1R0WA

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) apo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
281
structure length
266
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 90
structure length 266
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0wA00
2XZLA 4ZDIA 4NDZA 4GMDA 3G5UA 1BYUA 3KTAA 4TN1A 2ZAMA 2IYQA 3NEJA 4JLAA 4NYJR 4FMDB 1GKYA 4EIWA 4DLXA 3SYLA 5LBIA 5KOYA 1E96A 1VYVA 1EK0A 1JPNA 2O8CB 4IOLA 3T1TA 1VCMA 1KI1A 3OF5A 2J45A 1BMFD 2CE7A 3I72A 1XRJA 2XGJA 3QXSA 2RGNA 2C2HA 4BE7B 1XNJA 1DPFA 1G291 1X1SA 2V4ZA 2C77A 2E1RA 2ZRAA 3LO5A 1SKYE 4BZPA 1UKEA 1ZUIA 4ILEA 4MKFA 4M4SA 2ZUCA 1YR8A 4ZI3A 1ODFA 4Q1BA 3MJHA 4HAWA 5FOUA 2F1JA 2RHDA 1FQKA 2X8AA 1P61B 1H8HD 4MYHA 1AGPA 3K53A 3UATA 3G0HA 4TZ6A 1GFIA 4B71A 1BH2A 4GFDA 1MO5A 2GVDC 4ZIRA 4RFVA 1MOZA 3EPHA 3NEYA 221PA 4GOJA 5HZHA 1G8HA 3EWAA 2ZVPX 5KU1A 4BFXA 3PIRA 4HZUA 4R2HA 5KO2A 1NN5A 3EZ9A 1SULA 2BKEA 2QT1A 1KO8A 1GL6A 3LW7A 1E79A 1XX6A 2ANCA 4Q5IA 3ICEA 3TUJC 2JLZA 1N6PA 4PSKA 5AUPB 1SZPA 3B2EA 4Z1MD 2VSOA 1XD9A 2I3BA 2K5UA 2JJ1D 2Q21A 4Q02A 3IUYA 1ZD8A 1X3SA 1ZRHA 2WKQA 821PA 3T06B 2WAYA 4Z54A 3T1VA 2YVUA 5JBQA 4IHQA 3GEEA 1Y63A 3MWKA 1D9ZA 4C4PA 2CE2X 3U6BA 4M1KA 1ELOA 3BB4A 4Q4JA 1ZP6A 1FW6A 3TBKA 1CTQA 3BFXA 4I4LA 2VQSA 2ZRHA 5E7IA 1XB2A 2EW1A 3GLGA 3BOSA 4P31A 4EPYA 3KQKA 3LBNA 3SJZA 3KXLA 1T3LA 2IYVA 5BQ5A 4Q9JA 1TADA 1EFTA 5FPKA 4AD8A 3ETLA 1E9SA 3QEOA 1E4VA 2GEUA 3D6TB 4G0NA 3IO5A 2XAUA 2H1LA 4AKHA 1EG7A 5EXSA 1SXJA 2Q9BA 5TDHA 5FUXA 4C2TA 1JJ7A 4M9SA 3OEHA 5E7JA 5J4HA 1E9AA 1WE2A 2P65A 3OAAD 2QENA 1AQYA 4LHZA 3UMRA 1NJGA 4BFYA 2O8DA 4TZ0A 4LJYA 1UBGA 3QVUA 1FL9A 4NKRA 4QC2A 3Q7QA 3WP1B 1EFHA 2AL7A 2GEDA 4FWIB 4RD0A 2A3RA 4KO8A 2ZR0A 3G82C 4BECA 1R7RA 4F38A 1UADA 2JAQA 2ASEA 1OH7A 5EE3A 3GQBA 1HQCA 2QTFA 4IVQA 1G18A 1T4GA 4MITA 2FPKA 1CEEA 3SN6A 3RSLA 3QNUA 2AK3A 4IOJA 1I2MA 1G3QA 2J59A 3RS0A 3A4MA 1HTWA 3AGQA 2O0KA 4US0R 2JDIA 1ZD9A 4RD4A 2GILA 1S96A 1D2MA 4UXIA 1S8FA 4Q03A 1ZC4A 2PEYA 2VP2A 2UVQA 2IS2A 5JS7A 2IYSA 3M1IA 3ADKA 4HDCA 3K0SA 4DIDA 5L3SA 2HXYA 3VR2A 2W6IA 4GI7A 3QVVA 3SEAA 2JA1A 5DLQC 4B43A 4Q7JB 2NG1A 2JLSA 4QJ3A 3KKNA 3LRPA 4JIMA 2W6JA 2YC2C 2ZSEA 1HY3A 2QAJA 5C46F 1NNEA 1XJQA 3H0KA 1ZD1A 5EZ5A 2WPDA 3EG5A 4O0MA 1E6CA 4MQBA 3H1TA 3GLFE 1OFIA 1R8QA 1LF0A 1QRAA 1WF3A 4LYJA 1FOEB 5FUYA 2VP4A 2Z5FA 1KJZA 3K09C 2V3CC 1S1CA 3HWSA 3VHLB 5C4MA 3PG5A 5C2JB 2REOA 4QGAA 1IY2A 2WJVA 1JR3D 2NMVA 4QOSA 1BMFA 1KK1A 2WMNB 4QHSA 2GCOA 3VMFA 4KSCA 4GOKA 4TLDA 1X1RA 4MRPA 3GLHA 4JVSB 2VA8A 4R71A 2G3YA 3AKYA 2B8TA 4QGHA 3MRSA 4R98A 3BB1A 1FMJA 2A5GA 5FTMA 3LNCA 4A0HA 2O8BB 2XTMA 3IQWA 3BB3A 1E3MA 2D7DA 1IXZA 3SE0A 1H8HA 2ZJ5A 1KI6B 2RAPA 2RKOA 4MUBA 1Q1ZA 3J81k 4BFVA 2OFXA 4MGIR 3LQRA 2IYYA 2WVJA 1QHXA 1Z0JA 2ZRCA 3GCGA 3ZJYA 3A6PC 2DCUA 2RCNA 5JJKA 2ZJYA 4QFMA 1CJKC 5DN6D 1KZGB 2XJ4A 4K81B 5G53C 4NE2A 4F4IA 5A5GA 2OAQ1 2NO0A 5C1BA 5L3QA 2FFAA 2QA5A 1V5WA 3B1VA 1SHZA 4E5UA 2CCJA 1YKSA 2ZRFA 2DFTA 4B3CA 3R7WA 5AJZA 4MRSA 2VTKA 3A4LA 3E70C 4QXAA 4YONB 2AD1A 4JLBA 4JVLA 4AKGA 3LH5A 5DGXA 2HCJB 1P7CA 2ZUDA 1QHGA 3BBPA 3DPUA 3BRWD 1E2EA 1H8EA 8OHMA 2BEKA 5D3MB 3BD9A 4OQXA 1F2TA 4L9SA 1XPUA 2HT1A 3QF4A 4RCYA 2QU8A 1NVVQ 2W0MA 1PZNA 3QENA 2GCNA 4AG6A 1RRGA 3WNCA 2CNWA 2FEOA 4H1VA 4FWTA 2OCPA 3DZDA 4NMMA 2G77B 2QM7A 3O8CA 3AUXA 3LDAA 5E4FA 2W2VA 4IDHA 1VDZA 2B21A 3TRFA 3SJCA 3H2YA 3RRMA 3PQCA 3FKSD 3OAAA 2FFQA 2UKDA 2Z83A 1ZNXA 4CRWB 4PQYA 4NYMR 4OQLA 5H68A 3ADBA 2QE7D 3RABA 4LHVA 2GRJA 5JWHA 1Z07A 4C0HA 3JZAA 4MUAA 2D2EA 3K0FA 2WWYA 1Z6TA 4OI4A 2FGJA 4NCJA 2OFWA 1YU9A 4YMUA 3DM5A 3AV0B 2VH5R 2WJHA 3P4XA 2QTHA 3SYNA 1RRPA 5FBQB 2R6DA 2OSBA 2VP0A 3PFIA 4C0SA 1IY1A 2O8CA 1XF9A 3AH8A 3SFZA 2VP6A 1QHIA 4DT1B 1NY5A 1W1WA 4D6PA 4M9QA 1YJ5A 3AVOA 3QG5A 2PMKA 1BIFA 3PJRA 5D3QA 2WMOB 1Z0KA 3I3SR 1GRQA 3QKSB 4UXHA 4BASA 4Q9LA 1F48A 2V9PA 2XSZD 1BYIA 5EXTA 4YMTA 3U3MA 4GL2A 5DI3B 4J0QA 4HB3A 1LF5A 2AKAB 3QG1A 2Z43A 1S3GA 3VR6A 1GL9B 1FUKA 3C4JA 3ZZUA 1Q1EA 2GJSA 3K9HA 2R6GA 4LBZA 1EXMA 1JR3A 1SXJE 3UMSA 3X1WA 1COWD 3PCRB 4XOIA 4URYR 2FJUA 1OT3A 2G88A 1UEIA 2YOHA 1RRCA 4C7OB 2P6UA 4LPKA 2C78A 5FL7D 3DM9B 3EC2A 3NH9A 1W4RA 4PHFA 4MDEA 1JECA 2ATVA 1NLYA 3DZ8A 4OJQA 5AK0A 5JJIA 2J0VA 2VYFA 4Q1AA 4YC7A 4WXPA 1U98A 1AN0A 3SDZA 3AKCA 5IDVA 1FP6A 1IXSB 1P9RA 2NPIA 1U99A 1N5KA 3GEHA 2VO1A 3MG9A 3L2OB 3JVUA 3GFPA 3U4QB 4LBWA 2RGNC 4FN5A 4DDWA 2D74A 3KKMA 1XJ0A 3QXCA 4OHYA 2JEOA 1TEVA 1MH1A 3IILA 2WWXA 1U0HC 4LJ7A 3CRMA 4TL9A 1U2RA 1D8TA 4XSHA 3EASA 2NO7A 5JCZA 1HEIA 1NBMD 4JSYA 2OBLA 3F3YA 4ZCLA 3THXB 1OW3B 1CS4C 1E2NA 2F1HA 2OLKA 4LGMA 1N6NA 1UJ2A 1U8AA 4OL0A 3ZS8A 3VKGA 1P4SA 1XBTA 2O8FA 1NG1A 3DKVA 3SC3A 2REXB 3PXGA 3C41J 2GXQA 4RKFA 1ZNWA 2Y8EA 2OBNA 3CH4B 4QHTA 4ZDKA 5H70A 5JHHB 3GJ0A 4YQFA 2OCAA 3WMGA 4QM6A 3PEUA 4P0TA 1AIPA 2HV8A 2G6BA 2DY1A 5CB6A 2CLCX 1IM2A 2YV5A 1SVSA 2PT7A 2HXSA 1SVKA 1SVWA 5HR5A 2GAOA 4LC1A 2F55A 3I62A 1UDWA 2OM2A 1E9RA 1GILA 3CLVA 1G8FA 1W4AA 3D3QA 2YKGA 2RMKA 4JMPA 4WZAE 4Q1FA 2ZI3A 2WOOA 2ZE8A 1UFQA 2QM8A 1QDEA 2WKPA 2P67A 2YHSA 3CZQA 1M6NA 2ZQ5A 3BWDD 3I73A 3NH6A 5FPSA 5IT5A 3ZZ0A 3OE7D 1RJ9B 4EPVA 4KI0A 1NN0A 2GK6A 1NN3A 1ZAKA 2OAP1 3VR3A 4TL7A 5JSZB 4LBVA 4QM7A 2UZ3A 1L7VC 2ZRIA 3O47A 1R0ZA 1T0JB 4PTLA 4D0LB 4LBYA 4BFWA 4DLWA 1NVXQ 3W90A 2GXUA 4IEEA 2JIZA 4KVAA 4P3YA 4IJMA 3WNBA 4YLGA 5FL3A 3TGPA 4R2IA 4TSFD 2V54A 5EE0A 4KFSA 4KXFB 3BAFA 4D0GA 3DVLA 2YJTD 4TYPA 2QGZA 3K09A 1G6HA 1XD2B 5IK2D 4PAOA 1T0HB 2J46A 3SYKA 2XTZA 3T5GA 4ARZB 3NTUA 1HQYE 1R4AA 4LV6A 1KYIA 1NMYA 3CWQA 4FMCF 4DIEA 1JI0A 1ANKA 4B47A 1NIJA 3U3OA 1EFRD 2BMFA 1E9DA 5B58C 3W8RA 1KI4A 1FFHA 4DLYA 3DMNA 2PEZA 1NKSA 4G5OA 2XITA 1N3BA 5CDFE 1N2CE 2A5FA 3MJRA 3CH5A 4RKEA 1VG1A 2O8BA 2P3SA 1OH5A 1UDXA 1Q21A 3ZGXA 2NZJA 1JR6A 2GJ9A 1NL3A 1KOFA 2BJWA 1KI6A 4Q1EA 4BQSA 4BGDA 2DBYA 4D80A 3IBYA 3VKWA 4ZCIA 5CIWA 3B1YA 2CK3D 2V6IA 2JJ2D 3AF2A 3K1JA 2G9NA 1WP9A 3EC1A 4LK2A 3FMIA 5AJVB 2DB3A 3LX5A 1WMSA 3BERA 4NCNA 3UG7A 1P2VA 1OYWA 2BMEA 1IQPA 1KDPA 3TLXA 2Q0HA 4Y0VA 3FB4A 3KQNA 5G40A 5KHOC 3FTQA 1KK3A 1OFUX 3GLIB 2ZE5A 1N0VC 5HE9A 1E99A 1UF9A 4KJZA 4PPNA 1CRPA 2A5YB 1OKKD 3IDQA 2IF0A 5KSOA 1TQ2A 2HJGA 1G8GA 3DEFA 5FOVA 1XP8A 4DHEA 4TMXA 3W8NA 2GZHA 4DJTA 4HLCA 1KSGA 2IX3A 5IRCD 4EPXA 3TK1A 2RGBA 4JLMA 5D3MA 2BMJA 1N0WA 2J3EA 3SBEA 1DAEA 2JASA 2Z0MA 5H1YA 1DVRA 3THWB 1Q22A 3CKLA 1CP2A 4BZXA 2GJAA 2GNOA 2P6NA 2ZANA 5DIFA 2NIPA 1DS6A 4DDVA 2GXAA 1XFAA 1Z29A 4G5GA 4RD6A 2QP3A 1NBMA 1N6LA 2BBSA 3TSZA 5DI9A 2VRWA 1NVVR 4TLAA 1IY0A 5SZHB 4AWXA 2C5LA 5J47A 1Q0UA 3EPJA 2BEJA 2EVWX 4A2QA 5AJWA 4HB0A 2ZSBA 1YZUA 1GTVA 3LFUA 1PLJA 1RKBA 3RWOA 5F9FA 1XTSA 2IS4A 4DCVA 4QJ5A 1KKMA 2IT1A 3A1SA 1UM8A 3A1UA 3FPAA 2X77A 4IXNA 1W0KD 4JBYA 2GKSA 3EARA 1Z8FA 3SZRA 3FMPB 5TV2A 2ZRPA 4D4KA 3QSYA 1FZQA 4BPBA 1XXHE 1TUEA 4DWJA 1JQLB 1PUJA 3V9PA 2D4HA 3LAWA 2MSDB 4Q47A 5EE5B 1KO4A 1XCMA 4KFTA 2WHXA 1F2UB 1N0UA 1JEEA 1SKQA 2EFGA 2AWOA 1E94E 3EA5A 2BC9A 2R6FA 4DT1A 4DEXA 5FTKA 4ZKDA 1GAJA 1E1QD 5FR2A 3TAHA 3IO3A 1IONA 2ZIAA 1ZCAA 2WOJA 3QKSA 1L4UA 2D3WA 4OQFA 5KSYA 3AP2A 2H57A 5DI3A 4B3BA 2EFHB 3EIHA 2C95A 1N6KA 2Q3HA 2J5XA 1XMJA 4TSFA 3MWJA 4UNNA 2IS6A 1P9WA 3B5JA 5HCIA 2GWHA 2GTPA 4WZ6A 3RWMB 5DHFA 1IBRA 3ZVMA 2B92A 2CJWB 4K8OA 5IK2A 4BLOA 4QGFA 1GRRA 1KY2A 3I8XA 3EIQA 4O25A 1M7HA 2Q3MA 3ZD6A 4DDUA 4B3GA 5LPNA 2IHBA 1U90A 4C7OA 1YVDA 3CX8A 4WVFA 2J87A 3R9IA 2QNRA 4F7WA 5A0FA 2E87A 4DCSA 2IYLD 4RY2A 4OI0A 3BE4A 3RDPA 2QN6A 1DAHA 5FOSA 4DCTA 4DUGA 1Z63A 2A30A 4U02A 2V7QA 4OHWA 3ZLJA 2OBMA 4H1UA 4L5BA 3CF0A 2C8VA 4UNSA 2WIBA 1ESNA 2GF0A 5KSPA 3PUZA 1W46A 2IBMA 2GAAA 2QP9X 3RVBA 4BLSA 2CK3A 3U4QA 3VX4A 3U7HB 4EFMA 2N46A 1SVOA 3VR1A 4V0MA 4OHXA 4UNQA 2IXEA 1TPZA 4M8NE 1RZ3A 3AVPA 4UJ5A 4NHOA 2XEXA 1NF3A 2FX3A 1QVRA 4HAYA 1G16A 2GCPA 4DRZA 1ZINA 2KBFA 2OE2A 3OHMA 4KVGA 3THXA 2DWPA 3C5HA 3B13B 4Q66C 4JLVA 1GKIA 4DB2A 2AFHE 3GJ5A 3GJXC 2CL6X 3NBFA 2DFKB 3R20A 3TVTA 1N6OA 4E07A 3T1QA 4JVMA 4PHHA 2ZUBA 3W3AA 1AZTA 3BORA 4EAQA 2QP4A 5K8UA 3TKLA 4LWZA 2H18A 3C5CA 1NSFA 3CRRA 1TAGA 3K8YA 5FI0B 3WHLA 4AURA 2JLVA 2EFCB 4RJLA 4HUQB 1KNQA 5J40A 3R9XA 5FOXA 3TW8B 4DSNA 2VHTA 1DAKA 4JBWA 4PAMA 1CJMA 3AVQA 3PVSA 2DWQA 3A4NA 1RC8A 4DSTA 3L82B 3MUFA 2CHQA 3SQWA 4NYIQ 2IXGA 5JRJA 1CJVC 4A9AA 4Q00A 3E5HA 2PT5A 1OE0A 3S1AB 2YWFA 4URXR 4MDFA 1AZSC 1BKDR 3T1OA 1G41A 4P33A 1N6IA 4PZYA 2XNDA 2FFBA 1RJ9A 2C9CA 4P4TA 3QKRB 4EPRA 2ATXA 3HYRA 4QHYA 1R5OA 2QMOA 5JZVA 4XTRA 4CIDA 1N25A 2G0NA 4WA7A 5EP4A 3T5DA 1PLLA 4QG7A 1G7CA 1K5GA 2CL7X 4C2UA 3H86A 4P32A 2ZI7A 5BYKA 1XDBA 2OXCA 4B32A 2CHGA 3SI7A 1VCOA 4XD7D 3U7GA 3DOEA 3KXIA 1YR7A 2QG6A 4XVRA 2FPMA 4RD3A 1VCNA 4ASUD 2VF8A 4AKIA 1XD2A 3ZVLA 521PA 2QUZA 1UAAA 4TYWA 1UKVY 1HYQA 2ORIA 1ZIPA 4IVPA 1LNZA 1P72A 5H8WA 5FPTA 2XTNA 4X8LA 1J2JA 2CVFA 4EQ6B 4MGYR 3X2SA 1VYTA 4NL4H 4W5JA 3F5FA 3SJBA 4XSGA 1J8MF 5KUTA 1E1QA 2BOVA 2ZRMA 1M34E 1QVAA 4URUR 3CX6A 4MH0R 2A2ZA 4LZZA 3RAPR 4B3FX 2JLWA 1GNPA 2QGNA 1LB1B 4D25A 1NP6A 4LY6A 2B8WA 4AYWA 1LTQA 4G5RA 4V0LA 1N5IA 4RZ2A 5LDDC 4GZLA 3GEIA 2WWFA 2H8KA 1QHHB 2QTVB 4OI2A 1G8PA 3DO6A 4WOPA 1WBBA 1LW7A 2XOKA 1YRAA 4NCHA 5E7MA 3P27A 1EFUA 3KDSE 1GDDA 2ZJOA 2IF2A 2ZE7A 2F7SA 2GBLC 2I1VB 4PHGA 1HE1C 4N3NA 1IN4A 1NY6A 4X8OA 3EW9A 2IW3A 4E03A 2ZJBA 3TQFA 3TUZC 2HLDA 4C30A 2C96A 3GFOA 1XJCA 1G4AE 3FDIA 3OEED 1G5RA 1SKYB 4LJ6A 2ZSFA 3SOPA 3FWYA 3GLIA 1F5NA 2O0HA 1G3MA 1G20E 2R6CA 3HU1A 1PUIA 3OZXA 4HSEA 1E2LA 3ZD7A 1OXUA 1DG3A 5HKKD 1VTKA 5BN4A 2D2FA 3U3JA 2IUSA 3WBJA 2A9KA 2CLDX 2JLYA 1GRNA 4M0LA 4D2IA 2J0UB 1E4YA 3BFKA 3LVRE 3UG6A 4OK5A 1MO3A 4WW0A 2PMDA 3D7MA 2XZPA 3LLMA 2LCFA 3E2IA 2KWIA 3CR8A 4TL6A 1U8YA 4Q1DA 4U00A 3T15A 1QZXA 1Z83A 5B30A 3THWA 1J99A 4OHVA 4OI1A 2P0EA 2PZFA 1OXVA 5DISB 1KDOA 3VKHA 1TMKA 3QF7A 4MKHA 3PUVA 3KKQA 4UNPA 3KQLA 2G83A 3SJAA 1GVNB 1E0KA 4PANA 3VHXA 2ZEJA 2WV9A 1R8SA 3ND9A 4BLQA 3SNHA 1G3RA 4ESHA 2V8OA 2RGCA 3K0AB 5UKDA 1S9DA 4LCBA 5BXQC 1Z28A 3QBVA 1A5TA 4NCKA 5DO9A 4QBHA 1XEXB 4X8MA 4Q4HB 1IAQA 3WY9A 2W2XA 3L0PA 3GFTA 5HTKA 4PC1A 4BFUA 2TMKA 4ZI2A 5HZKA 1D5CA 4GBMA 3VR5A 3CF2A 2PLFA 4CEHB 2A5JA 2OHFA 1V43A 1OH8A 1IJEA 4LYHA 3N2IA 5GJVC 2N1BA 4Z1MA 1UBEA 1VG0B 721PA 1JJVA 2VL7A 1DOAA 1W49A 2D06A 2IL1A 2JJ1A 1MV5A 5AUOB 3BS4A 1KMHB 3KUDA 2CMKA 5FBRB 3AVYA 1M7BA 1W5TA 2I1QA 4URVR 1XEWY 4I81A 1J7KA 3MFYA 2FF7A 2EFDB 2IXFA 1F2UA 3IIKA 1YRBA 2F9MA 3QI2A 5GJBA 4A2WA 1ZC3A 1S9HA 3LD9A 1GITA 1Q3HA 2BMDA 1ZBDA 1G3IA 3KB2A 4TT3D 4PC6A 3I61A 1ZUNB 3NBXX 3O8DA 2B6HA 5CK5A 5EE1A 1VG9B 3REGA 2C9OA 4FIDA 1GZSA 1QHSA 2F3TA 1TQ4A 1N6HA 2LKCA 4KFRA 5AUNB 3DMDA 5J4LA 4TMWA 3KJEA 3K0EA 3Q5EA 4G1UC 2VSFA 1G3UA 5CLQA 2C04A 1ZM3A 5TVKA 2QPAA 2HF9A 1YE8A 2DPXA 1VECA 4M21A 4YDHB 4KSBA 1FQJA 2ODEA 5E95A 1MT0A 4JLOA 1Z3IX 4NZYA 1NKTA 3AVTA 4I1VA 1E2HA 3A37A 4FMCB 1KKLA 2GHIA 1Z6YA 2X2FA 3OESA 3X1DA 3OFND 1IOZA 4GNKA 4KITB 1UBCA 2FZLA 4Q1CA 4ASUA 4D0NA 2CJWA 2G0TA 4EJSB 2X1VA 4QBFA 4KFUA 2QROA 3VU9B 4EJSC 1FNNA 1E9BA 5KDLA 4AYTA 1O3YA 1PJRA 1KI2A 4KHZA 2NO1A 4LHWA 4WIAA 5CJPA 3RC3A 5DNYB 4QL3A 4CT5A 5J5CA 3ZDQA 3PEVA 1XD8A 4L16A 4FCWA 4PXAA 4DDTA 4A15A 1W0JD 2WM9B 4QNRA 2WWIA 3O8BA 5TB5A 3D8BA 1P5ZB 3FHOA 3GLFB 5SZIA 2A5DA 5L8VA 3AF4A 3KL4A 2GJKA 1GG2A 1KI3A 4CF7A 4NBSA 2AK2A 4PQFA 1DARA 1E0SA 2CBZA 1K5DA 3CPJB 1Z2AA 1ZU4A 3LWNA 3RANA 3QY0A 3UIEA 3QJYA 2W00A 1S3SA 4PHTA 2QAGB 3TR0A 2YOFA 3QE0A 4B74A 4JJZA 4UKDA 2EYQA 3W34A 2BV3A 2VHJA 3CNOA 5AJXA 1C1YA 2IYZA 2PJRA 3CB4A 2GXSA 2GZDA 1DG1G 3NHBA 4XWAA 4EPTA 1XU4A 1KO1A 2ZRJA 2XX3A 1FNMA 3OEEA 1NN1A 2C99A 4UNRA 3VR4A 4HATA 5EP1A 3GLGE 2LKDA 1AKYA 2FGKA 1HT2E 1XTIA 2AHOA 3HR7A 1HA3A 3W5IA 4BFSA 4TL8A 3LX8A 4AKEA 4BLRA 5HKKA 2YNMA 3B85A 1XMSA 2P2LA 2PLRA 2XZOA 1KDTA 1QHYA 1JB1A 1RYHA 2F1RA 3EAQA 3P32A 3RNLA 5FBWB 3UK6A 1G9XA 4MRNA 1WB9A 2JGNA 3C7KA 1LFDB 1W36B 4BLPA 3T61A 3X1XA 2ZJZA 2DFNA 4NCIA 5JI3E 4I1SA 1VCIA 1CF4A 3CNNA 3RS4A 2CVHA 4ZDWA 4HUQA 5F98A 4DLSA 1WRBA 2WAXA 1J90A 4JZKA 1WDTA 5C4GB 2ORVA 1KJWA 2BBWA 4OYHA 1W4BA 2FFHA 4HAVA 4Q4AB 1DEKA 4L8GA 4ACBA 1TF5A 4LX0A 5JRZA 1YHNA 1F6BA 3B82A 5DSZA 3S1AA 2ZRLA 1G5PA 2GJ8A 1S2MA 2IUUA 3SFVA 3KX2A 5AWFC 5IHPA 4GZMA 2R9VA 1R10A 2W83A 3KFXA 3QKRA 4P4SB 5FPYA 2NPFA 1R0WA 5JWRA 5DN6A 1IN5A 4LPSA 1JEDA 1TUIA 4NYIR 2ZRNA 2HEIA 4XIGS 1ZVQA 1CU1A 3KKPA 2QEQA 2FU5C 4BLTA 4ON9A 2WWHA 5EZ6B 2BVNA 3FFBA 1A1VA 4JVNA 4A92A 4YMVA 4JJKA 1GSIA 4U5XA 4I99A 5FTLA 4B3DA 4GT1A 4DVGA 2P6RA 5KDOA 2H7VA 2VHQA 3B9QA 1KIMA 1P60A 4MRRA 3GLIE 3KXKA 3CPEA 4TTQA 1W4CA 3CONA 2H5EA 4C9BA 1J70A 3C16C 4HI0E 4IFEA 3QKUA 2HUPA 4OK6A 4X8HA 4ZCMA 1G4UR 1E2FA 1W5SA 1QHNA 3REFA 3KZ1E 4ITRC 2R62A 3WNDA 5P21A 1TF7A 3NWJA 2HDNB 3K70D 1P75A 4GMXA 5EJEA 2OFOA 2ZETA 4KLNA 2PJZA 4Q19A 1ZJ6A 1UKYA 2ZREA 3B9PA 1LVGA 3F8TA 2BDTA 1XZPA 3GLHE 1JXOA 1QHHA 3WYFA 1CR0A 4HLUA 2NTYC 1EX7A 3FKSA 2RGXA 2O8FB 1W44A 4URZR 4BZQA 2UZIR 2NQ2C 4XVUA 1RYFA 2GBLA 3L0IB 2VPPA 3PITA 5JLJA 4M9ZA 2QE7A 3ADDA 2EFEB 3VNVA 2AWNA 3WMFA 5BN5A 2FPLA 1P2UA 2B7CA 4HLDA 3SHWA 4DXAA 2ZAOA 1T5LA 4DCUA 3K9NA 2OT3B 4UJ3A 1GP2A 4FMBB 4LJ8A 3GPLA 4IDPA 4OQNA 5G3YA 3Q9LA 1L2TA 4BEBA 1LV7A 2NGRA 4V0KA 5F3WB 2W58A 2YC4C 2BM0A 4GRAA 1FTNA 3ZQJA 5KDDA 3MCAA 5KNDA 2JLQA 1PVOA 2GK7A 2PZGA 2AN9A 5EUQB 4WXRA 4YXWD 3UWKA 2J0UA 1E69A 5A4JA 1DE0A 1ESMA 3CPHA 1W36D 1XPOA 1YZNA 1ZNYA 3HDTA 5JI2E 1XMIA 1D9XA 4HAUA 1E2KA 3LLUA 3U2QA 4BWYA 4QJ4A 5J4KA 2QPOA 5CLLA 1SXJB 1VKJA 421PA 4RZXA 1GOTA 2QL6A 4FI3C 4PZLA 4EPWA 2KBEA 2RH5A 5DH9A 4BFZA 4F91B 4TQUS 2XSZA 5K8TA 5M04A 2IEYA 1E1RD 3B78A 3IBGA 5GVRA 2NO6A 1T9HA 3TSWA 2B7BA 4EFLA 1OH6A 4P4UA 3QUSA 3MD0A 5HCNA 1T8UA 4DCNA 4PR0A 4LJ4A 4W5WA 3K0AA 4ABYA 3IEVA 4W9MC 2QMUA 4HDQB 1W48A 1XEXA 4Q4HA 4PPFA 1UKZA 3LW8A 1NVWQ 1RRFA 5FUWA 1D2NA 4MRVA 5TY0A 4CEHA 1N5JA 1COWA 2BBOA 4A2PA 1XEWX 1G1MA 3TE6A 2R8RA 3QXHA 4PZZA 4WAUA 3W5JA 1G8YA 1Z0IA 4PO8A 5FL7A 2BM1A 1M2OB 2WJYA 2BKUA 2PCJA 2J0SA 1KMHA 4N0DA 2CXXA 1CJTC 1OLOA 2FN4A 1Q44A 4TQ9A 3NXSA 3F0TA 2ZYWX 4KBGA 3AP1A 3B60A 4A8JB 5F9HA 3LQQA 4JLJA 1CR4A 1NI3A 2H16A 2IYWA 2DHRA 1QF9A 2C9YA 1NLFA 3KUCA 1OJLA 3IQXA 4M22A 2FDCA 4GSYA 1Z6GA 4IKEA 3EZ6A 4RCZA 5LB2A 2I4IA 1YZGA 1BOFA 2BCGY 2R6AA 1U94A 2OEPA 3B1ZA 4DLRA 4N0EA 4D82A 3U3KA 2Z4RA 4WZBE 4KCGA 4WBSA 3EXAA 2C98A 2GCOB 1E79D 2ZRBA 1P73A 2VP9A 2F43B 2VEDA 3RS3A 2QSZA 1VMAA 1XMVA 4LRWA 5FFMA 2QBYB 4A36A 1EESA 1R0YA 3U7FB 5FTNA 1G19A 1F60A 5EP3A 3TJZA 2AD5A 2FWRA 3OIYA 3D31A 1E2IA 4EJSA 4LI0A 2FSGA 3VU9A 1TTTA 2WJGA 1KK0A 5IF9A 2E9SA 3RYTC 1CJUC 2ZYVX 1VG8A 4PAQA 3U7EB 1TU4A 1P3JA 4M9XA 2R2AA 3PUYA 1II9A 1PLKA 2ECKA 2IA5A 4QNMA 2FG5A 3CO5A 5CYPA 3QEJA 1JR3E 1YZLA 3IIJA 5AJYA 1Z08A 4DKXA 2EYUA 2OV2A 4HLQB 2A7QA 3BH6A 2CHVA 3GLFA 1MABB 2DYKA 121PA 2ONKA 3K9LA 1XTKA 4LV8B 1X8KA 1FUUA 1G21E 4UQOA 3OE7A 1HV8A 1TQDA 3P26A 4URWR 2VHCA 2YYZA 2QAGA 1FX0B 3JZMA 2H92A 4PC3A 5EE9A 1YZQA 1W2GA 1SXJD 4BUJA 5EQTA 1ETUA 1C9KA 4LV5B 3OEHD 4TTPA 2ZPTX 3HPRA 2BCJQ 5ANRB 3WXMA 2F1IA 2Z4SA 4A6XA 1E2MA 2WJJA 4DLTA 1U9IC 3UMFA 1SVLA 1RFLA 3GP8A 4JLPA 4JYBA 3HYTA 4G5QA 2WKRA 2Q9CA 4LJ9A 4AG5A 3Q8XB 3NBZC 3AVXA 4Q21A 4POAA 4YXWA 1E9CA 4JL5A 1OXSC 6Q21A 4A1FA 1SQ5A 3MAAC 3U44B 3W6PA 5KNBA 1J8YF 1EX6A 5J4YA 4ZO4A 4B48A 4M1WA 1EFRA 4Q9HA 1KI8A 2HJVA 3QXXA 5JJLA 5AR1A 3U5ZB 5SZJA 4XVQA 5JS8A 2OILA 4B2IA 1E2DA 4TYYA 2RGGA 1RVDA 3E1SA 4M1TA 1OHHD 1QBKC 1E1RA 3IHLA 4LHXA 2G1KA 2W6ID 3TIFA 4C0LA 3P1JA 3L8YA 5LB4A 2BWJA 3U61B 3C15C 2EU8A 3BFVA 4PC2A 1ZUHA 2IK8A 4FCTA 5E3HA 2OLJA 1KO5A 2JJ2A 1Q20A 4GOXA 4Q18A 1MRNA 2WPDD 3WP0A 2VIIA 3EZ7A 2JLXA 4D4JA 1FPMA 3UWOA 4B3XA 3QBTA 1G7TA 2J0QA 3CM0A 4TMVA 2RB4A 4Q7KA 1Z22A 3B7GA 1Z0AA 3BC1A 4CZ2A 1M8PA 5KNCA 4ESVA 4I1UA 4II7A 5ELXA 4LHYA 2A78A 2XB4A 4IDNA 4TYQA 2O52A 5EXPA 4AK9A 2IYTA 2ODWA 3FVQA 3SS8A 1DAIA 4IDQA 1OKKA 3AQ4A 3T12A 1K6MA 1ZM2A 3CRVA 1CLUA 4IXMA 5CYOA 4C0KA 4LOAA 2MMCA 4G5SA 1OXTA 1T5IA 2AR7A 2PX0A 1T3SA 1OB2A 2NOAA 4PSVA 3WMEA 3TAUA 1KNXA 2CEAA 5B64A 5TXGA 1RW4A 4HUTA 3I5XA 1WBDA 5JMTA 2X2EA 4XWOA 2PX3A 2RGDA 2BIFA 1OYYA 5DHAA 3A36A 4O2LA 4TMKA 2ZSAA 4ZV4A 4AI6A 1XXHB 2VP5A 1D2EA 3NVAA 4NU0A 3K0CC 3MWYW 4PO1A 1S0UA 2ODNA 3IEUA 5JEEA 4CGZA 4RFSB 3ONWA 1TL7C 1HUQA 3I92A 1RPZA 4TLBA 5JSZA 4C0AC 3AF1A 2WBLC 3KKOA 1P2SA 4Q4LA 2OXRA 4NONA 5FOWA 2PCLA 5JHGB 3LXRA 4HDOB 2ZJ8A 2QT0A 4Z8XA 3THOA 4XWKA 2GF9A 3RC8A 4FW9A 4UXJA 1M1YE 1NVUQ 1W0KA 1WQ1R 4HEJA 4CEJB 4PPQA 3FE2A 5BW8A 1KHTA 4LJ5A 3AVWA 2W0SA 1CULC 2J7KA 1H8ED 1DAGA 4OHZA 3L0OA 1E9FA 1VHTA 1KO7A 3U6KA 1GM5A 1IN6A 1A82A 1R5BA 3RSOA 2HYDA 2VF7A 2QMEA 2X19A 4RZUA 2CNWD 2ZM5A 4ARZA 4DLZA 2PBRA 5SZKB 3FOZA 5JWOA 1OIWA 3LY5A 1HE8B 1R0XA 1E2PA 4W5HA 4F93B 4M1YA 4Q01A 3LVQE 5KSZA 2PH1A 4HB4A 2IHYA 1OB5A 4PO9A 1KTVA 1SGWA 1OPXA 2J41A 2ZU0C 4Y0AA 1ONBA 2ODBA 2ZROA 3QPWA 3P20A 1AJEA 3B1WA 4HLUC 1Y3AA 4DB4A 4MYTA 4O3MA 1MKYA 4MYUA 5CM9C 4NH0A 4CT4B 1CKEA 3WBKA 3LXXA 3BXZA 4JT4A 4A0FA 3VTKA 2IUTA 3DHWC 1OSNA 1NBME 1GKUB 2JLRA 1BS1A 1ZMXA 1OIVA 4DC9A 4Q48A 1E2QA 4KU4A 3EIEA 4PX9A 3AF3A 2FEMA 2FSIA 3GMTA 4A0RA 2VBCA 3UKDA 1KGDA 2ERYA 2EWWA 4C0BA 3EA0A 1I4TD 3FFAA 3QXJA 4R9UC 1W7AA 4DSUA 4EKDA 1OHHA 1YQTA 3X1YA 3FHTA 4IW3B 2D62A 4M1MA 2HCBA 1FTSA 3KQUA 3PEYA 4A8JA 3ND8A 1AK2A 1H65A 4Q7MB 4AYXA 4PC7A 5GJCA 5GVSA 4V03A 4EUNA 4TYNA 4Q7LA 4LSGA 1KY3A 1AM4D 4RD2A 1T3HA 1JNYA 3THYB 5B57C 4KODA 2QPTA 2HYIC 1DAFA 3KJGA 3DDCA 5HPYB 4E22A 1WA5A 1G6OA 1TQ6A 1HH4A 2C03A 3Q5DA 1VYUA 2KB0A 4M1OA 4LUCA 3ICQB 1NRJB 1ZU5A 1M7GA 4B2LA 3EPLA 1GIAA 1XTQA 2O8EB 2VLIA 3Q85A 4GPTA 3SBDA 5GJWC 1ZW6A 5FTJA 2F43A 3PUXA 1II8B 3TQCA 2QBYA 2ZI5A 1YR6A 3CWZA 3IPYA 3QIAA 3AF0A 4LJAA 3RLFA 3K9GA 3ECCA 2FNAA 4PQRA 2ZS9A 3O8RA 3AM1A 1NJFA 2XB2A 1G17A 1SVMA 1U0LA 1EFCA 1VPLA 3NC0C 1N5LA 1A2BA 5EUMA 3ZYCA 1W47A 1LY1A 2WIAA 3HR8A 4DLVA 1JALA 2YZ2A 3L8ZA 1XCPA 4MKIA 3T35A 2W2TA 1JAHA 4FMDF 4TQAA 3CR7A 4B35A 3HU3A 5TARA 5FR1A 1E9EA 1MABA 1U8ZA 3AKDA 3I32A 4K46A 2F6RA 4L15A 4F92B 2XXAB 4NP6A 1UBFA 1Q3TA 3FHCB 2CCGA 2J9RA 4ZDJA 3BJIC 2J7PD 4B75A 4PSAA 3A1WA 1FX0A 3CW2A 5K8LA 5AUQA 1O87A 5JECA 1G7SA 3Q3JB 4QGGA 5FBLB 4CVNA 4AIIA 5C18A 3BIFA 4C0QC 4Q9KA 5J4VA 3A1TA 3L43A 2WSSD 4RD1A 1ZM4A 3B8HA 1BO6A 5L3VA 2KE5A 5CM8B 3R8CA 1U9IA 4W7SA 1G7RA 5BWMA 2ZRDA 3NDPA 5FPHA 4XD7A 2AFIE 5CDFA 3N5CA 3VAAA 4IVRA 1NMZA 3GJ7A 3CRW1 4V0ME 4JS0A 2JJ8A 1X8LA 2WTUA 1DBSA 1Z0FA 1US8B 3C14C 3HP1A 4FXPA 2Q3FA 4MKGA 4A82A 4LDJA 3ZS9A 1I4LD 3A58B 1T8TA 2EWVA 3IPXA 4HAXA 3U44A 2JLUA 3KFVA 1Q1QA 4RVCA 1FP7A 4CYMA 3VNUA 2ZYTX 4BRWA 3GJ4A 3K70B 4BEJA 3K70C 1F3OA 2QSYA 4V0NA 3KB1A 1QG2A 3AP3A 3B6EA 1X8JA 3UPUA 3CF6R 3EZ2A 1OFHA 5LD2C 1XWIA 2GDJA 1GNQA 1L4YA 2GA8A 2ZR9A 4IOMA 4OBEA 3TUIC 4HZIA 3NIBA 4M53A 3MWLA 3U3RA 3LV8A 2P5SA 1KK2A 2JIZD 2QAGC 1JXMA 2SHKA 2V1UA 5FBVB 3PR1A 1P6XA 2CDNA 1EWRA 1WXQA 4ZPXA 4Z51A 2CLSA 3R8FA 1IN7A 1M74A 2WZQA 2YWGA 4EDHA 3LA6A 2WWWA 1IXRC 1VIAA 2FSHA 3GJ3A 3ZVRA 1IN8A 1ZYUA 2GZAA 4JBXA 4TLEA 1NIPA 2XJ9A 1X6VA 1DADA 2XNSA 2YINC 3RS2A 5JFGA 3TH5A 4F4JA 4JL8A 2AKYA 3CIOA 2WICA 4HYYA 4CEIB 1P62B 4LC0A 1NMXA 3EZFA 1R6BX 2R65A 3KJIA 3SR0A 1W36C 3TNFA 3PUWA 5L3RA 1KAOA 2FSFA 2RGEA 1A7JA 4PPGA 3RHFA 4QKQA 2ERXA 1AGRA 1MO6A 4JL6A 5TMPA 1RIFA 3I4LA 2R44A 3ZQ6A 2ZS7A 2QQEA 3RRNA 3MGCA 3DOFA 4GP6A 3FMFA 3LBIA 2IS1A 1GL7A 1KI7A 3SHFA 1P9NA 3BH0A 3A1VA 3VX3A 1XXHA 1LS1A 3K0CA 4NYJQ 1Z06A 4JYCA 1AQUA 4A6PA 3HU2A 4RFSA 4HAZA 1ZCBA 2REBA 4CDGA 2WJIA 1ZNZA 5FI1B 1DTSA 2QI9C 3KTAB 3NC1C 3W9YA 1HURA 3WYGA 1Z6AA 2PZEA 2H17A 5K8IA 3OIWA 4PFSA 1GNRA 2PL3A 2O5VA 4BRUA 2NO9A 2YWEA 1II0A 1R2QA 1XTRA 4US1R 5EXXA 4FINA 4CEJA 4GP7A 2WWGA 4H9GA 4RSGA 2Z6VA 2VHUA 3QKTA 4OKSA 4U7DA 4AC9A 1CRQA 4JLDA 2YOGA 3DL0A 2G1JA 5FOTA 2LWIA 3GD7A 5FUVA 2KJQA 1P2TA 2OCYC 1I2DA 4XH9B 3TR5A 1KMQA 2IWHA 2WSMA 5HE8A 1ZM9A 4OQMA 4TT3A 1I4DD 3PENA 1CBUA 4YMWA 1X86B 2ZI4A 4EQ6A 2V6JA 2J7PA 2BBTA 2ZTSA 4B2PA 4JSTA 3ZZTA 3MMPA 1U0JA 4ZIRB 2V1XA 2L0XA 4RZ3A 3MSXA 1NG9A 4IFBA 4B76A 3V4FA 3I8SA 2WSSA 3AEZA 4B44A 1HT1E 2P5TB 3HPQA 1E2GA 1AA9A 3FKQA 2MMGA 1DO0A 3W6OA 2O0JA 4N1AA 4QRHA 4HZUB 4MGZR 1XEFA 3NDBB 1S4QA 2BHRA 4BFTA 2FH5B 3OFNA 4AY2A 2ZI9A 1DAMA 3N2EA 3QPUA 5KTYA 1IJFA 3C8UA 3NBYC 4V0OA 1B0UA 3P4YA 4O2RA 4R7ZA 3MLEA 1T91A 2NZ8A 3CBQA 3GJ8A 2AX4A 4IRUB 1E0AA 3IKJA 3FMOB 4D4MA 1KI9A 4TMZA 3AGPA 4V02A 2ZITA 4KV9A 1CR2A 2DWOA 2HF8A 2ZXUA 4HB2A 2IWRA 3M4YA 3BK7A 4DLUA 1AS0A 2GETA 5BN3A 4Q4JB 3OIUA 1KDRA 2ZE6A 4C0JA 1KSHA 1W0JA 3RRYA 2CL0X 4I1OA 1VIYA 5LD2B 4FD2A 1WCV1 3GLGB 3AVVA 5F2EA 1N6RA 1CIPA 3CRQA 1E0JA 3BH7A 3WYAA 5JCPA 1NLZA 1Z6XA 1MRSA 2QRNA 1W2HA 2GESA 2VSXA 3EX7C 2ZRGA 4OJKA 1YR9A 3IHWA 1G5TA 1KSFX 3THYA 1AS3A 3CX7A 3QOFA 1Z2CA 4ZKEA 1KJYA 1SXJC 1E32A 3PV0A 2EQBA 4LYFA 2OZEA 3WRXC 3AB3A 1UPTA 1C4OA 5DE3A 1R5NA 5FH9A 2O8DB 4YMSA 3ZIAD 1A4RA 2FV8A 2HT6A 1Z5ZA 4ERNA 3T34A 3QQ5A 4OK3A 5KYKA 4B6EA 5CJ2A 3RRZA 2F3RA 2J1LA 3ZH9B 2O8EA 1NSTA 5G3ZA 2ZU6A 3CZPA 2ZYUX 5DYIA 1II8A 1MO4A 3TVDA 3WHKA 5B2ZA 4G3XA 3IGFA 4MGKR 3X1ZA 2FOLA 2JATA 3BGWA 4JLKA 4MYCA 4B73A 4Z8YA 4DUGD 3AUYA 3SQXA 2V7QD 2DFLA 5JEDA 1EGAA 5KPJA 3Q7PA 1D6JA 4S35A 2QZ4A 4DBLC 3AVUA 1PV4A 3KQHA 5L3SB 2RGAA 1U81A 1QG4A 4YDSA 4QBGB 2QRZA 2ZRKA 1YZKA 2OG2A 2QY9A 3DKPA 2XXAA 3UXMA 4D26A 4A8JC 1CR1A 2IYXA 5BYJA 1GUAA 2BJVA 4F4CA 2OCBA 2FA9A 2ZJ2A 1FMLA 3FYHA 1SHKA 3UANA 3PEWA 4EFNA 4KYUA 1B23P 1OF1A 3TMKA 1OIXA 1Q1BA 1Z0DA 4B6FA 1A2KC 2RHMA 2AXPA 3R9WA 4M2LA 1XPRA 2IC5A 3NKVA 4D4LA 2Q9AA 1JPJA 4KLZA 3RS7A 2OUKA 4DEYA 2KSQA 2ZJAA 3VQTA 4QBIA 4KYIB 3NHAA 1OV4A 4LYAA 3H84A 3FGNA 2DR3A 4L4UA 3W3ZB 5CIQA 1VHLA 3LBHA 3GLHB 1TF2A 2KI5A 3H4MA 3B1XA 1US8A 1TEXA 1SVIA 2FMXA 2ONJA 1K8RA 3M0EA 1YZTA 4GDFA 2ZI6A 1DO2A 2ORWA 4A0GA 2ZR7A 2ZS8A 4FCVA 4DSOA 4L9WA 1KAGA 3TSOA 4IDOA 1G64A 4DZZA 1T6NA 3Q72A 4KBFA 4TWZA 3I1FA 5EP2A 2YWHA 3ASYA 1S1MA 3I5YA 2XNDD 5KPDA 4XJXA 3TW4A 1MR3F 621PA 4JLNA 5DYGA 4S2EA 1AKEA 4E09A 3HJNA 2IYRA 2AXNA 2GEVA 3NG1A 3L0SA 3EPKA 1L8QA 4JKYA 3ASZA 1JAIA 5L3QB 1GWNA 1Z47A 4XTCS 3ADCA 1E98A 2FE4A 4ACAA 1XZQA 3U60B 5CB8A 2FZ4A 4M1SA 1ZM7A 4G01B 2QQ0A 3R7WB 1CXZA 3KJHA 4A4DA 4JT2A 4JKIA 3GJ6A 4C3ZA 3M6AA 2JCSA 1TNDA 1OFTA 4CW7A 4NTZA 1JQJC 2Q6TA 3IIMA 5CK4A 1AS2A 1F2TB 1TU3A 2IEZA 2QORA 4TLCA 3QF4B 4IEIA 1XCGB 3A8TA 1OXXK 3WRYC 4B34A 2QMHA 4CEIA 3JVVA 3ZVNA 1IHUA 2D7CA 2GVZC 4Q9IA 3EWSA 3CNLA 4D81A 1KSJA 1EWQA 1E2JA 2MSCB 2MSEB 1RE0A 2CCKA 4NYMQ 2JDID 1ZIOA 3V00A 1LS6A 3RS5A 4IOKA 1TX4B 4MA4A 4TTRA 4KAXA 3AKEA 2ANBA 2XOKD 2IYUA 4NPHA 1KZ7B 3W6NA 3VFDA 3QPVA 4Q4AA 3ZIAA 4B33A 3CUEF 1Q57A 2ZVQX 2OESA 5G41A 2OO7A 1DELA 4US2R 3V4RA 1XTJA 1UEJA 4TMTA 3SU8A 5CITA 2ZSDA 2N42A 2W6JD 2HLDD 3K0FB 3OIVA 5GADl 1Q12A 1JBKA 4P4SA 2F9LA 3N70A 2V55B
chains in the Genus database with same CATH superfamily
5HRCA 5KNLA 3C0KA 3I58A 4P5DA 3G5UA 1BYUA 1UXIA 2HSJA 3KTAA 2EFJA 4QGSA 1Y6QA 5HKAA 1OUMA 4NYJR 3NNNA 4NSNA 1OI3A 3KDAA 4FMDB 4ODIA 3B52X 1RKXA 1DCFA 1JPVA 3H1FA 1L5OA 4ZT7A 1CDZA 4JK3A 3JQGB 5LBIA 3RVSA 1TA9A 1E96A 1VYVA 3VZRA 3X2EA 2O8CB 3CZ5A 3OF5A 2J45A 1WUYA 1BMFD 2B5WA 1CRZA 3D6AA 1FXWF 1A9QA 3DW3X 5FLXA 3ZEIA 2OK8A 2X42A 4A73A 1SIUA 5K0ZA 3COJA 1I5RA 3VVCA 3RKSA 3DLPX 5GOTA 2GYYA 4AO6A 1GTL1 5AVTA 4MDYA 3IEIA 5JCJD 4YI5A 1JLMA 2GN2A 2X40A 5LZ9A 4K9QA 1AQLA 1QIFA 4BNYA 5CA1F 5KC8A 1LA2A 1ODFA 2PUTA 3PC3A 1UC4B 1B43A 3IKTA 1YB7A 2RHDA 3SQDA 3N8NA 1JYEA 2X8AA 3CEMA 3MMXA 3BIXA 5IC6A 4PCVA 1O0BA 1GTSA 1LJ8A 1XHFA 1Z75A 1CQJA 1E1KA 1GFIA 2JIQA 4PGGA 4ZIRA 4K9OA 3OZGA 4RFVA 3OZ7A 4ML3A 2WFLB 3DCJA 3R0ZA 1Y80A 2V03A 5HZHA 4PEVA 4F4HA 3FPCA 1Y6GA 1SBCA 4XQGA 3HE3A 5IASA 1M8JA 5KO2A 4ROTA 1SULA 2ZULA 3FHJA 3DG9A 3M6XA 2HDWA 3FUWA 3MJSA 3RU3A 3ZDFA 1E79A 4EJMA 2DQ4A 3ICEA 5AHKA 3ZGYA 5AUPB 1TO2E 3FYSA 3BGSA 2VSOA 1VKHA 4NZZA 4U9IS 4QSHA 5AW2A 3VI3B 2H4ZA 1G21B 3HCDA 1KS2A 4WEOA 1XKLA 1X7ZA 3IUYA 1DLIA 1X3SA 1DTWB 1LEHA 3WQSB 1ZITA 821PA 3T06B 2AC7A 3H2SA 3PXXA 3QFFA 2NU8B 1C7EA 4K9RA 3ZLTA 1W1UA 2BGWA 1E89A 3GEEA 2CNOA 4IHQA 3W7BA 5IN4A 4C4PA 1ESCA 5AW7A 4KQEA 3F7MA 4M1KA 1JDNA 2R6HA 2IHJA 1TU0A 1VYHA 1I13A 2OHHA 2QR5A 1WDMA 3KKLA 3PC2A 3R8XA 3PC4A 1Z3CA 1OWMA 3GFGA 4QX6A 3S0JA 4BV8A 4EEXA 4JI8B 4H7DA 5B3JC 2VC2B 3WLAA 3KQKA 5DBHX 3LGSA 4ZOEA 5H81A 4ZU6X 3SJZA 1H6AA 3AL2A 4DA8A 4Q9JA 5FDFA 2Y1OA 4YJHA 1NUQA 3A26A 4X1IB 4AD8A 5HOQA 3VUEA 4CLOA 3F2IA 2JVKA 5HHTA 4O59O 4AKHA 1YR1A 1IDN1 2CMFA 1V2HE 2Q9BA 5TDHA 3X43A 3R3SA 3TZEA 1V5EA 3KT6A 3CSSA 4GUDA 5J4HA 1E9AA 2P65A 2WTBA 1G59A 4JP1A 3QLEA 2EFYA 3UMRA 3QVUA 4NKRA 3UXHA 2AL7A 2PD4A 3GW8A 4GBGA 4MLZA 3R5HA 3U62A 4PNEA 5JXGA 2QUAA 1P3Y1 4MINA 4MIYA 4G5YA 5ETJA 4BECA 4F38A 5JC1A 1UADA 4H6PA 1OH7A 2ASEA 2Q0SA 3KAJA 4INJA 3HWRA 1U3TA 1HQCA 2FPPA 2NZUG 2FZWA 1U0RA 3KSMA 3KUUA 4ZJPA 1AKVA 2AK3A 2JHAA 3JVIA 3Q15C 3QHPA 4FU0A 1HTWA 4D46A 1SH7A 3AGQA 1GT91 2P8JA 2JAOA 2JDIA 2PQ2A 3ELUA 3IQFA 4U9UA 2GILA 2B1RA 1D2MA 2YQ5A 2WTNA 4Q9DA 5MFZA 1ZC4A 3LUJA 2PEYA 2CHUA 2UVQA 3PFKA 2IS2A 1FVOA 1F9AA 4FNOA 3RUHA 2IPNA 3D5EA 3PDUA 2F90A 1PBNA 2IODA 2HXYA 4M36A 3UV6A 3RT1A 3KCNA 3O4FA 4PX3A 4DIDA 5BWNA 1L5LA 5HM6A 4GI7A 1LDEA 1P9LA 2JA1A 3TNDA 5BSHA 4YJGB 4B43A 4G4GA 1C4WA 2NG1A 2JLSA 3SF0A 2EW2A 3VNBA 2Q2QA 3LRPA 1MJGM 2Q1WA 2W6JA 2FF5A 4DMMA 2QAJA 1VKOA 5GAJA 1FK8A 4V1CB 5EZ5A 2NNWB 4AB1A 3DXXA 2AUTA 2VAPA 1H1TA 4MQBA 3E81A 3H1TA 4GX2A 1ISSA 4QVKA 3TZKA 4JXXA 3BYZA 4RK7A 3I4FA 3QUBA 1IC6A 1WF3A 3IAHA 1FOEB 4LWOA 4XASA 5AOCA 5IBCA 1H5NA 5HWSA 3WB9A 4F5DA 4ZHQA 5JSFA 1PQYA 3U1BA 2V3CC 3ESCA 3OLQA 1U6IA 1T2FA 5I45A 5C4MA 3PG5A 5C2JB 2REOA 3RH0A 1IY2A 1JR3D 1X38A 1N7HA 3ZU5A 5SYAA 1U4NA 3BJMA 3MTEA 2I8LA 3KWLA 2HPVA 1GU7A 1XK6A 3ZGOA 1X1RA 1FNDA 1C1XB 3GLHA 3KE8A 4E08A 1VL0A 3TB4A 5IVDA 3SXPA 1ZBQA 3QGMA 4M0EA 4X3PA 2Z6UA 5ED4A 5A9SA 5JZ9A 4HEA1 1NE2A 2PSDA 2JL1A 3A7EA 2CF5A 1E62A 3KOZA 2FY8A 1YE5A 2XTMA 3ZDRA 1QDLB 4CG3A 1GZDA 4GYJA 5F12A 2VUIB 3SWWA 1KAMA 2FMFA 2L69A 2ZJ5A 3RVJA 2RAPA 2RKOA 4ZO8A 4MUBA 1M1YB 5K6AC 4MGIR 4F6CA 2IYYA 2ZRCA 3GCGA 2Q7DA 2JAXA 3T7IA 3WLQA 4QDXA 5E38A 2DCUA 3ZX4A 4XDGA 1IE3A 5JJKA 4QFMA 5H82A 1PS0A 2J9FB 3GEGA 1QFXA 4G2TA 4L7QA 4N5NA 2XJ4A 4P08A 3PNLA 1YTLA 3AWIA 4RHYA 5CG1A 4NBNA 3ST7A 3NJ8A 5IHXA 2CFOA 5DRTA 3T3PB 1XV5A 5JYCA 3R2JA 2OAQ1 3A6GA 3C8DA 1JLSA 1IB0A 4IFIA 1L5GB 4C3OB 1CUUA 3EXHB 4AZ0B 4CM8A 2B20A 3KJFA 4CU2A 1T4MA 3OQVA 1TDJA 4E5UA 2IYPA 1YKSA 4ZRMA 4YFVA 1Q0PA 4ZCPA 1V47A 5SY4A 3W79A 4RF4A 5FXMA 2DERA 2CKMA 4NZOA 5AJZA 1LLCA 2H5LA 1KARA 2VTKA 1U5BB 2LP4Y 3ODGA 2OD9A 1HMPA 4QXAA 4YONB 5IUKC 3MN1A 1KY4A 4AKGA 1CW2B 1DB3A 5DGXA 5EA2A 1MU0A 2GLUA 1W5FA 1P7CA 2HLPA 2ZUDA 4IHJA 4XJSA 1Z0ZA 4BB9A 1N34B 3VDRA 4FGKA 4M9RA 2BEKA 2VUHB 4QAQA 5H9VA 1VIVA 3C3YA 2E4AA 5E3JA 3NYWA 5B3AA 1J0CA 5FFFA 1XAHA 1JFFB 3NKFA 3R3HA 4BQEA 1LDGA 3O2NA 2INGX 3EMBA 3PQEA 1TZBA 1P7WA 1B6TA 3MILA 3EULA 2FEOA 3ABQB 1C7QA 3EN0A 2HWYA 3DZDA 3WGVA 2XPCA 3NAZA 4AQ7A 2V5AA 3LT2A 4DMHA 3D7RA 1G2PA 1HDGO 1H66A 2CD7A 5FWYB 1FYVA 1NAIA 1PQ4A 2XBUA 4LY3A 4S1PA 5GMOA 2HU2A 1QPBA 1XN1A 1V41E 1ZNXA 2YVKA 2CNBA 2H4XA 3IRVA 3O4RA 2GPBA 3JD0A 4H7EA 1JQBA 3UGQA 2RB5A 4CLXA 5JASA 3B9RA 4MMXB 2DH6A 1J42A 3B1KA 3DT6A 3DYIA 5L7YA 3TWOA 2E89A 3ZQUA 3V6MA 1C2TA 5DZSA 1QRUA 1USUA 2GRJA 3V33A 1AN9A 3JZAA 2XGOA 3SDSA 1JN0A 4E33A 1G63A 3E2PA 3KSRA 3Q2IA 2WWYA 2H6EA 3DOCA 1GLNA 1Z6TA 5FPKA 3HDHA 4LA4A 4MUFA 2BR3A 1FJGB 3W2IA 2PXXA 3AV0B 3MGGA 5DNAA 2VH5R 2YZNA 1XOIA 1J2UA 1S5PA 3CUWA 4EKIA 2R6DA 4IGEA 2FSVA 5ARCA 3G9ZA 1NW5A 3I2HA 3AEYA 4Z4QA 1N8SA 1R6TA 1VA4A 2Q50A 3TDNA 3AONB 5A04A 2Z95A 2IKQA 4TROA 3SFZA 2NVOA 3ODPA 4D6PA 4M9QA 1YJ5A 3AVOA 3WAJA 3QG5A 4TRJA 2PMKA 4H6VA 1O89A 2JHPA 2WMOB 3I3SR 1AU9A 4UXHA 4BASA 4E2XA 4Q9LA 4G65A 3ZWYA 1QTQA 3IP9A 2I34A 3RREA 2I8AA 3HMQA 1PVVA 2IYNA 1H6BA 3U3MA 5DI3B 4Y1FA 4MRMA 4JIGA 3OICA 4J0QA 4RVUA 4XPIB 1ISMA 1C9NA 1YXMA 7ADHA 1FQWA 1Y42X 2Z43A 4O2BF 3UAGA 3M83A 2IP2A 4BWGA 1T9GS 1FUKA 1KU6A 3ISVA 3ZZUA 2PUFA 2RC6A 4XA8A 3JD4A 3GIDA 4ZAYA 2G4LA 3ANSA 5E6SA 3S3TA 3D3WA 3BD6A 4X91A 2FZVA 1HI9A 2R6GA 4LBZA 3SHQA 3ZDBA 4DMFA 2HNAA 1EXMA 5BRAA 4FB4A 13PKA 2PV0A 2GH1A 5ALMA 1RBYA 1Q6YA 3DWEX 1W35A 1OBFO 3A3OA 1COWD 2J3MA 4URYR 4YBRA 2FJUA 1OT3A 1X7YB 1UEIA 1C30A 4C7OB 1Q74A 2J3HA 4LXUA 2C78A 5BQPA 5AD1A 2RG7A 1V6AA 3DM9B 1ONOA 5EPEA 1KVUA 3F2VA 4ARSA 1W6UA 4E5NA 4MDEA 2XIJA 1NLYA 2J4FA 2AIRA 1K75A 2HHLA 2J48A 3MWDA 4KE8A 3P2KA 4OJQA 2J0VA 1XRPA 2CLMB 1N92A 1EJ0A 5JJIA 1ORVA 1F6WA 1U98A 1AN0A 4FLEA 3AKCA 4K3VA 1FP6A 1KU0A 1IXSB 1P9RA 2NPIA 1U99A 2BZSA 4HGZA 4R69A 2RD2A 3GEHA 3IELA 3F4BA 1RLJA 4L85A 3MG9A 4XVCA 3L2OB 3VRHA 1ZOSA 1XVIA 4HTFA 2GQ0A 4KNWA 4LBWA 3U1VA 3W9SA 3HKBA 4RY0A 5C81A 3IR7A 3IVCA 2O2YA 1ISIA 3QMMA 5CLGA 4DDWA 2D74A 1ACLA 2PAFA 1NXTA 3ECAA 2A9OA 3KKMA 4R8MA 4NAVA 5HIJA 4C05A 5KS2A 4OHYA 4REOA 3ZOZA 2UZ1A 3VSEA 2WWXA 1XAIA 4J0GA 3ZU3A 3DMRA 2JGDB 4TL9A 4GMHA 3EASA 3D6MA 4YT2A 4BJ1A 5CFQA 5JCZA 4A0QA 4I7EA 4EITA 1HEIA 4UAJA 4ZCLA 1OW3B 2IEAA 3MD9A 1B41A 1N6NA 3EJWA 1WDLA 1AE1A 4PLYA 3KALA 2AV6A 3D64A 2BLNA 4NCAA 1WZEA 3H8SA 1TD9A 1UC9A 4TWAA 1EVKA 3G2HA 1N2ZA 4XCQA 4L0DA 2OZPA 3C41J 3GDHA 4RKFA 1A71A 1PEYA 4FGWA 4BGIA 2RK3A 3GJ0A 3M82A 1NR5A 1EBUA 3LPDA 3R24A 3TZBA 1SWVA 5G1OA 3FTCA 1AIPA 2AOTA 2I6QA 2O8NA 2RHOA 4EA8A 4B09A 1IBKB 4GICA 5F2OA 2WSYB 1N2JA 1N7IA 2MDTA 2HXSA 2PT7A 4B84A 1U0BB 3LBYA 4FOLA 4BYGA 1C8VB 1VPTA 3W2TA 4KRYA 4LC1A 3I62A 1LDMA 4PBSA 2RMKA 4WZAE 2O7SA 1SCIA 2ZI3A 2WOOA 1L4MA 3LYUA 4J1TA 3OSUA 4QU8A 3ZHSA 2QM8A 2H2FA 4RE5A 4QARA 4XX0B 2HHJA 1TZ2A 1WVIA 3I0ZA 4WN3A 5NULA 2HPHA 1T5OA 2EGUA 3E2MA 3FYUB 3ZZ0A 4FN4A 3PE3A 3QX9A 3FYUC 2OAP1 4QOJA 2V5UA 4X63A 2AJDA 1Y5NA 1W29A 4QM7A 3ZJUA 2ECFA 3CJTA 2O06A 3PFCA 1DX6A 1NRXA 4HWTA 4UE2A 1PYGA 5AVOA 4XWYA 5LOVF 3GG9A 4LBYA 4QTTB 1NVXQ 3SQMA 1AC5A 3N2LA 4R1SA 1R8XA 1CUYA 2A1IA 2O0MA 1VJ0A 4KVAA 3S2UA 3TEJA 3W90A 4BKUA 4BXOB 3KVVA 4FFBA 4R6XA 3EHDA 4R2IA 1E1CA 4MCHA 4TSFD 5JXIA 3KK0A 3LGXA 3BAFA 4U7TB 1WKCA 3RFVA 3DVLA 3JYLA 3ZE8A 1KIFA 1E18A 5IU6A 3ICVA 3E18A 3HVRA 2DPMA 2RHLA 1SCDA 5KVVA 1C3VA 1ZMRA 2VDMB 1NTRA 4QT4A 4TRRA 1DJLA 1RJWA 2VXOA 3BMNB 3T7SA 1GUYA 5CA1B 4DIEA 1R4AA 3ABRB 1WTAA 1XA0A 3VYWA 1AURA 3GCDA 5F78A 5B58C 1U4SA 2W11A 3K1TA 4INOA 1HYHA 1CUBA 4OU5A 4CCAA 1FFHA 3CN7A 4L57A 2NSLA 1VBMA 5I6DA 2DY0A 2YYSA 2XQIA 5F7JA 2A5FA 1FTWA 2Q1YA 3DR5A 1VG1A 4R9VA 3ACDA 1BU8A 3IPLA 5DBGA 3L8EA 3WAKA 1OWNA 2NZJA 1JP7A 4QYIA 5KYVA 1NL3A 2BJWA 2FW0A 4NX2A 2DBYA 5H3HA 3QFHA 2ZZNA 3WLTA 2IYOA 2PMBA 5CIWA 1LLFA 2JEZA 2F8LA 3B1YA 4CF3A 4U1RA 4ZCIA 5HTOA 2C5FA 1WP9A 1P6QA 4LK2A 5AJVB 4HPWA 5TPWA 5BVGB 1OAOC 1XJWA 3BERA 4HY3A 4KYTA 2BMEA 2HADA 2ECOA 2IV7A 3BXXA 1CR6A 3O8OB 5CTJA 3TLXA 4DIKA 4Y0VA 3FB4A 1VJ1A 3TTTA 3HJCA 4B3TB 3FTQA 1OFUX 3UAVA 2ZE5A 5HGJA 1WXDA 2HV9A 1P2FA 3RVOA 1TAHA 2PHZA 3O2JA 2I22A 5IJ0A 4V2UA 4QDOA 4PLWA 4W63A 4FOOA 2WT8A 1RPTA 4XCVA 5KSOA 2WD9A 2GO7A 1G8GA 2CLLB 5FOVA 1VL2A 1BMQA 2J4DA 2H1FA 1EH5A 1OILA 2BEWA 2GZHA 2VN8A 2WKWA 1UBJS 2GX6A 2X5XA 2ZJ0A 3AHDA 3H05A 3HN7A 5K3AA 4D8XA 2IX3A 4H4EA 4R81A 1K0UA 5IRCD 3TK1A 2FG6C 2BMJA 2H11A 3PA6A 4UCWA 5J9FA 3ZCRA 4BNDB 1OZHA 3AL0C 3NIGB 3TTWA 1VSTA 3FWNA 4PIVA 1HOTA 2SKDA 4CG1A 2COKA 2GJAA 1EA5A 4R3NA 1ZWLA 4DABA 2ZANA 4LRTB 4P35A 1FZTA 4MGHA 4DDVA 1PK9A 3KYCB 2Q8PA 4RAQA 2GXAA 3PXUA 5HK8A 3N5KA 4G5GA 2Q5LA 1V8OA 4I19A 1NBMA 3UT5A 2BBSA 4NU5A 3TSZA 1Y4DE 4QLAA 2QMYA 4XLZA 2G70A 1YDHA 3EQ2A 1XDSA 4ZU3A 2C5LA 5I9NA 2HO4A 4WKBA 5ILOA 3EPJA 1G20A 2BEJA 2QN2A 2P1ZA 5AI6A 4O8ZA 1NBIA 1ZZEA 1IY9A 1L7PA 5E2IA 3JARB 3LCVB 1JKJB 1Z17A 3LFUA 3KR9A 1NW8A 2W2QA 2XGGA 4OQZA 1XTSA 2VCYA 3B12A 3LX4A 4C5CA 2IS4A 1P2BA 1T9KA 4B6PA 4Q3KA 5FBZA 2EGHA 4HRVA 5DCUA 4JELA 1YO6A 3TXXA 2CLEB 4GYKA 2UVPB 2XF8A 4IXNA 4QWWA 5DNWA 4EZEA 1H4VB 2XA2A 2YXPX 5JH7B 4J3NA 1FDVA 1YK0A 2QVCA 3W5VA 1YK1A 2QI9F 3DF9A 2O2XA 5TV2A 4BPBA 3B6JA 4PYIA 1PZFA 1P0FA 1K1EA 1NYQA 2D4HA 5FRDA 4Q3CA 2UYYA 4BKPA 1KO4A 2OA0A 5TQ0B 4C29A 5CFLA 5KCMA 1TIBA 1U0FA 1F2UB 2NV2B 2WHXA 3K9BA 3S7TA 1GUBA 2JFXA 1UZLA 3RUFA 3ZD9A 2H9IA 5D5HA 3GBVA 4H17A 4YN3A 3NMUF 1E94E 2XZTA 3ZTYA 1CJCA 1YNSA 2R6FA 3ROZA 4LYYA 4YP7A 1BCSB 1G9TA 3GEDA 4G1CA 1E1QD 2P9QA 5B53A 2GN9A 2ZBPA 3GRAA 5FR2A 3UHJA 1YNOA 2PRKA 3HUUA 5K0FA 1NOIA 3T3EA 4BIMA 2Q2NA 4ZK6A 1CVIA 2GJ4A 1MC1A 1QAOA 2ZBQA 1UT8A 2ZCVA 3ESZA 4ZAFA 2WLTA 3IUQA 2H57A 4K6KA 4A8PA 2EFHB 2C95A 3KXPA 1N6KA 2Q3HA 3MWJA 4UNNA 4F8YA 3P9PA 4OLFA 3N9IA 3E1GA 5AH0A 4PVCA 2YX1A 3RVPA 2QOEA 3SK0A 2AEMA 1IBRA 3ZVMA 2QYTA 2B69A 2JIBA 4ZAWA 5AFSA 1MQ9A 1EAMA 2YXDA 4UUQA 2XD4A 3RS8A 1CDEA 1OLXA 4D9HA 2OG1A 4CLHA 4NBRA 2O19A 3IT2A 3IE2A 4QGFA 1HF3A 1KY2A 1SOWA 5EMLA 1PKEA 4KZKA 3GGSA 4ZI7F 4QD3A 1GN9A 3IVXA 2P2ZA 2FLWA 5EUCA 3WNZA 3BM5A 3E7WA 3CX8A 3LVBA 3RAGA 4BNGA 4WY5A 2CBGA 1YHZA 3R44A 4JJEA 3ZTTA 5FD8A 4JC0A 4U63A 2IYLD 2XT9A 1AO0A 3BE4A 4YGYA 2QN6A 5FOSA 3RDPA 4OI0A 5JE8A 1CEXA 2PS0A 1WXIA 2DQZA 2YDYA 4OHWA 1CSEE 2OBMA 3L8FA 1GGVA 3JPYA 1ITZA 2A88A 2XUOA 3O4GA 3OX1A 1YBAA 1EUDA 4UNSA 1TJYA 4Y2VA 3ZNPA 4RW0A 1G6KA 3GVPA 2IBMA 3GVIA 3KS9A 2BPOA 3OF2A 3HLKA 2NTVA 1EDZA 2JZOA 4ZZ2A 5KTOA 1ZI6A 1EP9A 1CCWA 4UUBA 3N8KA 3PFNA 3STWA 3U7HB 2N46A 2GEKA 2ISSD 4QJIA 3PGVA 4G6ZA 3TLBA 2V7UA 3PHJA 4P53A 3D8UA 2BZGA 1N2HA 3IMEA 3MAGA 4OX9Y 3BHMA 4EFKA 1I7PA 3DF7A 1TYEB 4Z1OA 2ZOSA 4MJ7A 4HAYA 3TKAA 4KHPB 4KUEA 1J0AA 2QLMA 2ZUVA 1AKQA 4DY6A 2OWDA 2DWPA 2XUIA 5EJIA 5K0BA 3MTBA 5BRJA 4BVGA 4V0RA 1PZXA 4C4YA 2CL6X 5IDQA 4AZVA 5IAEA 4J8PA 4JVMA 3W3AA 4ZVOA 1AGXA 1AZTA 4BX3A 2HGZA 1GQRA 2VPWA 5K8UA 4LFAB 2FK8A 1TE2A 2JFHA 3A6JA 5K4GA 2H18A 3NS7A 1NSFA 4AURA 2JLVA 4GI5A 4ISBA 5FHQA 2EFCB 1XZCA 3BIWA 3FXAA 2EP5A 3RF7A 5AVYA 1QTRA 1XROA 1EZ4A 3BDIA 4Q3NA 4E5VA 5JYDA 3TW8B 4IIBA 2VZLA 4AJOA 1CJMA 1Y3CE 1K86A 2OB1A 3DMTC 4XR9A 3WGKA 5ITZA 5B1YA 2FW1A 3IMKA 5K6TA 5EY5B 3HC7A 1RC8A 1KF0A 1XVVA 2FUEA 1EFPA 2IXGA 4KIFA 2IY7A 4W7HA 1A2OA 1QFSA 4A9AA 4Q00A 4I3HA 1H9BA 2PGLA 4MDFA 2YHUA 1IHOA 1AZSC 1QO9A 3KOXA 1UFKA 1G41A 1N6IA 2B1GA 2XNDA 2FFBA 1GSAA 1PV2A 1RJ9A 1E3JA 2BFOA 3ENVA 3IDZA 2ATXA 3QVWA 4LMPA 2Y68A 4P4TA 5C8YA 5KJFA 3J7TA 3NHPA 4QHYA 3NUQA 1Q7GA 3LUBA 4IJUA 4LHSA 1N25A 1T1SA 2C1ZA 4U2CA 5EP4A 3ZWBA 4D9KA 2C5SA 2H08A 2D5BA 4C2UA 1FYFA 3LQ4A 1Y33E 1IOVA 3SY8A 4FFOA 5BYKA 1XDBA 2OXCA 2QVBA 4ARBA 1YA6A 3OQ1A 1AH2A 4OXXA 1YBHA 1VJTA 5KU7A 1O9BA 2CHGA 3GN1A 4TXHA 3I9V6 3IAM1 3DC7A 4EB8A 2Z5VA 3FWPA 5IXSA 1GGKA 3V8VA 4EUSA 4XVRA 4QO7A 1MQ8B 3UBMA 1HLGA 1Z82A 2BR5A 2DH5A 2VF8A 3OKPA 3TBFA 1XD2A 4ASUD 5KREA 3PDIA 521PA 1UAAA 3EG9A 4DRYA 4UUOA 1XZBA 2ORIA 1ZHHA 1ZIPA 3WZ2A 4ZHSA 2V9CA 5H8WA 3R7LA 2WVGA 1GZVA 2DLDA 2XTNA 3K94A 1J2JA 1NUUA 1U2TA 3F96A 4KR6A 4PM4A 1VYTA 3H5WA 4W5JA 5B1EA 1HLDA 3JZFA 1PWEA 2E6UX 2FWMX 4RPGA 4AU1A 2JZNA 2F00A 4MH0R 3FPGA 4DV5B 3HRKA 3LZ6A 2R8OA 4LZZA 3RAPR 3PBKA 3BHJA 3AJ9A 4IDFA 4XXHA 1DKUA 1RWOA 2XNHA 3GG2A 2XWQA 3AY7A 4W1PA 4AYWA 3CVWA 4KO2S 1NJ2A 3DTVA 3GFRA 3MPOA 2G1PA 2EZ4A 2PUEA 1E6LA 1SO8A 1QHHB 3TRKA 2WUDA 5DOVA 2D2IA 4WOPA 1UMCB 2XOKA 2FPUA 3OC6A 4NCHA 5E7MA 1L7EA 3K6SB 4LVNA 4CUJA 1EFUA 1GDDA 3P0EA 4BNXA 2H63A 2ZJOA 2ZE7A 1BHSA 3H42B 4LXGA 2I1VB 1QM5A 2VHZA 4PHGA 2R8BA 1IN4A 4YMIA 5DGDA 4JENA 4F9FA 1NY6A 5MN6A 1YWGO 1LC0A 2I6TA 2FPOA 2VXYA 3EW9A 4X8OA 3W6ZA 4CCSA 2C96A 4J6EA 3IJRA 3F5DA 1PZEA 3O1JC 1G5RA 1SKYB 3GLIA 3SOPA 3ET5A 4IMPA 3HU1A 5ABPA 3OZXA 1MHTA 1PUIA 3WXBA 3KHUA 2I66A 3ZZNA 1ZMOA 2C7RA 4XYGA 1D09A 3L7LA 1OXUA 1TJPB 1DG3A 4RUKA 1VTKA 3TGWA 3V80A 4JMLA 2HRBA 4G26A 7YASA 1GRNA 3N75A 5FUMA 1WX1A 2ODTX 2QTBA 4D2IA 4GU5A 1E4YA 1CNMA 2GHRA 2ZYGA 3MT9A 4OK5A 3OP4A 1MO3A 3RRBA 3UG6A 3UFBA 3LLMA 2AR9A 3OM0A 4EYQA 2DXIA 2ZVJA 4P82A 4G0WA 5DB4A 3PJGA 2ILTA 2KWIA 3CR8A 4XWWA 4MW2A 1U8YA 1SBQA 1RQXA 3P9SA 4C0WA 2GT1A 3HV0A 4RTPA 1A98A 1AMUA 2WW8A 2P0EA 2P1RA 2DPHA 1OXVA 4OI1A 4LXXA 3IULA 3LUKA 3LF1A 5BQXA 5C5IA 9GPBA 3KKQA 1L8OA 4MLPA 3A9VA 4DG8A 2JK0A 4LK3A 3A31A 2W7TA 1VLQA 1GVNB 3QPCA 4HDNA 1E0KA 1UFOA 5LP6C 1PR1A 2ZEJA 1KVTA 3HY3A 4ZTBA 2J9YB 1QS0B 4OUKX 1X1AA 5A3SA 3WIUA 3HUTA 2RGCA 5JS2A 1S9DA 4P0QB 1P18A 2YY7A 1VA5A 4NCKA 4OQQA 3BXPA 1XEXB 4AY3A 5TNXA 1YFKA 3L0PA 3GFTA 5HTKA 4YVFA 6AT1A 2GEJA 3VYUB 4C4AA 2JBWA 2C2GA 3ITEA 4EYKA 2PT6A 4GBMA 4JI5B 1BVRA 4MV7A 4CEHB 4OHOA 1V43A 5IYZA 1SU6A 2JI7A 3N2IA 3W6UA 2WJZB 2C3MA 5GJVC 4RDXA 3CIFA 4B45A 1BTOA 3G68A 721PA 2VF5X 4MVWA 3OURA 1W49A 1WR8A 4FOPA 3G13A 2HH9A 2JJ1A 2NTNA 4ER0A 2OQ2A 2ZPUA 2CMKA 4DWOA 5FBRB 2I1QA 2Z2XA 4DZRA 3S5UA 1JJBA 4QOFA 3ICPA 1H3FA 1VSUA 4UMVA 2FF7A 2GUWA 3WQBA 5HQ3A 3BGDA 1SZJG 2PFSA 1K4MA 2C4HA 5GJBA 3CU5A 5ALSA 2VJMA 4HN9A 1S9HA 3LD9A 3AK4A 5TR9A 3ED5A 2UAGA 2G40A 4ND4A 1IHYA 3OQIB 3KE9A 4CMJA 1YQDA 4PC6A 1NVKA 3C6BA 1YAJA 2B6HA 2X6TA 1SKUA 1VLLA 3MCWA 2BFCA 3H1GA 4GHWA 2NUTB 4HVTA 3REGA 1QF7A 1UMDA 4PGMA 1QHSA 2F3TA 2LKCA 4WCDA 5IKXA 2VJOA 5HRAA 3J81A 2LPMA 3TOVA 3KJEA 4A10A 4DA6A 3K0EA 2QV7A 1G3UA 1G98A 2CGEA 2FRDC 3G2IA 4RESA 4JP2A 2GMWA 4MS1B 5TVKA 1JXAA 1YE8A 2DPXA 4M21A 4R1PA 2M1XA 3TNLA 3ZDDA 1FQJA 2E4WA 4LNAA 2MU1A 4JLOA 1Z3IX 1MVOA 5EERA 5BO5A 5AVRA 4O0LA 1NKTA 4Q24A 1WLSA 1P44A 2C84A 5KTNA 1E2HA 3A37A 5CDYA 2YH2A 3S1LA 5LIRA 3VPSA 1A72A 1KYTA 4JQOA 4CE6A 2BMVA 2HA6A 4GNKA 1UBCA 4JSRA 4Y9DA 4Q1CA 4D0NA 5TS3A 1A97A 1DEAA 2H4HA 3PTLA 3H9BA 1IAVA 1J6UA 2G0TA 3AERA 1JG2A 2X1VA 4EJSB 4QUGA 4EX7A 1GZ6A 3VU9B 4EJSC 3TBHA 5EAIA 4RYLA 4WZZA 4XAQA 3JW8A 3SMQA 2V6FA 3DLHA 1CUFA 1Q91A 1PJRA 2Z2JA 3PHCA 2FKAA 1XQVA 2XD9A 5CJPA 4DQDA 5DM4A 3PKZA 2VT6A 2ZUSA 3GCXA 5IUNC 2HHCA 2GAFA 2Z1DA 3WWDA 1WB6A 4F46A 3GCZA 4L16A 1JA1A 3ORYA 1U63A 2H4YA 1Z5VA 3KQTA 2NSHA 2WWIA 4HRXA 5TB5A 3HG7A 2XUHA 2A0UA 1KQ3A 1RMTA 3HBNA 2DPLA 3FHOA 3ML1A 4R8KA 3T9CA 1J22A 4P36A 5L8VA 3HB9A 5LZ7A 3KPJA 4ME6A 4NBSA 1PS9A 4QELA 2HO5A 1ZLXA 1K5DA 2YJNA 3LUHA 4AJIA 4XI9A 1ZU4A 2NADA 3C5EA 2C5BA 3RANA 3UIEA 4HC4A 2PQMA 4QPPA 3GRFA 2YOFA 1XSEA 3G1WA 4G4JA 1TVEA 3SSNA 3MT7A 4YT8A 1OLSB 5JMWA 2EYQA 3WYEA 1P1CA 3CNOA 3K96A 5JG7A 3LQKA 3SG0A 4P9NA 4QTYA 3CB4A 3MPUA 1DG1G 1M76A 2QZ9A 3JAWA 2QLFA 1XU4A 3PHLA 4GKAA 1JDUA 2IZOA 2RHWA 5TQ2A 4AJ4A 1FNMA 2PH7A 3EXG1 1AK9A 5LQMA 1NN1A 1U8XX 1WL8A 3FG9A 1GAEO 2EEZA 2Y1CA 3I0NA 3C8ZA 4PG7A 3LLSA 4HATA 2ZCJA 1ZS9A 3S1SA 2AHOA 1XLTC 2FPIB 1HA3A 4Q7EA 3IE0A 5KYXA 4BLRA 4ZEVA 3U80A 1PT9A 5ELMA 1DP4A 2YNMA 3LUAA 3BT7A 2PLRA 2X76A 2XZOA 2WJ4A 4YUVA 1RYHA 1W6RA 3ETDA 3RNLA 2GM4A 4PF1A 1WB9A 1DC6A 2O6LA 2V0NA 2I67A 2PYZA 3KCQA 3C70A 4GI3A 2KYRA 5LA6A 4K86A 3X1XA 4MSUA 4NCIA 5JI3E 5KQMA 2HHHB 4ZDWA 1CY7A 2IITA 4AY6A 4F7DA 4Y1RA 5AP9A 4F3NA 3SBOA 5IZ4A 3P9KA 1KRHA 2QV0A 4QOHA 2WAXA 5BV7A 1BWQA 3SIRA 3UPTA 1CY8A 5C4GB 1KJWA 2OHIA 2BBWA 4X41A 4BKRA 2FFHA 5IVPA 2PBFA 4IIJA 4IY1A 1DEKA 2JGAA 1T1IA 1E1DA 2ZSJA 2PKEA 5F2KA 1L5ZA 3ZDCA 2Y2VA 4AECA 3E5MA 1GA6A 2XDYA 3B82A 3BREA 4GZ6A 5DSZA 5KVQA 3DZCA 5DLYA 3USCS 3G79A 4CF6A 5TLSA 2WUGA 3D6VA 5DYWA 4KPUB 2H0RA 3A6EA 3SFVA 2EJWA 3P0RA 3QKRA 3KFXA 3SEZA 4GO1A 2P4SA 4QG3A 2QW0X 5DN6A 2FVXA 3ZY6A 4X00A 3S2YA 1ZVQA 1CU1A 2I9KA 2QEQA 2DQKA 2PRSA 4KPFC 1D4FA 2IVZA 4IIVA 3EAGA 4ON9A 4EJ6A 2QLTA 2BVNA 2RHJA 4JC4A 2QVLA 3FFBA 5ILGA 3CHYA 3WFJA 4YCSA 1BXZA 3HV2A 3WFZA 4A92A 3KLPX 1GSIA 1Z6PA 5KYNA 4U5XA 4CQMD 4CCYB 1X19A 1SHJA 1KTIA 4HX9A 1Z73A 3ZKWA 2PGAA 1H3EA 2GBPA 4B3DA 1JBQA 2B0JA 2F1OA 3A6FA 4DVGA 2Q27A 1B7GO 3R5KA 4KRXA 5B4VA 2P6RA 5J2UF 2NVUA 2VHQA 4CLRB 3B9QA 1OX5A 2PUHA 4PGFA 1X77A 5HMMA 3R74A 3IR5A 5DF1A 4YQEA 4BJ5A 1W4CA 3G1TA 1VE6A 3BRWA 1ZAYA 2I3AA 3ANYB 3C16C 4PY2A 5IANA 4YCNA 4KR0A 3IKVA 4RELA 3U81A 2WG1A 3R6TA 4GYYA 1GG5A 4JJ8A 3REFA 1CNFA 2PS9A 3KZ1E 2OWEA 3GLVA 4ITRC 4ZT5A 3SQOA 1G8MA 1XZGA 1P75A 4PRZA 2K7FA 1LSUA 3EF3A 4RK4A 4NV3A 3OCVA 3E22B 2ZETA 2OZLB 3EB9A 3N58A 4KLNA 3GHYA 1Y8ZA 5K0LA 3B9PA 3E3MA 2B1QA 2L18A 3OE1A 4L4SA 5JALA 1HGXA 2XUFA 5JNTA 2E85A 3C7AA 1BA2A 2WF5A 4FDAA 4N0MA 5CU7A 2WU4A 2XUGA 4P3KA 2EZUA 3C4QA 4BNHA 4ZI7B 1X13A 2H00A 2NQ2C 2VT2A 2VXBA 3NIFB 2GBLA 3LKBA 4P4LA 5JVDF 3L0IB 3PT9A 3K16A 3PITA 1P0QA 1E7WA 1TO6A 2QE7A 2R66A 5A6SA 1Y48E 2IOFA 2YWXA 4LRYA 5JU6A 1ZSVA 2FPLA 3CX4A 3OBIA 2ERCA 1RWKA 1TRKA 4FDTA 1ZISA 5HKOA 4HLDA 5D6NA 3SHWA 5A0VA 3ZI0A 4Q4CA 1L1QA 4YRPA 1GP2A 4LJ8A 2C3UA 3FPFA 3JQAA 1AMNA 2HU8A 3SFTA 2IQ5A 2X15A 1LV7A 3QVTA 5CFMA 1B8PA 1Y89A 2PIAA 2BM0A 2VUUA 2W58A 1R74A 4KJXA 4KKVA 5KDDA 5IAAA 2UUBB 2VRCD 3LE8A 1O6BA 3DKRA 2O9JA 2GK7A 5CFNA 2CV0A 2JBHA 2X6QA 3GJRA 3PUKA 1P1JA 1VZ2A 1Z26A 3FR7A 2J0UA 4YJ3A 1HNWB 1DE0A 2J67A 4ZVTA 4K8RB 4EAAA 1ZNYA 4TV8A 4AAYA 5JNRA 3H75A 1NR1A 4LQDA 4R2LA 3HDTA 4YO7A 4JB2A 5MDHA 1XMIA 4J4BA 4CTJA 5HKBA 3BKWA 4I1RA 3U2QA 4BWYA 3AHIA 1CB7A 1FP1D 1KQOA 1T1RA 2QPOA 4QJ4A 1VKJA 5CLLA 2IHTA 4RZXA 4ENRA 3PYLA 1GOTA 1TTHA 4FI3C 2XCUA 1O57A 4BFZA 2RH5A 5DH9A 3I9OA 2JFOA