1FUEA

Flavodoxin from helicobacter pylori
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
GKIGIFFGTDSGNAEAIAEKISKAIGNAEVVDVAKASKEQFNGFTKVILVAPTAGAGDLQTDWEDFLGTLEASDFANKTIGLVGLGDQDTYSETFAEGIFHIYEKAKAGKVVGQTSTDGYHFAASKAVEGGKFVGLVIDEDNQDDLTDERIAKWVEQVRGSFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Crystal structure of oxidized flavodoxin, an essential protein in Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 52
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fueA00
3NHUA 4C76A 1BVYF 3QFCA 2OHIA 4S24A 4Y9UA 3ESZA 4F8YA 5ULLA 3G5MA 1B1CA 3O2NA 3S2YA 3F2VA 1T0IA 3HA2A 3L9WA 1H66A 2MTBA 1OFVA 1AKUA 1YDGA 2R96A 3OJXA 5LJIA 2V5VA 3SVLA 2F1OA 5LLDA 1YCHA 4H2DA 1J8QA 2KLBA 4LTMA 5EA2A 5FUQA 3D7NA 1FX1A 2MOKA 3TE7A 2FVXA 2BMVA 2QX8A 5EMNA 3W79A 3EYWA 1CZLA 4HS4A 4LTDA 2BPOA 2QWXA 1QRDA 5LBUA 4ZVMA 4YAUA 3W78A 1E5DA 4FGKA 1KBQA 2RG1A 4GI5A 4QOEA 5TGZA 4U7GA 1FLDA 1QR2A 4J8PA 4N9QA 1FLAA 1AKRA 3NHKA 3LT5A 3KLBA 4QOFA 4QODA 1X77A 1BU5A 2QR2A 1C7EA 2QX4A 3LCMA 3UXHA 3OWHA 5B3KA 1AKVA 2FZ5A 4YQEA 4D02A 1XYYA 4FX2A 4H6PA 4PTZA 3R6WA 4XDGA 5FA6A 1RLIA 5BUCA 4QOIA 2BN4A 2ARKA 1SQSA 1CZNA 4U7FA 4QOHA 3RPEA 4N65A 3OVMA 1J9GA 4NULA 4ICIA 3B6KA 1D4AA 1CZUA 1AG9A 2QX6A 3QFRA 2FLVA 4YAWA 4M0CA 2OHJA 2BZSA 1TLLA 3F6SA 4DILA 4Y9RA 1DX9A 5F51A 1FLNA 2KQUA 3GFSA 4CF6A 1OBOA 3OWXA 1D04A 1YKGA 4DY4A 1JA0A 3N3BC 3OJWA 1F4PA 4Y7CA 1RLJA 3ES9A 1YOBA 4U7HA 1AKWA 3W7AA 1WSBA 1JA1A 1ZWLA 1QHEA 4R81A 4FGJA 4C0XA 4ESEA 3F6RA 1XT6A 4LA4A 3U7IA 2HPVA 2AMJA 3GFQA 5FX2A 1CZOA 1AKTA 2N1MA 3FJOA 1FTGA 2V9CA 3ESXA 4PTYA 2W5UA 4HEQA 3K1YA 3NLLA 3NFRA 4NLLA 4C0WA 2FX2A 2Q62A 3NHFA 1QBGA 2OYSA 3O73A 2WC1A 3L9XA 5EAIA 1CZRA 1WSWA 4N82A 2OHHA 4YAOA 1TIKA 3TZBA 1AHNA 2FAXA 2Z98A 2XODA 4OXXA 3JSXA 4CETA 5LBTA 1SG0A 1RTTA 4LAFA 2HNAA 5LVAA 2M6SA 4ZVNA 4FGLA 4XDHA 1YCFA 3GAMA 2Q9UA 2M6RA 1AZLA 6NULA 3FVWA 1CZKA 1AKQA 3UXEA 1OBVA 5F4BA 3NHJA 1V4BA 1D03A 4GQIA 4GR9A 1J9EA 2QMZA 3OX3A 2ZKIA 2FOXA 3QE2A 5F12A 1XYVA 1ZX1A 3KAPA 3B6IA 5NLLA 1XI2A 2X2PA 3N3AC 3NHLA 1NNI1 1ZWKA 1AMOA 3HLYA 4LTNA 1CZHA 4QOGA 3N39C 3B6MA 5LMCA 1FVXA 1C7FA 3TEMA 3FX2A 1GG5A 3HR4A 2QX9A 1I1OA 4BMPB 1RCFA 4YAFA 3P0RA 5LJLA 4C14A 3NHPA 2GSWA 2MT9A 3FW1A 2QMYA 3KAQA 2D5IA 3KEGA 3B6JA 3U7RA 1VMEA 3NHSA 2BF4A 3K20A 5A4KA 3W77A 1J9ZA 3ZHOA 2HNBA 2X2OA 3FNIA 5JROA 2A5LA 1T5BA 5B3LA 1FLVA 1DXQA 2FCRA 1DXOA 3F90A 5NULA 3EDOA 3OX2A 2MWMA 1H69A 3GFRA 4QOJA 2V5UA 4PU0A 1YRHA 3ESYA 2Z9DA 2Z9CA 1FUEA 2FZVA 4BMOB 2R97A 3NHYA 3NHRA 2B3DA 4ZVLA 2XOEA 3OX1A 1YCGA 2Z9BA 2FDXA 4YALA 3NHWA 1KBOA 4ZVKA 4DIKA
chains in the Genus database with same CATH superfamily
1K9SA 3J80A 4FUQA 3AR8A 3BZUA 3SOPA 1BVYF 3CVUA 2HMYB 4ZAXA 2UXCB 3A25A 3SFZA 4B43A 5JQGA 1RIIA 1ZQ9A 2LE0A 3QVGB 3H4VA 1N1MA 4L07A 3PB3A 5FBQB 4DUZB 2I7DA 3I04A 4QU0A 1EZ4A 2HJSA 2XB6A 2P9EA 3OQ6A 3OPVA 3RUHA 3PR2B 1HFJA 1AUQA 4MCHA 4TLEA 5JAPA 4KLCA 2VSNA 2FK7A 3ORYA 1ZD3A 1MRZA 1Z07A 2AQKA 4Q1FA 2QRVB 1J1ZA 4XUGB 1C4KA 1I2MA 5JCJD 4CGZA 1NPDA 4DUGA 5KOHB 4N41A 2OCPA 2PQ6A 2Z2JA 4MI3A 4C6TB 2PXAA 3WQRA 4PQEA 5EHXA 1GT6A 3K94A 2ODBA 2XPCA 1OWOA 2JLXA 4NG5A 5DYGA 1NVEA 2ZZKA 2LW7A 2O1SA 2DKFA 2J33A 2BEWA 2NZJA 1Y80A 3DZBA 3I6ZA 4M7WA 4XGIA 5LA6B 4ZKDA 1AN9A 2I8LA 3DL4A 4KYUA 3FWYA 3QPUA 1C1YA 3HMQA 3AR5A 1G8SA 5ALYA 5CA0F 1IMOA 2Z1NA 3MWEA 4DHEA 1DKLA 2ROQA 1LLCA 1T24A 4RLFA 2F62A 3FWKA 4RF2A 2YJ4A 3CNBA 3CV3A 2QUJA 1DIHA 1VDMA 4HXYA 4Q7KA 3ZTWA 1PJAA 5CITA 1PIWA 2P11A 1T2AA 2OBXA 3I58A 4OUDA 4LRWA 1W2GA 4QJBA 1K6XA 2I6SA 2JGMA 2XSZD 1UZNA 1V9SA 2R2AA 2NV2B 3QPDA 2UYGA 2V3WA 4OK3A 1SY7A 2LGJA 2ODPA 3ANTA 2CLMB 4DA7A 1II9A 1KJ8A 5DXFA 4F5YA 3F5DA 2ZEJA 3BORA 3DO8A 5JAMA 1RYBA 3OM0A 4UTOA 1PZFA 2NZYA 2XADA 5JAHA 1XKTA 1HQKA 1W0JD 2RG1A 2VDUE 1FRVA 3TZHA 2WJYA 4EPWA 5L8VA 4B3FX 3GLIA 2J4DA 3PNSA 1JAXA 1KAQA 1NE7A 3JAKB 3DE6X 4MGIR 4DEXA 4Z5XA 1T91A 5J3JA 2PBLA 1Q6ZA 2PYDA 1XLVA 4YJ3A 1B8OA 2JRCA 2XBUA 3V8MA 3RIYA 2DOKA 3PA8A 1XROA 2C2ZA 5EJ4A 1V45E 3R74A 1T8YA 1B3BA 2OLKA 1P6XA 2O3UA 4CM8A 5CVTA 1CK4A 3UB4A 2FMIA 4OGWA 4Q05A 2Q1XA 2PT9A 4QOFA 4FVTA 4Q47A 4JL8A 4OB7A 3SS8A 4HX5A 3VUFA 2HJ9A 4QODA 3A2KA 3MBOA 2WV7A 2JFWA 1H1TA 2GK7A 2RH9B 2W8ZA 3IEKA 2YJZA 5J4YA 4Q15A 3DNPA 2V7PA 1BXZA 1R5JA 3OJ0A 4LY0A 4O4HA 5HBRA 3WVNA 3R0IA 2QN1A 4DM3A 4EHFA 1T1JA 4P2GA 2ECPA 1RQPA 2JJ2D 1X8LA 3ECCA 5A7GA 1ODIA 1DUVG 1H2XA 3I6QA 4R2KA 4TL9A 121PA 3OTQA 2UYHA 4Z4GA 2ZE8A 4BKOA 1G5IA 1L7MA 1LW6E 3SM3A 4ZOLA 4EO4A 2V1UA 3RTBA 3AHEA 1REQB 2AHRA 2WFMA 3N2KB 1U9IC 2R8YA 3M5PA 4ATNA 3OURA 1ISHA 1ZIPA 1KVQA 4JKYA 4B8WA 1XGKA 1WQ1R 2AFHB 4PNZA 5BVGB 5C8YF 4IXMA 2BH2A 4FMPA 4H3VA 4HGZA 1YZLA 1YK0A 4LOJA 1E1RA 1Y6QA 2OBBA 2OCBA 3PA6A 4QPNA 5CW2A 5EIWA 3FCCA 4QHYA 3GFTA 3ZIAA 1CSEE 3KXIA 1S2LA 4DREA 5GJVC 4GP9A 2JFFA 5HS6A 4MVCA 1CUGA 3TW6A 4DNFA 1SHTX 2D1QA 1M2WA 4AW9A 4BKMA 4NNJA 2O2JA 3CZQA 4JJ8A 1JNXX 3HCDA 2P4UA 3HN7A 3BSFA 1QHGA 5JD3A 2PLAA 4M98A 2UZAA 1T25A 3NATA 3UK0A 3WX0A 4C07A 1JTVA 4ICIA 4KVFA 1QWSA 1SCKA 3B8HA 1YB4A 3B1XA 4OLJA 3EPLA 3HB9A 5DSZA 1ZGAA 2H4ZA 3FHJA 1M1NA 3PD0A 1C0PA 5HQ3A 4KR2A 2VDOB 2XWQA 4DTCA 3HDTA 2FF7A 3DAPA 3E8SA 2VDVE 1IZ0A 3QFRA 2VWPA 4LMAA 4XTRA 4YXWA 3W3AH 2GNOA 4EG1A 3O8CA 3PZRA 4DA8A 2VYCA 3B6EA 1ZCAA 2D7CA 1P4SA 3OIYA 4JC8A 4C4XA 2WD8A 1GADO 4L2IB 4XAQA 4IX9A 2J3IA 3I5AA 4IIJF 3TKLA 1WO8A 1Z0DA 1MBZA 2Q5CA 3IMCA 3A0RB 1GGMA 1HFEL 1F2UA 3KRTA 4M46A 5KU1A 1CJCA 1VCMA 5JDCC 2DPMA 4JHLA 2O8EB 1XU9A 2BDTA 4XYGA 3JQGB 4XYEA 2O54A 3C3PA 1OXTA 5FJJA 3PDIB 1Y3HA 3ED5A 1B6SA 3F74A 2LBPA 3IQHX 3TKAA 3VR1A 2GM5A 3KJZA 1GGNA 4BMZA 4CF6A 4M1QA 4OH7A 1M10A 2HRCA 4H4CA 3N6RA 4KOAA 3RYHA 3SGLA 4BJHB 4BVHA 3QTTA 1O6GA 1UJBA 4RGYA 1K7CA 3O92A 4RZ2A 1GPBA 2FWNA 4TVSA 2RH5A 4RABA 2IP4A 1QP8A 2OPBA 4M9QA 2OORA 2G04A 3BFPA 1DIGA 3X0DA 1RLJA 1WTAA 1XDSA 3I5MA 3EGVA 4WBXC 3UEOA 3HXQA 2JCGA 2HSWA 3PICA 4JLBA 3FWZA 5HKKA 4EA6A 2RCYA 1ZW6A 4FJ0A 5CT9A 5JCXA 2Q5JA 5L4NA 3ESCA 1ACLA 2H1CA 1G55A 2P1RA 3I01A 3IURA 3KWJA 2YOFA 4MS3B 3VBCA 1MTOA 4JL5A 5JISA 4PRZA 4F6RB 4Q9AA 1JIXA 2NZUG 1IPHA 2RC6A 3IMFA 3H99A 2HWWA 5AXAA 3WO0A 4E5VA 3A9WA 4B3CA 3MQFA 3TM5A 5CNMA 4B74A 2HXGA 1PI3A 2JPDA 2FN4A 4BFCA 3O47A 1FRQA 4X45A 4PQFA 4W5RA 1XQ1A 5I7VA 3K8YA 2V6IA 2ZU6A 3DAGA 3T5TA 5J43A 1H2RS 2FQ1A 1HG1A 2DVMA 2VHQA 4DWOA 1LU9A 1OE0A 1M74A 3KUXA 1UINA 3QKWA 3C8ZA 4JVMA 3DHWC 4TUYA 5GJCA 5CBPB 3F78A 4YMWA 1D1TA 2IHJA 1QTRA 1IIBA 1TJ3A 2FEWB 1W48A 1K2WA 1T43A 4NZOA 4XVQA 1FK8A 1U7TA 3QKTA 1CBUA 3Q8MA 4KYIB 5CT5A 3PT9A 4QRHA 5DN9A 4E11A 3TLAA 3JU3A 4F4HA 1WL8A 3GLSA 5FHQA 5CH5A 1NQVA 1FSZA 4IXWA 2ZM6B 1XPUA 5JMOA 4Y1FA 2O8NA 2FVYA 1F2DA 3MJTA 1SA0A 4GKAA 4O2AB 3P7MA 3E5MA 1FSSA 5KYWB 4CM3A 1D1PA 1Q22A 3AM5A 2C0PA 3IESA 1E6KA 3R9XA 1E2JA 2QMOA 2BYTA 2DJIA 3K1YA 5A7HA 4DLRA 2GKGA 3BL5A 3AL0C 3IR5A 4CLRA 1HNWB 3LP5A 4HH0A 2KBEA 3HLKA 1E3QA 1Q7BA 4FWBA 4IFBA 4N5LA 4ZI5A 2C97A 5TARA 3ZW8A 2ZCJA 4GKBA 2WF8A 4D0RA 5FP0A 1N9GB 1T9GR 5DLEA 1RBMA 4CMKA 1KDTA 2LR0A 1FW6A 1P8AA 4RH1A 3TLGB 2QW1A 3LQRA 2WC1A 4FD3A 1S02A 5JEEA 4P9NA 1W29A 3T99A 4L85A 1UJNA 1IL0A 3WKBA 4CNQA 1SEVA 2R6ZA 3HXLA 1E4YA 3ORQA 1XELA 3G5LA 2B35A 5B3JA 4DLKA 3L7KA 5DF1A 3DBOB 3PWSA 1A9TA 3KYBA 2AMVA 2C98A 1DRVA 2J6IA 3EIXA 3WDLA 4D9NA 2QTNA 1CU1A 4ZI7B 1ZOSA 1LW7A 2HQOA 3FPCA 2HN9A 3L4BC 2I33A 1GT91 2FSHA 2RGDA 2FDCA 3ZDRA 1GDDA 1N1GA 4CM6A 1H2BA 3LC7O 1GNVA 1VJ0A 2V6GA 4U6SA 5SICE 5BNIA 3KR2A 4O1MA 1PD0A 1G8JA 3LUDA 1T9GS 2ZVPX 2W2MA 1G17A 1JBEA 4XFJA 1P0IA 3KOMA 3QVXA 1OFUA 1EX1A 1XMJA 4HGYA 5B1EA 2ZJ3A 3KT3A 5A0FA 3PXEA 5CB8A 2FEAA 1U7HA 4G0MA 5JAIA 1E9VA 5FORA 4BVBA 4RZUA 4TTIA 4BWVA 5CDUA 3ER9A 4KG7A 3FGZA 3PGLA 4MPPA 3Q15C 1PYOA 5DX1A 2CYCA 2CVPA 3C2QA 1DO8A 1YE8A 2H4FA 4GYKA 3HY4A 1Q7RA 3I3SR 4QC2A 1U99A 4RKEA 4C30A 3AP2A 1FRZA 4LRSB 2ZLBA 4HP8A 5ETJA 3UT5B 2ZR0A 6NULA 1FFXA 2I6UA 5F7XA 4D0NA 3R8CA 3QRWA 1ULZA 4O33A 5BXYA 3GARA 2BY4A 3TPZA 2CXHA 1DC8A 2ZSDA 1G6HA 4P34A 4ZPJA 5IT9A 4TV8B 4AKHA 5C31A 1L7PA 4DKXA 1XRMA 1E3EA 2W8BA 4GR9A 2JFPA 4AIIA 4LYJA 1UBTS 3UK7A 5KQRA 3MGKA 4G1VA 4I99A 3OC0A 2H0QA 3QBJA 2R6CA 5AHWA 3QHQA 3RTGA 3WGOA 3PJRA 5TMEA 3ZGYA 2FOXA 3NT5A 2I8CA 3I6YA 4KWCA 3RFXA 3DEZA 3U4GA 1NQTA 3D6NB 3JVIA 4TKVB 1MNAA 1Y9JA 1DZIA 2J5RA 3RS4A 2PKWA 1ZD4A 3RB8A 3DE7X 4BBPA 1OZGA 4KX3A 4O2LA 4EY5A 5B6JA 4RFLA 3E05A 4UTRA 1YZGA 4BO0A 3D0QA 3SXJA 3H7AA 1EFVB 3IDZA 1N0WA 1IE3A 1MQ9A 2G1UA 2XF8A 4V02A 3A04A 1CZHA 2HV8A 1W1UA 3MWFA 2FCAA 2QGZA 3OZIA 2C9OA 2GXUA 4KGVA 4QOGA 5HDQA 3ADDA 2G28A 2XE4A 1PL8A 2ZJAA 5E4JA 1IOZA 1KPIA 2BSQA 2QE7D 5AJWA 1JI0A 2EFJA 3AJDA 3RTDA 4NJEA 2D1SA 2Z4TA 2WMNB 4TMWA 2OSBA 1TECE 3LRXA 1KETA 5GINE 5JI3E 2NO7A 1FVXA 2V7WA 1L8AA 2CY0A 3V1KA 1D0IA 2I2XB 4UXHA 4XUCA 1QGYA 1SZJG 8ADHA 2E1PA 3QFHA 3L8ZA 1FDUA 4JNCA 1SKQA 2IE8A 4X20B 2BI8A 4RESA 3DXXA 1JALA 2ZJ4A 3TJZA 1QH0A 4ARSA 1KVUA 4IO0A 1O6CA 3INYA 1QG6A 1BSVA 3U80A 4JKOA 3D59A 3IUJA 3M9WA 2ZJ7A 1FDSA 2JGLA 5BR4A 5I7WA 3IMEA 2D4AA 4J29A 4K6OA 4O2AF 1VCHA 1YB7A 2Y6UA 2FY8A 4QT0A 1V0JA 1VPDA 1XA4A 4I5GA 4K6KA 1RM4A 4OHVA 4BN4A 1HYBA 3T1OA 3E7PA 4U8HA 2IE0A 3TIIA 4LQ4A 1M6VA 1WHSA 3AF5A 4N39A 5LCXA 2IF0A 4F4JA 5A3VA 2C00A 5H9VA 3L0PA 4BFLA 3HABA 4GVPA 4L51A 2A0UA 2R5WA 3MUFA 2F48A 4DM4A 1BDIA 1Z22A 3AWIA 3FTEA 2AYXA 3IV9A 1LRKA 3VH3A 3QV2A 2IU3A 5E9JA 1EXDA 3JVDA 2NSLA 1Z6YA 5BSEA 2Q1WA 5K4HA 1JQ3A 2QUKA 4RA9B 1H8EA 1PFYA 1YZVA 3WYEA 3ZE9A 4OMUA 3LH5A 2QD2A 1D2CA 2BHTA 2H9YA 4KDCA 4CTJA 3WAJA 2CDBA 2O2SA 1UBMS 1XDWA 3PC8A 4J3NA 3GGGA 3U6BA 1EB9A 1CVRA 3TGLA 5NULA 3T9DA 6REQA 3RYCA 3TVTA 5T57A 1B0ZA 3OY7A 3QIAA 2OGTA 2FRXA 3MLAA 4IIUA 4UBKA 4NY1A 3WL6A 2ZB8A 3PX7A 1YS4A 1XD2A 4ZOCA 3ADPA 1SIOA 2B5OA 1UC9A 3DZFA 2HRDA 3IXMA 3LX8A 4AL4A 1QANA 1HE4A 1YDWA 3DZGA 3L92A 3PJGA 1H9AA 1EE2A 1EUYA 4UTPA 2PMKA 2VPXA 3CVVA 2AOUA 4JGIA 4ZGBA 3D0OA 3VPDA 3M6MD 3T5AA 2R97A 1BO6A 3JQ8B 4FDUA 4PANA 1NQ5A 1PTJC 2I5PO 3HJCA 4ZQIA 3RSGA 1GZDA 1KNXA 3OJOA 4M9ZA 1OLOA 3GLFA 2WM8A 4JYZA 1E0SA 2ZBPA 2CJFA 4EY7A 2R1TA 2JDIA 2ZSAA 1N9ZA 2C5GA 2Y1CA 4A5OA 4AZ0A 1CQWA 3E8XA 1NSYA 5AYVA 3ITEA 3GG2A 4AJ2A 3NV7A 5D3MA 1XZ8A 2X7JA 1UUFA 1XAGA 1EGAA 3SC2A 5JPCA 1SUWA 3ZXYA 4FFMA 5JALA 3RC1A 1QFSA 3CH5A 2R60A 4J2HA 3U7QB 3W7VA 1NULA 3WNDA 4LJYA 4JBWA 4X61A 4A2QA 4NR0A 2JHAA 4LHXA 4LYFA 5TEVA 1ZR4A 2Y0BA 4MVJP 2D1TA 1KOFA 4MPDA 2OL4A 2QAGC 4TYPA 4EUHA 4IDFA 2BTQA 2ZITA 3E0XA 4R8SA 4TT3A 5AW2A 3UUWA 3MINA 1WA5A 1J2YA 1VYHA 4BFSA 2BFEB 2R7KA 4PWYA 3V8RA 4MKZA 2MYUA 1M75A 1VBKA 3R5HA 1Z16A 1QV7A 1WCV1 5JHHB 2Q07A 1T0IA 3F2VA 2V0NA 3I0MA 3IOEA 3DWFA 3Q0IA 1XNGA 2FR0A 4LECA 1N0IA 2MTBA 3AF3A 1YO6A 2J45A 3A2MA 5JXIA 4ARZB 1KOGA 3NBKA 4GLBA 4M49A 1TUIA 1V8OA 2JFOA 2YWXA 3EGWA 4WZBA 3CGWA 4GLLA 4KXYA 4B40A 4D6PA 4HFJA 1ECJA 4EH1A 2ATIA 2HLDD 3GFPA 4DCOA 4BTVA 3I9MA 3HSSA 3RAJA 2R8RA 3EZ9A 4JSTA 4LCJA 1UOQA 4ZQGA 4PLTA 1OFIA 2C3UA 3CRMA 4X6YA 2FH5B 3GUHA 5LLSA 3U13A 4GR5A 4CU5A 4HPJB 5A4FS 1DV2A 4J7AA 3FTNA 8OHMA 5I45A 4QFMA 2AKEA 4CQLA 2BMVA 4GPTA 4MH0R 3VC1A 3X3HA 4EPYA 2YWRA 3GJYA 1MLDA 4UEWA 5ALTA 1T0JB 2G0NA 2GRUA 4DIUA 5BWOA 5DCYA 2BFNA 4JFAA 5MN6A 3QPAA 1F7UA 3DV0A 4OREX 1JMVA 2E6UX 4KXMA 4L72A 2A9OA 3KL2A 5KJEA 1ESZA 1V5WA 5HF9A 4YMSA 1NY5A 4JHXA 5ED4A 1GSIA 2Z5LA 1FRFS 1VHTA 2OILA 4ZVMA 3KSDO 1W36B 4Z9BA 4HLQB 1WLYA 3GVIA 3PC4A 2AV6A 2XBLA 2XVYA 3PYMA 2Z04A 2D06A 3E0QA 4NZZA 2MSCB 4R8MA 3F73A 3T7CA 1Y4SA 2HWYA 2I78A 1XX6A 3EXAA 4AURA 4KXWA 4YJ2A 1TA4A 3GEDA 3LWDA 1QRRA 1GRNA 2G5CA 3PV0A 4GL2A 1TRKA 5AW1A 3OCWA 3PS9A 4KO8A 2GPTA 3PT5A 3GLQA 3F5SA 3O4HA 5D1HA 5JZOA 5CJPA 5I9MA 4J1QA 2GBGA 3WIVA 3F6CA 1SQ0A 3ASYA 3JQRA 3K9BA 1LBEA 1NI3A 1WD7A 3N28A 4AY4A 4HUTA 5I4IA 1F0YA 1GZSA 1M5UA 1QIMA 2OTCA 2ZQYA 4BO8A 1R9GA 1TD1A 4NBSA 5GY7A 1WEHA 2QR2A 3LRPA 2XQGA 3PD1A 1Z88A 1LGYA 1KEEB 3GHYA 3GJ4A 3Q2OA 2WBLC 2WM3A 4PCLA 1U2SA 2DYKA 2H08A 1TQ6A 2IPMA 5HE8A 1G42A 1CR2A 4QRIA 1OLSA 5HIJA 5K8LA 5AQEA 1KJNA 2J48A 3E7FA 1LF5A 3SYNA 3UAVA 1T6BY 5BY2A 2B61A 5DWDA 5B3KA 1CF2O 3IQFA 3EY9A 2A9RA 3CONA 1PX0A 4GBMA 4RY0A 1I3MA 1MH1A 2Y1EA 2HF7A 3B1YA 1J21A 2O20A 3IO5A 4H6PA 4IHJF 3R6WA 3SC6A 3RFCA 1NMSA 2CHGA 2G9ZA 1GV0A 3IP6A 3M33A 3QOFA 3DZJA 4J43A 3AJ9A 4RY9A 2ZE5A 2HRBA 3H0CA 3VYVA 1X8XA 3K9QO 3PFCA 2JLQA 1Y8QA 2XZTA 3M9LA 4OHKA 1W1IA 4MI6A 5FFNA 5G41A 4EG4A 4WLFA 4TZKA 1WB9A 1QIGA 2VYFA 3K5PA 4IZHA 4R05A 4UM9B 3GLUA 5T67A 1C4XA 3PQFA 1XP5A 4RETA 1GA4A 4AJEA 4QDOA 3GP8A 4MIKA 4ZZIA 2DT5A 3G2IA 1U81A 3KUDA 3OFJA 4ZT4A 2H0RA 5IAAA 2I54A 1WU8A 3T9CA 1QK3A 1L5YA 2F1HA 1JV2B 5TXGA 3U49A 3GT3A 3DCIA 3U3OA 4BLSA 1JPUA 3SYKA 1E98A 4F3KA 3QTLA 3L82B 1UK6A 4MYDA 3WS7A 5ITVA 1XMXA 3TR6A 4J3JA 2QG4A 4DMMA 3BPSA 4E0BA 1E9FA 1M1ZA 3E2PA 2OO3A 5T4BA 2VXYA 2QD4A 1KTVA 4DQXA 2VQFB 1LQTA 3R3SA 2VPYA 4PHGA 2OHJA 4N01A 1SPXA 4ZV4A 4RV4A 1U1CA 3AKCA 2J6CA 4RLSA 1ORDA 1AGXA 3AB7A 3FCXA 1GZUA 3L0OA 1FFYA 5EQJB 1KZ7B 1E2NA 2BE7A 1DRUA 2WUGA 4FN5A 3ZZNA 1GILA 3RRBA 5I7OA 1JEQB 3HR8A 9GPBA 5KOHA 2GZRA 1A1SA 5F2NA 4C6TA 1OBOA 3C39A 4ZYUA 5I3CA 5BYJA 1J23A 2DY0A 2X42A 1M72A 4GM4A 4MV5A 2I1LA 4D5EA 5CBKA 4NL4H 5HHTA 1A7AA 1AKMA 3AMVA 1U9CA 3OCZA 2GVZC 4CN9A 4J0JA 1GYPA 1EVQA 4O4JA 2YWJA 3A6PC 5EMKA 4URXR 3VU9B 4P4TA 2W2XA 1V1RB 1T5SA 1ZZGA 1TM5E 4M86A 3FDZB 1NP6A 4KGZA 1DOAA 4LE0A 1IQPA 1F1BA 3NS7A 1PR3A 4CQMD 2RMKA 5EP2A 4A7PA 5IKMA 4FMDB 1F60A 5TDHA 3ADBA 3A3KA 5HKAA 1QV6A 4HNTA 5IABA 2JHCA 4ZCLA 4P3KA 3BXOA 5E3HA 5B7GA 3T1HB 1FL9A 1O96B 3NEPX 1OXVA 2Z8ZA 2VT3A 3NVMB 5DXJA 3VPFA 1ZAYA 1DBQA 5CVJA 3UUEA 2HA2A 4D9JA 4L76A 5BWCA 4G0VA 2HWUA 4GGOA 3PC2A 1RKUA 1OTHA 4S3MA 3QOYA 5IASA 2I91A 3PL5A 5TV2A 3JAKA 2R79A 4B4OA 4G6ZA 4QNRA 3O93A 4RUKA 4UOQA 2Y2VA 3UTCA 5B53A 1IC6A 5CVVA 1JDZA 3DVLA 3TO5A 3MWYW 4XWAA 3BF7A 2C58A 4EP1A 1V39A 5IJXA 3UF0A 5DYYA 2QN7A 3AKZA 2ZRMA 3FJOA 1BNCA 2P2LA 2A88A 3Q88A 4HQFA 2H9AA 3FKJA 3AINA 3TVDA 5L3VA 2GK4A 3QLUC 1CS0B 2HU7A 4LOIA 1X14A 4CM4A 2QN8A 2PY6A 2W5UA 2ZIUB 3LYUA 4XB1A 4HEQA 3WYBA 2RGWA 5AVXA 4UJ5A 1RZ3A 2IPOA 3D2CA 3DTVB 2NSHA 2RHDA 4JJAA 2ZPUA 3ICQB 4U2CA 4PQYA 4DT1B 1W36D 2POCA 2VTDA 2AOXA 1BS9A 1V37A 3FOEC 1KJIA 2GK3A 3EEIA 1NXTA 3HV0A 3N2KA 1W59A 4FCWA 5CX1B 1JLKA 3QKUA 1H6CA 2XJ9A 3EOBI 3NHFA 3KOWA 4WK2B 1G3RA 1RYDA 1S96A 1DCMA 2RK4A 3QE9Y 3DKKA 2HIHA 1YACA 5K0FA 2O5VA 1W35A 1ONNA 2XW6A 3RKUA 1FJ2A 1G20B 3N0WA 3H1TA 4UCXA 5CW1A 1K75A 2EGHA 2X23A 4P08A 2NXCA 3AI7A 4E6PA 4MVJF 4J94A 5HRUA 4I5IA 4DPKA 2J9FB 1Z0SA 1SXJB 3TL6A 4QUEA 2E5WA 4C7VA 3J81A 1GQOA 1J4AA 4EHKA 2C4WA 3RVQA 1ESMA 5AKHA 5IZCC 5IRCD 4EI9A 1FS4A 2PFKA 1QHFA 1SVNA 1TO1E 3NX4A 2H07A 4D0SA 1N34B 1JHVA 3I64A 4MQUA 2DTEA 4GVLA 2AFVA 3P9ZA 4GPZA 4OIFA 4B3DA 1PTKA 4EB6B 4N5IX 1O95C 3OCXA 2A94A 4MVJD 1UQUA 2IPXA 4Z1MD 2H17A 5K6RA 4PY2A 4RCYA 5A04A 5TC4A 1U5AA 4A73A 4KL8S 5KTPA 1J22A 1N7HA 4DQ0A 3CMCO 1D6SA 4Z0PA 1DMRA 1RR6A 2V74B 4EY8A 3WYAA 1U7WA 3OZUA 4RMNA 1W93A 5F98A 2I1QA 3BXZA 2O8EA 4PSDA 4UM9D 5THQA 1X1EA 2JASA 3V6MA 5LIPA 1MJ5A 3GC6A 1ZOOA 4A8HA 3JQGA 4MLZA 3QI7A 4BNJA 1GKIA 1HEUA 3PFWO 3HJHA 3D1JA 4MR9B 2C57A 2RGNA 3R7WB 3TNYA 4E5KA 1TA9A 4Z4IA 5GQSA 3JQ7A 5KCMA 1OC4A 3D81A 5EGNA 3V34A 1NJFA 3Q9LA 1G21B 3NM6B 1IZZA 2CBXA 3GRYA 4GDFA 1KXJA 3KSMA 4UTZA 1OD6A 4XH9B 5THKA 2Q3BA 3A9CA 2G8LA 2DHRA 2JKVA 4D44A 5IJZA 4XCQA 1QYWA 1BX1A 1D8TA 2C5EA 3KEQA 3MTAA 1LDBA 4LCBA 5HFNA 3A70A 5DNWA 1M76A 3VR6A 5C5CA 4IKOA 2G77B 3HZZA 3RC2A 2IELA 1ISRA 2CLHB 4HJRA 1OJ7A 1JXAA 1QFJA 4YWHA 4QDUA 4YCSA 1IQUA 1O58A 1UBHS 3NMUF 1RCUA 3H8VA 3AVWA 1C3VA 2LTAA 4WLVA 3LKVA 1GG8A 1EK1A 1OQAA 1YZHA 2FSIA 2YFKA 3HJGA 4QTZA 5PNTA 3DNMA 5JS7A 1VYUA 2BUAA 2JCVA 3DLPX 1PG5A 3H9EO 2XQVA 4GOOD 4KPGA 4MXDA 4O5OA 4PNPA 3U4AA 1FQOA 1BS1A 4MR7A 2GUGA 4OM8A 3KOXA 1QAMA 5L3QA 3MMNA 3P97A 3CN9A 3RVSA 4B4KA 4H7PA 2ZJOA 4YB8A 4DUGD 5EIXA 1GLNA 2FFBA 2P6UA 3CF0A 3KQVA 3OQIB 4D43A 3OLYA 4X7PA 2HMUA 3LCRA 5FV7A 1R10A 2GCPA 3THSA 1SVWA 1ZU4A 1IOLA 2G7MC 3LLCA 3AM3A 1FU7A 4FGZA 4FMDF 4IW3B 3M9XA 4Z86A 4ALIA 3GFVA 1GQ2A 4ESHA 1DXHA 2Q0QA 2XXJA 2EDCA 3G9XA 2Y4NA 3HFRA 3I9NA 3U62A 4AECA 4NTZA 1RTKA 4CV1A 4EKDA 2ABWA 3EA4A 3LW7A 4HNAB 4R0NA 3DF9A 4LJ7A 2FWMX 4S05A 1B8VA 1Z06A 4JGGA 4LI3X 3VBEA 5JQWA 3IEVA 1EP1B 2WTEA 4ZJPA 4PFJA 2BSXA 4NCXA 4PG4A 4QPPA 1S01A 2NZWA 2J07A 1MDFA 1XTTA 3I4LA 2E5LB 3FMFA 2NX2A 2V65A 3DWIA 3N8NA 1QE5A 3BGOS 4GX2A 3QMVA 3BEOA 4I66A 1ND6A 2I7VA 2WPDA 4NAUA 4AB1A 2DECA 2P2CA 4FLFA 3E9QA 3ONWA 3F67A 3BJMA 1JUDA 4G5QA 1ECLA 2ACWA 1QOZA 4MUHA 3FGOA 3VNBA 3U7RA 5L4SA 4LF9B 4DAOA 2IOFA 1EVEA 5DI3B 4AMUA 1XLTC 3NHSA 1P5RA 1TC2A 4MYRA 2WUDA 3GEIA 4BJ1A 1M7BA 2I2AA 1YQDA 2ZVQX 5JPIA 3ELDA 3AESA 3GV0A 2XWJI 3QPWA 2HD4A 4GXTA 3TLGA 2IYXA 3U3MA 3SX2A 1CERA 3W77A 3DL0A 2E37A 1GA1A 2TS1A 3T06B 3S2GA 2Z5FA 3S2FA 3PSHA 5IC4A 3V1LA 3K5HA 2JAWA 1GEEA 3I39X 5EFZA 3D2LA 4QHSA 3ZH2A 1ZHOA 2AKYA 4MQFB 2W93A 4PLCA 1P91A 1JQLB 3N58A 1VIDA 3PHLA 1V3UA 1R16A 2ISSD 3DTVD 4JJ6A 2X1MA 2VZEA 4MHSA 1KS9A 1XCPA 4OBBA 1OVGA 4NCHA 3ZWAA 4EQZA 4ZI7A 1GTSA 2JGKA 2ONKA 1WXIA 3GZNA 3K6SB 3TFQA 2V7UA 2LPMA 1NVBA 2BV3A 2WR8A 2A33A 1JHQA 621PA 2Q8NA 1LS1A 2JKZA 3LHFA 4H35A 3EXFB 1MQSA 1G3IA 1EG2A 3F90A 3H2YA 1FY2A 3ND5A 4GRAA 4PQRA 4X54A 3V4OA 4LYDA 1G2PA 2P2ZA 1XDGA 1HXHA 4KTTE 1S0UA 4C29A 4YACA 2FKAA 3SX0A 1F5NA 1Y42X 4TMYA 2YCLA 5CUQA 4G1FA 4ZP1A 1S7CA 5KHAA 1MJHA 4UUOA 5J4KA 5ALRA 1HYGA 1ZGBA 1P5JA 1XNHA 4BNIA 2OGWA 1KC1A 2QGNA 2AN1A 4OHMA 5C1BA 1IY9A 4ENQA 3BA1A 1MV5A 4D2IA 1FMJA 2AB0A 2XAUA 4AVYA 1OXXK 1U0TA 3DBIA 1U31A 3GAAA 1IJBA 1YRYE 3R8FA 4RVOA 4IUCS 3VHXB 4G23A 4ARIA 3TSOA 3PEFA 4XVRA 4Z7JA 5A5GA 1GCIA 1SXJD 2CL0X 3O8NA 1ESNA 2H5LA 4L5JA 1LRLA 1EZ1A 3QVKA 4JEUA 4KO4S 2HJGA 4ZKEA 1PGQA 1E66A 2BDUA 4X1KB 1BGWA 3AUUA 4S1WA 5E7IA 2P9QA 1R6VA 4TS3A 1G9TA 1H93A 1V71A 2IYWA 4N5HX 4K9PA 4BMDA 1Z6ZA 4TV8A 1U8TA 2IEDA 4C7MA 1Y1TA 2JVJA 3Q40A 3K72B 3WADA 4A27A 4BCCA 5J47A 1QOPB 1G59A 4XYBA 4UARA 2PBZA 2FLWA 1XZCA 1Y7HA 1X7YA 3TDNA 3HJBA 4DIKA 2AUMA 1FTYA 4U1RA 2IV2X 4RVUA 5DHTA 4UEJA 5BMVA 4WIAA 3TB6A 3VH4A 4YXWD 1D2AA 3AEKA 4DYDA 3KXLA 1V3QE 5D87A 3GIDA 4EHAA 3UJHA 5IP5A 2FB9A 2O3SA 5JG7A 1VBMA 2CK3A 1QNLA 3JQAB 4LDJA 3I76A 1U3CA 1R5NA 3GLFE 5B1HA 4UPDA 2MR6A 4KWEA 5K0JA 3OIWA 1QGUB 3R3JA 3AJAA 3WWCA 4ZHSA 2GM4A 2ORWA 2QORA 3EG5A 1JEYA 3FI0A 4GZ3A 3RCBA 4KITB 5DNYB 3G59A 5AK6A 2R00A 1NF8A 2Q2WA 6GPBA 5IF9A 4D99A 2R96A 2NSDA 3X1JA 5AD1A 1EQ2A 5LJIA 1CUFA 3W2EA 2PSEA 3AGPA 4UD6A 2DKNA 3KLMX 1TW3A 2QTRA 1I2ZA 2I4NA 4FNMA 2FEOA 3L7DA 2GEVA 4OJQA 4J0HA 1VSTA 4NDZA 5ED0A 5JNUA 1CIJA 2JBAB 5AK5A 5IDYA 1BE1A 4R1OA 5EIFA 4EMBA 1PO7A 4UBMA 1NM5A 2WFLB 2Z2XA 2H1LA 3LVRE 4KVZA 5HMMA 5HKKD 2FWRA 4EVIA 2XZDA 2ILTA 2R7AA 3JYQA 1UBLS 1W0KA 4FFPA 3E9RA 4EG0A 1Z5OA 4JLOA 1KGDA 1U8YA 2QSUA 1PW7A 2VP6A 3RI3A 4QECA 4RCZA 4WERA 3ADCA 4X20A 3HQ4O 4TUYF 4UM5A 2IH4A 5HIAA 3KXKA 4LBZA 4YUYA 3PNPA 3D6FA 1QRDA 2AR7A 3H05A 3FAZA 1W4LA 3HO6A 3NI2A 4G9GA 4LJ8A 3QFSA 3U31A 5CFNA 5AVWA 3FG9A 3W78A 2XVXA 3F3SA 3UHPA 1JEDA 1F51E 1RXUA 2FUG1 4RVDA 2XI4A 2QG6A 1FTNA 2PFGA 3DE1X 1E58A 3HVUA 3OAAD 4M0PA 4WA8A 3SYTA 4WZBE 3PEVA 1ZINA 1G2QA 3MAJA 4MV8A 2VJNA 5CLGA 1GKKA 2GSDA 3B20A 4URFA 5K20A 3SSNA 1FLAA 4U2FA 3IMGA 3O1JC 5FWAA 5EXEA 2D7DA 1AKRA 4UU8A 3SYRA 2OP1A 3OEYA 2RIRA 3N7TA 2Y1DA 3NBMA 4HTFB 2X9VA 2PRYA 3HCWA 4N7BA 2HCBA 1SUCA 1EXVA 2UYQA 4CMCA 4LF5B 1H4VB 2AUTA 4JLSA 1WHTB 4LS3A 4Y0VA 4UBLA 3WLQA 2E55A 3R6LA 1QGZA 4FHCA 2ZVDA 4GM0A 4NEHB 3RYIA 4C43A 2X15A 4X24A 3IOMA 5C8XA 4PICA 3W2IA 1L5NA 5JMWA 1UOEA 5HFJA 5K4GA 3HACA 4OBXA 5FWDA 2JFZA 3BTOA 4BLOA 1M2JA 2A6PA 2XUKA 3KC2A 1T5LA 2ZG6A 3RVNA 2FZGA 3FBTA 4XJSA 3S2IA 5FA6A 5E2IA 1C0EA 1NBAA 1UCFA 4FKZA 4ZOEA 5KYKA 2H00A 1HZZA 2UVPB 1AQJA 3N9IA 4EDFA 1GR0A 2DE0X 2F64A 3NM4A 2HZBA 4DDHA 4H0CA 1ZGGA 1WY7A 3AZQA 1H2FA 3HKBA 4TKUB 4DZTA 4F7DA 2C4UA 2O7RA 1KIFA 4DXDA 2BGKA 3D0RA 1Z29A 1GQFA 3OZBA 4OHPA 5ER9A 2OVFA 3U1TA 4ZO6A 3IAEA 1WMAA 4X00A 2YXPX 1JE1A 1GPLA 1AQ6A 2BEUA 3C1UA 4RSMA 2BTEA 1NRIA 1T0PA 2VTBA 3AVPA 3SC4A 4MOWA 4L74A 1DUIA 4OHXA 1UR5A 2OAP1 3VPAA 2YV1A 1WP9A 5G4KA 1DDOA 3KE8A 3SXUA 4OJNA 1QGED 1IG3A 2QY6A 4C2BA 1T3SA 3C3AA 5EQTA 5IH7A 4X97A 1N3YA 1GPKA 3L8EA 4B2LA 1LVUA 1UMBA 4UMFA 1AS3A 3BHNA 3DVRX 1CQPA 3T8YA 4Y3UA 1NBWB 1V11B 2SNIE 4M3NA 4QPZA 3K9HA 5F2KA 1VL0A 4BFXA 2DLCX 4GYJA 1EYZA 4ND1A 3H1AA 5HR5A 4BJ3A 3UPTA 2R8PA 2QW0X 1HGXA 5ALDA 2BFEA 4GZ6A 3L1IA 5F1PA 4YJDA 4BWFB 4BXOB 1EG7A 1TT5A 3U9LA 3UV7A 1X3SA 3H2GA 3PE4A 4IQ8A 3WLTA 5I8PA 5JJIA 1E4VA 1NTRA 5IJ9A 3PFKA 5I9NA 1B23P 3U19A 1ST3A 5DHAA 2WQ7A 2QMHA 2JGDA 4JX9A 4DC0A 1YKGA 1XCOA 3WHKA 5KVSA 1BX0A 1HLPA 2EQBA 2OV6A 2REQB 1HQYE 3CH4B 3ZTYA 4KN9S 2G6TA 1HFKA 4OQNA 5AUOB 3FUUA 4P7KA 4C4SA 1IPFA 3O0DA 4PLGA 4O4IB 3TQTA 4IINA 3ZDXB 1YJAA 1V5GA 5KTSA 4U7HA 2A5JA 5DGCA 3PEUA 4R51A 4CT0A 5IUJC 2IOHA 1MB3A 3F1LA 3LNTA 4JP5A 4DKJA 4FFVA 2AE2A 4FR0A 1NNEA 2ZJZA 3FSGA 4WY2A 3RWBA 5BR7A 5DBIA 3DMTA 5CDSA 5CLIA 1O7JA 1QGOA 1GTL1 5K7SA 4LHEA 1DEKA 5ECDA 3FYTA 5EXXA 1KYXA 1SUBA 1UADA 3EIEA 4I19A 4IUYA 1ISJA 2HHAA 5H3CA 2CSXA 2FKNA 3D31A 3MJRA 2QB5A 2QVCA 4ALMA 4BZPA 4Y7DA 4X91A 3O31A 2AMJA 4YHBA 2JARA 2CFTA 4AQDA 3AL2A 2BHRA 1TZ2A 1LZLA 3CCCA 5A4IS 1ZVVA 1BW9A 4PFSA 1RW4A 2YXEA 4AWBA 4UDYX 3Q11A 1ODKA 5JYDA 1OT3A 3TNLA 1J5EB 1NLUA 4DE5A 1JMYA 3IAS6 1RRCA 1KFJB 3D3EA 1ZSYA 1FEZA 1A9XB 1W88B 4R68A 4WW0A 3VDXA 4EJ2A 1KL7A 5ILOA 1PSWA 4KNVA 1C14A 4BP9A 1XDBA 2G9RA 3IT3A 3ICVA 1EX7A 2RBEA 4CBVA 3QZUA 4NX2A 3R7SA 1XZKA 3KHKA 5I01A 5LXTB 2EXXA 2PZAA 2CXRA 1R00A 1N25A 3PXDA 1PR4A 3TBKA 1VA4A 4KSCA 3NEYA 1G5TA 1PEYA 1U7ZA 1Y7TA 1LXCA 2EZ8A 2Y1OA 2I6TA 1N8TA 2EKLA 2C7GA 4H7KA 4HY3A 5AKLA 2NUTB 2FR8A 3H5TA 2AQ8A 4I14A 4WESB 5ENDA 3AY3A 3K1AA 1KEEA 1MAVA 2HY7A 5DHRA 1JFFA 4ADSG 3NT4A 2GB4A 2QZSA 3FCEA 3M2PA 5CJJA 5KSPA 3TNJA 3QK7A 3FD8A 4NS1A 4NLLA 4RIGA 2P77A 4MP6A 4MVXA 1HTTA 1SVIA 3QU5A 5FPHA 3IRVA 1JWLA 5KDDA 4GI3A 4PZZA 3SLRA 1SBZA 1NI4B 2H65A 3QUCA 4IIVA 3RIXA 5JEDA 4G37A 5A3QA 4LI0A 5K8JB 4IG4A 1W36C 5AFSA 1QR6A 2CUZA 2WIKA 3NAZA 5KVAA 4X66B 3L7JA 1XFDA 1KK1A 1BCRB 1E94E 4JBYA 1RWPA 5FR2A 3T4EA 4LRUA 4EHJA 5A4DA 2C83A 1UKVY 3EZFA 2AMYA 3DR5A 4AS1A 1YK1A 1TM4E 2QMEA 2Y1LA 2X14A 4FFBB 3CT6A 4RJTA 3ZHXA 3MAGA 1S3GA 1M2OB 4YDHB 4IJMA 3OLQA 4YJKA 2FAXA 1PJSA 4JUAA 4LNUB 2LUOA 1ILEA 1KMHB 4NZYA 4P6VF 4YN3A 1YMUA 2ZYSA 3PUZA 5EMHA 2PS3A 1JB1A 3DCJA 2YJNA 1MQAA 4UUAA 5CCDA 1NBHA 3OPMA 2C2BA 4D45A 3C8DA 1TLTA 1MMFB 3OUZA 5JY6A 1T1IA 2W83A 1U3FA 1I4DD 4Q3NA 4BAZA 3FPHA 4JJEA 4CG1A 3IELA 4TLDA 4R2IA 4NDAA 1OI3A 3BSSA 4R3UC 2V0CA 1CW2B 4OGLA 3V33A 4DCNA 1IHYA 5JMPA 3HBLA 4LAFA 5JATA 4NMXB 4HNVA 3MIIA 5GAJA 1OH8A 2IXTA 4UC0A 2CKDA 2ID9A 4RXTA 4XDHA 2AOTB 1FJGB 3I5YA 5D01A 4PM4A 1U7DA 4IAOA 3C6QA 4YDRA 3E2IA 2XGMA 4YRKA 1NDQA 5LNK6 2AQHA 2M6RA 4YRZA 2FOIA 1E69A 1USKA 1W8IA 1XK6A 1NTOA 2ZU0C 2IEZA 3ER8A 4O59O 3TIGA 3F71A 1GFWA 1WULS 3UJPA 2YV2A 2B6HA 3HRIA 1L4KA 2PV0A 3DB2A 5EJ5A 4KCGA 1ZI8A 2NPOA 5HA5A 4FYVA 2ZYAA 2J0SA 3U26A 1CDZA 5J5AA 4J9UE 4ER6A 1AUOA 2PJDA 2DFNA 3M34A 4NZ9A 3PLAE 1TCUA 1LA2A 4J0GA 4CLOA 3ENZA 3G0IA 5AM0A 1XWFA 1A2QA 2CL7X 2ZDGA 3BRSA 1SC6A 5E1MA 2H1RA 2RKWA 1DX6A 4EA8A 1T4CB 2QSJA 1DKUA 1W5EA 1VIAA 2A5DA 4TXLA 1FBNA 5FLYA 1E7YA 2XE7A 1V1RA 4TPKA 4DLSA 4E4YA 1H22A 2IHYA 3DEAA 2TRSB 1DAHA 3RT1A 3WL3A 3FDZA 2F67A 3BICA 3CLRD 1QK4A 1OI7A 3UMMA 2XKKA 1T0UA 4TZTA 5GV7A 3UCFA 3EWNA 3LV8A 3QKSB 1XI2A 1HDXA 2YDXA 3KZKA 1XJ0A 1KYIA 1NXXA 2ZJ1A 4JENA 5FA8A 5FBZA 3TOVA 4ENUA 1NWHA 4QAJA 3S1AB 3D7SA 4UQLA 4FFNA 1WDTA 4I1VA 1E3MA 2RI1A 3PI7A 1XA0A 1TFUA 2ZIEA 1G41A 3BHIA 3CWCA 3GLHA 4RVHA 2W2TA 4CODB 1MO3A 4ZFNA 2OGUA 3BXFA 3FHLA 3KQHA 1JG4A 1WOYA 4IVNA 1B93A 3NIGB 3VV3A 3MERA 1A77A 1FXSA 2PKYX 4AK9A 3S81A 5ICFA 3QXSA 2DJ5A 3BUSA 5JV5A 2WG1A 5H3HA 1YH3A 1C7QA 5IVIA 4B9EA 5LR6A 1W5AA 5CJ2A 2O2ZA 2XDQB 4F4IA 5DX8A 3X1WA 1YTUA 1L4BA 2IEGA 2PRJA 2OEPA 4M1WA 4BNVA 5JVDF 1UKAA 3C85A 3HU5A 3OCJA 4YPVA 1YFJA 2DUMA 3GYBA 2GVDC 4BMPB 3DULA 5IM4F 1KH2A 3Q7IA 1HNNA 5BQFA 1P7YA 1IBMB 3ENKA 3DM5A 5FQNA 2PV7A 3KR9A 2QQ5A 1MC4A 3QENA 3CUSA 1QRAA 4RPHA 3G7UA 3QSYA 1E77A 4LBVA 3AR3A 5K1ZA 1J24A 5B1DA 5LXTF 4YFYA 1YUNA 3QU2A 2W2PA 4UBJA 3W8FA 3UGTA 2C4HA 4IIBA 3AERB 1PWYE 1MOQA 3F97A 3D8SA 1WVMA 4OFBA 2Y67A 5HZKA 1W4ZA 1SBHA 3RAPR 2BF4A 4NYMR 2FW8A 4ZDIA 2J5KA 1QIKA 2NNWB 3FGNA 3NGLA 2AK3A 1OLXA 4K8RB 2ZUWA 4B48A 2WZCA 3Q1KA 3DBRB 2VDQB 4BP1A 3ZHCA 5IN4A 4EBFA 3C5HA 3GU3A 3IIMA 1X86B 2IS1A 3JTMA 4WZZA 1Q7CA 5EEGA 4CKWA 1NUQA 1O5IA 1OXMA 1ORVA 3OOSA 3ZE1B 3O8OB 4WA7A 1KDYA 2V4ZA 3H5VA 3IUSA 1QCZA 1L5MA 3Q3IA 1AO3A 3RREA 1U28C 2E85A 4ZAVA 3OFKA 3R6GA 1YU6A 4AN1A 1P4RA 5F1YA 3IL2A 4EWLA 1C4WA 2OLJA 4BYGA 3EVBA 5JFTA 2PX5A 2IU4A 1NBOA 1RD4A 1JFLA 2OD9A 2AJTA 1SPBS 2Q3EA 2PMFA 4OB6A 4YMLA 1Y4ZA 2CV1A 8AT1A 3DM9B 1PYDA 2MWMA 1NJ5A 1GG2A 1NW6A 3TI7A 1CCWA 2ZPAA 4WBSA 3BD9A 4B1FA 4M0KA 2O7VA 4Y6PA 3JD1A 4LBWA 4E13A 1QF6A 1WXFA 3OU7A 1JI3A 2ZIXB 4GQAA 3AI3A 2J08A 3H13A 3CHYA 1XZQA 2YWHA 2O57A 2ZIWB 1PQYA 2CJWB 3MQ4A 4KHZA 2Z9CA 5AM2A 2VDLB 1K3TA 1AUVA 2MMCA 3AEQA 4CKEA 2ZIVB 2CHQA 3V3TA 2ZPTX 1ISIA 2I6QA 4CM9A 4UFOA 4DF3A 1VJDA 2G3YA 3UOGA 2G88A 1XJWA 3CZMA 1XCLA 1ULSA 4KN8A 4PX9A 1Z3IX 4F2HA 3DT8A 4Q93A 5K9ZA 2QR3A 3LCVB 2YWEA 2C4MA 5KJ6A 4JKIA 2ZAGA 4GI2A 2AUNA 3TRDA 1XMSA 2NO5A 2WDZA 3K1ZA 3KV3O 2MCFA 3MSXA 1M66A 2FMHA 4ZYXA 1OJLA 2UKDA 1YCGA 4WCFA 3RVOA 2J3MA 2QT1A 1SXJC 1P0MA 4HQNA 3VO2A 2QTZA 3HS3A 1E2UA 3FFBA 4ZVKA 1BCSA 1C0IA 4IG9A 4UHJA 1QZZA 4ZHQB 4KMOA 2XYQA 1AA9A 4MYUA 1QQ7A 1UXKA 3GUVA 3L2OB 4RZQA 3T9EA 3QA9A 1Z2EA 5FB3A 3IAAA 3UA4A 3W6NA 4C2TA 4B3GA 3GQVA 2KJQA 3Q85A 2XUQA 3A6KA 3FRJA 1IVNA 2PWBA 3K0CA 4MSUA 2JLWA 1N6LA 2HZ7A 1GZ4A 3RS5A 3M49A 1C7ZA 1KXZA 1CUHA 3UMJA 4DIEA 4FD2A 5KYUA 4JUDX 4BNHA 2RI6A 4P7BA 1RRFA 5JCPA 3THYA 3LPNA 2WT4A 2B8TA 2WJAA 2I3DA 4J90A 2WB2A 1DC4A 5DASA 4PC1A 1QUFA 3U48A 1JVBA 1VCOA 5DW3A 5K8CA 5H9WA 1UXOA 2QIOA 3ETLA 4EHIA 2AG1A 3IILA 1Q5PA 2QNRA 1K2VN 2VN8A 1J8YF 1GG9A 3OUUA 3SMVA 4JOBA 3N2NA 2PCJA 2Z3VA 5DHPA 3GDWA 1CC1S 2PQMA 4D56A 2PZBA 2ZRIA 3DL2A 3DNFA 4ZTUB 1ZMOA 5IAOA 4DY6A 4OLFA 5EA2A 1QYXA 1TZKA 1F9EA 4I4TB 3G9QA 2JS7A 5KKAA 2PNJA 2E3JA 2JIOA 2H51A 4X6XA 2R5FA 2O59A 3N87A 1GU7A 3STVA 5BV7A 5LP6B 4O2RA 5B64A 2ZCVA 1AMNA 3GHHA 1FU8A 3THWB 2EGGA 2PUJA 1BJKA 4HLCA 1IUOA 1F2TA 6AT1A 3L8YA 4QUJA 5EP3A 2J3LA 1A82A 3K4PA 2C4KA 5ELLA 5REQA 1RC1A 3K2BA 4PO1A 4DLAA 5IK2D 2A86A 4ITUA 4NQZA 5KSYA 1QIEA 3K15A 4Z7OB 4UE2A 2UZ1A 3SNKA 2BPOA 5T8KA 4XEHA 5IYZB 3L0DA 3WA6A 4O08A 1THGA 2B34A 4QPJC 1PDWA 3D2BA 3LQFA 3JQBA 3KV1A 3OEEA 3PYXA 3H3JA 2TECE 1YS1X 3KZMA 1E5DA 3QITA 2PM8A 4I55A 5LQSA 2DP4E 2H7VA 3JASB 1ZOLA 5EWLA 3N2LA 2X5JO 4WUTA 2V4MA 4NRDA 4LJKA 1W30A 3IFSA 4H4DA 5AW0A 1OV4A 3C45A 3VXKA 4F91B 4RV5A 3K5WA 3KQYA 5ILQA 3JD2A 5K3OA 3RVBA 1D2GA 3AEUB 4Q9IA 1FBTA 4MO2A 1WD5A 5TGDA 5HZMA 3S1SA 3GB9A 3EZGA 3ELUA 4D8WA 2H16A 3SDZA 3KTOA 4NYJR 3O9VA 3D4OA 1OB2A 2AEMA 4C4RA 1Y81A 1XMPA 3WNZA 2IK8A 2GFIA 5DNAA 1T6ZA 4POOA 2FWJA 4NENA 4EX7A 3AFHA 1RJFA 1XN1A 3LCMA 5MGBA 4X5OA 3R23A 1BYUA 4TM7A 1V25A 2VHCA 4MYHA 3SFVA 4R1PA 3IKMB 4Z51A 1YF3A 2J3EA 2X9QA 3T41A 3HCEA 3PWKA 1AKVA 1DADA 4YO8A 3ZD9A 4C20A 4GNKA 3I9V6 4MIEA 1GR1A 4M1MA 5AQ1A 4HDNB 4JOQA 2IDMA 1JQ5A 4K6MA 2DPLA 2ZANA 4ENTA 4WRRA 4BKRA 3FPBA 4YMGA 1ZI6A 2G9UA 1I7DA 1W5BA 3AF1A 5EIHA 3Q6IA 4A0SA 1KYQA 2QJTA 4JJ7A 4LXHA 4XRGA 1DG9A 1P6UA 5DNDA 3ICEA 4Y1GA 4D82A 3OUTA 3H3XA 4NU6A 1Q50A 3WGIA 1QYIA 4US1R 1VG9B 1CZNA 1ZLXA 4JOSA 4QVGA 3T5BA 5CGZA 2LKDA 1T36A 3FKSD 2QMQA 4E21A 4J6EA 1L4LA 4S0XA 2ZATA 5C4MA 1KMNA 1R12A 4UCWA 3E5HA 1J9GA 3NKLA 3VOSA 2PZMA 2A14A 1E60A 2QL9A 3OIVA 4QYSA 3TMAA 2BFFB 2BCEA 3B6KA 3X1KA 1S4QA 2Q4EA 5C1OA 2IHKA 4FBMA 5JZVA 2FEMA 2IF2A 4I46A 4IF4A 1LI5A 4AP9A 3RFFA 1ZRSA 3LLVA 4JEMA 2GGSA 4BBAA 4Y2VA 1JTFA 5JAQA 1JP7A 3BMOB 1AHHA 1UOOA 4M99A 1NUSA 4MW1A 5EUBA 4LJ6A 2HF8A 1BE8A 1UBOS 3JZAA 1YMVA 1X7DA 1NXQA 3ESQA 3IVAA 4KUGA 4RLHA 1TRHA 2O6HA 4WJKB 1K92A 5LU9A 1SVKA 4FHFA 1PS0A 2I4IA 4YWJA 4G0NA 4F4UA 1U8AA 1W4CA 3LHDA 3NYQA 4Q4AB 3T35A 5AK3A 2PRSA 4ZT6A 2YC2C 4ZHQF 4ZMBA 1YHYA 3MTQA 5FO0A 1OYVA 4AD8A 1DX9A 1KO8A 1FJHA 1G6OA 1KRHA 2GOYA 4KDFA 4KZPA 2H85A 4RNDB 1L7EA 1RI1A 3OQPA 3ZXSA 4EG3A 4ENVA 2KQUA 5CPBA 4AS2A 4WFJA 4EG5A 4UHFA 2G82A 2J4CA 5TEWA 3ZXXA 2BOVA 3IMKA 2PGIA 2YH2A 3W34A 4AJOA 1DI0A 2J9ZB 1KK2A 2HK6A 3FF1A 4HNRA 1BZYA 5CA1B 3JVEA 4DQUA 4AMBA 4Z3DA 4AT1A 2ATXA 3M5DA 1QYDA 1KSJA 4BX2A 2CUNA 4MGZR 2XZOA 1I7LA 1N7JA 3LQ4A 3PF8A 5AVYA 2TSYB 1GO2A 1QVZA 3A1NA 3ISJA 2QYHA 4H3HB 2JBAA 2H18A 3S2UA 4DMCA 4KXFB 1YRBA 3PFIA 4Z8XA 1VYVA 2P9CA 3O8QB 1YD7A 1K4YA 3GLRA 1TK3A 4WEQA 4B81A 1WSBA 2P5UA 1KKLA 1YDFA 1TKCA 2GZDA 3HO8A 3B51X 3NBQA 1F5SA 3HVRA 1R0YA 2C88A 1C5KA 4RHTA 4C0XA 1E89A 2JGNA 1T8TA 3HHEA 4NCKA 5CB4B 2QUZA 2EFGA 2V6MA 2G7ZA 1JG1A 2QMUA 3A3NA 3IXLA 4JT9A 5H7XA 1PZNA 3ZKWA 1ABFA 1BH2A 1PE0A 2QU8A 3KEOA 3CBQA 3KQPA 1F4LA 3QWAA 2GBLA 1N0HA 4HGNA 2PBFA 4WD3A 5BWBA 5IJ0B 5P21A 4N47A 3SEFA 3P9NA 1B6RA 9LDBA 2P9HA 1WF3A 2JRLA 3COYA 2DTXA 2JLVA 4CCYA 4KREA 3F4KA 3PPVA 4LE1A 2X76A 2BL4A 4JR0A 4XUDA 1DQZA 4ZPXA 3S2ZA 1JDNA 3WAKA 2VP4A 1KI6B 2SKEA 1PDOA 2HYIC 4E14A 3ZK9A 1OX4B 3KPUA 3EC2A 4U3JA 5LKRA 3BK1A 4L5BA 4EOGA 1D6MA 5F1OA 2HFKA 4CLEA 4ZK2A 2FMTA 1P77A 4H59A 3QXJA 4BV3A 1AQLA 1MVLA 1I2BA 1H9CA 3ZW7A 3KKPA 3UKJA 4XYLA 3IULA 1EHIA 1IM8A 1GGHA 2IJGX 1T3TA 2KMLA 3CUWA 1A4XA 3EASA 3REQA 1X13A 5JTTA 4KE6A 1DQPA 1L4FA 3L46A 4RYDA 3JYNA 2GFHA 4DR5B 1SKMA 1SQ6A 3Q0EA 1I4OA 3DDOA 3NOVA 4YONB 1KH3A 4IKEA 5DULA 5IJAA 5ERXA 3RAEC 3RUPA 4BBZA 1WUKS 2XD9A 2HPAA 3I23A 4U5QA 1XN4A 1SUSA 3QSGA 2O2YA 4I50B 1IWBB 2OKCA 4Y6OA 3QBTA 1BJRE 1FP1D 3KQQA 1QBGA 4JVSB 3IC5A 4QX6A 3B3AA 4RANA 2GBFA 1TNDA 3AR4A 3ZU4A 4D96A 1QNFA 3K2EA 3WRYC 1KQPA 1J56A 3MUEA 1TJPB 3G79A 2NO0A 3H5RA 1JHZA 3TQHA 2GEJA 1E4OA 1WSWA 3O0TA 4PRLA 2WPNA 5JNVA 4M0UA 2EG5A 4IIXA 3HFGA 2VPQA 3TL2A 5ARCA 4L15A 3GDGA 2P8JA 2E82A 3ODGA 3C97A 4Y2QA 1IPEA 4IZ6A 4MW9A 4N3NA 1TT7A 2PLWA 4BDTA 5DK6A 1COZA 2JD2A 2G07A 3TXXA 3NDRA 3I2KA 3PNBA 1Q83A 4Y0NA 4ARBA 4BVGA 3RRZA 1NW5A 1JHDA 1Q21A 1XF9A 3FBGA 5EZYA 5FTJA 5P8WA 3ON5A 4TRMA 1XAHA 1FUIA 2NXEA 2YV3A 3A14A 1CDOA 1RTTA 1XQWA 3CTPA 4XIIA 5BQ5A 1K06A 2I7CA 3F9RA 2HSDA 3C3YA 1O4WA 3KVVA 5I5GA 4PIPA 2W4QA 3VVLA 4XWTA 1J39A 5G3ZA 5KNCA 5C81A 2M6SA 4HSGA 2PWAA 3GRPA 3O3NB 1V11A 3REGA 5FD8A 1UZAA 2FPPA 1Q11A 1HDRA 3RAGA 1XQ6A 4YRSA 1Z2PX 2G63A 5JSZB 5LQDA 1AZLA 2PGOA 3GG9A 4YGXB 1CZKA 1KPGA 3ND8A 4BXOA 3BGSA 3MSCA 2INGX 3NXSA 3TUJC 1OBVA 4PZDA 1R4NB 3AF0A 5LDGA 5DP1A 2HUNA 4FZJA 2C5AA 3C6MA 1DIOB 4EDHA 4WLUA 2J87A 3QHPA 4HO1X 2MJLA 3ZQJA 1QLJA 1T2NA 1A9PA 1MB9A 1VLLA 1NJ2A 3R75A 1EUCB 1Z2AA 4KLNA 2Q8QA 4LNAA 3TRKA 1E20A 4EIWA 3CN7A 2Z09A 2O9JA 4L57A 4PYLA 4Q9HA 4BJ5A 3MTIA 1IY0A 2XLCA 4MWBA 1JG7A 1UFRA 2WUFA 1JILA 3FZGA 2O52A 1JLSA 4Y9DA 5TQJA 5CDGA 3T5PA 5EEHA 4PTLA 2F59A 2V7EA 4QOSA 3SQMA 1O9HA 2IOYA 5DGTA 1E0KA 5G0SA 1YR2A 5CA1F 3LSYA 3QWFA 5HE9A 3L1JA 1XYVA 5AKZA 3RU9A 3RUDA 3SQDA 5IS2A 5A0VA 1FFAA 1UMDB 3DDNA 5DCLA 2DFDA 2FDRA 1T1RA 2ZDQA 2IZ1A 2AW3A 1HOTA 4IVPA 1DC3A 1DAFA 3RODA 1F14A 3AOEC 1L5KA 5BN1A 5BURA 1LTKA 2P9ZA 1GGEA 2HXYA 4OMFG 4YX9A 3C8HA 4K0KB 4K88A 4GHWA 1KK3A 1LDNA 1EUDA 4Q9DA 4HGRA 3G6KA 3ABSB 2YZ7A 5EE9A 2AJBA 2WYVA 3BWDD 1V35A 1DT5A 2PJUA 4OQ4A 3N2GB 1E6LA 5KTRA 3MMPA 2LP4Y 4KXQA 3PXAA 1LTQA 1SCUA 3JQPA 1OH7A 4C7JA 1E0DA 2D4HA 1MVNA 3IO3A 1TO2E 5B4VA 2JIBA 3FJYA 3L8MA 4MLDA 4IMJB 2XNDA 3TOSA 2MSNA 4Q24A 1A9XA 1M1XB 3GR6A 1D9XA 2NZ8A 3LDHA 4MW4A 3ANXA 2CVOA 3HVJA 1E6WA 4XLTA 3RRYA 3QF4A 1R6AA 1WAMA 4B17A 4LISA 4CLHA 1GG5A 2NXNA 2QZ4A 3QKRB 2NYVA 3EUEA 4ZGWA 2WQ6A 3MXOA 3V4ZA 4Y2HA 3DJFA 3KPVA 1IY8A 3UXYA 3OZWA 1G3QA 1WCXA 4GWGA 4TTAA 1FNSA 4OCZA 1KC3A 1R7RA 4FBGA 3T7RA 4EVRA 3G49A 1C1DA 1LUAA 3FW1A 3HUEA 4EELA 1SHKA 1L3CA 2A0XA 2IS4A 1SKUA 2G72A 4DBLE 2JGRA 1Y1KE 2IV7A 3GLHE 4Z0TA 1FFCA 1N9KA 2RHCA 2WVHA 4M88A 5DYNA 4DCJA 5AT1A 3ZHBA 3U44A 2PUBA 3D6HA 1DJLA 3Q3CA 7GPBA 2ECKA 1B2RA 2NNLD 3PG5A 2I9KA 2Q5IA 2XYPA 2GCOA 5BSFA 4KDRA 1FXWF 5A05A 5CEJA 1ABEA 1M9NA 1L3IA 1PV1A 2PGDA 1Q3HA 3DLAA 3HCRA 3PXBA 4NU8X 3RV3A 4DA6A 4H15A 5C7IO 3TYXA 3U3RA 1CRLA 1NRXA 4I50F 4YJGA 4BTEA 5KOJB 3E61A 5BT8A 2A5LA 5EE3A 3DHVA 3QQPA 2Z56A 2BCGY 4O4LA 4REMA 5HRCA 1H5NA 1M2OA 2CZGA 1J2UA 3CLTD 3HUUA 4Y2SA 1FLVA 4S1TA 5FI5A 4Q9LA 4BLUA 4XUEA 3ESBA 1XL0A 5T3UA 1EFTA 3I34X 3DL7A 3O6VA 4GVXA 1UFKA 3OCCA 1PK7A 4ZREA 3UMSA 4PYKA 4NFLA 1P1JA 4OF4A 2ZSHA 5JO0A 2R66A 4ZT3A 4B31A 1MAHA 5EKTA 4AY5A 5C5EA 3HB1A 4JI2B 4YQZA 4ID9A 3SZRA 1F3OA 2NAPA 3OPXA 2ACVA 3QYPA 2IS2A 3S2SA 1XFAA 4CMHA 3R09A 1DMSA 1X9GA 5CTAA 2ZOSA 3FF4A 5DYWA 3RSQA 3VOAA 2AN9A 4L8FA 2ZI7A 1QE0A 1XTVA 2J3KA 1Z8FA 3HUDA 1FNDA 2GM3A 5HM8A 3SQXA 1B6TA 2DBQA 4TYWA 4D9KA 5C46F 1Y5RA 4EI7A 1Q1ZA 4MYSA 1FUEA 5EVCA 4GQBA 1NVUQ 4LHZA 3DMRA 3MJ4A 3BMCB 2ZTHA 3ZWWA 2E49A 3RFUA 4N8SA 1C7JA 3EZ2A 4RPLA 4B45A 1DQYA 6CHYA 3BIWA 3B38A 3P0JA 3PF9A 3HCCA 3OE7D 3TW8A 3NHRA 4IDGA 4Y6GB 4B35A 2B3DA 5KHOC 3EXHB 1Q77A 1PS9A 2FF5A 5BWNA 1XDUA 3L40A 2HHCA 3CF2A 1Y9EA 2XRZA 4M8IA 4KLZA 1Z17A 5FLEX 5IKXA 3LYHA 5TNXA 1YJXA 3RR2A 5EJMA 2OESA 4D42A 1V8DA 4Q66C 2JA2A 4OU4A 3NHWA 3QY9A 2QZZA 4R1LA 2GZAA 2FUKA 2LWIA 4GO1A 3I2IA 1H85A 2LXNA 5CM8B 1JGTA 2ECQA 3ECSA 4LPSA 3HRKA 1WKVA 3I32A 5BV1A 4UREA 3UG6A 4AXBA 4RFVA 4Z0HO 5KSOA 4NOMA 3QELB 1FPQA 1T4CA 4M21A 5FT9A 2PWPA 2G80A 3EW9A 2WIGA 3ESZA 4MPRA 4DNQA 3ZGZA 5JDIA 3PWZA 3TD2A 2P3SA 2WT8A 4WNAB 2XQFA 5ESRA 3SJZA 1FE8A 3PHIA 2PH5A 1MAAA 1FYEA 1QZXA 2HI0A 2OV4A 3OMXA 2AT1A 5DN6A 5L7YA 3TOZA 8GPBA 4TYNA 1XVTA 3TTWA 3GA5A 3QPVA 4MPTA 3S1AA 1IOVA 3D2AA 4COKA 3C3JA 1IN7A 1SQGA 3GBVA 4KRXA 4YASA 3B36A 3PXGA 3ZQ6A 1FDOA 5KNBA 4D0LB 2ZAMA 3FNGA 1WZIA 3UATA 2QPLA 5A6SA 1Y4DE 2F1OA 4RXUA 1NLFA 2F90A 4TOIA 5ALUA 3REOA 2VC2B 4JAVC 2X19A 3JVVA 3AKYA 1I5RA 1OWNA 3WK7A 1VLMA 2YIJA 2OXFA 1XJCA 3CLUD 3PC7A 3FN4A 4X1YB 2HFJA 4MS4B 1ISSA 2H4YA 2C9BA 4ISCA 1SU8A 13PKA 5B6PA 3A7EA 1Q0TA 1JEAA 3CRW1 4J0KA 4DDTA 1E1CA 2XQIA 3VR5H 3IHKA 3WYNA 1H5UA 1VRWA 3EYWA 3HEMA 1N32B 3GFFA 5LWQA 1EX6A 2GEKA 1AF7A 1Z68A 2RGXA 4I4NA 3GXOA 2EJUA 2AA3A 4HS4A 4WDQA 3EIFA 4XPIA 5EQFA 5BRNA 1QU3A 5KJFA 2VJYA 2QTMA 4TV9A 1BVRA 4YFVA 2JC3A 1E7QA 1EI9A 1TUBB 2HCRA 4OQLA 4U2GA 5DNVA 2PRZA 2WJ6A 4I9UA 4R8LA 3T3NA 2I4OA 5K3FA 1HKHA 3HY3A 2GXQA 4J1TA 1RZUA 3FOCA 4KFUA 4QOEA 4DBZA 5JNSA 3ENWA 4LRTB 4EGFA 3NIDB 4I5FA 1IZ8A 5C8VA 1BDHA 2CWDA 3K4HA 4RGBA 5E4TA 1Q15A 3C3MA 5L6MB 4J16C 2F8MA 5U4XA 1NAIA 2WSMA 4BMCA 1G0OA 2HV9A 2RGBA 3PGVA 1JR3D 4UHDA 4WADA 3MIZA 2YMQA 1E3IA 2M98A 3OZ7A 4EQ6A 4P7GA 1NVDA 2IODA 4RK5A 1L5LA 3W04A 2QLNA 4EW2A 5JH7B 3S3TA 1OHHA 4M0DA 4YROA 1XPJA 3DP7A 1RE0A 3FIUA 4NE2A 2I2WA 2QE6A 1C30B 1CB0A 1K8QA 4OYYA 2WTNA 3B1VA 4WGFA 4YGYA 5HF6A 3LLMA 3Q2KA 4QGHA 5CDFA 3H2SA 4HAZA 5BNFA 4S2EA 2O7QA 2WF5A 3CW8X 3LUGA 3ORHA 4NE9A 2Q27A 1JSXA 1ZS9A 3HXTA 3H87A 2JFBA 3KBOA 3KQOA 4X8HA 4C0SA 3UNXA 4Z4CA 4JDPA 3M4YA 4AG3A 1ECCA 4RMGA 2Y68A 5F64A 4RTSA 5EWJA 2OCKA 1Y9ZA 2A57A 2VJAA 2ZIXA 3FYHA 4LQCA 2VAPA 2NO4A 1VIMA 2I99A 1DTWA 3QMPA 3F7OA 2QTGA 1X38A 2ZBGA 3GRZA 5G0WA 5HFAA 1W5FA 3E27A 3D4LA 1AZWA 2Y4OA 4HGQA 4JQYA 4CL3A 4KGXA 4PSKA 4P0QB 3H8SA 1IONA 1NR5A 1ORRA 5JNTA 4BCDA 1UEXC 4ZCSA 2G40A 1QAQA 3IOYA 3WK8A 1UXHA 1XEWY 1P9NA 2EBHX 4Q6BA 5JXWA 1Z26A 1DO0A 4QWWA 1TMYA 1SELA 2MR5A 3D6VA 3IBGA 4WI1A 3C98A 2PU7A 3A4MA 2AC2A 1GL7A 2CHFA 3MGAA 1EU1A 4UEQA 2GDZA 1PL6A 2Z8YM 1Y34E 1IHUA 2ZTMA 5E38A 4V1CB 3T1YB 1W581 2Q6TA 3ESAA 1L6RA 1BKSB 2NPIA 1EZZA 4NECA 1A97A 4M6WB 3C6YA 2IYEA 5DBOA 2BEKA 1NW3A 4OYHA 1N2HA 1WXWA 4Q3OA 3RF7A 3KAJA 1DAKA 2P2YA 4I81A 4M0CA 4B80A 3PRYA 1OA0A 2XRYA 4ND8A 4E03A 3O38A 4IHAA 3OZRA 4V0NA 1Q2UA 1HE1C 2BGWA 1M8FA 3LPCA 5AW8A 4NSNA 2I4MA 1UM9A 2PVSA 2ZETA 1X9IA 2O2CA 4G26A 5AOVA 2OE2A 3I37X 5KYNA 1M54A 2FPMA 2GARA 5EFOA 2V3VA 5FOQA 5J2TB 5M3BA 2B30A 4EITA 4HUQB 5EUMA 2CNWA 2ZSFA 3CX6A 3FHOA 3FVTA 2OQ2A 4P92A 3ZDBA 1C9JA 2C2XA 3K1JA 3PHCA 1ZXBA 1WX1A 2BUBA 1YRAA 2IL1A 3N3BC 1DUSA 2R6HA 5D5HA 2NU9B 4BKQA 4JU8A 4DYHA 3H11B 4CKCB 4C6HA 2YVAA 4XVUA 4G0YA 1RU3A 3QI2A 5TQ2A 1QX3A 2YY5A 3UFXA 4QUKA 2RDMA 1H05A 1TIBA 3GJXC 4G2NA 3ES9A 4I4TA 3H1EA 1T9CA 3LUFA 1EHYA 2HRZA 2ZRBA 4LW8A 1P1KA 2WHXA 4AXXA 3UV3A 3EGXA 4HBGA 3UJBA 1KYWA 1ECGA 2VBFA 1HLFA 4EG8A 3THWA 2EDAA 2H2GA 4LVNA 3HU3A 4Q3BA 1KY3A 4ER3A 7YASA 4GGPA 4UHEA 5KHLB 4PNHA 3EEFA 3HKEA 2BR3A 1Z8NA 3LGSA 3NR2A 3VKWA 3UPDA 4J2TA 2XCUA 5IEBA 5IYZA 1NURA 4A8JC 2VNKA 5DCWA 4Y30A 4KPEC 1K1EA 2ZAIA 4AZSA 2BGNA 3HBMA 3OSZA 2PKRA 5J4HA 2VHZA 2OECA 3EUFA 2R9VA 3GJSA 4P35A 3F7TA 1R27A 1NIPA 1TKBA 2HBZA 2XTJA 5HTKA 4NPHA 1A04A 1EA7A 3VO1A 3JR3A 3D6TB 5IARA 1BVUA 3LP8A 5FFMA 3L8DA 1WXEA 2VT6A 2YYZA 1E2GA 1GNQA 1G63A 2WYHA 4RC9A 4TWZA 1OAOC 5TMDA 3T4XA 4AJPA 1RQLA 4BU1A 1WQ3A 1UBFA 2PANA 3GBSA 1E2QA 1ZPDA 3I28A 4ITVA 3HDQA 5JAZA 2VSXA 2CDNA 3CT4A 4NZNA 5IU6A 2Q50A 4DUPA 3GLGB 1XDDA 1BDMA 2WSBA 3MRSA 3RT7A 1PV4A 5LP6C 2Q21A 3HJTA 3KU4A 3LA8A 3F3YA 4U5XA 4CCWA 3L4KA 1KSGA 3CJQA 4C0QC 4X8OA 1LNZA 4FZRA 3T7KA 1WW3A 1FA9A 3DTYA 3KJGA 3D8TA 2HBYA 4MGYR 3H5OA 1Z4QA 4IHKA 1K86A 2G0AA 4BNMA 2BM8A 2PO7A 3IYLW 4C0WA 2AFRA 2P90A 2ZUSA 5JH7F 1GRRA 2HK7A 2P5TB 2CNLA 4M9XA 3DKVA 2ZS9A 3AO0B 4AQYB 1V8PA 2Y05A 3A4TA 1WF6A 4MQMA 5T41A 5MN4A 2QSZA 2ZRQA 1KKMA 5TGTA 4QEDA 1ZZEA 2W70A 3B1FA 1CX9B 4C1NA 3QLVA 5JANA 4WKOA 5DLQC 5BYKA 1MR3F 2K7ZA 4G4SP 4M1EA 1U0LA 5EJGA 3RNLA 4DIBA 3FLMA 2J6BA 2FI1A 2FWBA 2HBRA 2OV8A 5TF4A 3BHMA 3FE2A 3N8HA 3GFOA 3NV9A 4KPUA 1AHNA 1G6KA 2QK4A 5ECGC 2Z98A 4BVAA 2MU1A 5I7FA 1I3CA 1XXHB 3B7WA 3USCS 5KNDA 3BGVA 1NQXA 2GASA 3AIIA 4BZQA 1FDTA 3DA8A 3TFOA 3P0EA 4D26A 1OMOA 2JLRA 2G6BA 4G8JA 4A92A 4RPJA 5YASA 4F38A 3TSWA 3R0JA 5L45A 2GLTA 4PZ9A 3II6X 9MHTA 3LNCA 1L7XA 4UPEA 4H6WA 4OG2A 4EKYA 2GESA 1SG0A 1N2CA 3GIWA 3LT2A 4HDKB 5A5FA 4W5TA 1MW8X 2NT4A 3BMOA 5EXDA 2NACA 1PFVA 4JLUA 4BQPA 2QTFA 4OO3A 4BB0A 3UWSA 1P3Y1 2AFIA 4PAMA 4LGMA 3HFJA 2WG0A 1L7AA 1T2UA 4FEAA 4N03A 4DLLA 4WXEA 3KKEA 5BOSB 2QRJA 4HUJA 3TD9A 3BWVA 4Q4AA 5HEKA 5T6BA 3L6BA 1KRXA 4RIFA 3FPSA 3K53A 5E0KB 1VA5A 4PCUA 1U0BB 1PX2A 1N92A 1PAUA 1YGPA 1QH9A 2PT7A 3G85A 3JWPA 3M7IA 1GJRA 4I6GA 5JSQA 2GLXA 1ZK1A 1SHZA 3CXRA 4F72A 1B14A 1UXIA 1E9RA 1G3MA 3C4VA 4F9TA 4ABTA 4BRWA 1ODSA 4K9LA 3UOWA 5DBGA 3O8BA 4QG7A 2G70A 5E6SB 3DDUA 4W9NA 4JJFA 2WVAA 4KU4A 5AI9A 5K2OA 3NNDA 4CJXA 2WWYA 2J7PA 4JA0A 1YVEI 1Z0ZA 4OY3A 5K6AA 2AZMA 1YC5A 2YV5A 2HMAA 2FRDA 4MKGA 1U2TA 1Z33A 2CCGA 3L05A 4A9AA 3ZCQA 4GH5A 2BFBB 1H4SA 1FB5A 4BV8A 3U61B 4FUTA 1HTBA 4HAIA 2N0SA 2JGEA 3O26A 5GIOE 3A2LA 3NEJA 4FWIB 4EEKA 3SKVA 1DQNA 4NCNA 2EQAA 1A76A 3KOYA 1DAEA 3VNQA 4H1VA 4GWLA 1X15A 3VVCA 1HQDA 3LT4A 3KR0A 4CMGA 2YWDA 4DWVA 1EM8B 1U63A 4B0OA 4DW8A 1R18A 4YJFA 1SXQA 1NRJB 3A28A 3FKQA 4RVFA 3DLTA 1K7FB 1QQTA 4YP9A 5DIZA 1PUJA 3MWKA 3BXHA 4OI1A 2OXTA 1ZWKA 3D4PA 4G1MB 2OR3A 2YZGA 2ASEA 1LC0A 3HZRA 1N7GA 1RRMA 1T1GA 1UT8A 3LY9A 3PD7A 1YVRA 1YFLA 3ZX5A 3WLMA 1JFRA 2AXQA 2QTVB 2IIQA 4MWOA 2GDJA 4PGMA 2H2HA 3O75A 2C4TA 2FX5A 5AHRA 1YZTA 4ZVOA 2IHVA 3C3XA 3FXAA 1ODLA 1U3TA 1QB7A 5WRFA 3ECAA 4H16A 4I8XA 3FX2A 3W5SA 3NCTA 4Z9XA 3B2EA 2ZWVA 1G6Q1 1RAHA 1FC0A 1Y5LA 4DEVA 2H5JA 1ICIA 2BI7A 1IJEA 4FKMA 4KACA 4QLAA 1L5QA 1SZDA 3EMVA 2XTNA 5TX7A 1ZD8A 3TRHA 4A82A 3SS9X 3I5UA 4UQOA 2HSZA 2GR9A 2ZRCA 4KH0A 5KTTA 3MF4A 4LHYA 4C5CA 4RTLA 4IH1A 5BV2P 4EB0A 4S1OA 1T5HX 2GH1A 3CO0S 4R81A 1GUAA 4QQFA 4M1YA 3TTXA 2PRKA 1IY1A 1GL3A 3OQMA 2PU5A 5G1PA 1T2VA 3HE3A 5DOZA 5ALMA 4FZVA 1X80A 3R0XA 4RPIA 2FPWA 4QXAA 4R4JA 2B3TA 1EKXA 4KVGA 3UC9A 3U2QA 1CEXA 4REQA 4DLWA 2DH5A 3AF2A 5CIQA 3U09A 1H2HA 2KYRA 2XQKA 3A0UA 3KKKA 3O9ZA 5JPDA 4C4YA 1OTXA 3DEJA 4X85A 3T94A 3CTMA 2CW5A 3ZTTA 1QHHA 2V7TA 3JQDA 4PPGA 2C92A 1PR6A 5JROA 2AI1A 4FP9A 3PLRA 4M36A 4YO7A 3PC6A 1TPZA 4TYMA 1RWMA 4Y6SA 1MVOA 1VXRA 1DXQA 4Q3AA 4YJHB 3TCKA 4EK9A 2QN6A 1JR6A 1DXOA 1O97D 5HIMA 3FNRA 4KW7A 2WW8A 4AZWA 2E4YA 3CRNA 4DA0A 2YMLA 4DHWA 1EDBA 5I8ZA 3T0FA 4P0PB 3IEPA 3V46A 1C29B 4AX4A 5K8UA 1NC1A 3MFQA 3CR8A 2C31A 3GFRA 3O8LA 1YRQA 3CRZA 4RQBA 2OZPA 5I5EA 3GGPA 3K1TA 3NIBA 3N0RA 3GCWA 4R5HA 5IG2A 1J6UA 5ER6A 5BWMA 2WU0A 3DD1A 2Z9DA 4UOZA 3G1WA 4XIJA 2CF6A 4Q34A 4Y2PA 1DAPA 3GJRA 3SBOA 5JY1A 2QGFA 1KNQA 1SULA 5JCZA 5KI6A 4B7CA 5F5XA 1OYWA 3GVPA 1AXGA 1LV8A 4IMRA 3EOAI 3HKDA 3SBEA 3M0EA 4EZBA 4MVWA 1ECFA 1TYCA 4Q6WA 3OICA 3NWOA 3VU1A 1F8FA 3WK6A 1YA8A 2DQ4A 5INTA 4AI6A 3WWOA 4CMIA 3PQDA 2OC9A 4H77A 4KBFA 1XZGA 3CKMA 2PS0A 5LUBA 4AYXA 2XOEA 5EMJA 2AWNA 2OGSA 1JKJB 3ZHZA 2B1GA 1R0SA 4L9SA 2IUTA 1PGNA 4GEGA 2HW8A 1QQ5A 5ALEA 2BEVB 1XNRB 1CDDA 1Z25A 1LB1B 2GN6A 3CC8A 4M8NE 5DX0A 3H9JA 5FOUA 1GZ5A 1LLDA 3RJTA 1Y3CE 4H4EA 1XPOA 3H6GA 2HIGA 2ONZA 2ZWIA 2NPFA 1KI2A 2KSQA 2MSLA 2FPKA 3OKFA 5FWXB 3F7NA 2H0AA 4G5XA 4BFZA 2CLOB 2P3LA 4E08A 4X62B 4Y9UA 1CT9A 1SIUA 3FMIA 4DCPA <