1XFAA

Structure of nbd1 from murine cftr- f508r mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
264
Chain Sequence
TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 89
structure length 264
sequence length 281
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xfaA00
3MSXA 3ZGXA 1JEDA 5KSYA 4BEJA 2G6BA 5LB2A 1MOZA 1Z8FA 2MMGA 2VL7A 1IM2A 2D7DA 4L16A 4B76A 3G5UA 1Z3IX 1Z06A 5LD2B 2Z4SA 4OHWA 2OAP1 2FSFA 1M74A 1UF9A 1KOFA 5CIWA 1XXHB 4BLQA 4AK9A 4HUQB 4NP6A 1ZW6A 1HQYE 4QL3A 4V0OA 1GVNB 3L0OA 5DI9A 5GJVC 5H8WA 3TR5A 4XWOA 4B3BA 1N0VC 2YC4C 1NKTA 2R6AA 3WMFA 4N0DA 4CT5A 2QPTA 3S1AA 3BB1A 1JQJC 1KDRA 2XNDA 3EA5A 1H8HD 2QP4A 1TX4B 4MGKR 4JBXA 3SJAA 1WBDA 2WWXA 4K8OA 4L9SA 2RGDA 3TUZC 3U60B 1G20E 1E2EA 2ZEJA 2OILA 2WJIA 3SJZA 4C0KA 3NEYA 3THYB 2VSFA 1W0JD 3IO3A 3EPHA 4A0FA 5JBQA 4JIMA 4DB4A 4LYHA 3L0SA 2BMEA 1NP6A 3Q7PA 4ERNA 3GFOA 3UXMA 2KBFA 1GDDA 2ZI6A 2O8BB 2QM8A 3K9GA 4A2WA 2R6CA 5HCNA 1EESA 3AF4A 5DYGA 2R6FA 2ZYWX 1R0ZA 1AA9A 2FDCA 2RGCA 2ZJOA 2AHOA 1DAGA 3VNUA 4HB0A 3CKLA 3GEIA 1Z6YA 3PXGA 4LX0A 2IXEA 1Z0DA 5GJCA 1YZTA 3CIOA 5C46F 4B3CA 1KMQA 4TLAA 1EK0A 2O0JA 1I2DA 1A82A 4Q7MB 5B30A 1OSNA 3B9QA 1XMJA 5JCPA 4OK5A 1FP7A 1OB2A 2VTKA 1JBKA 1KK3A 5AJYA 2WSMA 1GL9B 1KNQA 1LNZA 5KDLA 1TEVA 1NLFA 1S4QA 2H1LA 3P26A 2ZSEA 2CL6X 3QEOA 4P4SA 3BGWA 1XJQA 1NG1A 3OESA 3AKYA 2QMOA 1UKEA 2GA8A 4F92B 3AVWA 2GRJA 3AF2A 4X8OA 1XPUA 1M1YE 1OFTA 1Z6TA 5E95A 1II9A 3SOPA 2VH5R 2GEDA 2CHVA 3EZ9A 4M4SA 4YMTA 2XX3A 2ZANA 2FSGA 2Q9BA 2MSEB 4UJ3A 5F3WB 2IHYA 5FL3A 3B9PA 3K9NA 4KYIB 3KKNA 4MGYR 4MGZR 1SHKA 5AUPB 2YWEA 5IHPA 1G8HA 2GAOA 1ZJ6A 5A4JA 2ZAMA 2ZSDA 3AP2A 3KX2A 3RSLA 3GLFA 2AL7A 3MFYA 3I62A 3GEHA 2CCKA 4Q4JB 3ZQ6A 4QFMA 1CF4A 3TAUA 5EE1A 4DLSA 2ZR7A 5HR5A 1XCGB 1MT0A 5B57C 1IXSB 1OB5A 2JJ8A 4QBGB 3P27A 1G4UR 1G3MA 3SNHA 4JT4A 1EWRA 1YHNA 4I1VA 1ZM4A 3TQFA 3BH6A 2AKAB 5IRCD 1XEXA 5DO9A 3FOZA 1B0UA 3EWSA 3LW8A 3PQCA 1FP6A 5M04A 3CNNA 5JLJA 1TQDA 2WWGA 1G8PA 2NPFA 2GF9A 4QOSA 4WVFA 3NWJA 1DE0A 1ZM7A 1Z28A 1SGWA 5TARA 2PMKA 2J7PA 3BFVA 4BRWA 4QJ3A 1W7AA 4C2UA 4IFBA 2ZIAA 3KTAA 3GLFE 2HXYA 1W4RA 4TT3A 2RB4A 5EXXA 3R9XA 1U99A 4JLNA 2XTNA 3UWKA 3U6KA 4PC2A 1HEIA 1CJUC 1KI8A 3W5IA 4P4UA 1WP9A 1KDOA 2XOKD 5GADl 3SYKA 3F5FA 3GJXC 3WYFA 4E22A 1P9WA 4HSEA 4YMUA 1P2TA 2OE2A 1BO6A 4JVLA 1DADA 4OJQA 3TUJC 1FW6A 1U0LA 4TLDA 4LJ8A 4PC3A 5BYJA 4PO1A 5HCIA 5DI3A 2QROA 1CIPA 2IEZA 4DLWA 5HKKA 4MA4A 4DRZA 1AIPA 1FX0B 1S9HA 2LWIA 4CW7A 3AGQA 1Y63A 1XEWX 2CMKA 3U44B 1E32A 1E9CA 2J87A 4OQNA 4PSKA 1G41A 4Q4LA 5KNCA 1QHGA 4A1FA 1CP2A 2OXCA 3CF6R 4OQXA 4DHEA 1NN5A 3CRVA 1AK2A 5UKDA 4IXNA 2VHUA 1G3QA 4YONB 3QG5A 1NJFA 1DEKA 3ZIAD 4DLVA 1BIFA 2EYUA 2OHFA 2ZJAA 1WQ1R 1E2MA 3RRNA 2I4IA 3CM0A 1PUJA 2GNOA 1G16A 2FGKA 1TTTA 2UZ3A 4F4IA 2C78A 2QTVB 2BKUA 3BC1A 1UKVY 5CK5A 3X1YA 2C04A 2GAAA 4RY2A 2QEQA 4B43A 2KI5A 4I1OA 2ZM5A 2REOA 4Z8XA 1UJ2A 4HDOB 4DZZA 1RKBA 4JL6A 3TLXA 1Q1ZA 4Q1FA 3P20A 2QTHA 1XTIA 4IOJA 1NVWQ 2FFQA 3Q8XB 1QF9A 2P2LA 2Q9CA 2IYRA 3H86A 3T1OA 2YWFA 3OIUA 1CTQA 4ZV4A 1W36D 2QMEA 2C99A 3FB4A 4KFSA 2IYZA 3EXAA 2I1QA 4ZCLA 3WNBA 1ZM9A 4PAOA 1LV7A 4TMXA 4DIDA 1FNMA 4C9BA 4DUGD 2EFHB 5G3ZA 3K0EA 2DWOA 5J4HA 2WJJA 3U7EB 3CRW1 2QT1A 2GXAA 1NY6A 2CE2X 5J5CA 1IJEA 1SQ5A 1AJEA 1AGPA 2GKSA 3A8TA 2FFHA 1SVWA 2GILA 1QHHA 1ZUIA 2ORVA 3CX8A 5G3YA 3UG6A 1NLZA 1YZGA 1D2EA 2A78A 3B1XA 2VO1A 4B35A 1Z22A 3CPEA 3Q7QA 1ZU4A 3SYLA 4ESHA 3PFIA 5C4MA 2B92A 2PZGA 1H8EA 1SXJE 2EFDB 1TNDA 2ASEA 2BEKA 3CF2A 3LFUA 4ZKDA 3A6PC 3IBYA 1II0A 3IEUA 2MSCB 5B64A 2FFBA 3GJ6A 4HYYA 5L3VA 1D2MA 4NBSA 3GLHB 5EP2A 1OXVA 3FMOB 4TZ0A 3EWAA 3KDSE 4NYJR 3C15C 1EFRA 3RS3A 1NMYA 3RC8A 1EWQA 4CEHA 1KI2A 2ZRHA 5FBWB 3H84A 1GNPA 3K0CA 4JVSB 3LNCA 2ZE5A 1T3SA 3V4RA 1G4AE 1G6HA 4G5RA 3VU9B 3TVTA 1IXRC 4AD8A 2IUSA 2QGZA 4C0QC 1KJWA 4LZZA 3NBFA 2VP6A 3W6PA 2O8EA 1XTKA 3KZ1E 5AR1A 2C9OA 1DAMA 3A58B 1AQYA 3RS0A 4OI4A 1RC8A 2A3RA 1Q20A 1KY3A 1P2VA 2ZVQX 1JR3A 1SXJB 3IDQA 3QBTA 4H1UA 4GOKA 2HUPA 3QUSA 1JALA 1ZAKA 3T15A 4F4CA 2AWOA 2GJ9A 4TQ9A 1KDTA 3MJHA 3SC3A 5JSZA 5EE3A 2GESA 2A9KA 3KUDA 2OLKA 2ZJ2A 5AJVB 4V0ME 1HH4A 2DFLA 3TW8B 4MDFA 1QHXA 2ZI5A 3FMIA 1V43A 3ADDA 2DY1A 1O3YA 3K70C 2R44A 4E5UA 4A92A 3LD9A 4URWR 5IK2A 3K53A 4DDVA 2ZYTX 4FMBB 3THXA 4AY2A 3LO5A 3SBDA 3W8NA 3T1TA 2BCJQ 4LBYA 3TUIC 4A6XA 1F60A 3CRRA 3CWZA 2OBMA 2FFAA 5F2EA 3THOA 2FX3A 2PZEA 4EJSC 2J0QA 2QM7A 3C8UA 5EXSA 4M9QA 1Q21A 2OCYC 2QE7A 5LB4A 3O8DA 3CWQA 5FTMA 1SVSA 5EE5B 1GNQA 4C0AC 3CRMA 3T34A 2XITA 5L3SA 5FR1A 4LHVA 3BAFA 2Q6TA 3NHAA 1DS6A 2VA8A 4RJLA 4DSTA 5JJLA 1DAEA 1DO0A 3IHLA 5GVSA 1UDXA 2J59A 2PT7A 3UMFA 4E09A 2KE5A 4Q4HA 1RRCA 1DAKA 1YQTA 1TF7A 2GEVA 2P0EA 3EAQA 3OIYA 6Q21A 1YR8A 1G7CA 1CR4A 1E79A 1G64A 3ZS8A 2ONKA 3QVUA 2ZROA 3FKSA 3LXRA 1LW7A 1UADA 4TTPA 4GP7A 1Z6AA 4ZDWA 1D5CA 1TL7C 221PA 3AKCA 1COWA 4B32A 3E2IA 4G0NA 4BRUA 1S3GA 4NCKA 1Z83A 1XJ0A 3A4NA 4XD7A 1MO6A 1KJYA 3AVQA 4ZCMA 2H5EA 1N5KA 1N5LA 1OHHA 2WSSD 3WMGA 4OI1A 5JWRA 4AI6A 3T06B 4ARZA 4IOKA 4R9UC 3U3KA 1NMZA 2ZSBA 3WHKA 2CLCX 2RGBA 3C7KA 3LVQE 2ZVPX 4LV8B 4MH0R 4LJYA 2QGNA 2CLSA 3B82A 1G7SA 2P65A 4H9GA 3LBNA 4O3MA 2NG1A 4US2R 1KDPA 4ACAA 4HZUA 3GJ7A 1TAGA 3HU3A 2QNRA 3ND9A 1XZQA 1KK0A 3D7MA 3CRQA 3IQWA 4LYJA 2X2EA 1R8QA 2JAQA 2VSOA 4X8MA 3LAWA 3Q3JB 5FPTA 4KLNA 2B8TA 1E1RD 4RCZA 3P4XA 2RHMA 4LV6A 1L7VC 4FMCF 1ZNXA 1XWIA 3OE7A 2WTUA 4LJ9A 4F93B 5CLLA 5G40A 2G0TA 5JFGA 4LJ5A 1IBRA 2GJAA 2LKCA 1CBUA 1YRBA 3A1TA 3BORA 1X86B 3TVDA 2OG2A 4A6PA 4BFTA 4EDHA 2QMUA 4EKDA 1NNEA 1EGAA 1KI3A 4LWZA 4QNRA 2J41A 4OHVA 1OFUX 1KK2A 3AVYA 4FXPA 3RSOA 4R71A 3U7GA 5F9HA 2JEOA 2W2TA 5L3SB 2CHQA 2V1XA 5DI3B 2QT0A 4QKQA 1P4SA 5KPJA 3F8TA 2W6IA 1HT2E 4FWTA 2FGJA 4B74A 5JEEA 3KJIA 3NBZC 2JLSA 3CZPA 4MKGA 4V02A 3OIWA 3K1JA 1XF9A 3EA0A 5FPKA 1RPZA 2AKYA 4B6FA 2CJWB 2N1BA 1K5DA 1CR1A 2GTPA 5IK2D 4C0BA 3PUZA 1GTVA 5C1BA 3GD7A 5FH9A 1U8ZA 1W2HA 1VPLA 4Q01A 2QSYA 4RD3A 2HDNB 5FPSA 3VR3A 2J0VA 4JSYA 2VRWA 2DWQA 4OHZA 1Q1BA 4PZYA 4A82A 1N0UA 3ZLJA 3NBXX 5EP1A 2V54A 4HLQB 3C16C 3VMFA 3GLIB 3I3SR 5JJIA 4OHYA 4C2TA 2FU5C 2X2FA 2DR3A 2X8AA 1RRGA 3GLFB 2ECKA 1EX7A 1VECA 2J5XA 2W0SA 5FTKA 2RAPA 3NBYC 3A4LA 4PQFA 3BWDD 3LQQA 2ZITA 4QBIA 5KNDA 1XEFA 1KO5A 2QRZA 4M8NE 4DCUA 1U0JA 2OV2A 2R6GA 1FUUA 2AXNA 2WVJA 2EQBA 1GIAA 5JI2E 5L3QA 1R2QA 1YZLA 4CZ2A 2QRNA 5TVKA 2ZUDA 4YDHB 2XTMA 2ZU6A 3WP0A 4HB4A 1IN5A 1KI1A 2ZI3A 1LB1B 2IWHA 1AN0A 3I5YA 2X77A 1GAJA 2J0SA 2QG6A 3AUXA 4NCIA 3EC2A 5IDVA 3DZ8A 2WKQA 4C7OB 2JGNA 1OYWA 1AM4D 4Q00A 1T5LA 1PVOA 5HZHA 1D9XA 1ZD9A 3ZZ0A 1UPTA 3KQLA 1XMVA 4V0MA 3KXIA 4FWIB 1W0KD 3KXLA 4LJ7A 421PA 2IHBA 3R20A 4HB3A 1QHSA 4D26A 1KGDA 4EQ6B 1P72A 1VHLA 2ONJA 3MG9A 4LYAA 2GHIA 3NEJA 3TSOA 4CEIB 1Z0IA 4UQOA 1T3HA 4JJZA 3OF5A 1BKDR 2OXRA 2ZRNA 2ZS8A 2A2ZA 5HPYB 3WHLA 4NYIQ 2GXQA 4OQFA 3WXMA 1ESNA 2AFHE 3K0FA 1ZM3A 3LQRA 1MO5A 2H57A 2A5DA 4Q9LA 2YKGA 1YR6A 3KKMA 4OKSA 5CB6A 4II7A 2JLUA 4CEHB 2XSZA 2XSZD 5AJZA 2ZR0A 4EFLA 2JLRA 4X8HA 1TU3A 5E7JA 1W5TA 2RHDA 4GBMA 2HT6A 3EZFA 3WBKA 2WKPA 3KQNA 4CEJA 4FN5A 1ZYUA 3B1YA 4KBFA 2CCJA 2GBLA 3B85A 3VR4A 3OAAA 5KOYA 4TMTA 4BLPA 1MABB 1SVOA 4QHSA 5CK4A 3EG5A 1WBBA 2CXXA 4EFMA 3K70D 4B3FX 2CNWA 2WICA 2WJVA 4JVMA 4QXAA 3GJ8A 1CLUA 4OQMA 4KV9A 4DLYA 1ZMXA 3REFA 2HEIA 4CDGA 4HATA 3AF3A 1GNRA 4LJAA 1CS4C 1D2NA 1E0JA 4OI2A 4JLPA 3Q5DA 2YV5A 4W5HA 3M0EA 2BVNA 2VP9A 1KI4A 4JLBA 2IYVA 1VG9B 2CLDX 3MD0A 1YZNA 4US1R 1Z0AA 1IY2A 1F2UB 1JPJA 1W36C 5DHFA 2NO7A 2ZE8A 1VCMA 3SS8A 2D4HA 3SR0A 4IDQA 3BK7A 1AZTA 1G5RA 4OHXA 1KI6B 3NC1C 4D4LA 4GNKA 1NIPA 2PCJA 1X8JA 4HAXA 2HLDD 1CR0A 2GBLC 3CX6A 2EU8A 4IVRA 1J70A 1ZCAA 4P3YA 3RYTC 4D0GA 1J8MF 3BFXA 4TLBA 3ND8A 4BZQA 3KQHA 2BJWA 5AUNB 3AVTA 3HR8A 1XTSA 3B60A 5F9FA 1XTRA 1R10A 4GPTA 5FL7D 1JECA 4DT1A 4NCJA 5DH9A 2WWIA 4PPGA 3CB4A 1W49A 3HYTA 2CDNA 5CLQA 2WOOA 3AF0A 4YMVA 4DDTA 1ELOA 1XDBA 4W5JA 1E4YA 5DN6A 4ZDKA 3ZZUA 4FMDB 4A0HA 3W34A 4KYUA 4URVR 1MO3A 4GDFA 1K5GA 2Q3MA 2QU8A 4UXHA 2UKDA 2ZQ5A 2QPAA 1SXJD 5KPDA 1KKMA 1TQ6A 3K0FB 5GJBA 5CITA 4A2PA 1CU1A 2CHGA 2PX3A 3PEUA 3QQ5A 1XXHE 4M1MA 3VU9A 4HLDA 3BH0A 4LBVA 2EFGA 1WMSA 5D3MA 2FZ4A 3ZDQA 4ZCIA 1TF2A 4CEJB 3JZAA 1M34E 4CIDA 3THWB 4EPXA 1OH8A 2WKRA 2BKEA 2JATA 3BRWD 3GEEA 1EX6A 2XB2A 1Q44A 1BOFA 1H65A 2GCOA 1R0YA 2KJQA 1NSFA 1NSTA 1YZUA 3NIBA 4YMWA 4JLJA 1FL9A 2ZRGA 1NN3A 2CK3D 2JJ2A 5KHOC 2ZJYA 1ZVQA 4B71A 1ZCBA 4LBWA 1P3JA 4NCNA 1KSHA 1TMKA 1Q12A 3D3QA 3X1ZA 1DG3A 1EFUA 1CEEA 4PHHA 2C9YA 2VYFA 3X1XA 1XMSA 4BGDA 4B3DA 3LY5A 3TR0A 2D2EA 2B7BA 1RJ9B 3SE0A 5B2ZA 3UPUA 2Q3HA 4DSNA 1E2JA 1R0WA 4HZUB 3UK6A 2ZRLA 2YOGA 2V55B 1YJ5A 2D7CA 3BBPA 4NMMA 4WW0A 1N5IA 4W7SA 3RS2A 3EPJA 1NN1A 3IHWA 3K8YA 2VQSA 3AM1A 2IF0A 3H2YA 4M1SA 2ZAOA 4LBZA 4EPVA 1U8AA 3LV8A 5JECA 1Z0FA 2J1LA 4LC1A 1U90A 1E0AA 3KKPA 2PBRA 3PR1A 4YDSA 3F3YA 4OK6A 1VG8A 1F3OA 2DCUA 4LGMA 5TDHA 1AGRA 3RDPA 3V00A 5GVRA 2FJUA 3B78A 1OH5A 1PUIA 2XAUA 3IGFA 3A1UA 1Z63A 3BB4A 1UBCA 4ZI3A 2FWRA 4BECA 1XX6A 5K8IA 4BASA 1GFIA 2VHCA 1ZC4A 4C0LA 1SKYB 3ZS9A 4OJKA 2JIZD 4XTCS 1ZINA 1ZIPA 2F1IA 2ODEA 1XB2A 1AS3A 2NPIA 4XIGS 2YVUA 2FF7A 2VF8A 5H68A 2GCNA 1Z47A 2QQEA 3LXXA 3T35A 1OIVA 4B48A 1NVXQ 2XOKA 1VCOA 4Q7KA 4D81A 1F2TA 1G5TA 1N3BA 3Q5EA 4KBGA 4Q1DA 1E1RA 1TF5A 3W5JA 2QE7D 4BFZA 1JI0A 3VHXA 5AJXA 3REGA 1KO1A 2G1KA 4MQBA 1J8YF 5KSOA 2ZXUA 2WM9B 2F9LA 4BEBA 1TUIA 2ZRCA 2ZUBA 5FTNA 1L2TA 4NL4H 1E2IA 3TJZA 4HAVA 1E2PA 4MYTA 1SKYE 2AR7A 4ESVA 3GLGA 1KY2A 1TPZA 2W6ID 5FI0B 2GVDC 4EUNA 1G3RA 3E70C 2H92A 5FL7A 1HUQA 4XH9B 3I8SA 4MRNA 3CR8A 3E5HA 2A5JA 2ZJZA 2R2AA 4WAUA 2HXSA 1BYUA 4Q9IA 1DPFA 1S1MA 1OW3B 3D6TB 4GMDA 3UMRA 3AF1A 2FMXA 3PJRA 2CE7A 1T4GA 1S3SA 4PPNA 1MV5A 1JQLB 2C95A 4V03A 3QXHA 2HF9A 1LF0A 4GOJA 4BLOA 2PL3A 1Z6GA 3FWYA 1VTKA 1SXJC 4D0LB 2GVZC 1GL7A 4N0EA 1G6OA 3OZXA 1W5SA 4Q66C 1S2MA 2O0KA 1GKUB 4N1AA 8OHMA 1E98A 4GP6A 3SBEA 1R4AA 3U4QA 3PEWA 1UFQA 2ATVA 2QY9A 4TL7A 5G41A 2XB4A 4TL6A 4IXMA 3CH4B 1G291 1QG4A 4JJKA 2O8FA 3QKTA 1UM8A 5HTKA 4DEXA 1E2HA 1P2UA 2XXAA 1X1RA 1Z0JA 4IDOA 4NHOA 3B1WA 4NU0A 2O8DA 1OFIA 2IXGA 121PA 4ZI2A 3AVPA 1VYTA 4M1TA 2C5LA 3NVAA 3R7WB 1OLOA 1ZNWA 1E6CA 1AQUA 4JLDA 3IPXA 4FI3C 3PG5A 3L0PA 4A36A 1XD2B 3OIVA 5FUYA 1PJRA 2C2HA 3WP1B 4D80A 4GRAA 1LTQA 5JWHA 4D6PA 1E99A 2RGGA 2PJZA 2WZQA 2IS2A 1P60A 1OT3A 1E9EA 2W00A 4EIWA 2DHRA 3Q72A 1F2TB 4MRRA 5BW8A 4O0MA 3C5HA 3IILA 4RVCA 1E9BA 1X1SA 4EAQA 1T9HA 4PC1A 4DVGA 2JA1A 4Z8YA 3I8XA 3SFZA 4IFEA 1V5WA 3DKPA 4RZ3A 3BJIC 3MGCA 4M9XA 4PHTA 1NVVR 4LPKA 4H1VA 2QN6A 1N6PA 1ESMA 2PX0A 3DO6A 3W9YA 4TLEA 1KMHA 1T5IA 2F1RA 4XSGA 3L43A 4IW3B 1A4RA 2W2VA 3I61A 3CNOA 5C4GB 4TTRA 5SZJA 2GZHA 1E2NA 4M1OA 2FEOA 4DT1B 4GI7A 2CBZA 2FA9A 3C4JA 3QF4B 1FQJA 2IL1A 2CVFA 2AD1A 4JMPA 5AWFC 3NDBB 2F7SA 1GOTA 2W6JD 3P32A 3UKDA 4B3XA 1GRRA 1GZSA 1GG2A 4MUBA 4M53A 4TL8A 3KJHA 4ZKEA 3AKDA 3B7GA 4LC0A 1JR3E 4PZZA 5KSZA 1OE0A 3O8CA 4TSFD 1IQPA 5AUQA 3BXZA 3IIKA 1N6NA 1XEWY 2RGEA 4K46A 1D8TA 4GZLA 4Q1AA 3RHFA 1NY5A 2J7PD 1ZRHA 2P6NA 2AFIE 1OXTA 4LV5B 2QAGA 3QPVA 4Q1EA 2V1UA 1MKYA 4WIAA 4BFXA 3TE6A 3GQBA 3N2EA 3WBJA 4JBWA 4DCVA 2O8BA 2WPDA 1OH7A 2CCGA 3KKQA 3MMPA 2A5FA 2ZETA 1HQCA 1N25A 1OXSC 2W83A 4NE2A 2OLJA 4FD2A 2WMOB 1T3LA 1IJFA 4WBSA 4CF7A 4P4SB 1ETUA 1G8YA 1JNYA 3LRPA 4NONA 2WJGA 4Q18A 2OUKA 1IONA 3HP1A 1W1WA 3K0AB 5HKKD 2V8OA 1HYQA 4TN1A 1MH1A 2DB3A 2D74A 2VBCA 2X1VA 2QSZA 3ETLA 1KAOA 4QNMA 1SHZA 4AC9A 2ZUCA 1U8YA 4HAWA 4G01B 1PLKA 2QTFA 1BMFD 3VHLB 2JDID 5ANRB 2IXFA 4M22A 4GFDA 4IDNA 1F2UA 5CYPA 3N5CA 2GCOB 4NPHA 1ZD1A 4GL2A 3KFVA 2E1RA 4L9WA 3VX4A 3ADCA 1RW4A 4A0GA 2GEUA 2ZRKA 1AKEA 3W90A 4HAZA 1CKEA 4ITRC 4L5BA 2P5SA 1QG2A 5GJWC 3QE0A 1OXXK 1IHUA 1UKYA 1GWNA 4TTQA 3L2OB 3IIJA 2B6HA 4BFWA 1II8A 5EP3A 4XWKA 1HE8B 5TXGA 1P75A 2VP0A 3TW4A 2OESA 4KXFB 2ZSFA 3QENA 1RJ9A 2FSIA 3TK1A 2BHRA 3WYAA 3QJYA 1XP8A 1WXQA 1E1QA 3GJ0A 4DIEA 1BYIA 2R9VA 2ZI7A 4Q48A 3VR6A 1R7RA 4DB2A 1CJMA 2OT3B 4O25A 5EE0A 5DE3A 1G7TA 4QBHA 3TBKA 1CRQA 2F3RA 2F6RA 5FPHA 4DEYA 2NMVA 5DISB 3W3ZB 4C0SA 1MRNA 2J46A 1RVDA 1SVIA 2YJTD 3V4FA 4BFUA 2F1HA 4HLCA 2C77A 3GLHE 2PLRA 3ZVMA 2CNWD 5FBLB 3QVVA 2TMKA 4KODA 5FBRB 2ZTSA 5E7MA 4Y0AA 2OCAA 2ZRFA 1VIYA 3UG7A 1HTWA 2WHXA 4B75A 1L4YA 2IF2A 5JZVA 4UXIA 5CB8A 5HE9A 1KIMA 3HPQA 3FMFA 4W9MC 4B2PA 2L0XA 3FVQA 3BB3A 3T5DA 1RRPA 4HDQB 2IUUA 2FH5B 1F6BA 1VIAA 2RGNA 4PFSA 4Q21A 2ZPTX 4BWYA 4FCTA 5DGXA 3FHOA 4D0NA 1N2CE 1KKLA 3CR7A 3U5ZB 4DDUA 1E2FA 5J40A 1E9RA 4TZ6A 2HF8A 1FFHA 1KI9A 1DG1G 3K70B 1ANKA 2IT1A 4IVPA 5SZHB 1C4OA 1HE1C 2ZRPA 4I81A 4Q1CA 2CL7X 3HR7A 4PAMA 4RZXA 4URZR 4B33A 4GMXA 2DPXA 2OCPA 5AJWA 5K8UA 3BH7A 4WZ6A 3MAAC 3NTUA 2ZSAA 2N42A 2J3EA 1R5BA 2KSQA 3Q85A 4L4UA 1XTQA 3K09A 5DN6D 1XEXB 4P32A 3ZIAA 4LSGA 5KUTA 3QY0A 1S96A 1KSGA 3HJNA 4LI0A 5KDOA 2RKOA 2HJGA 1T0HB 3LBIA 1AZSC 4A2QA 1WE2A 1KK1A 2BMDA 1N6OA 4FIDA 2O0HA 5BXQC 2QBYA 3OEHD 3OEEA 3EZ2A 2IS6A 1N6IA 2YZ2A 1ZD8A 2WV9A 4ZPXA 3AVXA 2JLQA 2NO0A 3ZYCA 2JLYA 4ACBA 3WY9A 2MMCA 2H17A 1YR7A 2OEPA 1DAFA 4FCVA 1NVUQ 1E2GA 1YE8A 4FINA 3GJ3A 3RLFA 1FTNA 2D3WA 3AV0B 3KB1A 2ZS7A 3AVVA 1R0XA 3GLHA 3IO5A 5FOVA 3HWSA 3AB3A 4O2RA 3BFKA 1CR2A 1E69A 1NI3A 2BDTA 3RAPR 1P61B 3CH5A 4ASUD 1G8GA 2GJKA 1I4TD 3OFND 4U02A 2IYYA 4Q7LA 4JLKA 5LBIA 4C0JA 1N6KA 2SHKA 5FUXA 2Q21A 1NG9A 4ON9A 821PA 3PCRB 3KUCA 3FHCB 3PUXA 1UAAA 2O8CA 1W4BA 4MYUA 4MRSA 1MO4A 2D2FA 1E2KA 1A2BA 1P62B 3ASZA 3RANA 4CGZA 2OSBA 1LFDB 3FFBA 3W3AA 2OZEA 4IRUB 3RC3A 1M7HA 4QGGA 1COWD 4P4TA 5BYKA 1IN7A 1JB1A 2BV3A 2IYLD 4RD4A 1I4DD 2Y8EA 1T8TA 1VYVA 4TMVA 3VQTA 4BFYA 4D4KA 3NH6A 3EC1A 1VHTA 2CEAA 5G53C 2AK3A 1XRJA 4AURA 1E2QA 3VR5A 1DAHA 2IEYA 4UNQA 4U5XA 1OHHD 2PMDA 2WSSA 3NC0C 2J45A 1S1CA 4Q5IA 2XNSA 1XPRA 3TIFA 2FPLA 4TL9A 3UMSA 5FUWA 3DM9B 4ILEA 3S1AB 2P5TB 3QF4A 1N0WA 4B44A 1GM5A 1VKJA 4CRWB 4A8JA 2KB0A 3SJBA 2BCGY 1I4LD 3GJ5A 4LHWA 2BIFA 4MYCA 2PCLA 3MWJA 4DKXA 3TKLA 4B3GA 2V6IA 4TMKA 4E07A 2V3CC 3BIFA 1M7BA 3LA6A 4US0R 4KFRA 3IUYA 3C41J 3R9WA 1GP2A 5J4VA 2ZRDA 4CYMA 2ZJ8A 2HYDA 4KFUA 3KQUA 1EFTA 1W4CA 2WIBA 5CM8B 2J7KA 1MRSA 2AD5A 1TUEA 1U94A 2RGNC 3AH8A 5TB5A 4A8JC 5J4LA 2ZI9A 5EQTA 3EW9A 4B34A 2VEDA 1Z5ZA 3D31A 4URYR 1G8FA 1AS0A 3MRSA 2G9NA 2V9PA 1X3SA 3H0KA 4KITB 4WXPA 4KU4A 4URXR 2QAGB 2VLIA 4WA7A 4Q47A 3U3RA 1FTSA 4V0KA 4DLTA 2V6JA 3K0AA 4PAQA 2IX3A 4Z54A 3VAAA 3B1VA 3MWLA 5JRJA 4TMWA 3QNUA 3M6AA 4R98A 2ZE7A 3VTKA 1JPNA 4RFSB 3TQCA 2DBYA 4F38A 2D62A 2FPKA 5CDFA 1KO4A 4MGIR 5IF9A 2ZRJA 2N46A 3SQXA 3BOSA 1OPXA 1P9NA 3F0TA 1RIFA 1EFHA 2ZRIA 3U3OA 4JS0A 1HY3A 5EE9A 2NGRA 5JMTA 1XTJA 4D25A 1Q22A 1GILA 4LHYA 2O5VA 1KO7A 1JXMA 1M2OB 1H8HA 5JSZB 3O47A 4JKIA 4PTLA 2NO1A 1XD8A 1Z2CA 4M9ZA 2Q0HA 3DL0A 3RRMA 3LVRE 3ONWA 3MLEA 4BFSA 3VNVA 3CO5A 2G3YA 3QIAA 3TMKA 3GLIE 4B2IA 3QKSA 4M1KA 1FZQA 1SZPA 2GK7A 2X19A 2IYQA 3L8YA 1Q0UA 1C9KA 1ZP6A 4Q03A 2BBSA 3GFPA 2A5YB 3H4MA 2NO9A 4JZKA 3RWOA 1XMIA 1T91A 2IUTA 3EZ6A 2QA5A 1U0HC 2F1JA 2EWWA 1BMFA 3QXJA 4K81B 3VR2A 1Q57A 2BBWA 2IW3A 2XZPA 4P33A 3RS5A 3WYGA 3VKWA 2GXSA 5H1YA 5KTYA 2QP3A 5ELXA 1ZUHA 4Z1MD 1F5NA 2OAQ1 2ZJ5A 1SKQA 1OF1A 5B58C 1XCMA 4Q9JA 3U4QB 4MKHA 5FOXA 5SZIA 1C1YA 3NG1A 1DO2A 4URUR 3TRFA 4D82A 2JLVA 4F7WA 3B6EA 2Q9AA 3JVUA 2RMKA 4KLZA 4LJ6A 2O8FB 5EZ6B 3B5JA 1E9DA 1H8ED 4ZDIA 1JXOA 1RE0A 3PUYA 5E4FA 4A4DA 3VKHA 3U44A 3ZVRA 4YMSA 3D8BA 1R8SA 1UBGA 4NYMQ 5EUQB 3I5XA 1FPMA 2CJWA 2FN4A 2F55A 4DBLC 2VSXA 3PUVA 1IN4A 4L15A 3KXKA 5FBVB 1Y3AA 4PANA 1DVRA 1EFCA 1XD2A 2NQ2C 3U7HB 1W47A 1O87A 3DMNA 1NBMA 3SN6A 1OIWA 4RZ2A 3CW2A 3QG1A 3O8BA 3AGPA 1EXMA 3CPHA 2QP9X 2QMHA 4PR0A 1Z07A 4RKEA 4IDPA 1D6JA 1RZ3A 2ANBA 4EPRA 2JIZA 2I3BA 2QI9C 5J4KA 4RZUA 2GCPA 5DYIA 1A1VA 4XSHA 3T5GA 1G18A 4OYHA 3SDZA 4HLUA 4JLOA 4DCSA 4M9SA 4HAYA 2HCJB 4LPSA 1CXZA 2ORWA 2BBOA 3A36A 5LPNA 2B21A 1P73A 2VIIA 1CJVC 3I32A 3BE4A 4C3ZA 2BMJA 3AQ4A 1JR6A 3LH5A 4AKHA 1NBME 4WZBE 1PLLA 2BJVA 4LHZA 4Q7JB 2VP2A 1HA3A 4Y0VA 4YLGA 4C7OA 4AKGA 4G5QA 5JEDA 3THXB 4OQLA 3G0HA 1G3IA 5J4YA 3LDAA 1DARA 5H70A 1JJ7A 2WOJA 4GT1A 4LUCA 5CM9C 4UJ5A 1U9IA 4JBYA 1N6HA 4IEIA 4YXWD 5EP4A 3TGPA 2BEJA 4QGFA 3SZRA 1YR9A 4C4PA 3WRXC 2BM1A 4PC6A 2HCBA 1A5TA 4JYCA 1QHHB 2BC9A 3ICEA 2I1VB 4I1SA 1IXZA 4NYIR 3LX8A 2R62A 2HV8A 5KYKA 1EG7A 3QPUA 5KO2A 4KI0A 4MRPA 2ZYUX 2XJ4A 2Z6VA 3RABA 4LRWA 4TYNA 2GF0A 2QL6A 2ZS9A 1JEEA 3GJ4A 1GL6A 1Q1EA 3NDPA 5HE8A 1TQ2A 1XBTA 4LK2A 2MSDB 2ZI4A 3P4YA 621PA 2E9SA 4P31A 3KQKA 4KSCA 3W8RA 4Z1MA 1W36B 2JASA 3DDCA 1AKYA 1XCPA 3QSYA 2CVHA 4PX9A 4ZIRA 3KFXA 3GLIA 2NOAA 3TNFA 4AWXA 3A4MA 4JLMA 3EZ7A 1TEXA 3DPUA 4MRVA 4RCYA 3PENA 4RFVA 5TMPA 3A1VA 1ZUNB 1SXJA 1W2GA 1ZNYA 4I4LA 1OFHA 2FG5A 2QAJA 4QBFA 3E1SA 3TAHA 1WB9A 4DXAA 2EYQA 3UIEA 1W0KA 3QEJA 4M1WA 1UEIA 1KSFX 4BZXA 2OFWA 3QBVA 3A1WA 1PZNA 3RS4A 4EJSB 3AP3A 1SVLA 1X6VA 3EARA 3KL4A 3QKUA 4WXRA 4OI0A 3T61A 2GZAA 1IY1A 5TV2A 2EVWX 4PO8A 4POAA 3DZDA 3SFVA 1NKSA 4DSOA 3OAAD 3QXXA 4ZO4A 3CONA 3WNCA 3H1TA 2B7CA 2QAGC 4QC2A 2FE4A 4XTRA 3MUFA 3IPYA 4FCWA 5DLQC 4HI0E 2BBTA 3SU8A 5AK0A 1U2RA 3EASA 4Q4HB 1L8QA 4EQ6A 2IS4A 2FV8A 4V0NA 2WWFA 4F91B 1OXUA 2H16A 4CEIA 2YOFA 2Z83A 4OL0A 1Q1QA 3U3MA 3RRZA 1NLYA 1QHYA 4BLTA 3K09C 3ZJYA 4BPBA 5FOUA 5FTJA 2WWHA 2J9RA 1IAQA 2J0UB 2NO6A 2GDJA 3ZZTA 3SI7A 2V7QD 4E03A 3X1DA 4KVAA 2ODNA 1LVGA 3MJRA 4I99A 4QJ4A 1YZKA 1Q3HA 3SYNA 1MABA 4RD1A 5K8TA 4ARZB 3OE7D 5CDFE 3RVBA 3M1IA 2BOVA 3CLVA 4UNPA 1OKKD 4DC9A 2QENA 4FMDF 2ODBA 4M2LA 4S2EA 1WCV1 3BS4A 1N6RA 4LHXA 5FBQB 4B73A 4D2IA 1J2JA 2ZE6A 1A2KC 4NCHA 4RSGA 3L8ZA 4DCNA 5BN4A 4RFSA 3TSZA 5CJ2A 2DFKB 4AIIA 4F4JA 2XEXA 3THWA 3WRYC 1LS6A 2XGJA 1ZIOA 2YC2C 5EXTA 1OYYA 2ERXA 4NKRA 2UVQA 3SQWA 3KJGA 1XD9A 1VG1A 2ZRMA 2W0MA 3KKOA 3Q9LA 4JVNA 3EPKA 1P5ZB 3PVSA 4BLSA 3CX7A 5KNBA 5L3QB 3GMTA 2WAYA 4HUTA 3DKVA 4ASUA 2QPOA 2KBEA 4PZLA 2PEYA 1KO8A 5AUOB 1OIXA 3BERA 3U61B 1FMLA 1WRBA 4QGHA 1YVDA 4G5SA 4AKEA 2HT1A 1P6XA 2QORA 3CPJB 2YINC 3ZD6A 2QZ4A 1E0KA 3ICQB 2OBLA 2R8RA 3QF7A 4DSUA 3DVLA 1SVMA 2Z4RA 1VDZA 3LLUA 2BM0A 3DEFA 3QPWA 2LCFA 1YRAA 2QBYB 2CK3A 2JJ2D 1GITA 3OEHA 3B13B 1JAIA 2GJSA 4M21A 1LF5A 4RD0A 2AN9A 3VX3A 1TADA 1DAIA 1QRAA 1UBEA 5E7IA 2ZRAA 4XD7D 3T1VA 4EFNA 4JT2A 1Z2AA 3SEAA 3FMPB 1G19A 4V0LA 4O2LA 4RD6A 3QOFA 2XNDD 4U00A 2GWHA 2OBNA 5FTLA 2JDIA 2YWHA 3FDIA 4R2IA 2W2XA 3KB2A 1KI7A 2IYWA 2J0UA 3I73A 3W6NA 2C9CA 2FZLA 4AYXA 4QHTA 3ADBA 4BUJA 4DJTA 1US8B 5A5GA 1PV4A 3ECCA 2JJ1A 4UKDA 1E0SA 3QKRA 4TWZA 4DLXA 2YHSA 5LD2C 1LS1A 2G1JA 2ZJBA 2ZU0C 3J81k 3B8HA 2V7QA 3SHWA 3FE2A 5JCZA 2PT5A 3VR1A 2EWVA 2BMFA 3AKEA 1NRJB 5JI3E 5JRZA 4Q9KA 4DDWA 4IHQA 4M0LA 3FPAA 1CULC 1G1MA 1YU9A 2BWJA 4DLZA 5FFMA 3QI2A 2IBMA 3PEYA 5E3HA 3PEVA 3L82B 3I4LA 1RFLA 1J99A 5J47A 4DLUA 3DM5A 2LKDA 3FTQA 1KJZA 5FOTA 2VHTA 1EFRD 3ZQJA 3I92A 1DBSA 1JR3D 4RKFA 4JKYA 4QHYA 2C96A 4YQFA 4Q02A 1E9FA 4Q4AA 4I1UA 4XJXA 4EPWA 2AXPA 4A8JB 2JLWA 2WBLC 5DSZA 1W4AA 1NVVQ 3HDTA 2A7QA 1P2SA 2D06A 3HPRA 4M1YA 5JS8A 1QZXA 2YOHA 1DTSA 4MKIA 4NYJQ 2PJRA 3AVUA 4PHFA 3THYA 5HZKA 4JSTA 5JHHB 1YZQA 3B1ZA 4LDJA 4X8LA 4PC7A 1NJGA 5DIFA 4HB2A 4G3XA 4CT4B 1N5JA 2F3TA 4TLCA 1KSJA 1VCNA 2PEZA 3PV0A 5CJPA 3AUYA 3UANA 2IYUA 2CL0X 3DMDA 3NKVA 2VF7A 3LWNA 2Z43A 1T0JB 4G5OA 3T12A 1OJLA 2W6JA 3HU1A 1ZNZA 5CYOA 3DHWC 1M8PA 4BFVA 3ZH9B 4JL8A 2O52A 1IN6A 1DELA 1VG0B 2UZIR 4W5WA 1NIJA 2RCNA 4MUAA 4EPTA 4C0HA 2WAXA 2IYXA 2GJ8A 5FOWA 1FQKA 4LCBA 1R5OA 5C18A 3DOEA 4IOMA 1R6BX 4YXWA 4QJ5A 4PO9A 4MITA 5CIQA 2GK6A 1KNXA 5SZKB 1Q3TA 3M4YA 1N6LA 2G0NA 5D3MB 3ADKA 4MYHA 1X8LA 2ZR9A 5BN5A 3RS7A 1K6MA 3EIEA 2O8DB 3U6BA 4NDZA 1AS2A 5D3QA 2C98A 1XZPA 1QVAA 5FR2A 1S8FA 3CZQA 5JS7A 3FKSD 1Z29A 2E87A 2WJYA 1JJVA 2ZRBA 4NH0A 1KI6A 2WJHA 1KAGA 2JLZA 4QG7A 2PZFA 3IEVA 3GPLA 4BE7B 3RNLA 4G1UC 5JWOA 2HYIC 4PQYA 3FFAA 3MCAA 1G9XA 3ZVLA 5EJEA 2QUZA 4AG5A 2H7VA 2YWGA 2OFOA 1W44A 1UBFA 4HUQA 3R8FA 3QKSB 3L0IB 1I2MA 1QDEA 2AK2A 4PPFA 2P67A 4FW9A 5IT5A 1CRPA 4IVQA 1GSIA 3LLMA 521PA 1E96A 1NBMD 5TY0A 2FOLA 1E94E 1Z08A 2DFNA 1VYUA 5EZ5A 2H18A 2IC5A 1U81A 3OHMA 2HJVA 4KSBA 3BD9A 1U98A 1W46A 1FNNA 2F9MA 2VPPA 1FMJA 2IYTA 2R65A 2IS1A 2WWWA 2ZREA 3NXSA 3JVVA 3SJCA 1E2DA 2DWPA 2NZJA 3PITA 4JL5A 1VMAA 4AG6A 3K0SA 1OV4A 4C30A 1XFAA 3C14C 3CF0A 4J0QA 2C03A 3VFDA 1IY0A 4PSVA 4D4MA 4D4JA 4IEEA 1KZGB 2OFXA 2JJ1D 3CNLA 3IIMA 4OBEA 1OH6A 4L8GA 4UNRA 2FSHA 4LJ4A 4TQAA 4P0TA 3CBQA 4R7ZA 1F48A 4DWJA 3K0CC 2REBA 2NTYC 5FPYA 3ZVNA 2V4ZA 5EUMA 2VP5A 3AVOA 1QHNA 2XJ9A 3FYHA 3RWMB 1R5NA 4JLAA 2IA5A 4TQUS 5KSPA 4LOAA 2JCSA 3I1FA 1P9RA 2NZ8A 3NH9A 1JAHA 3HYRA 1FX0A 4TYWA 4HLUC 2O8EB 1RYHA 4BQSA 1G5PA 2IWRA 5KDDA 1FOEB 4Q19A 1E9SA 3AP1A 4Q4JA 3U3JA 1ODFA 2ATXA 3N70A 1RRFA 3WNDA 2QQ0A 1G17A 2IK8A 2DYKA 4BLRA 4WOPA 1XU4A 1QVRA 1KYIA 2XTZA 1ZBDA 4TYYA 4TSFA 4BZPA 1UEJA 2ERYA 4NZYA 1KMHB 1LY1A 1UKZA 1J90A 2K5UA 4KCGA 4TMZA 2YYZA 2RGXA 3K9HA 1E4VA 5C2JB 1A7JA 1CJTC 2EFCB 3FKQA 1MR3F 3I72A 3RRYA 3W6OA 1OKKA 3TH5A 2NIPA 1G3UA 1KTVA 1IOZA 1HURA 2Z5FA 3CUEF 1XNJA 3KTAB 4DCTA 3EX7C 2GETA 1XJCA 1HV8A 5KU1A 3LX5A 2VHJA 4A15A 1P7CA 3NHBA 1M7GA 2AX4A 3PUWA 3IKJA 1WDTA 1FUKA 4UNNA 1B23P 2ODWA 4A0RA 2G83A 4AKIA 4KAXA 3GCGA 2AWNA 1ONBA 2OO7A 1GRNA 2GZDA 3MWYW 4IDHA 3JZMA 2WWYA 1WF3A 1CJKC 1SVKA 1W0JA 3UATA 4B2LA 4S35A 2OM2A 4Q9HA 4Z51A 1T8UA 5A0FA 4ZDJA 4KFTA 1DOAA 4PXAA 2FPMA 4GOXA 1E2LA 1NN0A 3FHTA 4JLVA 1UDWA 5EXPA 1X8KA 1L4UA 4UNSA 4IKEA 4KHZA 1J7KA 1IN8A 3MWKA 2IYSA 4TYPA 4LYFA 5BWMA 1XPOA 4QM7A 3EIQA 5BQ5A 4UXJA 2F43A 3QXSA 1WA5A 3R9IA 4DUGA 3A1SA 1E79D 4KJZA 3R7WA 4PSAA 2RH5A 5BN3A 2DFTA 3ZD7A 1G7RA 4DLRA 1E1QD 2R6DA 4XVUA 3OFNA 1Z6XA 1NMXA 4ZIRB 2EW1A 3UWOA 1K8RA 1HT1E 4GZMA 2G88A 2WMNB 4PQRA 4N3NA 2RGAA 4R2HA 3GLGB 2A5GA 1NF3A 4AYWA 5JJKA 4WZAE 3SHFA 1GKYA 4JYBA 5L3RA 3X1WA 3AEZA 2VHQA 2C8VA 4HEJA 3QKRB 3GLGE 4CVNA 1XXHA 1QBKC 3TSWA 1TU4A 4B6EA 1U9IC 4QGAA 4XVQA 3V9PA 2GXUA 5FUVA 1VCIA 4NYMR 5JHGB 3B2EA 4FMCB 3QXCA 3U2QA 3C5CA 2W58A 3VKGA 2FEMA 2P6UA 4Q4AB 4KO8A 4PHGA 4EPYA 4B47A 4EJSA 4XWAA 2XZOA 3DOFA 1BH2A 1GUAA 2WIAA 1Z0KA 1ZM2A 4PPQA 2B8WA 1ZU5A 3LW7A 3T1QA 3A37A 4OK3A 1BS1A 2REXB 2ZYVX 4HDCA 1S0UA 4QRHA 4TYQA 3EPLA 2G77B 1GKIA 2Z0MA 3IQXA 1PLJA 1II8B 3LBHA 2Q3FA 2ANCA 4RD2A 3O8RA 1SULA 1QHIA 2VP4A 2PLFA 3ASYA 4GSYA 3GP8A 1W48A 4LY6A 4HAUA 3IBGA 4NTZA 3EIHA 3HU2A 5LDDC 2JLXA 3KJEA 3GFTA 2A30A 4IOLA 2PH1A 3R8CA 4IJMA 4A9AA 4XVRA 5FI1B 4AYTA 2ORIA 2YNMA 1KZ7B 1E9AA 3G82C 1GRQA 1NL3A 5P21A 1YKSA 4MKFA 1T6NA 1KHTA 2EFEB 3N2IA 5F98A 1ZC3A 4Q1BA 721PA 2KWIA 3WMEA 4TT3D 5FOSA 1D9ZA 3X2SA 1E3MA 2P3SA 2HLDA 5K8LA 4HZIA 5DNYB 5DHAA 4MDEA 3P1JA 2WPDD 4U7DA 5L8VA 1M6NA 3K9LA 4XOIA 3U7FB 2XXAB 1TQ4A 1US8A 3OEED 3FGNA 4ABYA 2P6RA 3PIRA 4KVGA 4YC7A 4G5GA 2O8CB 2XZLA 2H8KA 1RYFA 1S9DA 2OCBA 1G21E 2F43B 4QM6A 2FNAA
chains in the Genus database with same CATH superfamily
3ZGXA 1Y1KE 1KAQA 3V3KA 1XZHA 4HWSA 1MAVA 4KL8S 4MWDA 4BEJA 2BFFA 5KKCA 5LB2A 1Z8FA 2WIJA 1EINA 3FOBA 4FR0A 2JF0A 3IUEA 4XEHA 4ZOBA 3RM3A 3WWZA 1KU6A 4FYYA 4UFNA 2JZOA 3M9WA 1XJ5A 3GBSA 2QL7A 1ECFA 1CEQA 2W7TA 3I2GA 1RZRD 5GONA 5JH7B 2JARA 2YWCA 2UVDA 1EJ6A 1Z3IX 1Z06A 2WTMA 3PFWO 1F0NA 3WYCA 5LD2B 2I7TA 2OAP1 1UF9A 4MTLA 4DA9A 1NW3A 1KOFA 3UYLA 4GMHA 4BLQA 1LI5A 4HUQB 2FQWA 4NZPA 3HUFA 4UUNA 2V0GA 1F1JA 1GY8A 1ZMTA 5DYWA 2ID9A 1JMVA 1R0SA 2RHBA 1N0VC 1VLVA 1C0LA 1NKTA 2V59A 3ROTA 3WMFA 3ZWKA 4CT5A 3FPFA 1GTRA 1JQJC 1OLXA 2XNDA 5ECYA 3EEYA 2QP4A 1N7GA 1O94A 3OZUA 2WC1A 4JBXA 4XUEA 3SJAA 2ZSIA 1B8VA 3QE2A 4L9SA 2DR0A 1GKKA 3U60B 1WBDA 1CX9B 3HBLA 1ECJA 1T9KA 2H1IA 2WJIA 4L3OA 5K3FA 5LKRA 4AY4A 1O08A 4YCJA 3UF0A 2FPSA 2HIAA 4FHEA 3EEQA 4MHSA 3EPHA 1Y9ZA 2GBGA 4L02A 2BMEA 3Q7PA 3W8FA 4LDZA 4WECA 1Y4ZA 1X0VA 4XGIA 5A62A 2O8BB 3L41A 4HQNA 1GTZA 2HSDA 3AHCA 2R6CA 2Y66A 1EESA 5DYGA 1Z73A 4WNIA 3MXOA 2FDCA 2IEIA 3O4FA 4LVNA 4E94A 3H11A 4CUKA 4HB0A 1B43A 1JLSA 3OJEA 1U2GA 2VJAA 1Z0DA 1K3UB 5GJCA 2FDRA 4UBIA 3CIOA 5A3JA 3ZW8A 1BHSA 1EK0A 5KYYB 4HNAA 4BATA 3ZJUA 1QO0D 5K03A 4HGPA 1WMAA 1M0EA 1OSNA 5JCPA 1JHZA 2WF6A 1FU8A 2CDBA 1WAMA 3DC7A 1KK3A 5BV8A 3IEIA 4OMFG 2HSEA 4ZI7B 4P7BA 4UZFA 3LUBA 1MO2A 4NEHB 1Y6GA 3I2YX 3CZAA 4J1NA 1ZGCA 1S4QA 3I42A 1GPDG 2ZSEA 1USIA 4O08A 4HVTA 4P4SA 3OESA 1BNCA 1X8XA 3AKYA 3K31A 2QMOA 5EINA 1Y3BE 3EOZA 2GRJA 1XPUA 4J0IA 4GYYA 1Z6TA 3KVRA 2VH5R 4MUYA 3IVAA 3AR9A 4R1QA 1BW9A 2CHVA 3LYHA 1NBIA 5KAPA 4CR6A 1PYDA 2ZANA 5KTMA 4UJ3A 3D54D 2IHYA 1LQTA 4KYIB 5F3WB 2AJBA 1WPQA 3E3NA 2Z8YA 3T9DA 3LVFO 4PG7A 1OFGA 1KYVA 1XKQA 1X13A 5KSWB 1G8HA 2GAOA 3DMRA 2BUAA 4P98A 4ZYVA 5BVHB 3ZGOA 3KX2A 1UBKS 3RSLA 2WV7A 3GLFA 1Z38A 1ZJYA 2I80A 1U1IA 4UREA 1CUWA 3I62A 4BKRA 4Q4JB 2KLHA 1E5TA 1BMTA 4YRTA 4JX8A 2X9LA 5I7EA 2K7FA 1CF4A 5HR5A 5DMHA 1Z0SA 1MT0A 3NEAA 2FPXA 3EDYA 2JJ8A 4MW0A 3CJRA 3K4QA 2XDAA 4G84A 1O4WA 1A8HA 2BE9A 2DSNA 2E1PA 2Z98A 3C7TA 5KHAA 4BFCA 2YHIA 2YVQA 3OQJA 5E6UB 3AW9A 3GUVA 4YMIA 1QNLA 2R97A 2BSQA 1XEXA 1QRTA 1B0UA 3PQCA 3KYBA 1FP6A 2CY0A 4GHWA 4UDXX 3CNNA 1ZVVA 1TQDA 3AB7A 2MR6A 2WWGA 2W8BB 3B3FA 2NPFA 5TMBA 1JFRA 3DQPA 3AR3A 3JW8A 4QOSA 1PR2A 4WVFA 2NZ2A 1Y5NA 1UMDB 3P96A 2M6LA 1RWOA 3C3BA 4BO8A 1Z28A 4PLWA 2JD2A 4XX0A 5DBIA 4Z49A 4BRWA 2RHWA 3BFVA 3HE3A 3LPAA 4QQNA 4IFBA 4NFLA 5EWMB 3FNEA 4NRDA 3T1YB 4PVDA 4ZZIA 1TO2E 3L6DA 2QYOA 1L5YA 2RB4A 3ZN2A 3JD3A 1U99A 4JLNA 2G71A 2XB8A 1W6RA 2CVQA 2O2XA 3VO2A 5AM3A 5C4IA 1WP9A 3I37X 3JASB 3P0HA 3RVRA 5JXGA 1S3IA 1U31A 2R8BA 4BWGA 3I9OA 1V2HE 3O26A 3O31A 4YUYA 5IKEA 4GU5A 2AFHB 1A9OA 3TNJA 3QP9A 2WF9A 4MA0A 3RYHB 3U48A 1K89A 2FWBA 3R40A 4IY1A 2D8MA 2I91A 2JFGA 3QFSA 1V7CA 3TUJC 4Q3OA 1ZL0A 3V9AA 3CSDA 4OFXA 3AKZA 4O4LB 2H4JA 2HZ7A 2IRWA 3WO0A 3WICA 4D3SA 2A59A 2NNWB 5BWBA 3Q88A 4MA4A 2ZBFA 3TO5A 3CG0A 2FEKA 1HG1A 1Y8CA 2A4MA 4C78A 4DRZA 4EBFA 3CSUA 1FRVA 2LWIA 4X7BA 1Y63A 3L4EA 3U44B 5AXBA 2J87A 4ZEXA 4CKXA 3TRIA 5LZ9A 1G41A 3W1EA 1LLDA 5FHQA 1MFZA 2I22A 2R6JA 2Y1LA 4C6SA 3AB8A 1L4BA 3CF6R 4OQXA 5CGZA 4BCDA 3U09A 3IP3A 4G1MB 4PAGA 2XLCA 2R751 1Z5GA 2LV8A 1TKBA 4QYXA 4DLVA 2OHFA 1ZD2P 3L0BA 2NP6A 1PUJA 2D00A 5KU7A 1K8QA 3K35A 2UZ3A 3HMKA 2WE7A 3WL4A 1PGPA 2RC5A 3BC1A 1HNNA 3PYLA 4EI8A 2VDVE 3ECSA 5CK5A 1NTOA 4RY2A 1NVMB 1NAIA 2B5WA 1L7RA 5MGBA 2JD1A 3BPSA 3MXTA 4Y6GB 4DZZA 3ZQKA 3TLXA 2Q4OA 4YMGA 3ZD9A 5AFSA 3TXYA 3R2JA 4XLZA 3SVZA 1Z8HA 1XTIA 2LBPA 4DCPA 4KIWA 3Q2OA 4PLZA 3H86A 1ZAYA 4AMZA 4RE6A 5ARDA 1CQJB 4EW1A 1GGEA 2J6HA 3OIUA 1NRIA 3F6SA 2HREA 2IVFA 3U62A 3ZU3A 2C99A 3WNBA 2GYWA 2KQUA 4G0QA 4MO2A 1E3WA 1ZM9A 1LV7A 1CCWA 1SU8A 3PLRA 3QHPA 4QOJA 2ZULA 1ISGA 4NHOA 3T52A 1V8ZA 1GUFA 3X1JA 3VAYA 1AE1A 1P9LA 1IY9A 3L0YA 1ZCZA 1NY6A 3EZGA 4CTOA 3ELUA 5J5CA 3ZK7A 1VBNA 2RKWA 3ZEIA 2GILA 2ORVA 1FLVA 1QHHA 1YVUA 2X7HA 4H7PA 4B35A 2ZWAA 4XOUA 2V4MA 2E6KA 4WBNB 3I76A 3T3MB 1ILEA 1Y4UA 1JIVA 4FT4A 1MJGA 1Y1RA 2UZ1B 4DLPA 1YBHA 5GQSA 4HWKA 4ZKDA 1TNDA 4P2GA 1WXFA 2FZKA 3DT9A 3B9RA 3FKJA 3IBYA 3IEUA 4ES6A 4OLJA 2MSCB 5B64A 3P5BA 4XUCA 4ZHQB 1O97D 2BHLA 5LA6F 2B3TA 2IHNA 3WYNA 5EP2A 4NBSA 1H6BA 2H9AA 1IWOA 4TZ0A 4PSDA 2FQQA 2Q5IA 2ZKIA 6GPBA 1U8CB 1VZ2A 3GNTA 3CB2A 3PUIA 3ILXA 1CRWG 2ZP1A 3KLNA 3VSBA 3TOVA 1GCIA 2P9ZA 3HVKA 5HG0A 4AY5A 2Y1OA 3NTOA 1GTMA 4AF7A 4U6QA 1RHUA 1DC8A 4AM8A 1GLNA 4XAQA 1G6HA 2DFDA 4CG0A 2AE1A 2FUNB 3EN0A 1JG1A 1H05A 1SG9A 2M98A 5BT9A 1Z0ZA 2CHFA 3ZUGA 2VP6A 1Z2OX 2C9ZA 2UYQA 3UT5A 5A5DA 2IH4A 3EVFA 1BXRA 3EXFB 3I09A 4H59A 5AR1A 1DAMA 3RS0A 1AQYA 5AIAA 2A3RA 1OXBB 3T0IA 2IHTA 3TTTA 1P2VA 4H1UA 1JR3A 1SXJB 1GNSA 1S2NA 2VKQA 3A7EA 3QUSA 5E9JA 1MORA 2WFZA 3JZDA 3RVJA 1ZAKA 3T15A 3UW3A 3K1TA 3RHZA 3R8XA 4C7BA 1OI4A 1JHYA 3N0WA 1CUHA 4FBGA 4LX8A 4N39A 4UHHA 5JSZA 2GZSA 5AJVB 5KTSA 3R09A 4GG1A 2DCMA 4MV6A 4G4GA 4X5OA 5EHGA 2KHZA 4G2TA 3Q0IA 1PS0A 3WX0A 2YCBA 4W9NA 3K70C 2C7OA 4E5UA 1JHRA 3RJZA 4A92A 3ND7A 1RI1A 2AN4A 3K53A 1WXWA 2ZYTX 4YP5A 3THXA 4XDYA 2O20A 3EQ7A 1MPTA 1QX4A 3LO5A 4M0KA 1U4NA 3W8NA 3T1TA 4DLAA 3CWZA 1IXKA 3G6KA 3ANXA 4BRSA 2FX3A 3P45A 4IMPA 1CIJA 3MRXA 5IMSA 4DTIA 3M83A 2OVFA 1D2CA 1FSGA 1L1RA 4HXFB 4M9RA 4UHKA 1WHTA 3KSZO 4YP9A 3RWBA 2LGJA 3TZHA 4AJ2A 2I8CA 3O8DA 4IF6A 4C0AC 2QSUA 3CEAA 2FP3A 3CRMA 5F4BA 2C0CA 5L3SA 1J6UA 4LHVA 1JV2B 5CW1A 2Q6TA 5ABPA 5JJLA 4R1OA 4XFJA 1N1GA 5I48A 1DAEA 1DO0A 2HJRA 4ZAZA 2J59A 3BHJA 3VSEA 1LGYA 2QLBA 2QM3A 2QUJA 2XCUA 2YZNA 3NKLA 3V2UA 3ETCA 1DAKA 2CFTA 2P0EA 5BYAA 4GF5A 2CDRA 6Q21A 2W4IA 1OTHA 1YR8A 3UGKA 2RI1A 3ZS8A 4CTJA 3UUEA 1V3UA 3OI7A 3QVUA 3LUAA 2L18A 2IIQA 3MTQA 4P7GA 3HCOA 3W2IA 4LGCA 3X1KA 4F4HA 2HMTA 4P81A 1VB3A 1FP1D 2W48A 4TTPA 3UWPA 1TL7C 1GGMA 221PA 2XI4A 1B1CA 1E6LA 1I7SB 2GZ3A 2FYTA 5EC8A 3R3VA 1PG0A 2OV3A 1QP7A 5LMZA 1USUA 3Q15C 1GL3A 1QV9A 2PS9A 2XYHA 1XJ0A 2P2DA 2XCSB 3SYMA 3AG5A 3AVQA 3KLMX 2DETA 3C3KA 1IN1A 2EXXA 3FUCA 4M1QA 3RBVA 3OKAA 2DQ4A 4WY2A 1MN6A 1GAQA 1RAHA 2IDKA 3WE7A 1NMZA 4O6VA 2OD7A 4WXYB 3ZWWA 2HLNA 2ZVPX 2HWKA 5AVJA 1BW9B 1Z68A 2O3TA 2VDUE 2CLSA 1L5HB 3B82A 3HLYA 5IBCA 3DE4X 2P41A 4ODIA 4CLOA 4H9GA 3PJGA 4KE6A 2A9OA 1M0WA 2FPOA 2GM5A 2IHJA 1TAGA 4JIGA 2OB2A 3ND9A 3IQZA 4RTSA 1USGA 4RXTA 5IUNC 1A8UA 3KJXA 1KK0A 1T8WA 1UZUA 3T5MA 1ZVKA 2Q5HA 2ZFUA 1R8QA 4LYJA 2HWUA 5KOJB 2VSOA 3OF3A 3Q3JB 4X8MA 4KLNA 2JG3A 4DRXB 2B8TA 4CQMD 5DBFA 4RCZA 4DLKA 1CQIB 3P4XA 2RHMA 4FE3A 4AMBA 2ZWMA 4FMCF 2FPPB 1B3BA 4GR5A 1JDJA 2WTUA 1M34A 4MK4A 3UAGA 2I2AA 5AVWA 4BMOB 3W8EA 2FDXA 3PRKE 1IBRA 2PZ8A 1WSAA 2GJAA 4QBKA 2LKCA 2ZRQA 5IHXA 2JK1A 3T4UA 5LC1A 3WLRA 4F46A 3SICE 4BP1A 3S7TA 3DMHA 3FTDA 4CUZA 2FLWA 1O97C 1O95A 4NCXA 4BFTA 4ZP1A 3CS3A 1SB8A 1KU0A 2H8GA 4PEVA 2QMUA 4UAVA 4D41A 3CZMA 4O1HA 4HFRA 5IBPA 5K0EA 1Z2DA 1UANA 2OP0A 4LWZA 3GL9A 1JFTA 1OFUX 1S8OA 3GN2A 4R71A 5IP5A 4HRYA 4YRIA 5MN5A 5F9HA 5L3SB 4EGAA 2BI7A 3WA7A 2ZIGA 1W25A 4G8CA 5DJ5A 1NM5A 4A1OA 1GU0A 2LTAA 1DBWA 3ESBA 4ND1A 2JANA 3CLKA 4KUEA 1E1CB 1P4SA 2H0AA 2OYSA 3TQRA 3JYQA 4FWTA 4R0VA 4JYZA 1CIVA 5SYMA 2PRKA 3DEYX 4LXYA 5JEEA 3BMQA 1AH2A 4P5EA 1ONSA 3NBZC 4FX5A 2I9PA 3C1TA 4GS5A 3TBHA 3GCZA 1FDWA 1GG5A 4MB0A 3EA0A 1RPZA 5AW7A 3OTIA 1BC5A 3KPYA 2BEUB 3U3DA 2Y0DA 1VPLA 4GKKB 2BDEA 3ZWPA 2HDNB 5FPSA 3WQSB 2EZ9A 3GT4A 2VRWA 4JSYA 5CEFA 1GZDA 4EHKA 3ZLJA 3BQNB 3NBXX 1N8SA 3ZWYA 4CM6A 2F00A 3FYSA 1XO1A 1Q0RA 4L85A 1IOVA 2ZT5A 4CM4A 5A9SB 2I6XA 9ABPA 1I0LA 4NMXB 2W0SA 3KE8A 4J1SA 2RAPA 3BK1A 3NBYC 2PH5A 3A4LA 4R8KA 2BFBA 4DIKA 4PQFA 3BWDD 1L7XA 2DLNA 3LQQA 3OBIA 4ZVOA 5ITSA 3RT7A 4AP6A 5JI2E 1ID8A 1GIAA 1HTBA 1YZLA 4C5BA 4I19A 5GGXA 2JFZA 2YWDA 3LDUA 3T8YA 4Y98A 5CBPB 4ARIA 1BCRA 2IHVA 5A71A 1Y6FA 1UK6A 4HB4A 1FS6A 5DNAA 2B94A 5KVQA 1ISHA 3HCAA 1UBSB 3AHJA 2R8ZA 3OJWA 5C3UA 3P9IA 4D92A 1F8UA 4Q3LA 2YXLA 5LZ2A 2J0SA 3DMGA 2VTEA 1WB4A 1Y8QA 3RT9A 3LKVA 1OYWA 1P77A 1PVOA 3ZW9A 1FYVA 1Q0HA 1P80A 1D9XA 1ZOOA 3IELA 3MTIA 4D4HA 1GQSA 1V96A 1Z7YA 5B3LA 4WRRA 4IP0A 2F90A 2Y0BA 4NY1A 5K8CA 4OJYA 2E4YA 3EVAA 1RD4A 2G6TA 3R20A 3DE5X 1RXCA 2VZLA 1QHSA 2DUMA 3DE2X 1RLOA 2ORED 4UM7A 3WRYA 1P72A 2ONJA 2R1TA 3RVLA 4NIMA 2GHIA 1WU7A 1HMPA 1PJCA 4R0NA 4JYAB 3K9QO 1DBIA 3OF5A 4JJZA 1P0FA 4FPXA 5TJHA 3IUPA 4NOMA 2A2ZA 1XXLA 2XBMA 4EHLA 4MSUA 3V8VA 4JD5A 1ESNA 3K0FA 1ZM3A 2OCXA 1MO5A 1K7YA 1JHXA 3OUTA 4BE4A 5BNIA 1TD9A 1U4OA 4N5LA 2NYRA 4ASUD 4DIMA 3U7QB 4II7A 4BKOA 5MN6A 2R84A 2JLUA 2XSZA 2ZR0A 2JLRA 5THXA 2GAJA 1SOMA 3EIUA 4X8HA 4ER7A 5PNTA 3KHUA 5A1TA 2GVNA 1XZNA 4LVCA 3QFTA 4N5NA 3KQNA 1GZHB 2JRCA 2X22A 2OHXA 2AOUA 2WW8A 4KBFA 4N18A 2YDXA 5KOYA 1EI9A 2QXTA 2VWGA 4TMTA 3UC5A 4EENA 2ZDQA 3TZQA 3O93A 1BCSB 1UC8A 3E82A 4QHSA 4H7EA 1KARA 1NJ6A 4GQIA 4ARBA 3CZ9A 1RCFA 2GPNA 2WICA 4DYHA 3PUKA 3COYA 3FDXA 4JVMA 3ZC3A 3OQOA 1ZEMA 4QXAA 3LWBA 4DLYA 4TV9B 2HEIA 4ZARA 4HATA 1ZSYA 3AF3A 4A7PA 1HMYA 1YZVA 5BWOA 4CEJB 3VXKA 1P0IA 2HU7A 3B6KA 3M0EA 5EZYB 1ZUNA 3DEIA 3GJTA 3NHJA 3C4QA 2YVLA 3DZHA 3HKDA 2AUMA 4CMIA 2D5LA 1IY2A 4KPFC 4JBGA 2JA2A 1C3LA 3WBFA 1F2UB 1JPJA 1IM5A 3L46A 2ZE8A 3R7LA 3F5MA 1EU1A 4BB5A 2FSVC 4QPCA 4F6RA 1ZSVA 3N0TA 1J22A 1L6RA 4DKJA 4OP3A 4TKVA 1J56A 1K8YB 1Y3DE 3DBOB 4CM1A 3N39C 2ODTX 4D4LA 2NTJA 2HHCA 2Z8YM 4KSYA 1GPWB 3P71T 4L8VA 2PCJA 1U7TA 1W59A 2GBLC 3JCZA 4M8LA 5HA5A 5LLSA 1V7ZA 4IVRA 4BQRA 1J70A 1U28A 1B6TA 4IJ5A 2HAEA 3WB9A 5BW4A 4QTYA 5GMOA 4HPJB 1Q7EA 5C51B 1D2HA 2BJWA 4JEMA 1XTRA 2C3YA 3KOYA 3A06A 3V97A 4GPTA 1UC9A 4K6FA 3ONVA 3VOBA 4ZZ0A 1FIUA 1JECA 1LI4A 3CF4G 5L53A 2VHXA 4B0PA 1FFCA 2D8AA 2YQ5A 1F8XA 4E5YA 5C7OO 3AF0A 3PIIA 1ELOA 3WV4A 2QU7A 3VH1A 3FPBA 4W5JA 2V8BA 1MDBA 1M33A 4X44A 1RQLA 3ROZA 3SZMA 3EQ9A 4A0HA 4URVR 3W34A 3M1AA 4MVJD 1D6NA 4TRJA 4HMOA 2LUOA 1MO3A 2OYCA 4GDFA 3HHEA 4ZQCB 3ACBA 3CPSA 1E62A 3RYFA 4U7HA 1K5GA 4F9GA 3BX1A 3LC2O 2NZVG 1HYHA 2NAPA 2Q6VA 2ZQ5A 4LXQA 4KFCA 2MDTA 2BGGA 3WB1A 1J49A 2ZYGA 1KKMA 1PTJC 4PXSA 2B99A 2QW8A 1RMTA 5CITA 3UC9A 1CU1A 1EQAA 3HVJA 4A2PA 3AIKA 1C7IA 1ZHFA 1Q3KA 3EEFA 4BPRA 4D9NA 3ZGYA 4EJ0A 3UJ9A 4M1MA 2Z2KA 1SUSA 3DONA 4JNCA 1TT7A 3LDHA 4JB8A 3IOMA 5BN4B 5B6IA 1WMSA 1ZD4A 3ZCTA 1RMYA 4X00A 5AKHA 2H2WA 1PKEA 1SBIA 3JZAA 3T38A 5IXJA 4RK6A 4CIDA 4IEFB 4EPXA 3GEEA 3IBCA 3L79A 1EX6A 3ICWA 1CJBA 3G3EA 3CRZA 1YMQA 1JH8A 1YL7A 1H65A 3SJUA 4NJEA 4WN3A 2KJQA 5LP1A 3WOVA 1SC6A 2C7RA 3NIBA 2QMQA 4HWTA 4C07A 2C2YA 4BO4A 4QFBA 1LPOA 1U7DA 1DKOA 4OPMA 4LN1A 3FRIA 3UMGA 3DUFB 3I4FA 5F33A 3CINA 1U2ZA 4FFVA 4ZGWA 1DCKA 2HK8A 4IO0A 3VZSA 5THKA 3FJYA 3H3XA 5ILQA 5EOVA 1MC5A 5CDTA 2MIIA 2W2KB 3A7DA 3ET4A 3E58A 1DG3A 2FW1A 3BN3A 1CEEA 1HLDA 1YRLA 2YZ7A 2VYFA 4IDGA 3X1XA 1E4EB 1EX9A 4J0CA 3LY5A 4WDRA 1N0HA 1RACA 2D2EA 4R5HA 3TR0A 4B3DA 2B7BA 4DR7B 3UPUA 3O6VA 2Y9MB 1I4WA 4FDMA 5HGXA 2Q3HA 2X6RA 4GXNA 4AIRA 2OXTA 1GSOA 4RWEA 5EWLA 4HZUB 3OO0A 3AR5A 5DTQA 3P0IA 2YOGA 2V55B 3H83A 3WB2A 1ML4A 4XLLA 2QTRA 2PBZA 3NDJA 4WW0A 2OHGA 1SAYA 2VF4X 1K7SN 3EW7A 4GX1A 5AK5A 3IHWA 3MINB 1Y9DA 3UK2A 3AM1A 1CQIA 3UM9A 1E6KA 4TOIA 2J1LA 2JBWA 1U90A 3IBTA 4EARA 1QYRA 2BFNA 1XEAA 3F7NA 2A33A 4INJA 4LGMA 3RDPA 4BB0A 2WIKA 1AGRA 1RWQA 1ND5A 1BHO1 2GX6A 1YMVA 3M6IA 4K26A 5F21A 1ARZA 2FJUA 3WLLA 3BJMA 1PUIA 5KCMA 3GRPA 3IGFA 3DYBA 3A1DA 4QD3A 2GBFA 1UIMA 1UBCA 3BB4A 3A27A 3GLVA 4ZI3A 3AY3A 3HN6A 5IVHA 4U9HS 4HEHA 5LFAA 3OLXA 1Y8RB 2FG7C 3F9RA 4BECA 1DRWA 4V2UA 3QMWA 3E7DA 4F6LA 2Q0QA 1ZK1A 2PX4A 1ZC4A 5FWDA 3D64A 1PSZA 2X76A 1P1RA 1FYXA 1SKYB 3EE6A 2XCIA 4PS0A 1JTFA 4C0LA 1ZINA 2E5WA 4E0BA 5ELLA 4NVRA 1WVIA 2ODEA 3AJ8A 4G37A 4OYLA 4QXOA 5IS2A 1NU6A 5KNLA 4P92A 3DMTC 2FF7A 4ME6A 5REQB 1W52X 2VF8A 3WFZA 1E77A 5I7FA 1RYBA 2GCNA 2ZSUA 1OCEA 1AKWA 2Q5EA 4ALKA 4B48A 3P9YA 3AFMA 5A0TA 3MBKA 5CR9A 3Q5EA 4KBGA 5HFNA 2A9JA 2FTKE 1E1RA 1ZRSA 1N2CA 1TF5A 1NX6A 2O7NA 1PT5A 3NDIA 4H4EA 4KO1S 2F1OA 1KO1A 2G1KA 4MQBA 4M89A 1LCIA 1JWBB 1RQ7A 4GECA 4MW9A 2IEDA 3PC6A 1JHDA 4BEBA 4WNAA 2DT8A 2XWPA 3MWDB 1W76A 3AUKA 1L2TA 3L4BC 2AFIA 1XZMA 2QZ9A 1V8OA 2DTXA 2WUVA 3IOBA 4M36A 3AMVA 3L04A 3GLGA 1DXYA 4I55A 2Z6QA 4AX8A 1TPZA 2NVBA 4RY8A 4TSKA 5FI0B 4U3JA 2PMFA 1IZ8A 1X70A 2GVDC 4X6UA 1VQ1A 2O8NA 4XYGA 2X1MA 1JVBA 1ODTC 3MOIA 2M2IA 2OORC 4UUQA 4BHTA 3A9TA 3M4XA 3QY9A 3BA6A 4ND8B 4HGNA 4QJBA 4MVJH 5D00A 4XH9B 1EYZA 3HL4A 3I8SA 4FI3F 3CR8A 1Z62A 2PWYA 3C70A 3P9KA 3TM4A 3ZCVA 2RI6A 2R2AA 5C1IA 4WAUA 2AQHA 1AV7A 1BYUA 1XK7A 2A9FA 3LT4A 1IZ0A 3EOAI 4RMNA 3D6TB 2IPNA 2WDPA 5BORA 4FZ3A 3PJRA 2EG9A 2CE7A 1BXKA 2XUDA 3P97A 3ZH2A 2Z1NA 1C0IA 4PPNA 1RJEA 1JQLB 4N3GA 4PPYA 5F7XA 4AQYB 4MV5A 3AV3A 4QUHA 5A6SB 2GDZA 4NATA 3F1LA 2DLCX 1ZLYA 4K9MA 1Z6GA 3FWYA 4ER6A 2GVZC 1GL7A 1GUZA 1KGSA 4Q9NA 3UAWA 4LJRA 5FAKA 4N1AA 2AX3A 3O92A 5H9VA 1RWXA 4D99A 1RC0A 4D6YA 5MF6A 1F14A 3CH4B 2JZCA 4JJKA 1W35A 3QKTA 4WWHA 1RLUA 3BM5A 4HOYA 2H2DA 4JEHA 3U1VA 2J4FA 1DMRA 3PQ5A 4GDMA 1COZA 1E3QA 1Z36A 2CVZA 2AJLI 3E9RA 3OZEA 4IDOA 1BGWA 1Y8RA 1Y5IA 121PA 1MPXA 2IXGA 3JYOA 2XECA 3AVPA 2G17A 1NV9A 1EFVB 4KQKA 3NVAA 3R7WB 4RIEA 1ZNWA 1K98A 1FP2A 1QPBA 4CMAA 1LPNA 4L50A 3K05A 4BGUA 1E61A 2GPSA 4HHEA 4QA9A 4UAJA 2EP8A 2O2CA 1DHTA 1RYDA 4GRAA 1LTQA 3DV0B 4OUKX 4X3PA 5AOBA 1E99A 2PJZA 2RGGA 2WZQA 1PW7A 2Q7XA 4D7AA 3I6QA 2IXBA 4BV9A 3BRWA 1LPSA 1YS6A 2DHRA 2YRFA 5EMJA 1T35A 1IZ7A 1F2TB 2QRMA 3MUEA 3IMFA 4MRRA 4O0LA 4O0MA 1X1SA 4RVCA 5EVJA 1DBVO 4BTLA 1M8KA 4GPIB 4EAQA 2RH9B 4EB6A 3ME5A 3HO8A 3KYDA 2OQRA 1UXOA 4QEKA 5GWXA 1TYAE 4CKEA 4LEIA 1FSZA 2WHQA 3WRXA 3NTRA 2NM0A 4DWOA 3W6UA 5TQJA 4EFKA 1ZFNA 5JJ5A 3GT0A 1O4VA 3CJQA 4RZ3A 4LRTB 1ZN2A 2F4NA 3H17A 3OPVA 4PHTA 3N7AA 1JDZA 4KO4S 4LPKA 2GT1A 5FO0A 3OX1A 3ASUA 1N6PA 5CFPA 3LX6A 4PYRA 1IG0A 4ZMSA 1ZJWA 3MFQA 3MLBA 2PX0A 1OY1A 3DO6A 4XWYA 5ALPA 4N3AA 3D8NA 2JNWA 3HXKA 2PRZA 1QM5A 1IWPB 4YCCA 2QY6A 1C0KA 2OY0A 3CNOA 5C4GB 4E30A 2PTGA 4J75A 1QP8A 4P53A 2CBXA 3HG7A 3ZCXA 4E1BA 1HSZA 2A7XA 5HF9A 2NU7A 4JJ6A 3I8OA 1J2TA 3C4JA 5GP1A 1GT91 2WVAA 4AJ1A 3MMNA 4JMPA 1U9ZA 2Y2UA 3VPGA 3EF0A 3UKDA 3UBMA 2UYGA 5E6SA 1D7OA 4RTOA 3PXCX 3HZZA 3TDMA 1JR3E 5KSZA 1XHEA 2G40A 3B5EA 1TKRA 2VJPA 2IJGX 3E23A 1IQPA 2WAOA 4Y6QA 4Y9TA 4PYJA 2UUPA 4LE0A 1HX7A 3HKBB 1USWA 3KG2A 3RSQA 4BV8A 3X2EA 3C6KA 4M0FA 4O3FA 5EGNA 2UUBB 1IFXA 4K46A 3DQQA 5HGJA 4AJLA 1EUZA 1NY5A 2P6NA 2FR8A 2Q49A 4JZYA 1OXTA 3JRXA 5TMEA 2OA0A 4ZYYA 2QAGA 4R2MA 2OWDA 3M4ZA 4EWLA 3IPLA 4B3MB 1TM2A 5DNDA 2WDZA 3PFBA 4B09A 2WPDA 1MIOB 1NBHA 1MJGM 3MMPA 1IBKB 4N7JA 2PXAA 4R1MA 2A5FA 3OPQA 2RHGB 4B6SA 1OXSC 4KI7A 5LQDA 3PZRA 4NE2A 3KSRA 4LQDA 1BCSA 2AZTA 3RYFB 2WMOB 2J3HA 3RH0A 2QZSA 4DNFA 6CHYA 4CF7A 5J23A 3GP3A 4MVJF 4P4SB 2HR1A 1E1NA 1LPPA 2BM8A 2FI1A 1ECGA 2P9YA 2X5JO 1ZIDA 1T2CA 3ENNA 3HP1A 4AJOA 3I52A 4ZCPA 1IHOA 1O0SA 3C1AA 4XYEA 4L0CA 5KYNA 1T9CA 2VWPA 4CIVA 2X5NA 4QNMA 4YLEA 4AO7A 3A1EA 2PUGA 3KZXA 1BMFD 1C7QA 3BEDA 1UP4A 2F17A 3PC3A 4KXUA 2PS1A 2ZT7A 3EGIA 3LYLA 2I6UA 2IXFA 3NTQA 3ZWOA 4GFDA 4IDNA 3G1WA 5BRNA 1F2UA 2EJWA 4JYPA 4ZT6A 5C31A 1SCUA 2GCOB 3NGXA 4MI6A 1J7JA 4M7RA 5FO1A 5GM2A 5GV7A 1JDPA 1LLQA 1L6IA 4N49A 2XRZA 3HKCB 2V97A 3L1UA 3KFVA 4NI5A 3WDMA 4GL2A 3JRNA 4KAFA 1OXMA 1HI9A 4A0GA 1CQWA 1FF9A 2GEUA 1DC3A 2OV6A 2D5IA 5AVVA 1M72A 2WWTA 4L5BA 2UXBB 5CPBA 4YTEA 4N0MA 3ONFA 5I7AA 1E4OA 2XZTA 3E9NA 5KVCA 1TK2A 3EUWA 3E22B 4TTQA 2OL4A 2P4EA 1WUTA 2H85A 1VE1A 3IIJA 3L2OB 4GZ6A 4G97A 1II8A 4KMOA 5D6NA 4XWKA 1HE8B 2GEKA 1P75A 1ZQ9A 4FJ2A 1A9RA 5JD3A 1J8FA 3R41A 3DD5A 3HSKA 4KXFB 2TECE 4QUGA 4RABA 3ZV4A 5GIOE 4OV6B 2BHRA 4O4IA 4UMDA 3TL2A 3FMGA 1WXQA 2WNIA 4E32A 2R9VA 1YA8A 5JDIC 2GNAA 1D6MA 2D2XA 2IX9A 1ISRA 1TK3A 1UT5A 1R7RA 3S70A 4FS3A 4P1ZA 4KR6A 2OT3B 3SIWA 2QK4A 4ZT7A 3B9BA 3KAPA 1RBYA 2PANA 2FJ0A 2VZ8A 2XE6A 5EJIA 1C81A 1G7TA 1CRQA 4QQFA 1DIHA 3ITEA 3KEFA 2EQ5A 2F6RA 4FLEA 2A58A 2C4MA 3G89A 5EKDA 4C3VA 5JYEA 2OR3A 3CNEA 4Z53A 2NMVA 1NV8A 1LJUA 5GM1A 4Y6LA 4B7XA 1QU2A 4YALA 5HQJA 1MRNA 1X38A 4OIMA 4HYTA 2CC2A 4KPYA 2F1HA 3GLHE 1V39A 3DDUA 2DOKA 1JHMA 3RIHA 3RTGA 1RLIA 1X15A 1ZCJA 1CNEA 2ADMA 2XQGA 4CG2A 1U5BB 2XCQA 3VR0A 2AMLA 2OD9A 5H7XA 1KFCB 1JKJA 2J4DA 2P6OA 2YUIA 4EHAA 3P0RA 2J6IA 2I03A 4WJLA 1EGVB 5A4KA 3W5DA 1VA5A 1HTWA 3G02A 4RC9A 4U63A 4JT8A 4F60A 4UM5A 4UXIA 3CURA 3LUHA 4LOLA 4BVFA 5I9NA 1OAOA 5INTA 2VSNA 3FDZA 3R0VA 1NI4B 4LHSA 3FVQA 3VVLA 5F77A 5K3EA 1YI0A 3GI1A 4TUYF 5I9LA 5BUZA 2FH5B 2ZPUA 4GLOA 2RGNA 3ZIDA 1XALA 2QTMA 1FYEA 5IG2A 5GIPE 2EL7A 1D1PA 2XW6A 4CTMA 1WHSA 2C7VA 4OGKA 4B4KA 3U5ZB 2FAXA 3KKLA 4A6EA 4R3NA 3DDSA 4CKCA 4FKBA 4E4RA 2FMHA 4F06A 4YRMA 5J40A 1Y1QA 4FYKA 1YASA 3FCAA 2D0IA 1MXFA 2G8NA 4NZZA 1FFHA 1KI9A 5BNWA 4CTNA 1DG1G 1NOKA 1HDEA 4D46A 3V1NA 2IT1A 3L05A 1ZZEA 1FP4A 1HE1C 4LSMA 7ABPA 4LXXA 4OVKA 4BXOA 2O5RA 1ZXLA 3OCZA 2NXNA 1SIUA 2I34A 4D9JA 2OCPA 1V9SA 3GO4A 2C57A 3OUZA 2AJTA 1PQYA 1IVYA 2Q1WA 4YMHA 4RZQA 5BURA 2N42A 1QIFA 1PK8A 2KSQA 2X9NA 1B00A 3OQHA 1WM1A 3PPWA 5KUTA 5JSQA 2XWBF 4NOKA 4PXYA 2VEOA 4EYOA 2INGX 2HXGA 2RKOA 4CBVA 4QVIA 3V8MA 1SZJG 4KH0A 1R9NA 4BWFB 3J7TA 5FP0A 1WE2A 1NOIA 1T9GS 1KK1A 1QOZA 1TVCA 4MV7A 4ZVPA 1PFWA 3TOCA 2O0HA 3TTYA 2CZQA 1CY4A 5SV2A 2E4XA 1RR6A 4DA6A 2PUBA 2IS6A 5GPBA 2YZ2A 2WV9A 3EB9A 2OBYA 2JLYA 3O4GA 4X91A 2A0WA 2H17A 2MMCA 3A6JA 2CSUA 3C2QA 1DAFA 1LLFA 3NNNA 1RBMA 1YQWA 2AV6A 1YE8A 3TLEA 1RPTA 3T7RA 2D3WA 1CJCA 3NIDB 4OXRA 2RBGA 4OMDA 1PJ8A 3STWA 3D0OA 1CHDA 1JIUA 3IO5A 1EFVA 4LDNA 1ZJ5A 3HWSA 4XASA 4ZA2A 2ESRA 4DAOA 2RHHA 1NI3A 2IZZA 2L19A 3RAPR 1P61B 3CH5A 4UVHA 3RARA 5JSHA 2VOJA 2HBQA 1QFMA 3D6HA 4ED9A 3PA6A 3G7UA 4JLKA 4H7JA 3CT4A 4W1QA 1WUYA 2E37A 5A2GA 1O96B 1NG9A 2YHUA 3P9RA 821PA 3FGPA 2HJSA 3IMGA 5DBOA 3UY4A 2AUTA 3PJFA 4M99A 3ZV7A 5IJ0A 1HK7A 5HZGA 4MRSA 2D2FA 1MO4A 4HDNA 4ETMA 1M0SA 1QCCA 4DYDA 1BXRB 2FVXA 4J4BA 4RELA 3HJFA 2NUAA 2QZJA 3CEMA 4XCXA 3FFBA 1LFDB 3DBIA 4KH1A 5IYZF 3S2SA 1H2FA 2OZEA 4HNQA 4YRSA 5JISA 4F9TA 1QRUA 2XD4A 2QYHA 4P4TA 5BYKA 1IN7A 2IYLD 1L8AA 4UFOA 1VYVA 2O6HA 4TMVA 5K3AA 4BFYA 4EKIA 3UJPA 4KXWA 3U31A 4ZOCA 1RE1A 1JG3A 2GYVA 5K3DA 5G53C 4PCUA 1M1NA 4UZEA 4Y18A </