1FUEA

Flavodoxin from helicobacter pylori
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
GKIGIFFGTDSGNAEAIAEKISKAIGNAEVVDVAKASKEQFNGFTKVILVAPTAGAGDLQTDWEDFLGTLEASDFANKTIGLVGLGDQDTYSETFAEGIFHIYEKAKAGKVVGQTSTDGYHFAASKAVEGGKFVGLVIDEDNQDDLTDERIAKWVEQVRGSFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Crystal structure of oxidized flavodoxin, an essential protein in Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Electron transport
total genus 52
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fueA00
4N65A 2ZKIA 4LTNA 3NHSA 3QFRA 2MWMA 4DILA 4HS4A 2X2OA 4QOIA 2KLBA 3FX2A 1XYYA 1GG5A 4PU0A 1RLIA 3OVMA 4YAFA 1XYVA 5B3LA 2XODA 1D4AA 2FOXA 2Z9DA 3JSXA 3NHYA 1J9ZA 4BMPB 4C76A 4PTYA 2OHHA 2OYSA 3W78A 1I1OA 3ES9A 1AKWA 3HLYA 2HPVA 1JA0A 3W7AA 3FW1A 5BUCA 3O2NA 3GFRA 2FVXA 3KLBA 1FLVA 3OWHA 4BMOB 4N9QA 3QFCA 3HR4A 2HNBA 4NLLA 1XT6A 1YKGA 2QMZA 3R6WA 2D5IA 1CZRA 1YOBA 1FUEA 4FX2A 2F1OA 1AKUA 4QOGA 1AZLA 1OFVA 2M6RA 2HNAA 5FA6A 1QRDA 2Z9BA 4FGKA 3LCMA 1YCHA 5EMNA 4N82A 2BMVA 4S24A 2GSWA 1C7EA 3N3BC 1ZWKA 4F8YA 1FVXA 3NLLA 5LMCA 3TEMA 1CZNA 3SVLA 5FX2A 4Y9RA 2WC1A 3ZHOA 4QOHA 5F12A 3ESXA 4PTZA 2QX8A 1D03A 5LVAA 2FLVA 4U7FA 1DXQA 3S2YA 3W79A 1VMEA 4FGJA 1OBVA 3W77A 6NULA 1F4PA 1T5BA 2V5UA 1CZOA 1BVYF 1JA1A 4DY4A 4ZVKA 2QX9A 3N39C 2V5VA 4C14A 3HA2A 1AKTA 4ZVNA 4ZVLA 3NHKA 1YCGA 5EAIA 2MTBA 5JROA 3ESYA 3ESZA 1QBGA 4C0XA 2N1MA 1T0IA 3OX1A 1FLNA 2BPOA 3TE7A 4LTMA 2MOKA 3NHWA 2RG1A 3OJXA 1WSBA 1RCFA 4C0WA 3NFRA 2FZ5A 2BN4A 3NHLA 1D04A 2QMYA 4M0CA 5TGZA 3NHFA 3G5MA 5LLDA 2A5LA 3QE2A 2R96A 2FX2A 3OX3A 1E5DA 3B6IA 2V9CA 4J8PA 2B3DA 2Q62A 1CZUA 4U7HA 1YDGA 3F6RA 2QX4A 4DIKA 2W5UA 2R97A 4XDGA 1FLDA 2MT9A 5B3KA 3OJWA 4HEQA 5FUQA 1AKQA 2FZVA 4GR9A 3D7NA 5LJIA 1AKRA 1ZX1A 5NULA 3RPEA 1FLAA 4ESEA 3O73A 4QOFA 1WSWA 3L9WA 5F4BA 3KAPA 4XDHA 3GFQA 2Z9CA 3U7IA 4CF6A 5NLLA 4FGLA 2OHJA 3LT5A 5F51A 3TZBA 4Y9UA 1V4BA 2BF4A 1FX1A 4YQEA 1NNI1 4D02A 3UXEA 3F6SA 3EYWA 5A4KA 1CZHA 1TLLA 4YAWA 3NHUA 4YALA 2X2PA 2FAXA 3N3AC 2Q9UA 4GI5A 5ULLA 1J9GA 3F2VA 1OBOA 4Y7CA 2XOEA 2QX6A 1XI2A 4GQIA 1AMOA 1J9EA 2QWXA 3K20A 5LJLA 1BU5A 1CZLA 4QOJA 2FDXA 1SQSA 3B6JA 5LBTA 3K1YA 3F90A 5LBUA 1DXOA 4R81A 1KBQA 2OHIA 1QHEA 3EDOA 3OX2A 1J8QA 3NHPA 1FTGA 1B1CA 3NHJA 1ZWLA 3KEGA 1AG9A 3OWXA 4OXXA 2M6SA 3KAQA 4QOEA 1AHNA 4QODA 1RTTA 3L9XA 1SG0A 3GAMA 2AMJA 2KQUA 4H2DA 2ARKA 3FJOA 1X77A 4LAFA 3B6MA 2BZSA 4ICIA 5EA2A 1RLJA 1YRHA 4LA4A 1H69A 4NULA 1QR2A 4YAOA 3B6KA 1C7FA 3GFSA 3FVWA 3U7RA 3NHRA 2Z98A 4U7GA 3UXHA 3FNIA 1YCFA 2FCRA 1AKVA 1CZKA 2QR2A 3P0RA 4YAUA 1DX9A 1H66A 4CETA 1TIKA 1KBOA 4H6PA 4LTDA 4ZVMA
chains in the Genus database with same CATH superfamily
3R23A 1X39A 2R5FA 1ZJYA 4IV8A 1S96A 3HZHA 3T7EA 1SJ9A 1LK7A 1SRQA 5GZ6A 2X42A 7GPBA 1LC3A 1NN0A 5I7AA 3V2IA 1J22A 4TT8A 1YCDA 2COKA 3T1QA 2LPMA 2PX2A 3MJSA 3UHOA 1E9FA 1VHDA 3RSGA 1U90A 3ZGNA 2ZB8A 2ABWA 3ICQB 4PCAA 1PD1A 2FUEA 2V6BA 2ZQ5A 1JBQA 2R1UA 5IF3A 4EHNA 2Q3CA 5EJEA 2PD4A 2JJYA 4W1PA 4M83A 5C4IA 3H2KA 3H3FA 1UPBA 1JJFA 3L7OA 3BJRA 4D0GA 1AS2A 1M6VA 4HYEA 2YTZA 1LPMA 1USVA 2HQOA 3UMVA 2HRQA 3B9BA 1EDBA 1HMYA 2BMJA 3KWJA 3VU8A 1NP7A 2XOKD 3K72B 1N78A 1KU0A 2GZMA 3HBFA 1SK8A 1XMVA 4MUEA 5KCMA 1NSTA 4DJEC 1QG0A 3EQ7A 3TN7A 2ODTX 2QJFA 5U4QA 3CLVA 1MO6A 1F2UA 4EVQA 1VIDA 2NO0A 3P2YA 4YGXB 5EJ9A 3S5JA 1ULSA 4J49A 4BAGA 2Z9DA 2PNFA 1N0IA 2WWHA 1PX0A 4JUDX 2FGKA 2OENG 4ZAXA 1VB3A 1Y6FA 4R1PA 2ACWA 2RCNA 1BVHA 3W8DA 1Q1GA 2NZVG 3DZIA 5E3IA 3RVRA 3U7FB 2IBTA 3FI9A 3IAFA 3M9LA 4PW0A 2CLOB 4HVTA 3UT0A 2QNIA 3GRKA 1B93A 2ORWA 3I01M 1I8TA 5DH9A 3CLRC 3IVGA 4YRMA 4KTTE 5KYVA 3H2GA 4J7UA 1LPOA 4K2HA 2ZSIA 3ZDAA 1ULBA 3RYCA 1JQDA 2VJMB 3B48A 1MEOA 1KYXA 3R3UA 3F3MA 5P8WA 4TKVB 3BL6A 1W44A 1RQGA 3Q3IA 4OL0A 4URZR 1SZJG 5LOVF 1MH9A 5G3ZA 4AS2A 1HDCA 1D8AA 1T35A 2WYIA 2XEXA 4AYTA 4CQMD 3GCGA 3LBYA 1RJ9A 2R6FA 5C4GB 1EFLA 1GPYA 3KDPA 4FMBB 1Y98A 4YV2A 3ND8A 2FPPB 1W35A 2P4UA 3EODA 1XCLA 2VJLA 3BWMA 1VCIA 1B8PA 1KMHB 2XB9A 4LYAA 1QE5A 4ENUA 4X8MA 1ZOPA 3SOZA 3T4EA 1ZSVA 4LNUB 3HDTA 3JU3A 4EEXA 3IEPA 4PZUA 3FCCA 1BA2A 4NBKA 2O06A 3VO2A 3KLBA 4KFRA 3TR5A 2DYKA 2WQZA 3PHLA 1JHDA 5EUQB 3BILA 1KOLA 1DC8A 1K4KA 2WVAA 1OLXA 3S44A 3SHQA 2LBPA 4HZIA 1THZA 5JZMA 1N1EA 1Q7GA 4CMEA 3I53A 3SEZA 4CLDA 3O4JA 4V38A 2LCFA 2IYZA 4PPGA 3DP7A 1DOZA 1B2LA 2BFEB 4R9VA 3ERCA 4Z9FA 1C1XA 2RH9B 2IHTA 3P0EA 5CB4A 1RDFA 3NG1A 2ZTHA 5JVDF 4HLUC 1ONPA 4FNAA 3M3DA 4OV6B 3SX0A 2VJKA 4M3NA 1W1WA 2C2MA 1CQWA 2DFKB 2HGSA 5IEJA 1VYVA 2P79A 1UT8A 5CYFA 4ZVTA 3U56A 3OQBA 4QM6A 3QXHA 3ZW9A 3HNOA 5K9ZA 4MLDA 1DTEA 4Q7MB 2YWRA 1ZAKA 1E9DA 2XKKA 1ONNA 5K01A 4HUJA 3EVDA 3I4LA 2XVYA 2HK7A 3P0FA 4Y98A 2CHGA 2FNAA 2WF5A 4MHSA 4WN9B 3UW1A 3W8EA 1CYDA 2PQ6A 4WPGA 4TRNA 3JQGA 1FBTA 3HKBA 1ZI9A 2D0PB 2ZSEA 3QHPA 4FBGA 4EW2A 1Q1AA 1DKQA 2E4AA 2VXYA 4A0SA 1W4BA 1TD1A 3BTVA 1IWBB 4JJ6A 4EVIA 3B1WA 3CVYA 4BJ5A 1FNDA 5T67A 2M9MA 3GBSA 4BLQA 1K8ZB 2OBFA 1RAGA 4ZI2A 4YRSA 4AY6A 1GUFA 5CVEA 3GEEA 1W88B 4DQKA 1KH2A 4UUNA 1X1QA 2DQSA 5LKAA 2HRCA 2G4CA 4S1OA 1ZWKA 4D56A 5JCOC 4EAAA 5TQJA 4CFSA 4Z3KA 4JP5A 3UK7A 4UAUA 2HBYA 3G9ZA 4D6XA 3NGLA 1X7WB 3SVLA 1WY7A 1M2WA 2ZCJA 4OAOA 3LHFA 3ZZ0A 4FYXA 4YAGA 5JISA 5J4LA 2AJBA 4DR6B 2HB6A 1QLWA 3HMQA 4HFJA 2WM9B 1VP9A 2PZEA 3B20A 3VPFA 3ZQKA 4F3TA 1G2QA 4KSYA 3RYTC 4V0KA 5DI3B 1KMNA 4QXMA 2FG7C 1BCRB 4QYMA 4AZWA 2PZJA 1O5IA 1I9GA 3R24A 5BXQC 5KWEA 1POXA 1X9IA 1RI3A 2G76A 1YJAA 3IBFA 3C4QA 4JLOA 3ZOKA 1YRQA 4Z4CA 1RAFA 4ZRDA 3LOPA 3EPRA 4MVJH 4UVGA 3ZKAA 4L95C 4TROA 3DOJA 3ME5A 1E1LA 4LF5B 4P34A 4WBNB 1B6GA 5DTQA 3FHLA 1PVDA 4N8EA 4ARZA 2CCKA 1NV9A 1K7XB 2H4XA 2GPNA 1LRKA 1TM5E 2NXWA 1YJ5A 3IVXA 4FFPA 2CLCX 2G88A 4JLBA 1DXQA 4R7TA 4HDQB 3V55A 3DV0B 2EX1A 3I5XA 4RH0A 3BKXA 4TXJA 3X2EA 3HY4A 1W85A 2DBRA 1EIWA 4JWTA 3BK2A 4GNKA 1OBVA 2BI8A 2MSNA 2R8XA 3FPSA 2Z30A 1G4UR 5C1IA 4DREA 2ODEA 5IFLA 1I7QB 4PQFA 4G4JA 4E88A 2JS7A 4DA7A 4QG3A 4V39A 3DS8A 4M1QA 4DCNA 3KKQA 4MRMA 1J5PA 1Z8HA 1I0IA 2WI8A 5JD4A 2C2XA 1ANKA 5E7JA 2WAYA 3FTNA 1SWVA 3GV0A 2B83A 3NHZA 1KYTA 3WLIA 1CJUC 1MNQA 3ZLUA 4DF3A 4Z6KA 1E18A 7REQA 5KSWB 4F6LA 1M5RA 2JA1A 1OIXA 3F3SA 4Z7NB 2V45A 2GEJA 5BV7A 2MTBA 4IIBA 3QU4A 2UZAA 4LZLA 1GVNB 3HZZA 2AG0A 4B3RB 1EXNA 2REQA 1H1TA 4WLFA 1U5BB 2FEMA 1G3IA 1G3QA 1OXMA 1RW4A 4KU4A 1KC3A 4L8FA 4CHTA 1UCFA 1SQGA 1QQ6A 4G07A 3JQAA 5ITSA 1BIFA 1JPNA 3GJ4A 4RZUA 3WNVA 5ICMA 1PKEA 2C7RA 4OVKA 4KLCA 1M2OA 3EQ9A 4OJQA 1OW3B 2H2HA 3BORA 3G6WA 3VM6A 4UASA 3CEPB 3JYOA 4WUVA 2B0CA 4B8YA 2O50A 3N2GA 2ZKLA 4O2RA 5CT8A 1X7DA 4C3VA 3GEBA 4ZCTA 2Z0MA 4HNQA 5DM4A 4B5KA 7ABPA 2B7LA 3OY2A 3RQIA 1AB6A 1I3LA 3KOWA 2QVBA 4FNGA 3UG6A 4RZQA 1QOQB 5DRTA 1KVRA 2RG1A 4JHXA 4ONEA 1ZH2A 1J49A 5B4UA 2EFCB 3MBKA 5AKLA 2VAVA 4IIXA 2BTOA 1E2MA 2DAPA 1NQOA 3RUFA 1B4DA 1LGYA 1HOXA 1LB1B 2NQ2C 1S4MA 1CJKC 1NW3A 3GFOA 4MV3A 5KEIA 4O2AB 4TL7A 1NP6A 1UM8A 3RF7A 3PA6A 3NXKA 4JEUA 4KSCA 3KVRA 3LKZA 3ZNPA 4G4GA 2GN6A 4HDNB 1W94A 4EH1A 2PMWB 3A1EA 1WXHA 1QHNA 1OIVA 3GVXA 4ZT3A 4DDMA 1LTKA 5A5FA 4LVNA 1W36C 2WKPA 5BNIA 3OH8A 4TMWA 4JUCA 3TAXA 2XTZA 4EF6A 1FJ2A 3O8LA 3WB1A 3WWEA 2NP7A 1FFCA 4UC0A 1WCIA 2W8ZA 4M1ZA 2UVPB 4UVIA 1ZGBA 3VPHA 1Y8RB 1G4AE 3IMKA 4TYMA 4WJZA 1CRLA 3F97A 4IOJA 4PO3X 1OI2A 4CMHA 4FQ5A 1QFMA 2WG0A 3FUUA 5DEOA 1MX9A 1P0PA 3B6IA 2FWNA 1VE9A 2IITA 2VRBA 3MFQA 4LDAA 4ZCSA 3AR6A 1ATZA 2D8AA 2ZRPA 4ZOAA 5CB0A 1OPRA 3P9KA 1N5JA 4KFUA 4RESA 4ZIRA 2O3QA 2Q21A 2YV3A 2W93A 5I9LA 2V6MA 1KKLA 1LA2A 1SUSA 1PEYA 3AUSA 4Q7KA 5HDQA 4WH0A 1WUYA 5J5CA 4BLVA 4ECAA 1N2CA 3LVRE 2XCQA 3FHCB 3DMNA 3M89A 4WERA 3T9AA 1TAQA 4LXHA 3AEQA 4ETMA 1MA0A 3AEUB 1E2PA 2HQ1A 2F55A 1CY6A 3P26A 5C51B 1OFGA 4H7IA 4QU5A 4J3NA 4JLKA 2XRFA 3ANLA 1OB2A 5E38A 2HJHA 2WD9A 1WU7A 5DGXA 4DGSA 1HDXA 4NOMA 5A4MS 1TYEB 4BZZA 4Q4DA 1EVJA 3BB1A 1YZFA 3OMWA 1DAEA 2BD0A 5NULA 4R16A 4D9IA 4BO1A 5AESA 2P5SA 4KVZA 2O3SA 4ND8B 4PIPA 2F8MA 2BEWA 2BGMA 1Z22A 1YNOA 3W5SA 4H6WA 2W2PA 4ZOBA 3I04M 3IOCA 2VFAA 4FOLA 1CJMA 5SZJA 4QJ3A 5TR9A 2O8NA 3PD7A 5F4BA 4L51A 1L7RA 1N5MA 3RYIB 1NPTO 1P7PA 2AXEA 5FTNA 3JASB 3V6MA 2CXOA 3EXIA 1B8OA 2CKMA 3ONFA 5HMLA 1FFHA 1E92A 2B4TO 1J1IA 2ODQA 3UJ3X 2KE5A 3F9IA 1AKEA 4ZALA 3GIDA 2P0AA 1D2HA 2F3UA 4R9NA 4Z4GA 3AOGA 2GJSA 1Q50A 1EM8A 4FE7A 3B78A 4IG4A 3H2HA 5CFRA 2DUWA 5KHAA 1RYZA 3DW3X 2NU6A 2O9JA 3DDOA 2GM5A 3L8FA 3MNFA 4C4SA 5CJJA 4BCBA 3OIVA 2F8TA 3VKVA 3A1NA 1FX1A 5H3HA 5BURA 9LDTA 3HXMA 4XOIA 2BGRA 5IKPA 4M9ZA 5HBRA 5JALA 1GPLA 2WHPB 5A4KA 2CT8A 1H8HD 4LF9B 3IELA 3R3YA 5DM1A 1NOJA 5LR6A 3VR2D 3GCDA 1DWPA 3Q6NA 1P19A 3IHWA 4HJXA 4AY3A 1X7XA 3LW7A 2FAXA 2W2KA 4YROA 5SYAA 1W29A 2NGRA 3HI4A 3UXYA 3ZHXA 3LK7A 4EF5A 5F1PA 3FDZB 2I76A 4J07A 3S27A 1T2EA 2X5NA 2DQZA 2JAQA 3DE5X 3H1BA 4INOA 4RJTA 3RHZA 2W6IA 2YNMD 2G1UA 3WICA 1UPXA 1TT7A 4NDNE 4TLDA 4D9HA 5IWCA 3OZDA 4AKSA 4XYGA 1TIBA 1JLLB 4AMYA 4CKCB 4I2NA 1I24A 4WCFC 2IUSA 4CDGA 4FHZA 5IYZB 3G8YA 1XGKA 4MEJA 3CKLA 4NARA 4O02B 5TV2A 1YJQA 2JGLA 2OMKA 3AVYA 3U16A 1DV2A 1L4NA 2FB9A 3B6JA 4TVKA 5AD1A 4YCLA 5IT0A 2F1HA 1OBCA 5B30A 5LMZA 1WUTA 3BRCA 3K1YA 2O8BB 2X58A 1PYDA 1G63A 4HN2A 5B55A 4KHPB 1L7OA 3E58A 4HYTA 4EY7A 4DCPA 5JWHA 3M6UA 4XKJA 1A50B 2AMVA 1B1CA 1QONA 1JIQA 1C4XA 1ZK4A 3GVIA 3NTXA 2GJKA 3R6GA 3KQNA 2ERXA 2KX7A 3OE7A 4P54A 4KO2S 3M6WA 3LG2A 3MQ2A 3URKA 1MB2A 3MWKA 1UT5A 2XE7A 2ZVDA 2VIIA 1ZCAA 1T2FA 1WD5A 1WABA 3OEHA 1I10A 1TKCA 2BFMA 1XEWX 2NZXA 2YJ5A 2GILA 3KAQA 2QLLA 1L5MA 2JIQA 2PLAA 1EHIA 3H11A 1VI2A 4MMYB 1FUIA 5HE9A 5IN4A 4DN6A 1Q83A 1T36B 2ALJA 3L9XA 3R3XA 4M8IA 3GA5A 2FR8C 4W63A 1NI4B 3I2HA 2GJ9A 4C1NA 4N7RA 4E31A 1V8PA 2WG1A 2C7GA 3AB3A 5DW3A 2HO4A 1CJCA 2IZ7A 2ZBDA 3B6MA 3EA4A 1YDEA 1NE2A 3QITA 1Z26A 2LDXA 4R8RA 3LQ4A 1S3SA 2ACKA 3COPA 4PV7A 4M1YA 1EDDA 4LDNA 2FPPA 4DNFA 1X3SA 3G88A 1KMHA 4PQEA 3U3MA 4LNUA 2Z56A 3T61A 4AJPA 1G64A 5DGCA 1II0A 1XCOA 2O1SA 4B46A 3ZIAD 3MGCA 3TZEA 5CVVA 2BE7A 4M7RA 3BBPA 1PAUA 2ZYDA 1TF2A 4NPCA 4ABTA 1QP4A 2LKCA 3F73A 3LGAA 3NHAA 1E9EA 4TXNA 3QOYA 3TQHA 3W5AA 2QD4A 5JDCA 3F8WA 1YZQA 3IH5A 2JFUA 1E2EA 2UKDA 1QG4A 2XIJA 2YZGA 3C14C 4PSKA 3T5TA 4CV3A 1DX9A 1KOJA 1EJ2A 4PZAA 3ZNOA 4KE8A 2P62A 2FX5A 1BX1A 3I6ZA 3VRHA 4HFNA 1KSGA 3EFBA 3QQPA 1CXZA 3ROQA 2QGNA 3B52X 4C4ZA 3AWIA 3I0NA 4H6PA 1E2HA 1IY1A 5HW0A 5JARA 3VI4B 3DHYA 5LU9A 1NQVA 1Z07A 2C4TA 2ZLBA 2BISA 4GOND 3TTXA 4GEGA 1Y6QA 4MDEA 3HCAA 1HMPA 3IVCA 3MK31 1FYEA 4RZXA 2HZBA 3KSAC 1NY5A 1W6UA 2JIDA 2BGLA 1V1MB 5P21A 4E03A 1RC8A 1JFLA 1GNPA 2OM2A 1EYZA 4UBOA 3DNPA 4MR7B 4QAJA 1Z4OA 3V7UA 2CB0A 4Y2GA 2IYYA 3I2FA 4LHSA 2PIDA 4D0SA 1W88A 2YZ7A 3OZWA 4UUBA 1IM2A 1GLNA 1P61B 4ZA2A 3GRVA 5GTDA 3GQVA 2WJWA 2MU1A 1BO6A 1DQYA 2D62A 2AEMA 4LKOA 3REOA 4JUAA 3AU8A 1YU9A 1WD7A 1WKBA 1DKOA 2L17A 3GNSA 4JI7B 4PSDA 1GG5A 4WNYA 1MW8X 1CDOA 1H2EA 1EE1A 3B60A 3NBYC 2XHEA 1T8WA 1R9JA 3I9KA 2QT0A 3HL0A 3ORHA 1FNBA 2P6PA 4LJ8A 1Z0SA 4YRCA 5HILA 3S2GA 2QZPA 4I1UA 3JQDA 1N3LA 3UJNA 1Y9AA 1EWTA 1DPFA 3IB3A 4M9CA 4F85A 4L1KA 1UJCA 4CCYB 2ODPA 4G4IA 1QLJA 4YFYA 3DUWA 3DTNA 3R3VA 4U5XA 1PZXA 4WJLA 1L8AA 4HC4A 3H04A 3DZHA 2QRZA 3WIUA 1E9CA 1J2UA 5JS7A 1QCCA 5K2OA 1CF9A 2BUBA 5DLEA 2PS1A 4HGZA 3B1XA 3VAAA 3ZY6A 4US0R 1ZU4A 2GXUA 4NYMQ 3W78A 5JI2E 1T9DA 1AJEA 2G0AA 5C8YA 1NBEA 5KYWB 2NZUG 4Z54A 3G89A 3ZH9B 1V7QA 3ES9A 1TL7C 4RHYA 3CRMA 1OX4B 5GONB 4L7VA 5LWHA 2R87A 4DWOA 4NV3A 5ALYA 1XJCA 2IHVA 4ZXPA 4KR7A 1LDYA 4BY9E 1HSZA 1DS6A 2IT1A 2AQ8A 2NADA 4X62B 3O03A 5DX0A 3Q11A 1E2UA 1E3TA 3ZZNA 5GMOA 3PEEA 4YUVA 5BUCA 2V54A 3L18A 4I1IA 4BTEA 5H9WA 3NJ8A 2XXJA 4NBNA 4EP1A 1JTFA 4C4TA 3BGSA 5LCXA 1J5XA 3L7MA 3R8FA 4QVKA 1S2GA 3MWJA 3PDWA 4RL4A 4B6SA 3RS3A 2Y0CA 2OD7A 3T41A 4R9UC 1S7CA 1CRQA 1PO7A 2VYQA 4D9FA 1PS8A 1NW6A 4MTCA 4J1NA 3HS3A 4IFIA 5I7EA 1ADBA 2PGJA 1R9MA 3FSGD 4JYBA 1BXRA 1UBLS 3WGLA 4ZI7F 3AOEA 5I48A 4V0RA 2GB4A 1ND6A 1Y9EA 2IYUA 1RI5A 2ZR8A 3G9TA 4OAPA 4TN5A 3UWSA 4FFSA 1U2GC 2FF7A 4J16C 1WTAA 5DWVA 1TGVA 3CSUA 4BECA 1HZJA 3KOZA 5THQA 3KJQA 2PJDA 1DUSA 2DUUA 2ST1A 4L4RA 1AKUA 2D5BA 2VDQB 3JD3A 4MQUA 4Q9HA 4IYRA 2MJLA 1GZSA 3CH4B 5IASA 3BG5A 4KMSA 1TU3A 3TG8A 2I3ZA 3KOOA 2ADMA 3QTLA 4PX5A 5E95A 1F3OA 3BSYA 2WKRA 3LRTA 1J8VA 1H0RA 1YE3A 1C3VA 4MWEA 3UJ7A 4KMMA 2AZTA 3ORFA 5IKMA 4P4SA 3TLCA 4CW7A 2Y68A 4O2AA 3LT1A 1F7UA 2QVGA 3AY6A 3OTWA 4HDNA 3V32A 4EG5A 1TPYA 1KRXA 5LQRA 2PX0A 4N47A 1WXXA 4JUBA 5IJZA 2ZI4A 1B8NA 5IBCA 1RBQA 2AD5A 1AUXA 1GGVA 3WRXC 1AIPA 1M74A 2A0FA 5COQA 5C1DA 7MHTA 1D1QA 3PC3A 3ZWKA 2G1AA 4RX1A 3WRWA 2FZWA 3GH3A 4KP7A 3TQIA 2GZHA 2AQHA 1W5EA 4WLEA 5F7OA 4NMWA 1GQRA 3N0TA 2O2JA 2WDPA 3UYLA 4DUYB 4AUMA 4INZA 4TZ6A 1Z6TA 2VTVA 3DJFA 3PGXA 4UEQA 3OKAA 2WC1A 2VG8A 1IZ8A 3B12A 3OOJA 5J2TF 3ZHOA 1J8FA 2F64A 4NBVA 5AOBA 3CVJA 5I45A 1I6KA 1QNLA 4IMPA 4DV1B 2TMDA 5HQ3A 1RYHA 1XWWA 3GK3A 3ID6C 4I19A 4MKFA 3KOXA 2F9FA 4XJVA 4BB5A 4W6ZA 2Z04A 3FGZA 5HF9A 3TTSA 2QM8A 3AEUA 4C89A 1GA1A 3TS1A 3TSYA 1IPEA 2J3DA 1ORHA 1Q7TA 2XA9A 2B2NA 4O5AA 3ACCA 3SDBA 3W8FA 4DLBA 2PEYA 4P31A 4BQRA 2I91A 4AICA 5BSUA 1NZFA 1Q0ZA 3QH4A 3GEGA 3OIYA 5FTMA 5H8WA 4QRDA 3S2YA 4O4IF 2IZ0A 1I1HA 5JAZA 5TLSA 1UBOS 3K5IA 3QVXA 2J07A 2YHUA 4XVUA 4AN1A 1YIDA 5CW1A 2PUCA 1BC5A 3O4HA 3QEOA 1T8SA 1UK8A 4UATA 1PU2A 4YPFA 4CLOB 4URXR 4IL5A 1AQUA 4MVJD 2XCRB 2C88A 4OJTA 1NJFA 4RS4A 2L19A 1E2GA 4UD2A 1HEUA 1ISFA 4C2TA 2FPOA 3Q85A 3ZBTA 2WBLC 4PPQA 1FX0B 1JQ5A 2RE8A 3TM4A 1CB0A 2V65A 3BMOA 1ESMA 5HIIA 3RYIA 4DMUB 1SK9A 1E1MA 3A1DA 2O5VA 1VYTA 2X9GA 3O9VA 2YV4A 5DGTA 3CFYA 2YJ4A 1E79D 2WR8A 3FNRA 2JIRA 3FYUC 3X1WA 5IJ0A 2C7PA 3KJFA 1P1RA 2QR5A 1FTQA 3GL9A 3Q6IA 2FWAA 3CPSA 4IV0A 3CBQA 1W2HA 2YXDA 4QYWA 2EQBA 3U7QA 1XQ6A 3LA6A 4JL6A 4D5EA 4UW9A 2I4LA 4QXPA 4JSYA 3HJFA 1N3YA 1IBCA 2P91A 4ZAZA 1P9WA 1SKUA 2APJA 3PV0A 2MDTA 2RHDA 1P4HA 3L7IA 1UC4B 3LX5A 3A70A 4GX5A 2CF5A 3O9MA 4OK6A 5DGHA 2XYRA 1FPQA 3GEMA 2WNSA 3G17A 1BOFA 4IIJB 4C0XA 5K6AA 1PZFA 1UKEA 4FMDB 2HSDA 2NV0A 1V8OA 2WLSA 3CYFA 3R7WB 2RB5A 4I3HA 1DAFA 1JEJA 2JFWA 3O94A 1P29A 4Y2YA 5BR8B 4TSFD 1SC6A 5GVRA 2BM9A 2C2OA 2Z5FA 3T5DA 3Q6MA 4MPPA 4JH0A 3PHGA 1KWKA 3I9NA 4EL5A 1F0NA 3FKSA 2BFWA 2BEVA 1A69A 1OB5A 3PQ4A 4ZOLB 4RCZA 3V8QA 5EXEA 3ROEA 1V11B 2C9OA 2ZU6A 3DA8A 4FI3F 4GOKA 2PR7A 3VR4A 3ABIA 4X61A 5B1DA 4ABYA 4JITA 3KSDO 1WETA 4JI0B 3LF2A 3PC7A 4MI1A 1H2BA 4QQNA 3STWA 2QYHA 3CB4A 4HPXB 5CEFA 4CKCA 1H6AA 3E81A 3G1WA 5JTUA 3DC2A 2PGIA 3Q1LA 3LXRA 4I4TA 3OBBA 3KQMA 1E1QD 3VYSB 4LHYA 5JC8A 2BGKA 3RIMA 3MFYA 1KO5A 3GYGA 3KZVA 3PITA 3QVLA 4IJ5A 3RK1A 2QBYB 1MAUA 5BYBA 4YDQA 3NTUA 3MRVA 2W42A 2QMYA 2VUUA 3T7RA 3ZD8A 1ZNWA 4UEJA 3GX1A 2EC5A 4IQ4A 5AM5A 3U80A 5JWOA 4DB4A 1XD8A 4WLNA 1N3IA 3L7YA 2DJIA 3FPGA 3QXCA 1S1CA 4I66A 4CRWB 4DJ5X 3ITKA 5JS8A 4IM7A 3KKOA 1IUPA 2HXYA 2FR0A 3MSXA 1E63A 3R2JA 4JJZA 4OXQA 5B58T 4UBMA 3WYAA 3LUPA 3ZWXA 5LKRA 1UXOA 4TV9F 3E9EA 1OSNA 4KDRA 3V4SA 3SKVA 2BFPA 1GO2A 1VDMA 2RGYA 3M5WA 3S1AB 2C4WA 3AF0A 3B5JA 3F6RA 2QJTA 3H1TA 2IV2X 1AM4D 4G8DA 4FHCA 4OLFA 2OKCA 1GQSA 2X0FA 3SEQA 3SOPA 2I99A 3ESRA 1UJ6A 4ZQBA 1A96A 3PVZA 1NI4A 4NH4A 1D8TA 3RAPR 2ZJFA 1BQEA 4Y2QA 2EARA 4H77A 4PR0A 1LNQA 3BXGA 3U4AA 3VNVA 4LI0A 2B4QA 4X91A 3IKVA 4PHCA 1QVAA 4A6XA 5IDXA 3MGKA 4XYMA 2NPFA 2HSZA 3D7NA 5F35A 5LA6B 4FB5A 2VWHA 1ES9A 5CIWA 2FZCA 2EZUA 1XAJA 2JBWA 1E64A 2Q3LA 1PQUA 2XUZA 3A9SA 4DMKA 4HV4A 5BW8A 1JG1A 1EGHA 2ZULA 3FCEA 2EJBA 3WAGA 2WUWE 4BYMA 2IU6A 2JI4A 2VPYA 2HCJB 2XH8A 5MGNA 1DC7A 1BE6A 4F7DA 1PQWA 1TU4A 2JFGA 2MINA 5JO0A 4GIBA 5DSXA 4YRDA 3ZWOA 5IAEA 4HSGA 1A8HA 1CS4C 4R8KA 3NIWA 4NNJA 4EQ6B 3L9WA 3H5LA 3DEFA 4OSEA 3LUKA 1BDIA 4A36A 3QF4A 1RBZA 5JQGB 3GFQA 2JZNA 1PEKE 3DO6A 3KLNA 3R5FA 1ODIA 5E7QA 3ZDEA 5DBHX 3JZFA 4NY1A 2AC7A 3HUFA 2VF8A 1J6UA 2H85A 1IY2A 4LWZA 4U63A 4Q47A 4YRZA 3HY6A 1KNXA 3S2UA 2H00A 3RTDA 1XMPA 1SD5A 3JR7A 3STXA 3IIJA 4BAZA 1LLFA 4PZCA 2IOQA 2RH8A 5EYPB 2JLXA 2P0YA 3I09A 1HETA 3HKDB 2QZ4A 2G28A 5C7YA 3C16C 3QPWA 3HJNA 1N2SA 2E49A 4A6PA 3ZX5A 3F71A 3R9XB 1Y8ZA 2AN4A 2RHOA 3EVZA 4MR7A 3PL5A 5DNWA 4AP9A 3PEYA 2CJWA 3OQIB 5I9BA 4PZDA 2V4UA 1N5KA 2ZWMA 1QOZA 4WZAE 2OBNA 1FRQA 2GI4A 3KXLA 3BZWA 4YRRA 3ZI0A 1JLHA 2VWGA 3L8EA 1Z2PX 4DZTA 4E3WA 1MA3A 5F9HA 2W2VA 1V45E 3FR7A 4Y7CA 1ECFA 3GP3A 4IDNA 2H1HA 3BXHA 4KKXB 5ALXA 3IQZA 2C4MA 2HWUA 3EUAA 2C3YA 3IVAA 2QY6A 4LJSA 3VAYA 5ILOA 5FOVA 2QWXA 1E9BA 2CLDX 5DNYB 4PAWA 4TRJA 2BH9A 2H3EA 3Q2KA 2UYQA 3KAJA 3TO5A 3GEIA 1C2TA 1HEIA 1HYHA 4AJKA 3UGJA 2EW2A 1DRKA 1JSLA 1K5DA 1M6EX 1QHGA 1WHSB 2IKSA 3AVPA 4IDFA 4XVHA 3L1KA 4ZVRA 1X1BA 1DAKA 1SM4A 3RRXA 1FTGA 1R5OA 4G89A 2AJLI 3M5DA 5JT1A 4AG5A 5LZ4A 3KQLA 4EL0A 3WISA 1ABEA 2H06A 3KEGA 3R41A 1J42A 3OWXA 3G49A 4LHZA 4IDOA 4OBXA 3TOCA 4ANFA 1A2BA 2F48A 3OTGA 2HXSA 2QLJA 1QGUB 1P7WA 2WF7A 2XGJA 1YZYA 2WVJA 2YCBA 4QTUB 5G4KA 1N5LA 3T52A 5JH7B 1K9VF 1Y8QA 2X8BA 4L50A 3PZRA 3B3JA 3CWQA 4Q03A 2XEDA 2WVHA 3K3PA 3FOEC 1T2VA 2I55A 3P5SA 1MOSA 3EC7A 5HF8A 3D0KA 2I6TA 2GTHA 1LU9A 1VG9B 3GAMA 2WD8A 2AMJA 2P67A 2ZRNA 3GJ5A 3R0JA 2RMKA 2AJTA 1DJQA 2VF7A 4CU2A 2ZRJA 1U2PA 1VTKA 1U2TA 3VVCA 4JT2A 4F6RA 2VNKA 3I3OA 3JZDA 3U19A 1FYWA 1QB7A 3VZDA 2CJYA 2VYND 3S8YA 3OSUA 4JZYA 1INLA 3G0DA 2GZRA 2PL5A 3BE5A 4UNIA 4H1VA 4JQSA 3TIIA 3WQQA 1SCAA 2KB0A 2JKVA 4C7VA 2VTBB 2H59A 4RTMA 1QANA 1CR2A 3D9QX 4LMAA 4QUEA 1BKDR 3HKEA 5JMTA 1ZRSA 4INAA 1K68A 4BP1A 3S7ZA 3H5VA 5B6IA 1UQUA 3AHEA 3HN7A 1G2IA 4K9OA 4Q48A 4OFZA 3U17A 2WMOB 4G56A 4ODIA 5ED4A 4F4DA 1RHQA 3NAMA 4B83A 3O47A 1X2EA 1PIWA 4PX9A 4GNRA 1QZZA 3VUEA 1E1DA 3LDGA 4DUGA 4MPJA 1L4GA 5EY5B 3AFGA 4M21A 4JYZA 2WIDA 1KYYA 2PD3A 3K0FB 1AC5A 1QPBA 1ZRNA 3NWBA 1NAHA 1L5LA 4ZJZA 1UMDA 2NQ8A 2ZB3A 1IQPA 3FNIA 4IUYA 3FPBA 1I7PA 4LOHA 1SD1A 3F98A 1QO0A 3NU1A 1Q95A 4HRVA 1SKMA 1ZJWA 3K0CA 4Z3DA 2KW5A 4C4AA 4ZTZB 3VAZA 2CYCA 4P93A 1RYDA 1KORA 3NAZA 4AZ0B 4EJSC 4F2HA 3BFXA 3CF0A 1Y8CA 1Y80A 4J2OA 4F5DA 2PRYA 3EPPA 4LZZA 1XO1A 2BFAA 1XVLA 3BXOA 3WIDA 3GZNB 4CEHA 4JLPA 4UHJA 4BO5A 4WBXC 4IJKA 5EEHA 1PWYE 3EOAI 1G0OA 4G8JA 1R1DA 1QV9A 4P35A 2IBSA 3OE4A 4ES6A 4MHOA 4HK4A 1BQ4A 4PZEA 1H9CA 1TZKA 4WFIA 4CUJA 3CJTA 3RI3A 4GMKA 2Q5HA 4RD0A 4F4UA 4FVTA 4RLHA 3WWDA 4YT5A 5AJWA 3WNDA 3A1WA 1O9HA 1FSGA 2A30A 2RGNC 3RUEA 3PXBA 4B3IA 2RAVA 1FQKA 2FW6A 2VPQA 4G9BA 4O4HA 2A3NA 4G63A 2OXRA 1XA3A 2AVNA 2FZGA 1LVHA 3HBLA 3QNWA 2XUFA 2EGUA 1KAEA 1OYWA 3REGA 2Q07A 1M67A 3HUTA 2JLYA 4L0MA 4MOWA 4Y6SA 2CXTA 2NLOA 4LJ9A 1OFIA 5KPDA 1TTHA 2AK3A 3HL4A 5I7FA 1GNSA 2OILA 2YJ3A 4W7IA 1GTL1 1DL5A 2X1HA 2AB0A 3FF4A 3JQAD 3W5CA 4F97A 1HT2E 3I8SA 4BFTA 1P2FA 3V8NA 1NHWA 3FLEA 3C3KA 3VR4H 4BAUA 4G36A 2ZE5A 4OFBA 1ZMTA 3LQ2A 1RWXA 4TMVA 3NOOA 1TO6A 4K86A 2O3TA 1IN1A 4GX1A 3PGMA 3MGAA 1N5OX 4C4OA 3LUCA 4PRLA 4GZ3A 4HUQA 4ZREA 3RM3A 3SNHA 4C04A 1NVFA 2LRHA 5E1OA 1JIKA 2VP2A 3I62A 2V6GA 3KRTA 2EDAA 1QM5A 2QW0X 4KXWA 3V8PA 5TJHA 4BMPB 5K05A 3INNA 5H1YA 3HB7A 2RH4A 4HOYA 5A1JA 1J8YF 3I3SR 1IN4A 2ZIUB 1NKSA 1Z68A 2I4OA 3EIXA 4BB0A 1OH5A 1T4DA 3L7DA 1FNMA 1L4BA 2QVXX 3BN3A 4CT5A 2AWOA 4WXPA 3HA5A 4YMTA 3D6JA 4Z7OB 4R3NA 3S68A 3ONVA 3DBLB 5DCUA 3B3QA 1DDIA 3T0FA 5DBIA 4HAOA 4OIMA 2Y1FA 4FR0A 1QIEA 3TI7A 5A9RA 3QM1A 2QZJA 2VHWA 2VXOA 1IBSA 3DBVO 3IO3A 4CLOA 2ECQA 3E48A 1VLLA 3R20A 2Y0DA 3L4SO 1E0SA 1PLJA 4WXYB 1RACA 1SVIA 3F96A 4LKRA 2AGVA 1ZN7A 2SBTA 2JK0A 3RYFA 1MAHA 1LUAA 3M6IA 1FNSA 2OTCA 4D45A 2JB9A 2YYAA 3EQ6A 4CMGA 4L5JA 3ZCSA 1UBTS 5IDQA 3TLGA 1Z12A 4RPIA 2ZIGA 1DKNA 4KFTA 1H05A 1Z5PA 1BA3A 4F8EA 1MOZA 1E59A 5DN9A 5A9TA 5FBHA 4EB6B 1NN3A 4X6LA 4XVRA 1R8SA 3CR7A 3VI3B 1EQAA 3MAJA 4NLLA 5LZ5A 3NEAA 4IIVA 1P5FA 1B42A 2FWRA 5KCZA 2D54A 2G1JA 5CLJA 2RI6A 4CMKA 4DNPA 1FFDA 3KSUA 4TM7A 3RJ9A 2E9SA 4BMXA 4PN3A 1KO8A 5JIBA 4JXXA 1DRWA 2KPOA 1VHWA 3NKLA 5BWMA 3G2HA 1IBLB 2B94A 2PK3A 3DPUA 4AD8A 1N5RA 4WSOA 5HF6A 4GMGA 4DNOA 3A8TA 1M76A 4MCIA 4RAQA 2OZLA 1EHYA 2B9VA 2JHFA 2W6CX 5FOWA 1RPZA 3GWGA 3AR3A 1RJDA 5FA6A 3T94A 2X9QA 4G1CA 1KQFA 1H6DA 3A4VA 1DX6A 4OPMA 5H7XA 3VDQA 4HEA6 1A8SA 1D6JA 3WNZA 2CF6A 2A84A 5LFAA 1KI9A 4MWCA 4HWPA 2XUIA 1GZ3A 1NJ2A 2YASA 4KVGA 1VL5A 3CX3A 1RPJA 3KOMA 3O6VA 1CY1A 1K75A 2QLFA 4Z9YA 2IHNA 4ID9A 1SC9A 3T9BA 2BMVA 4LVCA 1BVUA 3SXUB 2GSWA 1OAOC 2QBYA 4A23A 2Q3EA 3DGEC 2HRRA 5IF9A 4G01B 3STUA 4FS8A 3I1YA 2W22A 3LAWA 4IXWA 1C9NA 4PXSA 4UAGA 1HGXA 3TLEA 3VQTA 3E5RA 4COKA 1XRMA 1HXHA 4XFKA 4DWJA 5KOJB 3K9BA 2C42A 3GC6A 4XUCA 3WL3A 1ZA2A 5JJBA 2IFTA 4CR6A 3QELB 3SQDA 4A8JA 3MSCA 5FOUA 5GOTA 3TM5A 3VJMA 5LU8A 4E5PA 3IJ5A 2ZT7A 1CUJA 1H22A 4HEA1 4L15A 5EUMA 4EA7A 2F1IA 3VOBA 2C0CA 5EINA 1ZRHA 3AP1A 1ZGCA 3KEOA 4CCSA 1YF3A 1SH7A 3K15A 2RB4A 4TWBA 2V9ZA 3DZJA 5AXCA 3MUNA 1HG1A 4F93B 1HYQA 1Z2AA 2AR9A 4X7PA 2ISQA 3H6GA 1R0LA 2EFYA 5LLSA 3ZJ5A 1CF4A 3SBEA 5JD6A 4L3OA 3CUVA 1XD2B 4AT1A 4V0OA 3W2TA 4ARAA 1SHUX 3WGMA 1CJTC 4H7HA 1FYFA 4BVBA 1G5QA 2EKZA 6LDHA 1CV2A 2HADA 4JNCA 3RTBA 3T5AA 2FPLA 3VOAA 1XTQA 4EX7A 2I2CA 4HAUA 2EG9A 3PNSA 3RYHA 4Y18A 5CIQA 2FOLA 1EUCB 4UE2A 3QJGA 4Z8XA 1GKUB 4G8CA 1BFKA 1LSSA 2Q2QA 3COSA 4H3KB 4MW7A 3ET5A 3X1ZA 2A0WA 4E6EA 3BKWA 2IP1A 4U7FA 2ZTVA 4DIEA 2N1BA 2GRAA 4FKZA 4RK5A 1HF3A 5K3BA 3RRNA 1AE1A 1ZIDA 4DC9A 4IYJA 1Z2CA 3UNXA 4R1SA 4BLWA 2EW1A 4Q15A 4XIYA 3QPUA 5D5HA 3QX7A 1F06A 3K6KA 4YAEA 5F1OA 1V9SA 2ZT5A 4RDIA 1LW6E 1DGQA 4E6PA 1PE0A 1JSXA 4JZKA 3TLBA 4NNOA 2AFIA 4AJ1A 2V5UA 3ZC3A 4EKDA 5AUNB 1VRWA 3CX7A 1KO1A 3P2EA 1O97C 2OXEA 1XB2A 3N39C 3BAFA 1XDUA 1QH1B 2GBLA 4LI3X 4CI9A 1JHXA 2OAQ1 1U7TA 1B26A 3OE7D 3G2JA 4MS3A 5CTAA 4ZVLA 1MG5A 1O6BA 4J4TA 2B3TA 3QJ5A 3OEHD 1ZXBA 3PNVA 4CIWA 3MELA 1Q84A 2R6DA 4BIIA 4G1EB 3U61B 2VKQA 2O23A 1L7PA 1JKMA 2VPIA 2WD7B 3FB4A 3HEAA 3ILHA 1OTHA 2QQ5A 3LUFA 3OQ6A 1LPNA 3P9CA 4XIJA 1FUKA 3W5DA 3ZGOA 4YCNA 1O58A 1GPWB 2CY0A 3AHCA 3PCRB 3A7DA 4G25A 4G3XA 3PUVA 4UMVA 2OE2A 2PMBA 2OCXA 4GXTA 1RE0A 3LGSA 2AA3A 3OX1A 3U9LA 4Q3KA 4E13A 4ZT5A 1EBFA 1NJ6A 1I4WA 1FXWF 1SUCA 4REOA 3TB6A 2I9PA 3CUSA 1QYXA 3TNJA 3JALB 1UK6A 4Y3UA 1VXOA 3DBHA 4WKNA 1GPDG 1N9GA 1C0PA 2BGTA 4K40A 2XE8A 4XPIA 4JB0A 2R1ZA 2OFFA 3UMFA 3PGVA 3OQIA 4C06A 3L4BC 3L7CA 5BP7A 4YFVA 3WGTA 3SS7X 1KI6B 1MX5A 1CUCA 4OFWA 3SIPA 5BMVB 1GFWA 4YJ3F 3AX6A 3WP0A 2JAOA 1IEWA 2FEXA 3A4LA 2P2GA 1CJVC 2M1ZA 1Z7GA 4OGKA 4ZQCB 1RZUA 2PEZA 3C1TA 2DWQA 3W6UA 4ZJPA 1BAPA 3II6X 3MG9A 4OHRA 4C87A 3K1ZA 1ISIA 9GPBA 2CNLA 5DLYA 1KDVA 1ZHOA 2LR0A 5BNTA 4HDRB 5FUYA 3P2IA 4ZAWA 2CXXA 4EG3A 1I6LA 5A5VA 2VNAA 3W06A 4TVSA 3NHFA 1IZ9A 1U9IA 4DS3A 1LDGA 4C7OB 1LPBB 2WSIA 3BPSA 3RIGA 3SBOA 1LQUA 4BS9A 1RAIA 1HBJA 5JAQA 4XX1A 1UWKA 1X1AA 1E5DA 1TO2E 1YDMA 2EGGA 3U4DA 4DPMA 3AW9A 6CHYA 2A0XA 2Y3IA 2H52A 3WFIA 4DLLA 1QGUA 2B3DA 1U3VA 3VVLA 3U1VA 1KEPA 3PQEA 1QLHA 4PNPA 4NZ9A 1NPYA 4Y1RB 4XYEA 5CXQA 4CEIA 3A6PC 3KPYA 3UAZA 4JYAB 3STHA 3Q87B 3A6JA 3IT3A 5DWQA 3P9XA 3WMWA 4CKBB 4EB0A 1CRZA 2XNSA 2QSZA 2OGZA 2E21A 2P3LA 1E62A 2ZPAA 3I4CA 1C81A 3WIVA 1VCOA 1ZH4A 4N12A 2D5AA 1VL0A 1G8YA 5TDHA 3ZLJA 1Q44A 1G66A 3KT0A 3RWBA 2PIAA 4HQFA 3S99A 2PKRA 1Z33A 2K5UA 4URUR 5BOVA 4PWYA 4ZMBA 5JNRA 3K6SB 3IBGA 3DDCA 5K8UA 2GXAA 1UWCA 1SULA 1YA6A 1E8DA 2D2XA 3ANSA 3BTUA 1LPSA 3LSYA 3WTBA 5FCDA 4DYHA 1BXGA 3PEUA 1R0SA 5DCLA 4TYPA 3VU9B 2IQIA 3AR4A 3GMIA 3I6YA 2PBRA 3A0UA 3TNLA 5B12A 3K0FA 1YR8A 5A71A 1OXUA 4R1UA 4XDHA 2BFCB 2LTAA 5AKGA 3HSSA 5C8DA 5KMGB 3HRIA 3JRWA 4BV9A 3VVBA 1KDTA 3IOBA 2PGAA 4FYVA 4NXMB 1FYDA 2J3QA 9MHTA 4H1UA 4UVDA 3OZSA 3LF1A 4AZ0A 5DASA 1JAZA 3A14A 4V03A 5G4LA 3DP9A 3AESB 3CZQA 5AVQA 2IS6A 3WSTA 4RVSA 1YB4A 4ALMA 3NDBB 1E94E 4XJXA 3C6ZA 3BGVA 3H8WA 3WAJA 4PE5B 4KQ1A 2V5AA 3KJZA 1YA4A 4RKQA 2IYTA 5J59A 2V03A 1MJFA 1ECPA 4OI2A 4MS4B 4BE7B 3B5EA 5U4XA 3T7DA 2GPTA 4EY5A 5AIAA 2D0IA 4LVOA 4Q3DA 4BWGA 1LPPA 3ELUA 3KVOA 1QRUA 1UJBA 1R0ZA 1XP8A 3M1YA 3H9CA 1G9XA 2QD1A 1MQSA 1QCYA 4FEGA 4XB1A 4YQFA 2I29A 1V16A 2BCGY 1Z45A 1EMDA 3ND5A 2ZDQA 4EJFA 3I5AA 5CYOA 5HUQA 3KYJB 4C03A 5D85A 1XXHE 3ZW8A 5JZ9A 3OG9A 3B2EA 1YQGA 2HUNA 2QX6A 3UAVA 3OZUA 2P5UA 1A8QA 1M8KA 1H1LA 2NT4A 1NHGA 3PYMA 4OGLA 5AXAA 4RTRA 2X76A 1FP6A 1Y4ZA 4NU6A 4MYTA 2YWFA 4ZXFA 2BR4A 3DFMA 2E1RA 1CZLA 1QIDA 1MPXA 3GGGA 1T0HB 2ZJ7A 4Q6BA 1TVEA 4Y2XA 3RARA 1ZMOA 3LHIA 3P2KA 2FFHA 1TRHA 2XTAA 5LBTA 4NCIA 4YRIA 1PSZA 3N8DA 4QQKA 5K0JA 4IVQA 2CXUA 3L40A 4R81A 1NP3A 1PI3A 2WPNA 3H13A 1YK1A 4H17A 4HQKA 2OV8A 3WMGA 1NR5A 3NHJA 3TJRA 4NR0A 4FW8A 3Q0TA 4CMEC 2RJ3A 4DAOA 3CRVA 3DO5A 4BQOA 3NMUF 2IIQA 4FX5A 4L4UA 1JR4A 3EUEA 1K5HA 2FW0A 4OBBA 3NH9A 4XD7D 4AAYA 3WLEA 4EGCB 2SKEA 3UUWA 1F0YA 3JD0A 1VRCA 2YBDA 4QOEA 3NNDA 4AX4A 5KINB 5ECGC 1TD9A 1U0TA 3PNQA 4RJLA 5K0TA 2EWMA 5J2UB 1RTTA 1SXJA 1G5HA 4OI0A 1YQWA 2KWIA 4KI7A 2AT1A 4ZP1A 1SBYA 2HN9A 3TL3A 4UHHA 1M2EA 3AFNA 3BCRA 4QFBA 3ZUGA 4B74A 3BE4A 1P9RA 3OP1A 3NB0A 4GKAA 1G8FA 3ICCA 5SYNA 1W96A 2I4MA 3HU2A 1LNZA 3SEFA 4DTCA 3OESA 1NY6A 5JATA 4RQBA 2XAAA 1I5RA 1SVWA 2XXBA 3OU6A 4L8GA 3B7WA 3IQXA 4QASA 3AEKA 2ZJ2A 3NANA 4WUTA 2BKXA 3LLCA 4GZ6A 4WZAB 1HFWA 2ZYAA 1QQ5A 4NULA 4F4JA 5HTOA 3DFKA 4YAOA 2LWIA 4ADSG 1AGPA 3VKUA 4DVGA 3TCNA 3VSBA 3GP8A 1Z6PA 3FLAA 1IHYA 3DLBA 3IUEA 4JROA 5LP6F 2ZW9A 2IHJA 2Q1UA 3ZBUA 4KXXA 1JEEA 1F8FA 3UMCA 1WBBA 4RVOA 1B0ZA 4ILEA 3E15A 1CB7A 1NJ8A 1PG0A 2VS1A 5H4GA 1GSOA 4PGGA 5KTMA 1VPVA 2RGWA 4DFDA 5CLHA 2XZPA 3RG8A 1A4IA 2AOUB 4ER7A 1ND5A 2QUBA 3C48A 4C1BA 3MCAA 3S8EA 5C18A 3P0RA 1GPJA 4EAQA 2PV0A 2ZRFA 2DM6A 1FNNA 1PF7E 1TIKA 2OXCA 2P35A 3L0CA 4K1XA 2JEOA 1SVSA 4M1SA 3LT0A 2C83A 4FDMA 1L5KA 1YONA 1IULA 4TUYB 1XL0A 4HAYA 5FHRA 1RHKA 2QT1A 5CDUA 4KOEC 2UVQA 1E2IA 5KC9A 4XX0B 1Z4LA 4ZRMA 4BPBA 1WDWB 4RIGA 5CH3A 1XQVA 5BN4B 4P32A 1JF8A 1YR2A 3IKJA 2H7CA 1GYQA 2IXAA 1KZ6A 4R8VA 3S1LA 2JFOA 3IO5A 3QVGA 2OO7A 1N7JA 1OTXA 2FZLA 2O20A 3D4PA 1ZOOA 1T0BA 2GLUA 2PKCA 4DDWA 4LVUA 2B34A 2O3JA 4JQOA 5DGIA 2NG1A 3ZTWA 3A37A 2JGFA 1JYSA 4E51A 1QC5B 5CD9A 3A3OA 2XRYA 2FWMX 1E1KA 5CX1A 3UT5A 1JQEA 3SXUA 2KM1A 3EZXA 2YWXA 1NBHA 2GR9A 1BEZA 1OY1A 3D0OA 2EP8A 5KJEA 4X65B 3AI3A 1H4VB 1L9XA 4IRMA 5KOJA 2Q27A 3WYCA 1GM5A 3NBMA 3HFSA 2CLMB 4FCCA 4HMQA 2H51A 3DWIA 4YAFA 3WK5A 5JNSA 2FJ0A 3Q7SA 1G291 1U0SY 4OGFA 3VDXA 4RZSA 5AW2A 1NYQA 2WWXA 4YVFA 1U6JA 1IK4A 1M1YA 2J5XA 4LC9A 5E9WA 1L7NA 1NLFA 4EGSA 3G0IA 4XVCA 4RHTA 2BMWA 1HY3A 3ZWNA 2WSBA 3ZV5A 2NYUA 4D4MA 2I87A 3JS5A 3T1OA 3UUFA 4BBAA 4FMPA 1LBTA 4TKLA 5KTOA 4ZZIA 4OIFA 2WHXA 2C00A 1SBNE 3HXTA 4OQZA 2A1TS 4QVIA 1XD2A 2BFBA 2ZJ1A 3D8UA 3L7KA 5AI8A 2YC2C 2ZIVB 3FKSD 1KPHA 4M9SA 1BCSA 1X7ZA 3JSAA 4MVWA 4PTYA 5D7NA 5HCNA 3FJ1A 1EAYA 5BORA 4D8TA 4K9RA 3VR4D 9ABPA 3NCTA 5K3OA 1DKMA 1VL2A 3H97A 2GX6A 1XCBA 1FDUA 2GZDA 2ZBEA 3PGJA 3FLBA 4J0IA 2B1GA 2WIFA 1SC3A 3LWNA 5HE8A 1XA4A 2AG6A 3B6EA 3BMCB 3EVCA 1JHVA 4P4UA 4PGHA 5DMHA 1AZTA 2NNWB 2P3QA 3OIGA 4L8YA 3RFCA 5HJEA 1DQZA 2WTXA 5CLLA 1DRUA 1E66A 3K5PA 1ADFA 1TO1E 5GVSA 1G2OA 1SHZA 1NW4A 1NNLA 2PRSA 3FKQA 2YHAA 3E18A 2ZUEA 1OI3A 3QYFA 4Y1EA 3FVTA 4UBKA 3VSDA 3TIVA 3LPDA 5IVIA 1LNSA 3WDSA 2R6HA 1PFKA 1XZHA 1ISGA 1ZD3A 4OEHA 2PRKA 1FK8A 2Z6UA 4TV8B 3W4IA 4EUHA 1B6SA 1C9JA 2WM2A 2BELA 1RLMA 1JIJA 2NUAA 3HRHA 3OWHA 3H65A 3OEWA 3AL2A 4RDXA 2IKQA 3QFCA 1UXJA 4QPPA 4EFNA 3QFSA 1NXVA 1CE8A 2VI5A 2WD7A 4R68A 5KYUB 3TZLA 4JB8A 3T1NA 1DLIA 2ATVA 3FWHA 3OQJA 4JP8A 2NZJA 3BF7A 5SYMA 1XJQA 3D5QA 3RWOA 4F46A 1TMGE 3R6WA 4OGGA 2G63A 4PICA 2ZUUA 4UHBA 2J3JA 1OLUA 4OHMA 5KOYA 1IXZA 2F67A 3I1JA 3RU3A 4C2BA 2HCRA 2VNIA 5CLQA 3KT3A 1T9HA 4JENA 1QVVA 3AF3A 5JYBA 1DAHA 4MKIA 2B98A 1JJBA 1SVKA 1KY2A 3OF5A 1Y3FE 4J2HA 3VR6A 2IS4A 2PPVA 3U3XA 1MO5A 2CEKA 3BE8A 4CM4B 1KAMA 1KI6A 4XVQA 2WIBA 1XEWY 4LISA 4ECEA 1NM5C 1Y9JA 3ESCA 4X9XA 3BWDD 3JPWA 2Z2IA 4OQLA 4ZV4A 3IAXA 3WA6A 3ZXYA 1C1YA 1FTWA 3S2EA 5JASA 1TQHA 1W46A 2XTMA 3KYCA 1U65A 3UYKA 3ANMA 1R6XA 3FLMA 4AZVA 3K94A 3UAGA 5K4AA 1SWWA 1YS2X 2HCFA 2V1XA 3NAGA 4U6QA 3I2YX 4YDRA 1SMKA 4YX9A 3FCUB 2YY5A 1O95A 4KE7A 4AXXA 1NF2A 4E4RA 1IZ7A 1BRTA 2DR0A 5D00A 2FPUA 4C7OA 2OUIA 3N70A 1ELOA 2AX4A 2FI1A 2YQZA 3E22B 1JA9A 3HP4A 4N5HX 4RKYA 3RVQA 4HTFB 3VPCA 2FLWA 1IN6A 1QYWA 4IR7A 1EXDA 1N9KA 2XPCA 1CR4A 3DFUA 4QOHA 1WNTA 3QPDA 1XK7A 2Q6IA 5M2QA 4DA4A 4ZVVA 4E21A 4JBYA 4NVRA 3OTQA 3BSWA 2WFLA 3LBIA 1TJNA 4B34A 1C14A 4RZIA 3EWSA 4QEDA 2ZSFA 4J76A 1B00A 3SHWA 3MTBA 3T3IA 4YYEA 3SYKA 5IVPA 3HYLA 3QEBZ 2AI2A 2J0UA 2O2EA 1M54A 1HL3A 4CPDA 5JJ5A 4O2BF 3KV1A 1EINA 2GXQA 4JCCA 3EA0A 4D0LB 3GAZA 2N42A 4QUAA 1MAWA 2FQ1A 4BQSA 3I05A 1UFQA 3FVQA 4QQ8A 5F1KA 4KBGA 3ICOA 2RI0A 4N40A 5JMWA 2GERA 3S5UA 1N4DA 3C39A 1VHLA 4BNVA 1RM0A 1CUBA 1VMEA 2NV6A 3O93A 2X3YA 3CMMA 4ESHA 3IMGA 5BNWA 1XFDA 3UXMA 2FP3A 4C5AA 2C5AA 3DHVA 4TLLB 1I33A 4Q3OA 2JNWA 4O33A 1B43A 2E5WA 3TSCA 3NRCA 3GLKA 4QO8A 4X54A 4MI3A 5K8LA 1QIHA 1BVYF 2EATA 1JA1A 1Z16A 1B1AA 2HEGA 3U4MA 3WRVA 1QX4A 3ZE0B 2FP4A 3V80A 3DG9A 4Z1MA 1QHFA 2BFCA 1IUKA 3ENKA 1PFQA 1S02A 2H7VA 3PWZA 4S2UA 3CISA 3WLNA 3FPKA 1WQ1R 4D8WA 1BJKA 3TD6A 2VJOA 4W9NA 5C37A 1UZLA 4BWYA 1OE0A 4HPJB 3AERA 5I9SA 3CE9A 3IIEA 1TUBB 4FMCB 1OJ7A 3M0EA 3FYCA 3FCSB 3PTZA 3PHIA 5CVUA 5FO0A 2Y66A 3ROMA 3EZ9A 3VNBA 3U7HB 3JQQA 2C5LA 3AUKA 1P9LA 2E3JA 4R5HA 5H0IA 5BUQA 3ZHTA 1O5OA 3DR5A 1WHTA 2NT3A 4RWZA 3C3AA 1GUYA 2N1MA 3P19A 2V7GA 5A5EA 3E5HA 1GPH1 1TVKB 1VE5A 1DVRA 3HCNA 4LDQA 4B33A 3OTOB 1L4LA 5TNXA 1Z56C 3CNBA 3D3KA 4EMSA 2XLBA 3O8BA 4AM8A 3Q3CA 2JG3A 4YO7A 1SCJA 5E4FA 3ZHCA 1GLGA 3QYJA 1DINA 1XVAA 1DEOA 2FRXA 1P0CA 2H48A 1MQ8B 4HG2A 4N6OA 5KNCA 1A2QA 4L4SA 3AVXA 3ZXUB 4DEVA 4H1WA 4KPYA 2P3OA 1XZGA 2F3QA 3H05A 1V8ZA 1JN0A 4QBKA 2PG3A 4GI3A 3WL4A 1Z4JA 1NXPA 1JHPA 3GA0A 4DUGD 1PJCA 1KJJA 2MR6A 1WMDA 3E0QA 3ZDFA 4CTJA 2RJNA 5IVHA 3LQKA 5MFZA 2I7TA 3ABQB 3L6DA 4GVLA 3WGZA 1VQ1A 3PIDA 2A6PA 1QO0D 1R6AA 3NDIA 5CXSA 2GD1O 5JNTA 4YJFB 3CLHA 3KQWA 2C2YA 3TSOA 2GDJA 4P84A 1O0CA 2VT3A 1I2ZA 3WTCA 3KZCA 4TTVA 3G5MA 5BW6B 2NTVA 4QARA 1PT9A 4XWTA 4IX9A 2P75A 4W5RA 4PNHA 1J0XO 3MS4A 5T8KA 3A2LA 2Y9MB 4CIVA 1V5WA 2UYCA 1F2TA 1V8DA 5KAMA 1XEAA 1FZTA 5AVOA 2P5TB 3OCJA 1I5EA 2QN6A 5JDCC 4MQFB 2MSCB 2TYSB 4DCTA 1KR5A 2AXPA 3KFVA 4PC1A 5DRYA 4EJ0A 1DWOA 3V1KA 5CDSA 3AUAA 2ZYGA 3QBDA 1M3SA 1QZXA 5K3FB 2VXBA 3FXAA 1MRNA 1PSWA 4U2CA 5JZVA 1C0IA 3SJ7A 3ETLA 4LSMA 4PF1A 2JAWA 2I4RA 4R2IA 1GDDA 3I0MA 4MUIA 4JD5A 4NG5A 3OJWA 1JWAB 3G2IA 1IAVA 4N5NA 3WLLA 3U9SA 2Q50A 1QIFA 1UJMA 1XCPA 1WRBA 4X63A 5ALMA 4M2LA 3AR8A 3OE5A 3QI7A 4DMMA 1QQ7A 4GXRA 2HU7A 4M6WB 1XN1A 3FN4A 4M86A 2VPTA 1XTIA 5CR9A 4CE6A 2PU7A 2RGXA 3IQHX 1T4MA 3KQTA 3DMDA 4WZAA 3RTCA 1SUIA 4LCEA 4YIHA 3RS9A 5G1OA 2FSSA 1WPQA 2XWQA 1JDZA 1IATA 1YBFA 3ETGA 4EY3A 4MGKR 4KODA 4DSZA 3LECA 1D6NA 4OHOA 5DM2A 1YMVA 4U02A 3GJ7A 2TRSB 3UAYA 1NF8A 2H1CA 2NWQA 4QOFA 3CLUD 2G1PA 1EWYA 3ABZA 3KAPA 1YS6A 3MMPA 2IA5A 4NE2A 5KREA 1G7CA 4PSUA 1Y3BE 4DADA 3OF2A 1Q3HA 1WP4A 2AOUA 4QBGB 3RRMA 1AVTA 2WT9A 3U7IA 3BDIA 2NVOA 2PQ0A 2GFQA 1BFDA 2WYUA 4PXYA 1NMYA 1SCIA 1C9YA 5FOTA 4CDNA 3AJDA 2C61A 2VBCA 4FDVA 4M36A 3ZE8A 4OHKA 3S0JA 1FFEA 5K8CA 2P9HA 4DMRA 3L7NA 3X43A 2DLNA 1XZCA 3PKZA 2R6ZA 3WLHA 1JEQA 1OCEA 3NC4A 3KALA 4CM3A 1TU0A 2WF6A 1W7AA 2WSMA 4XX0A 1EB9A 1WUIS 3VV2A 4AJJA 5JAPA 2GESA 2LIVA 4DAEA 1Y1KE 3WNQA 1LKZA 1FDRA 3VPAA 1W1UA 2DGDA 3RQSA 1DKPA 2VSOA 2YRXA 2EBWA 4M7WA 3TNFA 3AH8A 4IJVA 4E14A 3WGOA 1IEVA 4K87A 2QE6A 2WHYA 3L04A 3LDAA 1C0EA 3AR5A 1PWHA 2JLBA 1R27A 5TPZA 4F9GA 1OU4A 4REQA 3DL7A 3L3BA 3PDIB 5DHPA 4DL9A 4ZWNA 1NZJA 5KNBA 4JC8A 2BW0A 3KKPA 3PWSA 1MKYA 3KB8A 3URMA 4F3RA 3CW2A 3MD0A 4OMFG 3ET4A 1Z6YA 4X64B 1CR0A 2OAP1 5L3QA 1JVNA 1X86B 2XOEA 4B3XA 3USCS 4D8XA 2Q3FA 1TQ6A 3C85A 3VR6H 5KO2A 3K8OE 1E9SA 3TLJA 2ZSDA 4IX1A 1QKKA 1EUYA 1PV2A 4RSRA 4YRAA 3RB8A 4GI1A 4KQIA 2C7OA 1M2VB 3WQBA 1D7OA 3LC0A 4QOJA 3R9IA 1FVHA 2Q3DA 4A6DA 2E5LB 5JAIA 2B20A 1GGMA 2I7XA 2XAUA 1XTKA 3ETEA 3PYXA 2OB2A 5JXJA 4AP6A 2MSKA 2TS1A 1CUIA 1D1SA 4OQDA 5AKKA 3OOHA 621PA 2XJ4A 4Q4HB 4HGQA 1PNQA 2H2AA 4RVCA 3T15A 3AVOA 721PA 3FSJX 3G2KA 4IDPA 1MORA 1P0FA 2LZ0A 2ZTLA 3CH6A 4HQRA 3UPDA 1L8OA 1N6NA 2CLEB 3ZQ6A 4HDMA 3BD7A 1MT3A 3RGWS 3QBJA 1W36B 1SCUB 4RVDA 2Q2OA 1XDZA 4EVSA 1V48A 4DV0B 3VTFA 2VF2A 4I7EA 3SDZA 4B40A 3RC3A 4GC9A 1T1EA 3BMCA 1C3LA 3QWBA 4ZK2A 1VI5A 3QVSA 5EI5A 3ST7A 3HXLA 1H3NA 3ROGA 1UQRA 1UKCA 4AWBA 3R7LA 3QEMB 2EERA 3KPJA 4F2DA 2B4AA 2JGMA 4OB8A 1YZVA 2FRDA 4RLFA 2ZAMA 1JFFB 1WX1A 3E9DA 4M22A 2PGOA 4ZN6A 4XR4A 4ZO4A 3DQZA 3U1BA 3BL8A 1QXSA 5LMUB 2Q5EA 5FUXA 4LA4A 4GAEA 4LPKA 1RNLA 3CCFA 1U3TA 4IEFB 1B2RA 1ZM9A 4N0EA 3A9CA 3W9YA 4TV8A 1RXEA 2BHLA 4CKXA 1PNRA 4HO1X 1M5UA 5A7GA 3JQBA 3DE0X 1XXHB 1N77A 2DWPA 3GFSA 1G20A 4L72A 1DU4A 2VQDA 1I4TD 3O4RA 5BRAA 2ZXFA 4BO2A 3CVWA 2B78A 3DTVA 5DGDA 4B76A 1YKFA 2PZ8A 2IXDA 3B1FA 3H9GA 5KYUA 4AO7A 3LZCA 3ONDA 1J0CA 2R7LA 1LF5A 1HPLA 1PL8A 4KLNA 1SZCA 4D99A 2QRKA 4NMMA 1ISSA 1QK5A 1V1RB 5ESXA 3HVKA 4GKVA 1ZKMA 5MFPA 3HVRA 1UXHA 3T1YB 2AUNA 1VKRA 3FZEA 3QJYA 4DJAA 2EIHA 3IMCA 3OCWA 1W0JA 3K6JA 1JP7A 3OHMA 4LCBA 3TMKA 1O0SA 3HYNA 3K0HA 1N0UA 5HOEA 5K0CA 3WOHA 5A1TA 4RKFA 3JWPA 2IXEA 5TVGA 2R48A 3OIDA 2O4CA 2RHWA 4TMYA 3IODA 3TLKA 2Q6OA 2Q41A 3EDQA 4E5KA 1TKAA 2H18A 3QHAA 3L0DA 4OXKA 5AI5A 1HLGA 4KGZA 4NQZA 2A9JA 2QW1A 3J80A 1O89A 2G8LA 4MVJM 2P7HA 1A7KA 3N8NA 3UMGA 4DTIA 1RQ7A 2BMEA 1Y6RA 3OIFA 2NTEA 4DXDA 3K31A 1R0CA 1RQRA 3SS9X 5HUJA 3ZVNA 2HLDD 1ETHA 4YC7A 1JTVA 3PQFA 4NESA 2XUPA 4XASA 4CDMA 5KX5A 4R9RA 3R0IA 3CHYA 1TF5A 4DILA 3AHJA 4Y2TA 5BSVA 4EECA 2Z2JA 3ZYCA 1M1NA 1CUXA 3GLFE 2P9CA 4IWXA 4G1VA 4A8PA 3LBHA 1ZD2P 4E1AA 5FNZA 3VNAA 3AIMA 4LQ4A 5HYVA 2FPMA 2CXRA 1OJLA 3EZNA 3JQ8A 2WA1A 4ND2A 4GL2A 1PFYA 4OGWA 3W1VA 3QKUA 4AU1A 4B6GA 2HI0A 3MWFA 4RE5A 4YBZA 3MTEA 2GUWA 1PWZA 4UCQA 3UOAB 1BJRE 1NW7A 1IJEA 2VDJA 4QXRA 5EWLB 1IOLA 1ZCFA 1N6KA 1E1CB 3ZD7A 2AKEA 2BMDA 1D4AA 1PS0A 3WSWA 4QHYA 1XELA 8ABPA 4DEYA 5HIAA 3CPHA 4YUXA 2PD6A 3VGJA 4ZHSA 3LTNC 4AKGA 4YJGB 1R6DA 3T9DA 1J9ZA 3HPRA 4QFDA 2PKWA 2XDYA 4XD2A 3WI7A 2YQ4A 5ALSA 4BO6A 4IXMA 3LT4A 4QQRA 4WCFB 1H2FA 4O4LB 2JLZA 2QVLA 5JMOA 5KQMA 4BNKA 1CUEA 4MQEA 2C2HA 1N8NA 5K6AC 2OYSA 3K9LA 4GHWA 5HIKA 4FZRA 5FPYA 2VO1A 2PANA 2WP0A 2QM7A 2DG2A 5AM1A 4RPLA 3EVTA 2G4VA 1KZHA 3KQKA 1G8KA 1OXVA 3KKNA 1BD3A 1VMKA 2UUBB 4BNJA 4HN4B 5JXGA 3OHSX 5TF4A 2R4TA 3GGJA 1C50A 1ATIA 3L1IA 4J0HA 4R3UC 1T1RA 4KH1A 5K3DA 2IX3A 5AM2A 5EMMA 4JLJA 1B3RA 2C2GA 2EZ9A 1DOAA 1I2BA 1XZPA 1JA0A 2K4MA 2V7UA 4G41A 4IWNA 4JLNA 2R11A 4KH0A 1L5RA 4RMGA 3A7EA 2HWXA 4NAUA 4DM4A 4UUAA 2QJOA 2B7CA 1THGA 3EZLA 3UKDA 1RKXA 2ZIAA 2ZXEA 3IEUA 3OJLA 1X9HA 2HHAA 3DONA 5GIOE 5CGQB 1UDAA 4AJNA 1Z8NA 2I6UA 2XJ9A 3TTVA 1NRJB 1T3LA 3MCTA 3N59A 4XZ3A 4D4IA 2LW7A 3A4IA 3FOWA 1O96A 3C5VA 3RG2A 4AY4A 4D0NA 3HR4A 3Q8WA 3FOFC 3BWBA 3QOXA 4RV5A 3EGXB 1URPA 2G0NA 3L7LA 3CM0A 1T3GA 2ORVA 2QSJA 4RIFA 4Q9JA 4ZPJA 4IO0A 4JJ8A 3LXXA 3RKUA 1KS9A 5AVVA 3UMJA 5KWJA 4BNWA 2ORIA 1CFZA 1CW2B 4UM5A 4BJ6A 4NK5A 5FKJA 5FI3A 2HT6A 3L8ZA 2C1ZA 1FMCA 1WAMA 3KUXA 4IZHA 4LRTB 3C7AA 2ZIZA 1L7QA 2EKBA 2FWBA 4CR8A 5FWXB 1PRYA 4FGSA 4KWCA 1H0SA 3LY7A 4XA8A 2WSSA 2O2SA 1ZNQO 4Q4AB 5DISB 2J45A 2RIPA 4GOXA 4KCGA 4DQLA 2H2GA 1AXGA 2QUJA 1RP7A 2A1TR 1Q19A 3COVA 4WVFA 4DSTA 5K5EA 2WQ7A 1U0RA 1JHUA 4WGFA 1KJQA 1M1UA 1NU8A 3P5BA 4Q4JA 2VRWA 3RRFA 2WTBA 1BWRA 1HORA 5KYKA 1SCDA 4NOLA 4NOKA 2QF7A 3ED1A 1JDNA 4MV0A 2HA7A 3JQ9C 1ZP6A 3IQGX 4QDOA 4A2PA 2MSLA 2A9OA 3ICVA 2GM4A 4P5DA 2GBGA 3ADCA 1FDIA 4DXHA 2W6ZA 2E48A 4M9UA 3TPCA 3AKDA 3I45A 3G13A 1FVXA 3I73A 3D43A 4YJFA 3TEFA 2BGUA 2PL3A 3TEMA 1TMOA 2J31A 2VHUA 3K5WA 3NP7A 3E5NA 2ZRAA 1ST2A 1TTPB 2F8LA 2QIOA 3ROPA 3EGWA 5EKSA 4UNSA 2E2WA 3WL7A 1ADCA 3DBRA 2JEZA 5IDVA 1BW9A 1OWPA 4Y9TA 3GCZA 1E77A 1K89A 3ADKA 2XMRA 2WF9A 3T4UA 2ZRIA 4I50F 5GP1A 5DCWA 3H99A 3MM4A 2FPGB 4FN4A 4AJHA 2QD2A 4NABA 5JCJA 4E0BA 3K53A 3EY9A 2UZ4A 4ROSA 3ESDA 4TRRA 1T1GA 4YJHB 2YXLA 1YL5A 3TW6A 1CY2A 2NVWA 4IHAA 3RAJA 1QBKC 2QE7A 3DXFA 4LC0A 4BNTA 2ZAIA 3TTWA 2ZJBA 5AM4A 3VYVA 3BH7A 4KRXA 2QX8A 4RHXA 4WT7A 1M2KA 5L4LA 2GFIA 5CVCA 3FUVA 5L3SA 2NUBA 1D03A 1FS6A 3ZY4A 1Z3CA 1MDBA 2QL7A 3UHJA 4F4FA 1AA6A 4LJYA 4G67A 2C8LA 3AG6A 1YVUA 4QT4A 1ULHA 5AJVB 1IHUA 1OA0A 2J08A 2N3ZA 2QVZX 2RONA 3H84A 3QTBA 1S01A 1DSSG 2WAAA 3P52A 3I9OA 1ZITA 3A4MA 1HTWA 4PC7A 1X8KA 1NDUA 1NVTA 4KIFA 4UUOA 4BVHA 3ASVA 2XTNA 5AI0A 5F5XA 1RKUA 3EPHA 3W34A 2BFOA 3L4KA 5EFOA 3UV3A 1UMKA 4YY3B 1SXPA 1P75A 4XI9A 1RHJA 3M5PA 3KE8A 4UTNA 1AY0A 1IQ0A 5T6MA 3NOVA 1UBNA 1ZI6A 3OPYI 1YCGA 2IIVA 1B73A 2FPKA 2W48A 2PZFA 3GBVA 3HHPA 5EAIA 4GGOA 4RTPA 2WFAA 1DDOA 1I0ZA 4HVLA 5DLDA 4ENVA 2O8CB 3WK9A 2Q6KA 3E8SA 1JILA 3U40A 4R1OA 1X7GA 2B6HA 3A11A 4D9MA 3JWJA 1ZONA 5DT9A 5FL7A 4EI9A 4CF7A 5KJCA 1FJGB 3H19A 4X1YA 4BNIA 2GN0A 1YUNA 3OEYA 2GRJA 4FSXA 3ESZA 4P7JA 1D1PA 2J85A 3KZMA 3IUSA 4RM2A 3IKTA 3M2TA 3NM6B 4OY3A 2VVTA 5JDIC 2W9XA 2OBLA 4JQYA 1Z9BA 1NURA 1YDHA 1GY8A 4Q1AA 4XH9B 5IXYA 2PXXA 5H80A 3UH0A 3V4ZA 4PGMA 3SZ3A 1AKYA 1QGYA 2QAIA 3L82B 2CN1A 2HBZA 3IJPA 5KTKA 1T10A 2J3MA 2P41A 1D6SA 3RUDA 4F5EA 3T7JA 1KR2A 4XAQA 4F4CA 2DSTA 1YBVA 1UK9A 2HQSA 1DV1A 1FRFS 3L5KA 1EFRD 4JXKA 1EEHA 4MUBA 4CU5A 5HQJA 2WA2A 2QVCA 3RANA 3TBKA 4A2CA 1MGOA 4HS9A 4ZC8A 3DE6X 1UZUA 4JDUA 1R66A 2QTBA 3H8SA 4HH4A 1AS3A 2VDWB 5GV8A 3TZCA 2W6JA 3EFEA 3A36A 3NV7A 3WLOA 1E3LA 2QV7A 5SICE 4B7AA 4D3DA 1ZR2A 4PFQA 3D2AA 2H9YA 3LP5A 1XEXB 3FCOA 3NC0C 3TTTA 1W9MA 2I62A 4A5SA 1M2GA 1SVUA 5JRDS 2NXEA 3SC2B 3P0JA 4ZT2A 1R5BA 2NO6A 1W4ZA 3GT3A 3C8UA 4GECA 5FT9A 1D04A 3A06A 4Y2UA 5C9ZA 4HQ6A 5GGYA 4RJIA 3ZG6A 1LTHR 4I8DA 4WI1A 4WDRA 3V1NA 3IPCA 3SPXA 3OEED 3IBCA 1AQ6A 3IP6A 5I5GA 1JQBA 2FX2A 1R50A 1MJHA 1J8MF 1GKIA 1MO2A 1JJ7A 1I80A 2EFHB 3VJLA 1E7RA 3VSEA 4RVGA 2QGFA 1CZUA 3FYDA 4GLBA 2GHTA 2OCPA 4IIHA 2PVSA 1GPMA 4X0EA 3RFFA 4BFXA 3K0CC 1SCUA 5JNVA 3EB9A 2PVPA 1PR2A 2P9ZA 1IDOA 3DAHA 2DLCX 3QLJA 5BXYA 4LW8A 3Q8XB 4KPUB 1KP3A 2XY4A 1VA4A 3ROKA 2C78A 2NM0A 1KHTA 4ZEMA 3LHKA 2JLVA 1BS9A 2C3UA 3FYSA 1A9ZA 1QWSA 3PEFA 2VDPB 3WRYA 5MDHA 1QIMA 2A5DA 3EWIA 3IJRA 3QEMA 3UATA 2W4MA 1K6MA 1Z2DA 4R54A 4ZDKA 4J2TA 1X94A 2FSUA 2FZVA 5JFGA 4IBOA 4GR9A 4MV8A 4ZK6A 3P9RA 4MW4A 5C8ZA 5CXUA 3LO8A 3QE0A 3S81A 1VFNA 3MWYW 3Q7QA 1EVKA 4F96A 4FILA 3VPBA 1ORIA 3D59A 2A4KA 3EQ2A 1HUQA 1RI1A 2PUGA 3WZ2A 4B71A 4IFEA 3T06B 1IBMB 3ANNA 1EJBA 2R1VB 4GPZA 4PIVA 3AUFA 1ICIA 3L1HA 4M7PA 5JVDB 2EXXA 4FJ0A 4IF4A 4IKPA 3WLAA 1Q3TA 2XUDA 3WBBA 3GRYA 4G0VA 2CL0X 4LGCA 4N7BA 3UJBA 3UHFA 1HQKA 1YR1A 3E1SA 3N2YA 3O2QB 3TVTA 1Z0JA 1V1RA 3K0AA 2X0NA 3C7DB 2Q46A 1HFEL 3QVWA 2WLTA 4BMZA 3WLMA 1ZNXA 2VZ0A 1OGIA 2CXHA 4DT1A 5GQSA 2V7WA 1I3NA 4HYYA 4NJEB 4EARA 1U8YA 3CURA 1Q1BA 3AFIA 4P0PB 1CR1A 1KK1A 3H5IA 4ER0A 3OP4A 3SBDA 3OZBA 4D8UA 3BRWA 2GWRA 2R85A 2BF4A 5ALPA 2WWYA 3AEYA 3PI6A 4AJ9A 1ZW6A 1HI9A 3K30A 1A9YA 2ZAOA 4YACA 3VKGA 3F6SA 2FFBA 1KDYA 3R74A 1TLLA 3FYUB 3SZUA 3CO0S 3DZKA 3ML1A 3JAWA 4TTIA 4L2IA 1F1BA 4HNAA 5EE9A 4EYOA 5KC8A 4MCHA 1R64A 4BO9A 5BN5A 1CLEA 2O8EB 1EDEA 4UNQA 5KU7A 2QW8A 1Q14A 5A4IS 1T25A 2L2QA 1ZC4A 2QJRA 1UADA 3E05A 3UHPA 3VISA 2AKYA 2VUIB 4NCKA 1XEFA 1F20A 5BSTA 4ZD6A 4FIZA 5AJUA 4JBXA 3K8YA 2OCAA 4MP6A 4TL6A 4J75A 1ECCA 1C3OA 2W2MA 2FDCA 3TRHA 3THXB 3I9JA 3EXAA 3Q40A 3THOA 2GD0A 3IEIA 2YXNA 3ZV3A 4ZGWA 4X3OA 3UJ9A 3IEKA 3M3PA 4G1BA 2J0EA 2Y1KA 1MF7A 2C20A 3LCRA 4N01A 2YYSA 1NN1A 1AK9A 4S1VA 1KE2A 3UHAA 2FDXA 2VQ6A 5ERYA 4HDKA 1VL6A 1Q92A 1E1CA 3OCVA 1RIFA 5DBGA 4IHJF 4H6VA 3JQCA 1GA4A 5BR4A 1XTVA 1SNYA 4DUPA 4TGLA 5C0OE 2AW5A 2HMSA 5AT1A 4B4OA 4L57A 2XGGA 1YOVA 2W4IA 3VR6D 2RHTA 3AM4A 5SV2A 1M0SA 4F4HA 5DDIP 2X22A 3Q9UA 3UKOA 5F23A 1GITA 1MHPA 3QOFA 3IUQA 3V4PB 3NVMB 3P8ZA 3ZK7A 3KR1A 4E4TA 1MZVA 2ZXUA 3MGBA 5HPYB 1JXOA 4B5LA 2PUAA 1E6KA 4CIDA 1IHPA 1G4HA 3KQOA 4QODA 3FPEA 1ZPDA 4PCLA 2PA0A 1H0KA 1KY5A 4QUJA 3RVSA 1CK4A 4FZ5A 5G1NA 4PZZA 3NOQA 2XB4A 3ZDRA 2PMCA 4RV9A 3WGQA 2F3SA 1NVEA 2OBMA 4Y67A 1VG8A 4EHFA 4LAFA 4I3GA 3F3KA 4QYXA 4V0QA 4M49A 1BXZA 1A04A 1YT5A 3I39X 3KWMA 4J7XA 4PVCA 1ZBDA 2YMLA 4FOSA 3P71T 4JFAA 1OX6A 1QFYA 1RVV1 1KAOA 1W1IA 3N0WA 1WMFA 3CCCA 3MAGA 4WKPA 2EZ4A 4Y6RA 5C32A 1NPDA 2RBGA 2FW8A 1KMCA 2RH5A 3GLUA 3EZ6A 3DYBA 1LLCA 4B6OA 4UM9B 4AS3A 5I3ZA 4TWIA 2R47A 4JB3A 1H65A 2QSYA 1D2RA 1M0WA 1L7DA 2JD2A 2QD3A 3FAKA 1Q0LA 1BH2A 3KFLA 4G9GA 4RD1A 3PEWA 2FPWA 1H2AS 4MVYA 1VG1A 3F5MA 3KSRA 3QUAA 1A9XB 1KU6A 3NHRA 5EHGA 1WXWA 4RHUA 3ILXA 1IOWA 3IRUA 3QKSB 1DFHA 4RXUA 5IAOA 1RWPA 3DMRA 2XD9A 1ZNYA 1R4NB 4URVR 4A8JC 3CNHA 1Z5WA 2I4NA 1GNVA 2OCYC 4TL9A 4TLMB 1DHTA 1E6WA 2EL9A 5CM8B 4DM3A 5EOVA 2B5OA 4XB6B 2PO7A 4KR2A 4WCVA 3SC4A 1JQAA 2UAGA 3PB3A 3B1JA 1SUBA 1TM3E 4G81A 4I1VA 2HRZA 2V8OA 3QU5A 2YMPA 1T2NA 5F3WB 2IF0A 3WLQA 4D4HA 5IJ9B 3DCJA 1OFUA 2YMMA 4JYMA 1AMNA 3RAGA 4BX3A 4Q4AA 4H60A 3LY8A 5K8JB 1M0TA 2W8BB 4KQMA 3REQB 2JGRA 4QPJC 1K92A 2F43B 5EQJB 2NACA 2PUJA 2O0MA 3CR3C 1T8YA 1Q1ZA 4IGIA 1YNSA 3RJTA 1TLTA 3IURA 4CM8A 1QU3A 4YASA 1KQ3A 1Q11A 2XNKA 2QP3A 4N41A 3DL0A 2ZSAA 4E2ZA 1CP2A 1A5TA 1GRNA 1ZD4A 3IS3A 3K4QA 1MENA 1TJ3A 5A06A 5ABPA 3B13B 4XYLA 4Z1MD 3FM9A 5EJMA 3SP1A 2EGHA 1EM6A 2BFFA 3DFIA 1TT5B 2W6MA 2IPMA