1R0WA

Cystic fibrosis transmembrane conductance regulator (cftr) nucleotide-binding domain one (nbd1) apo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
281
structure length
266
Chain Sequence
TGIIMENVTAFWEEGFGELLEKVQSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSSILTETLRRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure of nucleotide-binding domain 1 of the cystic fibrosis transmembrane conductance regulator.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 90
structure length 266
sequence length 281
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1r0wA00
4JBWA 1HQYE 3EX7C 5FUWA 4ASUD 5C4GB 1HH4A 3U7HB 1RW4A 2QTHA 1UKEA 5G3YA 2OFWA 5B64A 1CKEA 5KSOA 2GK7A 4A8JB 2N46A 1Z29A 4Q1CA 2BWJA 1E2LA 2FU5C 2RHMA 5TB5A 2PBRA 1NVVQ 2GJ8A 4TZ6A 3U4QB 3B1XA 2AK3A 5JS7A 1GWNA 3N2EA 3C7KA 5L3QB 2XXAA 2ZRJA 1E9DA 5L3RA 5FUXA 1CIPA 1D9XA 1W0KD 3CRMA 4XJXA 5AJXA 1AQUA 2KBFA 3QUSA 1LB1B 3OEHA 4CEJB 4K8OA 4DCSA 1N6LA 4JBXA 1NJGA 2ZUDA 2WSSD 3U44B 2W00A 4M21A 4DLVA 3AP1A 2ZAMA 3AVTA 3D3QA 4UKDA 721PA 4V0LA 3Q72A 4YLGA 2O8DA 2IS6A 5FBQB 3K8YA 2IF0A 2EYUA 4LYFA 5EUQB 1G291 2NO7A 5DE3A 1U0HC 4JLVA 1RC8A 3U7FB 3CO5A 3HR8A 1QHHB 2A78A 2HDNB 3N5CA 3VU9A 4G5QA 1WXQA 1G8HA 2HXSA 1RVDA 2JJ1A 4U5XA 2ZM5A 2OESA 3RSOA 4IDPA 3VR5A 5BYKA 2WAYA 3OIYA 1EFCA 1NLZA 5C4MA 4QL3A 1YR9A 4YDHB 2EWVA 3ZGXA 1AK2A 1W46A 3IEVA 1NIPA 4DCNA 3VAAA 4V0NA 5JBQA 2IYZA 1T8TA 2EFCB 2OG2A 2XZLA 1BH2A 4TMVA 2CCJA 2BDTA 2BHRA 2ZANA 4XVQA 2B8TA 2JA1A 5K8LA 2W2TA 3R7WB 3SBEA 3A1VA 4AD8A 1FL9A 2RMKA 1X3SA 3HDTA 2DWOA 2REOA 3QXCA 1NG9A 1DADA 4Q4HA 2RGNC 1HE1C 2VHCA 4PAOA 3GP8A 4TQUS 2ZVPX 3AM1A 4HAVA 2VP0A 3QPUA 3BS4A 3CZPA 4L5BA 1VPLA 3OF5A 4KAXA 2J45A 3OIVA 1XJCA 1RZ3A 1DAHA 5H68A 2Y8EA 5GVRA 4GDFA 1G8GA 4DSNA 2NMVA 2DR3A 2CJWB 4NYMR 5AK0A 4GMXA 2FDCA 4XTRA 4OQLA 2I1QA 3THYA 1CP2A 3SYNA 5AUNB 2DFNA 4F4CA 4A6PA 3AVWA 3GJ0A 4JL8A 4Q48A 5AJZA 2DFLA 4Q03A 4PZYA 4G1UC 5EZ5A 2GTPA 2FZLA 2BCJQ 1N2CE 3SOPA 4IXNA 1DG3A 2AD1A 3C14C 2QBYA 4LPSA 521PA 4IDHA 3LAWA 3CRQA 3MJRA 1KGDA 2QPTA 4FMBB 1ZNXA 4UJ5A 4ZKDA 1KIMA 1W7AA 1SXJC 2VHJA 3SHFA 2F1IA 1E2JA 3BD9A 1CXZA 1KJWA 2CHGA 3FTQA 2BC9A 3UMSA 1G7CA 3X1XA 2IYRA 2N42A 1W49A 1RIFA 5FH9A 5FBRB 4B2PA 1G6OA 4EPTA 4MA4A 4C9BA 1RRPA 4IW3B 2WWYA 2C9CA 4HZUB 2PCJA 2XB4A 3GMTA 3GFPA 4RFVA 2UZ3A 4TYQA 2PCLA 3ZZUA 2WWWA 5AR1A 2DHRA 1SXJB 2BMDA 5P21A 3TSZA 1LFDB 2WKPA 2GF0A 3MWJA 2OM2A 3NWJA 4IHQA 4B76A 3TAUA 3CF0A 4PC6A 2JCSA 1I2DA 2F43B 2GCPA 4RKEA 3I32A 2ZREA 1Z0DA 5L3SA 4TMKA 2ZPTX 2EFDB 5E7JA 3CNOA 5DSZA 3LY5A 1TU3A 1Z83A 4FIDA 1X6VA 4JYCA 1E9CA 1ANKA 1G41A 2A5YB 1HQCA 4LBVA 4Q9JA 3K09A 3W5IA 4F4IA 4OI1A 1SXJE 1LF5A 3CF2A 3IDQA 4RZ3A 3SFZA 2GNOA 4OHWA 4D80A 4NCJA 2ODWA 4RFSA 2WJYA 2WVJA 5CDFA 4NCIA 1IBRA 1P9WA 1H8HD 4PC7A 4ZDKA 5JCZA 1QHYA 4G3XA 1S3SA 4JZKA 4MUBA 2MSEB 2JIZD 2R44A 3K0FB 4QG7A 4DUGD 2ZU0C 3FMPB 2UZIR 2IUSA 3L0IB 5K8IA 1UADA 2IHBA 2OILA 5FUYA 1JPNA 1ZW6A 4D4MA 4I1VA 3I62A 2G1JA 3QVUA 1OB2A 2BMEA 1XTIA 4PFSA 1O87A 2YWHA 1XEFA 3QBVA 4R2HA 1XMVA 3GCGA 5EXSA 1DO2A 4B2LA 4BLSA 2V7QA 4DKXA 3PJRA 2ATVA 2AX4A 1E2DA 1BMFA 1E69A 3QXHA 3IO3A 3ZS9A 3AF1A 4KFRA 2X2EA 1Q21A 3Q7PA 5HE9A 4XWKA 1XDBA 4I99A 1M8PA 4QM6A 1XB2A 3DVLA 3NHAA 5HR5A 3C4JA 4WZBE 3S1AB 2WIBA 3QEOA 4TL7A 2RB4A 2HCJB 3OZXA 3ZVLA 1DO0A 3BGWA 1OFIA 1D6JA 2VHTA 1A1VA 1H8EA 4EPVA 1F48A 1Q12A 2HEIA 2YVUA 4ABYA 3GPLA 1HT2E 3CRW1 1XMSA 1E2FA 5H70A 2QPAA 3WHLA 1RFLA 4D0NA 4WAUA 5KYKA 4KLZA 2P65A 4RD6A 1E2QA 4JVNA 1KJYA 1SVIA 3HJNA 1UF9A 3CKLA 2CL7X 1PJRA 2QSZA 4TSFA 1D2EA 1U2RA 4NKRA 3VKWA 3VX4A 4EJSA 5BN4A 2ZR7A 4CGZA 2C96A 4A0RA 1B0UA 1ESMA 4ASUA 4IFBA 1GTVA 3TQCA 4F91B 4AKIA 1YE8A 1U0JA 4WIAA 2GAOA 4BFSA 1CBUA 4LX0A 4NE2A 2GJ9A 4MRPA 3L43A 1QG4A 5FI1B 3QF4A 4W9MC 1FNMA 4UNQA 5CK5A 4TT3D 1ZD8A 2QQEA 2KI5A 2VP9A 4AYTA 3LW7A 3ZLJA 3TMKA 1SULA 3X1ZA 4LYAA 4S35A 3SYLA 1CR4A 3THXA 4PPQA 1W0KA 4NONA 1M2OB 4M9XA 4HI0E 3GQBA 3K70C 3CWQA 1YRBA 2C9OA 3U60B 3GLHB 1SVMA 1P5ZB 1N5IA 2XNDD 1S2MA 3VR1A 1SKYB 3IIJA 3AF0A 3R9XA 5FOVA 5KPJA 1XF9A 1II9A 1Q1ZA 3KUDA 3PFIA 5SZJA 5HCNA 4CZ2A 2VQSA 4G5OA 3TSWA 2F6RA 1U99A 1UM8A 5GVSA 1F2TB 3CR7A 1E1QD 4PC3A 5CLQA 1WF3A 1KSGA 1ZD1A 3VKGA 2EVWX 4C0KA 4WOPA 3K70B 4BASA 5FPKA 1E0SA 5KDDA 1YZTA 4HAUA 2A2ZA 2RGEA 2Z4RA 1AS3A 1E79D 1XBTA 4KHZA 1GM5A 3A1SA 4UJ3A 5EP4A 1JQJC 3GLHE 5HE8A 2A30A 2FNAA 1SKYE 5A5GA 1AGRA 3NH9A 3RDPA 5JEEA 2W58A 3GJ5A 3AKDA 1NN1A 4RVCA 2ZSFA 3PV0A 3KXKA 3E5HA 2F3RA 2GCOB 4KVAA 1YRAA 5UKDA 3U61B 2J59A 5FPYA 1WCV1 4C0SA 2V1XA 2VP6A 2GJSA 4W5WA 1Q3TA 4XSHA 3UXMA 3EZFA 3SQXA 2YINC 2R62A 1KZGB 4DIDA 1KK2A 3GLIB 4M1KA 4LBZA 2BEJA 1UFQA 1R0ZA 4IOKA 3GLGB 1N6IA 2G77B 2BMJA 1R5BA 2ZRLA 4O2LA 1QRAA 1T8UA 2EFGA 4IRUB 4C2UA 2WKQA 2OBLA 4PPFA 1N6RA 1WE2A 1SHZA 2AFIE 3LQQA 3QI2A 1KMQA 1E2GA 1TX4B 1RYHA 2XZPA 3I8XA 4QHTA 2ZYVX 4GBMA 1NJFA 5JS8A 3SBDA 2CHVA 4JL6A 2H8KA 3BJIC 4CEIA 2AK2A 2F3TA 4N1AA 3FYHA 3BORA 3Q9LA 1XXHA 2NG1A 4ILEA 5FI0B 3GLIE 1G3UA 4L9SA 4A82A 1WB9A 5G40A 4EQ6A 3WRYC 3GLGE 4WZ6A 2PZGA 1KYIA 1E0JA 4YMVA 1VG0B 4K46A 3MWLA 4EAQA 3WRXC 1MOZA 1G7TA 5JCPA 2OXCA 1XPOA 2LKDA 3GJXC 3P4YA 4MKFA 1US8B 5E7MA 4DDUA 2O52A 4AIIA 1E2IA 3IQWA 3CX7A 3QEJA 4PO8A 1U8YA 1JJ7A 1YR7A 3LDAA 3THWA 4G5SA 4FMCB 2BBWA 4W5JA 1E6CA 4D25A 4GNKA 1XU4A 3X1YA 121PA 3ZQJA 4HLUC 3D31A 3PUVA 1SVKA 3LO5A 2O5VA 1BOFA 1MH1A 2J9RA 3W3AA 4LOAA 3CBQA 1FTSA 2O8CB 1II8B 3VTKA 1XMJA 1FX0B 4HB4A 3X1WA 3EIHA 3U5ZB 1HTWA 2ZE6A 5BN3A 3L2OB 4NH0A 3SJZA 2HV8A 4M2LA 1Z6TA 3UMFA 1P73A 4LV8B 5IF9A 3H2YA 2FFAA 2JDIA 1CTQA 1VECA 2O8FA 1EX7A 1DPFA 1VDZA 3TUZC 1Z3IX 4QBGB 1IOZA 4BLTA 3CPJB 5JSZB 5D3QA 4DCVA 4QC2A 4RD2A 2J0VA 3TUIC 1ZRHA 2AN9A 2FFBA 5F2EA 2JEOA 3U3RA 3RC3A 3FOZA 4Q7LA 3DOFA 1Z22A 5FTNA 1KAGA 3QKRB 5LD2C 3FMOB 4FXPA 4HAZA 5J4LA 1H65A 2AWOA 1H8HA 4O25A 2QG6A 3GEEA 1OSNA 1COWD 1AGPA 2BV3A 4Z51A 2JIZA 3CIOA 4QGAA 3QG1A 4DUGA 3FE2A 1ZUNB 2R6FA 1RE0A 4B44A 3K9LA 3B5JA 5J4YA 1HA3A 4PPNA 2QTFA 2N1BA 2VP2A 3U44A 4BEBA 1EK0A 1ZJ6A 4MDEA 2QMHA 3TK1A 4FWTA 1JAIA 4EUNA 1G3RA 1KKLA 4LSGA 5LD2B 2F1JA 4RZXA 1P2TA 5TV2A 5KUTA 1LTQA 3QKSB 3UG6A 2FWRA 1TQDA 5EE1A 1FPMA 2QL6A 1CRPA 1A4RA 2QGZA 1NVWQ 4URYR 5H1YA 3R20A 4IDOA 4TQ9A 3KKPA 4DEXA 5AJWA 4DB4A 1U94A 3QBTA 3ADKA 4HDOB 1RRCA 1NI3A 2GXUA 1XFAA 3TQFA 1WP9A 3BB1A 2ZRDA 3IPYA 3MLEA 3LV8A 2EWWA 3H4MA 5HZHA 3LQRA 2IWHA 2IUUA 2Q9AA 2H7VA 2J87A 4Q1FA 4J0QA 1G9XA 1G8PA 1ZBDA 2WWHA 3GLFB 3SFVA 1TUEA 1XTRA 1ELOA 2BM1A 3OEED 4FW9A 2F1RA 4HLQB 3E1SA 1G4UR 1U8AA 2VHUA 4Q1BA 3ZQ6A 1S9DA 2GCNA 2JAQA 3DL0A 2J0UB 2FEOA 4ZV4A 1R5OA 3K0CC 5JEDA 3A4MA 4DSUA 2FPLA 1F60A 4YONB 5KPDA 3SYKA 5DYGA 4XVUA 1P2UA 4MYCA 4JVSB 2ZRMA 4GOJA 4BLOA 4EFLA 3M6AA 3NC0C 1GVNB 1IN8A 3VX3A 4E09A 2PT5A 4TT3A 1VYVA 1LF0A 1WMSA 1T6NA 4KFTA 4R7ZA 4Q4AB 3HU3A 1Z07A 2Q3MA 4DEYA 3GLFE 2R6CA 1IN7A 3BFVA 3KJGA 4FWIB 4Q7MB 5AUOB 1X8KA 2JASA 4DXAA 2QMOA 2ZJOA 3FPAA 4LCBA 3ICQB 3KXLA 1JAHA 2XNDA 2ZSDA 4URUR 1A7JA 4L16A 1IQPA 4NBSA 1E2KA 1I2MA 5E95A 4JBYA 2PMKA 2JLQA 2F55A 4D4KA 2OXRA 3BH0A 4NYMQ 2FH5B 2CXXA 1Z6YA 1M7BA 3GEHA 3B8HA 4GT1A 4V0ME 5EZ6B 3FB4A 2B21A 4A0FA 3BBPA 3FHTA 4G0NA 2OE2A 1E1QA 2IC5A 2QE7D 1U81A 5SZHB 4RD1A 4HDQB 2FFHA 3VR4A 3EPJA 1W36D 4ZIRB 5GJVC 2WSMA 3KUCA 3AP3A 1U90A 4QJ3A 3PENA 1CJTC 1E79A 3NG1A 4B6EA 4FD2A 1CR0A 2FX3A 1TEXA 1D2NA 1UBEA 2G0NA 4LPKA 3EW9A 3AVYA 2FGJA 4DCUA 1LS6A 3LX5A 4PR0A 3O8BA 4Q1EA 1VCNA 4KSBA 4PQFA 1GIAA 4AK9A 1BO6A 4LJ7A 2F1HA 3LH5A 2V7QD 1NIJA 1OFHA 4OHXA 4JKIA 4GFDA 4RY2A 1TADA 4B47A 221PA 2ZRNA 3BB4A 5GADl 2ZROA 5JHGB 1K5GA 1WDTA 4OHZA 1EWQA 4P0TA 1Q1QA 3CZQA 3AVOA 1PUIA 3H86A 3EAQA 2BJVA 4FINA 3CR8A 4XD7A 1UPTA 2YOFA 3EC1A 1TPZA 1IY1A 1F5NA 1DE0A 1P3JA 2AXNA 1NNEA 4KXFB 5K8UA 4MKHA 2MSDB 3AF4A 3UWKA 3KKMA 4R98A 2OAP1 3EASA 4HB3A 4UNSA 4LY6A 1OPXA 5JJIA 1U0LA 1Q1BA 4MGIR 1OIWA 2W83A 2O0KA 3NDPA 4PSKA 5CM9C 1Z8FA 1I4TD 3T06B 4BQSA 2IW3A 4TSFD 4EPRA 2GBLC 1HEIA 1JJVA 3TAHA 3U3KA 8OHMA 3EC2A 3SQWA 2XSZD 3K53A 2A5GA 4GP7A 1KDTA 1VKJA 3P26A 2GHIA 5J4VA 3A4LA 2AXPA 3RSLA 1QDEA 5JHHB 3TE6A 4RCZA 2QQ0A 3GJ4A 3OFND 3ZZ0A 2P6UA 4BFTA 3AV0B 1SVOA 5J40A 3NH6A 3OE7D 1G3IA 1A82A 3FFAA 1GKYA 2BCGY 4KVGA 3OHMA 3X1DA 1TL7C 4LRWA 4MRNA 2IYUA 3RRYA 1TTTA 1NY6A 3RS7A 1FQJA 2IT1A 2NTYC 3V00A 2L0XA 2V4ZA 5FOSA 2EU8A 2CDNA 3NEJA 1IY0A 1XZQA 4JSYA 3KX2A 2ORWA 2ZI5A 3I61A 3AF2A 2CMKA 5KTYA 4NP6A 3UWOA 3EPKA 1G8YA 2IYYA 1NN0A 4GOXA 3O47A 1QHSA 1P62B 3W5JA 1QG2A 3LD9A 1P9NA 2IYVA 5BWMA 3D6TB 3PITA 1NSTA 2OCYC 3RLFA 3DO6A 3MAAC 2RGGA 4M22A 3UANA 3PUYA 1KO1A 1RRGA 4Q7KA 4AY2A 1E9SA 4MRSA 5KNDA 4Q4JA 3ASYA 4ZDIA 4TYNA 4MGYR 3N70A 4JL5A 2IYLD 1XD9A 2RKOA 4UNNA 3C41J 3I3SR 1R5NA 2XOKD 3DZDA 5DN6D 4TTRA 2ORVA 1LVGA 1NVUQ 2G3YA 4CT5A 4BFYA 4DLYA 4PZLA 4RD4A 4LJ6A 2B8WA 1P72A 2Z0MA 1MABB 4DDVA 1GL7A 4LJ4A 2AWNA 4TLBA 1C9KA 1RYFA 3ETLA 3HWSA 4C7OB 1COWA 2FPMA 4BECA 1Z06A 3MFYA 4ON9A 3FMIA 1AKYA 1AA9A 4X8OA 3ZD7A 2ZRAA 2RAPA 5FPHA 4JLBA 4BFVA 4CEHA 3NTUA 3CNLA 1UKYA 3HR7A 1QF9A 1OXXK 5KDOA 4CDGA 2Q3HA 4A6XA 4GL2A 4B74A 4OYHA 1SQ5A 4LV5B 1M1YE 2R6AA 3D8BA 1J99A 1N0WA 5DH9A 4NZYA 2V54A 1JR3D 3CB4A 2KSQA 2SHKA 2ZSBA 2CLSA 2I4IA 4C0HA 4Q47A 4QJ5A 2QAGA 4ARZB 3K0EA 4QHSA 2WKRA 4A36A 2H16A 1U9IA 4FMCF 3TGPA 5F98A 1XRJA 2H57A 3K1JA 2DWPA 4HZIA 3KB2A 3Q8XB 4QFMA 3F8TA 4OK5A 3MWKA 3WBJA 2WJJA 1TNDA 2WWXA 3OEEA 4GOKA 5FOXA 1N25A 2BBSA 3RWMB 3C5HA 5TY0A 2QP3A 3I5YA 5LBIA 3W6NA 4E07A 2QUZA 3PUXA 4Q21A 2GAAA 3SNHA 2JLYA 3WXMA 3HP1A 2VRWA 2FJUA 5FUVA 4NCNA 3BK7A 4OHVA 4MQBA 4XWAA 4DLSA 2BEKA 4GRAA 3TNFA 2BJWA 3K0AA 4M9ZA 3RAPR 3MSXA 1E2PA 5C1BA 2V1UA 5JRJA 1PUJA 3WMEA 3L0OA 1ZM9A 4IVQA 1MR3F 3CWZA 4L15A 1XEXB 4IEIA 1R10A 2V55B 3B1VA 4LJ5A 2CBZA 1DG1G 2IYTA 4RKFA 2ZITA 3NHBA 3SE0A 4LI0A 1G3MA 1N6OA 1Q44A 1ZD9A 4JLMA 4IOJA 2IWRA 4PO1A 2JDID 2NO0A 4JLKA 2P5TB 4A4DA 1YZGA 4D4LA 1TMKA 1ZP6A 2ODBA 1G20E 1W4BA 3LXXA 2YWEA 4PHHA 1NKTA 5FR1A 3PG5A 1UEJA 3PCRB 4L4UA 1KTVA 4JLDA 4XH9B 3LVQE 3BFKA 4I1OA 2CEAA 2QRNA 4Z8XA 4PC2A 4DCTA 4HUQB 2QE7A 3MUFA 1E4VA 5AUQA 4A0GA 2X1VA 2XEXA 1KSFX 1QHGA 4B3DA 1PLLA 2ODEA 4ZDWA 3CRVA 5FOUA 2E87A 2GESA 3DPUA 3NBFA 3TIFA 3UIEA 4E03A 1K6MA 3ADBA 3LX8A 4LGMA 3NIBA 4BEJA 4P31A 4Q00A 2FFQA 4PANA 1C4OA 4C0BA 5B58C 1G5RA 1R6BX 4OQMA 2IXEA 3B13B 2OBMA 3K9NA 5EP3A 3DHWC 2IBMA 3DDCA 2MSCB 2O8BA 2YKGA 4IXMA 1II8A 4B2IA 1FX0A 1G5TA 3HYTA 1A5TA 4B6FA 4PTLA 3A4NA 5ANRB 5GJWC 5EJEA 3EPHA 4QKQA 2G1KA 1NMYA 3ZVMA 3EZ7A 1F2UA 4BZXA 2D2EA 4RCYA 1GL6A 1T5IA 3KJHA 2G83A 4U00A 4D0GA 2UVQA 2R9VA 5L3VA 3CH5A 3F3YA 2VYFA 1IHUA 2PLRA 4TMWA 3IBGA 2FPKA 4YMSA 3SU8A 2WZQA 4R71A 4QNMA 5HKKD 5HZKA 1JALA 4D82A 3WY9A 3O8CA 1DAEA 2IYSA 1GDDA 4FMDB 4U02A 4I81A 3FFBA 1GZSA 1NLFA 3LBHA 2ZYWX 2YC2C 5JMTA 4O3MA 2XXAB 2ZI9A 4YMTA 3NVAA 2BKUA 5JI2E 1Z0JA 2DY1A 4Q9IA 3NXSA 4ACBA 2H1LA 3I4LA 4TN1A 2HT1A 1M7GA 2XTNA 5J4KA 4URWR 2XSZA 4YXWD 3AP2A 3QVVA 4TQAA 5KU1A 2CK3D 1KMHA 3CX8A 3MGCA 4FI3C 4B34A 3WP0A 3OFNA 1N5LA 2ZRIA 1Z0IA 4XTCS 2O8DB 3OE7A 4EIWA 2XTMA 5E7IA 4BUJA 2NPFA 3PR1A 3OESA 2G9NA 1KI6A 1X8JA 2CVFA 2OSBA 4D81A 5KNBA 4URXR 2A5FA 2I1VB 2J7PD 2A5DA 2EYQA 1ZM4A 4QXAA 4IOLA 4P32A 1VG9B 4LHYA 3B9QA 3VU9B 1E9AA 1G4AE 1ZMXA 4P4UA 4DT1A 3RNLA 3BOSA 2R8RA 2XTZA 4KSCA 5EP1A 3KQKA 2P3SA 4IFEA 1XCMA 2ZJAA 4GZMA 4HLDA 3SJCA 2XJ9A 4D0LB 2P6RA 2RGAA 3WNDA 4M1TA 3ZD6A 4F4JA 1VG8A 5BW8A 2BBOA 4A9AA 1CR1A 3I1FA 3AVPA 3LA6A 4AKEA 5KSPA 2CE2X 3BH6A 2QTVB 2GJKA 4JLAA 1LV7A 3R9WA 2QRZA 3UG7A 4B3GA 3B9PA 3AGPA 2V6IA 4TLEA 5TDHA 4IEEA 3QXJA 4Q02A 1L4UA 3ZJYA 3QXXA 4DLUA 4DDWA 4Q4HB 4JYBA 4A92A 3RYTC 1SGWA 3HU1A 1A2BA 2WIAA 2XOKA 4AYWA 5DN6A 2EW1A 2QMUA 4M8NE 3J81k 2YHSA 5LDDC 1FOEB 2VLIA 2ZE8A 4Q5IA 4P4SB 4B3FX 3PIRA 4CRWB 1GKIA 1F6BA 1SXJD 1HYQA 4MKGA 2ZJYA 3FVQA 3THYB 4MITA 3R8FA 1ZUIA 5FOWA 5KO2A 1YR8A 4WA7A 4NYIR 1GNQA 1ESNA 4H9GA 2JLRA 4LHVA 1GFIA 4UXIA 3W90A 1N6PA 3QKUA 4JT4A 5DI3A 2CNWD 4D2IA 1TU4A 3AVXA 1M6NA 4TLDA 4FN5A 2HXYA 4XD7D 5FBLB 4TTQA 1IY2A 1ZNZA 2IL1A 1HY3A 5JECA 2OT3B 1GP2A 5CB6A 4JLJA 3KTAA 1E9RA 3QSYA 3GEIA 3QXSA 2C78A 3FKQA 4NPHA 4HATA 1EFTA 3QJYA 2ONKA 2XZOA 2IEZA 4Q9LA 5JFGA 1GG2A 2QI9C 1OHHD 2OCAA 1VMAA 4GMDA 4KLNA 3M4YA 4OQXA 4B71A 2J3EA 1JR3A 1YU9A 4LK2A 1G18A 5DHFA 2O8EA 2HF9A 4KFUA 2FSHA 4Q19A 3U7GA 3BAFA 1KSHA 4CT4B 4C2TA 421PA 3EXAA 5EE9A 4C0AC 2BVNA 1EESA 2XGJA 4EPXA 5D3MA 3HYRA 2QT1A 1KK3A 4BZPA 3K09C 1NBME 2GF9A 2QY9A 2W6ID 4A1FA 621PA 1RPZA 1K8RA 1E9EA 1BIFA 1J8MF 2GILA 2VHQA 3E2IA 5LB4A 1FTNA 1FFHA 2ZI6A 2ZJBA 2ASEA 2DWQA 4UXHA 3REFA 1PV4A 1J2JA 1W36C 1UDXA 4DWJA 3VNVA 5JWOA 1MO4A 2CCGA 3AVUA 4P33A 4NCHA 3AKCA 1ZC4A 3ADCA 2ZYTX 5FPTA 2IF2A 1NN5A 1T0HB 1YHNA 2IXGA 1EX6A 2HJGA 5L8VA 5C46F 1L2TA 1UBCA 3IIMA 4WXRA 4EFMA 4B32A 3T1TA 2CL0X 1J70A 1LS1A 4C0QC 3CONA 1EFUA 2Q6TA 3VFDA 4US2R 1Z6GA 4MYHA 4RFSB 4ZCLA 1UAAA 2DFKB 3QF7A 1ODFA 2WBLC 4PC1A 2PZFA 2CLDX 2ZIAA 5FL7D 2UKDA 4II7A 2VEDA 1Y63A 3B82A 4TYPA 2FZ4A 2GA8A 4OJQA 3W8NA 1YR6A 4ZI2A 1EXMA 1N6NA 1QHIA 3X2SA 3B6EA 5HCIA 1OB5A 4LZZA 4PHTA 1Z63A 3WYFA 1TF2A 1KY3A 4AI6A 1W5SA 5CIWA 4X8HA 4OBEA 2HCBA 1LNZA 1ZUHA 2BM0A 3LBNA 5AJVB 1T5LA 4B3XA 4MGZR 1T9HA 4Y0VA 4A8JA 2WTUA 2C9YA 1M74A 1WQ1R 4DB2A 1XTKA 4NL4H 3U4QA 1ZM7A 1RKBA 1G7RA 4LYHA 1OYYA 1GITA 4JLOA 5L3QA 4KYIB 1FUUA 1GRQA 4M9SA 4OK6A 5DIFA 2VF8A 4NHOA 3M0EA 4EJSC 1G1MA 3DEFA 3ZS8A 5F9FA 1OKKD 2OCBA 3TR0A 1R8QA 2DYKA 2QPOA 1TAGA 2ZRPA 4M1SA 3KQLA 4CEJA 4TTPA 1R0YA 2NOAA 4BRUA 4ESHA 3PVSA 1XD2B 5JJLA 2IXFA 3IO5A 1AZSC 3OIUA 4OI0A 4QM7A 2KB0A 3RS2A 1R2QA 4N0DA 4BPBA 3WYGA 4Z54A 2GKSA 2FG5A 4EJSB 1JI0A 1QVAA 3U2QA 3K70D 2AHOA 4AKHA 1YJ5A 1QHHA 2CLCX 3AQ4A 3AUXA 4ZPXA 5TARA 3RWOA 2ZUCA 1NN3A 1KI2A 3F0TA 3L0PA 3RRMA 1Z0AA 5FFMA 5KDLA 3G5UA 3ZZTA 4QRHA 4IDQA 1S4QA 2IHYA 4KU4A 3QF4B 2WWIA 3FHOA 2VH5R 5B57C 1TF7A 4TWZA 4DZZA 1W2HA 5HKKA 3IPXA 1IONA 2DFTA 3B1YA 1DAIA 1OT3A 3MRSA 4DC9A 1PLJA 4Q1DA 1Z6XA 4HLCA 2J46A 2B6HA 1WBDA 4TMXA 4GP6A 4TMZA 3THXB 1MV5A 1RJ9B 1WBBA 1CJUC 1E1RD 3A8TA 1OYWA 3O8DA 3R7WA 3KL4A 2Q9CA 4C7OA 1XCPA 2YZ2A 3IKJA 1N6HA 2TMKA 3B7GA 3P32A 4YXWA 3SR0A 2CK3A 1IM2A 1XCGB 1NKSA 2FSIA 2W2XA 4D26A 3U3OA 1HT1E 2J1LA 2AL7A 1AM4D 2ZRKA 1GUAA 3SDZA 4QGHA 1NBMD 3KJEA 3K0SA 4ZKEA 1DAGA 5EP2A 3AF3A 1S3GA 2Z43A 2CJWA 5GJBA 4PAMA 1W0JA 1S1CA 2J7PA 2QENA 3BWDD 5FPSA 5CITA 2FF7A 4MDFA 1XMIA 2IYQA 3W6OA 4P4TA 1J7KA 2RGNA 1F3OA 2AD5A 1E94E 4ARZA 2IX3A 1MO5A 3H1TA 3QIAA 2PEYA 2IS1A 1E2NA 3T1OA 1DS6A 4PHFA 4AG5A 4EKDA 2ZRCA 5DO9A 3PEVA 1G7SA 3OAAD 5FTLA 5TXGA 2QAJA 1CRQA 2FOLA 4N3NA 1KDRA 3MWYW 4L9WA 4Q4LA 3T61A 2YOHA 1KO4A 3JVUA 4Q1AA 1KHTA 2WAXA 3ZH9B 4NYJR 3BIFA 2A7QA 2OLKA 4MGKR 4Q66C 3RS4A 4HB0A 4LYJA 5B2ZA 1ZC3A 2WWGA 5CIQA 4BGDA 4H1UA 5FBWB 3RS0A 2D62A 3VMFA 4DRZA 1L7VC 4D6PA 1VIYA 4HZUA 2G88A 3QKTA 5CJPA 2D4HA 2P6NA 5CK4A 3RRNA 4B43A 2JLWA 5G41A 1UJ2A 1SXJA 3T5DA 1ONBA 4HAYA 5FTKA 4CEIB 2ZEJA 3TLXA 2ORIA 3U3JA 1Z2CA 3ECCA 2F43A 2OUKA 1YKSA 1XNJA 1P75A 1DOAA 1OH6A 1G21E 821PA 1MKYA 4HAXA 4M0LA 3TVDA 2YJTD 2GEUA 1NMXA 5CB8A 1GNPA 1OFTA 4HSEA 1YVDA 2CNWA 1GOTA 2PZEA 5EUMA 5EXTA 4QBHA 3SJAA 2C98A 3Q85A 1L4YA 1UDWA 1TQ4A 4M1YA 5EE3A 4E5UA 3N2IA 2GRJA 2YWFA 1OHHA 3Q5DA 4UNPA 2EFHB 4HUQA 1AS0A 3NKVA 3VR6A 2P2LA 4YQFA 1QHXA 2J41A 1G16A 4DLRA 3THWB 1N5KA 3I72A 4D4JA 2C5LA 1W4AA 2GZHA 3LNCA 4B3CA 1W4RA 2HYDA 1XJQA 1P2SA 2PJZA 4PZZA 1BYIA 3K0FA 1GSIA 2B7CA 2KE5A 4B75A 5KNCA 2PLFA 2NPIA 4NCKA 3HPQA 1FNNA 4TL9A 2QN6A 2ZUBA 4C0JA 4L8GA 4F38A 4JIMA 3KQUA 2W6IA 3TJZA 2C04A 3FMFA 1YZNA 2GVZC 2NO1A 2R6GA 1FP7A 1L8QA 3QQ5A 4UXJA 1WA5A 2NO9A 2VSFA 2WHXA 1W1WA 2WV9A 3B1ZA 4URZR 3MJHA 4AKGA 2QSYA 1NP6A 3T35A 2NGRA 3S1AA 4URVR 2ZJ8A 1CJMA 2QU8A 4DSOA 1SHKA 4YC7A 1GNRA 2ZRGA 3KJIA 4PXAA 2XB2A 3R9IA 3ZDQA 1X86B 4PSAA 3P4XA 1XZPA 1FP6A 2OZEA 4QBFA 2JGNA 4ZDJA 2VTKA 1VHLA 1ZIOA 2G6BA 3KB1A 1FUKA 4A15A 1XTJA 4ZCIA 1V43A 4CIDA 5FL7A 3TBKA 4JVLA 3UPUA 1DAMA 5KOYA 2BKEA 1NSFA 3L0SA 1R7RA 3ZIAD 1NF3A 3KQNA 5JJKA 2PX0A 3KQHA 3IUYA 5K8TA 3RANA 2HUPA 4CF7A 1T4GA 1Q3HA 3IQXA 1Q0UA 2OO7A 2Q9BA 4BWYA 2JLUA 4OHYA 4Y0AA 3NBYC 4HUTA 4KFSA 3BXZA 2Z4SA 3FGNA 3RVBA 3B60A 2F7SA 2ZSEA 3GJ6A 4CVNA 1NLYA 5KSYA 1KNXA 3EA5A 3K9HA 3PEUA 1CJKC 1S8FA 1TUIA 2IS2A 2RCNA 3GLHA 1Z28A 2HJVA 1OKKA 1J8YF 4K81B 2ZS7A 4RSGA 2B92A 3AKEA 2XAUA 3MMPA 5C18A 3MG9A 1KK0A 2ZJ2A 2EQBA 2IUTA 1OIXA 4LHZA 1SKQA 5FR2A 4ZO4A 3LFUA 1JBKA 2C8VA 4V0OA 3CX6A 2GEDA 1OXUA 4C0LA 1F2TA 4GI7A 4LBWA 2DB3A 4M4SA 1U98A 1E9FA 3QY0A 1IJEA 1GRNA 3EZ9A 3TUJC 2OLJA 4OQNA 4MKIA 4UNRA 3Q5EA 1Z0KA 5J47A 4QOSA 4V03A 3T1QA 5DNYB 2XX3A 5AUPB 3UMRA 3FDIA 3C8UA 4DLTA 2JLZA 1KJZA 2C99A 2IYWA 4LDJA 3DKPA 3H84A 4Q7JB 3ONWA 3V9PA 1KI7A 2YOGA 4P4SA 3WHKA 2QM8A 1N3BA 4UQOA 2ZYUX 3RABA 5C2JB 3CRRA 1W47A 5IT5A 4LBYA 2ANCA 2GCOA 2VSOA 5FOTA 2GDJA 3W34A 3TW8B 5KHOC 1EGAA 4F92B 1YZQA 2K5UA 4BZQA 5IK2D 1E32A 2QP9X 4JMPA 1OE0A 1MT0A 4IVPA 1KI3A 1E1RA 5AJYA 1M34E 3AUYA 1I4LD 2JJ8A 3DMDA 1EFHA 1TEVA 1DARA 4E22A 4LC1A 1KKMA 3GLIA 1E9BA 1N5JA 2JATA 3H0KA 3ND9A 3GD7A 3NDBB 3GLGA 1OH8A 4C4PA 2DCUA 2NZ8A 4BRWA 1JEDA 1NBMA 3QOFA 2MMGA 4NYIQ 4CW7A 5J4HA 1E98A 3UATA 3REGA 3SC3A 1R8SA 1IXSB 4ERNA 2JJ2D 4AYXA 3DM5A 2HLDD 3A36A 4HEJA 2V3CC 3QPWA 3K9GA 3W3ZB 3R8CA 4LV6A 1B23P 4KBGA 2OV2A 2F9LA 2QP4A 2OEPA 2GWHA 4PQYA 5FL3A 4P3YA 2E1RA 5DHAA 4X8LA 3ICEA 1N6KA 5G3ZA 1OH7A 1KI9A 1VTKA 4ITRC 4F7WA 1CR2A 3OAAA 4MH0R 4S2EA 2P67A 4AG6A 1KI1A 2EFEB 4NDZA 1ZINA 3MD0A 2ZJ5A 3GFOA 1NG1A 4IKEA 2OFXA 1P2VA 3KXIA 1UBGA 1GRRA 2IA5A 3TR5A 4DIEA 4OKSA 1G5PA 3T15A 2RH5A 2BMFA 4XOIA 3W9YA 4A0HA 1US8A 3LXRA 1KY2A 3B78A 4JSTA 2A3RA 3KDSE 1J90A 2X77A 1HUQA 2WM9B 3W8RA 3T5GA 3IEUA 2ECKA 1GL9B 4MYUA 4AWXA 3U6KA 3QE0A 3DMNA 4BLQA 4ZI3A 1ETUA 1E0AA 2MMCA 2W2VA 4M1OA 3C15C 1AS2A 2CHQA 5SZIA 4JJZA 1JPJA 1VCOA 2FE4A 3LLMA 2O8CA 4M9QA 4I1UA 1NY5A 3PUWA 3BB3A 2GXSA 2H17A 2GK6A 1BKDR 3BH7A 1NVVR 1XPRA 4O0MA 5JLJA 5EQTA 1Z2AA 4QBIA 1KDOA 4HAWA 2D7CA 3LRPA 2NIPA 2OCPA 4DBLC 4HLUA 1RRFA 1IJFA 1T0JB 1VHTA 1W5TA 4DLXA 4R2IA 2QM7A 2W0SA 3BE4A 5JSZA 1OJLA 4Q9KA 5BQ5A 4BFUA 1UBFA 1VCIA 5CYPA 1XTQA 3VKHA 3P1JA 5IRCD 5DLQC 4TLAA 4TMTA 4Z8YA 4JS0A 1TQ6A 1XD8A 3OIWA 2ZRBA 1W2GA 2CL6X 4A2PA 4BFXA 1LY1A 3ASZA 2WJGA 4Q18A 2VBCA 2PX3A 4Z1MA 4DHEA 4TL8A 3C5CA 3U7EB 1Z0FA 2QT0A 5BN5A 3QKRA 3CPHA 2QORA 3FKSD 3QENA 1R4AA 3EWAA 4LWZA 4G5RA 1TF5A 1G17A 1X1SA 1P9RA 3CUEF 3RS5A 1G8FA 3EIEA 1MO6A 1E3MA 2C95A 2ERYA 2V9PA 5LPNA 1JECA 2ZR9A 3IBYA 1KAOA 1CS4C 2KBEA 5EXXA 4DLZA 3B1WA 1XD2A 4Q01A 4KI0A 1G6HA 2QZ4A 1Q1EA 1N0UA 1Y3AA 4KITB 1XPUA 1W0JD 2GVDC 4HB2A 4Q4JB 1DAFA 2V8OA 4LC0A 2F9MA 3QKSA 1NRJB 2DBYA 3M1IA 1UKZA 3RRZA 3U6BA 2YYZA 5ELXA 5BXQC 4DVGA 1JNYA 3WBKA 4I1SA 2BBTA 1WRBA 4PAQA 2PMDA 1ZCBA 4LJ9A 4M1WA 4HDCA 2ZTSA 1KO7A 3NBXX 4NU0A 4XIGS 5M04A 3L82B 4EFNA 3ZYCA 1E2EA 2WMNB 1AQYA 3CNNA 3GLFA 4KCGA 4ACAA 1RJ9A 1EG7A 3E70C 2VF7A 3IHLA 4KJZA 1EFRD 4JKYA 2XJ4A 4RZ2A 3GFTA 4KV9A 4W5HA 5FTJA 4CYMA 4DSTA 2LWIA 3FWYA 3CW2A 2J0UA 3TSOA 3HPRA 4JJKA 2RGXA 1V5WA 2FGKA 3PQCA 3ZIAA 4ZCMA 4GZLA 4TYYA 2QAGC 3AB3A 2WJHA 4XVRA 4U7DA 4CEHB 3VNUA 5JI3E 3V4FA 2WSSA 1HURA 1II0A 3WYAA 1OLOA 1E96A 1E99A 1U9IC 4V0MA 3TW4A 5CJ2A 3SZRA 1PZNA 3DKVA 3LLUA 1ZNWA 4POAA 1SVLA 5A0FA 1CLUA 3QNUA 3L8YA 1ZM3A 1T91A 3VR2A 2V6JA 2CCKA 3P27A 4PSVA 1P60A 3EA0A 3EIQA 3I73A 4Q4AA 1MRNA 2VO1A 1IN5A 1TQ2A 3PXGA 4KYUA 3MCAA 3CM0A 3GJ8A 2D74A 2QAGB 2DPXA 2ERXA 3K0CA 4JVMA 4YMUA 4NMMA 4DDTA 3SJBA 2JLVA 3A1UA 2GEVA 4TL6A 2Z6VA 1W48A 3TH5A 2GZAA 3AEZA 2QBYB 1JB1A 2WWFA 3QPVA 1OIVA 2W0MA 5CM8B 1AZTA 4LJ8A 1E2MA 1MRSA 2A5JA 3ND8A 4C3ZA 1PLKA 3AH8A 1KDPA 5A4JA 3VQTA 2R6DA 2ZQ5A 2I3BA 1N0VC 6Q21A 1DBSA 5AWFC 1QBKC 2GJAA 4YDSA 4OQFA 4A2QA 2FMXA 1CJVC 3AGQA 1P7CA 4JLNA 4LHWA 2O0HA 3FHCB 4WW0A 3U3MA 4ZIRA 1S96A 1ZAKA 3IILA 3BC1A 3Q7QA 4WZAE 2YWGA 1KOFA 4FCTA 2QEQA 2H5EA 3KZ1E 4US0R 3EPLA 3EZ6A 4QJ4A 4N0EA 2FA9A 3VHLB 2XNSA 5HTKA 3TVTA 1OH5A 1P6XA 1IN4A 3K0AB 4JT2A 2W6JD 3CH4B 4NYJQ 1T3SA 2D3WA 2WPDD 2C03A 1DTSA 4FCWA 4QHYA 4WVFA 4KO8A 1OXVA 5IHPA 1KNQA 3L8ZA 2ZVQX 4YMWA 3UKDA 5IK2A 1CEEA 2RGCA 2WMOB 1OF1A 4WBSA 3DZ8A 2ANBA 3I5XA 4XSGA 2JLSA 5L3SB 2VP5A 2J0SA 1G64A 2WICA 1E0KA 3D7MA 5IDVA 4IJMA 4G5GA 2VL7A 1KO5A 4DLWA 1KSJA 2VA8A 3LWNA 1CULC 1ZVQA 4LJAA 2HYIC 3EWSA 2FSFA 5B30A 2AKAB 4B48A 4QNRA 3SN6A 1KK1A 1XWIA 2WJIA 2GXAA 2JJ2A 2A9KA 2ZR0A 1HV8A 1W36B 3KKNA 2HLDA 2NO6A 4PPGA 3SHWA 2ZXUA 2OFOA 2RHDA 4M1MA 1S1MA 3JZAA 5EE0A 1JR6A 4IVRA 1K5DA 3EG5A 3RC8A 3OEHD 4QGGA 1OXSC 1OXTA 3A1TA 1GKUB 4LUCA 2VP4A 2YNMA 1FMLA 1Q57A 3AKYA 3O8RA 1AIPA 5JZVA 4EPYA 2ZAOA 2O8BB 2P0EA 3PEWA 3CPEA 4EPWA 5BYJA 4BFWA 5JRZA 4KODA 2OHFA 3JVVA 4IDNA 1KZ7B 4PHGA 1HE8B 3WNCA 1F2UB 4AC9A 4B73A 5KSZA 3LVRE 2H92A 2GBLA 5DISB 5EXPA 1VYTA 2WJVA 2GZDA 2IEYA 2RGBA 5CDFE 2ZS9A 2PL3A 2XITA 4JLPA 1Z08A 2ZI7A 2JJ1D 1SZPA 2KJQA 1OV4A 1VCMA 4PX9A 2ZE5A 1W4CA 1KI4A 2RGDA 4TZ0A 3SEAA 2REXB 3KFXA 2QGNA 1S0UA 1ZIPA 1QZXA 2AKYA 2QA5A 4R9UC 1ZYUA 1IN6A 4PO9A 2ZSAA 4V0KA 3PEYA 3THOA 4I4LA 3IGFA 5HPYB 1S9HA 1ZM2A 3VR3A 5CLLA 1G19A 5CYOA 3T12A 5F3WB 2C2HA 4PQRA 1BS1A 2PT7A 1AJEA 1P4SA 4QGFA 5JWRA 1ZU4A 4OL0A 3KFVA 1AKEA 2C77A 1KMHB 1R0WA 2IK8A 2J5XA 1X8LA 4MUAA 4OJKA 2J7KA 3HU2A 5DI9A 4C30A 1O3YA 4WXPA 1FMJA 4DJTA 1U8ZA 3RS3A 3WNBA 1OFUX 1YZUA 4RD0A 3CLVA 1KI6B 3WMFA 1QVRA 1G3QA 2PEZA 3ZVRA 1T3LA 2ZS8A 5EE5B 2FN4A 2ZU6A 1MABA 5GJCA 1I4DD 2PJRA 5JWHA 4GSYA 2BIFA 1Z47A 2WOJA 4DT1B 3FKSA 1A2KC 4B33A 3P20A 4A2WA 5FBVB 3ZVNA 2P5SA 3Q3JB 4W7SA 1XEWY 3WP1B 2FSGA 1FQKA 2VIIA 1ZU5A 5E4FA 3NEYA 2IYXA 2FEMA 4F93B 3A1WA 3C16C 4Q9HA 3F5FA 1XX6A 3IHWA 4H1VA 4BFZA 2KWIA 3I92A 1VYUA 3EZ2A 4G01B 5J5CA 5H8WA 3A6PC 1VIAA 3EARA 1C1YA 2X19A 3RHFA 4AURA 3BFXA 1Z6AA 1M7HA 5LB2A 4HYYA 1UKVY 4B3BA 4BE7B 2J0QA 3LBIA 1DVRA 1YZKA 2QNRA 1UEIA 1W44A 1XTSA 2VPPA 2FV8A 3W6PA 1KI8A 4FCVA 4ESVA 2NZJA 2D7DA 4LHXA 1D5CA 1Z5ZA 2NQ2C 3BRWD 2O0JA 3GJ7A 3LW8A 1D8TA 2D06A 2WOOA 3G82C 3TKLA 3TRFA 2ZRFA 1GAJA 1D2MA 1PVOA 1XP8A 1FW6A 1SVWA 3NC1C 5SZKB 3SS8A 2JLXA 4OK3A 2ZE7A 2QMEA 2B7BA 1DAKA 3KKOA 2Z83A 1GILA 2CE7A 1EFRA 1LW7A 2Q3FA 3B2EA 2ZI4A 3A58B 3I8SA 1D9ZA 3PUZA 2YV5A 5DI3B 5F9HA 2ZJZA 2BOVA 2OAQ1 2REBA 2R65A 2HF8A 3IIKA 4M53A 3WMGA 1EWRA 1OW3B 1IXRC 4KBFA 4MYTA 3KTAB 4XWOA 2PH1A 2D2FA 3ADDA 1Q22A 1JXOA 3KKQA 3QG5A 5DYIA 3GJ3A 3AVVA 2QROA 2IS4A 2X8AA 3DM9B 1CF4A 1XEXA 2Q0HA 1SVSA 2Z5FA 2X2FA 2O8EB 3CF6R 2H18A 4FMDF 1MO3A 1Q20A 1DEKA 3BERA 1XXHB 5G53C 1ZNYA 4BLPA 3DOEA 2AFHE 2E9SA 2OBNA 4NTZA 3G0HA 1E2HA 5DGXA 1E4YA 4V02A 1BYUA 3AVQA 1NL3A 3UK6A 4EQ6B 2R2AA 5D3MB 4TYWA 2ZRHA 1AN0A 2ONJA 3V4RA 1YZLA 2ODNA 1QHNA 4RD3A 4MRVA 2Q21A 4US1R 4OI4A 1ZCAA 2G0TA 1BMFD 2LCFA 2LKCA 4B35A 1X1RA 2CVHA 4O2RA 2YC4C 4IOMA 4Z1MD 3B85A 1YQTA 1JR3E 1KO8A 1IAQA 1IXZA 4RJLA 1XEWX 1CU1A 1XXHE 1T3HA 3JZMA 3T34A 3NBZC 1P61B 2ATXA 1VG1A 2GETA 4LJYA 1JEEA 5FTMA 2AR7A 2GXQA 4TLCA 2ZI3A 4OI2A 4GPTA 3A37A 3VHXA 5TMPA 1H8ED 2W6JA 1JXMA 4EDHA 1R0XA 1JQLB 1NMZA 3SI7A 2VSXA 2WPDA 4BLRA 4MRRA 4A8JC 4RZUA 1NVXQ 2ZETA 5E3HA 1DELA 1FZQA 4X8MA 5TVKA 2HT6A 2O8FB 1XJ0A 3T1VA
chains in the Genus database with same CATH superfamily
2YJZA 4TWBA 2B98A 1X13A 2IPNA 2RHJA 3EX7C 1TIBA 3LVBA 4OBWA 1RW4A 2QTHA 5K3SA 3JQ8A 3VYTB 3KYDA 3WYDA 2BPOA 2X7XA 1P74A 3M9WA 2XCUA 1LK5A 4CF4A 2NTNA 4I4TB 5B64A 5BNIA 3NU1A 2H1CA 1GAEO 3HJHA 4B0PA 4OUDA 1X1TA 4GL4A 4LC9A 1Z29A 4GG1A 2BWJA 3K4HA 3CZRA 4A8JB 4XRGA 4F84A 3GLUA 1E2LA 4Z9YA 3W1VA 4NC9A 1NVVQ 4IWNA 5KTOA 1DBVO 1KEPA 2AR0A 3B1XA 2AK3A 5JS7A 3N2EA 4IFIA 4E2WA 3GL9A 2XXAA 3ZWCA 2WMDA 3IEKA 3NM5A 4LYDA 5FUXA 1OWPA 1W0KD 2E85A 3CRMA 1IK4A 3DLIA 4NZPA 4PCUA 2KBFA 1F12A 3U7QA 1QH9A 1XZCA 1TYZA 1YQQA 3FYUB 3T3MB 5BYAA 3T9DA 4ZJYA 3CEJA 1R6AA 5FWYB 3OEHA 3RR2A 1ISJA 3FCEA 1IQUA 3QTLA 1H0KA 1K7SN 2WUEA 2ZUDA 3KSUA 4R83A 1ZK4A 4UMFA 3PE3A 2IBSA 4ZTZB 4JIGA 5EJ5A 2DQSA 3HKBB 3H9EO 1EUDA 2ZAMA 4BYGA 4DLVA 4V2UA 4CM5A 4NZ9A 3Q72A 1E5XA 4LKOA 2O06A 1ZIDA 3KXDA 3QA9A 3ZW8A 4LYFA 5EUQB 1KMIY 4IIJB 4RTNA 1VM6A 3D6NB 1B00A 3PCTA 3HR8A 4R16A 3U7FB 1QHHB 2A78A 1L4BA 3A1FA 3AUSA 3N5CA 5LC1A 3ED5A 2CLMB 3S2GA 3WQHA 1PNOA 1H22A 1GUYA 1V8FA 3HGQA 4CM4A 1KJ9A 5KYUA 3RTAA 1FK8A 3INNA 1J5EB 1JDBC 4ZZ3A 1XNRB 3V7WA 5D01A 3I6IA 2WAYA 1TAUA 1CY2A 3RB8A 2XYQA 4Y2HA 1EFCA 1DWPA 2NQTA 2ZR8A 3NAZA 4MR7A 1YR9A 3O8OA 4QL3A 1QAMA 1W1IA 1W46A 2G9RA 2UVDA 3V8QA 2PY6A 1JT2A 3ESAA 4H0CA 1JQBA 3H2KA 4N7JA 4QODA 4DCNA 1ZN7A 1T10A 3N2KA 5A6SB 2Z5LA 1VPVA 1B16A 1T8TA 3D5EA 3OZEA 3W7BA 1BH2A 2X0KA 4F1KA 2QI9F 2NUTA 4YUWA 2QTVA 2IH2A 2ABWA 2QTTA 4FKBA 3U49A 1VBNA 3RH0A 1N1GA 2WTNA 5FKJA 5K8LA 5BVHB 3A1VA 5SY9A 3HDTA 1KDYA 5BV7A 3HDVA 5FULA 3UJ7A 5JALA 2DWOA 1JEYA 3TLCA 5KJ6A 2BLLA 2PO5A 3B1FA 1N2CB 2NSDA 1HE1C 3QKWA 3V4SA 1CW2B 1YB5A 3O31A 4TQUS 2ZVPX 3FGPA 4R8MA 2VP0A 1LC0A 1B8NA 3OF5A 4Z7QB 2A9PA 4W9RA 2J45A 4F6RA 3R5JA 1T29A 2Y8EA 5GVRA 3IR7A 1P9LA 1BQ4A 2DR3A 2COEA 2APJA 1K9VF 2FDCA 4XTRA 4ALJA 2IU4A 4BB6A 4ENUA 1Z9BA 5DWDA 1BFKA 1SURA 2J3DA 1AH2A 5FF9A 2ZIFA 3GJQA 3KCQA 1IBKB 3SVTA 5EIXA 4AXBA 4J4TA 1ORIA 3EDCA 3F6EX 3FUUA 4MQ6A 2GERA 2BI8A 4QPZA 4Z3DA 2P4HX 5K05A 4G1UC 2H2FA 1Y6RA 3DBHB 1N2CE 1S2OA 4IXNA 3OPYB 2IZ6A 5U1PA 1V8OA 1PAUA 1JR4A 3C3AA 2CLEB 3HYLA 1RYNA 1KRHA 4CM7A 4X20A 1JB9A 3CRQA 1P17A 5BQXA 5KWJA 1DRWA 3EIXA 5A04A 3TVYA 2BFEB 2QPTA 3LDUA 5L7WA 2I91A 3AHHA 1KIMA 3AUAA 3WO0A 1W7AA 3PHGA 1ZESA 4L9RA 4P7KA 4KJXA 3VPFA 2F1IA 4KR7A 4Z5XA 3EGXB 3FTQA 3X1XA 3TF5A 1ZH0A 2FUEA 2N42A 1HZZC 3UHPA 3G8AA 3N6RA 4J75A 3G8YA 1I80A 4BC0A 4C4TA 4DIFA 1Z37A 4YV1A 2WIJA 1KVSA 3EXHA 4R1OA 5DGHA 3LLVA 2W2NA 4EPTA 4C76A 3DEAA 5EPUA 3CN7A 1QYDA 4OUKX 1KBQA 5CVJA 2C9CA 1ORVA 1IPFA 1U0FA 2XB4A 5A62A 2VJMB 4RFVA 3ZZUA 2E4XA 1ZH6A 3VPSA 5KIAA 2WWWA 3WQSB 3W3AD 3JVDA 4ERXA 2OWEA 1I6LA 1LFDB 1FNSA 2YVAA 4M7WA 3MWJA 3GZJA 1ZI9A 5AMXA 4OFBA 3NWJA 3I58A 2JEYA 3DZKA 4IP0A 4ANFA 3AR8A 1I2DA 2QOEA 2GD6A 1V16A 3M6VA 3I32A 5M2QA 1ZOLA 3T0GA 3RFUA 3CNOA 5DSZA 4BFCA 1SG9A 2HMYB 2LD4A 1Z83A 3DLAA 4EWLA 4DMKA 5HX7A 1R8YA 2VWHA 4LXGA 5CXXA 5HOQA 3UFXB 1ANKA 2A1TR 1DEXA 4P58A 2BTOA 1QNFA 1UFVA 3K09A 2X15A 4NX2A 3W5IA 3CGWA 1Q0QA 1MVNA 4O4HF 2VJBA 1QC5B 3CF2A 3IDQA 2DLDA 4NJOA 4TTIA 1NI4B 2WD8A 1P8AA 3HXPA 2ODWA 1SZDA 4IR7A 1I5OA 1DOZA 1GPWB 1N5MA 1NW7A 4NCIA 4UAJA 1K3TA 4ZDKA 1QHYA 2JHFA 3R0ZA 4GECA 2WU8A 2KW5A 4QX6A 2FLVA 3L0IB 3LQ4A 2UZIR 3ZWVA 2ZYHA 4D4MA 1JPNA 2CF6A 3AEYA 3P2MA 3HB1A 3W05A 1NJ5A 5BSMA 3BK2A 4ZT2A 3QVUA 1OB2A 1J8VA 3EG9A 5ALIA 1XEFA 4R2HA 1DBQA 4XCXA 1ZJ4A 4DEVA 4MQ5A 4BY9E 3TNDA 2QUBA 5HKAA 4I8XA 4F2HA 3D64A 2W6NA 1VC2A 1T8SA 4R81A 2QIPA 3LQKA 4RDCA 4UM9B 5C7OO 2XYHA 1Q21A 3FDJA 1D6SA 4P84A 2Q5EA 3PJGA 4L2IA 2I6SA 3RSZA 2RK3A 3T41A 1XB2A 3NHAA 1E7QA 1GL3A 5HR5A 2WTMA 2H1FA 3P71T 1EAYA 5BWCA 1C30B 5IFLA 4UFPA 1QF6A 2FPXA 3IV9A 3ZXIA 1HTTA 1PWEA 4OJTA 1TD9A 2VHTA 4AZ3B 4IFTA 4EPVA 2J5BA 1F48A 2IGBA 4IDDA 1CYEA 3G0BA 4BGVA 3GPLA 3DO5A 5JMPA 1XMSA 4RSHA 1EX9A 2QPAA 2VATA 4OV6B 3WHLA 1LV8A 4FM9A 4KE9A 4KLZA 2P65A 1A9OA 4RD6A 4ZVTA 3DQQA 3GRUA 1JJBA 1SVIA 4KYTA 2Z6UA 3N0XA 4EJSA 5AO9A 3VDMA 3AL2A 3IX7A 4RAQA 1AD2A 3CVJA 2D1RA 3ROEA 4F91B 1O1YA 1U0JA 5TLSA 2OZKA 2EXXA 3WIVA 2VDWA 1CBUA 4QLBA 2PKRA 4NE2A 4L78A 1QG4A 1VKNA 4O4HA 3DBIA 1JLLB 1VPTA 4R7GA 3UH0A 4UNQA 5CK5A 4QZVA 4ZRNA 4OSOA 3AEUA 3ESQA 4F8JA 1J25A 1GQ2A 3NNNA 3SMVA 4Z6KA 5DGXA 4K87A 4NOMA 3EVCA 2Y0EA 4ZU6X 1NMEA 3SYLA 4NONA 1MH9A 4PHCA 3IIEA 1W76A 5BWOA 3CWQA 5JNTA 3GLHB 1P5ZB 1ILEA 3AOEC 3NRJA 3VR1A 4X00A 3R6TA 4G56A 1EK5A 1H69A 2PL1A 1TIKA 5KPJA 1Q1ZA 5EIEA 4HT3B 4UBKA 3EODA 5SZJA 1NJ1A 2HJSA 2JARA 4XWTA 5JPDA 2V96A 3PJEA 4LWQA 3TD9A 1M1ZA 1J5PA 3BVPA 4RPKA 3UFBA 5JOQA 5COQA 4UUAA 2HDWA 1U99A 1UM8A 3WI7A 4JB2A 5FWXB 1BW9A 3OT4A 1ADYA 3HU5A 1FSGA 1VDMA 1WF3A 5DE3A 4CFZA 3ENNA 2FSVC 1HG0A 3VR4D 4YMHA 1T0IA 3E5RA 4L8FA 1DBRA 3B6MA 1YZTA 2IVZA 4YRKA 2VT2A 3K6KA 2K2QB 2AQHA 4HAUA 4QPDA 4XE5A 1F4VA 2Z4RA 2DBZA 4MHTA 1E79D 4KHZA 4NLLA 2Z4TA 3A1SA 2GHQA 2Y4OA 1KIAA 3GLHE 3PDJA 1CEYA 5HE8A 2A30A 4JQCA 1AGRA 5F5NA 2A3NA 1H42A 1U28A 2GPJA 2ZPUA 3IQGX 4QUDA 1OCEA 3RDPA 2W58A 3LHIA 3NS7A 1NN1A 1AX9A 4C4SA 2AFIB 4EYQA 3OIGA 5KTKA 2NVOA 4ARCA 4DMMA 2JFWA 2QV0A 2HSJA 2XUHA 4KVAA 1HL3A 4MQFB 3U61B 4EGJA 5FEMA 2CFRA 4B4OA 3JAWB 1X70A 4UEOA 2VP6A 5M3BA 3UYKA 2YFHA 5KTNA 1OU0A 1M66A 3SQXA 2Z5GA 2QN3A 1G21A 2ZVJA 2YINC 5ALSA 3KO8A 3VHRA 2G7ZA 3PDCA 3GLIB 4LBZA 8ADHA 3OJ0A 2ZIEA 4L75A 3SVLA 1N6IA 3GLGB 1U2DC 3WJAA 3T95A 1AE1A 4KQFA 4CMEC 2C2YA 3ZBQA 5DHPA 1JQAA 3TLGA 1N6RA 2AFIE 4NZNA 1NYRA 1KMQA 2OCGA 2EZTA 3QVJA 4IO1A 2XZPA 2JI7A 3L79A 2HWWA 2C7BA 2DMRA 2GJ4A 3LCRA 2NU7A 1IJBA 2F2TA 4JEUA 1I2CA 2ZLBA 5DMXA 5JS8A 3QZUA 1MD9A 4YP9A 4CMHA 3V55A 2F3TA 5BO5A 5EVCA 2H85A 4N1AA 4G65A 4PGGA 2GA9A 3BORA 4IIHA 5BWNA 3DBRB 2EQAA 1HNWB 2FVYA 2NG1A 2E89A 1P7YA 5FI0B 3GLIE 2IEAA 4JJGA 2XBUA 4FYIA 1C8KA 1SD2A 2H4ZA 3B6KA 3A70A 4JI1B 3WRYC 3GLGE 1LKZA 4HQ6A 4MJ3A 2RHLA 1BN7A 4FFPA 1E0JA 1XDDA 1RZRD 4C6HA 2C2ZA 1NC3A 4K46A 4AJPA 2Q4EA 3I6YA 1MOZA 2O7QA 3PYLA 1NASA 2FN9A 4EP1A 1RM4A 3DCIA 4NJMA 3P4YA 3ZDEA 3L8EA 1US8B 3K9BA 1DQPA 2B30A 5F3RA 2O52A 1GTMA 3B53X 4MVJD 4YUXA 4MRAA 3IQWA 5JD6A 4D8TA 1YR7A 3UY4A 5CDUA 4FMCB 4OAPA 5GY7A 2CC2A 1FY2A 1XU4A 4GNKA 4PBTA 1KA9H 1BXGA 2VHVA 3PHIA 2VF5X 3DS8A 4OLJA 3M34A 2A0UA 3D31A 5CPBA 4ZT3A 2OXEA 1ZISA 5THQA 4DSOA 4M9UA 2PA3A 4WQMA 2O5VA 4GXTA 5AH0A 2J9RA 2ZJFA 1BU8A 3IKTA 2VTBA 2A4KA 2O8CB 1FTSA 4HB4A 3PGKA 4PZ9A 3U5ZB 1RWQA 4MIEA 2ZE6A 4TXHA 4E88A 2BP7B 4NH0A 3HB0A 3TTSA 3KHKA 4EJ0A 3F97A 1Y4SA 4UTZA 4I08A 3KJNA 1P73A 1LX7A 5ICCA 3JQ7B 4O3FA 5JNVA 5IF9A 5IVKA 3H2YA 2FFAA 2JJYA 4TPKA 2I5PO 1A5SB 1TTHA 3H4IA 1CNMA 3ZV3A 2PBLA 2P8SA 3VV2A 2C4WA 3KOWA 5ADWA 3TUZC 2W8ZA 4M60A 1PGOA 4JN6B 1IULA 1FDWA 5J5VA 1E92A 2H5LA 3AX6A 5F77A 3NEAA 5I7EA 2PFKA 1XYVA 2HCRA 2I62A 2PKXA 3G7NA 1M0EA 5DGIA 4HDSA 1EWVA 4RD2A 1NGSA 2J0VA 5C1DA 2LCQA 3UW3A 4ZEVA 1ZR4A 2DU8A 1A27A 3RC3A 1X15A 2XNKA 2NVUA 3T7AA 2LGJA 3HMKA 3URMA 3FOZA 3IE1A 2H52A 1D1SA 2Z57A 3K6JA 3FM9A 4LKRA 1C9MA 2GPYA 3AONB 1E5DA 3IVCA 2AWOA 4OXKA 1MOQA 2KYRA 2JFNA 2JIBA 1O94D 2WNHA 3FFXA 1COWD 1IWPB 1YJAA 4EI8A 4DUGA 3QG1A 4KMRA 3QELA 3DHYA 1XRPA 1ZUNB 4GHWA 3E7WA 1RE0A 4FHFA 5EXEA 4DA6A 4BO6A 3DFZA 4PPNA 2QTFA 1Q7CA 3HCWA 4CMGA 2H4XA 1AKWA 4JT9A 4JQSA 4KWEA 4C22A 4DLKA 5DEOA 4RDXA 1NF8A 2E4WA 3HY3A 4ZOBA 2DKNA 2ZG6A 4CN8A 4Z7NB 1EVEA 3HN2A 4MRMB 4TKUB 1G3RA 4LSGA 5LD2B 2CXHA 5BOSB 1A50B 1CY7A 2QL7A 1U6KA 1SK8A 3MJ4A 3NOVA 4RZXA 3WK8A 1A4RA 2GOYA 2QGZA 1SU7A 2CXNA 1NVWQ 3ABOB 4URYR 1KYZA 1OU4A 2A1UB 4CETA 4WY5A 3AWDA 3KKPA 4QWMA 3RVNA 1KETA 4JUBA 4YY3B 4DB4A 4YVFA 2GHTA 3WKBA 1XFAA 3TQFA 2P11A 4BX8A 1NT2A 3MLEA 3VZBA 3LV8A 2PV7A 1F5SA 4G1VA 2VK1A 3LY8A 1NMQA 1M6WA 4XJSA 5GONF 5HZHA 1V1MB 3FCOA 4RGVA 4BJ1A 1F17A 2ISSD 1OTYA 4GH5A 1JEQB 4P1ZA 5AM1A 1U3VA 3S2SA 3SZLA 6REQA 5TR9A 3GLFB 1ELOA 1FRQA 5DM1A 1VA5A 1PR6A 3CX3A 4RCZA 3OEED 3ZQ6A 2F1RA 4YMTA 3E1SA 3N8DA 1U8AA 5AM3A 3PPIA 1S9DA 2ID8A 3HXKA 5FI3A 5C31A 2B61A 5LDGA 2DQ4A 2I7CA 1JVNA 3A27A 2X4DA 1NUTA 3BXPA 1R5OA 4FMPA 4UE2A 5LIPA 4R1PA 1CE8A 1G2QA 4L74A 1RU3A 2FPLA 4RK7A 4ZMSA 1L7EA 2YUTA 4MX8A 2EC5A 4IDAA 1PEAA 4XVUA 1P2UA 4RXMA 2YFYA 4MYCA 2IEGA 1KORA 4GOJA 5L4NA 3KHTA 5TQ2B 2QMQA 1GVNB 1IN8A 2JHPA 2XV1A 4TT3A 4K40A 1VYVA 4LOLA 2XVMA 1JLRA 4IV5A 5EMJA 4CI9A 2F4NA 3TW8A 2J33A 1YWGO 2Q3MA 3JALA 4V1CB 3GLFE 3FWHA 2R6CA 1QCDA 1D4AA 3E2PA 2VT6A 3KJGA 4PWZA 4BN0A 1THGA 3EQZA 1T5SA 2NTJA 4ZK6A 2QMOA 4Z9AA 1ZS9A 1SC4A 3B38A 3PGJA 2XNDA 2DH5A 3G6KA 1YK1A 3PHLA 4URUR 3RKUA 3UHFA 4YEDA 1I7QB 2WPNA 2Q5JA 5BMVB 5I4CA 4TRMA 1E6MA 2HJ9A 2JLQA 1IQ0A 2P1DA 2F55A 3BH0A 3AOGA 5EHZA 2FH5B 2CXXA 1Z6YA 2ZRQA 4BJ6A 1Y5NA 2O8NA 2PQ0A 1KC3A 2PXHA 1Z88A 3FB4A 2FPWA 3CMCO 4GT1A 1MG5A 5INTA 2CXSA 1AHNA 2C58A 4RQTA 4LE1A 2OE2A 1E1QA 1V8DA 4HZGA 2CZGA 4B4DA 1U81A 2CNOA 5SZHB 2QYSA 1UMDB 5TMDA 3F78A 1W36D 3TZKA 3BTVA 3K32A 3JYNA 3WBBA 4GS5A 4RBNA 5EIOA 3D8NA 4XZ3A 4MVJI 4G0OA 3NR2A 4RVFA 3UJBA 5K99A 1CEXA 3M2TA 3W2TA 1PJSA 4B80A 1MTOA 2ORYA 4ZAZA 3JZFA 4Z0NA 5GONA 3X44A 5KWEA 4B3JA 4YGXB 2G0NA 1J1IA 1TEXA 2W93A 1IZ9A 3RU9A 5JDCA 2H11A 2O3JA 2M98A 1JR2A 3LX5A 1QKIA 3KQSA 3UNXA 1RQ2A 4D1YA 1FRNA 3I6MA 1L5ZA 1VI5A 3P9YA 1VCNA 3QU2A 4RUKA 3OQJA 4BWGA 4AK9A 1BO6A 3JQAA 2F1HA 4P2GA 1OFHA 3CFYA 1B76A 4RLFA 4RPGA 1MZVA 1UEXC 1BHSA 2YIMA 2YTZA 3HO8A 4J1QA 4JKIA 4BVEA 1W34A 2AJDA 5GADl 1PR5A 1WDTA 4P35A 4B6PA 3RIGA 5ADHA 1Z73A 1DSSG 5MF6A 4Z4IA 3R7LA 3QKIA 4OLBA 3GUVA 1YIOA 4RM2A 1D03A 1TZMA 3H86A 4JXZA 5IWAB 5I7RA 4R2WA 2YOFA 2CNNA 4MWEA 4JK3A 2DR2A 1Q1NA 3EQ6A 1DE0A 4YBRA 3T9FA 2CKDA 3FHJA 1QTRA 5D3ZA 2IE0A 2XUZA 1TCAA 2NZ2A 3GQVA 1UCFA 3HNRA 5CDGA 4MKHA 2MSDB 2XRFA 1T2FA 2VVTA 3OOYA 4NQRA 4IPTA 4DARA 1J09A 3LUFA 1QIFA 4R98A 4UNSA 4R1NA 4AJIA 1JU4A 1Q1BA 1RPTA 2HJRA 2W83A 3NDPA 5CM9C 5CFLA 1I4TD 1NATA 2GBLC 1HEIA 1M6VB 3KG2A 2ORED 1Z45A 1VGVA 2R4UA 2LV8A 1PQYA 2XUPA 3PFWO 4WXHA 1VKJA 3RT1A 1QTIA 1QUFA 4K2AA 3GJ4A 3OFND 3ZZ0A 5ITWA 4FNGA 3MMXA 5J40A 1JFTA 3KEGA 1ENZA 2LVBA 4FEYA 4Y6GB 2GN9A 1JHPA 1MOSA 3OHMA 2ID7A 2ZUUA 4LRWA 4MRNA 2IYUA 1TT7A 4HXGA 3W8EA 3GRYA 1E1CA 1NY6A 4WEOA 2IT1A 3NI2A 3OCVA 2VA9A 3MWDA 5C51B 2P91A 4G0MA 4HX9A 2EU8A 2QGFA 1UAGA 4TLMB 1XZQA 4EW3A 2ORWA 3EK2A 3BD7A 3AF2A 3MWEB 2CMKA 2GASA 3X0DA 3EPKA 3GZNB 4K1XA 4MLDA 1BMQA 1TFRA 3EVTA 1JA1A 4LMRA 1J9EA 1VBMA 3O47A 1QHSA 1PRYA 5KJEA 4RTQA 2BFCA 3W5JA 2Q2QA 1XK7A 1MOPA 1P9NA 2IYVA 3I0MA 3PXDA 5F7XA 5BW5A 1D4FA 4FHGA 1KU0A 2D1SA 1EZ1A 3N7UA 4NECA 4WKOA 5D5HA 3RLFA 3RVJA 4AL4A 3NQ41 3MAAC 3ZE6A 5I4BA 3UANA 2PTHA 4HTFB 4M49A 3M3PA 2H08A 1JSCA 5LVAA 4BVFA 1E9SA 4GF5A 4MGYR 3OQVA 4RQAA 2O57A 1FP2A 3BKXA 3GCXA 4UNNA 3C41J 1DQZA 1PDVA 3FN4A 2E82A 5L95A 3Q11A 3CUWA 5IUJC 2C83A 4P22A 4P3XA 4WK4B 5A1TA 4D9MA 1CUEA 1LVGA 1SU8A 1V4BA 1YQ9A 2YJNA 3V8RA 2G3YA 4CT5A 4Q4CA 4PZLA 1M6EX 4KN6A 1M1YB 1YMVA 2B8WA 3VTFA 1BXRA 1C9NA 2VLBA 4W63A 1OY1A 1MABB 1XFDA 3OBIA 3ZVKA 4R1QA 3LPMA 3MQ4A 3FA2A 3W06A 3WGNA 2IZZA 1KPIA 2XCQA 5AW4A 2V6GA 3ETLA 2FMFA 1YC5A 1EP3B 2Q0SA 1PGQA 3KR9A 1BCRA 1DAPA 3O8QB 4BECA 5BN1A 4YCNA 4LCJA 4C7OB 1Z06A 1UP7A 3E22A 2JVJA 4QUHA 1AA9A 1F3LA 2HFJA 4X8OA 3SC4A 4IAOA 1ZGCA 2WDZA 4F06A 3QBEA 1PKXA 2RAPA 2Y05A 2B2CA 1L5SA 5FPHA 3HN6A 4DA8A 2EG5A 3T9AA 3EOAI 3NTUA 4BC1A 1UKYA 3B3GA 4BFVA 1QF9A 2X42A 4WL0A 3TO5A 2R5NA 5GIPE 4MNTA 1BS2A 4OYHA 1N2XA 3DYIA 3UGQA 1SQ5A 1JTVA 4LV5B 4OX9Y 1M1YE 4BMYA 1J99A 2HU2A 4JCCA 4WBNA 4NZYA 1JR3D 2A14A 2WLTA 4YJFA 2R5WA 3A25A 3CB4A 2KSQA 3FUTA 1SCBA 2CLSA 2OV4A 3IQDB 3ORSA 1RMYA 2I4IA 1X14A 3JQPA 3KPJA 2JAXA 1R66A 2ZM6B 1WLYA 4M38A 4ARZB 1V2GA 4B8YA 3ABQB 3O9VA 3M5CA 2RHBA 2AN3A 1O0BA 3BTOA 2WKRA 3GP5A 4R54A 5EJ8A 4YIHA 1JDTA 5J9FA 4BKQA 1R4MB 1NTOA 3QLEA 3H83A 2H57A 3ZGYA 1T36B 2XUAA 5EJ6A 5K03A 2BYTA 1NXWA 2HCFA 4ND1A 3KB2A 1A2OA 4DILA 5NULA 4GX1A 1L8AA 3RK0A 5BSEA 4U3JA 1VSUA 4OK5A 2HA4A 3MWKA 3WBJA 4W9NA 2WJJA 5FOXA 2CV0A 4FGJA 4GOKA 2IOFA 3C5HA 5TY0A 3WOVA 4G8CA 2LRHA 1EP1B 1Z4LA 2G07A 3KJXA 1WW2A 3PUXA 1M2GA 2DCMA 1IH8A 4OKIA 2GAAA 4Y98A 3F47A 5EUMA 2JLYA 2D7JA 2XLBA 1A5AB 4BNKA 5HZGA 3F98A 2FJUA 1PJQA 2QU7A 5FUVA 3BK7A 4UUMA 3SC6A 4OQQA 3DV0A 5HM6A 1Q0PA 5C8YB 2Q8NA 3A05A 1ULSA 4GR4A 3TNFA 2BJWA 2JFXA 3IODA 3DZFA 4FK8A 2OD9A 3WJ1A 2W2PA 2ZUTA 4MV7A 1IBMB 4Y7DA 4CM1A 2CUNA 3CWZA 4IVQA 3KJFA 1R10A 3B1VA 3PNOA 3OP1A 4IEIA 4EYKA 2QUKA 3ZXXA 1DG1G 3MGBA 5CTJA 2ZITA 4HO1X 1XRLA 1ZKMA 3NHBA 1G3MA 1MT3A 1Q44A 2IGTA 4MUMA 2EBFX 3FR8A 3EDOA 3H11B 4FDMA 4A4DA 4D4LA 4ZYYA 4KXNA 4AM8A 2GZMA 1P4AA 4PHHA 2IP4A 5L9AA 4D8YA 4PGAA 3HDQA 5SY6A 4LMBA 1A9QA 1I2AA 4RMNA 3HVHA 3PCRB 1VL2A 2XIQA 2PE5A 2Q29A 4XH9B 3DEYX 3PQEA 2B82A 3WOHA 1I32A 1DJQA 2LE0A 2XWBF 2OB1A 3FZGA 3LVQE 4I1OA 4O5OA 3RVQA 1MVOA 3AY7A 1SC9A 2QE7A 2XBLA 3RYHB 2FUNB 3ZHOA 3I9FA 5C8VA 4KH1A 5ISMA 2XEXA 3GFFA 1TKRA 5I47A 2B4TO 4G5HA 1PLLA 4LXIA 3IC5A 5FOUA 2JFYA 1W96A 3TIFA 4C5AA 3CNEA 1DCKA 1YB2A 4QLAA 1PJTA 3ZHQA 2WB4A 4MEAA 4ZV7A 5I7FA 4BEJA 4P31A 4Q00A 1JHXA 2PFGA 4Q1VA 4Y2QA 3ZKWA 4C0BA 2QVCA 3NUGA 1Y3CE 2I03A 2VI5A 4DWVA 3UF0A 1ISFA 1QFYA 1H2XA 2DTXA 2WTAA 3NMUF 1XOIA 1KS2A 5EP3A 2BMAA 4OLAA 3QYPA 2YKGA 2O8BA 4B2IA 1FX0A 2B36A 3G68A 4X6LA 2VDKB 2ZB2A 2JZCA 2IIQA 4DS3A 1C3LA 5CD1A 3A3YA 2MINA 5JNUA 3ZVMA 3HABA 3JCZA 4KWHA 4KXMA 1GYRA 1N1MA 3MF4A 4XUGB 4YRCA 4BZXA 5LR6A 1ZHHA 4FBLA 4OLFA 4HHEA 3KJHA 2R9VA 3OOEA 5K3FB 5KEIA 4GLLA 2A67A 5L3VA 1FUIA 1IHUA 2PLRA 2XF2A 4WUTA 1XDUA 2HRQA 1Y7HA 3IBGA 4L0MA 3GFVA 5HZMA 5IVHA 3RU7A 1G63A 2IZOA 4X63A 4Y9TA 5AOAA 3KHSA 4H18A 1PX2A 4IIGA 3O8CA 4QAJA 5JS6A 3HH8A 4Q37A 3AWIA 1ISSA 1TVCA 4BZZA 1QQTA 2GNPA 4NK5A 5B7GA 1OI3A 4UHBA 2ZYRA 5CA0F 2WF7A 3IEMA 4P7FA 5I6DA 3K73O 4Y6LA 1N4AA 4EGCB 3F3MA 1H2YA 3NBUA 4BUCA 4TN1A 5IT9A 3FZYA 1S2DA 3BMXA 4FX2A 2CJFA 1OMOA 1WO8A 1WTAA 2P77A 5J4KA 3FOFC 4TQAA 2GT1A 1SKMA 1QR6A 4XIIA 1KMHA 1R4ZA 1XRNA 3WP0A 2BHTA 4MW7A 4YLEA 2JIPA 2X9LA 4BV8A 1UBSB 4JB8A 4RTOA 3SQWA 1O6ZA 1GHTA 3A32A 3HADA 2HJHA 4OTZA 2Q0QA 2NPFA 1X7HA 1PV1A 2AMLA 2OSBA 4YJHA 2YXPX 5KNBA 4CG2A 1CUAA 2I1VB 4OL9A 4PYLA 4TXJA 5AKHA 1K86A 4LK3A 5BP7A 5A5FA 1AOXA 1VZ2A 4P32A 1L8LA 5IBPA 4LHYA 2OZPA 3VU9B 4UM7A 3HVRA 3R6DA 1O9HA 2A1IA 2WZCA 1T5HX 2C2MA 1XLWA 3MIZA 2A58A 1ABEA 2CD7A 2XTZA 3GGPA 3IDAA 4M0MA 4MI6A 4RIFA 4XRRA 3WKEA 1R00A 4IFEA 4E3ZA 3AB8A 4HLDA 4JBGA 3VKVA 2X9GA 1YR1A 1TLLA 1WD5A 1E3IA 1GR0A 1VG8A 2FQWA 5L4SA 4JITA 4JUCA 1O6BA 4IIUA 5KYNA 3WISA 5KSPA 4FFNA 1BMDA 1NVDA 1KQOA 3HUTA 1C7FA 2EZ8A 3UXYA 2GJKA 3MWFA 4JLAA 1OVGA 2BE7A 2QRZA 5KKNB 3UG7A 4MK4A 2B5VA 1DCFA 5CT4A 5EZYB 3IUBA 3AGPA 4K88A 5G4KB 1HDYA 4TLEA 5TDHA 4BKRA 5KQRA 2YXLA 1DIOB 4Q02A 1L4UA 3OO1A 4JBHA 1HEYA 5LZ9A 1MB9A 2J9FA 2VXCA 3HHEA 3ZJYA 1VI6A 4JYBA 3JS5A 4PG7A 5EMHA 5F5LA 3VTZA 2WIAA 2X9VA 2QMUA 5JG7A 4MZDA 4ZPJA 1B6TA 1YTUA 1ZWLA 1USWA 4XQ9A 1Z34A 4FD3A 4UBMA 2IOQA 2WUFA 3VO9A 1GKIA 4FN4A 1USKA 3JQAD 4GM1A 3TCKA 1HYQA 2ZJYA 3FVQA 2GARA 1OTHA 2W2LA 3G7UA 3IYLW 4MITA 4NJEA 3FNBA 3OVMA 2PSSA 2XQVA 3K0KA 1H6AA 5T4BA 4OB8A 4WA7A 1ZL0A 4BNJA 4L02A 3B2NA 3UTDA 2F64A 3QWIA 3PNVA 1EUQA 1T9GR 4DY4A 4EG1A 4DKJA 1OV6A 4UXIA 2ZIWB 3EXHC 1N6PA 1MUUA 1X7ZB 2HIHA 4MPDA 3GOQA 1M6NA 5FBLB 4C08A 5JECA 2YY5A 1ZNZA 2IL1A 1HY3A 1GP2A 3LLCA 2JB9A 4YHBA 1W88A 2BDEA 2Y1WA 2CMDA 3ZK9A 3QXSA 4NPHA 3ACBA 3IDFA 4RTMA 1GADO 4Q9LA 5JFGA 1GG2A 4MWTA 2QI9C 1OHHD 3AY6A 4JR0A 5DLDA 1P0PA 4B3SB 2OCAA 2JVIA 2BR5A 1DKOA 3VR6D 4DM4A 4ZRDA 1SR8A 4OQXA 5DM60 2J3EA 1G8SA 3GP3A 1IEVA 2NZUG 4MB2A 4DN6A 3ABRB 2O8EA 1TC1A 1P3Y1 1R12A 2OTCA 4Q19A 3ZHUA 2ACKA 2BHNA 3ESXA 1T3GA 3BAFA 3LQFA 4MP6A 1IPEA 1EJ2A 3SZOA 3IHKA 4CT4B 3D4IA 3JSXA 3ITNA 4YBZA 3UJPA 1R37A 3LM8A 1T2VA 4KZKA 4UHHA 3W4IA 3FDZA 2BVNA 2PR7A 3CXUA 5DX1A 6ADHA 4OM8A 4Q7QA 1N0IA 4F9EA 2IV3A 1EVZA 3MC1A 1KK3A 2H3HA 3K09C 5JS2A 4P38A 4XB2A 4MWSA 5F73A 3KD2A 2C07A 1RPZA 1RHRA 1E9EA 4GDMA 6ABPA 4XFKA 4IS3A 2H4YA 5DK4A 1D6NA 5EWJA 1FTNA 1Y1LA 1XKQA 4LHSA 3DF7A 5CP8A 2ASEA 1YQXA 3WLIA 2GM5A 1ADJA 3A0RB 3QIVA 4Q3BA 1LA2A 2RHTA 3EEFA 2W70A 3U4HA 2MHCA 3T5DA 1G59A 4OXRA 1W36C 1EZ4A 5T8KA 3HDJA 1MO4A 4J94A 4JX8A 4UD2A 4AMGA 4F45A 4GPIB 3V3TA 1IUOA 3F74A 1Z5GA 4DABA 2VAXA 1YVUA 3AKCA 4RADA 4QRIA 1TA9A 1V5GA 4JJ4A 2B0JA 3VH3A 4QASA 1T0HB 4BNUA 1T24A 1EX6A 1Y5RA 2H4WA 2HJGA 3MMZA 4MCIA 3WK9A 5AVXA 1NYTA 1NLUA 3IIMA 2BFDB 5ERXA 3TQOA 2JGAA 3K1AA 4WXRA 2Q3JA 5CD9A 4C0QC 5B1DA 3RSGA 4HQKA 3S6JA 3O03A 1HFEL 3E3OA 4UTNA 1DDOA 3VFDA 4M9RA 4U2GA 2V7VA 4IGFA 4MYHA 2DFKB 3LT0A 2WBLC 1MC1A 2PZFA 2R8YA 2P7HA 1FBNA 3JD3A 3KVYA 2PR2A 1YCDA 1I1OA 5CAEA 4TXLA 1YZHA 4L5YA 4JV5B 4L4SA 4FKZA 4II7A 2VEDA 1SUWA 3B82A 1GFWA 1QZUA 1K4KA 1GVHA 2FZ4A 2GA8A 1YR6A 1USUA 2H2IA 2OV6A 1LGYA 4KACA 4R40A 2Z08A 5IDQA 1F8GA 1OB5A 2VUHB 4PHTA 4UQPA 5C9ZA 1TF2A 5TEVA 5CFRA 1VOTA 1ZD3A 3HEAA 5DTIA 2HQRA 3OMXA 4LZWA 5AJVB 4A10A 4H6VA 1RE1A 4WSOA 5FV7A 3TX2A 5CVUA 4F5YA 5DF1A 2GUGA 3TD2A 2HA3A 3KUUA 2JGKA 3DMPA 4Z4CA 3LIIA 4FLMA 4NL4H 3U4QA 1P18A 1RKBA 3OJLA 2PUWA 1G7RA 3C3YA 4JLOA 3EQ9A 4KPUB 1M83A 4YLYA 1IU9A 1NBAA 4F1WA 4M9SA 3E8XA 3IMKA 1NYLA 2VF8A 4JASB 4EJSC 1QH1A 2D5IA 4D9NA 3ZS8A 4D41A 5F9FA 2FP4B 1ZVMA 2OCBA 1U1CA 4LVUA 2C42A 3E3NA 1TAGA 2ZRPA 5C5IA 4I6EA 1KAMA 2GB4A 2YQZA 4M3NA 1MX1A 1CV2A 1YK0A 2G4VA 2NOAA 1JDJA 2PL5A 3QJGA 5FYQA 2NZVG 3TIGA 1DBWA 2LUOA 4KK4A 1JKJA 2X7JA 4BJ3A 3RUCA 2P9BA 1BWRA 3O2QB 1SUBA 5DHUA 1RWMA 2EBHX 1A7AA 1Z8NA 3JYPA 3M6LA 2C7OA 3C8HA 3GFBA 5A5EA 4OB6A 2W6OA 3D6FA 1O9GA 4Z54A 1RKVA 2GKSA 5I7HA 1QGAA 4UUNA 1LDYA 2OECA 3I2KA 1JI0A 3ML1A 3BL8A 1RMQA 1XZGA 4AKHA 4NBTA 4ZODA 2CLCX 5AKJA 4ZPXA 3AUXA 4FZ5A 3RWOA 3SQLA 4W5RA 3FJ1A 5H80A 2QRQA 3F0TA 1CZNA 3QHPA 4I2NA 2GYWA 3GUZA 2E0IA 1Z0AA 3IOBA 4IDGA 3RRMA 3UJ3X 2HZBA 3LIPA 5KDLA 2XMZA 3C24A 5DGCA 5GM1A 3ZZTA 1S4QA 4MQ4A 4KU4A 3KOMA 7GPBA 1WSAA 2VH5R 1XYGA 4TZKA 4DZZA 3ZNPA 2Z56A 3IPXA 3B1YA 3G2JA 3IULA 3WGTA 3IVXA 1K08A 1OT3A 3MRSA 3SXJA 1R8XA 3LL7A 4QYWA 2CV1A 2B6HA 3U7JA 2XCIA 4PV7A 4TMXA 4BLWA 1QIHA 3P2JA 3ETGA 4TMZA 1EEHA 1MV5A 3EUAA 4INOA 1MJNA 5HFAA 1CJUC 1XV5A 2IPOA 4G8DA 1E1RD 1YS1X 2XYVA 3GQBB