1R0WA

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) apo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
281
structure length
266
Chain Sequence
b'TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 90
structure length 266
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0wA00
2VP6A 1Q1BA 3KKMA 2NOAA 2N46A 1OYYA 1KJWA 1I4TD 3KKQA 2FSGA 3QEOA 3WRYC 1BH2A 1KIMA 1I4LD 5JCZA 1G3MA 3UANA 4ZDKA 2J7KA 4OK3A 4AI6A 2PCLA 2QMUA 3OESA 3TAUA 3MSXA 3CW2A 4LBYA 2WVJA 2C04A 3KUDA 5UKDA 4OQXA 4HB4A 4LK2A 5AUPB 2JIZD 2Z6VA 4GZMA 1Z6XA 3OEHD 4HUTA 3KJGA 2JLXA 5JWHA 2QT1A 4UNSA 3GP8A 1EESA 4GP6A 3U3MA 4TTPA 4DDTA 4ON9A 4V02A 1JXMA 1CJMA 1NSTA 5HKKA 4TSFA 4OK6A 3OFND 1U0LA 3L82B 4HSEA 4Q47A 1FQJA 2CVFA 2C8VA 2CHQA 1ZYUA 1Z6YA 2IX3A 1G16A 1OXXK 5JJIA 2EU8A 4BGDA 2CHGA 3IHWA 3PV0A 1CR1A 1NVXQ 4N3NA 1BS1A 2X1VA 2OLKA 2OFWA 1N3BA 1H8EA 5JJLA 2RHMA 4GZLA 2DR3A 3CX8A 5KSPA 4QJ5A 1KO1A 1ELOA 3H4MA 3MWKA 2MSEB 2C9OA 1CJTC 1R6BX 5GJBA 1AN0A 3BGWA 4WXRA 4BLRA 1OHHA 1ZCAA 3RRYA 1L2TA 3DPUA 4Q9KA 5JFGA 5K8UA 3SBDA 4DLZA 1XTJA 5G41A 1TEXA 1K5DA 2OILA 3QEJA 1E9DA 2G6BA 3PR1A 2C78A 1J70A 2F1HA 3EARA 1GFIA 2GJAA 1TNDA 4Q4JB 1QVAA 2DFNA 4I81A 1N0WA 2DHRA 2HLDD 4HUQB 4DIEA 4RZUA 1I2DA 4PO9A 2AFHE 2VSOA 2FDCA 4LBVA 2DWOA 1RC8A 1U0JA 2QP9X 2NZ8A 4LYAA 2ZE5A 4Q7MB 4NYMQ 2WMOB 4HLQB 4G1UC 3S1AB 1NN3A 821PA 1P72A 1NKSA 4DUGD 1S1CA 4NYIQ 1TU3A 2ZJOA 5IDVA 5JHHB 1M7HA 4ERNA 1MV5A 2BBSA 1UM8A 1Z3IX 1G3UA 1N5IA 2Z4SA 5C4GB 4WZAE 5EE5B 1ZINA 4JBYA 1U0HC 4TMWA 4EPYA 4DCTA 1Q22A 3Q3JB 1W36D 2XTMA 1X8JA 3B1YA 4BFWA 3T1OA 1UKZA 2O8DB 3BD9A 4NYMR 1YRAA 2QP3A 2ZRDA 3U3JA 3KX2A 3NBFA 5HCIA 3LQRA 4TMVA 4GOKA 3CRW1 2HJGA 2EWWA 4HATA 4LY6A 4JLPA 4ESHA 2PZGA 4L16A 2RHDA 2XOKD 4PC7A 4PPNA 1G5TA 3SDZA 1T0HB 3KTAB 2CJWB 1Z2CA 1EWQA 4JT2A 2YJTD 1F2UB 2QPAA 5KYKA 1W47A 4ZCLA 3MD0A 2ZE7A 4TQAA 5EP2A 5SZJA 2IYRA 2AN9A 3HU1A 2OUKA 4JL8A 1NSFA 3CRQA 2A30A 4PXAA 3LW7A 2YOFA 1CIPA 3SJZA 2LWIA 3IIKA 2HYDA 1QRAA 4YMVA 2O52A 1HV8A 3FKSA 5DSZA 3TVDA 4A4DA 4IJMA 4PC2A 5H68A 1QHNA 1KKMA 2RGXA 4Q4JA 121PA 2NTYC 1ZUHA 4HUQA 1LVGA 5J4HA 4NYJQ 2FWRA 4V0ME 3CRMA 4LBWA 1X86B 4YMUA 2J0VA 1NMZA 3SZRA 1Q44A 4G0NA 5JWOA 4JYCA 3SN6A 3MGCA 4BLSA 2O8BB 1E3MA 2QTVB 3S1AA 4BZXA 1TUEA 4F4JA 3EZFA 2J46A 3FDIA 4TTQA 3ONWA 3CRRA 4WOPA 2RMKA 3AUYA 2BMFA 4Q7JB 4NP6A 1UBEA 1QG4A 4MKHA 4KFTA 2ORVA 3IDQA 3X1XA 4Z51A 2J59A 3NEJA 3A1SA 4EAQA 3WYFA 2ANCA 4PTLA 2EYUA 3B2EA 1ZW6A 2IHYA 1XBTA 3FPAA 3HDTA 3ADDA 2C96A 2J3EA 2C98A 3IPYA 1N6KA 4LYHA 2O8DA 2UZIR 2VP9A 3ZVNA 1OH7A 5ANRB 2D3WA 3IO3A 2C5LA 4X8HA 2ZIAA 4CT5A 2REXB 1E2NA 1Z29A 2YWEA 1FUUA 2ZRCA 4QL3A 3I8XA 1N6IA 3K8YA 3K9LA 3KTAA 5L3QB 2CE2X 5E7JA 1E9BA 1YRBA 2CJWA 5JRZA 1EFRD 3KJEA 3VR5A 1RZ3A 4B32A 5C46F 3SFVA 1I4DD 2NO6A 3LDAA 1F2UA 1WBDA 1W46A 2PMDA 3KUCA 3UWOA 4DDWA 3K09C 2VO1A 5FL7A 4TLEA 4FMBB 3DEFA 2SHKA 2GTPA 3I32A 2JLUA 4CGZA 5LDDC 2NMVA 2R8RA 4Q19A 4IHQA 3IEUA 1DVRA 5D3QA 4BLPA 1X6VA 3AVXA 4AKGA 3TE6A 4EPXA 2HYIC 4ARZB 1RJ9B 2D2FA 1FOEB 5M04A 3K0EA 2H16A 2NO9A 4MUAA 3R9WA 1KNQA 1U8ZA 2EFCB 2QMEA 2ZRKA 2PZEA 4Q4LA 1NMYA 2IYZA 3UG7A 4LJYA 4M1YA 1G64A 1NVWQ 1XTSA 2AD5A 4L9SA 2XNDA 3KXLA 1IAQA 4TT3A 2V6IA 3HU3A 3OAAA 4CEIB 5KUTA 4LZZA 1ZP6A 2O8BA 1IY0A 4B6EA 1XXHB 3H1TA 1TQ2A 1XEWY 5B30A 3H2YA 3P4YA 1X3SA 3FTQA 2J45A 1RE0A 1Q21A 1SKYE 1E1RA 2CL0X 3KKNA 1OH6A 5DO9A 3RSLA 3U60B 1IONA 2V7QD 3PUWA 3TH5A 1BYIA 1Z6AA 1G9XA 2AL7A 3PUXA 1W44A 4IXMA 3W8NA 4CVNA 4R71A 1CS4C 1RRPA 4D26A 2AK3A 2FJUA 1MO5A 4BZPA 4DCUA 3VKHA 4LUCA 3A1UA 1Z6GA 4TZ6A 3PIRA 1WA5A 3IBGA 4KFRA 1YE8A 2YOHA 3KFXA 1MABB 2WSSA 2WAYA 4TL8A 4AC9A 2QI9C 1U99A 2ZSDA 4A8JC 4BRUA 2DFLA 1A2BA 3ICEA 1E2IA 1YU9A 5FTNA 2O8CB 4G5GA 3GJ0A 2NQ2C 3B7GA 4B3CA 1XCGB 4TYQA 1LY1A 1G4AE 1HQYE 2PT5A 3OIWA 4GI7A 2D7DA 3F8TA 4RZXA 1BO6A 5L3QA 1NVVR 1M1YE 1PUIA 4GPTA 2ZS9A 1BOFA 1P7CA 3DOEA 4JLOA 3VNVA 3LXXA 1VDZA 2XSZA 2ASEA 2QRNA 4OJQA 2OESA 5CDFA 2B92A 2XZOA 3ZD7A 3BFVA 2AKAB 1AQUA 3FHOA 2GAAA 2H18A 4LHVA 1KO7A 3EIQA 5FOVA 1L7VC 2RGGA 2IXFA 3E5HA 3EPHA 3WBKA 1C1YA 4RSGA 4IRUB 3OIVA 4B35A 4EPWA 2ZUDA 4KSBA 5F3WB 2MMGA 4KLZA 1E98A 4ARZA 1MO3A 1RJ9A 4US0R 1KK2A 2DPXA 1E2LA 4LPSA 8OHMA 2A9KA 3TR5A 2XX3A 3V9PA 5IK2D 3HYRA 4CEIA 5AJXA 5EUMA 1OXUA 4LJ5A 4BLTA 3VR3A 4FCTA 2C03A 1XXHA 1E1QA 4FCWA 4KCGA 5DHAA 4DLYA 3GLGB 3WYAA 1RVDA 3QXHA 1QHSA 4ILEA 4R9UC 5CJ2A 4BFTA 4DZZA 1VIAA 4UJ5A 3GLFB 1VG8A 1TF7A 2P2LA 3SQXA 2WJIA 1ZU5A 2WJYA 3QBVA 4MQBA 3WYGA 1FTNA 5KDLA 3OE7A 4QOSA 4WVFA 5A4JA 3X1ZA 4YLGA 2ODWA 1H8HD 1MABA 1Z0JA 4OHVA 2W6IA 5LD2C 2BM0A 4W9MC 4BZQA 2IUSA 3AP3A 2VP4A 3N2EA 2VTKA 4BPBA 3E70C 2O8CA 1JB1A 2IF2A 1KI8A 3BB3A 1A7JA 4RCYA 1M6NA 4NBSA 2ZAOA 2FN4A 2ZR0A 4D25A 2GETA 1E2GA 1U9IA 3B1XA 5FTKA 5BYKA 4PC3A 1GKIA 2EW1A 2HF8A 3IO5A 3WMFA 1OXSC 1U2RA 2ZPTX 1UF9A 2Y8EA 4JT4A 4AKEA 4JSTA 3THOA 1G20E 3CR7A 1AKYA 4XH9B 4L8GA 1KI4A 2WV9A 4MYHA 4WW0A 2GVDC 5TB5A 1NBMD 1FMJA 1XNJA 4PZZA 2JJ8A 2ZROA 3DMDA 4HAYA 2E87A 3EA0A 2KBFA 3LV8A 2R2AA 4NKRA 3ZIAD 4O0MA 2QM7A 5JCPA 1AS0A 4RZ3A 2ZRBA 3A58B 3ECCA 4MRRA 2FSHA 1J7KA 2YC2C 5AUOB 4V0NA 4D80A 1KO4A 2YWHA 3UKDA 2GCNA 2G3YA 1S3SA 1E2JA 2J7PD 4UNRA 4PR0A 2J9RA 1YR8A 2W2TA 4B3GA 3GLGA 4GOXA 3MMPA 1WP9A 4OHWA 4MITA 3IHLA 1T5IA 4US1R 1NLYA 2ZJBA 2ZRMA 4RKFA 1OIVA 2D74A 3PENA 4QGFA 2RGNC 4PAQA 2CK3D 3B6EA 1E0KA 5BN4A 3GLFA 3KXIA 3AVQA 4OHXA 1OFUX 2W6JA 4QC2A 4QHYA 2P6NA 1F48A 1XCPA 1F6BA 4XD7A 4IDNA 3T5GA 1LF0A 1XTKA 1XJ0A 2QU8A 1W7AA 4JJZA 3RRNA 1N25A 3ZS9A 1KI7A 5CJPA 2PCJA 1NBME 4ABYA 2NO1A 4LJ4A 4KBFA 3LAWA 2WWWA 1EFUA 4DJTA 1UKYA 1NL3A 1BKDR 2X77A 2BHRA 5KSZA 2MSCB 2ZJAA 1KK1A 4X8LA 1K6MA 1XJCA 2ZU6A 5FTLA 1R10A 1AS3A 1TX4B 2WZQA 4QHSA 3DDCA 3RHFA 1QF9A 2LKDA 3TIFA 2IBMA 1B23P 2WKQA 5EJEA 1FUKA 1NN1A 2TMKA 3AEZA 1W36C 2IYVA 1FZQA 1NLFA 3GJ7A 4B73A 4DCSA 2GNOA 3PUVA 3R9IA 2CBZA 1G18A 2NGRA 2UKDA 3L0PA 5CIQA 4LDJA 4TYPA 3DZDA 5P21A 2ZSFA 5HPYB 3C14C 3GLHB 2O0HA 3E2IA 1YZNA 2WWFA 2AD1A 2CVHA 2KE5A 3SHWA 1E9AA 3LA6A 1YR6A 3EASA 2F6RA 1SQ5A 2GF0A 1E2QA 2D2EA 5A5GA 1Q20A 3VR6A 1PVOA 2QRZA 5FUYA 2H17A 3IIJA 5E4FA 3A1WA 2YYZA 4IVRA 3NEYA 1G6OA 2FSFA 2QSYA 2GJSA 3FFBA 2BMEA 4URXR 1XPUA 1TTTA 3AF1A 3VR1A 2ZI9A 4JLKA 2ZSAA 4JKYA 2ZJ2A 1TF2A 2Q9CA 4U7DA 1ANKA 3CNOA 5L3VA 1HE8B 2PEZA 3QQ5A 6Q21A 1E6CA 3GPLA 3GMTA 3CX6A 1GL6A 2WJHA 4A0RA 3NG1A 1YQTA 2B7CA 2L0XA 3KB1A 1P6XA 2OCYC 1X1RA 4J0QA 2IWHA 1G291 4QBFA 2QG6A 1HE1C 4NCIA 2WWHA 1EXMA 2G1KA 5CYPA 1UJ2A 2ZU0C 3U4QB 3OEED 4EIWA 2GZDA 4II7A 5K8LA 1W0JD 4IEIA 1YZTA 4N1AA 1YJ5A 2OCBA 4Q9JA 2OFXA 1FX0B 3LBNA 4QM6A 5B64A 4PAOA 4DIDA 5HKKD 2WOJA 4B74A 2P5SA 2FEMA 2ORWA 1SVIA 2D7CA 3KJHA 2ANBA 1M74A 5CM9C 2CL6X 3NH6A 2ZJZA 4R2HA 4V0LA 1N6PA 4D0LB 3QJYA 2QTFA 4IOMA 4M22A 4D4LA 4D4MA 4P4UA 3BB4A 2BDTA 1SVSA 1KY3A 2J0UB 3Q7QA 2H92A 4KVAA 1BIFA 5DN6A 1WCV1 3GLHA 1MR3F 3F5FA 2CLSA 4JSYA 3GCGA 1M7GA 4X8OA 5DGXA 3REGA 4FW9A 3LVQE 4DSOA 1NP6A 4YXWA 3CBQA 1R5NA 4G5QA 4TWZA 1OHHD 2FSIA 2P3SA 2WAXA 4AD8A 3EWSA 5LPNA 3U7EB 2QSZA 3CKLA 3W3ZB 5FUXA 1G41A 4D0GA 1ONBA 1GTVA 4WA7A 3HJNA 1SXJD 4LJ6A 3RS7A 3RS2A 3EZ2A 2ZI5A 3SFZA 2DB3A 1UAAA 5KNBA 2YWGA 1KAGA 3MJRA 3Q5DA 3GQBA 1ZRHA 2Q9AA 3RS5A 3QI2A 2ZRHA 3TNFA 2EVWX 4D4KA 3H0KA 3T1TA 1OF1A 2V3CC 3W5JA 1E2DA 3X1DA 1KNXA 1G7CA 5KSYA 4F38A 1FP7A 3I3SR 2OLJA 4AK9A 1R0YA 3THXB 4Q00A 4DSNA 2CNWD 3R20A 2HXYA 4MKFA 4A8JB 3U4QA 3P32A 3PCRB 3WMGA 4ZO4A 4C0AC 5BQ5A 3W34A 3UPUA 4RD2A 3QSYA 1C4OA 2CEAA 4U00A 2A5GA 1FX0A 3C7KA 3BRWD 3ZGXA 3RANA 1N0UA 1OLOA 2B8TA 4LJ9A 2BEJA 4URWR 1W2GA 2R6CA 4LOAA 4HAZA 1EX6A 4I1SA 1ZNYA 4MUBA 3ZQ6A 4C0HA 1KO8A 3GFOA 2A5JA 4WZ6A 3MAAC 5JS8A 3KJIA 1MT0A 1E69A 1S2MA 1W48A 3K09A 2BKUA 2P5TB 4HDQB 4MGIR 5KDDA 1M7BA 1P62B 2J0UA 2ZAMA 1SXJE 3GEHA 4DSTA 5IRCD 1GRQA 1AK2A 2CCKA 2OM2A 1SULA 2C77A 2WWGA 3KQHA 1DG1G 5KHOC 4PQRA 4TYNA 5F2EA 2G83A 3QF4B 1G3IA 3AM1A 3BB1A 4D0NA 3NHAA 1X8LA 1XMVA 4LHZA 4MRSA 2DYKA 1E2EA 1XEXB 2VP2A 1AA9A 5FOSA 3OF5A 1AGPA 2BBOA 3D6TB 3BE4A 4P3YA 3AVPA 1CP2A 4FXPA 1MH1A 5EUQB 1P60A 1XZQA 1UPTA 4RKEA 3FKSD 4JYBA 2YNMA 3TVTA 3KKOA 3VQTA 3OHMA 2HT1A 3HPRA 2XITA 3EC1A 3KKPA 3NWJA 3DM5A 1JI0A 2ZYWX 4BEBA 3I4LA 5J40A 1X8KA 1XRJA 4Q21A 3ZS8A 1N6LA 1O87A 3JZAA 3W8RA 1ZNZA 1ZMXA 1KHTA 2JJ2D 1ZM7A 1Q1EA 5TV2A 4FWTA 3C4JA 1R2QA 2F1IA 4M1OA 3THXA 4IEEA 2YOGA 3WNBA 5LD2B 4A8JA 3VX4A 3BC1A 3F3YA 1ZM9A 3A8TA 3NXSA 4HAUA 2O8FB 2P6UA 2WBLC 2YINC 2IS6A 4OHZA 4JVNA 4URUR 1UFQA 1ZUNB 4LWZA 3IUYA 2IYLD 4V0KA 1ESMA 1XPOA 3BAFA 3GLIB 1TQ4A 1GSIA 5TARA 4W5HA 5J4YA 5CYOA 3PEVA 1TPZA 4M53A 1OFIA 2WIAA 5L3SB 2GILA 1VYVA 1NKTA 2YHSA 5IF9A 4Q48A 1ZNWA 1G8FA 5KOYA 4FWIB 2CXXA 2J87A 3LRPA 1VMAA 1E79A 1G8HA 3MWYW 1E4VA 1XMIA 5EP3A 3RWMB 2JLVA 2FPMA 1D8TA 4OI0A 3V4RA 3QF4A 2J1LA 3PITA 2ZTSA 4PPFA 4DC9A 1JBKA 1XEXA 4PFSA 1KSGA 1N6HA 1CRPA 2HJVA 2JA1A 4D82A 2OBLA 2A7QA 1OFHA 5G40A 2QN6A 3VR2A 4UJ3A 3HP1A 5DI9A 1GOTA 3CH4B 2Z4RA 3U3OA 1RRCA 2GJKA 2GVZC 1QHIA 2N1BA 1GZSA 1KI2A 1D9ZA 4EKDA 3FFAA 3KB2A 4CW7A 1DO2A 1P2SA 1ZM3A 1RRGA 2IXEA 4ZDWA 4AYTA 4E5UA 4ZCMA 1G5RA 1N0VC 4I1OA 4TT3D 3OAAD 4NU0A 4Q03A 4B2PA 1P75A 2QPOA 2IS1A 3LNCA 1W1WA 4U5XA 5J4KA 3O8CA 4Y0VA 2OCAA 5E95A 4LCBA 4WIAA 4Q01A 1VYUA 1KOFA 1Q12A 3AUXA 2IK8A 2FNAA 1DAMA 2ZUBA 3Q9LA 4PANA 1Z63A 4XTCS 4HEJA 2FA9A 3AQ4A 2ZRFA 5J47A 4M4SA 4TYYA 5G53C 2O8FA 1N5LA 1Z06A 4ACAA 3PEUA 4BFVA 1IJFA 1W4AA 4TQ9A 2WIBA 4H9GA 1ZM2A 4P4TA 4QFMA 1JR3D 1Q1QA 1RKBA 5BN5A 2ZJ5A 3RWOA 3CWZA 4RCZA 2PLFA 3LLMA 4I4LA 2A5YB 3SOPA 1NJFA 4A0GA 1KO5A 2OAQ1 3AP2A 4EQ6B 2IHBA 5FTJA 5L3SA 4C0BA 1P2TA 5AUNB 1EK0A 5J5CA 2CCJA 3OFNA 5C4MA 3OIYA 3ZVMA 4FIDA 4JLDA 3CO5A 2QGZA 1A5TA 3WNDA 1W36B 4Z8XA 1NI3A 5EXSA 2WHXA 1HTWA 2HUPA 4L9WA 1Z47A 3ETLA 3PVSA 1COWD 1E2PA 4UNNA 1II0A 2B7BA 4ZDIA 5JRJA 1D2EA 3CPJB 5FH9A 5KNCA 4D2IA 3U2QA 1VCMA 4QGGA 4AYXA 2F1RA 1FNNA 5JHGB 1Z0DA 2CLDX 3ZD6A 4LJ7A 3FOZA 3KL4A 5TMPA 3M4YA 4I99A 1YVDA 3CWQA 1DELA 2JGNA 2XNSA 1G19A 1ZD8A 2I1VB 1PJRA 1CJKC 1ZD9A 4JS0A 2R6DA 421PA 2BKEA 4PHHA 1N6RA 5FPTA 1T4GA 1A82A 4LV5B 3FMFA 4Q1DA 3M1IA 4AYWA 2WWIA 1UBCA 1U8AA 2QQ0A 4H1UA 3BIFA 3NC1C 2YV5A 2BMJA 2RGNA 1OKKA 1CKEA 1RW4A 1UBGA 4EUNA 4F93B 5JLJA 1JR3E 1WRBA 2OSBA 1FMLA 1L8QA 2ORIA 2P67A 2ONJA 1N5KA 1W0KD 2BIFA 2C95A 1EGAA 2HLDA 3P26A 4BFZA 2NPIA 5EP1A 2ODNA 4M8NE 1KI6B 2AHOA 2W0SA 2X2FA 1S8FA 5JWRA 1E2FA 1XU4A 4YMSA 4XVUA 4V03A 3JVUA 3L0OA 4HB0A 2DY1A 2WPDA 3CPHA 4C0KA 4C0SA 3CX7A 2FPKA 2ZR9A 4DUGA 2OCPA 4PHTA 4HLDA 1LV7A 1XF9A 2W6ID 5FR2A 4K8OA 4TLCA 1R0WA 3FWYA 3WHLA 1CBUA 2ZETA 1E2KA 4Z8YA 1NJGA 4EQ6A 1JJVA 1MO6A 4CYMA 4KFUA 1KAOA 3EC2A 4V0MA 4ZCIA 2P6RA 2JJ1D 721PA 1E9SA 1EFHA 1TUIA 5KSOA 1G5PA 1WMSA 4JL6A 4QBIA 2FX3A 1G4UR 1B0UA 1MO4A 1FTSA 3NBZC 1NVVQ 4N0EA 1LB1B 1QVRA 4FMCB 3G0HA 1T9HA 1SKYB 1DPFA 4GMXA 3I5YA 2ZRLA 2OXCA 1MRSA 1FFHA 4DB4A 2XB4A 2XOKA 1OIWA 4URVR 5FOWA 2AWNA 1OH5A 4OJKA 1JQJC 3DHWC 1VPLA 2VP5A 4A2QA 1CF4A 2PLRA 3QG5A 3QY0A 4AG6A 2WWXA 1CTQA 1Z5ZA 4JVSB 2JATA 4MA4A 1KI1A 4DLXA 1KKLA 1HURA 2N42A 3AVVA 4OHYA 1YZGA 2QE7D 4MYUA 3VHLB 2F43B 2FH5B 3DO6A 4QM7A 2EFGA 1DEKA 2EFDB 2ZRNA 4FINA 1ZBDA 3BWDD 2Q21A 3X1YA 2V9PA 2GEUA 2FG5A 1G8PA 3RRZA 1NVUQ 3GJ6A 3RAPR 3QKRB 3K1JA 1CU1A 4ESVA 4QNMA 1GRNA 3NVAA 4QBHA 1KI6A 2I3BA 1SVLA 5AR1A 2H1LA 1CR4A 2OV2A 3KFVA 2ECKA 5DYGA 5EXPA 3LO5A 1VIYA 1P9NA 1KK3A 3EPLA 2PX3A 4CDGA 1SXJC 4XD7D 1JAIA 3ADKA 1GWNA 3SNHA 3BK7A 1GNPA 4NCJA 4UXJA 4NCKA 1N2CE 3ND8A 3T12A 4B6FA 2O0KA 4KFSA 5BW8A 1NNEA 1Z0AA 3SJAA 2JDIA 4JVLA 2MMCA 2RKOA 3K70C 3ASZA 1WF3A 1XB2A 4MYTA 2EWVA 4LV8B 4A2WA 1IN4A 4A82A 2QNRA 3CM0A 4KAXA 5FUWA 1KTVA 1F2TB 3BFKA 3PJRA 1G21E 2IWRA 3RS4A 3SE0A 1F5NA 4IXNA 3UMFA 4Q7LA 1XDBA 3I8SA 3K53A 3AGPA 3CF0A 4MYCA 1QZXA 1D2NA 3MRSA 4UXIA 2ZJ8A 1KSJA 3ZYCA 1T5LA 4LGMA 1BMFA 1WXQA 3C5HA 2REOA 1E2HA 2XGJA 1SGWA 3WBJA 5FI1B 1EFRA 1N6NA 2QUZA 4URYR 3GLGE 2GWHA 3LD9A 3CUEF 3HPQA 3WHKA 1YZKA 4CRWB 4B3DA 1GL9B 4TL6A 4XIGS 2CL7X 4XWOA 2W0MA 4B34A 2ERYA 4X8MA 4NPHA 1DADA 4AG5A 1GG2A 2BVNA 4EPRA 3AKYA 4IOLA 4PSAA 4PQFA 3TUJC 1FPMA 2F43A 2IA5A 4ACBA 1R0XA 3IBYA 4LPKA 221PA 1YHNA 4DEXA 1G8YA 5LB4A 2WKPA 3P1JA 3OZXA 4A9AA 4WAUA 3T5DA 4A36A 5ELXA 1CXZA 1OSNA 2QAGC 4W5WA 5EP4A 2KJQA 3EIEA 3QKRA 3U44B 4C0JA 3C8UA 1KJYA 4YONB 3SJCA 4BQSA 2IW3A 4IVQA 3NC0C 4GBMA 4GNKA 1IN5A 3UMRA 4R7ZA 3B85A 4M2LA 4YMTA 3K0SA 2DFKB 2CLCX 3GEEA 2GF9A 3G5UA 3QG1A 1KMHB 3MWLA 2ZYTX 4NCNA 3VKWA 5FBVB 2G1JA 1OV4A 4OQFA 5HZKA 1S9DA 1KMQA 2HT6A 4HI0E 4B33A 5GADl 1Z07A 4TL9A 4JLJA 2W83A 5DE3A 3ZVLA 1QBKC 1T3LA 4RJLA 2VF7A 3FB4A 1Q57A 1J2JA 1VCIA 4Z1MD 4ZPXA 4DDVA 1H65A 2ZM5A 1CULC 4LRWA 5FPKA 3TW8B 3R8FA 4KODA 2WJVA 2XEXA 2B21A 3FE2A 4U02A 2WKRA 1ZNXA 5IHPA 3JVVA 4NHOA 1F2TA 1XPRA 2V54A 4M9SA 4A6PA 3EPJA 1OFTA 1ZVQA 3IIMA 2VHUA 4NMMA 4KYUA 4B71A 4DLWA 1IN8A 3VU9B 2GCOB 3C5CA 3AP1A 5G3YA 3RRMA 4WBSA 1Z2AA 4Y0AA 3QPUA 4GSYA 4MH0R 3AKCA 1UEIA 3O8DA 4FCVA 2FGJA 1KSFX 4LC1A 2WM9B 2CDNA 2VRWA 2C9YA 2D06A 4BLOA 3P20A 2Q3HA 4IDOA 3LY5A 2ZRJA 2GXQA 2R62A 3J81k 5DN6D 2GZAA 1KSHA 2QL6A 4QKQA 4AY2A 1OXTA 3EA5A 4OYHA 4MRVA 3UIEA 2BCJQ 1XD2B 5JZVA 4HLUC 2QMOA 1WQ1R 1FL9A 4M1MA 1W5SA 3B8HA 2BC9A 2V4ZA 2ZXUA 2VHCA 3U44A 3W6OA 5SZKB 5IK2A 4RFVA 3QF7A 1Z83A 4B3XA 1KK0A 5TXGA 1F3OA 2ZITA 4OKSA 2VEDA 2FFHA 1KMHA 3U7FB 2RGCA 2GAOA 1KZ7B 1E0JA 1W4CA 3RSOA 2CMKA 3ICQB 4KV9A 1T91A 4IKEA 1CLUA 1G7TA 3BH0A 1VG1A 4A0FA 5D3MB 521PA 4QRHA 1ZC4A 3CZPA 2Q6TA 1P73A 4TLBA 2B6HA 2OAP1 1ESNA 2ONKA 4B2IA 4CEJB 1IN7A 3Q5EA 3QXCA 5KU1A 1NMXA 2QAJA 4JIMA 3W6PA 3U61B 4F4CA 3LX8A 2VPPA 4LHYA 2G0TA 1KJZA 5EXTA 3VU9A 2GCOA 1T3HA 3PUZA 5DLQC 1HA3A 3W5IA 2QZ4A 2IL1A 2ZE6A 3X1WA 4A92A 4B76A 2PJZA 3QUSA 5FL3A 4O3MA 4PX9A 1DE0A 1QG2A 4IOJA 4AWXA 2CCGA 5JBQA 1GDDA 4UNQA 3RABA 3CONA 1OB5A 5EXXA 3ZLJA 3ZZTA 3B13B 4L15A 3ZQJA 4DXAA 1NLZA 1IXRC 4KBGA 4OL0A 4G5SA 5LB2A 3LLUA 3CR8A 2AX4A 1HYQA 3B9PA 3A6PC 5DH9A 1XD2A 3KXKA 5H70A 3UK6A 2F1JA 5J4VA 1DARA 2NO0A 3FKQA 5AUQA 4Q5IA 1ZIOA 4TSFD 2IYYA 2G77B 2LKCA 1CJVC 3EXAA 3VFDA 4DB2A 3LX5A 1NN5A 2QA5A 1E9EA 2ZYUX 1YZLA 3U6KA 3IEVA 4MKGA 5HTKA 4Q4HB 1AGRA 2J41A 5GJWC 3AV0B 1J8MF 5KDOA 3QNUA 3AVTA 2AK2A 2GEVA 3NBXX 4KYIB 4QGHA 3RNLA 1XTRA 3SHFA 4PHFA 4TN1A 5F98A 1W2HA 2Z5FA 3U5ZB 1XEFA 1OW3B 1H8ED 3LW8A 4M9QA 4A15A 4JLVA 5D3MA 1JECA 4LI0A 2CK3A 1II9A 2BM1A 4TMXA 4ZI3A 4AIIA 1TAGA 3H86A 2YWFA 2HEIA 5HE8A 4DSUA 3HR8A 4CEJA 2IYWA 1S1MA 3IQXA 1SVKA 1D2MA 1DS6A 3B1WA 3TAHA 4ZDJA 4A2PA 1FW6A 1AM4D 5JECA 1M2OB 4TTRA 1P61B 3ZDQA 3SYLA 2JLYA 3K9GA 4HYYA 4ASUA 4JL5A 5CLQA 1NY6A 5DYIA 3C41J 1XP8A 1Z0FA 4XVQA 2AKYA 1DTSA 2GA8A 4UKDA 3QOFA 1U90A 2XXAB 2ZQ5A 4RFSB 3EZ9A 3Q72A 1J90A 2I4IA 1W49A 5L8VA 3AB3A 4URZR 3AKEA 2F9MA 1E79D 2GJ9A 1GVNB 4UQOA 3SYKA 5BN3A 1HY3A 4Q9HA 3M0EA 2JCSA 3BJIC 1NG1A 2Q9BA 4FMDB 1E4YA 2IYTA 4Q1CA 1VYTA 5SZIA 2J5XA 3T61A 1U94A 5DI3B 5J4LA 5CM8B 4JLAA 4B48A 5HE9A 4EJSC 3QXXA 4GDFA 1JJ7A 2ATVA 3UATA 1AS2A 4NH0A 3QKTA 2Q0HA 3PFIA 1SVMA 4TMKA 3GJXC 5TDHA 4BUJA 4Q4HA 1VHLA 1YZQA 4PHGA 2PX0A 1JXOA 3K9NA 2QY9A 4Q1FA 2VBCA 4DT1B 4PSVA 3MUFA 5FBRB 4Q1BA 1IY2A 4WZBE 2WSMA 3MCAA 5E3HA 2HCBA 3VTKA 4PO1A 4DKXA 1KI9A 3CPEA 3VAAA 1M34E 2VQSA 1RRFA 2YC4C 2R6GA 2RGEA 5SZHB 4EPVA 4HB2A 4AKHA 1AKEA 4K81B 5C1BA 1SXJB 4PAMA 1NIPA 2MSDB 2DWPA 4XSGA 3C16C 5BYJA 2Z43A 2BV3A 3B5JA 5FBWB 1R7RA 3TK1A 3PEYA 3Q7PA 1X1SA 3AF3A 3T1QA 2IYXA 3EWAA 3AF4A 4BFUA 2ZEJA 3ADCA 4PO8A 3KQUA 4M9XA 2D4HA 1W4BA 2XJ4A 3K70B 1GP2A 1IJEA 4D4JA 4ZKDA 2E9SA 1Y3AA 4LHXA 2ZRIA 2GK6A 4GRAA 4YC7A 1TL7C 5F9HA 3K0CC 2GEDA 4AKIA 1R4AA 1XD9A 2DWQA 3HR7A 3OEEA 3T15A 2KWIA 2XXAA 1E0SA 1W0JA 4NCHA 4RFSA 2PMKA 3KQKA 2IS4A 1P4SA 3BOSA 1FQKA 1JPNA 5EZ5A 3PQCA 1RYHA 2IYQA 4OQLA 1G7SA 1LS1A 2QGNA 1RYFA 4QJ3A 5K8IA 3V00A 1QHGA 1T0JB 1AZTA 3Q8XB 4S35A 4E03A 1UEJA 3HWSA 5DI3A 2PEYA 2W2VA 4DWJA 3A37A 4DLUA 4TQUS 1EFCA 1GKYA 2ZJYA 4G5RA 4PPQA 4V0OA 2G0NA 4FD2A 5HCNA 4P4SB 3ZJYA 3VHXA 1J99A 2WJGA 2IYUA 3RC3A 2RB4A 2ZVPX 4A0HA 4LYJA 1WDTA 5GJCA 3VKGA 2QAGB 4DT1A 3TBKA 1CJUC 1ZC3A 1G6HA 4HZIA 4MGZR 2OE2A 2VH5R 1E96A 1OKKD 2G9NA 1EFTA 3O8BA 4BRWA 4F4IA 3GLIE 2RGBA 4OQNA 4MDEA 1KGDA 1SXJA 2R65A 2P65A 1JNYA 4FMCF 5CITA 4C7OB 1JEDA 3K0FB 2ZI6A 5FL7D 3AVOA 4S2EA 2IEYA 1KI3A 2F55A 1OT3A 5FOUA 1F60A 1S0UA 3B9QA 2H57A 1DAHA 1PLLA 2AFIE 2JEOA 4YMWA 3SU8A 4BWYA 2F7SA 1P9RA 2VHJA 4BECA 2FMXA 5AK0A 1XD8A 3B82A 3DKVA 3E1SA 1P5ZB 2WPDD 4XWKA 2ZUCA 1NY5A 1CR2A 1UKVY 2GKSA 2ZYVX 4MRNA 2IXGA 2V1XA 1XEWX 2LCFA 2ZANA 2NIPA 3ZH9B 1PLKA 2CNWA 3THWB 2WICA 3DZ8A 1S3GA 2R9VA 1HT2E 2V55B 2JLRA 1OE0A 3DMNA 3L8ZA 3WRXC 2XNDD 5EQTA 2R44A 4RY2A 1XZPA 3N2IA 1JAHA 5HZHA 1OB2A 5E7MA 1Z22A 1LNZA 4EFMA 1N5JA 2VSFA 3PUYA 1E1RD 2A5FA 5AWFC 4B2LA 1Q0UA 3ASYA 1Z0KA 1ODFA 4JZKA 3IKJA 3D31A 4I1VA 3WMEA 1ZU4A 4KVGA 5EE0A 5TY0A 2PJRA 4Q7KA 3BFXA 3TRFA 5FBQB 1XJQA 2X8AA 1A4RA 4IDHA 4NYIR 2JIZA 3WY9A 4LYFA 5BWMA 3OEHA 4P4SA 2RGAA 1GILA 4LHWA 4B3BA 2QROA 4BFYA 2WSSD 1Q3TA 1SZPA 1LS6A 1VCNA 3UWKA 3NKVA 1E9FA 1ZUIA 1J8YF 2QAGA 4LV6A 3SBEA 4XOIA 5GJVC 4GMDA 3VX3A 2ZRPA 2GBLC 2UVQA 4IVPA 1OH8A 1DO0A 2IUUA 1S96A 1G17A 4EPTA 3R8CA 1IXZA 4DCNA 2QMHA 3UG6A 4EFNA 2FEOA 3X2SA 2XSZD 4C7OA 4GL2A 5FTMA 4R98A 3K0FA 2GHIA 1JQLB 2QENA 2AXPA 1AQYA 1TEVA 4NZYA 1TQDA 1XMSA 3HYTA 4DLRA 2CE7A 1DAEA 2ZE8A 1T8UA 1GKUB 4K46A 2GXAA 4MDFA 4UXHA 4HAVA 3FMIA 4XVRA 3QBTA 3FGNA 2GZHA 2KBEA 2W2XA 5EE9A 2JJ2A 3ND9A 3GJ8A 5FOTA 2GESA 4A6XA 4Q4AB 4GP7A 2NPFA 5KPDA 1NG9A 3NIBA 4GFDA 1OPXA 2ZI3A 3THWA 2DBYA 1ZIPA 4OK5A 2JDID 3CB4A 5B57C 2BOVA 3LXRA 1AJEA 3QPVA 4PC6A 1AIPA 2XZPA 1UADA 4JKIA 4TMZA 1M8PA 2NG1A 4ZKEA 1E1QD 4TZ0A 4NYJR 2A2ZA 4BLQA 3FHCB 5FBLB 1ZJ6A 3AVWA 3LWNA 1KDPA 1HEIA 3NH9A 1KZGB 3CRVA 3JZMA 4XTRA 4YQFA 3SC3A 4PQYA 2IC5A 4HAXA 1RFLA 1VHTA 4EDHA 3IGFA 4DDUA 2JLZA 3OE7D 1BMFD 1E32A 2OFOA 4LJ8A 2JASA 4HLUA 5CDFE 4JLMA 1N6OA 2OHFA 4P0TA 1NIJA 3ZZUA 4QXAA 4G5OA 1DOAA 4C4PA 4KLNA 2VP0A 1IBRA 3WNCA 4HB3A 4RD1A 4DLVA 2KSQA 1GUAA 1US8B 4Z54A 5JEDA 1KYIA 1D9XA 2XTNA 3NHBA 1SVWA 1UDWA 1XFAA 2GCPA 4XJXA 3EPKA 4M1SA 1A2KC 2V6JA 3EG5A 1IHUA 3T06B 4IDPA 2XB2A 2RCNA 3DKPA 4M1TA 3NBYC 4CT4B 5KTYA 2RAPA 3UXMA 4C0LA 4KO8A 3EX7C 3RYTC 3V4FA 5E7IA 2EFEB 1TADA 2BEKA 1FNMA 1P3JA 4RVCA 1JPJA 1L4UA 1BYUA 1XXHE 2GRJA 4JJKA 4P33A 4KSCA 4TLDA 5FR1A 1IXSB 4LSGA 3SEAA 4C0QC 3NDPA 3W6NA 4KJZA 3OIUA 3DL0A 2YKGA 1DAFA 1GL7A 3WP1B 5CB8A 3VNUA 3BERA 4RD3A 3L8YA 4Q4AA 2QBYB 2WJJA 1KDOA 1MRNA 2ODBA 3EW9A 1E99A 3QKSB 2Z83A 2FOLA 3N5CA 2J0QA 4TYWA 1OYWA 2XAUA 2ZI7A 3L2OB 1R8SA 2ZR7A 3PG5A 4XWAA 3GLIA 1WBBA 4MGYR 5FOXA 3A1VA 4CEHB 5KPJA 3M6AA 3HU2A 4KHZA 1R5OA 3LBIA 1JR3A 3C15C 1UDXA 4ZI2A 1II8B 2BMDA 4IFBA 2D62A 2OXRA 2QQEA 4H1VA 2OEPA 2PT7A 5EE1A 2OBNA 2HXSA 2O8EB 4BASA 3DVLA 2W6JD 1XTQA 4NONA 4NTZA 2OZEA 4EFLA 1LW7A 4MRPA 5JSZB 1Z28A 1WE2A 1G8GA 2FE4A 3RDPA 3KZ1E 5AJWA 1DAIA 4JMPA 1IN6A 3BBPA 1COWA 2AWOA 3G82C 2UZ3A 3AF2A 4RD6A 2NZJA 4EJSB 1CRQA 5LBIA 3GEIA 1LF5A 5EE3A 3I73A 1US8A 4L5BA 1JEEA 2H7VA 2ZSEA 1DAKA 1Z8FA 3WXMA 2O0JA 3FMOB 1HH4A 5H1YA 3RVBA 3R7WB 4CZ2A 3SI7A 4P32A 3FVQA 3TJZA 2ZREA 1VTKA 3P4XA 4PC1A 4OI4A 2C9CA 1KDTA 2IS2A 4F7WA 5F9FA 3BH7A 1T6NA 5DISB 2F9LA 4G3XA 1QHHB 4W5JA 1VG0B 1PUJA 4YDSA 1W4RA 4JLNA 4YDHB 3U3RA 3B1ZA 3A1TA 2Z0MA 3LVRE 4NDZA 5KO2A 1GNRA 3QKUA 4I1UA 2IF0A 5B58C 5TVKA 5C18A 3H84A 4C9BA 1GAJA 3UMSA 2V8OA 2OT3B 2V1UA 1CEEA 1HUQA 3Q85A 2JAQA 3RS0A 2R6AA 1W0KA 4FN5A 3GLFE 2HCJB 1D6JA 3WP0A 2QBYA 3TSWA 4O2LA 2A5DA 4G01B 5A0FA 4PPGA 4DVGA 3QKSA 3I5XA 4LBZA 3QVUA 3W9YA 3SQWA 2HF9A 1NN0A 2F3RA 3QXJA 1E9RA 2VSXA 4CEHA 2WWYA 2ZSBA 1L4YA 3MFYA 1W5TA 3QXSA 1SHZA 5AJVB 3R9XA 3ZVRA 4E22A 2REBA 5L3RA 1II8A 2FFAA 4HLCA 2X2EA 5C2JB 1XTIA 4POAA 3CF2A 4HAWA 2KB0A 5FPSA 4UNPA 5CK4A 3I72A 3LH5A 1KDRA 1GITA 2Q3MA 1E2MA 2JJ1A 1IM2A 3AH8A 2QPTA 4DRZA 3KQLA 2O8EA 2HV8A 1K5GA 1XWIA 5DIFA 1C9KA 2FFQA 5AJYA 2DCUA 1GIAA 1P2VA 5EZ6B 5JSZA 3BH6A 3THYB 4RD4A 3A4NA 3AF0A 3KDSE 3MJHA 2ZRGA 2HDNB 3L0SA 4OI2A 3SS8A 4EJSA 5GVRA 4MKIA 2V7QA 4A1FA 2IEZA 3CF6R 2FPLA 2VHQA 2NO7A 1Q3HA 2VLIA 3W3AA 5CLLA 1EX7A 4M21A 3P27A 3R7WA 4Q02A 4DHEA 4E09A 1IQPA 5B2ZA 2PZFA 1TU4A 2VA8A 4TMTA 3GJ5A 2FZLA 1I2MA 1ZAKA 4DBLC 3BS4A 1WB9A 4F92B 5AJZA 2GK7A 1QHHA 2A3RA 2XJ9A 2QE7A 1KY2A 2FZ4A 4Q1EA 3U7GA 2OO7A 5CIWA 1UBFA 2I1QA 1EWRA 1IOZA 2OBMA 3EZ7A 4KU4A 2ODEA 4DLTA 5CB6A 3FHTA 3N70A 3T35A 1RPZA 2AXNA 2ZVQX 4MGKR 3RS3A 4O25A 4TL7A 3CZQA 3QENA 2H8KA 2FFBA 4RZ2A 1IY1A 1OIXA 4FMDF 4L4UA 1RIFA 3BORA 2GXUA 4ZIRB 4YXWD 3TQCA 2ATXA 3K0CA 1T8TA 1JR6A 2QM8A 1K8RA 2BBWA 1V5WA 3REFA 3NDBB 4O2RA 4KI0A 4TLAA 2H5EA 3L0IB 3TSOA 2ZS8A 2FU5C 1LTQA 1YZUA 5FPHA 2O5VA 4AURA 4F91B 1TMKA 4ASUD 1PZNA 3TUIC 4OBEA 4DLSA 2WOOA 4E07A 3LQQA 4NE2A 2Q3FA 5DNYB 3RC8A 2QT0A 4KXFB 3THYA 2FF7A 4PZYA 1Y63A 1XX6A 3GD7A 4US2R 4HDCA 3TQFA 2EQBA 2GDJA 2EYQA 3EIHA 4RD0A 2WTUA 1D5CA 1QDEA 1MOZA 2CHVA 1XMJA 2VF8A 4B47A 2BJVA 2JLWA 4DCVA 3SR0A 1P2UA 3T34A 3O8RA 1YR7A 3LFUA 4W7SA 1OXVA 3U3KA 2JLQA 5HR5A 2A78A 1H8HA 2GXSA 3GLHE 3PXGA 3TSZA 1S9HA 3B78A 3K0AB 1NRJB 1JALA 5KNDA 1EG7A 4JVMA 1PV4A 1G1MA 5FPYA 5JI3E 3VMFA 2J0SA 2XZLA 1FP6A 2ZI4A 2B8WA 3GJ3A 4IW3B 1Z0IA 4HZUB 2PL3A 3IQWA 4Q18A 4D6PA 1G3QA 1R8QA 1NF3A 1OJLA 1VECA 3D8BA 3IILA 1T3SA 1A1VA 4IOKA 4C2UA 3NTUA 4BFSA 3PEWA 1GNQA 1U81A 2PBRA 4LC0A 1SHKA 2C99A 3MG9A 3SJBA 2ZRAA 4XSHA 1LFDB 1QHYA 4FI3C 3EZ6A 2FGKA 1VKJA 2IT1A 2VYFA 1R0ZA 1GM5A 1VCOA 4DEYA 1ZCBA 1AZSC 1NBMA 3D3QA 2ZS7A 4ZIRA 2VIIA 4QGAA 1YR9A 4Q66C 3DM9B 2QEQA 3A4MA 4B75A 4IFEA 3QVVA 5FFMA 4P31A 4WXPA 3ZIAA 2BCGY 1ZD1A 2YVUA 2QP4A 4GOJA 1DAGA 4QBGB 1G7RA 1O3YA 1MKYA 4Z1MA 5DHFA 4QNRA 3TKLA 1ETUA 3B1VA 4QJ4A 1G3RA 3A4LA 2J7PA 3TMKA 3AGQA 4IDQA 3T1VA 5BXQC 1DG3A 3FYHA 3BXZA 2WMNB 1R5BA 1S4QA 2QORA 2AR7A 3I61A 3MWJA 3ZZ0A 3QIAA 4C2TA 2IYSA 3LBHA 4Q9LA 4CF7A 3I92A 1UKEA 1U8YA 2DFTA 621PA 1U98A 1TF5A 1SKQA 3D7MA 4CIDA 4M0LA 4NL4H 3RLFA 1SVOA 2OG2A 4PZLA 3GFTA 3AVUA 3AKDA 1Z6TA 4B3FX 1DBSA 4BFXA 2E1RA 4BEJA 3TUZC 4M1WA 2X19A 3SYNA 3TGPA 2FV8A 4N0DA 3TLXA 2GBLA 3U6BA 3K0AA 4QHTA 3QPWA 5FUVA 4BE7B 2YZ2A 4JLBA 5IT5A 4D81A 4B44A 3CNLA 5JEEA 2JLSA 5FI0B 3I62A 1HQCA 4Q9IA 2GJ8A 2RH5A 2R6FA 4HZUA 4OI1A 1QHXA 3GJ4A 5JS7A 3ADBA 2VHTA 3L43A 4LJAA 5JI2E 4R2IA 1Q1ZA 2W58A 1GRRA 3VR4A 2G88A 4QG7A 4C3ZA 4JBWA 5CK5A 5JMTA 3CH5A 2RGDA 3CLVA 2BJWA 1P9WA 3DOFA 1E0AA 3TR0A 3AVYA 2QTHA 2ERXA 2KI5A 3A36A 1XCMA 3FMPB 3CIOA 4ZV4A 2IUTA 1U9IC 3KQNA 1TQ6A 4ITRC 4M1KA 5GVSA 1HT1E 2C2HA 4Q1AA 2EFHB 4OQMA 3W90A 5H8WA 5JJKA 2P0EA 2XTZA 2VL7A 3I1FA 1VG9B 3CNNA 3F0TA 4C30A 5K8TA 3K9HA 4JBXA 2BWJA 2F3TA 3IPXA 1V43A 1ZM4A 3K70D 3GFPA 1E94E 2W00A 3O47A 4LX0A 1PLJA 2K5UA 3B60A 3QE0A 5G3ZA 4KITB 1Z08A 3TW4A 3EAQA 3MLEA 1CR0A 3U7HB 4M9ZA 4B43A 2BBTA 2PH1A 1YKSA 4GT1A 4HDOB 4PSKA 1E9CA
chains in the Genus database with same CATH superfamily
2WTAA 1LLFA 2VP6A 2WDZA 3N74A 2FWBA 5BR7A 4P86A 1UOEA 1YMVA 1ZJYA 2IDZA 4KX3A 3TSYA 2GN6A 2EL9A 2C9BA 5E6SA 3SSOA 2AZ4A 2M32A 4NFSA 2J7KA 2QPLA 3IMCA 3P0HA 1AK9A 2GJ4A 4PCVA 1GT91 3KVOA 2OCIA 3OY7A 3WL5A 3KV3O 2Q6LA 3G23A 3JYLA 3LECA 3BA1A 1R0RE 2VUIB 5EWMA 4UPVA 3QVKA 4ZO9A 5FO0A 1NUPA 2C04A 3ZXSA 1VZ3A 1P0QA 4LK2A 3HRHA 2CF5A 4BRZA 4QLOA 3ZWWA 2CSXA 3WO0A 2JLXA 1Q84A 2Y0BA 2LD4A 1ESCA 1T26A 1EESA 4GP6A 1R6DA 3EQ7A 2H4ZA 1U2GA 4V1CI 4Q12A 3K4QA 2A9QA 4G26A 4I1IA 1IPHA 1JXMA 2JGJA 1CJMA 3EMKA 4GGMX 1KOLA 3KYIB 4TSFA 1BU5A 4HSEA 1FA9A 2VYND 4CQNA 4X7MA 1ORIA 3NTOA 4QVGA 1XQYA 1B42A 3AILA 1V71A 1JDUA 2C07A 1ZYUA 2C8VA 2QZSA 3T3GA 4UQLA 4GP9A 1YDGA 1EA7A 1LJ8A 2VKTA 3RTGA 4FJ2A 5KNCD 3VXKA 3IHWA 4GC9A 1HWYA 4LOHA 1KRWA 1C8KA 1CR1A 4QEKA 3GRKA 3TRDA 3SLKA 2CLIB 1GPUA 1HTTA 5CU7A 3BT7A 3QA9A 5SYMA 2ZVJA 1RYNA 4YRFA 3WA7A 2BDUA 1SN7A 2I4OA 3SVTA 1GKKA 1D1SA 2DR3A 3HCRA 5LUBA 3LWDA 5H83A 3F5MA 3L8MA 1CJTC 4IXWA 4WN3A 2PK3A 1CZKA 1SPXA 4TPKA 4D1YA 1ISSA 1YB6A 4X71A 3A3YA 5EXDA 4M6WA 4TTIA 1OHHA 1EIWA 1BDMA 2JGFA 5LJLA 5K99A 3DPUA 4KQWA 4Q9KA 1KMNA 1RAFA 3GPIA 5HBGA 2L18A 1TEXA 1KC1A 1W1UA 3AEUB 3QEJA 1AV7A 4RLFA 4B1FA 3ENZA 1XMOB 4B4OA 1E1NA 1GFIA 1YR2A 3BJRA 3KWLA 2DFNA 2HLDD 4P1ZA 2ZSKA 1TE2A 2V7GA 3KSUA 4K6GA 3PIIA 5I3ZA 1CE8A 1YHZA 3OJ0A 1P81A 5ALLA 4EG7A 1RC8A 2QP9X 1PGJA 1PEAA 4HOYA 1VGRA 2ZE5A 4FHZA 2VH2A 4Y7DA 4HLQB 5JASA 2CLEB 4PCAA 4MWCA 3H18A 1P72A 4G1EB 3JYQA 3HB1A 3CZMA 4QUDA 1S1CA 2BHSA 2NT4A 4IX9A 4BNTA 3AJ9A 2YN4A 5K6AA 3CEHA 4KI7A 2ZJOA 3X1WA 2DBVO 3Q3GE 4GZ5A 2XKKA 3LZCA 4HK4A 3RR2A 3COJA 2BBSA 3ZJVA 4A91A 1H3FA 5IT4A 2YVKA 3DULA 3GYGA 4IO0A 4B4VA 4AY3A 1PJBA 3E3NA 2P1ZA 4DPKA 2Q7XA 4ZV7A 3S70A 1U0HC 4EPYA 4DCTA 4NBVA 2C84A 2I6XA 3VYUB 3EF1A 4BFWA 3T1OA 1FNSA 2PUHA 4BP9A 4NYMR 4M0UA 1U1FA 3U3JA 3NBFA 1CUJA 1RFGE 1EVZA 1NXTA 3K35A 5ITZA 3L5KA 2I3GA 3CRW1 2EWWA 3VISA 3W4IA 2XUZA 3JD1A 2PZGA 3OD1A 2RHDA 1CX9B 4I50F 1G5TA 3M49A 2EGGA 3KJZA 1V5FA 3ZJ5A 2PX2A 5B7GA 1NDHA 2RAUA 1V3QE 3GJQA 3VPGA 3WX0A 3JTEA 2YJTD 3BGIA 5JTTA 3IVGA 3SY8A 1F2UB 3F5SA 4PINA 5CYFA 1QP0A 1R88A 1WUIS 1Y3IA 5A06A 1UK6A 3LOPA 2A0UA 1MIOA 4JV5B 1LBTA 4LJSA 2AEMA 4BATA 4H7PA 1XNRB 2Q4RA 2EL7A 3GBVA 3IBCA 3HU1A 4ZRNA 1HE2A 4J49A 4PPYA 3HXTA 4TS1A 2PVCA 1DXOA 3G5LA 3KYCA 4L28A 2D1YA 4LRSB 6REQA 2FN9A 3KU1A 4XIFA 3FIJA 3RKSA 4N49A 4KOEC 4YMVA 3DDNA 5EGNA 3QLUA 2I6QA 3NWBA 4BNDB 3SZMA 4U7WA 4KQ6A 4BEVA 3JYHA 3ZXUB 1N7JA 3VNAA 121PA 3SHQA 4WSOA 1V6AA 4ZXPA 3QE3A 4BNMA 4AROA 1FY2A 1RWKA 2PRJA 2QQFA 2XVMA 3CRMA 4M60A 4NYJQ 4P7GA 3RSQA 3TSCA 2AJDA 1NMZA 1X7ZB 3T38A 4DC1A 1Q44A 4S1PA 5BWCA 1QFMA 4JYCA 2R8OA 1NXOA 2CW5A 3OJOA 3EDCA 5A6SA 3KZOA 4BLSA 2QV7A 2OV3A 2A14A 5JVDB 2Z56A 4HN9A 2RMKA 3AUYA 2OGTA 4U1RA 4ETNA 1O4WA 2Y9MB 3V3KA 2KLBA 3L0BA 1UBEA 2HRQA 1FTGA 1FQWA 1QIIA 4MKHA 4WESB 2ZRQA 4F96A 3LKVA 1PJ4A 2ORVA 3HSYA 3IDQA 2RHHA 4MGHA 5K3BA 2RGUA 3L1JA 1RXCA 4WXYB 4EAQA 2AN4A 5BWOA 2XVYA 4S04A 5B2FA 2X9VA 1KVTA 4ZAYA 3TM5A 2PAFA 3FPAA 1R18A 1IG0A 1NKVA 4R1MA 3FA2A 2QTAA 4JH0A 2C98A 4LYHA 3RJZA 2UZIR 1RI5A 4AJJA 1OH7A 3QXGA 3R0QA 4MV7A 1RMTA 1YO6A 4CT5A 4JP5A 2ZRCA 3QYJA 5INTA 3PDWA 1TGVA 4OUDA 5JTUA 4QL3A 1XA3A 3I8XA 3E7DA 3BHJA 2QRGA 2Z2XA 1KPGA 3V4VB 1IU9A 1GLVA 5E7JA 1E9BA 5L3QB 1QZZA 3CXUA 1R27A 2G07A 4L74A 3GFQA 4B32A 5C46F 1IOLA 2HWUA 3ONEA 1DU4A 4QUEA 4QYIB 4BX9A 4EVSA 4KNYA 1WBDA 1C3VA 2PMDA 3KUCA 4WXHA 1T5HX 3UWOA 3WFJA 1X0VA 3K09C 1UM9B 3ZV6A 1CG6A 2SHKA 4P36A 1HO3A 1XDWA 2YWBA 1F2DA 4CPDA 2B34A 2JLUA 3HVHA 1VJGA 5FXMA 3I2GA 3W1VA 1PWEA 1PR9A 1OFUA 2GPJA 1QQ7A 3HA7A 4U7TB 5D3QA 1L5LA 1JFFB 4UHCA 4EYKA 2QJTA 3IQHX 1T43A 7ABPA 5EEHA 5B53A 3AVXA 2B37A 3E27A 4ARZB 2D2FA 1FOEB 3VH1A 5M04A 2H16A 1PFGA 2NO9A 3IPAA 3R9WA 5GOZA 3ZWDA 3UG7A 1IE3A 3WIVA 2IYZA 2ZFUA 3OLZA 4J29A 3M7IA 5ECYA 4ZVSA 3V4LA 5BMVA 2BGIA 2QUBA 3Q7IA 2JI6A 2XNDA 3KXLA 4TT3A 4CEIB 4KACA 1L5NA 2WP0A 2O8BA 2YNMC 4G56A 5B30A 3NBUA 3H2YA 5AW2A 4BJ1A 4FQ8A 2RGWA 3CO0S 4FHCA 4LRUA 1RE0A 3B2QA 5EJ5A 2IZ1A 1IC6A 2QKYA 2CL0X 4GXRA 4IICA 4GEKA 2XAAA 2WC1A 3KKNA 4LGYA 5FO1A 2E4XA 5JADA 2HHCA 1IONA 3DE3X 4A1OA 4X90A 2DP4E 2DT5A 1BYIA 5JSYA 1G9XA 3EEFA 3W8NA 3NIFB 1QWOA 3OQVA 3CVVA 2AK3A 4JUCA 3VKHA 2FCRA 1LV8A 3A1UA 1Z6GA 5A05A 4B3HA 4KFRA 3IBGA 2FEWB 2IDJA 3V8QA 5J2UF 2Z8YA 3AUSA 1U99A 2I8AA 2ZSDA 2JEZA 3PKZA 4G86A 1G2QA 4G97A 3TTXA 3SKXA 4AT1A 4BRUA 2PUBA 4MV4A 1UQTA 1UINA 4AUKA 1ST3A 3F46A 2NQ2C 1RPNA 3C8ZA 5ADHA 4M38A 4U7FA 3ZTTA 4QXOA 1V2GA 3N53A 5AXAA 2C2MA 2AHRA 4QEZA 4RZXA 1BO6A 1J0XO 1NVVR 3OT1B 1KP3A 4GPTA 3RKRA 2GAIA 2B4YA 2O3RA 4KXNA 1N8KA 3DOEA 4LYYA 4EB3A 1JG7A 3VNVA 1VDZA 2QF7A 1JBEA 1XXLA 2C0CA 2IP1A 3ZHCA 2QRNA 1MBZA 3CZ9A 4YK7A 3T4EA 2OESA 3TE7A 2B92A 3ZD7A 1TA0A 2GTIA 2GTHA 5BN1A 3BQ9A 3FHOA 2E6KA 5H59A 2GAAA 3QW4B 4X24A 5JH7F 5FOVA 3EIQA 1WW2A 4LW8A 1UPUA 3DJFA 3PEEA 1RLUA 1W73A 4GOLD 1DP4A 2IXFA 5LNK6 1J2UA 1C1YA 3SZ3A 2C2ZA 5JANA 3ENNA 1DL5A 4B35A 3OZAA 4L85A 4O0LA 5B6JA 4KOAA 5F3WB 2MMGA 1DWOA 1XR3A 2D54A 3BXPA 3JWEA 4H7DA 4G9BA 4LS3A 5DHTA 1NATA 5ICCA 3RARA 2LW7A 3H4TA 4LPSA 5IJ9A 1SCDA 4J91A 4MIEA 8OHMA 1H4QA 3OI7A 5AM1A 3RU3A 3TR5A 2XX3A 2I7XA 1UBKS 4EMTA 1QCZA 1EFVB 1H22A 5AJXA 3ETHA 4YASA 1KH1A 5AQ1A 1A76A 1X7XB 2QVZX 2BTQB 2FUG6 4WXEA 1XXHA 4BV3A 2IIQA 4LRXA 3VTKA 2VFAA 3QYPA 2C2WA 4DLYA 4NAUA 1TCVA 4J2HA 3GELA 3RYHA 4D5GA 4FILA 1RXUA 5CJ2A 3UAGA 4NMLA 3B52X 2QXUA 4H7KA 2BL4A 2QTZA 5CUQA 2EDAA 3CZ4A 1VG8A 2G36A 3F9IA 1O9BA 3SQXA 3HA3A 2WJYA 4KE9A 4IKPA 5KDLA 4B8WA 1ZGAA 3EIWA 1TCUA 4ENVA 1O94D 5A4JA 3QFTA 4FOSA 4CUJA 1Q7RA 2IQ5A 1I2ZA 1MX1A 2H7CA 4AUNA 2OLEA 1MABA 4GGPA 4KN8A 4OHVA 3OPVA 4X7BA 5AK6A 3SR4A 1J20A 3GBPA 3OQIA 5G4KB 4G4GA 2O8CA 1JB1A 2BGTA 2BEVB 4J1TA 5BPFA 1TAQA 2EP8A 1WABA 2NT3A 4YJGB 3WHPA 1Q1NA 1A7JA 3JQ9A 3N58A 1U3CA 5ALOA 5AVUA 3HMKA 1Y5NA 4X7PA 3EYWA 4TS4A 2DTXA 2GFQA 3B1XA 2XMGA 4JP8A 5F77A 3WMFA 2HF8A 3LDFA 4OXYA 3T99A 2BGGA 5FA6A 5HRAA 2XZTA 1ULSA 2ZPTX 4JT4A 1TPYA 3DLBA 3TIGA 1JKJB 2QX8A 2Y6UA 3PQ6A 3CR7A 1FMTA 1W85B 3L1UA 4MI9A 4XH9B 3Q9UA 5MGNA 2B4TO 4ALKA 2BM8A 3WZ2A 4WW0A 4P81A 4DM3A 1AOXA 5TB5A 4PZZA 2W2NA 3S28A 5JQGF 2JJ8A 5C34B 1UXIA 3ENVA 2SKEA 1UOQA 4YBRA 4YAIA 1YR3A 3FNIA 4B8YA 3CXRA 4AUMA 3NHRA 1RQ2A 2A1UA 3F9CA 3WGVA 4DNQA 3OF2A 1SVNA 1G5FA 1G5HA 2O5RA 2YFKA 2ZRBA 3ECCA 4MRRA 5I4IA 1ID8A 2Y1OA 3DLAA 4HH1A 2JFQA 4I08A 4KQIA 5LU9A 3HWRA 5AUOB 1JEOA 2JCYA 4D80A 1NURA 2GCNA 3JD4A 4JDPA 4RTQA 1VRVA 4AN1A 5CNMA 3KAJA 4PR0A 4II2A 4XASA 1YR8A 3ZIDA 3HKBA 5FWXA 4D56A 3G5MA 3UEOA 1VL0A 4FB4A 5EL0A 4NIMA 4RK6A 4JWKA 4US1R 2NTJA 1OIVA 2AJ8A 4OF4A 5L6MB 4OHXA 4CKYA 4YMIA 5LP1A 3VSAA 3O2QB 1FFCA 4CTNA 1G2OA 2E2WA 5EQJB 4OA5A 4XD7A 5FLYA 5KOHA 5LQDA 4IDNA 3RI3A 1L3BA 5K6TA 2EBWA 1XTKA 3MWDA 6YASA 1JH9A 1XJ0A 4UCFA 1W7AA 1MPTA 1BMTA 2PGAA 4WBNB 1C8BA 4ZYLA 3ZHZA 1PWHA 1TXGA 4YRIA 2V97A 4K9NA 2PCJA 2ZJ3A 1NBME 1KA9H 4GWLA 1BCSB 4BQQA 2JAOA 3G9ZA 2WWWA 3GEDA 2J9ZB 4DTCA 3LUCA 2QYTA 1IWOA 3OC6A 1KQGA 2Q4OA 4BQFA 5ENVA 2C3PA 3FRIA 1YKGA 4LQDA 4QECA 4U0KA 1JVNA 4RULA 2JAHA 3FSJX 4X1IA 5JD6A 1KQPA 1Z2PX 2AH5A 1Q6YA 2CXQA 2ZU6A 4PG6A 5AKZA 1R10A 1TX4B 2BFEA 3NYIA 1B41A 1A8HA 1RLMA 3PFNA 2JBHA 4M1ZA 1CQZA 3TIFA 3WQBA 3EYAA 4RFLA 4RXTA 4DG5A 3ACCA 1NLFA 3ORRA 5ER6A 5K2MA 3PQEA 1BKSB 5ALSA 1Z2DA 4DCSA 2G4LA 2GNOA 3QELA 4HQ0A 3S5JA 2PKCA 3OC0A 1SIWA 5GP1A 3DE1X 5F2NA 3BRQA 3P9CA 4WKNA 2ZSFA 4NOJA 4FYPA 5HPYB 3CIFA 1SRQA 1PEKE 1OILA 1YZNA 2B4AA 2WIGA 1GGKA 2I9PA 2Y2UA 3L41A 4LVOA 2CVHA 3MWEB 4KR6A 1WCXA 1E9AA 2W48A 1YR6A 2OBFA 3L40A 1GPNA 3EASA 4XYEA 4X3CA 5B1DA 4NZMA 1MTOA 2GF0A 1DC3A 4AO6A 4B7XA 3TLCA 4F3TA 1EE2A 2BF7A 2HO5A 1J8QA 1UPXA 2VJAA 5F78A 1K3FA 2H17A 3IIJA 3PR3A 4JEMA 5A7GA 5TJHA 1AUVA 1VJTA 1FU7A 4RL4A 5CCEA 3KBBA 1AJEA 5AXDA 2FSFA 2GZMA 2QSYA 1DV2A 3FFBA 3O94A 4ZHQA 4YREA 3B9BA 4NU5A 5KWIA 2BMEA 4K0KB 4TQGA 4X45A 1CY4A 3VR1A 4JLKA 1FYXA 1EUZA 1XQ1A 3ETGA 3OMLA 4AQYB 3L6UA 1TF2A 3ND5A 1MXFA 1J33A 2JGRA 4UUAA 4EB6A 3DFUA 4U7DA 3D02A 4MVJI 2O7RA 3GPLA 1UZLA 4NABA 1C2YA 3H6GA 4FDAA 2F67A 4JC5A 3NG1A 4DLAA 1EFLA 4F3KA 3KB1A 2E4VA 2VT3A 1XQ9A 2FG6C 3U17A 4YRKA 1HE1C 4NCIA 4IHJF 2EKDA 1EXMA 2GSWA 3KVVA 5CYPA 5IBRA 3ZE8A 2QVGA 5A5DA 3AERA 4KDRA 4LCJA 4PRZA 4EGSA 2NU6B 5FJIA 5K8LA 4B3TB 4UUOA 1X39A 1ZLXA 1KAHA 3BRSA 3ZK9A 4OHFA 1FFGA 4BQIA 3G1TA 1FX0B 2VYCA 1AUOA 1F8FA 1PT5A 3OJWA 4DIDA 2WOJA 5HKKD 1RYMA 1BVRA 1QQTA 1SVIA 2D7CA 3OLVA 3LYAA 4U39A 2CL6X 2FPIA 3CCCA 1FP4B 5ALNA 1UBUS 4F4FA 1ZD3A 3BILA 3DZJA 4L4ZA 4V0LA 1RNLA 4QWWA 5KQRA 2IZOA 4ZVLA 5DXJA 1K86A 2GKGA 1QUFA 1HFEL 3DTVB 1J2YA 4S1VA 1BKYA 1L5VA 2FPRA 1A5AB 2FRDC 1KY3A 2V74B 3FF1A 1UMBA 3NM6B 1JKMA 2GCEA 4KVAA 2OCGA 4YCLA 3U9LA 1WCV1 2I80A 1WWKA 3SBXA 1B1AA 2QG4A 1I7QB 3FM9A 3FYSA 3W04A 2AJTA 3CJRA 3P2OA 4XYGA 4BS9A 5L4NA 4CODB 3B3QA 2R8ZA 2GD6A 3ERCA 4BKPA 1CHNA 1K89A 5KU7A 4WA8A 4CFZA 2P3SA 2ZCJA 1P0FA 4AD8A 4QUJA 2AZXA 2AR0A 4RENA 3DOCA 2IIPA 4JBLA 3W3ZB 4CL0A 1N78A 1G41A 3MTAA 5CVJA 2XMCA 2UZ1B 1MOSA 3HJNA 1HQKA 1SXJD 2FPPA 1Z6ZA 2EJBA 1RHQA 4HGYA 4OFXA 4RPHA 5FP0A 5KHAA 3RS7A 3SFZA 3H3XA 2OFFA 3TNYA 5JYCA 4J7CA 1WX1A 4TVSA 2UUPA 3MMZA 3N59A 5CPBA 5IJXA 2Q9AA 4RPIA 1Y1QA 3DVSX 1HFJA 4R5MA 2ZRHA 3SDBA 1DCTA 2EVWX 2QTCA 5DGCA 1VMKA 2GVNA 3JWJA 3T1TA 2V3CC 3QTTA 3E22B 4IH9A 3FBWA 4JI0B 1PV2A 2DFVA 1XJWA 5KQMA 5CA0A 1G7CA 5KSYA 4KWEA 4FDUA 4R0NA 4F38A 5BV8A 3I3SR 5KC8A 3FUWA 3U1TA 1K7FB 4D7AA 3RYCB 3H5LA 4DSNA 4MKFA 2OZLA 3LL4A 2PHZA 3P32A 5JSQA 4ZO4A 2E3JA 4GD3Q 1Y1PA 4NJMB 4YXFA 2Q5CA 1KEEA 4PRKA 3UPUA 3FCOA 3GZNB 4U00A 3WK5A 4X97A 3C7KA 1B8UA 2QXTA 4GE0A 2AW3A 4N9WA 2D5LA 1PBNA 4LJ9A 3ZEIA 3ZWNA 3QM1A 2ZIUB 2J3HA 4K9MA 4MUBA 2A9VA 4KL8S 1V4NA 3UWDA 1H66A 2ZUWA 1B1CA 2C4UA 5KKAA 4Z7OB 2B94A 2RFLA 2O1WA 5A3SA 3KJIA 2AOUA 1MT0A 3K09A 3RBVA 3TTWA 1VIVA 2P5TB 3K5IA 4MWDA 4WINA 1M7BA 1ULHA 3O21A 1P62B 4FNMA 2ZAMA 2EX4A 4FFLA 4DSTA 3PDHA 1FJGB 1AK2A 2XGOA 5FF9A 1GA4A 3QY9A 2V45A 2G1PA 1FPQA 1U1CA 3RJTA 3D2CA 5F2EA 3ZUGA 1G3IA 4P98A 4RQBA 2R5FA 2X41A 3BB1A 4CI0B 4X94A 1Z7WA 4XD2A 5IT9A 4JB8A 4FFMA 2YWDA 2GZ1A 2WYVA 3L6BA 1LI7A 3G88A 3OF5A 3OZDA 3X2FA 4ZZ1A 2BGKA 1OBOA 1D7AA 3RSSA 2ZXEA 3BE4A 2V5VA 5HJEA 4UTOA 3QK7A 5EHXA 5FIUA 5DM2A 2Q5FA 4Z9BA 5LXTF 1UQUA 4RKEA 2JH3A 1ZPDA 1VSUA 2YNMA 2X5NA 2D3TA 1UP6A 3VQTA 1TM1E 4ND6A 3EC1A 1Z0SA 2XOEA 3TO5A 2GPAA 4U6NA 2CFTA 2VG8A 2PXCA 5L4LA 3ELBA 3PQ3A 5HQ3A 3LWZA 1EGMB 4UOEA 1ZH0A 4PV7A 5J40A 1FC0A 2BR3A 2WFZA 2W2QA 4PWYA 3ZS8A 1IDN1 1QVWA 3TW6A 3JZAA 5BSMA 3OCCA 1ZQ9A 4QQRA 1X1EA 1KHTA 5CR9A 1AQ6A 1SJ9A 1KMCA 5TV2A 1CQIA 4FWTA 3MF4A 3R1IA 4MCAA 2QR2A 3U48A 4BMDA 1MRZA 2P9EA 2YFHA 4FNAA 5JIBA 3WNBA 3RF7A 4DE5A 3HMQA 3VX4A 2K7ZA 3LM8A 4CG3A 3R7SA 1E7QA 2BUBA 1UJ6A 4NK5A 1QKIA 5AI8A 4E14A 4D99A 2P6UA 2WBLC 3HXKA 2R4TA 2O07A 2ECPA 1ZK4A 1X77A 3P0RA 3U81A 1ZUNB 1JHDA 4V0KA 5ICSA 3AM5A 3ZBUA 3V1KA 3BAFA 4ER0A 1EP2B 3P94A 2DY0A 5IVIA 3GLIB 3A1CA 4W5HA 1O94C 2ISSD 2A86A 2ZAIA 3N7UA 5L3SB 4YALA 1KERA 2GILA 3AETB 2VNHA 4MROA 1I13A 5IF9A 3LT2A 1ZCJA 4HR7A 5KOYA 3QE4A 5EVJA 4AY4A 4ARAA 1E79A 3L84A 3X3HA 3ED5A 4MW9A 1BX0A 2Q3JA 5IAEA 4BXOA 2JLVA 1KJJA 2XZDA 3BJZA 3FOAA 4CCWA 2W6PA 3PITA 1QRTA 2QRVA 5K2OA 1LSUA 4QPPA 3WFZA 1KSGA 4J6FA 2DZDA 3PGA1 3KYBA 4KMRA 4YMGA 2HJVA 2JA1A 4PU0A 3SEQA 2H4WA 2A7QA 3OZGA 3Q2OA 3PTAA 2KW5A 4LA4A 2IV2X 2QN6A 4BNGA 3VR2A 1FLDA 4UUNA 5F2KA 5DI9A 1F8YA 4AY5A 1GOTA 2BI8A 3SIRA 1QGYA 4KWHA 1Y1TA 2QZPA 1A9XB 3OICA 3OQ1A 3QU7A 4AW9A 3HO1A 2B98A 5KNCH 1KI2A 3QFCA 3L7CA 4MVWA 3L7NA 4FEGA 1GZDA 3PPXA 4C5AA 2CFOA 3F8WA 4CLHA 4UTNA 1DO2A 4JBIA 1MLDA 2B20A 3GUZA 2O2DA 1L5WA 2PTGA 3UPTA 4FDTA 4HNHA 4NOMA 3WGZA 1YVPA 1BVYF 1RAIA 2OWDA 4QE3A 1BWPA 4Q03A 5EJ8A 4TV8A 2WG1A 2M2IA 4F3RA 1QJ4A 4U5XA 4WNCA 4ZT7A 2Z2ZA 5B2ZA 1LRJA 3GB9A 4R2KA 5J4KA 5FJJA 5JT1A 1PJAA 2FPGB 4LCBA 4WIAA 4YIKA 2FEKA 3HFRA 4F60A 1Q12A 4E08A 2IK8A 4TWBA 2IPOA 3VVCA 3WLIA 3KFLA 4M7PA 5K0JA 1YJCA 3SIXA 2P4UA 1LNQA 2ZUBA 4IIFA 3R8XA 2VAMA 3OJFA 3PXDA 3USZA 1Z63A 4TLLB 2I22A 2ZRFA 1LZKA 1ZOIA 2Z4TA 3G49A 4M4SA 3PEUA 2ZTMA 1IJFA 1OI7A 4TQ9A 1JKXA 1ZCZA 2CLLB 5DT9A 3FOWA 5CPFA 2RIPA 4UHEA 5TX7A 5MFZA 1RLOA 1XN4A 4P4TA 8ATCA 1A2QA 1RKBA 2IOHA 2ZJ5A 3G7SA 3CWZA 3KE9A 3LLMA 4KTTE 2G9UA 4MKRA 4UU7A 4GM4A 2WAAA 1H93A 3AP2A 4AJNA 2K4MA 1L5OA 5ALVA 1JA1A 1S3IA 2PAAA 4NOKA 1Y9JA 3BQMB 3A28A 1EK0A 4REQB 2QB5A 5DPMA 1V0JA 4KSYA 4ENUA 1P2DA 1QFJA 3BJMA 4TMYA 2VYNA 2G5CA 4TM7A 4CCYA 1Z4JA 2E37A 4Z8XA 3DGEC 5EXSA 3NEPX 4ECAA 4L9WA 3NVKI 3ZX5A 2MHCA 1Z47A 3ZI0A 4F97A 4JC4A 1COWD 3NUZA 1DINA 2B7BA 2QV0A 4MJ3A 4XM2A 5JRJA 1JRLA 1FRNA 4XJVA 4DIUA 1VXOA 3U2QA 1VCMA 3AFMA 3ROPA 4YUXA 5KNCA 4AYXA 1WOMA 3OFJA 4LQLA 4OAOA 2BGUA 2CLDX 1EFPA 3ROXA 2JLBA 3VDMA 5M5BA 5DHPA 3M4YA 3IR6A 3ET5A 4XQ0A 4RAOA 3CWQA 5LQKA 1MC4A 3LP5A 4GSLA 3KT8A 2H2HA 5IC6A 1T4BA 1L8OA 2ERCA 2PL9A 4WZAA 4XLZA 5I5GA 1ZD9A 1PT6A 4JS0A 2BKEA 1T4GA 2XVAA 3IAM6 4NCAA 3M1IA 2HI0A 2BE9A 2I7DA 3CMCO 1V96A 3V4ZA 1U8AA 5C1PA 2Z3ZA 2XGSA 1PSDA 4Q16A 3GA5A 3EMDA 5J2UA 1EBBA 1ZK2A 1T9GS 4EUNA 3PC6A 5JLJA 4C0WA 1JR3E 1Y3DE 1WRBA 2OSBA 4GKAA 4KB5A 3V6LA 4BZZA 1HDOA 4RM3A 4QSHA 4LZNA 1E7YA 2HLDA 3O4VA 4KN9S 4DQ0A 1JIIA 1P0PA 2ODNA 3TNDA 2DAPA 1S8FA 4FB5A 5JWRA 4Z4QA 1X7YA 3LU1A 5KYVA 1JEYA 1D0SA 1PFVA 4YMSA 4XVUA 4V03A 4S1TA 2R1TB 3DHNA 3UAVA 2WPDA 3FCEA 4RS3A 1RHJA 4AQDA 3CX7A 4QWMA 5JMOA 1CUYA 3VZQA 2X5OA 3A2KA 1UPBA 4XB2A 1Y1RA 4FLFA 3ZCXA 3HBNA 2HF7A 4JEIA 2IQIA 3L6DA 1S8NA 3K1AA 2PU5A 4GOOD 4KR0A 1PK9A 3OM9A 1WG8A 4Z7NB 1J09A 3ZHSA 4KFUA 5E38A 4MPPA 2XRZA 4LF7B 721PA 2JCGA 2M6KA 1B6RA 1E9SA 1TUIA 3BXOA 4H77A 4OM7A 2OR3A 2HOQA 1AY0A 3RC1A 1UT6A 2CNDA 2FX3A 2VTEA 3I9NA 3BZUA 3GA0A 2WIFA 1B0UA 3O1LA 1FTSA 7MHTA 2Y1FA 3K16A 3NBZC 5AVZA 3O4HA 3FPSA 1FTYA 4L2IB 1X2EA 2GK3A 3IA2A 1LB1B 1U0SY 2HLNA 4N8EA 2A0YA 4B7AA 1WVGA 4NG5A 1MVLA 3D6UA 3FUCA 3RBZA 2XB4A 4FBLA 4DB4A 1UJBA 4C7VA 2VSYA 3UT6A 2AWNA 5REQB 3M5CA 4DWOA 1X1AA 1JQJC 3RUCA 3DAOA 4QAQA 4A2QA 5FV4A 2XYGA 4JGIA 2PLRA 5A0TA 4YS6A 4C06A 4DV1B 4JVSB 1ESZA 4MA4A 3RVOA 3AL0C 1YCDA 3KYDB 5F3RA 1KKLA 2W22A 3DR5A 5KKCA 4ZQCB 1U04A 1G5IA 3EGXA 1N4AA 1C1DB 2FEPA 2WA2A 4XDHA 2WVHA 4QM7A 1DEKA 2P0AA 4AMBA 2EFDB 2QN9A 3UJBA 3NYWA 1UPCA 3KJQA 2GS9A 2WB2A 1JJBA 1FDOA 2F00A 2G0AA 3OECA 3A2MA 3PNKA 4L0QA 1JW9B 3X1YA 4M1EA 4GRDA 2J5BA 3O0TA 1H4TA 1KDVA 3RVPA 4CNQA 1G8PA 1IHXA 3RRZA 1BEZA 3A9VA 2Z9DA 3GLRA 3PNMA 3WYDA 1LDNA 4ESVA 3DE5X 1JPVA 3NOXA 1LLCA 1KI6A 3E7FA 4L5AA 2I3BA 4M8LA 1S6YA 3EDYA 3KEMA 4R1PA 3ILXA 4QQKA 4RDHA 3KFVA 5DYGA 5TGTA 4K03A 3N7AA 5EXPA 5HM6A 2IBSA 1HDIA 1VIYA 5HG0A 1P9NA 1R8XA 1BEUB 3EE6A 2PX3A 4BX2A 1SXJC 3SKVA 4OP2A 4MICA 3I76A 1U0BB 2E49A 2R68A 5EUBA 5HCUA 3TDKA 3LLVA 4HFMA 2OO5C 4NCKA 3M5DA 1N2CE 3ND8A 1ZS9A 2IU0A 4BY9E 1FRFS 2IZ7A 4B6FA 4GUDA 3UJPA 5G1PA 3SJAA 3IV6A 1NPDA 4EY7A 4W99A 3EG9A 5B4VA 5E0OA 3K70C 3TGLA 4GNRA 3IIIA 4ZOLB 4O1MA 4E31A 4XQ9A 2X8BA 1Q77A 2EG9A 1X8XA 2PRKA 5GONF 3WNZA 1IN4A 3A9RA 4O4LB 2QNRA 5EQDA 1YZ3A 3JARA 2J3DA 4Q4CA 3RAEC 1QF6A 3L0CA 1O8BA 1VA5A 5D6OA 4LE0A 3KZMA 5BWLA 1IJBA 4Q7LA 3I8SA 3RT7A 1U28C 1ICIA 4OXRA 2FRDA 3AGPA 1PHPA 1TD1A 4MYCA 3IUBA 2ZBUA 4UXIA 2VPYA 4Y1RB 1GPMA 3DMRA 4MW0A 5DN9A 2WAOA 3QFSA 4HQLA 1V3VA 2NX2A 3LYUA 3LC0A 1BMFA 5T8KC 4C2BA 1C9EA 2QUIA 3FXAA 1GEGA 5FI1B 2A0KA 1CY7A 1JFLA 2QUZA 2YTZA 3ACDA 3DV0B 4DA0A 2AF3C 3V2GA 4F6RB 2CL7X 2V7VA 4R2LA 3FVVA 2W0MA 1P39A 3EPPA 1IB6A 2Q41A 4NPHA 2C2OA 1OGIA 3IDZA 4WXMA 2MINA 1P18A 3LY9A 1X7WB 4K9DA 1GG9A 3L6OO 4IGAA 4IS3A 3AKYA 5ALUA 2QN8A 3RBXA 1DX9A 3EXG2 2XCUA 1DJQA 4ACBA 1A04A 3IBYA 4FXOA 4DANA 2AX3A 1L5QA 2VCYA 2VDOB 2PMWB 221PA 1WB4A 2C5GA 3KLNA 3DBVO 3ITNA 2HMAA 3OZXA 2ZYGA 3P1JA 4IWNA 2H06A 4IR7A 4P80A 3T5DA 1Z3CA 3VDQA 4WCVA 1CXZA 3NNDA 3IHKA 4L0CA 4RU1A 4RSMA 2KJQA 1JBQA 3ZW9A 1D1QA 3U44B 1D4OA 1YFZA 2JGIA 4IVQA 4DF3A 3P2YA 4EEKA 3ER8A 4KC0A 4QA9A 4QPNA 2Q5LA 4HBZA 3C6XA 4IUCS 3EXIA 3N8DA 3TQIA 3G5UA 1ZNQO 4UFOA 4TRRA 1TAUA 3O82A 3TOCA 3VKWA 4KQXA 3AHDA 4G4JA 4MDHA 4Q37A 1S9DA 3WGNA 1IZZA 5GADl 1X0XA 1EE1A 4ZWNA 1S7CA 2J5KA 1P4AA 2FJPA 1HF3A 1EUCB 2OQRA 2Q6VA 3AUFA 4MYRA 1GUDA 3DEAA 4MSUA 4RJLA 4MO9A 2CJXA 2V5UA 5HKLA 1Q57A 1J2JA 1VCIA 2ACEA 4DDVA 1ZI9A 5FPKA 1UXHA 3V8RA 1RWWA 3G0DA 1P4JA 3UHPA 2WJVA 2C3UA 5K0FA 3FE2A 3BL6A 1O97C 3M6XA 4P5EA 4TKUB 3AHHA 1MEJA 3OY2A 3EEOA 3AU9A 3I83A 3BX1A 3RFVA 5IHPA 4COOA 3JVVA 4GLLA 1Z5VA 2V54A 5H0IA 2ZCUA 3HCNA 4BQEA 1IVNA 5GGYA 2O6LA 1SKMA 3R5SA 4EG4A 3PICA 3LHDA 2WY2D 5KYWB 3FNQA 4J43A 2I5PO 4D9JA 4FN4A 1ZGZA 5LP6C 4Y0AA 5H7XA 3VR6H 2QLTA 1L1EA 4CQLA 4EI7A 3AKCA 3INNA 3NPMA 2C9YA 1I1OA 4C6TA 4C7KA 1ZOOA 2HUNA 3MC1A 3LY5A 2GD0A 1E7RA 1Z4MA 2WQ7A 1A5ZA 2GXQA 1SA0B 2JKYA 3PT9A 3TNLA 3LTNC 4QELA 3LF2A 4QKQA 1Q2XA 4FOOA 3UIEA 4OXKA 3HH8A 2B4QA 3AFOA 3NHPA 2V6FA 1Y7HA 2X0IA 3N6RA 2HU5A 2BGJA 1OVMA 3CISA 3CCFA 2JH9A 3OQOA 3D7LA 3F67A 3S6JA 3G8AA 3ZWMA 2F3PA 2O7QA 2PPVA 2YIDA 4BVAA 3LUAA 1JDNA 1GRCA 1Z13A 3E6AA 1GXSA 2VDUE 3ZHTA 2RJ3A 5BWNA 1L7RA 1N36B 4YP6A 5TS3A 3CEPB 2FWMX 2YN2A 4QICA 1XRRA 1SCIA 1YRQA 2Q8QA 4DARA 4F4HA 2FMFA 2J3MA 2MTBA 1M6VB 1VHQA 1F3OA 2HFKA 2ZITA 4FNOA 1YRLA 2W6MA 4TT8A 1KMHA 5C8YA 5LNK1 2G6TA 5HBRA 3TSAA 1EMDA 4BMPB 3FBTA 1E0JA 1T10A 3DQQA 5ENDA 4KO8A 4EELA 1CLUA 2HU2A 4YRRA 5F12A 3BH0A 2I9KA 1N0HA 3OLXA 2G71A 3DSRA 4XR4A 4TMFA 4GKVA 3QMVA 1ZC4A 4EHHA 1QFYA 3CZPA 1UPAA 2CJYA 2Q6TA 3OTHA 5FKJA 3NHUA 3QEKA 3C8HA 3M6UA 1N2SA 2OAP1 2ONKA 1JXAA 1HORA 1DJPA 2R2GA 2FUG1 3FJOA 1O94A 3G02A 1ZRMA 3GP5A 3Q5EA 4ZRDA 1RLJA 1WO8A 5JXJA 3I23A 1QV7A 3I45A 1NMXA 3W6PA 5B1YA 3RTBA 1SC1A 2H4YA 3DHYA 4INZA 4UU8A 5B3JA 4BQOA 2O7SA 3NYRA 4R41A 5CRIA 4KDFA 3UXYA 1QRRA 4Q3BA 4RQUA 3LVFO 3VU9A 2GCOA 1ISFA 1LK5A 2ZIVB 3IP5A 4KIJA 3RUHA 3TG2A 4BP1A 1WS6A 2IH4A 4A92A 4RX1A 4B76A 3JZDA 3JQQA 1ZN2A 4I1RA 1CT9A 1DE0A 1QG2A 3Q3VA 2CCGA 4ICIA 4IOJA 3PCTA 1UJNA 4N39A 4UNQA 3TTSA 4EJMA 5IT0A 1WPQA 4BKMA 4M8KA 4FFDA 2WHQA 3OX4A 4LFCB 2QUKA 5D5HA<