1XFAA

Structure of nbd1 from murine cftr- f508r mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
264
Chain Sequence
TGIIMENVTAFWEEGFGELLEKSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Side chain and backbone contributions of Phe508 to CFTR folding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 89
structure length 264
sequence length 281
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xfaA00
3DEFA 1E0AA 1EK0A 4B76A 1KZGB 2JLUA 2ZS8A 5DI3A 4LYJA 1OHHD 4CEHA 2P3SA 5IRCD 5KHOC 3RSOA 3VX4A 4Q4AB 4BLTA 1DAKA 1MT0A 3WMEA 1QHHB 1F2UA 4Q19A 3SC3A 4UXIA 2IA5A 2ONJA 3EIEA 1R8QA 2BMJA 4MH0R 1IJFA 2V8OA 4IOMA 4E09A 1OT3A 3CRW1 3U3JA 4OHYA 2PT7A 2A78A 2ZAOA 4QKQA 5SZHB 1QHIA 1E2PA 2JIZA 4ZO4A 2AK3A 1M2OB 1IJEA 1M8PA 1DG1G 2GF9A 3RS4A 4C0JA 3TVTA 3LV8A 2PT5A 4JLKA 4EFLA 4G0NA 2J87A 1Z0DA 2WPDD 3P4YA 4PX9A 3WBKA 4NYJR 2XZOA 5KPDA 2AXNA 1NI3A 4LHYA 2IYZA 3IBYA 3ZVMA 1CKEA 3SBEA 2ZEJA 3RANA 3VR6A 1UKVY 3R7WA 5F3WB 1GL9B 5HTKA 4QJ4A 4DVGA 1OFIA 3I32A 3QEOA 1ZD9A 4M2LA 2XTNA 3TUIC 3OESA 2GHIA 1W0JD 2DPXA 2W6JA 3C41J 4IFBA 2FMXA 2X77A 2ZI5A 1A2KC 1E6CA 2W58A 2H7VA 2VHJA 2REBA 1EESA 3G5UA 1EGAA 5AJYA 2HCBA 3AVYA 2J59A 4UNRA 2C96A 4PAMA 1CXZA 4AKGA 2OLKA 2H8KA 3M0EA 621PA 3AUXA 1KZ7B 3QBTA 3GLFE 4OI1A 2CL7X 3FKQA 1N6RA 2PJZA 3T1TA 3AKEA 1N5IA 2PZEA 4JS0A 4LWZA 1EXMA 3S1AB 1BYUA 3LX5A 4Q1AA 4EFNA 4QG7A 1U8ZA 5DSZA 1UPTA 5CDFA 2BBWA 4BPBA 4H1VA 1J99A 3K0FB 1XEXB 1LNZA 1MABB 4CT4B 5DISB 3QQ5A 1HQYE 2JDIA 1I4LD 2PX0A 3PVSA 4C4PA 4NU0A 1VYUA 3L0IB 4RZUA 5E95A 1Z07A 1AQUA 1R5NA 3TIFA 5CJ2A 4CEJB 3TQCA 4DLWA 2P5SA 1ZIPA 2BCJQ 2IYSA 1CJUC 2JAQA 1EG7A 1R6BX 1GL7A 2ZJAA 1T3HA 5K8UA 1P75A 1ZM9A 4BFWA 2X1VA 4MRPA 1MV5A 4DDVA 4NDZA 2KB0A 4A8JC 3AGQA 1XMIA 4QOSA 3TKLA 3RWMB 4MGKR 4D4LA 2G0TA 4US0R 3NIBA 2D4HA 1OV4A 2GF0A 4ZIRB 4D4JA 4AG6A 2N42A 1PUIA 3KL4A 4NH0A 3W34A 2O0HA 1W44A 2P6UA 4FINA 2ZE7A 3OZXA 1JALA 2O8FA 1OIXA 4X8LA 4GP6A 3Q72A 4LCBA 1IONA 5K8LA 2A5YB 2ZU6A 1W47A 2JASA 3OIYA 4D80A 1G16A 1D8TA 1XTJA 1US8B 3IHLA 4LJYA 4QHSA 3GJ7A 3K0AB 1GVNB 4M1SA 1KI3A 3BAFA 5C18A 3MWYW 4DCTA 4YLGA 3AF1A 1KK1A 1DVRA 1DAHA 2QU8A 4TQUS 1HYQA 4Q4JB 1J8MF 4M21A 1LF0A 4AKHA 2QSZA 4G5GA 4DLYA 1W2GA 4C0HA 721PA 2W0SA 3SQXA 5TY0A 1OXXK 2B21A 421PA 5J4VA 4V0LA 2IEYA 3RYTC 5DHAA 4M9ZA 4XVRA 2OM2A 5CLLA 1UEJA 4Q4HA 2A2ZA 2O8CA 2TMKA 1E4YA 4I1UA 4NBSA 3CF2A 3N2EA 1S3GA 1Z6GA 3B13B 3CPHA 1CR1A 1G7TA 1O3YA 1W46A 3K8YA 4CEIB 3RS2A 1XDBA 2GAOA 4MYTA 3CIOA 2QZ4A 1Z29A 2G83A 3OF5A 3DOFA 2E87A 4JLJA 3B8HA 1UKZA 3R7WB 2WBLC 2GXQA 3ADDA 4XH9B 1JJVA 3CH5A 2CHVA 3H1TA 4V0NA 2WV9A 4JVMA 1U8AA 2OLJA 1P2SA 2HLDD 1SVMA 3I8XA 3X1XA 2ZR0A 1NVUQ 4TLCA 3CX8A 4XTCS 1NIJA 3NTUA 1W4AA 3V00A 4PSAA 2BJVA 2XSZD 1R2QA 3AUYA 3ZVLA 5SZJA 2C9OA 2P6RA 1NNEA 1QVRA 4PFSA 1M1YE 3MG9A 1TADA 2ECKA 2DYKA 1Z6XA 1SZPA 1XU4A 1IAQA 3DM5A 5BW8A 4OK3A 1T3LA 3W5IA 1N0WA 4IKEA 2QORA 3QSYA 1T0HB 3BH6A 1G7SA 4B3BA 3EZ6A 2Q3FA 2UZ3A 3KQHA 4KV9A 1AS3A 4NCKA 1P9NA 3WMFA 1KTVA 1WBDA 2Z4RA 4ACBA 1ZUIA 1T8UA 4FD2A 1K5GA 2NO7A 2FPLA 3U3KA 1Q21A 3GFOA 3LD9A 4TQ9A 4A1FA 3PUWA 4W5HA 3V4FA 5JEDA 3LVRE 3DKPA 2QAGA 1H8EA 2RGNC 1AM4D 4KFSA 1DADA 2ORVA 2DY1A 2W6ID 2O52A 5G40A 1MRNA 2V4ZA 4D0NA 4F4IA 2FV8A 4RD0A 2VQSA 3VMFA 1KO1A 8OHMA 4BGDA 2BWJA 3SYKA 2BBTA 3AB3A 3LBHA 1ZMXA 2JLXA 3CRQA 1SVWA 3B82A 1JJ7A 3AVPA 5A4JA 3K9GA 3LWNA 1GILA 3GJ3A 2DWOA 1OH6A 1QBKC 3O47A 2RMKA 1CRQA 5FBRB 1XXHE 4EPXA 1NY6A 4OYHA 1R0YA 3F5FA 2W2VA 2GEVA 4PPNA 3A1TA 1F2TA 4Q1EA 4RJLA 2QGZA 1FMLA 3QKUA 5KDDA 2H57A 3L82B 4LGMA 1VG9B 1KYIA 2GESA 1ESNA 1N6PA 2NGRA 4G5QA 5FR1A 2HT6A 4CZ2A 4IDHA 2VPPA 3B78A 3GLFB 4A6XA 4PANA 4JLNA 3W9YA 4KYIB 3WP1B 3GEIA 2WWGA 1ESMA 1ZNZA 2WWYA 1SVSA 1DARA 2ERXA 4JYCA 5JLJA 3CF0A 1XTIA 2JJ2A 4DLZA 1Z6TA 4JL6A 1BH2A 2GRJA 3EZ7A 4DRZA 1XJQA 3CZQA 4KJZA 2DBYA 2ZJOA 4OBEA 5LBIA 4Q18A 2I1QA 4CVNA 2IXFA 4URYR 2D7CA 3K0SA 4CEJA 1IOZA 3BB3A 2ATXA 3HU1A 4B2IA 1FX0A 2WMNB 3B1VA 4HAYA 1R0ZA 1TQ6A 1MABA 1GM5A 1SULA 1U0JA 1CJTC 4F93B 1NSTA 3NWJA 3HR7A 4XWOA 2Z0MA 2ZJ2A 4RZXA 4IOLA 1TU4A 1IN4A 1D9XA 1GFIA 2PCLA 2ZJ8A 3A1UA 5UKDA 2FNAA 2C99A 2FU5C 4MRNA 1R7RA 5FH9A 3A1WA 3T1QA 1UBFA 4IVPA 5FUVA 4EUNA 2OSBA 3IO5A 4C0KA 1XJCA 4I1VA 1CU1A 1KKMA 4ZDWA 1RYFA 2A5GA 2WJGA 2WJVA 5G3ZA 3CX7A 2WIAA 5BWMA 4UKDA 1CF4A 4WW0A 1ANKA 1JPJA 1B0UA 3IGFA 1G7CA 4UXJA 5LB4A 2OEPA 1DO2A 2ERYA 3PG5A 4OK5A 2MMGA 1ZIOA 4KBGA 2NPFA 4JLVA 5GJWC 3VAAA 4GMDA 2QPOA 2Z5FA 3MMPA 3WMGA 3QF4A 3TGPA 2GJ8A 4RFVA 2FDCA 1Z0IA 1E79A 2QGNA 3DO6A 4JBYA 4B34A 4LBZA 4Q03A 4MUBA 4A9AA 4PQRA 1HA3A 1S1CA 1VCMA 2QE7D 5FUWA 2IYXA 4Q9KA 2G1JA 5IK2A 5IT5A 3V4RA 2CCJA 3EAQA 2IL1A 4FWTA 1QG4A 4GOJA 4LPKA 1FZQA 2IYVA 4L9WA 2G0NA 2J7KA 4B33A 4B43A 5AWFC 1M6NA 5F98A 4K8OA 2WJHA 3AF0A 3HPQA 3LO5A 3FMFA 2NO0A 4KHZA 1HTWA 4YMVA 5H1YA 5DN6D 4P4SB 3K70D 2J0SA 5FOTA 4GT1A 2Z4SA 3OE7A 3TQFA 3CONA 3ZJYA 1KMHB 3A4MA 3IEUA 1VYVA 1Q1QA 3VR4A 3UMRA 4ESVA 1NN3A 2PL3A 4GOXA 2ZJZA 3D8BA 1FOEB 4PR0A 4R98A 1NJGA 1FUUA 1OXUA 2PMDA 2ZVPX 3DM9B 4B6EA 2IX3A 3ZVNA 4QJ5A 2XTMA 3KX2A 4Q4AA 1ZUHA 4P4TA 4DLTA 1DTSA 1DBSA 4TYWA 2ZI7A 4DXAA 5GADl 4V0OA 2ZSEA 1LTQA 4U7DA 1HV8A 5JS7A 2OXCA 3AKCA 4IFEA 4NP6A 3GFPA 1NG1A 2F9LA 5JWHA 3SJAA 1FP6A 3WP0A 3BS4A 4KODA 3FKSD 1OYYA 3P4XA 4ZI3A 3BD9A 4O0MA 1JR3E 2VSFA 3D6TB 1DAFA 5JI2E 3U4QB 2GVDC 4BQSA 2D62A 3PUVA 4C2TA 1JECA 1IBRA 5ANRB 4UNSA 2VP2A 3GLFA 4YDSA 3AM1A 3CNOA 4Q4LA 4XTRA 1ZVQA 2JLSA 1CULC 4PXAA 1F2TB 1Z6AA 1IN7A 2JGNA 2WVJA 5EE3A 4BLQA 2VYFA 1YRAA 2XOKD 3D31A 2G77B 2OAP1 3ZGXA 1ZCBA 1KI9A 3TW4A 1ZNXA 2QMUA 2XB2A 5J47A 3EC1A 5EP3A 2CK3D 2QTHA 3AVWA 3PEUA 2AL7A 3NHAA 2WICA 4BRUA 3R9WA 2AFIE 2AD5A 2QP4A 1T5LA 3T5GA 4A82A 4OJKA 4TYQA 2BHRA 2NO6A 2EFEB 2VF7A 1X8LA 4US2R 4QHTA 1AS0A 3G0HA 4MRSA 2GWHA 1KIMA 4URZR 2OFWA 3KQLA 3ICQB 4B3XA 3QJYA 5KPJA 4NE2A 1VHTA 1NVXQ 3BXZA 5EZ6B 2V6IA 4M9QA 1L4UA 2GEUA 1XJ0A 2F3RA 1ZM7A 1ELOA 5JECA 1VG8A 3VR5A 1G5RA 4WAUA 3IPXA 3EPKA 3A37A 4JVNA 2NO9A 2JJ8A 2Q3HA 1Z2AA 3Q5EA 3UK6A 4EQ6A 1T4GA 121PA 2ZYTX 2BVNA 4L5BA 1VG0B 3FMIA 1R4AA 1FNMA 3P32A 3KB1A 3HU2A 4Z51A 2ZXUA 2D2EA 3P1JA 4ARZA 3ZLJA 2ZQ5A 1A2BA 4TLEA 2DWPA 4YMWA 4FMCF 2IXEA 4A0FA 1KJYA 3CF6R 4FI3C 1J7KA 2DWQA 3IIMA 2ZSBA 4QXAA 2G3YA 4IOJA 3OEHD 3GQBA 2HV8A 5CLQA 5DHFA 4DHEA 1KJWA 2ZITA 3SFZA 2VHTA 4NHOA 2PEZA 4Q7KA 3NC0C 5B57C 3BORA 1I2DA 4LZZA 3QEJA 3F3YA 2QPAA 2C98A 1NMZA 3OIUA 4A4DA 2UZIR 4TL8A 5FPSA 3T1OA 2WWXA 2B8WA 2AFHE 1YZLA 2YJTD 5J4HA 4G5RA 3P20A 4QM6A 4D0GA 5TV2A 1G64A 2BM1A 2GJSA 4PHHA 3IO3A 3SHFA 4EPWA 5F2EA 2I1VB 3WNCA 5FOSA 4FIDA 1KDOA 2CHGA 3BB4A 3HP1A 4LYHA 4ITRC 3GLHA 3I4LA 4PO9A 4YMUA 4IXNA 4EKDA 3GJ0A 4DSOA 2IW3A 2P67A 1F60A 2ODNA 1DS6A 2ZTSA 3BOSA 5SZIA 3U3RA 4WA7A 3ZQ6A 1YHNA 2O0KA 3MJRA 4Q1CA 3H84A 2QRZA 5L3SA 2YKGA 4M53A 1ONBA 2QTFA 2FGJA 5B30A 4IW3B 3GFTA 2KBEA 1MOZA 2CE7A 4Z1MD 4JLAA 1RRGA 2DCUA 2XITA 2ODBA 5FI1B 1NL3A 1D2NA 1J8YF 1YU9A 4MITA 3RDPA 1BMFA 1FQJA 1NF3A 4A2PA 3N2IA 2GZHA 4V02A 2FOLA 3B1WA 2OILA 1SXJE 2ZVQX 3DZDA 4HLUC 2JLWA 3LY5A 2A9KA 3PEVA 2GCOA 4HZUB 3H0KA 2FH5B 1OXTA 3MSXA 1BIFA 3EW9A 4MRRA 3QNUA 3ZZUA 2ZE5A 4M1YA 3EA0A 5F9FA 2YVUA 2WHXA 2QBYA 2IYYA 4EJSB 4E07A 1GRNA 5EXPA 3IBGA 2C9CA 1HY3A 4LBYA 4PPFA 2FPKA 3L43A 1KSJA 3F8TA 3CO5A 4IJMA 4FCTA 1KK3A 5AR1A 3AVVA 2WOJA 4EPTA 5FUXA 3IQXA 1UFQA 5FUYA 3CW2A 4NMMA 1KMQA 3A36A 4BFTA 1IN6A 1EFUA 3LW8A 1LS6A 4PC1A 2WJYA 4HI0E 3RABA 2EW1A 2B92A 4Q7JB 4XVQA 3A4LA 5KSZA 1TQ4A 2GCNA 1IXRC 3ZVRA 1FQKA 3PQCA 4X8HA 2FPMA 3T15A 3NC1C 1E2DA 3BERA 1FTSA 4FXPA 4DLXA 2BEJA 5A0FA 5CYPA 5CB8A 2WM9B 2ZRBA 2ZRIA 3IKJA 2G88A 3GP8A 4MYHA 1AGPA 2QUZA 3LFUA 2ZU0C 4TWZA 3A4NA 2XZPA 3NH6A 4TMKA 2FEOA 1X3SA 5EQTA 3AV0B 2Q9BA 4NCJA 3Q5DA 3AH8A 1E9EA 4YDHB 1OH7A 1S8FA 3EXAA 2YOFA 3SJZA 2N1BA 4HB3A 2ZUCA 4RD3A 4NPHA 2VA8A 1NVWQ 1W4BA 5JFGA 3KTAA 2AKYA 1FTNA 4TYPA 2Q6TA 4XSHA 1OJLA 1Q22A 3VKHA 4II7A 2NOAA 3LAWA 5CK4A 2HT1A 2FX3A 2C77A 3KKPA 4IRUB 3TJZA 3K9LA 1XZQA 2ZSFA 4S35A 3W6NA 4OK6A 1G291 2C04A 3KXLA 4PHFA 6Q21A 2QY9A 1N5KA 4KVGA 2J0VA 2C78A 1OE0A 1XCGB 1SHZA 1JQLB 2ZSDA 3ETLA 1NJFA 2KSQA 3B60A 3L0OA 4HEJA 4WVFA 3GJXC 4F91B 2R9VA 2BEKA 5B58C 3TSOA 3RVBA 3FFBA 2XX3A 2YC4C 1SVIA 2BMDA 4J0QA 1JAIA 1NP6A 5HCIA 4OHWA 4OQFA 1JEEA 2F6RA 2OCBA 2QQ0A 3KFXA 1G19A 4NZYA 2ZE8A 3SDZA 2PZFA 5FTMA 3SYLA 5F9HA 4LHWA 3WRYC 1Q3TA 1TU3A 3B9PA 3IDQA 1ZINA 2AK2A 3L0SA 5KDOA 1W49A 2IS2A 1P2VA 2J5XA 4LRWA 3TUJC 5JI3E 1R0WA 3SN6A 2EFDB 2GJ9A 5CM8B 2QE7A 5IK2D 2ZRNA 1AS2A 5J5CA 1YZGA 2FGKA 2Q9CA 2R8RA 3EZ9A 3IIJA 2G6BA 1KY2A 2VP9A 2ZRLA 3VR1A 4OHXA 1NG9A 4E5UA 2EFGA 4CEHB 1RPZA 1SVLA 2BJWA 2YV5A 1X8KA 2QG6A 2ZR9A 1P7CA 1M34E 4TMZA 1QF9A 4OL0A 1A1VA 2IK8A 1XEWX 2Q21A 3ZD7A 4QM7A 1NMYA 1GKYA 3KJIA 4K81B 4AWXA 3PR1A 2GZAA 3BFXA 3U60B 1LB1B 1R8SA 4TL9A 4A0GA 2JLZA 1PLKA 2YINC 4EFMA 4P4UA 4OQXA 5AUNB 5JHHB 3EPJA 2ZRDA 1AZTA 2ZYUX 5CDFE 4BWYA 3QY0A 4HUQA 2J7PA 3Q85A 2A3RA 1KNQA 3IIKA 1NN0A 1OSNA 1W4CA 3QI2A 4MDEA 1HH4A 2VEDA 3VNUA 4Q9LA 1TUEA 2QQEA 1XTQA 3KXKA 1Z08A 4E03A 3PEYA 2WJIA 3REGA 1W2HA 3NVAA 4M9XA 3U4QA 1OB5A 1RW4A 2VP6A 3G82C 1GP2A 1GG2A 2FF7A 2Z6VA 2ZJYA 4ZKEA 1L7VC 3CRVA 2YOHA 1IY1A 1E9CA 3EA5A 3PUXA 1XF9A 4B44A 2YYZA 5JWRA 1YE8A 4FCVA 2FZLA 1P2TA 1C9KA 2ODWA 2OCAA 2WAXA 4RVCA 2P65A 2RKOA 3B5JA 4BUJA 2PZGA 4N0EA 2ZRGA 1Q1EA 3BFVA 4PZYA 4QGHA 2XOKA 2ZYWX 3HJNA 1KOFA 2XSZA 5CM9C 1GAJA 1DAEA 3UPUA 4NL4H 2H17A 4HYYA 4LV8B 2GETA 1N3BA 1GIAA 2YOGA 3THXB 4GOKA 2QMOA 1XXHB 4A0HA 2HYIC 4UNQA 1II0A 821PA 4A6PA 3KXIA 1LY1A 4Q1BA 1K6MA 2HJVA 3QUSA 4HAWA 3ZS8A 2OAQ1 3JVUA 2V3CC 4LUCA 1C1YA 4RD2A 1PJRA 5LD2B 2WSSD 4Q1DA 3W6OA 4DB2A 2F3TA 2XNDD 2QAJA 4MDFA 2O8DA 5JMTA 1VMAA 4X8MA 1H8ED 3SBDA 4C0QC 5JJIA 4LYFA 1WBBA 2QP9X 5EJEA 1VECA 4AD8A 2IYTA 4W5WA 4JLPA 1SVOA 3ADBA 5TXGA 3X1DA 4A2WA 4JLDA 2QN6A 1JXOA 1LS1A 2IT1A 4CRWB 3B1XA 3KTAB 1R5BA 4C30A 3W6PA 1Q12A 3MCAA 2A7QA 3QKTA 1E9FA 3UG6A 2FFQA 4DJTA 4ILEA 4AYWA 4Q01A 2WKQA 2GTPA 2H92A 1A5TA 1G3RA 2VHUA 4MYUA 3QXJA 1DAIA 1SXJA 1Z2CA 1NN5A 1ZNWA 3AVXA 4KI0A 5H68A 2OZEA 4DLUA 4NYMR 1G8HA 2VRWA 5DYIA 1CP2A 3KQKA 1G8GA 1GNPA 3ONWA 3M4YA 4WOPA 2ZI6A 2I4IA 3VU9A 3GLIA 4NCNA 3IILA 3I8SA 4BEBA 2JJ2D 4O25A 3VQTA 4BEJA 1CS4C 3IQWA 4AK9A 1E2GA 4CGZA 4YQFA 5EP2A 4RFSB 2VHCA 4IOKA 1M7HA 4X8OA 1ETUA 2WKRA 3REFA 4B74A 1FMJA 1CJKC 1GKIA 2AR7A 3PJRA 2REOA 2BDTA 2IF2A 2PBRA 3RS0A 4CT5A 3LQQA 4ESHA 4QGAA 3QPVA 4LJ9A 4EJSA 2QBYB 2FN4A 4BECA 4D6PA 4OJQA 4OQLA 4QNMA 4QGFA 1M74A 4KSCA 3ZS9A 1D2MA 2FSIA 3T35A 1Z63A 5L3VA 1Q20A 4PPQA 2RGEA 2FSGA 3ZIAD 4TTPA 3RRYA 4TZ0A 4RKFA 4B75A 4KFRA 4KYUA 1U99A 3NDPA 2VSOA 2NO1A 3AEZA 3LDAA 3GLHB 1J90A 5EE0A 3O8DA 3PENA 1RRFA 2OCPA 2W00A 5HE9A 5FTJA 2NMVA 3C4JA 3I73A 4Z1MA 1RE0A 2CDNA 4WXPA 3FTQA 1G6HA 1ZU4A 4DCUA 1PVOA 3E1SA 4XD7D 3TH5A 1KAGA 1WE2A 3SEAA 3GJ5A 3QOFA 4FMDB 5KNDA 2RCNA 4KCGA 1E2LA 3QKRB 1S0UA 2IUUA 4IEIA 5FTNA 4O2RA 4PPGA 5SZKB 4EAQA 1UADA 2OBMA 4XVUA 1E3MA 3QPWA 1FPMA 3N5CA 3SJBA 5E3HA 1RVDA 5BYJA 4M1OA 1QHYA 1PZNA 4JL8A 4C2UA 2RHDA 5FBVB 2OFXA 1ZNYA 1N6HA 4DKXA 2B7BA 2IHBA 1Z6YA 4B3DA 3GLGA 1XP8A 1HE8B 1Z0KA 5FOUA 3OEHA 5JSZB 4TL6A 2AWOA 3JZMA 2ORIA 4B35A 2NQ2C 4G1UC 4DUGA 2CJWA 4M0LA 2W2XA 1AJEA 3PEWA 2QENA 3SQWA 2XGJA 3NH9A 1TAGA 4R7ZA 2X2EA 3CZPA 2RGBA 5BXQC 3VKGA 4DDUA 4TTQA 1OF1A 1XCPA 5JSZA 2WSMA 2XXAA 1G8PA 2ZUBA 1H8HD 1Y63A 2BIFA 4Z8YA 4YMTA 4ARZB 4RSGA 3GLGB 2ZI3A 4PHTA 2C9YA 2VO1A 4RZ2A 4DBLC 3EZFA 4GZMA 1AIPA 2IWHA 5JCPA 5FL3A 3BB1A 4G5SA 4EQ6B 3C5CA 4DIDA 1KI6A 3UANA 1XCMA 1E2JA 1II9A 4QBGB 1Q0UA 2ZR7A 2QA5A 3KZ1E 4Q4JA 4B3FX 4PSVA 3U7GA 5TB5A 4PC6A 4IVQA 1E2FA 4H9GA 4MKHA 2VL7A 1KI4A 1U0LA 4V03A 4TYYA 2H18A 3EG5A 1J70A 1PLJA 3AP2A 3CB4A 1NVVQ 1HURA 1ZM2A 1KHTA 1E69A 4LY6A 3BE4A 1ZW6A 2PLFA 1SKQA 4DEXA 1E79D 1RRPA 5FI0B 2VBCA 1G4UR 2KWIA 2MSEB 4JT4A 5EP1A 2R62A 2I3BA 1BKDR 1WF3A 4GNKA 4A92A 5CIWA 5H70A 3Q7PA 4F7WA 1US8A 1OFTA 2ZRMA 3Q7QA 4D82A 2J1LA 2YC2C 2IS6A 4LSGA 3AVUA 4MGYR 2MSDB 3R8FA 2BV3A 1GOTA 1U9IC 1QZXA 4HB4A 4GMXA 4HDQB 2FE4A 3OE7D 5E7JA 4OI2A 3R8CA 1AN0A 2QAGC 3DHWC 4TMTA 2AXPA 2XJ9A 1W4RA 2ANCA 1KY3A 2LKDA 2R65A 3LVQE 4PO1A 1E2EA 4PO8A 2FFAA 4HZIA 1GRRA 1QHGA 1VPLA 4JIMA 5CB6A 4FWIB 5JJLA 2GCPA 2JEOA 1AZSC 4JLOA 2XTZA 3CH4B 1YVDA 1SHKA 5AJXA 4V0MA 2CL0X 4PC2A 1YZQA 2QRNA 4RD1A 1EFRD 1KNXA 1RKBA 1VHLA 1E2KA 2HJGA 1Z06A 4ZDIA 1SGWA 3K0FA 2VH5R 4Y0VA 1E1QD 1DG3A 2QEQA 2ZI9A 1RIFA 4D2IA 3AF4A 2O5VA 1P5ZB 2QL6A 3WNBA 3GLIB 3VU9B 2XEXA 2V7QA 3SI7A 3THWB 2BBOA 2O8EA 4EPYA 2CLCX 4L9SA 2XZLA 5DLQC 1ZM4A 3UATA 2QROA 3QBVA 4BFSA 5FOWA 1E96A 1KKLA 4DT1B 4JBWA 2HXSA 5JEEA 1SKYB 4LHXA 3U7FB 3DMNA 3HR8A 2QT1A 1UEIA 1XTKA 2X2FA 2A5FA 3DMDA 4DCVA 1JXMA 1KMHA 4C0BA 1XD2B 5B2ZA 2CNWD 4GRAA 5C4GB 4D26A 3OEED 3GD7A 2CE2X 3ND8A 4JSYA 2ZS7A 1E98A 1PLLA 4I99A 4RD4A 4RCYA 4HB2A 4Z54A 2RB4A 1KJZA 2GEDA 1CR4A 3QF4B 4M9SA 4QJ3A 2ZE6A 1XNJA 2G9NA 1JR3D 2KJQA 1JNYA 2ZRFA 4LJAA 4F4CA 3PXGA 2RH5A 3NG1A 5KSYA 1UJ2A 1Z28A 1E0JA 2EFHB 2N46A 1EFCA 4MUAA 1UKYA 5L8VA 1F48A 4P31A 4QL3A 5KU1A 2IYQA 1KDPA 4QBIA 1NBME 3ASZA 3THXA 1E99A 1Z5ZA 1W5TA 2E9SA 3BJIC 1R10A 1XD2A 3WHLA 3NHBA 1G3IA 1YR7A 3SR0A 1XPUA 3NBFA 4NTZA 4Q5IA 4JKIA 1FNNA 3KFVA 4JT2A 4WBSA 1YRBA 3U7HB 3HWSA 1FUKA 1G18A 2NZJA 2ZAMA 1NKSA 1PUJA 4U00A 4ON9A 5HPYB 2QT0A 4FN5A 2FSFA 1MR3F 4TMVA 3U61B 1D9ZA 4IVRA 3FHOA 3B85A 4OI4A 3A8TA 3E2IA 2RGCA 3WYAA 1N0VC 2FZ4A 4XWAA 1II8A 2F7SA 1SQ5A 3CNLA 3A1SA 4OQMA 2UKDA 5DI3B 4AYXA 2AWNA 3U5ZB 1ZM3A 1U81A 4EIWA 1KAOA 1T3SA 5L3QB 5HKKA 3HPRA 1L4YA 5J4KA 5HZKA 2O0JA 2QPTA 1EFHA 1XEFA 3C14C 3KJHA 1F2UB 4PSKA 5LD2C 3T34A 2PH1A 2R2AA 1FX0B 4AC9A 1VYTA 4AKEA 1YR6A 2GNOA 4KO8A 4LV6A 3Q9LA 2WJJA 1R0XA 2RHMA 2SHKA 3D7MA 2J3EA 3AVQA 2W83A 1ZC4A 4W5JA 2WWFA 5J40A 2C03A 2JLYA 1WQ1R 1Z0FA 2IEZA 2LKCA 2ZJ5A 5EXXA 2HCJB 2ZPTX 1OH8A 3ADKA 1JQJC 5C1BA 4C3ZA 1CLUA 2OO7A 1T91A 1XD9A 2F1IA 3QPUA 1FP7A 4JLBA 3RS3A 3FPAA 2PCJA 1U94A 1X1RA 3QENA 4Q66C 3K70B 5KYKA 3F0TA 4FCWA 1NBMD 4GFDA 3U44A 1TL7C 2JLQA 2EYQA 1I4TD 1E94E 4LJ5A 1E32A 3UMSA 3R9XA 3FMOB 1MO4A 1E9DA 1GNRA 1H65A 1VDZA 2NIPA 3N70A 2JATA 4D4KA 5KUTA 4Q02A 2EFCB 1E4VA 4PQYA 2WOOA 1HEIA 1TF2A 5H8WA 5DE3A 1JPNA 3TSWA 4UJ3A 3K70C 3OIWA 2J9RA 4HAVA 3AP1A 4NKRA 1COWD 5GJCA 1T8TA 3EX7C 2Q9AA 4JLMA 3QXCA 2IWRA 4FW9A 4Q9JA 5JRJA 3RRZA 4ZI2A 4DB4A 1TQ2A 1TX4B 3IEVA 4TMWA 3ZIAA 4DZZA 4AG5A 4P33A 1G3UA 3I5XA 3JZAA 2VP0A 1T6NA 4ZCLA 1U2RA 5L3QA 2P6NA 4KITB 4I4LA 1G20E 4QC2A 1Z0AA 1QHSA 1KI6B 3WNDA 2ZYVX 4OKSA 3THYB 5FR2A 5JHGB 4Q9IA 1W48A 2CCGA 4DCSA 4HB0A 4RY2A 1ZYUA 4KLNA 2VP5A 2J0QA 1AK2A 4N1AA 1Q3HA 4B3GA 1S9HA 1TQDA 4TQAA 3FOZA 3AP3A 3OIVA 3ASYA 4LDJA 1IXZA 5G3YA 3B1ZA 2IBMA 4MYCA 2A30A 4GP7A 3B2EA 1JBKA 3KKQA 1U8YA 2WAYA 5EUMA 3ZDQA 3GMTA 5FPKA 2CL6X 4BASA 2NZ8A 1N2CE 1AKYA 4PAOA 4NONA 1CIPA 1SXJD 2GBLC 1W7AA 3KKNA 3TR5A 2Q0HA 3C16C 1VCIA 2D3WA 2DB3A 1CEEA 1GTVA 3KUCA 1FFHA 1AGRA 3FFAA 3NBYC 4N3NA 2J0UB 3U6BA 1TPZA 4M1TA 3A6PC 2EWVA 2OG2A 3ZD6A 1E2MA 1E9AA 3CBQA 3MWJA 4GDFA 3FDIA 1UBCA 1JB1A 2YWFA 4YONB 5FTKA 1F6BA 4QGGA 1P3JA 3TSZA 3PITA 1N6KA 3W3ZB 3OAAD 1U98A 1G9XA 4W7SA 3KUDA 2IUTA 1ZAKA 2GVZC 3CR8A 5JWOA 4NYIR 5EZ5A 2KBFA 1ZP6A 3MUFA 4WXRA 4D25A 2QSYA 2AN9A 3LA6A 4KSBA 1G1MA 2VSXA 1WCV1 1UDXA 5D3MA 3WYGA 4D81A 4KFUA 1IHUA 2IC5A 4TT3A 1YZTA 3TR0A 1OFUX 2F1HA 2ATVA 4MQBA 4EDHA 1MO6A 3MWKA 5DI9A 1OPXA 1EWQA 2O8EB 3MFYA 3THWA 1XZPA 1OB2A 4BFXA 1RC8A 3T06B 3K0AA 2PJRA 3GPLA 4Q48A 3BH0A 2ZRHA 1OH5A 2GCOB 3KJGA 1OHHA 3WY9A 1W0KD 3H86A 5FBWB 5FL7A 1VCOA 2OXRA 2PMKA 4TLBA 1E1RD 1WDTA 1E9BA 2FFHA 5FPTA 4DDWA 3SJCA 3VKWA 4L8GA 1YZUA 1TEXA 2EVWX 4LBVA 3C5HA 3UWKA 4R71A 4DLVA 2IYRA 2WMOB 3CM0A 4LJ4A 4QRHA 1HUQA 4BZPA 4ZIRA 1KO4A 4M1KA 4RKEA 2QMHA 3NEJA 1OKKD 4D4MA 1XTRA 4ASUA 4LC1A 3EPHA 1T0JB 3BFKA 1RYHA 3RHFA 1HT1E 3WHKA 4D0LB 3RRMA 1CJMA 3I92A 3W5JA 4BLRA 2IS4A 5G41A 4A36A 3O8CA 4G01B 3T61A 2WSSA 1G8FA 1AA9A 3PUZA 1DAMA 3S1AA 2H1LA 3EIHA 2ZRCA 2KE5A 2IYUA 4B47A 4FMBB 1ZC3A 2D2FA 3IHWA 1NRJB 5DYGA 1UM8A 3KQNA 1XTSA 1N6NA 2X8AA 2CVHA 5KDLA 1V43A 2GXSA 4Q1FA 2YNMA 2RGDA 3K09C 3L0PA 5D3MB 1DE0A 1T5IA 3Q8XB 5HZHA 5JBQA 1XEXA 3T1VA 5IF9A 1QHNA 3HDTA 4M8NE 1P4SA 2CXXA 1GDDA 1A4RA 1KDTA 2HF9A 2J7PD 1G3QA 1QVAA 3IUYA 3RAPR 1S9DA 3AVOA 3U3MA 4CIDA 4M1WA 1GUAA 3AKYA 3LXXA 4KLZA 5L3RA 5C46F 1E0SA 1IM2A 1KGDA 2IHYA 4KXFB 1X1SA 3IPYA 5LDDC 1MH1A 3UKDA 1KSHA 1GZSA 1E2QA 4U02A 4YXWD 3H2YA 1M7BA 4QFMA 2ZETA 3WXMA 4O3MA 1JR6A 5EP4A 3DZ8A 1GSIA 1FL9A 5EE1A 3TRFA 1P72A 3QXSA 2J0UA 2HYDA 3DPUA 4DDTA 3ECCA 1GITA 1MO5A 4LYAA 2ASEA 2CMKA 2AD1A 3KKMA 3CPEA 2XJ4A 3I72A 4MKFA 3L2OB 4GBMA 1N5LA 4DLSA 4R2HA 5JJKA 1RFLA 1W1WA 3BGWA 2V1UA 2GK7A 2RGAA 5CK5A 4M4SA 4G3XA 4AY2A 1G8YA 3VNVA 1XRJA 5TARA 3GEHA 4IEEA 3CRRA 3UWOA 1WP9A 4OI0A 2IS1A 2JIZD 3DDCA 1YQTA 1QHHA 2OFOA 5DGXA 3MAAC 3OHMA 1VIAA 3KJEA 2GAAA 2WPDA 4TSFA 4JZKA 4BZQA 3SS8A 1DEKA 5HR5A 2CBZA 3GJ4A 3HYRA 5GVRA 4URVR 4B2LA 4LJ8A 1BS1A 2FWRA 4DLRA 2XNDA 4C0SA 1P6XA 4IXMA 3K9HA 2W2TA 2R6DA 3RLFA 4C0LA 5C4MA 2GXUA 2R6GA 3FGNA 1CBUA 1U0HC 1W0JA 3LLUA 5GJBA 4HLQB 4XD7A 1OIWA 2RAPA 1N6OA 2QI9C 2QM8A 2IXGA 4NCIA 1XPRA 3T12A 1WB9A 2GBLA 4P3YA 3R9IA 2P5TB 3UG7A 1XEWY 1EFRA 2XNSA 3E5HA 2WTUA 2Q3MA 1OXVA 2OT3B 1SKYE 2PLRA 3BH7A 2YWEA 3QF7A 4BLOA 2F55A 1VIYA 3UIEA 3QKSA 2RGGA 2V7QD 1LFDB 3QIAA 3VX3A 3GLIE 5GJVC 3ZYCA 4A2QA 3OFND 5CJPA 4DWJA 1V5WA 1YZKA 5EE5B 4MRVA 3QE0A 2BKUA 2E1RA 2P0EA 3K0CA 4ZDJA 2OUKA 4BFVA 2DR3A 4XIGS 4R2IA 3CWQA 3EWAA 3I3SR 4CDGA 2YWGA 1G5TA 2DFLA 2UVQA 1XWIA 3AQ4A 2GK6A 3FWYA 5DIFA 4DUGD 4ABYA 3GCGA 4QHYA 3VR2A 4Q47A 5AUPB 4WZAE 4O2LA 4C7OB 5JZVA 3TE6A 1Z83A 2CNWA 4DSTA 3B7GA 4BLSA 1EX7A 4ZCMA 2BM0A 3OEEA 4CF7A 3W8NA 4NCHA 1H8HA 5FOVA 5FPHA 1JI0A 1NVVR 4FMCB 2JJ1A 1N25A 5IDVA 2ZRKA 1XD8A 2HLDA 1U9IA 4A15A 4LBWA 4P4SA 4PAQA 4M1MA 2XB4A 5B64A 3K0EA 5EXTA 1K8RA 1VTKA 5KNBA 4MGZR 1R5OA 2EWWA 4Y0AA 1II8B 2ANBA 3L8YA 1S2MA 3MD0A 4KU4A 3BRWD 1UF9A 2QTVB 2ZSAA 2YHSA 2GJKA 4HAZA 4LC0A 1DO0A 3EARA 4EPVA 2IYLD 3PCRB 1IQPA 2WIBA 3I5YA 4LX0A 4QBFA 5FOXA 3QVUA 1Z8FA 3RS5A 1RJ9A 5AUQA 3AGPA 4AIIA 3BC1A 2VTKA 3SHWA 3ZH9B 2R6FA 3MGCA 1RRCA 1WRBA 4IDNA 3THOA 2X19A 2HF8A 2LCFA 3O8RA 5AK0A 2ZUDA 1WA5A 2K5UA 1Z0JA 2RGNA 3DL0A 4UNPA 1VG1A 3RC8A 3KB2A 1GL6A 2J45A 1S96A 4GZLA 1TEVA 5TDHA 2O8DB 1X6VA 3RRNA 221PA 1NN1A 4AI6A 2C95A 1XMSA 4V0KA 4B73A 1C4OA 4TL7A 4JBXA 3A1VA 4RD6A 1HQCA 3TK1A 1Z3IX 3C8UA 1CJVC 3WBJA 1OIVA 2H16A 2VLIA 1J2JA 4WIAA 5FPYA 1Y3AA 2O8BB 3GJ8A 4I1OA 4GPTA 5EUQB 1S3SA 4JMPA 5D3QA 2A5DA 1G7RA 1L8QA 1K5DA 3CUEF 4WZ6A 1DAGA 3U2QA 4DSUA 3RNLA 5CITA 2ZANA 1TTTA 1W36C 1E9RA 4L16A 4A0RA 2GILA 4RCZA 5JRZA 4XJXA 3CKLA 2B7CA 5KTYA 2J41A 4DT1A 1EFTA 1W5SA 1L2TA 4AYTA 1UBEA 1IY2A 2OE2A 3CWZA 1IN5A 3BIFA 5BN5A 2NG1A 1E1QA 2WZQA 2QMEA 4LOAA 2PEYA 1SVKA 5AJZA 1XB2A 5TVKA 5CYOA 1BO6A 4HLCA 1X8JA 5HCNA 4XSGA 2FA9A 3SZRA 3RS7A 2FSHA 3AKDA 5EE9A 521PA 3MLEA 3MWLA 4C7OA 2C8VA 5LB2A 4MA4A 1NLFA 4XWKA 3J81k 2CVFA 4ZV4A 3FVQA 3QKSB 2Z43A 4PZLA 4AURA 1D2EA 3Q3JB 2L0XA 2H5EA 4HAUA 2JDID 3AF3A 3X1WA 4FMDF 1Q1BA 4LHVA 2ZM5A 1P61B 1MRSA 5AJWA 1Q57A 2F9MA 2YZ2A 2YWHA 4ERNA 2D7DA 2EYUA 3EIQA 1KO8A 3W3AA 4HUQB 3CRMA 5L3SB 1P9RA 4P0TA 3WYFA 1N6IA 2D06A 4MGIR 4CW7A 4BE7B 4HUTA 5AUOB 2ZS9A 5A5GA 2G1KA 4GL2A 1UBGA 1ZU5A 4HATA 3EASA 4Q21A 3ZZ0A 1A82A 5BN3A 5KSOA 4KAXA 3WRXC 3KQUA 1IY0A 4TLAA 3UXMA 4Q00A 2W6IA 4DCNA 5FBQB 5DNYB 4BFYA 1QG2A 3GJ6A 1GKUB 4WZBE 1G21E 4NYIQ 1E0KA 2C5LA 2OESA 3LRPA 3GLGE 2BMEA 5FTLA 1NLZA 3SOPA 4B6FA 3NDBB 3QXXA 2ZIAA 1OKKA 3CPJB 1YJ5A 2PX3A 3PV0A 4LI0A 4BFUA 2ZREA 5KNCA 5J4LA 4HLUA 1CR0A 4KBFA 4N0DA 4ZDKA 2FJUA 1G5PA 2F43A 3BK7A 3LBNA 2DFNA 2W6JD 3B6EA 5JS8A 1ODFA 2GXAA 1B23P 3MJHA 4A8JB 4F38A 1XX6A 1OYWA 4DSNA 1CR2A 4PC3A 1E2IA 4LJ6A 2D74A 5DN6A 1OW3B 4BLPA 1D6JA 1JEDA 2WKPA 3K0CC 4HLDA 3L8ZA 4F4JA 3TUZC 2VF8A 1WXQA 5BYKA 5HKKD 5AJVB 2AHOA 3X1ZA 1P62B 1ZD8A 2F1JA 2OBLA 1XPOA 3O8BA 5P21A 3NXSA 3SNHA 5C2JB 4IDOA 5K8IA 1KDRA 1NLYA 1LVGA 3VTKA 4IHQA 4BFZA 1YR9A 1LV7A 2B8TA 3FMPB 3LQRA 1ZBDA 2JA1A 4CEIA 2XXAB 4DC9A 1NIPA 2ZRAA 1Z47A 1QHXA 1A7JA 1VCNA 1UKEA 1GWNA 2V54A 2JCSA 2WWWA 1Q44A 3KDSE 4Q4HB 2CJWB 3X1YA 4DIEA 2O8CB 4C0AC 2F1RA 4B71A 4JKYA 2F43B 2OHFA 4Q9HA 1I2MA 2FEMA 2NTYC 2W0MA 3PFIA 1AQYA 3LBIA 1E2HA 2QM7A 2VP4A 3GEEA 4I81A 4LPSA 4LHZA 3VFDA 3W90A 1FW6A 1NSFA 4TT3D 4YXWA 5LPNA 3PIRA 5G53C 2HXYA 2V55B 3AVTA 2BKEA 3E70C 4JSTA 2CEAA 3ND9A 2CLSA 4G5OA 4U5XA 4B32A 4ZCIA 5DO9A 1HE1C 4A8JA 2ZRJA 1LW7A 3TW8B 1JR3A 4CYMA 1BOFA 2FG5A 4DEYA 2BMFA 1G4AE 1NBMA 1E1RA 4TN1A 3UMFA 4EPRA 3BWDD 4MKIA 2OV2A 2QNRA 4H1UA 4URUR 3I62A 3QKRA 2ORWA 4ZPXA 4BZXA 3QXHA 3V9PA 2IUSA 3K9NA 4IDPA 1CRPA 4R9UC 4JYBA 4URWR 4KVAA 1N5JA 4TZ6A 2O8FB 1G41A 1XFAA 4Z8XA 3LLMA 3TBKA 4ASUD 3K1JA 3ZZTA 2KI5A 1UDWA 4V0ME 4OHVA 3TAHA 4PQFA 4TSFD 4JJKA 2REXB 3SE0A 4P32A 3T5DA 3FHTA 2VHQA 3ZQJA 2JLVA 1F3OA 1N6LA 1O87A 2MMCA 1TNDA 2V6JA 3X2SA 3EPLA 3QG1A 4M22A 2GA8A 2R6AA 3FHCB 3GLHE 3P26A 4HZUA 5ELXA 3CLVA 3VHLB 1P60A 1KSGA 1P2UA 4I1SA 2A5JA 1HT2E 2ZI4A 1KI7A 4QNRA 2XAUA 1ZUNB 1IN8A 3MRSA 3SYNA 1CTQA 5JCZA 2V9PA 2ZJBA 2DFKB 1G3MA 3BBPA 4US1R 4HSEA 4W9MC 3NBXX 4RFSA 2BC9A 3SFVA 4B2PA 5K8TA 3EZ2A 2WWIA 2CHQA 4GI7A 4MKGA 1D5CA 4EJSC 4XOIA 2OCYC 3LXRA 1NY5A 3C7KA 1YKSA 1M7GA 3LX8A 4HAXA 3B9QA 2WWHA 1W36D 2O8BA 1XBTA 4LV5B 3RWOA 1OLOA 3AF2A 3KKOA 1TF7A 1YR8A 1YZNA 2EQBA 4BRWA 3R20A 5HE8A 2MSCB 3H4MA 5E7MA 3VHXA 3TMKA 1DOAA 5E7IA 1U90A 1JAHA 1SXJB 4TTRA 4RZ3A 1XMVA 1KK2A 3W8RA 3B1YA 2GJAA 2CCKA 3ADCA 4L15A 3NKVA 3NBZC 2DFTA 4OHZA 1AKEA 1NMXA 2BOVA 2Z83A 1DELA 2JJ1D 2CLDX 2RGXA 3SU8A 3DKVA 3NEYA 4HDOB 1PV4A 1S4QA 5BN4A 4F92B 1SXJC 1ZJ6A 2CK3A 1KSFX 3FE2A 1N0UA 1RJ9B 1WMSA 4Q7MB 1TUIA 3JVVA 1UAAA 1COWA 1KO7A 3LW7A 5KOYA 3U6KA 2ONKA 3CR7A 1T9HA 1TMKA 1KO5A 3ICEA 1NKTA 4PTLA 3D3QA 1GRQA 4L4UA 1E9SA 1QDEA 2NPIA 4POAA 3RC3A 4JJZA 2HDNB 1TF5A 1W0KA 3M6AA 5FL7D 3TNFA 2AX4A 3QG5A 1Q1ZA 4Q7LA 1EX6A 4B48A 1Z22A 2ODEA 1XXHA 1G6OA 3I1FA 3LNCA 4UQOA 1GNQA 3QVVA 2V1XA 3TLXA 1P9WA 4HDCA 4TLDA 2R6CA 4GSYA 4IDQA 3M1IA 3P27A 1BMFD 1BYIA 4ZKDA 2HUPA 3EC2A 1VKJA 3HYTA 1DPFA 5BQ5A 2AKAB 1I4DD 2QP3A 5FFMA 3U3OA 1G17A 3THYA 4KFTA 1OFHA 3FYHA 1X86B 3CX6A 1IXSB 1KI2A 3LH5A 4JVSB 3VR3A 2HEIA 3HU3A 2IYWA 4PHGA 1LF5A 2DHRA 2VIIA 4UXHA 1XMJA 5J4YA 3FB4A 3OFNA 1S1MA 2IF0A 4OQNA 2JLRA 3A58B 2ZRPA 5GVSA 2ZROA 3EWSA 5IHPA 4LK2A 4UJ5A 5E4FA 1W36B 3I61A 2OBNA 1ZRHA 2Y8EA 1MO3A 4JVLA 4NYJQ 4YMSA 3DOEA 2BCGY 2FFBA 3C15C 4B3CA 3PUYA 1EWRA 4TMXA 2P2LA 4C9BA 4AKIA 1ZD1A 3OAAA 4YC7A 4URXR 5TMPA 4NYMQ 4UNNA 1ZCAA 1MKYA 1P73A 5EXSA 3U44B 3DVLA 3U7EB 1RZ3A 2J46A 5KSPA 4LJ7A 4JL5A 4QBHA 4K46A 2GDJA 2B6HA 5FBLB 2R44A 2GZDA 3CNNA 1E2NA 2EU8A 3K09A 5CIQA 4TYNA 3TAUA 1KI1A 1QRAA 4ACAA 3FKSA 1F5NA 4E22A 3K53A 4S2EA 2C2HA 3RSLA 4PZZA 2GKSA 4PC7A 5M04A 5DH9A 3TVDA 2BBSA 2QAGB 1KI8A 1KK0A 5KO2A 2LWIA 1OXSC
chains in the Genus database with same CATH superfamily
3D0QA 3DEFA 5JARA 2GKOA 4EGQA 2W37A 2DF8A 2CYAA 3SMVA 2HSGA 3HSKA 2P3SA 3MK31 3ZNQA 2PGOA 3HQ4O 1MQ8B 3MCVA 2NWQA 5CNIA 4Z7NB 3RSOA 5IRCD 4UBNA 3VX4A 1EHCA 1C3OB 3GF4A 3M6IA 2CUNA 5I8WA 1MT0A 3BL5A 1ST2A 1BH6A 4BYGA 4WK2B 1G8SA 3PNBA 3A9WA 4GXTA 4UBIA 4BMYA 4ZYXA 3EIEA 2BMJA 3O1HB 4JEUA 4QJIA 2XCOA 3K3PA 1IJFA 2FN3A 2XUHA 3WGMA 1OT3A 3CRW1 4WGGA 3D0RA 3VC3A 5J43A 1I4EB 2QDKA 1KFBB 5TPWB 2JIZA 1NONA 2ZWPA 1E1MA 4EY8A 1RM0A 3QVTA 4PLZA 1DG1G 1OV6A 2WUEA 3X43A 1ZAYA 3Q8WA 3TVTA 4KV7A 2BKAA 3NHZA 4EFLA 2J87A 2WPDD 3P4YA 3B7PA 5ED4A 4PHCA 1L5NA 3TM4A 4IHAA 1C7FA 1E8MA 1QB7A 1U7OA 3TEMA 2Z6UA 1TFRA 4WY2A 3RUIA 2IOFA 1UC4B 4QTXA 3W77A 4D8VA 1TTPB 1QCCA 3GFQA 4OFWA 4S3MA 3ZVMA 1CKEA 4XJTA 1SUFA 1M6HA 1UKVY 1NQTA 2W9XA 3AESB 1WZCA 3FPJA 1SCNE 2O57A 3IP8A 1GYRA 5F3WB 4QJ4A 1G8MA 5KNCD 1OFIA 4W5QA 1D8AA 1WHTB 1MIOA 3QEOA 1GEEA 2SKCA 3LPDA 4FGJA 4FUQA 3O4RA 1CR6A 1JHOA 3OESA 4WKCA 2O2CA 1CHDA 1C7EA 4AY4A 4KWIA 1N2IA 2GHIA 2B34A 1R6TA 2YNMD 1C30A 2M6SA 4IFBA 1OFUA 1J09A 2FMXA 5B1EA 2X77A 2ZI5A 1SKUA 3N58A 1JBEA 5HFNA 4GECA 3SZUA 3SGLA 1N77A 2BZ0A 3AQIA 1GT91 4BUZA 3PQFA 1EGAA 1GN9A 4P5PA 4DCMA 2ADMA 4MRMB 3G1TA 3KQPA 3NLLA 2J3MA 2FZEA 1SQ6A 2GD0A 2JAWA 4I36A 3TBHA 2VNSA 4BWGA 3T9FA 3GDGA 1L5YA 2C96A 4UNRA 3SHVA 1XVUA 4BEWA 1TCAA 1QNFA 1XK7A 1QR2A 3MBIA 4JOQA 5F3DA 1BVRA 4EGFA 2DT5A 4KAJA 3ENZA 4YPOA 3RADC 1EIWA 1C9MA 3L1IA 1L5ZA 2H8KA 1UJMA 3AG6A 621PA 3ZDAA 3LXUX 5KOHB 2CL7X 3FKQA 1N6RA 1Z33A 4O63O 4J03A 4W63A 4P54A 5ADHA 4LWZA 3LX5A 4WT7A 4EFNA 4CHGA 1QYXA 3KZOA 2X8BA 5DSZA 4KPUA 5DHQA 4UOEA 1J99A 1HMYA 1XEXB 4NY1A 1DKQA 1LNZA 3HHEA 3CS3A 3R7LA 1YI1A 1P9OA 1P4GA 4GYYA 3OX4A 1HQYE 5DX1A 3FHLA 3PVSA 3L0IB 5E95A 1Z07A 2W8ZA 2PWPA 3SWWA 3TQCA 1I2ZA 3ZQKA 1AKRA 2AMVA 3MRVA 3DOIA 3GXOA 1ZIPA 2CFTA 3L01A 1CJUC 1EG7A 4FYMA 3IAXA 4L08A 5TJHA 1ZA1A 4OHCA 1RKQA 2A0YA 2MSWA 1T3HA 2ZJAA 1MT3A 5K8UA 3TQQA 1P75A 4BFWA 4MRPA 1XNGA 2P30A 1H2BA 4BO1A 3JAMA 2JCXA 3BCHA 4NDZA 5DT9A 4BVJA 4LNUB 4A8JC 4YJ3F 5BSKA 1HNZB 1X1BA 4BNMA 3ZHQA 1RBQA 5IW8A 3C5EA 1KTIA 4D4LA 1W85A 3PNPA 2D4HA 1NTRA 4TVKA 4WCFB 1YIAA 3QNMA 5ARBA 5KVQA 4EEZA 4AG6A 1WW2A 3L8FA 3KL4A 2JJMA 2FW7A 3KE8A 4K9MA 1PSWA 1P6QA 3VPSA 1VJDA 3L6EA 4R3NA 4UE6A 4WLNA 3H1AA 4CV3A 2ZAGA 3ZZ1A 1YKGA 4FINA 4RLHA 5CTJA 3WK5A 3ZWMA 3HSSA 1WVIA 4MTLA 2O8FA 1OIXA 1EX9A 2GYUA 3V55A 2EJBA 5K8LA 1W47A 3K2IA 1CVLA 5EJ9A 1G16A 4D46A 1IM8A 3HVHA 1US8B 4CM4B 3GJ7A 2EJCA 4M1SA 1KI3A 2QGFA 1JHDA 4HRVA 2ATCA 4YRJA 3MWYW 4R2LA 4DCTA 4EO4A 2J5QA 1JDVA 3E15A 3TW8A 3G02A 4I50B 5BQOA 1JHMA 1A04A 1DVRA 2FWJA 1NXTA 3WB2A 5KOHA 2AT1A 1SJ9A 1OCEA 3NTLA 1LF0A 5DU2A 5I9NA 4TTSA 1FLDA 1N3LA 3O82A 1W2GA 4PY2A 4S0XA 2PYDA 3VI4B 1WDMA 2GFIA 1K8ZB 2B21A 5TY0A 4ZMSA 4V0LA 4X3PA 4RTKA 1F4VA 2AH5A 5TMDA 3U80A 5KTKA 1U28A 4GPAA 3BL8A 4M9ZA 5DHAA 4MARA 1M2JA 3NVMB 2A8YA 3MMNA 3QUCA 4LX8A 4YO7A 4GNRA 1VMEA 3F3SA 2O8CA 5KJFA 4H0FA 4B1FA 4NBSA 4I1UA 5BV7A 3CF2A 3N2EA 5CBKA 3FI9A 4FX5A 1JH9A 1WR8A 1C30B 5ED0A 1Z6GA 4EYOA 3VVLA 1CR1A 1O3YA 2ZTVA 3CN7A 3W5CA 1CUXA 4R1PA 2VNKA 1J4AA 4CEIB 1CZOA 3LA8A 1EJ0A 2YZMA 3E4CA 3Q87B 2VJCA 4IEFB 3CIOA 4J6EA 3DOFA 3RARA 3B8HA 3HA7A 4D9HA 4FKBA 1F0YA 2BFEA 5A06A 4E4RA 1NBIA 3H5OA 5TEVA 4JVMA 1W29A 2CXNA 1LK5A 4DNQA 3DZCA 2XOEA 5H3CA 2H5IA 1PSZA 2EGUA 2HLDD 1SVUA 4EZIA 2G9ZA 5L7TA 1Z88A 4N5HX 3HN2A 2X9QA 2J09A 5KJ6A 2BI8A 2Q5IA 4RAOA 3SBXA 1QV7A 3N6RA 3I9V1 4XTCS 2X58A 5D5PA 5DBOA 1N2JA 4EFKA 4V3CA 2PYZA 3CVXA 3V00A 1TUBB 1W4AA 3KD3A 3N28A 3TAXA 1RZVA 2XSZD 1R2QA 2G8NA 2I4LA 3ROQA 1N7GA 1QVRA 5B6IA 4PFSA 1DIOB 1M1YE 2XVYA 4R40A 2RI0A 2H8GA 2ZYRA 1SZPA 4PS1A 1IAQA 2G71A 3X1MA 3F96A 4OK3A 5IVKA 4E13A 1DZIA 4D8UA 3BH6A 4MINA 1G7SA 1YULA 3EZ6A 2Q3FA 2J5KA 3S55A 3KQHA 3VZCA 3V4PB 1P9NA 3DFMA 2XBLA 4QTZA 4KO4S 2M98A 1T8UA 2MOKA 3DG9A 3Q2OA 2NO7A 2FPLA 5CLGA 3GH3A 4EX6A 3ZDDA 1ORDA 2WM3A 2H06A 2NYRA 1ACJA 1M8KA 1BE8A 2AI1A 3CHYA 3HKBA 5JYCA 1A9YA 1LLCA 2HHCA 3F47A 1AM4D 2W6ID 3PDWA 1VLMA 1G38A 4RU1A 1MRNA 1XUOA 2VS1A 1PGOA 3OQPA 5FO0A 4AZ3A 1MU0A 2VQSA 8OHMA 2BWJA 4NE7A 4AVYA 4H7DA 3WGVA 1PGQA 2BBTA 4B3RB 1E5TA 1CNFA 4ZEVA 3J7AC 5B36A 1JJ7A 2YQZA 4H3HB 2VK1A 4C7VA 2D0DA 2NV0A 1OGJA 2DWOA 2YHIB 2Y6VA 3CLUC 3JQGB 3OQJA 4GO1A 4J91A 3OZUA 4LCJA 4KQMA 4BFCA 1SB8A 4DV4B 3RTGA 1IN1A 4FONA 3MOGA 4YDRA 3F5FA 3K6SB 4E4TA 1CK4A 1OLSB 2EBUA 2W2VA 3COPA 4WEQA 1F2TA 4OLJA 1V6CA 3QKUA 2C00A 2CJYA 4U3JA 3L82B 4LGMA 1VG9B 3TG8A 1P7ZA 1PQYA 3L7IA 1K2VN 4RQAA 2NGRA 1ESNA 2R8EA 4TV8A 3SSNA 1DKRA 4JITA 4E5SA 1Y33E 3GH1A 4GSKA 4V3BA 5KYTA 4IF4A 2VYQA 4KYIB 1LEHA 4WK6A 2NZWA 4MYRA 3W4KA 2TECE 4NV3A 1QONA 3WV5A 1USWA 1JU3A 2C61A 4RTJA 5G4KA 2BISA 4GBJA 2ERXA 4V1CI 4MS4B 4MK4A 1FJHA 2DGDA 2I62A 4F3TA 1AV6A 5HILA 5A9SB 5K0CA 2VAPA 4JL6A 3SIPA 2GRJA 1V8FA 2P75A 4ZO9A 4B3MB 3MGGA 2ZB3A 3K0BA 4MB2A 1HZZA 2OKCA 2YV3A 5LBIA 4B3JA 4Q18A 3IXMA 3F71A 3PC4A 1T6XA 4K9SA 2V9CA 1ETHA 2GM3A 4QELA 2D7CA 4A5SA 3QU5A 4AZTA 3K0SA 4CEJA 4ENTA 3HU1A 4PNHA 2D0IA 3DAFA 5KTMA 2BUBA 3NHFA 4MO9A 4G0WA 3NBMA 4I14A 4R16A 5H4GA 4Y6QA 3GAAA 1SULA 5CU7A 1AA6A 1QPZA 4X9XA 2OY0A 2ILTA 4F93B 1NSTA 3NWJA 2WFLB 1B2LA 3A9CA 5DULA 3C6XA 3RQIA 1PQWA 2VUHB 2NSHA 1TU4A 4IOLA 1WZIA 1W4ZA 3EOAI 2PQ6A 2WTNA 3Q3VA 4ZRDA 3L4BC 5FUVA 4EUNA 4P3OA 1UFRA 1XJCA 2J9FA 4C0KA 1SIWA 1CU1A 2GZ1A 2P69A 5CG1A 1L3BA 3NIDB 2C31A 5CX4A 2A5GA 1JE1A 3Q7TA 1CF4A 4UKDA 1ZONA 1VXOA 3AYZB 4WW0A 4DY6A 1B0UA 3IGFA 5EN4A 1GAQA 3MTGA 4QARA 2OEPA 3PG5A 3SPXA 2WT9A 1ARZA 4N41A 3NASA 3C70A 4JLVA 3VAAA 2VQDA 2BFBA 1FPQA 1O1YA 4I5FA 4DA7A 1GPAA 1G4HA 2VCYA 3MMPA 3KYDB 1EUCA 1E8DA 2C4UA 3FRHA 2GJ8A 1WPGA 4ZEOA 2QLMA 2CLKB 2FMFA 3DO6A 4B34A 4LBZA 4MUBA 3HCOA 3VTZA 2Q0QA 3Q7IA 2AW3A 1S1CA 2QE7D 3V4RA 2X8LA 2EW8A 4W4TA 1KU6A 1XQWA 3REQB 1N9GB 2W6ZA 3OI7A 3VUFA 3OE5A 2AUMA 1HR0B 3OC0A 2ACKA 5CT6A 2HMSA 2BGNA 1QG4A 1VI6A 3KJXA 3TOZA 2JFFA 2DFPA 1K08A 2GN1A 2J7KA 3OECA 2HWUA 1D2CA 4V0RA 5AWFC 3IMEA 1RD4A 4KXNA 1EWVA 3AF0A 3HPQA 3LO5A 5IWAB 3DP7A 2ZBQA 2NO0A 2M9MA 1HTWA 1XRNA 3OTQA 4IXWA 4G9EA 4XM0A 3UMGA 4O29A 4RXMA 4XASA 4P4SB 3NBQA 5CHEA 1P3DA 4OG2A 4TVSA 1U28C 2WF9A 4HNAA 1KMHB 4ZOCA 1WDKA 5BW4A 4DGSA 3A4MA 3DAYA 3IEUA 4PONA 1VYVA 1Q1QA 3R41A 5KWVA 3WICA 4HDRB 2QZJA 1I1QB 2PUVA 4PR0A 3QE3A 4TZTA 3TW0A 3H9EO 3NONA 3ZVNA 4X95A 2PMDA 2ZSIA 4R1LA 2RHWA 4ZAGA 3LDGA 1NI5A 3ON5A 3IALA 4KIUA 5IMSA 3EB9A 4YCSA 1Q84A 4G85A 3KX2A 4P4TA 3MXOA 1JHAA 3UT6A 4DLTA 1WEKA 3E1KA 2ZI7A 5CEEA 5LDHA 3I9LA 4TYWA 1OTXA 2YIMA 3G2JA 4IFEA 3HEBA 2FDRA 4EHLA 1I7LA 1XN1A 4FX2A 5H0IA 3ZDZB 2DRIA 3SHOA 3ZZNA 2W2LA 5A9SA 5JNVA 3EMBA 1ISSA 1AQJA 1LW6E 4O0MA 2FUG6 2ZT5A 2XD4A 1N1MA 2VSFA 4W82A 4C5AA 5LZ7A 1JTFA 2D6FA 1PEYA 4MQFA 3U4QB 4RJIA 5BMOA 1UINA 2D62A 3URKA 1JECA 4GPIB 4DCGA 1KQFA 4IIUA 1N32B 1ADFA 2A9OA 1AXEA 4LZLA 3AJRA 4TV8B 4C20A 3B1FA 1XIVA 2HIGA 4YDSA 4D92A 2H0QA 3PC8C 4NU8X 4Q4LA 3S2YA 1LU9A 1ZVQA 2Z9BA 4CKBB 4PXAA 1F2TB 3F5MA 1IN7A 4LY3A 2WVJA 5EE3A 2ZM6B 3DB1A 1E3LA 4BLQA 2QVYX 3EJ6A 1JSLA 4MVJD 4YJ2B 4K6OA 2CJPA 3B1KA 5FJJA 3VAYA 4BX9A 1DPGA 3H13A 4K28A 2G77B 3L7YA 3DBVO 1ZCBA 2CXOA 3NHKA 2FTKE 3MCZA 3IUNA 4X44A 3RTBA 4PG5A 1Q0LA 4V0SA 1ZNXA 3PSHA 5FYQA 5C5CA 5J47A 3QPCA 5A6VA 3BPSA 4XJVA 5C8YF 5EP3A 5FYDA 2QYSA 4LF9B 3I6BA 4RE5A 3PNKA 1KEKA 2QTHA 1RLUA 4HDKB 1PG5A 5AVQA 3AVWA 6REQA 3NHAA 5CFQA 3TPCA 5KYWA 2RHTA 2C7GA 4BRUA 2QP4A 3AI2A 1T5LA 3L8HA 2VJPA 3JPYA 1JXAA 1QLJA 2AV6A 1QPGA 2AEFA 2BHRA 2VF7A 5LQNA 3NT5A 4DV6B 1Z4LA 1JIXA 1X8LA 4BFLA 1QIKA 3MAJA 1AS0A 4S1OA 1TGVA 5G2OA 2FZCA 4TZKA 1RJFA 1SPBS 1F8XA 4QLAA 2BHLA 1BXGA 1IC6A 2XCLA 3C6YA 3LHIA 3RKSA 5T41A 3RFXA 1TT5A 4KWEA 2Y1CA 4LE0A 1ZMBA 2ZT7A 2PH5A 1VL8A 3CTPA 5IDXA 1K6XA 2VHVA 5EZ6B 1I9GA 3FW1A 1AUQA 2PIDA 4KJXA 3OP4A 3IAAA 1B7GO 2WTAA 5C0OE 3L6CA 4B17A 4Z7JA 3BBLA 2FDXA 1R8YA 1LZLA 2RK3A 1QDUA 3UB3A 3W2IA 2CXRA 3AEUB 5AVTA 3P96A 3IPXA 3EPKA 5AKKA 1PNQA 4G65A 2VP3A 1MZPA 2NO9A 3R7SA 3SDBA 1Z2AA 3Q5EA 4HQ6A 4EQ6A 3OQIB 2X8WA 2ZBPA 3T5CA 4E2ZA 1NLUA 3BGIA 1PO7A 1RDFA 2RKBA 4UE2A 4FBLA 3U9LA 5HM8A 1KH1A 1G20A 3FMIA 3JQ8B 1FNMA 3KB1A 1P0MA 1YS1X 2ZXUA 5I9LA 3OTHA 3NKFA 4IKOA 3AETA 3G13A 3SEFA 3AIKA 2ZQ5A 3OCCA 3CVYA 5LBUA 2CXTA 4NECA 1QCYA 4FMCF 2IEBA 1Y1QA 5IEBA 3BULA 2JHGA 4DF3A 1VQ1A 5BWBA 1VE3A 2J9ZB 1KOGA 4B6PA 4K9QA 2ZSBA 2PGIA 1MJNA 4QXAA 5T4EA 4WDQA 4BAUA 3N7TA 3I9KA 4MMZB 4DHEA 2ZITA 5TPZA 4JCOA 4BRZA 1CUUA 5JZOA 4LFBB 5B57C 4WXYB 4QICA 4LZZA 1QAOA 4UMVA 2HHLA 4DJAA 5GGXA 2QPAA 1R4MB 3EVGA 4Y2JA 1T8SA 1NMZA 3OIUA 4ZQGA 3HXPA 2H2AA 1AUOA 2OGZA 1NX9A 3UMBA 1MFPA 4QA9A 3G9XA 1XLTC 5DRTA 2YJTD 3UBMA 2I71A 5A6SB 1NUQA 3DVRX 4G5RA 2HMAA 4WX2B 5TV2A 1G64A 2BM1A 3IO3A 3SHFA 3V3KA 1DX9A 5AKYA 1A9OA 1PE0A 4XARA 3I58A 3RCBA 1N9ZA 2EERA 4EAAA 2CSXA 1YRLA 3HP1A 4LYHA 3DXYA 3I4LA 2PV7A 2BMAA 3KKKA 4MUFA 4PWYA 5TMEA 1YC5A 4EKDA 4ER5A 3GJ0A 4FZVA 4M55A 4J0EA 3U9TA 2R4UA 1NT4A 2J4FA 3U3RA 4FNOA 3WMXA 4CM4A 3T4XA 1M5RA 3MJRA 4L9AA 5JAOA 5IYZB 5JIBA 3H9QA 3MW8A 1PS8A 3DR3A 1V45E 2QD5A 4CM9A 2HJRA 4JY7A 1J1ZA 1ZOSA 2RK6A 1NNLA 4P34A 1B8NA 3CLRC 1FUIA 3DGEC 4E08A 2DCUA 4A73A 5FI1B 1J8YF 4MITA 2VZ8A 3RDPA 3ZD9A 1ZG3A 2ESRA 4FHCA 4DCPA 4V02A 1A9TA 3P71T 1HFWA 4OOFA 2OILA 2LR0A 5I7FA 4WESB 3S7ZA 5K20A 4AN1A 5L53A 2W93A 3IE2A 5LQJA 4ZRNA 3ZOZA 3UJNA 3LY5A 4H08A 3PEVA 1IPEA 2VYNA 4PWZA 3H0KA 4Q82A 3MSXA 4L5JA 3ZZUA 3QNUA 4LNUA 1XAIA 5F9FA 1HE3A 5JY1A 1B74A 3H2IA 2YVUA 3LGSA 4L4YA 1PGJA 5K4GA 4RV5A 2AQ8A 1T4CB 3C98A 4W9NA 1FIUA 3FJ1A 4EJSB 2WSIA 2VT7A 4BEVA 2HEGA 4C1BA 5KX5B 2RG1A 3MUOA 4ZCSA 1HY3A 1ZVJA 2A86A 2JI7A 3AIMA 4ROSA 2JBHA 2WTMA 1J2YA 3L43A 5EMHA 3URMA 4IJMA 4FCTA 1PW7A 2F9FA 4PGFA 3ER8A 4P3XA 5TQJA 1LDMA 3CW2A 2I2AA 2J33A 1NC3A 2G5PA 3A36A 4BFTA 2NUPA 3UGQA 2EJUA 1IN6A 4NBKA 5A3QA 2INGX 2XF8A 3D7NA 4AZ0B 3NCTA 4HI0E 3RABA 3S99A 3VAZA 2EW1A 4QGSA 2J3KA 4FE3A 2DLCX 2OM6A 3W5DA 4XVQA 4KE7A 1SCBA 4FDLA 1K3FA 1TQ4A 4YRQA 4AY3A 3SIXA 1U0FA 2GCNA 2PFSA 3UN1A 3IB6A 4CKEB 5EIXA 2QL9A 2IYNA 2V7UA 4X8HA 2FPMA 1HFEL 3AEYA 3TKYA 3T15A 5LYJA 3J7TA 3I01M 1LI5A 3QLVA 4KVFA 4MCJA 2ISQA 4MGHA 3GCXA 1Q7TA 5A0FA 3IERA 1VLJA 2O3TA 4S05A 1WUJS 4V38A 3DWIA 5DM70 2G88A 3GP8A 4QUGA 3H4VA 1KAEA 4UAUA 4DR6B 2N3ZA 1GHTA 2ZU0C 2JCVA 4TWZA 3A4NA 4JXKA 3NH6A 3KSBC 4HDNB 5EQTA 4BIIA 4DMKA 1K4YA 5MN6A 3Q5DA 4DWVA 1HG0A 2XCQA 4G4SP 3UXHA 3S81A 5FJIA 5JAIA 5L40A 1EQAA 2YOFA 4KQWA 1Y8RB 2BZ1A 4Q3AA 5K1ZA 4RSHA 2WNSA 1W4BA 5HJ2A 3UJ9A 5JFGA 1LPSA 3GQBB 3EGVA 4WMLA 4XSHA 4HOYA 5B1YA 3U3DA 4P7GA 3UV6A 1R0RE 1XVTA 5BWLA 3TJZA 4KXWA 1WNFA 2ZSFA 3O38A 2C04A 2GLUA 4PHFA 4C43A 5H3HA 2P9BA 4FC6A 1SHZA 4BOYA 1FU8A 1NJFA 2KSQA 3P19A 3OICA 4PCAA 1CZUA 4G6ZA 4WVFA 4F91B 1HK7A 3F7NA 5B4TA 3AUTA 5IUNC 1UPUA 4PYQA 1H66A 3HY6A 2E49A 2YC4C 1I7DA 2NVWA 4W8OA 1SVIA 1FDTA 4I08A 1JAIA 1NP6A 3TW6A 3IKTA 4OQFA 2RKWA 4QQFA 3UAOA 3R7NA 4BVFA 5E3IA 1IBLB 3ABRB 3A3PA 1G19A 3E03A 4NZYA 4IJQA 2P0YA 3SDZA 5BWOA 1UKCA 4DV0B 1Q95A 2AZTA 1Q3TA 1TU3A 3COYA 3IDQA 1O94D 4RQBA 3WI7A 1SHLA 1EFLA 3CUVA 5KDOA 3ELBA 2IS2A 4LRWA 3TUJC 1R0WA 2CWDA 5JSKA 3DB2A 3A1DA 5JU6A 3HXKA 2D2XA 3EGIA 2GJ9A 4CLHA 5CM8B 2QE7A 4UVGA 3O9ZA 1CRLA 1AS2A 1UFKA 2KHZA 2IPOA 3IIJA 1L7PA 2NXCA 2VP9A 5AVRA 4X7MA 2FFJA 4ID9A 2ZRLA 4OHXA 2EFGA 2IP2A 1DBPA 3N0VA 3BD8A 3WGIA 3P0JA 1M34E 2H4ZA 2GYYA 4Z49A 3EOBI 4R8RA 1DCFA 1KZ4A 3U81A 1XEWX 4Y8VA 2Q21A 2XYQA 3EH1A 1Y3DE 3N0XA 3TB4A 1MEJA 1NMYA 2I3GA 3IE0A 4K81B 2IVZA 3EE6A 3HYNA 2Y1KA 1YGPA 4TL9A 2JLZA 1V4VA 1PLKA 4RJKA 4AJ1A 5IBCA 3L4EA 2I87A 2R8OA 3OPYA 1AZTA 7YASA 1AURA 3G5MA 2YQ5A 5KWJA 3Q3GE 1NUTA 4I4IA 3U31A 4BWYA 4Y67A 1ES9A 2J7PA 4BMZA 4Q7QA 3IKVA 1OSNA 1I1HA 1QV9A 1ADCA 1N5RA 4AJOA 2HO5A 2HMYB 1Y5IA 1KC3A 3K7EA 1V35A 3CRZA 4R0NA 2ATIA 4RPJA 2JGAA 5ES3A 4FYHA 4HVLA 3PEYA 1PDVA 1M1YB 3NWBA 2XGGA 5A03A 5BWNA 1R8JA 1W2HA 2AC2A 1QM5A 5AXCA 1N0IA 1DBVO 1ODSA 3HGMA 4HN4B 3ZX4A 2FF7A 2WFMA 3OU2A 3ZJTA 1CY4A 2VBFA 2YOHA 3DOJA 1FTGA 3VVBA 1WPRA 2RHJA 2R68A 1MFZA 2YYZA 2PKWA 3ICPA 5ULLA 4C06A 3ENWA 5JWRA 3AB7A 1QH1A 1IHXA 3L07A 2FB9A 4IYRA 2P9TA 3SXUB 1STOA 2QAIA 3ILSA 5FBZA 1PT6A 1A95A 4ZQHA 2OCAA 4RVCA 2CLOB 4ZAWA 4ISBA 4BUJA 4WACA 2JD2A 5EXDA 1J8FA 1GNVA 1U7ZA 4UBJA 4K9RA 1TLLA 4YROA 4PZYA 1B26A 3C3CA 4JI3B 4A82A 4D6YA 2YVLA 4BNUA 2GBPA 1E77A 1INLA 2QYOA 1JAXA 3CEJA 2XGMA 1GAJA 2ZJ4A 3EFBA 4F9FA 3TDKA 1P3Y1 2H17A 4LV8B 4ZJPA 1ABEA 1FDVA 2H63A 1JDBB 3PXDA 4XE5A 2A35A 3ESZA 4IDCA 2QMOA 3WBFA 4AXBA 2JRLA 4PINA 4BQNA 4UNQA 2HYIC 2FR8A 1BGXT 2AN4A 3MIZA 3D8HA 4BC0A 1LY1A 1X94A 4OHUA 3TLGB 5JVDB 4RS3A 1NWHA 1UXHA 2V3CC 1BGWA 2ID4A 3A26A 1C1YA 4CTKA 1ADBA 5J23A 3I5UA 3W6OA 1SRRA 1K5PA 3AFMA 4ISCA 4F8YA 2XNDD 1E6WA 4XQGA 3D8SA 1JYEA 1QX4A 2GK4A 1MPTA 2I7VA 1SC9A 4AKTA 2FMTA 4N3AA 1AUVA 3CC8A 4F96A 1XCOA 3KDPA 3FTDA 1LK7A 1WBBA 2WAAA 4OUDA 2IIBA 2B7LA 2CFOA 3I52A 4OOEA 4AD8A 3C3MA 4ZJZA 5HKBA 4JLPA 1TT7A 4BBAA 2OKGA 3JR7A 4UOQA 5H82A 1O96B 4DWOA 1FJGB 4J0IA 2A0KA 1U7TA 1AUXA 2GGSA 4C0WA 1LS1A 1OAKA 2BONA 3B1XA 3KTAB 1R5BA 4C30A 3W6PA 4MVCA 1Q1NA 3A6JA 3JSXA 4Z4IA 3QKTA 1X92A 3PUKA 4RX1A 4JX8A 3IYLW 5AI6A 5F4BA 3SNKA 4CKEA 4UTZA 3KPUA 3GDOA 4U63A 4F56A 2P2SA 2PL9A 5LVAA 2OMEA 3FBWA 3IDOA 3MJCA 4G0MA 3ZXSA 4CKWB 3OLVA 1ZN8A 1ZNWA 4AZ0A 4EJMA 5JCOC 1HOXA 5H68A 5JY6A 2IPLA 1KVSA 2I78A 1XHFA 1UK8A 1GSOA 2G5TA 1UBNA 2VRWA 2W90A 3JD3A 5HJ7A 2XF2A 3IEMA 1DV1A 1NR1A 2DECA 1U1DA 1FCJA 3V1TC 1G8GA 1GNPA 1THZA 2O1EA 2YXDA 3M4YA 4I4TA 2JFUA 5LJIA 3W5SA 4RA9A 3GOQA 4DS3A 1FQOA 4RESA 4Q16A 2QRMA 1VRVA 3GIDA 2B78A 1BHJA 3UAXA 3W1WA 2BMWA 3T3OA 3EXG2 3WISA 4WLOA 3E3LA 1E2GA 4M49A 4MQ6A 4H3VA 1D0SA 3D81A 3KCNA 3HA2A 5DNDA 3K9QO 5DP2A 4I1PA 2XADA 2EP7A 4X0EA 3V1UA 3EUFA 1P2GA 1YBAA 4MX8A 2HSJA 4DA0A 1M7HA 2PX2A 1ETUA 3UNXA 4GYWA 3REFA 1CJKC 4NHEA 2AR7A 4FW8A 2IF2A 4G1VA 4CIYA 3AB8A 3LQQA 1M1UA 4KK3A 3NU1A 4LOHA 5DBFA 3SZOA 5M2QA 2FN4A 4BECA 3GRYA 3L4BA 3AW9A 2OO3A 3O74A 4OJQA 4D6PA 1AKWA 1FFSA 1VSUA 1FLAA 2UYYA 4QGFA 4TTIA 4YJ2F 3RYFA 3ZS9A 2PQ0A 2G09A 5DCYA 4ENRA 1MQ9A 4PPQA 4NEHB 5ES4B 1B6TA 4OGFA 1BKSB 1YUNA 4QEKA 4RKFA 4X85A 5A05A 3HXMA 2IIQA 4KYUA 1U99A 1B0ZA 5BMVF 1XRQA 4I1YA 3LC1O 1GZ3A 3AIOA 5DW0A 4KQHA 4H27A 2J3QA 2XYHA 3JQBC 3B20A 3G2IA 4OYRA 2AE1A 2BFWA 2JFYA 1FRFS 1V37A 3LCUA 4OXKA 5BSMA 1KRHA 3GLSA 3O8DA 1ISHA 3KVNA 3PENA 3QMVA 2QRKA 2W00A 5FLYA 2Z2XA 4Q15A 3C4JA 2EZTA 3RT1A 1IXKA 2CDNA 4MHSA 2C4VA 1EWKA 1ND5A 1TVKB 3FTQA 3HB1A 2CLFB 5JNUA 1PVOA 2I22A 1H23A 1QKKA 1XROA 3ZCPA 2ES4A 5ALLA 3W9BA 5J2TF 2RCNA 3M7IA 4KCGA 4HRXA 3TTVA 3QWIA 2NVUA 4HG2A 1S0UA 3FLAA 2YWDA 1L5MA 2OECA 4IEIA 4L3WA 3USZA 1QFMA 1U2EA 2XI4A 3KEOA 3LDFA 4O2RA 3JW8A 4REQA 4BNHA 4ENSA 2VZLA 3RSCA 4F5WA 3HDJA 2DFDA 2P2DA 3BFPA 3KOZA 4OCZA 4YA6A 3EVCA 3KQSA 1NYTA 3AFHA 2GRUA 4ZA2A 1V8PA 1YJBA 3KVYA 3L8CA 4L8YA 5H7XA 3WK4A 3ZXYA 4BVEA 5E3HA 1RVDA 3EGWA 4U0KA 1KMNA 3E6AA 5JPCA 4HTFB 3DUWA 4KUEA 4M1OA 2VT3A 4EP1A 4C2UA 3OMWA 3U1TA 2RHDA 5FBVB 1FZTA 5K03A 2BAGA 1KAQA 4QU8A 4R1SA 5CM2Z 2R1ZA 4DKXA 2BI4A 5C5IA 1K98A 1PNVA 3OWOA 4JBLA 2P4UA 3HVKA 3CN9A 4N5LA 2C2OA 3BX1A 4Y2HA 1GGHA 2C7RA 3C48A 3OZEA 3ZV6A 3OEHA 2V9ZA 1KQGA 1P5JA 1CS0B 4ALIA 2CJWA 4M0LA 2GS9A 4X54A 5C8DA 3AU9A 3GAMA 4XWWA 3PEWA 1T3GA 2GM5A 2Q5EA 2PG3A 1NHGA 1BEEA 8AT1A 1CUCA 2ZYAA 3PQ4A 4L85A 1OF1A 1XCPA 2I33A 4LZPA 4TTQA 2WSMA 2HC9A 2WEKA 3HCNA 3B2QA 2BIFA 2E4UA 4MUNA 3FPSA 4ARZB 5LLDA 3LHDA 1XPJA 2VAVA 1B00A 1F8YA 2PRZA 3TZQA 1Z16A 2C9YA 2RK4A 3HJBA 4DBLC 4OQQA 4YUXA 3IQFA 3ZUPA 2LTAA 2Q2WA 4EKIA 1THTA 2XVMA 4HGRA 4GKJB 5JAQA 3BB1A 4BO6A 2VDWA 3VNRA 4L28A 4CT4B 3IP1A 3GELA 4UUOA 1XCMA 4AMYA 3W5AA 4KR2A 3F90A 3I2FA 1U3UA 3WZLA 1Q0UA 4J0KA 2QA5A 3O3MB 3TKAA 3KVOA 1Q7RA 3EEQA 3G8YA 3U7GA 1WJGA 5TB5A 3CWCA 1KPIA 5A9TA 2CHEA 5THXA 2A9RA 2GCGA 3ORQA 2H18A 2PPVA 4UU7A 1KIAA 2MYNA 2WUDA 4YIKA 2ZOSA 3CB4A 4IUBS 1ZM2A 2O2SA 2WU4A 4FDUA 2QZSA 4BV9A 4ZZ3A 5B3JC 1E61A 5D5QA 4Z1OA 3GNQA 4CLOB 1JL3A 3C3JA 1ACMA 1SKQA 4HRYA 1Y42X 3AY7A 4KXQA 1SCJA 5IH3A 5FI5A 5ESRA 1EVEA 2GN4A 4H35A 5ALMA 2O2YA 1JPUA 4QDUA 1QRSA 4L5YA 3Q6IA 2YJ6A 1QK4A 1H0KA 1BKDR 1GZ7A 2ZCUA 3PYLA 4GNKA 4GZ3A 4MVWA 5GV8A 3PWKA 5H70A 3Q7PA 2WSYB 4EHHA 1NZDA 1UKBA 1TAUA 2C5AA 1YBHA 1OBOA 2Z98A 1TJ4A 3Q7QA 3UAGA 4LSGA 4NJMA 4EUHA 2IS6A 2YJ4A 1GXSA 3QV2A 4ZI7F 2MSDB 1DFHA 1ATIA 3FPEA 4LWOA 4TKLA 3S28A 1GRCA 3B6IA 4CR8A 4OB7A 3HSYA 4J1SA 7MHTA 4HB4A 4GMXA 3DT6A 1TUGA 3HRKA 3OE7D 1LI4A 3R8CA 3B1JA 4BCCA 1O7JA 2JAXA 3OPQA 4YT5A 4ZOLB 3VHQA 1A5ZA 1MO2A 4ZQBA 4BB6A 4OXNA 3DCNA 2Y0DA 1CUWA 1IJBA 4H1HA 2E6UX 3S2EA 3P0IA 4PO8A 3DBIA 3PRJA 4JIMA 2V3WA 5CB6A 1EFAA 2GCPA 5GQSA 1MW8X 4JLOA 3CH4B 3AY6A 1YVDA 4D96A 1ZGZA 1MX3A 3VR5D 2GPBA 3P2OA 1WZEA 3JS5A 2OD7A 2IZ6A 1NFRA 1XRRA 2Z5VA 1O54A 3GUYA 5DMHA 3RB8A 1Z06A 4GRDA 4CWAA 4IILA 2VH5R 1DG3A 3WQBA 3OCVA 4RHUA 3AF4A 1I7SB 3ER9A 2XUGA 2QL6A 4I5EA 1O95C 3GLIB 4M86A 2C4KA 2RAUA 2V7QA 3PC3A 1BD4A 3SI7A 1USVA 5BQPA 4ICIA 2IIPA 4F12A 2CLCX 4L9SA 1SG0A 4M8LA 2VCEA 4CODB 2EF1A 2OPHA 4FR2A 3UATA 3WIBA 2QROA 5B3KA 1X80B 3D3WB 5T3UA 1E7SA 1O89A 1BMQA 1RYDA 2B30A 3FDZB 4KIGA 4BFSA 2NTVA 3HP4A 3NANA 3WLMA 1KKLA 4CMEA 4DV2B 2PNJA 1GYQA 3WNZA 4JBWA 2HXSA 2XWSA 4ND8A 3SZGA 2A14A 4HV4A 2XEDA 3H2BA 3HR8A 2QT1A 2OV3A 1Q7EA 2X2FA 3KQWA 2X2PA 1C14A 1OMOA 1Y37A 2PV0A 1E1LA 1JXMA 4C0BA 1HYBA 4DRYA 1M6VA 1TMGE 1HSZA 3BIXA 3GDFA 3HCFA 5EGSA 5B2ZA 3TN7A 1ENYA 3QE2A 3OEED 5FWNA 3GD7A 4RADA 1EE1A 4CM7A 3Q40A 2CXPA 2REQA 3D3JA 4YUAA 1D03A 1UQUA 4Z54A 1KJZA 1UUFA 5D7NA 2GEDA 1CR4A 1Z17A 2V5UA 4HEHA 4M9SA 1SHTX 4QJ3A 4LHSA 4N12A 1WV0A 4YRRA 2BFBB 3B53X 3GP3A 3TX2A 2RH5A 1CQIB 5CDUA 4KE6A 4EYQA 2C57A 3GGPA 1TIKA 3GARA 1FUYB 1UJ2A 2W6CX 5CXQA 3V6LA 1E0JA 1AB5A 3PXEA 4GKAA 5ALHA 4KX5A 1HE4A 5L51A 2X9NA 1XQXA 2IYQA 2HWKA 3H1EA 3U4IA 1L4BA 2I2FA 4BMNA 3THXA 3DTVD 1DCTA 1W5TA 3D8TA 1MW9X 5DX8A 2F3UA 4NX2A 4KQFA 5FULA 1HL3A 1QGYA 1R3UA 3L7OA 3NHBA 4CI9A 2IBSA 4MO2A 1Y1RA 3ROEA 1XPUA 1COZA 1JFRA 2FLVA 2BFNA 1AF7A 3N2NA 4QFDA 2BEVA 2R0QC 1VLVA 2UZ0A </