1R0WA

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) apo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
281
structure length
266
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
total genus 90
structure length 266
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0wA00
1QHHA 4BEBA 2D62A 1XCMA 3T34A 1UPTA 3UMRA 1SVOA 1E9FA 1KSFX 2J9RA 4D82A 4P4SB 3RAPR 4MRNA 2CXXA 4BLRA 3K0AB 4D0NA 3KJEA 4PQRA 3WYGA 2P5SA 4DWJA 2IYSA 4AD8A 2PEYA 1OXSC 1VCIA 3PEYA 4XJXA 5B30A 4EJSA 4OQMA 2YJTD 1WMSA 1ZUHA 4P32A 5AUNB 4GDFA 1HYQA 2C5LA 3I3SR 4Q4JB 3TVDA 3VR4A 1E2NA 1EG7A 1NIJA 1SXJB 3C14C 4HB3A 1DBSA 1P72A 3ADKA 4OBEA 1E2EA 4QGFA 3ZIAD 1Z06A 3AVYA 1X3SA 1HEIA 2FPLA 2IL1A 5DIFA 4DEYA 1TQ2A 1G17A 4M0LA 3K0EA 1XPUA 2NGRA 1HQYE 2R6GA 4KFTA 1XMSA 2RHDA 1KAGA 3A1SA 3LQQA 3HYRA 4K46A 5FTKA 5C4GB 3FB4A 1WBDA 3LNCA 5P21A 1D2NA 5CYPA 2R6CA 4J0QA 1ZMXA 4TLBA 3K9LA 1N5KA 1LVGA 2FG5A 4NHOA 3U2QA 4QBFA 1TPZA 1GWNA 2H16A 2HF8A 2Q9CA 4IEIA 4Q7JB 5CDFE 5K8TA 2IF0A 1G8HA 3AUYA 4Q7MB 4EQ6B 4R71A 1E0SA 1SVMA 5FUVA 1DS6A 1CJMA 4N1AA 4KV9A 2WBLC 5FFMA 2J0VA 4BRUA 4D2IA 5IK2A 3TRFA 1II0A 5LD2C 3FFAA 1NVVR 2XITA 4OQNA 1UEIA 1CJTC 1VECA 2ZYUX 2FF7A 3MAAC 3MFYA 4IDPA 1OE0A 1XDBA 2KSQA 4HB4A 4OK3A 2DFTA 2HYIC 1T91A 821PA 3BH6A 5CDFA 2OCAA 2FN4A 1EK0A 3MJHA 1RRFA 2IUUA 3GLGB 4DSNA 1JB1A 1YZQA 1ZAKA 2IYYA 5EXSA 3NBYC 1VTKA 1E3MA 3TIFA 4HAWA 5EP2A 3LBNA 5L3SB 1NBMD 2SHKA 2K5UA 1R0XA 4GOKA 1KKMA 3BBPA 4QG7A 2PMDA 4GZLA 4QXAA 2QAGB 3FHOA 1COWD 3Q7PA 4TMZA 1TEXA 5FH9A 3CRVA 1NLFA 2A5YB 3B82A 4LHWA 1R2QA 2OFOA 4FMCB 2C2HA 1P6XA 4M1YA 4AK9A 3F0TA 521PA 1R5BA 5JRZA 2QL6A 2V6IA 2OLJA 4FI3C 4MYHA 1JPJA 1N6PA 2C78A 2G9NA 4UXIA 1N6KA 3O8DA 1OFTA 3HDTA 1VHTA 1NY5A 3EAQA 4MGZR 1DARA 1KI1A 2QMUA 4XSGA 1E2MA 1R5NA 1ZNXA 4ZIRA 3HP1A 2FDCA 3GJ6A 2AFIE 4B3DA 4AURA 4QFMA 4DLWA 4K8OA 3EXAA 3TVTA 2N42A 2X1VA 4L9SA 1CRPA 4PANA 4KSCA 1A4RA 1Y3AA 2PL3A 1Q22A 3EIQA 4GP6A 3WXMA 4TLDA 4Q4HA 3ZIAA 3CPEA 5J4VA 4V02A 3CZPA 4G5QA 1G4AE 2WWXA 4YONB 4YC7A 1D8TA 2OO7A 3QKTA 4LRWA 1E0JA 1A2BA 2ZANA 4TSFD 2H57A 3LW8A 4TYQA 1XEXA 2WJYA 4XWOA 1L2TA 2VBCA 4KYUA 4LHZA 5JBQA 5FOVA 1IXZA 2XJ4A 1DVRA 4IVQA 1FX0A 3U7EB 1ODFA 2Z5FA 3O47A 2CL7X 3AGPA 1Z6AA 3VFDA 2P0EA 2R6DA 5FI0B 1Z63A 4ARZB 2QPTA 1LF5A 3L43A 4KXFB 3JZMA 4XIGS 3UPUA 3B1WA 1JI0A 2OG2A 4FMDB 4L16A 4G5OA 2ZI7A 1NBME 3NC1C 1KMHA 3PEVA 3T15A 3CX8A 5IHPA 1B0UA 4MUBA 2QT1A 1CJKC 4YMSA 1ZIOA 3R7WB 4I81A 2XZPA 2QP9X 2O8FB 5BWMA 2GEDA 3HYTA 3RSOA 1H8EA 5HTKA 2HF9A 1GZSA 5EUQB 4EJSB 3O8BA 1E1RA 2RGBA 1HY3A 5FTNA 2ZRFA 4BEJA 2ZEJA 4GPTA 3BS4A 4DCTA 5LB4A 4M1OA 1VKJA 4ZPXA 1G8GA 3BE4A 1P62B 2NZJA 5ANRB 1WF3A 2BJWA 3K70C 5CB8A 2X8AA 2ZS9A 3X1YA 1NBMA 3TE6A 4F93B 3AM1A 2C9YA 5EP3A 1XXHB 2BHRA 1J90A 3D6TB 4EPXA 3LA6A 5CJPA 1V5WA 1G41A 2CNWD 3C4JA 3GEEA 2DFLA 1KKLA 3LWNA 2LCFA 2GTPA 4B3XA 3OAAA 2CHQA 1OFUX 4V03A 3THYA 1DAGA 2CLDX 4Q5IA 4DSUA 2GXQA 1VCOA 1T8UA 2XEXA 2CLCX 1W36C 4JLMA 1AQYA 1TX4B 2WTUA 3TUJC 2EFHB 1EWRA 2Q6TA 4NH0A 3SEAA 3ZD7A 1OIVA 3TKLA 4U02A 1NN5A 1KSJA 4CVNA 1JQJC 4GOXA 5KYKA 1M7GA 3GJ4A 4X8HA 1UJ2A 4FIDA 3WRYC 3AVTA 1N0WA 3LRPA 4WAUA 4FMCF 3TSOA 1W36D 3QF4A 1OV4A 2QMOA 3IEUA 3REFA 1A5TA 2FNAA 4LBZA 1VG1A 5BQ5A 2E9SA 3K9GA 2GVDC 1W1WA 1L4UA 1C4OA 1RW4A 2CDNA 1KI9A 4AWXA 4U7DA 1E9RA 3IGFA 4PC7A 4US1R 4WA7A 1KY2A 4NZYA 4MKHA 2QTHA 1PVOA 3SC3A 5HKKD 4EDHA 4A6XA 2G77B 1KNQA 4G5GA 2Q9BA 4QKQA 3C16C 3CR8A 4B6EA 1JECA 1AK2A 1FMLA 1W5SA 1Q1EA 3UG6A 1OB5A 5EE0A 4BLSA 1W2HA 1QBKC 2IXGA 3U3OA 2R6AA 1KJWA 1TUIA 2W00A 2A9KA 4BFUA 1KI6B 2O8EA 3TQCA 3W9YA 2QTFA 1VG0B 3BAFA 4OHXA 1P9NA 5C46F 3MUFA 4MA4A 1YRAA 4RD4A 3GLHB 4D25A 1GIAA 1OYWA 2FA9A 1XJQA 1G7TA 2UKDA 2NIPA 4FCWA 2IUTA 1FMJA 4I1OA 1RJ9B 1G7SA 4CZ2A 3FWYA 5B58C 2XZOA 4LHXA 3X1ZA 2RGEA 2ZETA 2QM7A 3M4YA 4F92B 1W2GA 4RVCA 4URZR 3W6OA 5FL3A 2GAAA 3CWQA 1ZUIA 4RZ3A 5JEEA 2OBLA 3AV0B 4Z8XA 3C15C 4PTLA 5FTJA 5FUYA 1SXJC 2FSHA 1GITA 4FMDF 5IF9A 2QA5A 2BM1A 5BN3A 4PAQA 5KDOA 2HLDD 2BKUA 1E9BA 4KYIB 5AR1A 5LBIA 3ICEA 3KFVA 4LPKA 3KTAB 2VF8A 3RLFA 4C9BA 1Z28A 1SVWA 4BASA 5ELXA 3CNOA 2CNWA 4BLOA 4XVQA 4TMTA 1MR3F 2ZS8A 5FBRB 2ZROA 3AF3A 2AFHE 1N6HA 5UKDA 4YQFA 1SHKA 5F2EA 3B7GA 1T8TA 2B21A 4Q9HA 2HCBA 2VSFA 3THOA 5GADl 2ZI4A 1WA5A 1Z0FA 3T1OA 1T0HB 4BLQA 2GCOA 4L15A 5CYOA 3P1JA 1Q12A 2YWGA 3JZAA 1WRBA 2IT1A 2D3WA 2WJIA 1NMXA 3MSXA 5JWRA 2J7PD 2YOHA 4ZV4A 3F5FA 2ZYVX 3R9XA 5LDDC 5LB2A 4TTRA 4B32A 1EFTA 2PZEA 4HB0A 1F2TA 3W5IA 4BFZA 2UZIR 4JKYA 3RHFA 1VCMA 4TZ0A 3A1TA 4JLAA 3NBFA 2QG6A 2X19A 1D6JA 3ZDQA 2A5FA 2P6NA 4QBHA 221PA 4LY6A 4B3CA 2F3RA 3OFND 1G5RA 3QE0A 3QXHA 3KKQA 1M2OB 2OCPA 3TQFA 4KI0A 1NSTA 1QHNA 3KXIA 2V1XA 3KZ1E 4PC6A 1IJFA 1U8ZA 2G83A 2CL6X 3QKSA 5KSPA 8OHMA 3THXB 1Q44A 3IO3A 4BQSA 4Q48A 4CT5A 4B34A 3BJIC 2WJJA 4CDGA 4RD0A 1NVWQ 1HT1E 1JQLB 4LUCA 2WSSA 3DMDA 2V54A 5AWFC 4JVMA 1P9WA 5DNYB 4PXAA 3FE2A 3B1VA 3LX5A 4RZUA 1M7BA 4BGDA 1T9HA 3FHTA 4AG6A 1AS2A 1ZVQA 2CVHA 2D74A 2ZRBA 4M21A 5J4HA 5GVRA 1XD8A 3BERA 4DCUA 1E99A 3I62A 3L0OA 1CF4A 2IEZA 5HE9A 3CRRA 1SQ5A 2VP4A 2GWHA 4D4MA 2BDTA 1NLZA 4DB2A 2R8RA 1XJCA 3CIOA 1RZ3A 4OKSA 3CZQA 4HSEA 3FPAA 3K0SA 3LLMA 4TQUS 4LDJA 2WWIA 3NHBA 1UDWA 5EJEA 3KKOA 4Z1MD 3NIBA 4NKRA 3I5XA 1N5LA 3C7KA 3VR5A 1PLLA 4IHQA 4BRWA 3DOEA 1AKYA 4PSAA 3KX2A 5FBLB 4IRUB 1F60A 4R9UC 4DIDA 1MRNA 1SXJE 3SJCA 3B60A 1NP6A 2A30A 2XGJA 4JLPA 5F3WB 2AHOA 4IDQA 1CR4A 2PBRA 3VTKA 1G8PA 1YZTA 2PZGA 4P4SA 3QVUA 1W44A 1ZNZA 3DVLA 1WQ1R 1AIPA 4C3ZA 2HLDA 3ND8A 4PSVA 1KO7A 2VRWA 3CLVA 5EXPA 2GK7A 2NO6A 3AVPA 3QI2A 1F6BA 4PC3A 3EWSA 1K8RA 2N46A 1L4YA 2Q3FA 2O8EB 1IN7A 1SXJA 4IVRA 4P3YA 4A6PA 1OLOA 3M0EA 4MRVA 4UQOA 1U8AA 4O2LA 2OBMA 4CRWB 2VLIA 4XOIA 4H9GA 2P65A 4LHYA 1A82A 5C18A 4KBFA 2EU8A 4OI0A 3ETLA 3Q7QA 3ZH9B 2ANBA 3T5GA 3R7WA 5TDHA 3AQ4A 3UMFA 4Z54A 1DAKA 2X2EA 5L3VA 1E98A 4R98A 3HU3A 3EX7C 1DAHA 1E2FA 1GG2A 1C9KA 1FTNA 1YU9A 3PFIA 4L5BA 3RRZA 1FUUA 4EPWA 1BH2A 1XCPA 2IYWA 4LCBA 1IM2A 3GLGE 1U94A 1B23P 3G0HA 3QUSA 4C0AC 4KITB 1G3MA 1VHLA 4KBGA 1R4AA 1VIYA 2KWIA 3E70C 3OFNA 3SFVA 1WXQA 3WHKA 4PO8A 1HT2E 1CEEA 3Q85A 3NWJA 2OBNA 2OLKA 4LOAA 4RCYA 3AKEA 3MMPA 2GKSA 4DHEA 2WWHA 2NG1A 4NCKA 1IN6A 1LW7A 4WZAE 1N2CE 5HZHA 3CNNA 2RH5A 5DI9A 3GLGA 2DPXA 4DCNA 2CMKA 1IHUA 5EE9A 2WAYA 3P4XA 2FGKA 4FWTA 5TXGA 3RRNA 2GCOB 2PMKA 3VKGA 2RGDA 3O8CA 1EFRD 3DOFA 1DAMA 5L3SA 1XX6A 4IDHA 3DL0A 1E1QA 3MWYW 4TMKA 3HR7A 1GKIA 3BB4A 2ZE6A 4B75A 2WJHA 4QBGB 2C8VA 3G82C 1A2KC 3RC8A 4M22A 2ZE5A 1ZJ6A 4ZI2A 3LXXA 4Z1MA 2QPAA 3L0SA 2ZI5A 2I4IA 2WV9A 5JS8A 1DAEA 1RRGA 1QRAA 4N0DA 4B33A 1EGAA 5CJ2A 2NPIA 3WMFA 1X6VA 2ZRIA 1ZW6A 3D7MA 3K0CC 4M2LA 1R0ZA 4WZ6A 4DSOA 2KE5A 1J8YF 1TMKA 3W3AA 2HDNB 1PLKA 2C9CA 1K5DA 5FPKA 5FUWA 1IXRC 3AB3A 2REOA 2Y8EA 2J1LA 3BFXA 4L9WA 1GDDA 1YRBA 1Z08A 4AC9A 4QHSA 4IEEA 2IS1A 3BFVA 2FX3A 1FQKA 3WBJA 5TMPA 1P61B 2P5TB 3AKDA 1MV5A 2G1KA 3I73A 2IYZA 4MGKR 1JBKA 2C03A 3RVBA 2J46A 4JIMA 4JBWA 2ZJ8A 1W5TA 1WCV1 3EIEA 2FFQA 2I1VB 2F7SA 2ZSBA 3ASZA 3HJNA 2IX3A 2B8TA 3BRWD 3OIVA 1G1MA 2D06A 1JR3D 2RCNA 4POAA 5JHGB 3K09C 1XU4A 4ZKDA 2VHUA 3FKSD 4HAVA 4A15A 1YR7A 4IDOA 3A4NA 3G5UA 1QG2A 4YXWA 1JAHA 1H8HD 4HLDA 4DDUA 2NMVA 4H1UA 3W8NA 1IY1A 3QVVA 2H18A 1UKEA 1SVSA 4MYCA 3KB1A 5TV2A 4DC9A 5JWHA 4CT4B 5KSZA 4PPFA 3SJBA 2BIFA 2IK8A 1VG8A 2QMEA 2RGNC 3MD0A 3ZVMA 3D8BA 1M74A 5KDDA 2OM2A 4HAUA 2G0TA 3K9HA 1EX7A 2ODNA 2RAPA 3MRSA 3TR0A 1OHHD 1TUEA 4ACBA 3TGPA 4M1SA 4ARZA 2OHFA 1NJGA 5L3RA 1L7VC 4DKXA 4NCNA 3S1AB 2VSOA 2GK6A 2V55B 2AWOA 3RSLA 1VDZA 2HT1A 1W0JA 2ZSAA 5CIQA 2A78A 4DUGD 1XXHE 2VPPA 2GRJA 3NTUA 4A8JB 2VHJA 2O8FA 2HJVA 1N3BA 1ZC4A 2FU5C 1Z5ZA 2UVQA 2VHTA 4OQXA 1S3GA 2WKRA 4URUR 4WVFA 4LK2A 3AVXA 1D9ZA 2GCNA 2JIZA 3ADDA 4AG5A 4EFMA 5HR5A 4Q21A 3KQLA 1PV4A 1XJ0A 2PZFA 2QI9C 2X77A 4DJTA 4B3GA 3KKNA 4I4LA 4ASUD 3P27A 1N6LA 5L8VA 4RD6A 2YVUA 3DM9B 2YWEA 3RC3A 1XXHA 2ZYWX 3QQ5A 1UAAA 1G6HA 3BH0A 4EPVA 4IW3B 5DYIA 3CNLA 4OJKA 3QPUA 5FBQB 2CLSA 5E4FA 1S8FA 4M8NE 3U60B 4MRRA 1TF7A 3ZVRA 1NG9A 3TBKA 5D3QA 2JJ1D 3IQXA 4C0SA 4GL2A 4X8LA 3RDPA 4B43A 1AJEA 1G7CA 5KNCA 3VNUA 1W46A 1KZGB 3U3JA 5M04A 1JR3E 4I99A 1DG3A 1II9A 2ERXA 2HXSA 2ZR9A 4HDCA 2QBYA 4A0FA 1FNNA 2AR7A 5F98A 2JLWA 2ZS7A 3U3RA 3TR5A 4DBLC 1ZD1A 2F1RA 2WWWA 4RCZA 5TARA 3KUDA 1HH4A 2Q0HA 4IJMA 4KFUA 2CEAA 3EW9A 4PHFA 5H8WA 2RGXA 5KU1A 3GEIA 2BM0A 3U3KA 3F3YA 1NI3A 3ZD6A 4LYFA 3FMPB 3K0CA 1KYIA 4JVSB 4C0HA 3DDCA 1E9EA 2PX0A 3EWAA 5HPYB 1JR3A 1FP6A 2W6JD 4NCJA 3FKSA 2AXNA 4QJ3A 3GLHE 1PUJA 1CTQA 1NJFA 2JJ2D 2WKPA 3VNVA 4M53A 1G3IA 2E1RA 3LBHA 3SFZA 4JS0A 3BB3A 1H8HA 2WJVA 1Z07A 1KK3A 2J59A 3CX6A 3GQBA 4GZMA 4LZZA 5KSYA 2Z43A 1IAQA 2ZQ5A 2GEUA 2JDID 1ZM3A 5JRJA 3IUYA 2WAXA 4W7SA 5CK5A 4MRSA 2FWRA 2CE2X 2Z0MA 2Z83A 4X8MA 1G291 3QJYA 1RVDA 3C5HA 2IYUA 4F38A 1OYYA 4NYJQ 3K09A 4AKGA 4FMBB 1JXMA 1KI6A 2OXRA 4Q4AB 3SS8A 2QPOA 4DZZA 1LF0A 4F4CA 3L8YA 1K5GA 4DRZA 1XMIA 4Q7LA 3GLHA 4HZUB 3I92A 3NEJA 4HAYA 3GLFE 5G40A 2TMKA 2F55A 3EZ2A 1ZNWA 2VP2A 1RRCA 2IYVA 5GJBA 3B1YA 1BOFA 1RJ9A 2ZJ2A 1NG1A 3ZJYA 3QXSA 5EQTA 5A4JA 721PA 2XZLA 1PZNA 2ZUDA 2IS4A 2RGNA 1E2PA 1E4VA 1OPXA 2B6HA 4KCGA 3RS7A 1G19A 1MKYA 5L3QB 4V0OA 2V6JA 3EASA 1WB9A 1E9DA 5FBWB 4ABYA 4JLKA 4MYUA 2CJWA 2FMXA 4NMMA 3EG5A 3QIAA 1BKDR 4HUQA 1R10A 5A5GA 1Z0KA 4I1SA 5AUPB 3EA0A 5F9FA 3GLFA 1LB1B 1S1MA 3CONA 2IXEA 2YYZA 1P5ZB 2J7KA 4LV8B 4PPNA 3KL4A 1GNRA 1ZUNB 2VHCA 3KB2A 3H2YA 3CB4A 2J45A 1R0YA 2B92A 3KTAA 4DCVA 3TUIC 4EFNA 1MO5A 1QVRA 2WPDD 4BUJA 5KHOC 1CJUC 1KDOA 4UJ3A 1KY3A 1P2TA 1YE8A 4TN1A 5K8UA 1UBGA 3CM0A 2JJ1A 2ZYTX 1UDXA 4F91B 3B13B 1E9CA 1G5TA 4TL8A 2OFXA 5CB6A 1TQ6A 3A1WA 3RWOA 2BBSA 4NPHA 2JASA 1XD2B 5EZ6B 4PZZA 2PEZA 1YZLA 2BV3A 3LO5A 4D4KA 3ICQB 3SDZA 3A1UA 3FGNA 4M9ZA 2GZDA 4CW7A 3T1VA 3IO5A 3R9IA 3ZQJA 3IHWA 2G0NA 2V3CC 3ZLJA 1NF3A 1OJLA 2HUPA 1NSFA 3R9WA 3WMGA 3DKPA 1GNPA 1OIXA 2ZIAA 4NCIA 4Q19A 3GLIE 4ZCLA 4IOKA 1NRJB 3U4QA 3MCAA 1GP2A 4ACAA 3OESA 4GRAA 2VIIA 4LC1A 4R2IA 5FTLA 3AF4A 1U90A 2MSDB 4FINA 2QNRA 4TTQA 4OHYA 3P20A 2C04A 4PX9A 4IVPA 5CM8B 4C2UA 2GEVA 3CPHA 4M1KA 3WYAA 3R8FA 1OH7A 1GM5A 1Q0UA 1XEFA 2WM9B 3THXA 4L4UA 2AX4A 3K9NA 1NKSA 2RB4A 3GFTA 1COWA 4C2TA 5KO2A 3F8TA 4N0EA 3ASYA 2YZ2A 3CF6R 2ZUCA 4D81A 4A0HA 2LKCA 3VQTA 5CIWA 4A2WA 3GLIA 4DCSA 3VR1A 3ZVLA 2OUKA 3I72A 2V4ZA 4GBMA 3REGA 1R8SA 2W2TA 2V1UA 4GMXA 1Q1BA 2BBWA 2A7QA 3UMSA 1E9AA 2MMCA 4KVGA 2ZXUA 2GJAA 4OI4A 4E03A 4URVR 1G21E 2ECKA 4B3FX 4C0QC 3EZ7A 1N5IA 2E87A 2WZQA 1N6IA 1Z29A 1DPFA 3GMTA 3Q8XB 4JSTA 2QBYB 4FW9A 5BYJA 3ZZUA 2HYDA 1R0WA 1E2JA 1EESA 1G8YA 2FFBA 3AKCA 4P0TA 3X2SA 3LDAA 4B48A 4XSHA 4A0RA 1E6CA 2YOFA 3UANA 5AJXA 1XZQA 2LWIA 3A36A 5KOYA 1T5LA 4KU4A 2QEQA 3EZ9A 2QTVB 4HUTA 3QY0A 4KLZA 4BWYA 2O0JA 4PFSA 2HEIA 3WP1B 4R7ZA 4JKIA 4KLNA 3WBKA 2GJKA 4TYPA 1KO8A 2WWGA 2ZVQX 4CYMA 3V9PA 3B5JA 1AKEA 2D2EA 3QKRB 3KXKA 2KJQA 5JWOA 4WW0A 2ZI3A 4G01B 1XNJA 4OYHA 1XMVA 1BMFD 5GJCA 4TT3D 4S35A 2PH1A 4JLBA 3RS3A 3Q9LA 2JLSA 4NYIQ 5D3MA 3PENA 4TL6A 3PUZA 1E9SA 5CLQA 4TSFA 2ZRJA 4GT1A 1DAIA 3SU8A 1EX6A 2REBA 4HLQB 2EQBA 1KSGA 4Q1EA 3SHWA 1EWQA 2KI5A 1W4BA 4MKGA 1X8KA 4ILEA 5BN5A 1KO4A 3PUWA 1ESMA 1WBBA 2PJRA 1GUAA 3OZXA 3KKMA 1N5JA 1ZINA 2XB4A 3KQUA 1HA3A 2V7QD 3L2OB 4HAXA 1D5CA 1NKTA 3U3MA 2CK3D 4LSGA 4F7WA 2VEDA 4QBIA 4KODA 3IEVA 4JBYA 4WXRA 4LV6A 4IDNA 3KJHA 1KDPA 2NZ8A 1NVUQ 2EFCB 1XD9A 2AD1A 3E1SA 2H1LA 5DI3B 2ZJAA 3VKHA 2XTZA 3ZYCA 4A8JC 2WVJA 5JI2E 1DO0A 5EXXA 2CJWB 1H65A 1ZM4A 5DLQC 1G6OA 4EIWA 5IRCD 4HUQB 4RD2A 2QN6A 2WJGA 2EFEB 4UNNA 1JR6A 4TQAA 2GBLC 1X86B 1OFHA 2AK3A 3GLFB 2AD5A 1NY6A 4DDTA 1X1SA 3LBIA 5F9HA 1FUKA 3CR7A 1N0VC 3QNUA 4WBSA 4KO8A 4LPSA 4ZDWA 1JALA 3TW4A 1EFCA 3PEWA 5JJIA 2ZE7A 1ZYUA 2FSIA 5KNBA 5DYGA 4KAXA 5FL7D 2VHQA 3BIFA 5DN6D 3AF1A 2B8WA 2F43B 3AP2A 1CBUA 4C7OB 2G3YA 4JLOA 4H1VA 1S1CA 3J81k 3U6KA 3LW7A 2WSMA 3LLUA 3R8CA 1ZC3A 3QPVA 4DLXA 4HYYA 2ZJOA 1VIAA 5G41A 1TEVA 2GNOA 2ZREA 4US2R 2A3RA 1XMJA 5G3YA 2OZEA 3B78A 4OHZA 1NIPA 1Z0DA 2MSCB 1T0JB 4QHYA 3A6PC 1KK0A 3D3QA 3U4QB 2ODWA 3KQHA 1RKBA 1QZXA 3NH6A 4PHHA 2VSXA 4U5XA 5G53C 1TU4A 2YOGA 4UJ5A 4LJ4A 4RZXA 3QPWA 4V0NA 3IILA 1ANKA 3WNCA 1XZPA 3U44B 2GJ9A 3FMFA 2P6RA 4QJ5A 2OSBA 1BMFA 4WIAA 5HKKA 2J0QA 5G3ZA 1E79D 4XWAA 4NTZA 4BFTA 4FWIB 3MLEA 3TAHA 3LXRA 3TSZA 2WICA 1G3UA 3PIRA 4YDSA 2BEKA 3GLIB 1CR1A 3OHMA 5B2ZA 1KI7A 1W4RA 4MKFA 3TH5A 3VU9B 1OXVA 2O0KA 3A4MA 2BMDA 4WXPA 2CCGA 1ZP6A 3AKYA 1M8PA 2CHGA 2JAQA 1ZU5A 1ZM2A 2NOAA 1E2QA 2ZSFA 2V7QA 3EPJA 4RY2A 5EE5B 1M34E 1NVVQ 2WMOB 3GJ0A 1CKEA 3VX4A 2CK3A 1Z22A 1II8B 1SVKA 2WWFA 1TU3A 3KFXA 4JL5A 1T4GA 2GVZC 2ODBA 2OXCA 2IUSA 5AJYA 5DO9A 2IYXA 4A2PA 1E2KA 4W5HA 5IT5A 1AGRA 4D26A 4DEXA 3P32A 421PA 2ZI9A 4TWZA 2EW1A 1CIPA 3CRW1 2PLRA 1TQ4A 2Q3HA 1N6RA 4QRHA 4QNMA 4I1VA 1T3LA 2FJUA 4IKEA 1OH6A 1JJVA 2BMFA 1NMZA 3KQKA 2XXAA 3NVAA 1MT0A 4BFSA 1Z6XA 2UZ3A 2XNSA 4LBWA 3PXGA 5JLJA 5JMTA 3S1AA 2CL0X 4O2RA 5D3MB 3TMKA 2O5VA 2D7DA 4D6PA 3L0PA 2GDJA 4DLSA 4A8JA 5AK0A 4TQ9A 1KI8A 1T3HA 4URXR 2XSZD 1I4TD 1UKZA 2OT3B 5FOXA 3GP8A 3DM5A 1CU1A 1Q21A 2XOKD 5FL7A 3T35A 3WY9A 5EXTA 1S3SA 4TZ6A 2O8BA 1XTSA 2GBLA 1G7RA 5DN6A 1XEWX 4Q1DA 2F1IA 4BFXA 2O8DB 4LYJA 1MOZA 2QRNA 3LAWA 3TW8B 4Q03A 1O87A 3N70A 4G3XA 1KO5A 3DZ8A 2J7PA 1XTRA 2AN9A 4P31A 1GAJA 1E2IA 1OKKD 2ASEA 4PO1A 4QHTA 1KGDA 3I1FA 1MO3A 3C41J 1W48A 2JA1A 3AH8A 3ADBA 2W83A 4LX0A 3UWKA 4HB2A 1GSIA 5K8LA 4LBYA 1P2VA 5B57C 3I8XA 3FFBA 4Q9LA 3L8ZA 3ZZ0A 5J4YA 1UEJA 2IW3A 5FUXA 4A82A 4QNRA 1KZ7B 1IJEA 3CBQA 2D2FA 3QXXA 3FYHA 3EPHA 1SHZA 2BOVA 2IBMA 3MWLA 1W0KD 1NNEA 1T6NA 1T5IA 1U0HC 2FPKA 3MG9A 1HE1C 3BOSA 2RGCA 4AKIA 1E79A 4PC2A 2EVWX 4CEIB 4CEHB 4JJZA 3EZFA 1NN0A 4MDFA 1OXXK 2VTKA 5FTMA 2O0HA 3LV8A 2FGJA 4PO9A 3BWDD 2ZI6A 2QU8A 2ZRKA 5KSOA 3QG5A 4DIEA 3UWOA 3K1JA 5EUMA 4ESVA 3GJ5A 4RKFA 3C5CA 1ESNA 1I2DA 1VYVA 4KSBA 1QHSA 2VA8A 3BGWA 3IIJA 5C2JB 3P4YA 3K0FB 3BK7A 1I4DD 5K8IA 3KQNA 1OH8A 2FZ4A 4TLEA 3RS5A 1DELA 3QKUA 2GA8A 1ZM9A 4B71A 3AF2A 1GL9B 1XB2A 4AYTA 4D0LB 1ETUA 5AUQA 2IS6A 5CLLA 2XJ9A 4EFLA 4DT1B 4IOLA 1IN5A 1XEWY 4EPTA 4UNQA 1PJRA 2RHMA 3BD9A 4JZKA 3WP0A 2ZRDA 4MRPA 4Q4AA 1W7AA 3FDIA 3GJXC 4UNPA 4GMDA 1YVDA 4Q1AA 2MMGA 2DFKB 4WOPA 2GZAA 2WMNB 3SR0A 4HZUA 3OF5A 1C1YA 2ZTSA 2REXB 1ELOA 4LV5B 2ZR0A 3V4RA 5GJVC 3L82B 2EYUA 3QEJA 2J0SA 4DLUA 5GJWC 3PCRB 3W5JA 4BFVA 3DMNA 4OHVA 1YR8A 1D9XA 4FN5A 4ZI3A 2Q21A 5JS7A 5JFGA 2XSZA 4CEJB 2BCGY 2P67A 2ZRCA 1J8MF 2ORVA 3WRXC 5L3QA 2R65A 4UKDA 3FVQA 4B73A 1G18A 2DYKA 3IKJA 1P3JA 4Q7KA 3ZS8A 1SULA 2QP3A 2ZAMA 3CUEF 4HLUC 4YMTA 1KSHA 4FXPA 1AM4D 1U0LA 1KK1A 2YV5A 1TADA 4HEJA 4UNRA 3PG5A 1DOAA 1IQPA 1FW6A 2O8CB 3CF2A 4I1UA 1YQTA 4D0GA 2NO9A 4ZCMA 2BBOA 1OKKA 4M1WA 4AIIA 1G9XA 1IN4A 3RS4A 1QF9A 1AN0A 4M9QA 3T06B 2A5DA 3U6BA 2H17A 1JEEA 3QENA 4US0R 1DTSA 1KO1A 4EKDA 4ERNA 621PA 3X1DA 4A0GA 3AP1A 4HI0E 4JJKA 2KB0A 1KIMA 1LS1A 5BW8A 1W0KA 3OEED 3U5ZB 4JBXA 3VR6A 1Q3TA 4G1UC 1F2UA 5FOTA 3SJAA 1FZQA 4N3NA 5HCNA 4IXNA 3SN6A 2IEYA 1XD2A 4V0LA 2XXAB 2DWOA 5AJVB 2ODEA 1Q1QA 3B85A 4S2EA 2BCJQ 3NG1A 3AGQA 4TYYA 3AEZA 4NU0A 4DDVA 1OFIA 4Z51A 1RC8A 3RRMA 2DBYA 2YWFA 1S2MA 4LJ5A 2YKGA 1LTQA 2GJSA 2F1JA 3I8SA 1KTVA 3A1VA 3QXJA 2GAOA 3PQCA 2C9OA 2O8BB 3TJZA 5DHFA 2Q9AA 4GP7A 5FR1A 5JEDA 5DHAA 4RFSB 1GOTA 2X2FA 1XPRA 2GHIA 4IXMA 1KDTA 4LC0A 2IWHA 1EFRA 1V43A 2XNDD 3M6AA 2F6RA 1IY2A 4HDQB 4JLJA 1PLJA 3QSYA 1GKUB 2G88A 4QGGA 3KJIA 2ZUBA 3BB1A 4W5WA 1GRQA 1CS4C 3SI7A 4XH9B 1NMYA 2VH5R 1KJZA 2FZLA 2H5EA 4MITA 5JI3E 2VL7A 1I4LD 1MO4A 2DR3A 2P2LA 4PAMA 3BORA 3FOZA 1PUIA 2HV8A 3CRMA 3KJGA 4DDWA 4IFEA 4AY2A 2C98A 1Z2CA 1J7KA 4XWKA 1GTVA 1KMQA 1HUQA 1E0AA 5C1BA 2DY1A 2KBEA 2C96A 2GF9A 1FL9A 3SHFA 3EZ6A 2HXYA 3EA5A 1XTJA 1QDEA 3SZRA 4QL3A 5KPDA 3ZS9A 2WOOA 3DZDA 1R6BX 2J0UB 1N6OA 2ZU6A 2FEOA 3SYLA 1Q20A 4BPBA 4A1FA 5JCZA 2PCJA 2D4HA 4MQBA 3TLXA 1U98A 1M6NA 1YZGA 1OH5A 4TTPA 3EC1A 4RFVA 2JGNA 3VMFA 1WE2A 4EUNA 2D7CA 4O0MA 1G4UR 4PHTA 3QKRA 3NHAA 5C4MA 5E7MA 2JCSA 3NC0C 4C4PA 2QROA 3NBZC 2IYTA 4AI6A 3AVOA 1US8B 3IBYA 2GETA 1XWIA 4BE7B 4P4TA 3W34A 3LX8A 3GPLA 4GOJA 2ZRNA 4C0BA 1BO6A 5JCPA 1H8ED 4KFSA 4XTRA 5EE1A 2JLZA 2ORIA 1E1RD 1SKYB 4V0ME 3TUZC 3QXCA 1D2MA 4ITRC 4Q02A 1OXTA 1FFHA 4B2IA 1Q57A 4ZDJA 3BFKA 3H0KA 3SOPA 5FR2A 1KI4A 1W49A 4HLUA 3SJZA 2IYLD 3E5HA 1VMAA 2FE4A 3OEEA 4TL7A 5IDVA 5JSZB 2YC4C 2IHYA 3B1XA 1FOEB 1OHHA 2FH5B 3CX7A 4ESHA 3IDQA 3T1QA 1XF9A 1GILA 1TAGA 5JJLA 1E2GA 4JMPA 4CF7A 2PLFA 2JLVA 2CHVA 2OAQ1 4QM7A 1D2EA 3T5DA 2JATA 1EXMA 4K81B 2XAUA 4BLPA 4DUGA 4V0MA 4ON9A 1JAIA 3FHCB 3OAAD 1Z47A 3VAAA 3DKVA 4M1TA 3SE0A 2GXUA 1M7HA 1Z6TA 5DI3A 3NDBB 3RYTC 2Q3MA 2ZJYA 1FP7A 4G5SA 2P6UA 2FFAA 2R44A 4Q66C 4BZXA 3AF0A 1JPNA 5FPSA 4Q4LA 2XTNA 3THWB 2BEJA 3AVWA 5J4LA 3B8HA 2GXSA 2XNDA 4C0LA 1MO6A 3AUXA 4ASUA 1RPZA 3N2EA 3LH5A 4LGMA 4B3BA 5SZKB 2QY9A 1ZRHA 2XTMA 3PEUA 1X1RA 1S0UA 1XBTA 1KOFA 5FI1B 4QM6A 1Z2AA 1S9DA 2AK2A 2V8OA 4NCHA 3UIEA 3VKWA 2V9PA 3AP3A 4G0NA 4JVLA 1N0UA 2W2XA 2EWVA 1BIFA 2F43A 5J40A 5FOUA 3ADCA 4C7OA 1F2UB 1VPLA 4HZIA 1UBFA 2ATVA 4M9SA 1CULC 2QUZA 2AKAB 4TMXA 2ONJA 1U8YA 2EFDB 3ECCA 3R20A 4LBVA 1BS1A 4NYMR 2IF2A 4TYNA 2JLXA 4BECA 4YDHB 1W4AA 1ZU4A 2VF7A 1E96A 3HU1A 4KJZA 2W0SA 1UM8A 1TNDA 3GJ7A 4B6FA 2QRZA 3DO6A 4OQFA 1FNMA 3X1WA 4XVRA 3TAUA 2QE7D 2ZPTX 3PUXA 4KFRA 4IOMA 4M1MA 1QHHB 2DFNA 3UK6A 3CF0A 1AS0A 2PJZA 3E2IA 3IIMA 2DHRA 2B7CA 2FOLA 4L8GA 1XTIA 1XPOA 1G16A 4AYXA 3GD7A 2QT0A 1U99A 4HLCA 3U44A 1F5NA 4QC2A 3GJ8A 1FTSA 4PSKA 3V00A 2W6JA 1OSNA 3K8YA 3ZQ6A 4FCTA 4MYTA 2IA5A 2W6ID 2JJ2A 2PX3A 2IYQA 4UXHA 2ZM5A 3BH7A 3QBTA 2WIBA 2YINC 5FBVB 4G5RA 1YR9A 1QHGA 3QOFA 3IPXA 1T3SA 4ZKEA 4TMVA 5E3HA 2JDIA 2NO1A 3OIYA 4BLTA 1K6MA 2QGNA 3CPJB 3VU9A 4IFBA 1KI3A 1DEKA 1OT3A 4PHGA 3VHXA 4PR0A 4ZO4A 2YHSA 4LJ8A 1LFDB 1CR2A 2YNMA 1Q3HA 2OE2A 1NL3A 4AYWA 4DLTA 3N5CA 4Q9IA 1E94E 2ORWA 1FQJA 1KHTA 2DCUA 3B9QA 5JZVA 1AS3A 1UFQA 2WHXA 1II8A 3IQWA 1G3RA 1R7RA 4A4DA 1IONA 2Z4RA 4DB4A 3WHLA 4GFDA 4NDZA 4A2QA 4DLYA 1G3QA 3OIWA 3K70D 4ZCIA 3LD9A 2R9VA 4QOSA 3A37A 3TSWA 2A5JA 2GESA 2B7BA 2R6FA 2J87A 2YWHA 4JLDA 4Q18A 3CO5A 2JLRA 5SZJA 4W5JA 1KI2A 2FV8A 4B2PA 1S4QA 3CKLA 5J5CA 2HT6A 4Y0AA 4FCVA 4EPRA 3CRQA 3VX3A 3OEHD 2QSZA 1RYHA 3W6NA 2W2VA 4HAZA 2QP4A 3IIKA 5CITA 4TMWA 1ZM7A 2VP6A 2L0XA 3C8UA 2WPDA 4Q01A 3SBDA 2MSEB 4ZDKA 1S9HA 1LY1A 1E2HA 4YMWA 2QZ4A 1TL7C 5H68A 1U9IC 3I4LA 1XP8A 4PZYA 1Z6YA 4D4LA 3QF7A 4YLGA 2F1HA 1YZKA 4B76A 2O8DA 3N2IA 3RRYA 1AQUA 3M1IA 2IWRA 1SVIA 1YR6A 1W4CA 4EPYA 1GL6A 4Q1CA 2AXPA 2ZJBA 4LJYA 1LNZA 1TQDA 2IC5A 4LJ7A 5H70A 3ZZTA 2PT5A 2QGZA 4RD3A 2WSSD 4OI1A 1R5OA 1XTQA 3CWZA 4BFYA 4YMUA 3B6EA 3LQRA 4A92A 1YJ5A 5BN4A 1F3OA 1U2RA 3LVRE 4NBSA 2J3EA 3NXSA 2QE7A 3OIUA 1Z0JA 2BBTA 5EZ5A 3B2EA 1QVAA 2CBZA 5EE3A 2QQEA 2BMEA 4URWR 3U7HB 4MKIA 4ZIRB 1HQCA 3T61A 4RSGA 4BFWA 2IHBA 2ZE8A 5DISB 2F3TA 1GFIA 2RGGA 1NN3A 2BKEA 3Q5DA 3QBVA 4WZBE 1HTWA 4QJ4A 2W6IA 3SBEA 1TF2A 2I1QA 4XD7D 5FOSA 3BC1A 4DLZA 1TTTA 1JNYA 3LY5A 4CEIA 4CEHA 3KKPA 1AZSC 5TVKA 1IBRA 1BYIA 6Q21A 1MH1A 1MABA 1Z0AA 4JVNA 1UKVY 4JYCA 2I3BA 1JEDA 3NDPA 2VP5A 4JT2A 1KDRA 3EC2A 1VG9B 4Q4HB 2ZR7A 2ZITA 4X8OA 4RZ2A 5EP4A 2R62A 1N25A 1ONBA 4NL4H 3NEYA 3WYFA 3P26A 3LFUA 4PQFA 1R8QA 1UF9A 1QG4A 2ZRAA 5BXQC 4JL8A 5KPJA 1P4SA 1VYTA 3ZGXA 3HR8A 4D4JA 2YC2C 3GJ3A 4JYBA 2Z6VA 5KNDA 3K0FA 1DE0A 1XEXB 3A58B 3WNBA 2FSGA 3I61A 2J5XA 2CCKA 3OE7D 3AVVA 3A8TA 4LJ6A 1E69A 4M9XA 2H7VA 2ANCA 3DEFA 1FX0B 3Q72A 2P3SA 2QENA 4PPQA 2H92A 1SXJD 1GRNA 1YZNA 2QSYA 1SKQA 4OQLA 5BYKA 2IS2A 4DT1A 3EPKA 3W90A 1I2MA 4F4JA 4URYR 2HJGA 1ZD9A 2GCPA 1KMHB 2LKDA 1IY0A 3CH4B 2DB3A 2BJVA 4O25A 3UG7A 4II7A 1Y63A 3RS2A 4D80A 1G5PA 1P75A 2F9MA 2AWNA 4DLRA 2WWYA 3FMOB 4TT3A 1Z3IX 5FPHA 1CXZA 3OEHA 5FOWA 4A36A 1FPMA 4Q9KA 1GVNB 3CW2A 5FPYA 1LV7A 4ZDIA 2VO1A 1G8FA 3I5YA 2ZSDA 3X1XA 4DVGA 2FFHA 1DG1G 4LWZA 3RNLA 2IXFA 4CEJA 2WIAA 2ONKA 3Q5EA 4JT4A 3H1TA 3ONWA 4LYHA 4YMVA 5LD2B 3FMIA 4NYJR 2BC9A 4MH0R 4MUAA 2ZRPA 1KJYA 4MGYR 3HPQA 1SZPA 1M1YE 2GILA 3U7FB 2ZRMA 5CK4A 1MRSA 3GCGA 1OXUA 4B35A 4AKEA 2O8CA 1RIFA 1DAFA 2FSFA 2GJ8A 4NONA 5AUOB 2O52A 1AA9A 2QAGC 1EFUA 1Z8FA 3THYB 1U9IA 3EIHA 3H86A 4RKEA 3WMEA 2C95A 2N1BA 4Y0VA 3O8RA 1UBEA 1RRPA 2WOJA 3DHWC 1SVLA 2W58A 4LHVA 4DLVA 3GFOA 1E2DA 3GEHA 1DO2A 2IYRA 2GXAA 1VCNA 2A5GA 1CLUA 4P4UA 2GZHA 1HE8B 2OESA 3SNHA 3W3ZB 1AGPA 3BXZA 1E1QD 1X8JA 4B47A 3QEOA 1GRRA 1F48A 2EFGA 1YKSA 2JLYA 1LS6A 2EYQA 2ATXA 3NBXX 4HATA 4U00A 3UATA 4B2LA 2G6BA 1Z6GA 4XD7A 1IOZA 4B44A 1HURA 2XB2A 1J2JA 2ZU0C 2ZVPX 3QF4B 1E0KA 1E32A 4DXAA 2AL7A 1RE0A 2JJ8A 3RABA 2QORA 3L0IB 4JL6A 1IN8A 2XX3A 2Z4SA 3LVQE 5CM9C 4RJLA 1ZNYA 1KAOA 4UNSA 4OL0A 4QGAA 4Q47A 4RFSA 4PQYA 5SZIA 3SYKA 4E22A 1E4YA 3WNDA 5B64A 5TY0A 1P73A 1KK2A 5AJZA 3K0AA 3D31A 4JSYA 5LPNA 1CP2A 1P9RA 3SYNA 1ZD8A 3SQXA 3EARA 1WDTA 1ZIPA 2KBFA 3OE7A 1JJ7A 2A2ZA 3UKDA 121PA 3DPUA 4Q4JA 4V0KA 4IOJA 3JVUA 2OAP1 1JXOA 1YZUA 4PZLA 5HCIA 3Q3JB 5DGXA 2QAJA 4GNKA 2GF0A 4O3MA 4M4SA 1GNQA 3IPYA 4OI2A 4A9AA 4E5UA 3IBGA 4OK5A 4Q1FA 5E95A 5TB5A 4E07A 4LJAA 5A0FA 1ZCAA 3PITA 4YXWD 4C30A 1OW3B 3PV0A 4NE2A 4UXJA 2ZSEA 1TF5A 4Q9JA 1HV8A 1IXSB 4PC1A 2BWJA 2J0UA 3NKVA 4TLAA 1A1VA 3KDSE 3FTQA 2NQ2C 3KUCA 1MABB 2NO0A 3U7GA 4TYWA 1SKYE 3EPLA 2CCJA 5DE3A 1GL7A 3RWMB 1G64A 5SZHB 4EJSC 4TLCA 4EQ6A 2ZRHA 4OHWA 3GFPA 3JVVA 1OB2A 1UBCA 2OCYC 3HPRA 2RGAA 2JLUA 3NH9A 1O3YA 1CR0A 4JLVA 2RMKA 2OCBA 4OJQA 4NYMQ 4PAOA 5JHHB 5DH9A 2C77A 4FD2A 1UKYA 1S96A 1ZBDA 2QQ0A 1W0JD 3PUYA 4Q1BA 1XFAA 1US8A 4GSYA 1J70A 4XVUA 1X8LA 2G1JA 4HDOB 1Z0IA 2ZJZA 1XCGB 2C99A 2OFWA 3H4MA 1NVXQ 2VP9A 4JLNA 5GVSA 4W9MC 3A4LA 4EAQA 3K70B 2CVFA 2JIZD 1J99A 2QM8A 1VYUA 2RKOA 1NLYA 3AVUA 1G20E 3B1ZA 5FPTA 3ZVNA 5JSZA 3H84A 3B9PA 2ERYA 3CH5A 4RD1A 5E7IA 2NTYC 1RFLA 1AZTA 4BZPA 2ZRGA 1F2TB 4LYAA 5KTYA 1UADA 2QAGA 2QMHA 2ZJ5A 2FPMA 5EP1A 3T1TA 4NYIR 1RYFA 4MDEA 4F4IA 3PJRA 2PT7A 3K53A 1OF1A 1W36B 1GKYA 4B74A 5J4KA 4MGIR 4QGHA 5E7JA 3IHLA 3W8RA 2DWPA 1P2SA 1Q1ZA 1WP9A 2AKYA 4NP6A 5JJKA 4C0KA 4BZQA 2XOKA 2VYFA 3MJRA 2OILA 5KDLA 2JEOA 2W0MA 2NPFA 3RANA 2HCJB 1QHIA 4E09A 1XRJA 1Z83A 5DSZA 2J41A 3QKSB 5HE8A 4DSTA 1CRQA 1U0JA 1W47A 3VR3A 5IK2D 3THWA 3U61B 1QHYA 2FEMA 4LJ9A 4PPGA 3TK1A 2ZRLA 3ND9A 1P2UA 4P33A 4R2HA 3I32A 4C0JA 2BMJA 4CGZA 2BVNA 4Z8YA 1E2LA 4AKHA 1P60A 4Q00A 1OIWA 1P7CA 2ZAOA 3V4FA 1N6NA 4OK6A 3QG1A 2NO7A 1SGWA 3PVSA 3MWJA 3VHLB 3MGCA 3T12A 5J47A 1KNXA 3HWSA 1XTKA 3FKQA 1CJVC 3RS0A 3TNFA 4KHZA 4CIDA 1U81A 1BYUA 2VQSA 3SQWA 5AJWA 1YHNA 1QHXA 2OEPA 5HZKA 5KUTA 3PUVA 3HU2A 4XTCS 2R2AA 3AVQA 2OV2A 2VP0A 2PCLA 2CE7A 2EWWA 3PR1A 4LI0A 3W6PA 1A7JA 4KVAA 1NN1A 2DWQA 2WKQA 3KXLA 1DADA 4TL9A 3UXMA 5H1YA 5JECA 1EFHA 2F9LA 2JLQA 2H8KA 3MWKA 3VR2A 1ZCBA 4GI7A 1L8QA
chains in the Genus database with same CATH superfamily
2DLCX 1XCMA 1P7WA 4LE0A 1EIWA 2R68A 4MUFA 4EHDA 3PEEA 1SVOA 1E9FA 1N4AA 3T41A 3D6JA 1D0VA 3ZOZA 4Q16A 3SQNA 4EO9A 4F3YA 4W1QA 4MRNA 3QUCA 4M7RA 4WH0A 1VZ2A 5AMXA 2GZ1A 3H11B 4AD8A 1YCHA 5FXMA 4PRYA 1VCIA 1WBJB 4CF3A 4FFVA 4EJSA 1YI0A 5AUNB 4GDFA 6ADHA 1J56A 1NVGA 2DKFA 2C5LA 3VR4A 5JAIA 1OLXA 3KVRA 3MMNA 4WERA 2YXBA 3AUAA 4L1KA 4MV0A 4P35A 1P72A 3DAHA 4WKBA 1D0IA 3NYRA 1ZR4A 5BNWA 4BV8A 5DNCA 1DCFA 3C3JA 2EERA 1Z06A 1NC1A 3KWJA 1X3SA 2AT1A 2Q8PA 1WWKA 1RAEA 1XRPA 4AMUA 1MRZA 4GXQA 2OG1A 1KR5A 2BTOA 2DKNA 2R6GA 2RHDA 1KAGA 4KFTA 4K46A 3HYRA 3R7WB 4V24A 1OGYA 2X76A 5P21A 3W2HA 3ZHXA 5CYPA 4J0QA 2QW8A 2DBQA 1LVGA 3U2QA 3IUEA 4X3CA 4UUMA 4WFKA 1GWNA 3RHTA 2PX2A 3N6XA 5K8TA 1J9GA 2O1EA 4K9MA 3UZUA 2XOEA 1TUBB 1U3TA 1FXWA 1GZ5A 1M3SA 4LDRA 4QEDA 4R71A 3H5IA 4I36A 3LSYA 4GPEA 4IZOA 1F9EA 4PNHA 3U1TA 3DKIA 5F7XA 1O89A 2UYHA 2CNNA 3U4AA 2OBFA 2HL6A 4FN4A 1NSYA 3G6KA 3FA2A 5FFMA 5IS2A 3KJNA 3IV7A 1T3ZA 1KZ4A 3COWA 3TLZA 2WV7A 3G49A 4OQNA 2QL9A 2ZYUX 4NZOA 2AMVA 3MAAC 3ROXA 3MFYA 1G63A 1I9GA 4EYKA 2HYIC 3N59A 4E13A 3W8DA 1K9SA 1T9CA 2Y71A 5A3QA 4JBNA 1NUAA 4QECA 2FN4A 3MJHA 3U39A 4B09A 4RGYA 1KTIA 1GQSA 2XT0A 4DSNA 4FS3A 5GY7A 4L3OA 1X70A 3EDCA 4FOLA 4RKYA 5K6AC 3INTA 2EDCA 4AMGA 2JGEA 3Q9SA 3OZBA 2XAAA 4N65A 5EHNA 1N8NA 1T9ZA 2YDYA 4CI0B 4AY6A 2XUAA 4Z9YA 3LUHA 4DLPA 3A6KA 3CX3A 3KJFA 3FRHA 5CA0B 1NMQA 1PR0A 3GI1A 4RENA 1NBMD 1U7XA 3E3LA 3VNAA 2SHKA 3WLIA 2FMFA 5ALDA 2HMWA 5JSQA 1R0XA 1KKMA 1LC0A 2CDRA 3BBPA 3N58A 4QG7A 4BCBA 4MV3A 4DLKA 4XQ9A 1UINA 3Q7PA 1L7EA 1GT91 1VLQA 2VC2B 3CRVA 1DJMA 1T15A 1J8FA 1DWPA 1R2QA 2OFOA 3RIHA 4FMCB 1JSCA 2C2HA 3NO4A 1DXHA 2VJLA 5JRZA 3GAZA 3HVUA 2XVYA 3O73A 1M8FA 4P4NA 5JZ9A 1JPJA 4TROA 1QXSA 3FTPA 3L49A 4UXIA 2OV3A 1OBOA 1XZFA 1DIOB 1GGMA 1OFTA 2Y92A 3HDTA 1VHTA 4WKNA 2B9VA 3Q9UA 3R9KA 3EAQA 3RKSA 5TF4A 4LW8A 4BQIA 4UE3S 3NJRA 3IVAA 3OZFA 2WY2D 4XSGA 3AOEA 1E2MA 4YO8A 3HP1A 2PQ6A 4LY9A 4ZMSA 2YXPX 1U3FA 2AFIE 2O2CA 4YAJA 4M8LA 3IAFA 3WHIA 4B3DA 1FNBA 3AX6A 2W8ZA 2JVIA 4MIKA 1HNNA 3WK4A 2A94A 2GJ4A 4GMHA 5CDHA 3U31A 4PANA 3KR9A 1A4RA 4EGSA 4LGVA 1C8KA 3BYZA 3PC6A 1KAHA 2MOKA 4WJLA 3EIQA 4ZVVA 4EKNB 2VUTA 3AR8A 3HBNA 5EWLB 1QZZA 2OORA 4Q4HA 4TLDA 2E2WA 5JRDS 4AU1A 1OI7A 1C50A 4J9UE 2HWKA 3IV9A 3QW2A 1VQ1A 1TZCA 4OHUA 1ECCA 1TKCA 3CPEA 4OYLA 3ZIAA 1SHTX 2C4WA 3B53X 4V02A 1V0JA 1VL6A 4O4IA 5EESA 4OHMA 3ZKWA 3FNQA 1ACJA 1D8TA 3BRQA 5ADUS 3QEAZ 1G8KA 2OO7A 3RUCA 4LRWA 2WSBA 1HFJA 1PE0A 2ZANA 3EEQA 2W2LD 3WGTA 1DKRA 1I1OA 3DYIA 4XQCA 1TAQA 3I1JA 4TYQA 3UA3A 3IPCA 1TZMA 5AW7A 4G5YA 3AL3A 3L0DA 3ND5A 5JBQA 3HXTA 5FOVA 4UREA 5LQNA 2L17A 1XNRB 3GA0A 4RJIA 5AVWA 1USUA 1IVNA 1SKBA 3O47A 3VAYA 2ODPA 1M6WA 3TEFA 1JJAA 1N2OA 3S1SA 2X8JA 1TW3A 4NJMA 4TKMA 5FI0B 1U31A 1OWPA 1W85A 4QUBA 3VOBA 4C04A 2FKNA 5BMVF 4B82A 3KV3O 4F21A 3CZ5A 1JI0A 2OG2A 4LSZA 4YRCA 4I4TB 1Y9AA 2NYRA 2ZI7A 1F20A 3PEVA 1GNVA 3G8YA 2Y1CA 3CX8A 3GIDA 3T15A 4V0SA 3TBFA 3VU0A 1YO6A 3GDFA 1RACA 2O2HA 3RRJA 3C6KA 2ZRQA 1LDMA 1WM1A 2COEA 2DTEA 3GB9A 3HYTA 3RSOA 2WUFA 3BCSA 5HTKA 3SSMA 1NU8A 4YRBA 1L4FA 1PDWA 1EXVA 4P7JA 4MJ3A 4DYVA 2JAPA 1JKJA 4RAOA 3UJ9A 2Q8NA 4YRZA 2BZ1A 2P40A 1QAQA 4X6UA 1N34B 3BS4A 3COPA 3ZE6A 4ARBA 1NMEA 2X0IA 4JXKA 3F6SA 4FHCA 1G8GA 1P62B 3OI7A 3GCZA 3JQ8B 4YWHA 2PPVA 4QATA 2EL9A 5KKAA 1HE5A 1QIMA 4RXTA 2AYYA 2X8AA 2R84A 1N2GA 3LQKA 1QF6A 1SC4A 4JUAA 1DTEA 1RXIA 2WG2A 4LYYA 3BX1A 3MT7A 4YASA 1Y4SA 2W6CX 1VHWA 3R3SA 2GCEA 2H4FA 1USGA 1HETA 4PZUA 4BV3A 5DV9A 3KVNA 1CVIA 1AKNA 4EBFA 3DWFA 1G41A 2MTBA 3CUKA 2FWJA 4FX5A 5KNBD 2DFLA 3P9NA 3WYBA 3B5IA 1V6SA 4BXOA 3ZWYA 1V39A 2XNHA 2LCFA 2GTPA 2UZ1A 3ASUA 4INPA 2RB5A 1K98A 2FRDA 3OAAA 3QUBA 4B3XA 1NV8A 3ZCVA 4DZTA 4V03A 4EEXA 5B2FA 3PNKA 3P94A 2JJMA 4X66B 3V4VB 1RM3A 4OQPA 1JDBC 1T8UA 2XEXA 3UOAB 1PS0A 4JLMA 2WTUA 3FF4A 3TUJC 2N1MA 3BMNB 2Q6TA 2Q45A 4NH0A 5E2BA 3SEAA 3WMRA 1Q1GA 5AXBA 1DKLA 2VDWB 2WTXA 3I83A 4YRQA 4GOND 2ZSIA 4J7AA 1AGXA 4E2YA 2XCOA 3GJ4A 4KR3A 1UJ2A 2IUEA 4TMFA 4KVFA 3AVTA 2HSGA 3W7AA 1W6RA 2ZBRA 2YV4A 4ZMRA 5BSWA 5BV8A 4WAUA 2IU0A 4L28A 3I58A 3QF4A 2D6FA 1YNSA 2D8AA 5GAJA 2V6FA 3P0JA 2VAXA 2CL5A 2FNAA 4V3CA 1Q0QA 5CPFA 1E7MA 2ZIXB 1I01A 5FHQA 2GVDC 4K9KA 4HX9A 1L4UA 1A96A 1RW4A 4MIEA 4IEFB 2ASVA 1SH7A 3M7IA 1KI9A 3GX1A 5F52A 4ZWNA 1W1UA 3IGFA 4PC7A 4WA7A 5ALZA 1KY2A 4NZYA 4XKJA 3ZWXA 2QTHA 4IX9A 4ZC1A 3SC3A 1EHYA 5D01A 4KGXA 2OV1A 4BMVA 3CURA 1LPPA 3D0RA 3PUKA 3WNZA 1E5LA 3V8MA 4UEJA 4OCZA 5TIIA 1OWOA 1K97A 1RPTA 1EBUA 1I9CA 3DE2X 3G1WA 4PEVA 4PLGA 4FGWA 4Y2VA 5BQOA 3S55A 3W4KA 3AFNA 1FMLA 1W5SA 2OQVA 3K92A 4W4TA 3ZWOA 2PTHA 4P0QB 1AN9A 1FBTA 1VE5A 1UDRA 1FVHA 1VPTA 2R6AA 3F98A 4WUTA 1FEZA 4MQEB 4NMLA 5G02A 4BMOB 4G6ZA 4WNIA 3TQCA 2D5AA 2QTFA 4BLVA 3G5TA 1VG0B 3P0IA 4ZCTA 1FJXA 1QLWA 3NWBA 5DYTA 3O9MA 5JPIA 2PUAA 1WCIA 3LOPA 3ES9A 5AP9A 4ALNA 4NJOA 2HRQA 3GLHB 1GIAA 2C7OA 3DXXA 2CUNA 5CVEA 3DGEC 1ADFA 1UBTS 1XJQA 1VL0A 3D5QA 3QFCA 5EWJA 4FCWA 3KOZA 3V42A 2IU6A 3IAS6 4RAQA 2P2ZA 1FMJA 4P1ZA 3DAGA 4IY1A 1NVBA 1V48A 2HK9A 4I1OA 2RHLA 1RJ9B 4M55A 4RHYA 5T4EA 3R76A 3SYMA 1ULUA 3ZXUB 5LIRA 3X1ZA 1JMKC 2RGEA 3OO1A 1KP2A 4F92B 1KERA 5KTRA 3HADA 3I5UA 4Y2QA 1EA5A 8LDHA 3EHDA 1GQYA 1SC6A 3KYBA 4MKXA 2GAAA 2VN8A 2J0EA 4YLEA 3M5CA 2CYCA 4Z8XA 3JU3A 4JI4B 1J49A 3NALA 5KB3A 1ODCA 3NPMA 4BHTA 4PTLA 1R9NA 2C00A 2VDUE 4CF4A 5KQPA 2QVXX 4R2WA 1SXJC 2FSHA 1TLTA 1A9PA 3DLAA 3ME5A 1SQSA 4MS4A 4C4TA 3LUPA 2YMPA 5IF9A 3KIPA 4QNNA 2QA5A 3E8SA 4PAQA 5KX5B 1L5ZA 2BKUA 1E9BA 3LM8A 4Q3NA 3QMWA 3N75A 2JBAA 2PUFA 1F17A 2HQRA 3RLFA 1UPCA 3DF9A 4C87A 1Z28A 1T29A 2XIQA 2ZYHA 3N2KB 3CNOA 2CV0A 2CNWA 4M8IA 3WC4A 4KYVA 3PNVA 2PS9A 1GV1A 4ALLA 2JCXA 1MO2A 4TQGA 3FPEA 1VZ3A 2BE9A 2ZROA 3KZCA 3E6AA 1XE3A 3JTMA 4G9EA 4YQFA 1SXPA 1QO0A 3B7GA 1T8TA 1TKRA 1XT6A 4AG3A 3OY2A 2NP6A 3DC7A 3ANTA 4ZAYA 5GADl 1TFRA 2ZI4A 3T1OA 3F7MA 1T0HB 3ESDA 2VTBA 5K4GA 1W4LA 1W93A 3P1JA 5ALQA 5BQPA 3JZAA 3ZDRA 1B42A 1SG6A 2IT1A 3CSUA 3MJCA 2H0RA 2WJIA 6REQA 3LRXA 4ZV4A 3F5FA 1FCJA 2I7VA 2ZYVX 4CE6A 4UBLA 5ALSA 3MAGA 3D3KA 2LCIA 3ET4A 3FYUC 4GGOA 4TTRA 5AW0A 3ZXXA 1Y8RA 4HB0A 2OUIA 5F5NA 2UZIR 2JKVA 3FMVA 4IMJB 4ABTA 2G9RA 3H5VA 4FGUA 4MUXA 4EP1A 3WYNA 3K5HA 5CGQB 4LOLA 4M60A 1ZK0A 4A91A 1FXWF 3MJDA 5I6DA 2FN3A 2P6NA 3Q0TA 4LY6A 3OFND 3CUVA 2QMQA 2ZIFA 3ZWVA 3BRSA 3QE0A 4O8CA 1IYZA 4G5FA 3RTCA 1L7OA 3TQFA 5DBOA 3W5CA 1QV9A 4CG3A 3KXIA 4B87A 1FRNA 2V1XA 2A35A 1ISGA 4MV9A 1E5DA 4TV8A 4AQ7A 3JRWA 1DP4A 3QKSA 4ETNA 8OHMA 2OV6A 3HSKA 4DM7A 3AFMA 1V8FA 3BJIC 3L05A 1TAUA 4CDGA 4NBKA 4RD0A 5C1PA 3CY6A 5ENDA 3BFJA 5B3JC 1JQLB 4LUCA 1P7VA 3H8JA 4BIMA 4I9GA 4RTQA 1A9YA 1LK5A 3WOVA 5AWFC 5C7OO 3G1UA 4IIJB 4YRTA 3BVPA 2AC4A 2GPAA 5ABPA 1WW8A 4GRIA 2BW0A 3FE2A 3QOXA 4JFAA 2IYEA 4O4LF 3HJGA 1PK9A 2G5PA 5DGHA 1YZHA 4Q3DA 4B46A 2ZRBA 1J1UA 4M21A 2C2BA 2WF5A 1P81A 3MBOA 1JIIA 1GTG1 1R0RE 5J4HA 4DCUA 4GX0A 1E99A 2I5PO 5HFAA 1F2VA 3C7TA 3CTMA 3NWPA 1LBHA 3B12A 1RU3A 3CRRA 5DU2A 4B31A 1CF4A 4PLHA 3ZUGA 4JDPA 4BVFA 2FUG6 2FOIA 1Z33A 1J8VA 1RZ3A 3H4TA 4OKSA 4HSEA 2D59A 1DI0A 4TQUS 3K0SA 2WWIA 3MCZA 4LXHA 3TZLA 3NHBA 5EJEA 3KKOA 4QYSA 4B80A 4DNPA 2JJQA 4Z1MD 5ICCA 2VSNA 1XVTA 1VPWA 3I3OA 4NKRA 2XE8A 4KR0A 3VR5A 5J23A 1PLLA 5LZ8A 2CSUA 5FPQA 2VUSA 3CLTD 4KWHA 2F3UA 3DOEA 3RVSA 3QPAA 4ND2A 4CM4B 4DWWA 2VRCD 4ID3A 3M5DA 1SXJE 1IULA 4OHFA 1ONSA 1DQZA 4HTFA 1C4KA 1NP6A 3QYFA 3A2LA 2PWYA 4JHLA 5K0EA 5K09A 2PZ8A 1YVRA 4L07A 5JQGB 1D7OA 2CV2A 2C8KA 3W3AD 1UPFA 2FR8A 1KIFA 2ATCA 1CR4A 2GLXA 2PBRA 4HDKA 4IG4A 4DQKA 1DZIA 4P4SA 1HE3A 3ZE7A 1N1GA 3NKFA 4FNGA 4WLVA 3SKYA 3T3IA 4C3ZA 1BFDA 2GPJA 2HLDA 3ND8A 1KOLA 1KO7A 1XLVA 1V37A 3I1IA 1KH2A 4NBLA 2NO6A 2OHIA 1ULAA 4G81A 3OQOA 2I71A 1F6BA 1SPBS 1P0CA 3FI0A 3EWSA 4AWBA 3D8TA 2CGEA 1PW5A 3TFOA 1L4YA 4ENQA 4JI1B 4ENUA 1Z3CA 1R4ZA 4KB5A 4L8VA 2VKQA 3KU4A 2ERCA 1U0RA 4MRVA 5HHTA 1NTOA 4O2LA 1H2ZA 1YBAA 2D1SA 4CRWB 3CA8A 4XOIA 3KKLA 1CJSA 1HNXB 1QRUA 3M4ZA 3C8DA 3R77A 4O4IF 2EU8A 5D1NA 4C4RA 3GJZA 3Q7QA 2VDNB 4IMIB 3TNDA 2ANBA 2PL1A 5CB4F 3TCKA 1WZIA 3Q3EA 4C3UA 3FJOA 4QOFA 4HMOA 1OQAA 1ZITA 2MSWA 3F97A 3N0RA 5BVHA 2FZGA 1B7GO 1E2FA 8AT1A 1C9KA 3UENA 1TTHA 4EA7A 2W90A 1FTNA 3OPMA 3TQOA 1BE1A 4L5BA 1N7HA 1LPSA 2UVPB 5CFLA 2G63A 2OOKA 2OC4A 4LCBA 3OQBA 4UE2A 4KITB 1RQPA 2KWIA 1XA3A 4ZYVA 2GLTA 1H2AS 3QJGA 4HR7A 5CBPA 1YQGA 4ITUA 1HT2E 1YH3A 4B4VA 1YCGA 3RM3A 2D0IA 3EMBA 1QTQA 3AKEA 3DBVO 4RWZA 2GKSA 2WT4A 4R1QA 1E1CA 3T9FA 1E9VA 1M2JA 4B3TB 4B3RB 2BFEB 2PT6A 3GEGA 1UP6A 3QTTA 2W2KA 3THSA 1N2HA 3MMXA 4AZTA 1IBCA 2OCDA 1VJCA 3CNNA 4A0FA 3MJSA 1PSZA 3LYHA 2B36A 3OZTA 1Y4AE 3ANMA 3UYLA 3GLGA 3BTVA 2W2QA 1IHUA 1FLAA 5KVQA 3EF0A 1Y1RA 4PHCA 2NSHA 3DEKA 4K3UA 1TO2E 2JFGA 3KQWA 2IY9A 2NU6B 2PMKA 3Q6NA 4XM2A 5K03A 2CXQA 3VKGA 1GJRA 2RGDA 4FHFA 1VGVA 3DOFA 1FNSA 1L5KA 1F3LA 1GQRA 2V59A 1SUSA 2WU0A 4DN6A 5L3SA 1JIQA 1PWZA 4IDHA 4JEIA 1J06A 4TMKA 2R60A 2ZE6A 4F5YA 4L5IA 1SK9A 4OLJA 5LP6F 5EIFA 2C8VA 4WZAA 1TMGE 3RC8A 4MK4A 1CNEA 2ZE5A 4X54A 3C7DB 5FWDA 4DLLA 4FFBA 4NQRA 2CB9A 3HB4X 2M2IA 4GXRA 4R8LA 2XUGA 4MQ4A 5EI5A 2I4IA 2J3DA 2WV9A 5JS8A 2VQFB 4BMZA 4JXZA 5FNZA 2P4SA 4N0DA 4YVFA 1ZVJA 3KCNA 2P0YA 5CJ2A 2NPIA 1AKUA 1FDUA 1WCXA 1X6VA 5DJ5A 2W6QA 1G98A 3K0CC 2H4XA 5COBA 4HFJA 2HDNB 1EP1B 3GW8A 3H3FA 2IQIA 4FTWA 4PGHA 3HU5A 1IXRC 4P83A 2A84A 4JJ7A 1K4KA 2Z3ZA 3BFXA 4A3SA 4LF6B 3PQDA 1GDDA 1NQWA 1Z08A 2J48A 4UATA 4BL5A 4EHJA 3LVFO 2IS1A 4N5HX 1R3DA 3JQFC 1QIFA 5AVKA 2GYYA 2QL5A 2P5TB 3AKDA 3GG9A 3WBJA 1MV5A 4U6SA 2G1KA 4YIHA 2CF6A 4TVBA 1WKVA 3EXHB 4YJFB 1JBKA 1F4PA 2B4AA 1S01A 3RVBA 4DJJA 3BKWA 5KVCA 4EL0A 4LSMA 2MINB 3SOZA 4XIJA 3DBLA 3TPCA 4QU9A 2ZJ8A 3MIZA 4RHFA 3EIEA 3WIEA 2P4HX 3MQ2A 2ZSBA 2PZBA 1L8OA 2RGWA 2IX3A 2B8TA 1Y8AA 2XQVA 1HGXA 1AX9A 1G1MA 2D06A 2CXTA 4PAWA 5J59A 5JHGB 3T9AA 1WXXA 4A15A 1JQKA 3KYJB 2FI1A 3G5UA 3O8QA 4BTLA 2H2GA 1S3FA 3T0IA 4YXWA 3QLUC 4HLDA 4DDUA 4YRIA 4Z49A 1JQBA 5IKXA 1BX0A 3BXEA 4KUHA 4H1UA 3X1KA 2NMVA 4UM9D 3BZWA 1X19A 4TRJA 2P1DA 1U28A 1SVSA 3N8KA 4CIBA 4MYCA 5TV2A 1QKIA 3WB1A 4UUPA 2OGWA 4KE7A 4KP7A 4O5OA 4CDMA 2ZB7A 4HHEA 4DC9A 7ABPA 5JWHA 4JUFA 5DB4A 4DA8A 6AT1A 1UK8A 3AYZB 3S2FA 5CG2A 1VG8A 1Z45A 3ADOA 2BFWA 2RGNC 4C01A 4WMLA 1M74A 4P7BA 2O05A 1EX7A 3OJFA 3ISVA 3TR0A 1M34B 1TUEA 2EF1A 4MRAA 4ZEXA 1M2NA 2R00A 1J0CA 1M5UA 2JGKA 4XVHA 1EP2B 1A9XB 1L7VC 3KT3A 4MKRA 3DXFA 3QVTA 4NCNA 3V8VA 4U2BA 2AUTA 1PFYA 4KK3A 2IU4A 5JADA 2B4QA 2V55B 1H94A 3RSLA 4IM7A 1JDUA 1QFJA 6PFKA 2VPPA 3NTUA 3GNSA 4E5VA 1EM8B 2VT7A 1W87A 2X0RA 2FU5C 4OFWA 5AI5A 4EYGA 4UAUA 1PQPA 1GDHA 4LK2A 2VNJA 4G9BA 4KN8A 1S8OA 2DVMA 4AG5A 1TC1A 2OZLA 4Q21A 3R7BA 3KQLA 1KWGA 3F67A 4Y2HA 2GI4A 2FLWA 3KSUA 5TSDA 5TR9A 1LI4A 4BVBA 3VUFA 3U80A 2JBHA 4CKWA 4ASUD 9LDTA 3D2LA 2DEUA 2YVUA 4F12A 1FFSA 1TCVA 3AFIA 2B2CA 3CVOA 1C3EA 1SOMA 1XXHA 1YDHA 3COZA 3VPCA 4AZ0B 3GNQA 4L08A 3EJ6A 4E32A 4NXNB 2XGGA 4HGYA 3I6IA 4MW7A 5H3LA 1NKVA 5E4FA 3E3OA 5I7UA 3LRTA 1G8MA 3PJEA 4M8NE 1Z7YA 3U3DA 1C8VB 3TBKA 5D3QA 1M2FA 2JJ1D 3DLBA 3IQXA 4C0SA 4YK7A 2RHHA 4RY8A 4DQ0A 4L4RA 2I62A 4M0PA 4YCDA 3W78A 1YASA 1AJEA 3M6WA 1CUSA 3H2BA 1NULA 3BHJA 3O94A 3MWEB 1NXWA 5M04A 1QMPA 2WJPA 5TQVA 3L8GA 3VKFA 3I2IA 4EUSA 4OLHA 3CLRC 1GTSA 2QBYA 1N57A 2JZOA 2SCUA 2JLWA 1L6RA 1DV1A 4DBLC 4CBVA 2WWWA 1P1BA 4RCZA 2W22A 3L01A 4BBZA 3RYHA 3H5NA 1GKLA 2CEAA 4PHFA 4YA6A 4V1CA 1T0IA 1DZ3A 5TNXA 1NVEA 2BM0A 3W0LB 3U3KA 3H6GA 3VVBA 3KPUA 2HNKA 1Z25A 2QZ9A 5BXYA 1SZJG 4LG1A 2FUEA 3IQIX 1T35A 3FMPB 5EGSA 5CAEA 2RONA 1AKQA 4JVSB 4C0HA 1MXHA 5ARCA 4YDQA 1O6ZA 2WUWE 3DQPA 1V2HE 1JDJA 5HPYB 1SCNE 2W6JD 4TV8F 4QJ3A 2WTNA 1GPJA 4GGPA 4CQMD 1JFFA 2EIHA 3K20A 4DA4A 2G8NA 5AVOA 4C1NA 3VNVA 1QC5A 3N2YA 5AXAA 2VYVD 4ZODA 2X23A 4INJA 3RR2A 1H8HA 3I4CA 1K2VN 5LMNB 3PI6A 3GQBA 4MPDA 4GZMA 4LZZA 4CKEB 2W6PA 2OMKA 3VV2A 4D44A 2ZQ5A 1X87A 4R1OA 4F8YA 5JRJA 3IUYA 2WAXA 4CMEC 1QGAA 2DUWA 1JWLA 4F38A 1N9KA 4NECA 2R3SA 3WRWA 4XWWA 1KI6A 2OXRA 2H48A 3F6EX 4RF2A 5ALYA 3VKVA 3ZEAA 4DZZA 2C9DA 4ARSA 2OY0A 3H83A 3DT9A 3QUTA 3VVMA 1K5GA 5F7ZA 2WF8A 3BXPA 2FP4A 2CEKA 3TXXA 2CUZA 4HAYA 3FNEA 5HBGA 5K8CA 2B1JA 2X42A 2E89A 1DBQA 1BOFA 4MHOA 1AV6A 3V32A 1RHKA 2ZJ2A 3QXSA 4G36A 5EQTA 2HMAA 5A62A 1GQQA 4FDVA 1Q95A 2GEJA 1YKFA 3C3MA 1A2QA 3DWIA 3VTZA 4DG5A 4WKPA 1TA9A 4P92A 3TAXA 4U3JB 3K4QA 2XCIA 2R1ZA 1C8LA 1GHTA 5L3QB 4V0OA 3DV0A 1WB9A 2CJXA 5EHQA 4N4AA 3HCWA 3A27A 3R44A 5AW1A 3GAFA 5DNEA 1MIOA 2ID8A 2XE6A 4J43A 3O1HB 4HUQA 2ZYRA 3DEZA 3KR2A 3AY7A 3OE4A 4RDCA 4X92A 2XRZA 1GPDG 4DKJA 1SOWA 5AK5A 5KTNA 3D4NA 3A6GA 1PJAA 2Q2NA 1WV1A 3CONA 1FVFA 1P5ZB 1L4MA 4PPNA 3SZLA 4D9FA 1P0MA 2FSVC 3HBFA 1CDEA 1GNRA 4KQHA 1EBBA 4WX2B 1KVSA 3DTVB 1YQUA 3CB4A 3EFOB 4BYMA 3BEOA 5L4SA 4FEAA 1AQIA 1UPBA 3S2SA 3MPOA 1DEOA 2YMLA 2CJFA 1NV9A 3G2LA 1CJUC 5A9SA 4FXOA 3EA4A 1J9EA 3CLUC 4K3VA 2PKQO 4TN1A 5K8UA 3TW8A 2ZYTX 1UDXA 3B13B 2Z8YA 1E9CA 4TL8A 5CB6A 4NV1A 4G0MA 4C22A 2MSKA 2JFVA 2UUOA 2JASA 1XD2B 3QK7A 2YVKA 1YZLA 2YZNA 1VE7A 4R54A 5TQ0A 3SDZA 2JBWA 3A1UA 4WNAA 4DBLE 5I51A 2ADFA 4AJPA 4P4LA 2C5GA 2ZDQA 3BIOA 4FVTA 3LLCA 4OTZA 4U7TB 4W8HA 1TD1A 2G0NA 3G2MA 4FFPA 1NC3A 1NF3A 1NSFA 3WMGA 3OKFA 3PZRA 2HGSA 1KRXA 4OSPA 2HJSA 4E12A 4EZIA 4NCIA 1D5WA 1ZGCA 1N78A 3ENZA 3JYPA 2HA0A 3WS7A 1GP2A 1OX5A 3PJGA 2AN5A 4RNDB 4I9NA 4Y30A 1N9GA 1B1AA 3KKZA 3KETA 3A9RA 4D9BA 1MGOA 3TDKA 5JSKA 1U90A 4H2DA 1M2OA 4FINA 3E53A 3RJTA 5E9QA 4B3IA 4HS4A 5DZSA 5CM8B 4IVPA 5JNLA 2A9JA 2GEVA 1OH7A 3WYAA 4L74A 3ILVA 1Q0UA 2AHRA 4FOTA 2R7NA 1TOAA 2RB4A 5E0OA 4AJ2A 2Q6IA 2QIPA 2V7EA 4BNHA 1PEDA 1JLSA 1QYXA 2GK3A 2CLEB 2QJOA 2XWQA 2YZ2A 4D81A 2LKCA 1QIEA 3A3OA 1UK7A 1WL8A 4LOJA 3ZVLA 4TS9A 4RIGA 3VR6H 3HCNA 4HFNA 2ZBGA 1ECFA 3LJKA 3I1YA 3VPFA 2EBUA 4BE4A 3SMQA 7REQB 2V1UA 4AP9A 1E9AA 3NWEA 5EERA 4LWOA 2W42A 1H2HA 1VLVA 2DG2A 3VYRB 3SIXA 2IZOA 2XMGA 2ECKA 4NULA 5FBKA 4BZWA 2FMUA 3EZ7A 3ZBPA 2Z8ZA 1Z29A 1U04A 3GMTA 4W5OA 1WZUA 1P7YA 1A5BB 2NW6A 2HYDA 4FSDA 1E2JA 2FEAA 1C9YA 1I0IA 2FFBA 3EQ9A 4P0TA 3WL4A 3AF6A 3OM0A 1AK1A 1ORVA 1VKHA 2BFDB 3PDWA 1B41A 5D85A 3RS8A 3JAMA 3PXXA 2YRFA 1ZIXA 3KVYA 2QN2A 4KU4A 3EZ9A 2QTVB 3QY0A 3KEFA 3KTFA 3T7DA 4BWYA 5K45A 1KOJA 1ZQ1A 3WP1B 3I34X 3WYDA 1ZRNA 1U4NA 1WUKS 3R7DA 3WBKA 4DW8A 2GJKA 4LX8A 5DHPA 2DECA 3NHMA 1R6UA 1BAPA 3H1EA 1PVVA 2E7ZA 3B5JA 2Z3WA 3NW9A 3ZCTA 3M5PA 3L0BA 3KXKA 3INNA 4Y6QA 2L18A 4PE5B 4R2MA 4WW0A 4BNUA 1Z38A 2ZI3A 4D8UA 2C29D 3JYHA 1P29A 1Y5RA 3Q3VA 4OYHA 4X60A 2QTTA 4E7OA 4DV7B 4QQKA 3ZCSA 4I8DA 1HFWA 2OCGA 3BGDA 4BGIA 1ISMA 4BCDA 4YJKA 2PH1A 2YIJA 2YQ5A 3WG9A 5LNK6 4JLBA 4KEAA 2V7XA 4ND5A 2G28A 4NYIQ 4Y1EA 3VR4H 4UEQA 3PUZA 4DIOA 5F35A 1ZOPA 2P30A 3O2NA 1U1FA 2W2LA 3HXKA 1EX6A 1DL5A 2REBA 5B3KA 3RTDA 2ZWIA 2KI5A 5AHRA 4XM0A 1SC9A 1X8KA 5DBGA 4ZT4A 3TL2A 3S2UA 1T1IA 2D2VA 1WBBA 1GUAA 4FUTA 1EH5A 3OZXA 2C7QA 1ZINA 2XB4A 1L5YA 3BWYA 4LS3A 1HA3A 1D5CA 2YWRA 3CMCO 1HDXA 3U3MA 5HRAA 2NM0A 4UCQA 3R0JA 4F7WA 2F17A 2DBRA 3NYWA 1JPUA 3ZW7A 3ZU2A 2GEKA 4K88A 4J0JA 4M36A 4HXYA 3MPUA 2IIBA 2VK8A 4IUBS 3SD7A 2AD1A 5KAMA 2VCHA 4N3GA 1TUGA 4HDMB 2OYRA 1LLDA 1P31A 3UAGA 2ZJ6A 4BIIA 2QXTA 3WLKX 2UUCB 4QVGA 1KXJA 2XTZA 3MNFA 3SYTA 1DKNA 5JI2E 2RD2A 4K7JA 2YXDA 3U0VA 4BO4A 7AT1A 4KR6A 2V5UA 4YCNA 2IPAB 2O1XA 1KMNA 2P2NA 5DLQC 3RHZA 2M6SA 4P38A 2Q3LA 2QN6A 1JR6A 1FF9A 5IXJA 4TQAA 1X86B 3NAQA 1KEKA 2AK3A 2H2FA 2M6LA 4BO1A 1R8YA 4B7UA 2H4JA 2VCEA 1P1CA 4MA0A 3ROGA 3SHTA 4BB9A 4N40A 3ZXSA 2BLLA 3QNUA 4B0OA 4KO8A 4ZDWA 3E9NA 1CHNA 3H5OA 1DB3A 5CW1A 4KR7A 1EIZA 5AKEA 2BGWA 1G0NA 5JJIA 2GPTA 2ZE7A 5IWAB 5KNBA 1ST3A 4KAXA 1EK5A 3GOQA 5H9VA 5KYWB 3KJQA 1LI5A 3K9WA 4L6CA 1ZK4A 2F8LA 4OL9A 4D41A 3PFFA 5A5EA 4BFZA 2PRYA 1AKRA 3FPKA 4J8PA 2X4LA 3UA4A 2F43B 2G4VA 3HH8A 2F8TA 4JGBA 4PM4A 4FYXA 5BP7A 2ZLBA 3U6KA 1HO3A 1ZC3A 5IZCC 2PK3A 4US2R 2AX3A 1NZJA 5F2OA 1I80A 2AE1A 1HNWB 2HF7A 1J0BA 1DRKA 4HPJB 3Q10A 3IOCA 1WQ3A 3REQB 5BNIA 4YV0A 3VO2A 1Z0DA 4HO1X 3B9RA 3A6PC 1VFPA 4K6KA 3TNFA 1I30A 3NORA 2R7LA 3DMGA 1WY7A 1KK0A 3D3QA 3L6CA 3U7RA 3U4QB 3TQHA 1H2WA 1LLQA 4D42A 1E62A 1FJ2A 5JD5A 2ORED 4YRFA 4B6PA 2YOGA 3O0TA 1X1EA 4LJ4A 1ZD3A 2G80A 2HDWA 2JIRA 3R5JA 5CBKA 2CFSA 1JHRA 1H85A 1KEEB 4MV4A 4RS3A 3IVRA 1XZPA 1YKGA 1RQRA 3WNCA 1TM4E 3B5EA 3FMFA 1MNAA 2OSBA 1BMFA 4WIAA 3GZJA 4BATA 4XWAA 3DFKA 4D9CA 1QTIA 3GLIB 1E5QA 5LLDA 3PXDA 3SP1A 3ITDA 3P97A 1QK3A 1G3UA 1UWVA 2IZ1A 2Z8YM 3HKEB 4O63O 1M5RA 2WFLB 1QK4A 2V45A 1CR1A 3IHTA 3EXIB 2AOXA 3E3AA 1R9GA 3LKDA 3W1VA 4A6EA 1EJ6A 1OXVA 4OLBA 4BCCA 2QRLA 4WXPA 4LNHA 2CCGA 1PR2A 2UYCA 1M8PA 2YJ4A 1UFKA 1ZU5A 3IBCA 3LXMA 1ZM2A 4I2VA 5F2NA 1E3WB 3QU9A 3B1KA 4RA9A 4YJ3A 2AQ8A 5EY5B 4UAJA 2PJDA 4C4XA 5EE5B 1NVVQ 2WMOB 1SPXA 3AR6A 3RG8A 1P2FA 2CXRA 5CT8A 3DT8A 2A1UB 3BDAA 2X0JA 3WK7A 4F8EA 1YBHA 2WWFA 1SVKA 4MVWA 4RLHA 3KFXA 4JL5A 1T4GA 2OXCA 2YJNA 2VEOA 2Z09A 2CMDA 2ZTMA 4UTNA 2X2OA 1VDMA 3DPSA 4PLFA 3UPTA 1XZJA 2IYXA 3RAJA 1E2KA 1L6IA 4YV7A 1AGRA 2LIPA 4D26A 3UUEA 4P58A 4EJFA 2JLXA 2I3ZA 1U7OA 1JB9A 3DCYA 421PA 3GJTA 2EW1A 4GZ6A 1KE1A 3ZJ5A 1CIPA 4RCVA 2O5EA 2PLRA 5CRIA 5DGCA 5CFMA 3LI2A 3IUBA 3HB0A 3HKDA 4RHUA 2H0AA 4RPIA 5HQTA 1OZHA 5LWQA 2Y0EA 4OUDB 3R3UA 5FWYA 3T99A 4DCJA 2PQMA 3R2JA 2HQBA 4KZPA 4AO7A 4EI8A 1A9RA 3NVAA 1PBNA 4MYSA 2Q5CA 2UZ3A 1UM9B 2OV4A 3UY4A 5C8VA 3TLKA 4O2RA 1BU5A 1FS6A 2O5VA 5HOEA 3JVDA 2D7DA 2BGJA 4Z4GA 1Y7TA 1YUMA 3PRJA 1Q0LA 5EJAA 1WR8A 3PLRA 2ZWMA 3V8BA 4DLSA 3CXRA 5I9NA 1P2DA 3TLAA 1JJFA 3K0KA 2NXWA 5K6TA 3OLVA 1N8KA 3ZY3A 1D2GA 1R6AA 4CLOA 1I4TD 1S2DA 1UKZA 2OT3B 1ZSYA 3DM5A 1CU1A 2O8BA 4I50A 2GBLA 5B37A 3RRBA 1KFCB 2WUDA 3R3JA 5C31A 2OB1A 1UJ5A 3WA6A 2WSIA 3S70A 3MJVA 3AU8A 4HS9A 2JVJA 2PLNA 4IL5A 1JP7A 3N70A 4J0GA 1YAHA 3VO1A 4TLMB 1RT9A 1AU9A 5C51B 3GJYA 1OY1A 2NUAB 1U02A 1XTRA 2XGMA 3T8YA 3MGKA 4FJ0A 3RSZA 1OKKD 3PPWA 4G0PA 5EJFA 2Q07A 3WGIA 1K8ZB 2EP7A 4I3FA 4MTLA 3TD2A 2FSUA 1Q5PA 1CERA 1Z17A 2W83A 4D4HA 4J0EA 1VE6A 5K0BA 5BW6B 5CJJA 3U4CA 1O9HA 2X0KA 3A2MA 3PC4