW8A 3N2KB 3V5NA 2K7FA 1JIJA 4JU9A 3T41A 3AL3A 2XUHA 3BMNA 3T5MA 3TLKA 1C30B 4CKWA 4D3XA 4A0GA 2Y1CA 4DMMA 1VCMA 5LUBA 4GH5A 1J90A 1VJRA 4YAFA 3MGCA 4MS1B 1D07A 4DUZB 5EIAA 3H2KA 4HBGA 5AXDA 3SKYA 1DC3A 5CA0F 3MUNA 2BMDA 3LWBA 2D1SA 1CX9B 4C0AC 2XTJA 1YCHA 3S2FA 1YZUA 4FN4A 4Z4GA 3P9IA 2E5LB 5J58A 5FNZA 5K3FB 1GTL1 4ZMSA 2QD4A 3E82A 5LDHA 2VNIA 1Y98A 2WVGA 3QKRB 5JCPA 1OVGA 3TRFA 1N0VC 3OE7A 5ECWA 4BFSA 4JB3A 3OEEA 5L6LB 3H8JA 2HSZA 2ENUA 3VR3A 4EARA 3IP5A 3ETHA 2X8JA 3CNHA 4NKRA 3U7QB 4EELA 3ESBA 5LMCA 3NHJA 2Q4TA 1HYQA 2X0FA 1SVMA 1GOTA 4P7JA 4M8IA 1XRLA 3NHUA 1T8UA 4HQ0A 4TVKA 2XRFA 3WNCA 1RAHA 5IPFA 3QEAZ 3LHKA 2BIFA 2BZ0A 3AI1A 1CC1S 3FZQA 3PX3A 3ZZTA 2LCFA 3IE2A 3RVLA 3F6YA 3WQRA 1MC8A 5GY7A 1M34E 4CLXA 3S40A 4TXNA 2HDNB 3K96A 3IUNA 4EO7A 4F3NA 1T9KA 4AY4A 2V96A 3K20A 4FNGA 1KJZA 3IMKA 3TL2A 2DAPA 2YKGA 3R75A 4NC9A 3AC0A 2CXNA 4QBGB 2ODBA 1GZDA 3NATA 1YA8A 1FW6A 3LPLA 4JODA 2Q5EA 1LY1A 2WIDA 5TMDA 2AI3A 2JGAA 3D6MA 1PGNA 4Q15A 4RPKA 4R1QA 2OENG 2BR3A 2P2DA 2YJTD 2VZ9A 2VSFA 3NIDB 5JDCA 4M9UA 3VU9B 4Q3EA 3W2TA 3W2EA 1I6WA 5A4FS 1L6RA 1GKLA 1QCCA 3D59A 3IQXA 4UAGA 5LDDC 1H66A 4M1ZA 4AZVA 2ZS8A 3BMNB 1U5AA 2FF5A 3NC1C 1TM3E 3P2JA 4FR2A 3N3BC 5DU2A 4JZKA 2Y0BA 2ZJBA 4WNAA 1BGXT 2FUNB 1AN0A 4HAOA 4JBXA 2P2YA 4TWZA 5BUSA 4MI3A 4YONB 1JKFA 1AGPA 2K7ZA 2IYQA 3EN0A 4FLFA 4R9NA 4B32A 3M70A 1ONSA 4TRRA 4UDXX 1WVMA 2W0SA 3AR7A 4AMGA 5KJFA 3WA7A 1NURA 3TLAA 4MRMA 3OQMA 4HOYA 3PQFA 4L6AA 3JQFA 3S2YA 4XPIA 1I32A 3EGDB 2ZJOA 1M2EA 1F2UA 3GUZA 1KETA 1KJWA 3ZW8A 1VL6A 4UVGA 5TNXA 4CG2A 3H5VA 4XYEA 4X63A 4V0MA 4GOLD 2X8LA 3FHTA 4I66A 2J08A 1WW3A 3AGQA 5FPYA 3QPUA 3VMFA 4Q7QA 2X4LA 2XA2A 3CY6A 3EQ6A 2X8JB 4IOJA 4PAQA 2WJYA 3LX4A 3U40A 1G7CA 4DMCA 1XMIA 1SCBA 3VPHA 1XXHA 3DLCA 3NEYA 3QXSA 3TIIA 4LXXA 1DX6A 1DNPA 2B4RO 3K0FA 2H08A 2X8AA 3O3NB 1T3GA 3MT9A 1DX9A 3C3MA 5FR2A 2PSJA 4K1XA 5SV2A 2PGXA 3M1IA 4DNFA 3QXGA 4RPHA 1KQGA 2C03A 5J4LA 4P5DA 2K5UA 5IKMA 1Q7CA 3ZDRA 2VUUA 2UAGA 4TV9A 1P6QA 2W4IA 5CEJA 4ABTA 2JS7A 3H7IA 2ZWPA 1NUPA 3AY3A 4F5DA 2B83A 4JBWA 1SXGA 1VZ3A 5EWMA 3FMVA 3O9ZA 1F9EA 2CXQA 4QQ8A 3K73O 4ZOLF 3D8NA 1Z4NA 5FWXA 2IQ5A 3F49S 1UDBA 3EEOA 3V42A 2FMKA 3ZG6A 3ADKA 4OXXA 1FXUA 1W9HA 6Q21A 4W63A 3LOPA 3HM9A 2PKRA 2TMKA 3DMFA 2XUOA 2A9JA 3HHPA 5DYTA 4PVDA 1HI9A 1NVWQ 1W85A 2QSZA 4FYXA 1XTTA 2NYUA 3JRNA 2GK6A 4HB3A 4RGBA 4FHDA 1IDOA 4NSNA 3SYNA 2IVZA 3ZY6A 2FZKA 4K6MA 5CDSA 1IWOA 1R6TA 2QN1A 2J9FB 2BRUC 4WNAB 1GPAA 3O47A 3IERA 4B6OA 4BVBA 1LK0A 1UJBA 2VOJA 5K3CA 1ZIOA 4RV5A 4F3RA 4O3MA 4RHYA 1CY1A 4BB6A 4E5DA 4DCSA 4QOGA 2Z56A 3NHAA 2HA5A 3VR4A 5I3ZA 4MRMB 2O7VA 1QRSA 2COEA 4KQMA 4JYBA 3CVJA 4JX9A 4FCWA 1NF8A 4NNPA 4XPIB 1V8ZA 3TQCA 2EQAA 4XXHA 1ESMA 3H6GA 1F2UB 4QU5A 3FE2A 4W5HA 2VIIA 5GJCA 1XZEA 1H65A 2C9OA 2PX8A 3TQFA 1OI7A 4QECA 4PGHA 5CGZA 3KHTA 3W5BA 1K7SN 2Q3HA 3AFIA 4QJBA 3T9FA 4BVFA 5MHTA 1CY6A 3ICEA 6ADHA 1T0UA 1GFWA 3QVGA 1AMOA 3T5BA 1KTIA 2XNCA 2XIJA 1KMMA 3DAPA 3DHNA 5EIBC 4ZCIA 1XXHB 3S28A 3EPKA 1YIOA 3OTGA 4OQPA 2VXBA 4BFZA 4JC8A 1SPXA 4PSCA 5ALPA 3OHSX 1PJ2A 4C7BA 5ALMA 3K0FB 3UJ7A 2D5AA 3B7PA 3KLOA 4NBVA 3GT4A 2AEMA 3VPXA 5BVHB 3TBKA 3KYDA 1E3MA 2J9GA 3BDVA 4KNVA 4US1R 1SHKA 4GRDA 4L9SA 4TTPA 2AG8A 1WB9A 1O3YA 1HDZA 4TV9B 2OR3A 5IVKA 3W3AA 4FEAA 4OHBA 4B79A 4CDGA 1P73A 4E33A 1RYNA 2QU7A 4E5NA 3IPCA 3QWHA 1UOOA 1VGRA 5EWMB 2CFSA 4PNPA 4Z9AA 3VH2A 1DWUA 3IJEB 5HF8A 5FWXB 4P4TA 2GA9A 3WK7A 3EH2A 1F2VA 4YLYA 4H7JA 2XUAA 2QAIA 1H8ED 4FE4A 2QLJA 1Z3CA 4XFDA 5EXDA 4UZEA 3L0YA 5EJMA 1WPRA 5A3QA 1QR2A 2WJWA 3NBXX 4L51A 3FSRA 1SCNE 2PK3A 4NS4A 4DDKA 1J09A 1MJGM 1W85B 2ISCA 1SCAA 2V7PA 2VAWA 2YRXA 3FKQA 4XGKA 1KI1A 3RBXA 3NVDA 3SJZA 2DHRA 3ZIUA 4CKYA 5LU9A 5AFSA 3OCZA 3WK4A 5HKOA 3RSLA 2C2KA 5DLQC 1TMKA 4YRNA 1XTSA 2JHAA 3GJ5A 3X1MA 4RY8A 4K7JA 4RH1A 2ZUBA 1VL8A 2EXXA 4RPCA 4YO7A 2QRUA 4L72A 3KQHA 5HCIA 2GCEA 1WHTA 3JTMA 4EKGA 1VGVA 4JJFA 5EXPA 3X2SA 1XC7A 4FDUA 1ND6A 1P2GA 1YR3A 4CBVA 1OYVA 4EUFA 4D26A 1YDEA 5D6NA 2WPDD 2RHGB 3HE3A 4G9GA 4LYDA 1UJNA 3NYQA 5JMTA 3UQYS 4EPTA 2BJVA 2FSFA 4W7HA 3KZNA 3P0RA 2R4UA 2OILA 3FNHA 3VX3A 3WSTA 3OM1A 4HGRA 4OGFA 1S02A 3T0IA 3SNHA 4H16A 2MJLA 1V71A 1Y1PA 2P9ZA 2PX6A 3KBOA 1M6VA 3QFRA 3QVGB 4S1PA 2NZ2A 3GJSA 3M4XA 1S2IA 1DG9A 4RESA 4XARA 3WWOA 3ZCSA 3KWLA 3GGSA 4DLKA 2G1AA 3WGOA 1FE8A 1H2XA 4QZVA 4M7WA 3RDPA 3GA0A 3RT7A 1KBOA 5K0LA 3MCWA 1C7RA 3RADC 1TYAE 4HZIA 2AEFA 2QU8A 4UATA 3KBBA 3KYDB 2O2HA 2ZE6A 1UZNA 3G7SA 5TQ2B 1NI3A 1NONA 5IT0A 2GBIA 4TROA 3PQ6A 1A9YA 3W2HA 2AXPA 1L7BA 2JFBA 4E32A 1DJPA 3VRHA 3HY3A 3SBDA 2X6QA 4LHXA 1VBMA 2ZIVB 1V8FA 4EFKA 1I94B 3KOMA 4EY7A 4CMHA 1CK4A 3DXZA 2B4QA 2VK1A 2ZJ8A 2ZE7A 3BTUA 4E5YA 1C7EA 1XLTC 3D6NB 3QJYA 1I2CA 4MI9A 4HUTA 3S2UA 3JWIA 1KMQA 1SG0A 3B20A 4V0ME 4M55A 1FRQA 2Y1OA 1QTQA 1U0BB 3TLCA 2YV5A 1D0SA 3CLTC 3KQNA 1HO3A 2EGUA 2H4JA 4DJAA 5KSOA 3T3NA 3DB1A 1SKQA 2PBFA 1P2SA 4RPGA 1I1NA 3B78A 4ZO6A 1MW8X 3ORFA 1ZINA 5FI0B 3TNJA 2Q5IA 2X9VA 2YICA 3C48A 2XBLA 4FSDA 4JVSB 5ITWA 5C0OE 2RJNA 4ZMBA 3KTFA 2IPOA 5CCXA 1YJBA 2QRPA 1IYZA 4JGGA 4P54A 3E7DA 4Q1VA 2FE1A 2P2LA 4EAQA 2AZTA 4URUR 3LQQA 1VE1A 4LRTB 8GPBA 3LUCA 3GLRA 4H1VA 3VOBA 2WK1A 1Y6FA 5KDDA 2X1HA 3E81A 1JR3A 4XQ9A 3CH5A 2RKWA 5F7ZA 2IV3A 1M6VB 5FUWA 1AKTA 4JKIA 2YZ7A 4JT8A 3NWJA 4Q39A 5KPDA 3UKOA 2ONKA 1F7VA 2XB9A 4TTQA 4WFJA 1JR6A 4ALKA 2LTAA 3NHBA 4I1OA 3DB2A 1TLFA 1WXDA 3ORYA 1UWLA 1I3MA 4K86A 3OTWA 2J6IA 5JALA 4IRMA 1QMPA 2G67A 3OEWA 1RAEA 4KUEA 1A0OA 1Z45A 1QNLA 1WPGA 1M8GA 4BC1A 4CF5A 3L77A 4ZQCB 3DXXA 4PPYA 4JGBA 5F4BA 2CVOA 1DC6A 2W70A 1AX9A 1DELA 3TQHA 1H8HD 5FPKA 3IUQA 2CK3A 1RLOA 2QENA 1FFXA 2N42A 3NTOA 4QM6A 3VR6A 1BXRA 4QPNA 4EYQA 5JTTA 1UQRA 3FWNA 5IABA 3LYLA 1ISFA 1CY0A 2CVHA 3KALA 4DLWA 5KMGA 1H3EA 3F7TA 1E3QA 3L1HA 4PLVA 3B51X 4F2GA 2V6MA 4K9DA 4R8MA 4XM0A 1UFVA 3HL4A 5FV4A