1FUEA

Flavodoxin from helicobacter pylori
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
GKIGIFFGTDSGNAEAIAEKISKAIGNAEVVDVAKASKEQFNGFTKVILVAPTAGAGDLQTDWEDFLGTLEASDFANKTIGLVGLGDQDTYSETFAEGIFHIYEKAKAGKVVGQTSTDGYHFAASKAVEGGKFVGLVIDEDNQDDLTDERIAKWVEQVRGSFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Crystal structure of oxidized flavodoxin, an essential protein in Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Electron transport
total genus 52
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fueA00
2BMVA 5JROA 4QOEA 5NLLA 2WC1A 3NFRA 2Q62A 1YRHA 4ESEA 5F12A 3RPEA 3KAPA 1QRDA 4YALA 4YAUA 3N3AC 2M6RA 2QX9A 4DIKA 5B3LA 3SVLA 1H66A 4C0WA 2KQUA 2D5IA 1KBOA 2FVXA 3QFRA 3N39C 4YAWA 2X2OA 5B3KA 3KAQA 1X77A 4OXXA 1FLNA 2GSWA 1YDGA 1AMOA 3EYWA 2MTBA 4QOFA 1ZX1A 3FX2A 4N82A 3D7NA 1QBGA 2XODA 4C76A 3FJOA 3OX1A 2V9CA 1SG0A 4H2DA 4R81A 4DY4A 1AG9A 2R97A 2KLBA 2FAXA 2OHIA 1ZWKA 3TZBA 4C14A 5TGZA 3OJXA 1AKVA 4M0CA 1BU5A 2ZKIA 3W7AA 2M6SA 3GAMA 2FDXA 2R96A 1J9EA 1AKQA 1I1OA 2V5UA 4C0XA 4QOJA 1T5BA 3FW1A 4ZVNA 4PTZA 1TIKA 3OJWA 2QMZA 3TE7A 1CZOA 1JA0A 3QFCA 3OX3A 1E5DA 4QOHA 3HLYA 4Y9UA 5LLDA 3F90A 2QMYA 4LAFA 5F4BA 6NULA 3B6MA 2FLVA 1XYVA 2V5VA 3NHWA 1FX1A 3G5MA 1DXOA 1FUEA 1FLDA 1YCGA 2Z9DA 1AZLA 1H69A 1VMEA 2MWMA 2QR2A 4PTYA 4XDGA 1RLJA 2AMJA 2B3DA 1J8QA 4N65A 2FCRA 3FNIA 1RCFA 2W5UA 3B6KA 1WSWA 1KBQA 5LBTA 2OYSA 4D02A 3ESYA 3W79A 1CZUA 1J9ZA 5EMNA 4YQEA 3NHKA 2BPOA 3P0RA 2BN4A 2FOXA 1JA1A 1F4PA 4GR9A 3F6SA 2X2PA 4ICIA 1GG5A 2Z98A 4HS4A 5LMCA 4S24A 2QX8A 4GQIA 1RLIA 1QHEA 2QWXA 2N1MA 2FZ5A 3HA2A 5FUQA 1NNI1 1RTTA 2OHHA 1D04A 1XI2A 4J8PA 3U7RA 1FVXA 3JSXA 3K20A 1YCFA 2BF4A 3U7IA 4QOGA 4CF6A 4FX2A 1YCHA 4LTMA 3OWXA 3ESXA 3GFRA 2HPVA 3K1YA 5LBUA 4ZVMA 3OX2A 1XT6A 4BMPB 1WSBA 4YAFA 1QR2A 5NULA 3GFSA 3NHYA 3L9XA 1V4BA 4PU0A 1OFVA 3S2YA 1J9GA 1AKRA 2OHJA 5ULLA 4QODA 5BUCA 2MOKA 4QOIA 1XYYA 1TLLA 1CZLA 4Y9RA 2HNBA 5LJIA 4CETA 4NULA 2ARKA 3N3BC 1D03A 4GI5A 1DX9A 1SQSA 3OVMA 2MT9A 3UXHA 3NHFA 4XDHA 3ZHOA 3F2VA 4U7FA 4YAOA 2QX4A 3KEGA 1AHNA 3O73A 3GFQA 1FLVA 1DXQA 1OBOA 4N9QA 1BVYF 4Y7CA 2FX2A 5LVAA 1CZKA 1YKGA 3NHLA 3NHJA 3NLLA 1C7EA 1ZWLA 2Z9BA 3LT5A 1AKUA 1B1CA 3LCMA 3ES9A 1YOBA 3HR4A 4LA4A 3QE2A 2RG1A 4FGJA 5A4KA 5EA2A 4DILA 1D4AA 4ZVLA 4LTNA 2Z9CA 3UXEA 4H6PA 2XOEA 1AKWA 3KLBA 1AKTA 4LTDA 1CZNA 3B6IA 3FVWA 3L9WA 2Q9UA 2HNAA 1C7FA 5F51A 4NLLA 4BMOB 1FTGA 3W78A 1OBVA 3W77A 5FX2A 1CZRA 3TEMA 4F8YA 3NHRA 3O2NA 5FA6A 4U7HA 3ESZA 3NHPA 2QX6A 3NHUA 1T0IA 4U7GA 5LJLA 3NHSA 2BZSA 4FGKA 2FZVA 3EDOA 3R6WA 4HEQA 4ZVKA 1FLAA 3F6RA 4FGLA 2A5LA 2F1OA 3OWHA 5EAIA 3B6JA 1CZHA
chains in the Genus database with same CATH superfamily
3IUYA 2O3RA 2PZMA 3PHHA 2RKWA 5KJFA 4X62B 3ZOZA 3E3MA 4D26A 3KOMA 3EGCA 4YJGA 3E6AA 3FFTA 5F5XA 4OQQA 1TM4E 2AZDA 2HLHA 3KJQA 4U7WA 1GLNA 4MW2A 3DW3X 1E2BA 2R7KA 3ZDZB 3L0YA 2R5FA 3SEAA 1YAJA 2EKLA 5KNBD 1HSOA 4QUIA 1FSPA 2GLTA 1SUEA 3KUKA 4OQEA 1MXHA 1K5PA 1H2BA 1W4RA 1JYFA 3OZWA 3SDSA 2X8JB 2G82A 3RI3A 2F43A 4DQDA 2ENUA 1BJRE 3BFXA 1V26A 2M6RA 1JHVA 1O95A 3IDFA 5LBUA 1JFFB 4XLTA 4H1UA 1SG9A 5HEKA 4E2FA 1WOMA 3E1KA 3RH0A 3T7DA 4JA2A 3DV9A 2EFHB 3LUBA 4WCVA 5EJGA 1MJFA 3FI9A 2LDBA 3OOSA 2GZDA 3BGWA 3C7TA 3ECSA 1MN6A 1VLLA 3ZWYA 3MIZA 2W6MA 4GW3A 3B52X 2NQ2C 2QRKA 4CQLA 3K16A 4D3SA 4FPXA 3ANLA 4IUDS 2UVDA 4I2VA 5L3SB 4BQEA 3B3JA 2RKOA 3IVCA 3PYXA 2UUCB 1SKYB 3OM9A 5CUQA 3QFHA 4PC6A 3WV4A 1WD5A 2PMFA 2GX6A 4M0EA 4YRPA 4G1FA 4ZI5A 4CLXA 2CXXA 2X41A 3E7XA 3KPVA 3LRXA 3O3NB 2BD0A 3RU3A 4B3DA 2JATA 3AVVA 3II6X 3O93A 3QE0A 4N82A 5BOSA 3KZKA 4K1LA 5CH8A 4DV7B 1K4KA 3PC7A 1DAOA 1H65A 2PZBA 5L3QB 5KWSA 1DAEA 2NYAA 3D7MA 2H7CA 3OPXA 2PGNA 3QWIA 5I8ZA 4L4UA 4B3GA 3F47A 1DQSA 1G8AA 3VPDA 2A30A 1LVHA 1TFRA 3DL7A 4Q1BA 4KR7A 1F2UB 1Z7EA 1T4DA 1U81A 3KYJB 3SJ7A 4UFPA 4HBGA 3IH5A 2RAVA 1MP0A 2X6QA 2CXPA 1SQ0A 2EQAA 2W93A 3DC2A 2EEPA 1ZUD1 3N2NA 5FQNA 2R47A 3ZWNA 1FZQA 4M9UA 3U7QA 3WGUA 3FH0A 3NWJA 1I2CA 4X92A 5FL3A 2GCIA 4OQZA 5AJUA 3ODPA 3QV1A 3OFND 1GQYA 3FROA 2XI4A 4DB2A 1COZA 4TT8A 4A3SA 2FRDC 1IJBA 4HJXA 1MJNA 3TQTA 4EYQA 1FOEB 2ZATA 3WGGA 3OQIB 1A1SA 5ALPA 5KNDD 4BJHB 4I8IA 3AR9A 3P2MA 3LKDA 1PS0A 1X70A 5KNCD 1J25A 3FCOA 5TS3A 1GDTA 4F0JA 1RZRA 3NDBB 1DS6A 1DX4A 1ZJZA 3ILVA 4IEEA 3TK1A 2FW8A 4LJ9A 5K0JA 4ZQCB 2H92A 1XL1A 3GDHA 4NCXA 1NHWA 4B85A 3K2EA 4IJKA 4U8HA 1UPAA 1H5NA 3MUEA 4DN6A 4F46A 5HK9A 5C5CA 3ZCUA 3R9WA 4DV6B 4XZ3A 2DJIA 1BXZA 1K8XB 4ZAYA 3TLXA 3EBOA 4R2HA 4EZEA 3WGLA 2ZI7A 3HDYA 1SULA 4UHDA 1A5BB 2QMZA 3E5NA 4P82A 3SXPA 2O5RA 1DJLA 3TE7A 1A1VA 3MS4A 1NLFA 4GOLD 3LL7A 5JTTA 4LSWA 4BNIA 4UMDA 4JVOA 3KD2A 5JMOA 2IYAA 2VA9A 3PKIA 5BXQC 5E4FA 3EZFA 3IP8A 1G1AA 5ICSA 1OVGA 2Z2ZA 3DZJA 3SQLA 5HRCA 4TL7A 1GGJA 1VHJA 4GNRA 4DQLA 4S0ZA 4PLPA 3AEXA 5CCXA 4UBNA 4DA8A 1BKSB 3GJTA 3SOPA 4HMQA 1JLMA 4PF1A 3A1NA 1GKIA 1E96A 1KDRA 2EFCB 2FZLA 3AUFA 3E9CA 3PNQA 3EEYA 5C5EA 2VAMA 3L0BA 2CMHA 1PDVA 2DPXA 1Z83A 2I80A 1ZH2A 2V7PA 4X6LA 4DE5A 1ADFA 1D2MA 2X3YA 4J0FA 4NONA 1SA0A 5EYPB 4LF6B 1P7WA 5KSOA 3BFPA 5BV8A 2HYIC 4RF5A 4ZHSA 4CG3A 2YIDA 5DEIA 3R0IA 1KC3A 4RE5A 4X84A 4MRVA 3HXMA 5LQMA 1IQ0A 4Y1GA 1PEYA 5FUXA 3MQ2A 1A76A 2GHTA 1V2HE 1ZM9A 3WL4A 3GMIA 2PT5A 4LY3A 4GOKA 3F8TA 3CUYA 4IXTA 3LGAA 2WSSD 5EP3A 1CUAA 1H05A 4HVTA 4Q1AA 2W42A 1F8FA 2BZ1A 1XJ5A 3CV3A 3E5HA 3JQ6A 3KLNA 3KU1A 4QBFA 1E1CB 3WFIA 4M8SA 2BFCA 3SJCA 5D01A 1LPSA 1OBCA 3JTEA 2HSDA 5JSUA 4B83A 5JH7F 1YJCA 1RABA 1I2ZA 2I6TA 1CUEA 3WC4A 1V5GA 3FOCA 3K09A 4X65B 3IO5A 1E7QA 2II6A 5IAEA 3W2HA 3ANMA 2P77A 3SEFA 3X1MA 5BV1A 1TKBA 3EC7A 1M8PA 3QOXA 4L51A 4LDNA 1Q57A 3ZOKA 3I3SR 3G89A 2NO4A 4PW0A 2KHZA 4BFZA 3VTKA 3X44A 3WLRA 4EUKA 1WE2A 1G21A 2X3FA 1JHPA 5FL7D 2F3QA 4X1IB 1JI0A 1H22A 4JYAB 1R3UA 1MFZA 2ZUSA 3ZH2A 2DBQA 1U8UA 1YR1A 3W6UA 3H3FA 4RY8A 4PGAA 1OB2A 1NFFA 2AG8A 2BN4A 1H9AA 4EGJA 4PSAA 3M4XA 1JA1A 2GZ3A 2VHVA 4J1QA 4L22A 1NQAO 4UU8A 2OQVA 3DDHA 2UZ0A 3JQCA 3WMWA 1RLIA 3IEIA 5ERYA 1FP4B 1ZSYA 4F60A 4DSNA 3GDGA 1Q7CA 4B74A 1XZPA 2YIVX 1GWNA 2CD7A 1XCBA 2H2HA 2PZFA 1WW8A 3L79A 4NKRA 4G23A 4PZUA 2VPPA 1Q16A 4LJLA 4MITA 1GYPA 2O50A 4L5YA 1DKUA 2GVDC 4S0XA 4TXLA 3TZLA 2XX3A 3FSRA 4NF2A 1MW8X 3C3WA 5F78A 1OREA 1PHPA 3HCNA 2ZRJA 1CY6A 3PFBA 1ZQ1A 4YONB 1JIIA 3M7IA 2R751 3IX7A 4LJ5A 5FUVA 4ZV7A 2PGXA 4MR9B 4FDTA 2H1FA 2IKSA 2XE8A 2J3HA 4FW9A 1J1UA 2P78A 4I4IA 5I7FA 5T4BA 1B73A 3QNMA 1Y8ZA 3VR6H 4KXXA 1ZJ4A 1ZK1A 5TGTA 2BEKA 3ICOA 1ML3A 4AB1A 2D00A 1TM5E 4QUHA 4MR7A 2G8NA 4RA9A 1XMQB 1CRPA 4K1XA 2QY9A 5A2GA 2VHJA 3CN7A 4XD7D 1FP6A 2WIJA 3EASA 3GYGA 3UVEA 5DF1A 3VOSA 1IXYA 2WF9A 1NY6A 2YYZA 4LJYA 2JIBA 4TVSA 3PA6A 3LGSA 1WBDA 2Y71A 4YJKA 4TKLA 2JI8A 3B12A 3EPHA 1BEUB 3OZIA 4L50A 3WGMA 1ZCAA 1N6RA 3ECCA 1SR8A 4MI3A 1ENPA 4AK9A 4N7MA 3ULKA 4GC9A 3L18A 4CMIB 1GEEA 3UT6A 4B45A 5TT1A 4C1BA 4LN1A 1P18A 2CB9A 4ZVMA 1MRZA 2J9FA 3BK7A 3GRFA 3GGCA 5JBQA 2IXBA 2Y68A 1A8PA 2C59A 5CDYA 2LCQA 1T9GS 1WD7A 2Q5JA 2NAFA 1RE0A 3GZJA 4Q16A 4HYEA 2DLNA 2L17A 1HG1A 2JFVA 3DEFA 1CERA 5REQA 1YIDA 2X5NA 4ZRMA 3DVSX 3TTXA 2GAIA 5A4AA 1JQ5A 1JHZA 3BDVA 4G81A 5JCZA 3U2QA 3PE6A 5FWYB 4A6XA 1C0PA 1N1EA 1NUAA 4FZJA 3E3OA 3I8XA 3C15C 1KJZA 4CEHB 2JD2A 2J4FA 2HKIA 2XW6A 4JGBA 3EA4A 3PX2A 3TKLA 2PH5A 2VK2A 2AJCA 4BFSA 1P29A 2O57A 3GELA 1QF9A 3PDIA 5BSEA 5BT9A 2HQRA 2VCHA 4JNCA 4UHCA 1HLGA 5I51A 1OFIA 7ABPA 1VL0A 3H2ZA 2GYUA 1JR2A 3PF8A 2W7TA 4OUDB 4Q9JA 3JD1A 3VZRA 1BYUA 1SUPA 3T7AA 2VJAA 1BYIA 3DFIA 5HOEA 5K3EA 1YVUA 1KPIA 4DXHA 1JHRA 5F7XA 4E5YA 4U2DA 5I3ZA 1REQA 2F8SA 4E2WA 2WWTA 3F4BA 1E9AA 4IDCA 1UDRA 3EXFB 5KVQA 2AHOA 5AW3A 4NOJA 3ER8A 4OTZA 5FBWB 3CLRC 2Q0HA 3I61A 1U3FA 2VT3A 5KYXA 3NHFA 3UJHA 2ODBA 3CVJA 3CU5A 4B43A 4CM8B 1AX9A 2OP1A 4D99A 4P84A 4XVUA 5A1JA 2ZUFA 2I6QA 3PEYA 1G4HA 1MQSA 2ECFA 4I81A 4XPIB 2XUHA 2YWFA 2Z6VA 3DDOA 1YQ9A 2DTXA 4I14A 1T8WA 5J2TA 5KNBH 1ZMRA 2P2NA 4LFCB 4I4TB 3T4UA 3L7JA 2O0HA 4Z3OA 2QGFA 3F3YA 3O6VA 1TMOA 5TVGA 2ECOA 2BMEA 3G59A 1OBOA 3K0SA 2QQ5A 4OHYA 3URKA 1TD1A 4LGVA 2V3CC 1E2MA 2H63A 2QNBA 2IS1A 1TO2E 1EFUA 3D2CA 2IPLA 3SBDA 5JAMA 4KPYA 3I9KA 4G5GA 2JRLA 5FTLA 2L0XA 2QM0A 2X8LA 4Z3KA 2ZS7A 2P5SA 2ZI9A 1JN0A 4JLAA 5K45A 2XDAA 3UBTA 3ZY3A 3N0RA 2X1MA 4YJ3B 4JOQA 2Q45A 2XIQA 2FPSA 1MJGA 2IYLD 2G5CA 1FNDA 2VHYA 1UQUA 1Q3TA 1K9SA 2FR0A 2I99A 3OURA 4LXTA 2XB8A 3ZXXA 5CGQB 121PA 1IH8A 3JAWB 3STUA 1QFSA 2CUKA 3SIRA 3JD3A 1AO3A 2K7ZA 4I5FA 3PT5A 4OEHA 3ES9A 5DMHA 1NLUA 1F48A 3VMMA 1TDJA 4HNTA 1W36B 5IN4A 2QUZA 3PUXA 2FW1A 3KJHA 3LQYA 3WNBA 4AKIA 4WL0A 3IAHA 4KKXB 3PE4A 1K5HA 4WINA 2QJFA 4PLGA 5FOUA 3HVRA 4FP9A 5B57C 2N3ZA 4XRRA 4F1WA 2PIDA 3T1TA 3HU1A 1NKTA 1JIJA 4MDYA 1U3TA 3DVAB 3LIIA 1E3QA 3UXEA 4RORA 1E2KA 2QMUA 2V0CA 1NGSA 3MWFA 3MXOA 2O5CA 4HUTA 3A36A 2FE4A 4RDXA 4B0PA 1GL9B 1R6BX 2BOVA 3RC3A 3SC3A 3W4IA 5J4LA 1W5SA 2O0MA 5C8YA 1ZDMA 5C8XA 1Y37A 1NVEA 3BCRA 1GR1A 3I6ZA 5F2KA 4EK9A 4OI4A 1A9YA 2VNSA 5C52B 2PEZA 2WU1A 1FDWA 2C7BA 1C50A 5A5DA 2A78A 1E2HA 1GGKA 3M1YA 4BAZA 4KXWA 4TMKA 3K9HA 3U0BA 4TL9A 3JQ7B 1H8HA 1YJ8A 4OCZA 1WHTA 2B5VA 2HZBA 3E0XA 2AW5A 4X1YB 1E6MA 1HZZC 1J1IA 4J6EA 4F9GA 1Z13A 4PAOA 3GRKA 4IKPA 3SZOA 1RPZA 3NTOA 2C42A 5B6JA 1F1BA 1XDDA 9LDBA 4YRMA 3UGTA 2HLNA 2XYGA 1KNXA 1B3RA 5JXGA 4N8EA 1QXSA 4KR2A 1NRXA 1KPGA 1FDOA 2PR7A 1HTWA 5FHRA 3SU8A 5KTKA 5AUNB 4F3YA 2E48A 1RSZA 3TXAA 2I1VB 4QKQA 5B4TA 5KNDH 1PVOA 2W2QA 1HDRA 4F4DA 1D0IA 3UAWA 5BN3A 1K8RA 2EARA 1LSUA 4RZ2A 1ZONA 4BNYA 1P39A 1UWKA 4JQSA 1P0FA 5CDFA 3RC9A 5KNCH 4F4CA 4Z4CA 2B5OA 2I8LA 1WJGA 2W48A 2XSZD 3H2BA 1NP3A 4HWTA 4EUHA 3AERB 3AKYA 4C6RA 1AGXA 3EIUA 5DYYA 4KVGA 3B36A 3PITA 2J6IA 5ICMA 3ZQ4A 2C5FA 4FD2A 3BRWA 4L4ZA 2PJRA 3RQSA 2VI5A 4CKBA 1ZJ6A 5GOTA 3TTTA 1B7GO 2Q99A 2VTBB 1JLLA 1G7RA 2J0SA 1RIIA 1S8OA 3S70A 1QYVA 3UFXA 4NX2A 3NTRA 1UPBA 4OA5A 2C1XA 3CQ9A 4QYSA 4EW3A 4MV9A 4OXNA 1HMYA 2EW2A 4BE9A 3FLEA 4HDNB 4J29A 2GBGA 3CRMA 4CKXA 5IH7A 1VYUA 2JJMA 2GKSA 1E9FA 2R65A 1J97A 4JSRA 2FCAA 2EC5A 3EDOA 3LOUA 3AONB 4O2BA 1HLDA 3VKUA 4CMAA 4F91B 5KQPA 1J2UA 1U8XX 3THWB 5I9MA 3T0IA 4BY9E 2DWOA 4C5AA 2QR5A 4G4SP 4GQAA 4KEAA 3NC4A 4E2YA 1P1CA 1MQ8B 4DL9A 3I01A 1YL6A 2QLTA 3GPCA 1SZJG 3K8OE 5FNVA 1CQPA 1OTYA 1TXGA 1Y8RB 3HKDB 3RLIA 5KWEA 3FF1A 2ST1A 2CXTA 2V6JA 3GUVA 1XLWA 3W1VA 3NB0A 3LC2O 4J4HA 3DHEA 1ZICA 5ALHA 1R6XA 1MAAA 4MVJD 1SJ9A 2XNHA 4JEHA 1YQGA 4H3VA 3L3BA 4MKRA 5JFOA 4B8YA 1A8QA 4U2CA 2HWWA 3RYIA 3WJ1A 3O26A 4WJLA 4BKPA 2WC1A 2CT8A 3QX9A 2GCGA 4CLEA 1I3KA 5DCWA 2Q62A 1RAGA 3SNHA 2DULA 2EJTA 4IG9A 4M37A 4MVJM 3FNQA 2NYVA 1A71A 3URMA 2IYSA 3WIVA 4BO7A 5A5VA 1A9SA 2C9CA 1YR6A 2NO0A 2JFZA 4YALA 3HEBA 1Y81A 1ZZGA 4LVOA 4TMXA 3PF9A 3HGMA 3HKCA 4IDDA 2D7JA 1ATIA 1F0PA 1ONSA 5CJPA 1N2SA 1UDBA 1TK9A 2Y76A 2X7XA 1XXLA 5DK6A 1JMKC 3L04A 4H59A 4OAQA 4Q93A 3OZ7A 3H5VA 4ZU3A 2JH3A 2KQUA 2NSYA 4FN4A 2IWRA 5K8UA 2X22A 2AHRA 1OCEA 2WUFA 3ETJA 3T94A 5LPNA 3QA9A 3N86A 4ZI3A 4Y6RA 2RAFA 1BEEA 2IS2A 2BM0A 3TLYA 3LHFA 3B3QA 1XDGA 3IT3A 2PMDA 4YR9A 1Z5OA 2ZRCA 3I34X 4E46A 4EA9A 3CEAA 3QWBA 3BDIA 4RTLA 3DA8A 3H65A 4URFA 3N2LA 3AL2A 2PSDA 1NATA 1ZOLA 2ZWIA 4IJUA 4KO3S 3C8MA 1BHQ1 2HBRA 5DK4A 3GBSA 4TS3A 2JGAA 1Y5NA 2IU4A 1SVMA 1U02A 2BZ0A 2YJ3A 2ZJ3A 3ZK7A 1ADGA 3IP9A 1L4HA 1M8JA 1UKCA 2PQ2A 4L8FA 1OI4A 2LR0A 4MXDA 5ED4A 1ZNXA 3GRPA 3DONA 1QG4A 3HJTA 4IAOA 5FOWA 2MSDB 3KEOA 1OLUB 1XQYA 3OETA 4KMSA 2NGRA 4LPKA 4R41A 1FRQA 3ZXIA 4GPEA 4ARVA 2C78A 4YR7A 3GG2A 3QKSA 1FTSA 3E9EA 4AJLA 1NVMB 1NXOA 4WY5A 1U9YA 1AXRA 1WV0A 1I9CA 2FY8A 3FYTA 5DGTA 4Z9XA 1WM1A 1LTQA 4IO0A 1UL1X 4HNHA 1SHZA 1WY5A 3CNEA 4F2WA 1MAVA 4B2YA 3GBVA 3H1PA 3OQ1A 3HU5A 2PUGA 1EWKA 4I0WB 4RD3A 3ZIAD 4ZCIA 2XD9A 1RRGA 4ESOA 4UNRA 5C8ZA 4IZIA 1V7QA 3WJ7A 3QPDA 4JS0A 2VSXA 4I46A 4N9WA 1Y1KE 2D0DA 3EJWA 3P9YA 4QUBA 2ANCA 2B0JA 1JB9A 3ISTA 1H42A 1R4NB 2QRUA 3AFGA 3HLKA 4UE6A 3T54A 4BFVA 3AIIA 3EGDA 3KKLA 4QGBA 3ZV7A 2FEPA 3HP4A 1YA6A 2I4MA 4Y9SA 3N9IA 5M04A 3SWWA 5LWQA 3FLAA 2WHRA 4LRWA 2BMAA 5HJ7A 1FBTA 5CYFA 2R96A 4QLBA 5ADVA 3F1KA 2JLUA 4ENUA 4EM6A 5T67A 3EWAA 1B6RA 5DLQC 4E1BA 1QP8A 5AJVB 5FUBA 3TNDA 3JW8A 1I1OA 4I1YA 4Z53A 3U4HA 2FWJA 4EHDA 1M5TA 2QAGC 1I0IA 3KV3O 4ZVNA 4ZYZA 1ZM2A 4OK6A 1G20B 4HWSA 4CTMA 2AT1A 1CV2A 4WOPA 4DCPA 4U39A 3KQKA 2CWDA 4X0EA 2XBUA 3R5TA 4IQGA 4PLYA 3M81A 2YZ2A 3UXYA 3HMKA 1GPUA 3OIFA 3FPGA 4OHRA 1V1JA 4E7OA 1H4VB 1ZHOA 4F2HA 1Z33A 1RI2A 4WESB 5EWJB 7REQA 4IM7A 3FPJA 3Q5EA 3OEHA 5I4CA 4S05A 1E2LA 2PVSA 4X64B 3MK31 4C08A 2YRWA 2ASEA 3IGFA 5CXUA 3A8TA 5DBHX 4B6SA 3CZCA 5A3SA 4QQKA 2E4WA 3A28A 2W0SA 3PEFA 2B1GA 5AKZA 1S6YA 3TVTA 4IOLA 3JS5A 3O38A 3AM1A 1E9SA 4C2TA 1J33A 1H69A 4NI5A 3TCKA 2PANA 4RV5A 5CT5A 1NVXQ 1T2UA 1CUZA 3E58A 1A9XA 3W4KA 1ZUWA 1XTVA 1HL7A 1COWA 3LYHA 5F2NA 4QQFA 2CUNA 2OOSA 3L6UA 3V4OA 1BS9A 3QBDA 2Z5GA 2GF2A 4F4HA 4W5JA 3HO1A 4D74A 1NP6A 1TYBE 2OB2A 4M0FA 3UWPA 5DHPA 1QORA 3DBIA 2O8DB 2OUKA 3QYJA 1B42A 4RGQA 1GD1O 6CHYA 1N6KA 3OCXA 1I3MA 4NRDA 4QGGA 1JDVA 3SKXA 2OZPA 4R2IA 4XIYA 2O2EA 1RJWA 4FNAA 3RSCA 5DLPA 4L3OA 3SZGA 1XPOA 2ZUBA 1EGVB 5KYYB 1E9DA 1LTHR 3HCWA 3RODA 5YASA 1BXGB 5LKAA 3THYB 3A6ZA 1N34B 5IKOA 1Q21A 3BFKA 3EFBA 3ZDXB 4E6EA 2DSTA 2RHLA 4CEJA 1SBIA 1Y3FE 1AF7A 2LWIA 2ZPUA 2FOXA 3WZ2A 3X43A 4AG5A 3ZJUA 3WL7A 1AIPA 3LVRE 3LX6A 5ILOA 2WAXA 2V7GA 3BHIA 1XPRA 1HI9A 2GYYA 1ODSA 2NU6A 2A9RA 5AKEA 2AC7A 3T8YA 3E15A 3VPBA 3PUJA 4EYOA 5L4LA 4F3TA 3IBFA 1PQUA 3QBEA 1GZ7A 1AS0A 1ICIA 2IP4A 2XHEA 4K9LA 2G76A 3UGKA 5IUJC 1QH8A 2XYRA 4ROTA 1FQWA 1QFYA 3DBRA 1HE4A 3IERA 4Y2GA 1J0BA 2LGJA 3VUFA 4BB6A 2FZ5A 3CJTA 2JVKA 4MWOA 4WJKB 4RMIA 3RSFA 1V1MB 1Z8DA 3JWIA 3KKNA 3P9IA 4HPWA 1JUDA 6REQB 3GNTA 4UTPA 1Z4JA 1OJ7A 4CXMA 4RTKA 4BV8A 5JZSA 1R6DA 1U2QA 1QOQB 1QK5A 2C2KA 3HXTA 1IU9A 3KL4A 4RD1A 1HZZA 4BNKA 3QOWA 1RPTA 5JSHA 2HT1A 1XI2A 4U7JA 4F12A 1EUCB 3JZDA 2G40A 2PA3A 3MW8A 2IY8A 5DM2A 3I4LA 3KFLA 1R10A 3D6VA 4YPOA 2NUPA 2P3OA 1RI4A 1HKUA 4YVFA 1XXHE 1PWYE 1EFVB 1BQ3A 1B8OA 1JQKA 4Y2PA 2Q3CA 4XRGA 5JSQA 4TT3D 4NCAA 4D0LB 1QLWA 3L2OB 2H31A 4WKPA 4QQ8A 1IUPA 2ZUDA 3D5EA 5A9SA 2JA1A 3HZHA 3DZFA 4V0RA 4BC0A 1ML4A 1WZCA 3U5ZB 5DNVA 1FFBA 3VI3B 1RI1A 2R00C 3ORFA 1WKCA 1KOGA 3U7IA 4L6IA 3GFBA 2WZCA 1IMJA 2Z6UA 3WHIA 1ZZEA 2Y0DA 3D8RA 4FHEA 2EGUA 3OPYA 3F9CA 3UAVA 3GLFA 2RJOA 3QF7A 1VTKA 4INOA 1CLEA 3DMPA 1FFAA 5F1OA 5U9CA 2HV8A 1UEIA 5AM2A 2F9FA 4QVIA 1HETA 3FUVA 3S1AB 3ADPA 3ZDEA 4EGAA 2A5FA 4L28A 4N18A 1TT5A 4OJQA 3TOVA 3PHIA 4GKJB 4JT2A 1KQOA 2ZSAA 3TVDA 2VS1A 2JGDB 2V7QD 4O1HA 5KJ1A 4GBGA 4OGGA 1N0WA 1QR2A 3MINA 5BYKA 1I80A 3LCUA 3N8HA 3WLEA 4C3UA 1PE0A 2HCRA 1G291 3RT1A 4LYYA 3WI7A 1QDUA 3DDWA 4LIPD 5KZMB 3I0ZA 4HNVA 1T1SA 2RGGA 2XUGA 4G0NA 2W6QA 4UAUA 5KTTA 1P0IA 1E2GA 3DT8A 2QRQA 5I7WA 1AS3A 1QVAA 1VFPA 4AJHA 4M0PA 3DAOA 4MH0R 4CI0B 1H2EA 1M2HA 1OVMA 3NJ4A 4JP5A 3W2EA 1CQJA 3E9QA 3IIIA 4N39A 2VH2A 1F5SA 3V4FA 3RYFA 2BGTA 2C7PA 1GPMA 2WNHA 5GIPE 1UBJS 5KDDA 5HZMA 4NULA 2FFAA 3BX1A 2DQ4A 1VHLA 1E9EA 2BKEA 2O2IA 2XCIA 4EYGA 1W6UA 3HI6A 4CEIA 2X2EA 2FMTA 3OJCA 3C3KA 2ARKA 1Z0AA 1K08A 2NYRA 3BMXA 1HK7A 4PZ9A 2E6UX 3FUUA 4DLPA 3IT2A 2NSJA 1OWMA 3DP7A 2F9MA 3BD9A 3QKTA 2QRLA 2R6GA 2G6BA 4NH0A 1XLVA 4CDGA 1SCUA 4L4XA 4S1OA 4MVJH 1JPUA 1W76A 3QVLA 3W34A 2R6DA 4KE9A 1N33B 1TJ5A 1X1SA 2Z0MA 1QU2A 4MYRA 2FX5A 4BKQA 3LBFA 1A5AB 1A5TA 3KTOA 5JAPA 1GU1A 1YBMA 1CUYA 3AI1A 4L8GA 1JWAB 4X9XA 2B6NA 4PC3A 3SZMA 3IJPA 2C2ZA 5GV7A 5KOHB 3EGEA 4IGKA 1M76A 5IYZF 5C35A 3GNLA 3UG6A 1QV6A 3K0KA 3KB2A 1UFQA 1PV4A 3WADA 2J8ZA 5KIAA 5DCLA 1ZMXA 4RUKA 4HN4B 3DHWC 4TRJA 4DCCA 4BNDA 1R16A 3ZGLA 2Z4TA 1D07A 4L5AA 4K2HA 4G1BA 4R98A 5CM2Z 4D1YA 3LDUA 4PNPA 1KZ9A 1YKGA 5EIFA 3SM3A 4ARAA 2O23A 1ETUA 1K3TA 3MT7A 3VDMA 4FYYA 3CWCA 4KQWA 2UUBB 2IBTA 3FYSA 1HGXA 3MYYA 3QSGA 3R0XA 3NBZC 3I30X 2GPNA 3HVUA 1ZWLA 3ZNQA 4F8JA 2FN7A 5IDQA 2Z57A 4RO0A 5BRAA 3N59A 4GPAA 4TRMA 3R8XA 5KX5A 1QFMA 3KQVA 3LT5A 2D5AA 2GEDA 5DNEA 3RUEA 2I4OA 1EVIA 4QXMA 3EDMA 2LVBA 4LEIA 2R0QC 1QGOA 5DIZA 3I9V1 1ABBA 3T1YB 3CR3C 1DUSA 3D8BA 3HR4A 1F4LA 1OHHD 1QHSA 1YHZA 4PLTA 3WOHA 5CNJA 1EWTA 1CRLA 4C2UA 3MMPA 4YRAA 5K01A 5ITZA 4YI3A 1WCWA 4RY9A 1F7UA 2JAOA 1FC0A 2YFHA 4EKEA 2FMXA 4BLSA 1N2ZA 1AA6A 1A4UA 1XN1A 2DECA 2XPCA 1L7MA 1RHRA 2Z9CA 1WTCA 4TSFA 3LTNC 1SPBS 4ZVRA 1W5EA 4ZYWA 1YB4A 1W34A 3PRJA 5EUQB 3WGKA 1KJQA 5HIKA 2BGNA 3PLRA 4W7HA 1EHIA 1GGMA 3OE5A 5THXA 3D6UA 1G8SA 2YHBA 4ZDIA 5GY7A 5GJCA 1EVYA 2REXB 2R6ZA 3ORYA 1RQNA 1NQVA 1E1RD 4KC0A 1VE7A 4NPAA 2C2BA 3EXIB 1VJ5A 4YJDA 2CL0X 3KSUA 4GLBA 3ZK9A 4DQVA 5TLSA 1OX5A 3QNUA 3J81k 1PWZA 2Q1WA 1FJ2A 1MUUA 4OXKA 3CLTD 3RT9A 3BE6A 2MMCA 4Q3DA 5TY0A 3W78A 1A8HA 1SY7A 4L4RA 4YCBA 4ASUA 2QXYA 4K9QA 2PGJA 1E5TA 1EHCA 1ZN2A 4CG2A 1UIMA 1AGRA 3OPNA 3L84A 4HWGA 4PBSA 4WVFA 5ADUS 3MG9A 2EBFX 2X23A 3CLKA 2C4WA 3EGXA 2WD7B 2UZ3A 3Q12A 4C4YA 2YRXA 2N75A 3U60B 1DAGA 5KSZA 1DAPA 3IT0A 4Z3DA 3HADA 3L4BC 2QAGA 4NATA 5JSFA 1VGRA 1KZ1A 4GRAA 3H1GA 1TNDA 3WLOA 2VOJA 1ZJWA 4OKSA 1IHXA 1EIZA 3AW9A 3A1WA 3NHZA 4XGRA 1YRLA 1KO5A 1XHFA 3Q15C 4G0MA 3K05A 5LZ5A 3VTZA 5CDFE 1NBOA 4HRAA 5IVKA 4KBYA 1JXOA 3QX7A 5CDGA 4BLUA 1C4KA 5CEJA 2VLBA 3LD9A 1VL8A 1PD1A 5IZCC 1FW6A 3GCZA 4XWYA 1J4AA 1JXQA 4MS1B 2EP5A 3BRQA 4DUYB 2GS9A 4D79A 1KEUA 1XCJA 2QUBA 3C48A 3TNFA 5AIAA 5JAUA 1CY4A 5HKKD 2PVPA 2HQSA 2XUOA 3NBXX 3Q9UA 2F3UA 1OLXA 2GB4A 2BZSA 4K8RB 4MUXA 4X1KB 5GM1A 2GKOA 1Z0FA 1ZGJA 2RG7A 3CTMA 5TNXA 4BB5A 4CN8A 2XEXA 2Q3HA 1ZGBA 3LWNA 3I0MA 3REQA 3D31A 1HDEA 3L4JA 1QKJA 1UOPA 4JLBA 4PIPA 3JZIA 2WJAA 1JR3A 1PV2A 2ZQ5A 4QEZA 4CM3A 1TF2A 1GZ4A 5KWIA 2A5LA 4L8LA 3W9BA 2YY7A 4ZKEA 3U17A 3WA6A 1BSVA 4CBVA 5CFPA 5JALA 1T1RA 2O2DA 2CGEA 4JR0A 4A8HA 1RHKA 5EUBA 1JP7A 4E30A 5ALGA 1CTQA 1ZHHA 5K3DA 4HY3A 1JEAA 5K05A 1QHHB 1QK4A 2BH9A 2R6FA 4XQGA 3DM9B 3V33A 4P2BA 2P7HA 1JFTA 2H5IA 2C54A 3A3NA 2WINI 4XSVA 1ECPA 5JMPA 5I7HA 3V8QA 4EI8A 3NT5A 3DPIA 3FFAA 2TRSB 1EFHA 4MUEA 2AFIB 1Z29A 4E11A 4BBAA 2ZM5A 4GZMA 1POWA 3BCSA 4Z51A 1GIAA 2ZI4A 3B2NA 2QN6A 2Q4DA 2YVKA 3GEIA 2WF5A 4IINA 1DUIA 1GA6A 1YZNA 3P9XA 2VYQA 1FMFA 3TI7A 1ODFA 2I4NA 3AR8A 3AY7A 3PPXA 2AQHA 1ISMA 1EP3B 1QIEA 5EJ6A 1SBTA 4RJ2A 2ODWA 4AUNA 2WNIA 5IEBA 3CJQA 4MPDA 5JFGA 3EPLA 2D5IA 1RWXA 2F6RA 4QNRA 4YP0A 1XEWX 4IH9A 3BXGA 3DOIA 2BR4A 4AM8A 2W2VA 3AUKA 1R0BA 1F8GA 4TXHA 5KU7A 3ISJA 3MWEA 2QT1A 3W2FA 1GSIA 3KAQA 1AK2A 3LIPA 1YZUA 3RTAA 2AYXA 1KKMA 2RC6A 1CEYA 1QTRA 2BEWB 3SBOA 3AB8A 1CYEA 2G6TA 3BSYA 3D1VA 1H5QA 1KFBB 1N5RA 2QTTA 4KXVA 3IQEA 3NXKA 4A1OA 3DGFC 5B6PA 2UAGA 1DARA 2VNJA 3CW2A 1NLMA 3FAZA 2XQJA 3EPJA 3ICPA 3O31A 3OY7A 4GPD1 1VHDA 3P4XA 1B0PA 3BERA 3T7RA 3LFUA 3RIXA 2DQKA 3LYUA 5TMEA 4A0FA 3AJEA 4OP3A 4EPTA 2HSEA 1K88A 1W0CA 3RV3A 3GL9A 4F9FA 1CETA 2W8BB 2ZE6A 3D7NA 2ZUCA 1SUAA 2WHEA 3CKYA 3IAM1 2OBMA 2VJCA 3R7NA 1JKFA 3K7EA 1GQQA 3F8WA 3OM1A 5HJEA 2D4AA 4YRKA 1M2OB 2WIGA 3UUGA 3AUAA 1ORIA 1WLYA 4GZ3A 2ZAMA 3RVSA 4C04A 2VZ8A 2JJ1D 4E4TA 2JK0A 5GQSA 2FPMA 4H2DA 2XKAA 2PCLA 3L6RA 5LUBA 1AVTA 1P2DA 1X8KA 3U56A 4OQDA 1DT3A 1GKUB 1Q92A 5HMMA 4AURA 5C7IO 4G4GA 4OG2A 1QANA 2CK3A 2RGUA 4L75A 4E1VA 4DEYA 2J32A 3C4QA 3LQQA 3TZBA 4AIRA 1QVWA 3LDGA 4P0QB 4NJEB 1JNXX 4DWVA 4M0CA 4KWTA 10MHA 1BHO1 2DG2A 2GZ2A 3QBVA 4IEFB 4MEBA 4R40A 4EMTA 3NV7A 3D6NB 2ZR8A 3NASA 3PFHA 1OGIA 1RXUA 4OBWA 3KYIB 3F9IA 3HXPA 4RFSB 4BB0A 1T0UA 2ILTA 2OZLA 5ALQA 5BQ3A 1GY8A 3D7RA 1A4RA 4J9UE 4B44A 2FDXA 3OEYA 4QT4A 4FR2A 3R7BA 3NU1A 3IQHX 1DEHA 5L7WA 4I3FA 5DGIA 1U6IA 4R2MA 4RV4A 1J8YF 2W9XA 5JRZA 1T91A 3L4SO 3LY5A 2GI4A 2A67A 3AIOA 1T43A 1XVAA 4ZREA 3KXDA 2XCTB 4EZBA 4ND6A 2V74B 4TYMA 4BX8A 3V7FA 3IILA 1AMUA 1Y9JA 1YRYE 2ZJ4A 2PBLA 3AY0A 3F6CA 3L7OA 4K9KA 5CW2A 3SXUB 4OHCA 2ZIFA 3V80A 1Y9EA 4GGPA 3KVOA 4PNHA 3VU8A 1VIYA 3KFVA 5DHFA 1RI3A 4QICA 2ZWPA 2A3RA 5AR1A 1HDXA 5FJIA 2VO1A 3THRA 4Q7MB 2J3MA 3IEKA 3LW8A 3JAKB 5JSYA 4O63O 5CA1B 1QRAA 3VSEA 1C9NA 4PSUA 2WMNB 2EFJA 4DJ5X 1NVBA 2G9ZA 3A25A 1YK1A 3S2SA 4OPMA 3SS8A 3W5DA 3NANA 2M98A 5HTOA 2AR7A 3QH4A 4HNSA 2A2ZA 2EFDB 2O5EA 3R6DA 2IV7A 5JS6A 2IHZA 4JLWA 3GIWA 3DO8A 1SQ5A 4LYFA 3QVXA 4JMLA 4H9GA 1WPXA 1FVHA 2G3YA 2IPNA 1FUEA 1MH1A 3KR9A 4QU8A 4U8GA 3HPRA 5H16A 2I6UA 1YMVA 1EZ1A 3NH6A 2PGAA 1KI4A 5AVQA 2QUJA 4Z9AA 5ALUA 3MS2A 4PCLA 2FA9A 2RFLA 4UBKA 1PGOA 1XNJA 2EU8A 5SZKB 4XFDA 1KH3A 3OJOA 2QV0A 2ZSBA 4QSMA 2X7JA 1E3EA 1QTNA 4IIEA 3L0PA 4XJVA 4DNFA 1LW6E 4TS9A 4CHGA 5L3VA 1AMNA 1TGVA 4NYMQ 4IJQA 1BMFA 1N9GA 4PC7A 4OQPA 1YZLA 2WAMA 4H0CA 5JVDA 1WXIA 1XP8A 1Y5RA 2A0WA 2ZIXA 2JVJA 1L4MA 3AR5A 3PXAA 1V3TA 3H4IA 4ZOLF 1ATZA 2OLEA 3T0GA 4KKVA 4BLWA 2N1BA 1Y7IA 3D6TB 3D9QX 3W5IA 1DBWA 1ZKMA 4YC7A 5ESDA 3TTYA 4BVHA 2P69A 1ECGA 4B09A 4I1OA 1KR5A 3UKOA 5ABPA 2DPYA 3CC8A 5K5EA 3ANTA 3SP1A 2XCUA 4JC5A 1LK7A 4OH7A 2X0DA 2F48A 4HZGA 4V2IA 5DYNA 3ESRA 2ZYSA 2CLSA 1RAIA 5IM4A 1XEXB 2C1ZA 5DW3A 1LLFA 3B1WA 4MQMA 3GRVA 4RK6A 3S1LA 1RYMA 5ED0A 3E05A 3HVHA 4OGFA 4NG5A 1Q14A 4GZLA 1NYQA 2G7ZA 2VPWA 1EK5A 3HXKA 1R18A 1L7XA 4YGYA 1TMGE 2ICAA 4W1PA 2Q4OA 4ZP1A 3B51X 2QJTA 3MWGA 4MR8B 1XDUA 4QDJA 4QYMA 4CZ2A 4ABTA 4YS6A 2V7VA 1UMDB 1Q74A 1ZH6A 4P4TA 1ACLA 1Z26A 2J5RA 4E6PA 2WHYA 3G02A 1Q3KA 4PZYA 1XROA 2WPNA 3TX2A 3UYKA 3MCTA 2C92A 3BRCA 3HA2A 1UJ4A 3V8VA 1OB5A 5KYGA 2P9JA 3LY7A 3E70C 1H1TA 1T2NA 1UP4A 2G07A 4OU5A 3DDCA 4JLMA 2HV9A 2J41A 3HR8A 2LW7A 2I2CA 3BH7A 1II0A 2CMFA 2OQ2A 1ZPDA 4WXHA 3WQQA 1DXHA 2Q0QA 2MJLA 2BI8A 3QGMA 1S96A 3OOEA 2JKVA 5AK4A 2J9YB 1W8IA 4DG8A 4AQYB 1JILA 2OG2A 5IJAA 1DU4A 3T99A 1WETA 2VLIA 2JIZD 3O74A 5EXSA 3GRZA 4P3PA 4J3JA 4TSRA 3L4BA 3CO0S 3PIDA 1GZSA 4QYIA 1AZWA 3BA1A 1WAMA 3I37X 3JWPA 3T3PB 3TUJC 5GVSA 1D2RA 1MG0A 3VU0A 2UZ4A 2ODEA 2W98A 4OHFA 4GXRA 1OPXA 4LDPA 4RTRA 4MIEA 3FNFA 4TTTS 1KSHA 3QFFA 4H60A 4CF6A 5LFAA 3GJRA 1N8SA 2DKNA 3GFOA 5BSMA 5LIPA 4G4JA 2ID9A 3OH8A 1IAVA 5A0FA 1PQYA 1BDHA 5E9WA 5IZCA 4BFCA 4PQFA 2HA4A 1C0KA 4FX5A 3UUWA 3IS3A 1NVFA 4DYHA 2BSAA 4ML3A 3GUCA 4YGXB 4JP1A 5KPDA 2C7QA 2Q46A 1G6KA 4ENTA 2IEZA 3C2QA 1RJDA 3NUZA 1XRNA 4HWKA 4B6PA 1KSFX 1W0JD 3JALB 4JI3B 1KGSA 2FGJA 3WGOA 1E69A 1QSGA 2AE1A 1UJBA 5AICA 5CB6A 1JDSA 2GETA 3UQYS 4RJJA 3FGNA 1NF2A 2Z56A 4IMRA 3AFIA 3A4MA 1FX0B 2H1LA 5ALTA 4DJJA 2VF4X 1ESCA 4P08A 2CEKA 4OB7A 2HA7A 4R2XA 3ONEA 4RK5A 2F59A 5G53C 2YYSA 4REQB 3KYCB 1KETA 4X6YA 1EVZA 2C4VA 4XLZA 1W7AA 4DC0A 1TX4B 1Z63A 2IXDA 4JBGA 3P2JA 3TQSA 3BBPA 4KCGA 1R37A 2HNBA 3C6YA 2XHZA 5B7PA 2BFMA 3GLGA 4MGYR 2Z83A 1GAEO 2JFPA 2J0EA 3L7AA 1CR1A 2PN1A 1TTQB 2EZTA 3B7PA 1EXMA 1DDGA 4MUAA 3M6LA 3Q7SA 2IOFK 1TJPB 2AE2A 1R1DA 3KJEA 3O2JA 2BGKA 1BD4A 4NEHB 4OHOA 5IBQA 2H1OA 4M55A 2AMVA 2FPRA 2JFYA 2OWDA 4IICA 5CU7A 2FKAA 2PRJA 4BBZA 4ZWNA 3VXKA 3ENQA 2FOLA 4S1TA 2P3SA 3Q2KA 5K3FB 1DWPA 2PU5A 2Y1LA 1HFEL 2ZK7A 4F1KA 1WUJS 2ZSFA 3OHSX 1AC5A 3ABZA 1Z36A 1LDGA 2O9JA 1WXEA 1AHIA 1BA3A 4B48A 5CFOA 2X0NA 3AHHA 1H6DA 2XOKD 3F7MA 1CT9A 1W581 4D9MA 3UF0A 4JQOA 2IOFA 1EVJA 2JFUA 4G5XA 4JJEA 3CB2A 1XC7A 2Z3ZA 3M89A 4B35A 1H94A 3DXZA 1VMKA 4J7CA 2B4KA 3EY9A 4FOTA 3JQGB 4KWEA 4NDNE 5HF5A 2VR1A 3ET4A 4N9QA 2ZIZA 1N5DA 1NOJA 3VZCA 2GD6A 4G5YA 3ZVRA 1L0BA 1CQIA 3D3WB 5LVAA 2FPPB 2UZ1B 4AD8A 3FVVA 1JG4A 4LJSA 3B1VA 1TUIA 2I71A 3D81A 1UIRA 4NBNA 3O8BA 4IDPA 3Q88A 3SG0A 4HDKA 4P4NA 4HB0A 4AROA 5A4FS 4W5OA 3VISA 3BMQB 5CDSA 4N12A 3OLVA 3K1JA 2J6HA 3A9VA 4FZ3A 4RBNA 3D8NA 5H81A 1ILWA 2WOJA 5FYDA 2WTUA 3SYMA 2RI0A 1X1CA 5C53B 3TR5A 4BFUA 2CJWA 3N0WA 4RMGA 4YJHA 4UXHA 5B2EA 2B99A 2RC5A 3NR2A 13PKA 3AG6A 4CIWA 5JYDA 3EW9A 4AZ3A 1TUBA 1U8FO 3LXMA 3W5BA 1WQ3A 2B25A 2FSVC 3PQFA 2J46A 3MZ0A 3HGTA 2VDVE 4BVLA 1SG6A 4J4BA 3U1TA 4N76A 4HQKA 5FEUA 1AB5A 1Z0JA 2WJWA 1S2OA 4IDFA 4P2GA 5KVAA 2JJ8A 1U0FA 5H4HA 1QG2A 4QGFA 4KAFA 2I5PO 2IYUA 2XCRB 1WB4A 1BDBA 4QAQA 1IC6A 2HU2A 3CPHA 4CCYA 2C9YA 4MUJA 3M70A 5FDFA 3RNOA 3E9YA 3VU3A 1IUKA 5KOYA 3KETA 3MWDB 4HUQA 4ZANA 3IR7A 2HRQA 4US0R 4ZCSA 2FB9A 3SFVA 5C37A 3QMWA 4XB2A 1UODA 5EESA 4ND1A 1C7FA 1YBVA 2YFYA 5FBKA 4LOKA 3KTAA 3OU2A 4KLRA 5K3AA 4BMSA 4DV4B 4QYTA 1NIPA 3DOCA 2Y9PB 2C3MA 1LBEA 1OBVA 1RXCA 2G06A 3SEZA 1SGWA 1WX1A 2GVNA 1MB3A 4FFBB 3SYRA 4OQ4A 1WP4A 4H7HA 4MCAA 1N0HA 2FFRA 4BNVA 1NF8A 1I13A 2G83A 3DUWA 3FBTA 5DSTA 4Z54A 1JX6A 2BKXA 2ZBRA 3PD7A 5B4UA 3NW9A 3PR1A 2CUZA 1CY0A 3H9BA 2YJ4A 4BCCA 3A37A 5BRJA 2RE8A 3DYBA 1S3FA 1JNYA 1UXJA 3DNFA 4HJRA 5B5SA 3QLUC 4DMFA 2HIGA 3R7LA 2GK6A 3VVMA 5EGSA 1V8BA 1E2UA 1V45E 2G04A 1W36D 4FM9A 1JJVA 3JPWA 2PH3A 4HLUC 1R5JA 4DXAA 3B6ZA 3GGJA 1R4AA 3IV6A 4K40A 2IGTA 4WERA 1WMBA 3FNBA 3BGIA 1XAJA 3PTZA 1P5ZB 3ECAA 4EB6B 3JQAD 3CEHA 5A3VA 2IHNA 1ULAA 3NHPA 2C84A 4XKJA 5HBGA 1N2CE 1OGJA 4JBNA 2HADA 3RS4A 3F6EX 4AP9A 3RHSA 1GNQA 2QG6A 1RWMA 1CJCA 2W6JD 3SHTA 2WG1A 3DLCA 3FBWA 1NVTA 2INGX 4JX8A 3GHYA 4FGKA 4U6SA 2X3UA 1LF0A 5DGHA 1KYYA 1YR2A 3IDSA 4MAMA 4M9SA 3UA4A 3VHRA 5LP1A 2ZXFA 5J2UB 2DETA 3F71A 1EWRA 3N0TA 3MMNA 3QI2A 2CY0A 3F6RA 1E94E 1L8QA 4Q3AA 3M9LA 4TLBA 4WGGA 3ZNOA 3IAS6 5ETJA 1FPMA 2DTEA 2NG1A 4JX9A 2H18A 4X1OA 3W5AA 5F7JA 3I2YX 1L5HA 3OKAA 4CE6A 2GK3A 3MERA 3AFOA 3HWRA 5JPIA 2F1OA 3VH2A 2W2XA 1Z88A 2Q6IA 1EM8B 1ZD1A 3WFZA 2YCLA 3ROFA 2H4FA 1KMCA 3FMGA 3KZXA 1UMCA 3O9VA 4HGYA 4HQNA 3WIBA 5DIFA 4BMDA 4GUDA 4MDFA 3WK6A 4ZTUB 2H1SA 2RGBA 3ZCXA 2O2CA 4JBWA 4Z4HA 1C9YA 1AKEA 1CHNA 1ZW1A 3LWDA 1M3SA 5JH7A 2B4TO 4JQCA 1KWKA 4ZI7B 3AF2A 4EY5A 5AHWA 1XTIA 3LU1A 1AGYA 2LV8A 1LVGA 1UKZA 4BC1A 1U0GA 2YH2A 4K26A 1J56A 1M74A 3INYA 3U3DA 4H0FA 4H1VA 6ADHA 3CUUA 3GFVA 3K0AA 4HQFA 2AUTA 3GIDA 4NICA 4BWGA 4OX9B 4ND8B 2R8BA 5AOVA 5JJCA 2XGJA 1UXOA 3E22B 1O8CA 4IXMA 2AN3A 3I3OA 3HCPA 5H8WA 3QKUA 1JHMA 4WZAE 2M6LA 1ULSA 4BFTA 1R15A 1IOZA 2O8EA 1SU7A 4BRSA 5C8DA 1SD1A 3HWX1 3N2ZB 2XTNA 2A7QA 4DMUB 4Y9DA 3R75A 2QD4A 3IULA 2V65A 3E4CA 2O8FB 1P62B 2H5JA 2HJHA 1UC5B 2BEVB 3EG9B 3B3AA 3EEIA 4IGFA 5E6UA 1BVRA 4NBVA 1F6DA 2X4GA 4B6QA 4N54A 4ZYYA 3C6QA 2NZJA 5CG2A 1DOAA 1DWUA 3KPJA 2ACKA 2RBKA 1JEQA 4HCJA 3UT5B 5FWNA 3P2YA 1MHTA 3OQJA 4E51A 5IJ0A 4AY3A 4WN3A 2PMKA 3TPCA 3ZU3A 4B87A 2VDWB 4E5SA 4J0GA 2HHLA 2HMVA 3ZX5A 3IIJA 4UMVA 4GP9A 5CX1B 1S2LA 2ZAGA 3HP1A 4XTRA 1P74A 2DR3A 3VR4A 2EX4A 3WK5A 1TTTA 4IIJF 3OQPA 2C04A 4BO8A 3PZRA 4W9NA 4K9SA 2QYSA 4JLPA 3U4AA 1J23A 1HKHA 2PUVA 4BLVA 2OGZA 4BU1A 2O8BB 3LVQE 5FA5A 1SOMA 3DBOB 4OGWA 4DMLA 4J94A 4LOLA 4F8EA 4K9PA 1AM4D 4YJFA 3VJMA 1KO8A 4IDOA 3IKVA 5CFZA 2P0YA 4MQLA 2QD2A 3DOFA 1UAYA 1X9GA 3EZ2A 1U7XA 3O83A 3PFFA 3VDXA 3H11B 1UBHS 4FFVA 3AHFA 3VU1A 2V9CA 3AKZA 3G1TA 5IBPA 4R8VA 4DT1B 2I55A 1S89A 2COKA 2P11A 3FJYA 5IAOA 1ZM4A 3AEUB 3MTQA 5KDLA 2C3UA 4DB4A 2VUIB 4DCUA 1YZVA 1H2YA 3GVIA 3Q1LA 1AG9A 3GVCA 2QUAA 2E4AA 4UHFA 5A4JA 2CBXA 4S2EA 3ZHTA 3MIIA 4MP6A 1FS4A 1JQAA 2QVLA 3G2PA 4ITVA 1MEJA 2H65A 2J0QA 5D6OA 1NRJB 1Z07A 3KXLA 5ER9A 2YMPA 3VPHA 1HNWB 1A88A 1I14A 3AKCA 2E3JA 3I12A 3KR1A 3PKJA 4MHTA 5ARBA 4KE7A 4LSGA 1CQZA 4UFOA 3TN7A 3DTNA 1G8PA 1Q15A 1KMHB 2X4DA 2WVAA 1WV1A 2HEIA 1DPFA 3LNTA 1HE2A 4RDIA 2XUIA 1KP3A 1J8FA 4KLCA 3TR0A 3Q3JB 3U9LA 2RHHA 2WFMA 3HN2A 1ZH4A 2R5NA 2OD9A 4YRQA 3UMGA 3FTEA 4NZPA 2VJMB 4EJSB 4MPPA 2Z95A 4JV5B 3EOBI 1M1YE 1PHRA 2RHJA 3CX3A 3I2JA 2V5UA 2DOKA 2ZUWA 3TZCA 2XMSA 1EWQA 1YJXA 4TMYA 2WWGA 1VPLA 4ATNA 4FN5A 3SIWA 3PEVA 4IQ8A 1U3WA 3C3AA 5C7YA 3KXPA 4XTCS 5FPSA 2VPZA 3EXEB 4EHNA 3D5QA 4CNQA 3X1JA 2P9QA 2SECE 5GVRA 2RGEA 4V3BA 4ON9A 4BYGA 4PN7A 4MV3A 4M1WA 3DG9A 4EG7A 2OCBA 1YJ5A 2FZKA 1ICEA 1PVVA 1E5DA 1L5SA 1L5ZA 1Q12A 3V42A 4DV0B 4QPPA 2D59A 2QQFA 3AW8A 5AW8A 3DOEA 1DGQA 2RDMA 1M10A 1D4ZA 4Q1CA 2H9AA 1SXJC 2IIVA 4L0QA 4JP3A 1GT6A 2CNNA 3FVQA 1Y4SA 3IQGX 3R2JA 4KAXA 1BKYA 4LAFA 3LX5A 4ZQBA 3MAAC 4DBVO 1DKLA 2WTXA 5EKUA 2I6FA 1J99A 1KK1A 1U8TA 2AOUA 1ZP6A 4DR3B 3FPBA 4WY8A 4PYRA 2X40A 4OO3A 1Q0RA 1FX1A 2FZCA 5FI3A 4GDMA 1DXOA 4UE2A 5ILQA 3UAOA 1MA3A 3PFGA 4QPJC 4WBXC 3X1YA 5ARCA 2GBPA 4TVOA 4EKYA 3KOWA 1ZESA 1C8KA 1RACA 3QPWA 1Z56C 1MX9A 1VSTA 4ZPJA 3MT9A 3V8RA 4BMVA 3SEQA 4US2R 5T3UA 4D43A 4Q34A 1NXTA 3M9WA 2BP7B 8ADHA 2EG9A 3WTCA 1YF3A 1V16A 2A58A 3OLXA 2I7DA 3BMNB 4KDCA 1XLUA 3IJEB 5HILA 4E22A 2XZOA 4N65A 4G41A 4EYSA 1QIKA 4EUEA 2YZNA 2X9GA 5BWMA 1ZIOA 2O8CB 5JRDS 4G01B 5KWJA 4QAJA 4TMTA 4ZCTA 5ICFA 1VXRA 2IE0A 4HDRA 5JQGB 2VPTA 3TTWA 5E3HA 3Q7PA 3HV0A 4QATA 4X24A 3UG7A 2PL3A 2GNOA 1LC3A 4L2IA 1CG6A 4ZOBA 4AYWA 3PV0A 3ZLBA 2QTRA 1NI3A 4PZCA 2AKAB 4RY2A 5J63A 1O6GA 2P2YA 1E6UA 5HTKA 4LDJA 2Q3DA 2Q8NA 1RYZA 2AVNA 4FQ5A 4GX1A 4QFMA 2HTFA 2A0XA 2P35A 1J42A 2X8WA 5J5CA 5PNTA 2X0KA 2MR5A 4BMNA 2G1KA 4MJXA 4TXJA 1JIXA 2LCIA 3X1ZA 3EA5A 4MV4A 4R8KA 3TO5A 3FUWA 3V7YA 4MJ7A 4V1CB 2FSVA 1DZ3A 2PZJA 2W2PA 3AR3A 3FMOB 4R0MA 2ZJFA 2H48A 3OKFA 4JL6A 4KIGA 4DVJA 2QF7A 2MYTA 2P68A 3OJLA 2XZPA 5LDGA 2YZKA 4FDAA 1XFDA 1LZKA 2J6CA 4GBMA 3ETDA 1Z47A 1AO0A 4D82A 5HVNA 3AESB 4J2HA 1KIAA 1HYBA 5EE0A 2ZR0A 4ZMBA 1Z45A 2O48X 4DF3A 2QWXA 1VFNA 5FR2A 4R2JA 2REQB 2ZYWX 1QB8A 3KKMA 1QNFA 1RM0A 1M1NB 3FSGA 2W6OA 1PYDA 1PCXA 1VZ3A 3WYDA 2V5AA 3A58B 2M1XA 4G5SA 4NZNA 1SC6A 4F2DA 4OY3A 2UUAB 2X8JA 1GHTA 2IZOA 2OGTA 3PUIA 5TC4A 3B6EA 1X3LA 1V2GA 1JFFA 5H7XA 4IS3A 5K4HA 4RIHA 5DO9A 3TUIC 1DOZA 1BGVA 2C95A 2ZRBA 3JQ9C 1W44A 3NIBA 1WXFA 3FR7A 3G88A 5T4HA 3O4GA 3SM9A 3ACDA 4CUJA 3EPRA 1EB9A 4YASA 5EMMA 1FNNA 3QU7A 4M1TA 1HQCA 4AULA 4DUZB 3M5PA 2TS1A 1ID1A 1ZCBA 2TMYA 4B75A 1JT9A 4L9SA 1ZQ9A 2BFNA 5SY9A 2RJNA 4HLUA 3RKRA 4AN1A 5HJ5A 5E95A 3R9XA 3VHXA 1N9KA 3SYKA 1VLZA 5H1YA 4W9RA 1NVAA 4DANA 4D4MA 3KJZA 3O1JC 4Q19A 4J0JA 4DM7A 4S12A 1XMIA 1S2NA 2FN4A 3KYDB 3KZMA 4N6NA 2A1TR 1E5VA 1RM5A 3KVRA 3U4MA 2N47A 1XO1A 3A4IA 1MAUA 1OR8A 3TZQA 2PJZA 5L3QA 3PD1A 4CWAA 1PZXA 5JCXA 2DXIA 2NMVA 2QRNA 2BV3A 4UW9A 3RNLA 4DJTA 1NYRA 3Q87B 3WL3A 4J4TA 3W90A 2QSZA 4ZO9A 4EPVA 4MW6A 3U44B 1F2UA 3BWYA 2YZ7A 5AMXA 1YGPA 2FP4B 2IEBA 2WJZB 4PZDA 5TGDA 3G49A 1ZNQO 5AM5A 2ADMA 3USZA 3R5JA 3SFZA 2Z2IA 3SHWA 1LY1A 1DBRA 2I2WA 3KEQA 4PG7A 5CFRA 1EE9A 1EFLA 3BCUA 4NU8X 2C2HA 3UAZA 1W0KD 2O3SA 1RAAA 3QEMA 4IP0A 4JVLA 4RM3A 2C4HA 2DFTA 5TMBA 2GK4A 3GMTA 1LU9A 5K0NA 3A70A 3PJGA 4URHA 3LO5A 2AKYA 5FI0B 2H1WA 2R8EA 3OQIA 3GLGE 4JLDA 2JCBA 3R3VA 2WUWE 1QRUA 2HRBA 4P3NA 3LQFA 4N6OA 4C2BA 1D03A 4GI5A 2F17A 3UHJA 4KXNA 4CF4A 2XCLA 5A1TA 1GUAA 4A0RA 2GM9A 1KP9A 3TG2A 1SQSA 4PGHA 3IODA 4JBHA 5FCDA 5MN4A 2KE5A 2WM3A 4X6XA 1DC4A 1EG7A 2BCJQ 5BQOA 3DLAA 1VBFA 3PDHA 4RKYA 4A15A 4N3AA 5AVZA 4IJVA 1NBMD 3HXLA 3ZVKA 2P75A 3GGSA 4HZUB 3GQBA 4JA0A 5AKJA 3PLAE 1NX6A 1XSEA 1Q91A 3F49S 1AQIA 3ZHOA 3F5FA 4KIFA 2PCJA 2IXEA 3RU7A 1H5UA 3AOGA 5BN5B 1XOIA 1H2HA 1US8A 2C9MA 2YWJA 1LSJA 4LISA 4RGVA 1X0XA 1JEDA 1S7CA 1Z39A 1S8AA 2EXXA 3BSWA 2OPHA 3TW4A 1YT5A 2QW1A 3P5SA 3B8EA 4KP7A 5K0LA 4M22A 3WHLA 4CIBA 4KLAA 2J0UB 2G7MC 3LCCA 4BGDA 2EERA 2I78A 2VP4A 3E9DA 2EZ9A 1V4NA 2WVGA 3KWJA 3LKZA 4FXPA 4UNPA 1IVYA 4MB6A 4RCZA 3M1AA 4LK3A 2Q7DA 3EB9A 2PL9A 4Q7KA 1Y3HA 5AH0A 1KDZA 3KQMA 4X7RA 4EPWA 5M29A 1PKXA 3FZGA 4OB8A 3S68A 2EKPA 3NLLA 3CLUD 4NOMA 2IXGA 1JLRA 4YRFA 1NVKA 4PPQA 1NE2A 5EYPA 3V8EA 5HM6A 4EECA 2XMCA 5FFNA 1W2GA 3Q5DA 2V45A 4WDQA 5G0WA 1U5BB 3DM5A 2ZVJA 1FPQA 4O3FA 5TPZD 2IV2X 4EY8A 1H23A 2HWUA 1I6LA 2FEMA 2P9BA 1H2RS 2VK8A 5JD6A 3GX1A 2K7FA 4ZAZA 3EISA 3CYFA 1XF1A 1A7JA 2A9FA 3ZYZA 1ISIA 2OY0A 3A1DA 3QP9A 5DN6D 3RBVA 3U4IA 3TKAA 4EYEA 2GN9A 4LZOA 3VPCA 4BJ5A 1R8XA 4IDBA 5HA5A 1DWOA 1EQAA 2AX3A 5ALZA 2XT0A 3C5CA 3HBAA 4D0NA 3B3GA 1GN9A 4RD2A 3OQBA 5EIEA 2JIQA 2ZYUX 4KGXA 4OFWA 1NLZA 1BW9B 4OJMX 1H0SA 1FJGB 2O52A 2W58A 3LKBA 3F5QA 1VL2A 5DTMA 4C6SA 1NBHA 2FPGA 1YBAA 2GERA 2RHGB 4XOUA 3HK2A 2OM6A 2WT9A 2SCUB 3RQIA 1XZAA 1GAWA 3M4ZA 1Y6RA 4C03A 2AA3A 2PX8A 5SYNA 2ZS9A 2QYTA 1GADO 2BFFB 1A27A 2CYBA 2J6BA 2XE7A 1NASA 4H7JA 4AWAA 5K2OA 2EFEB 4FKMA 4PV7A 5EY5B 3GLIB 3SJBA 1ESDA 4G07A 5GGXA 3G2IA 3O91A 2KX7A 2AEEA 4Z4QA 1KYZA 1I4DD 3FD8A 4KAAA 4PYOA 3ZXSA 2WFLA 1YDHA 2CNOA 2VUUA 3AI3A 1FP4A 3GV0A 1QF6A 2VAWA 1PNOA 3Q3EA 3E3NA 3I2HA 4NYMR 1VM6A 4XB1A 4P7BA 4MVJP 2PA0A 3AK4A 2QAIA 5IUKC 2GHQA 1BEZA 5KOIA 1R9MA 4Y2RA 1Y63A 4BNFA 1J2YA 1C1DB 3OT1B 2GCOA 3REFA 1QO0D 4COOA 1GA4A 3FRJA 3VTFA 5CVCA 1DIGA 4JP2A 2ID7A 4M7RA 1R8JA 4DNPA 5LA6F 1TQDA 3UMSA 4KZPA 4MWCA 2X5JO 3BE4A 4KW7A 1W85B 1KXZA 1CR2A 2B9VA 1BDMA 1IEVA 3HZZA 4IV0A 2RHDA 2QX6A 4MR9A 4D4HA 3RFCA 1SXJA 1DJNA 4K3VA 2DVMA 3NHUA 4LZZA 4OIMA 5HFAA 1FVFA 4ZHQB 4PG6A 1B43A 2DZDA 2Q1UA 3UMJA 3PX3A 3LQRA 1KI3A 1GG2A 1T3TA 2BTQA 3KZNA 4P0TA 5GAJA 2MMGA 1PFVA 1E6EA 1X7WB 3G23A 4QSHA 4WFKA 4ZXPA 2H6EA 2CB0A 1ECLA 3MJVA 3VKVA 5KYNA 4MLCA 5DYGA 1T8UA 1Z75A 1WPGA 2QE6A 1OV4A 3L0IB 3HFJA 4OHKA 4DA6A 4DA9A 5ELMA 1FLAA 3RAGA 4MAFA 3QI7A 1RJ9B 2GWRA 3DPUA 5AW5A 2VBGA 5HDQA 1AQLA 1M34B 4HB3A 3AJAA 3LSTA 1VKRA 1NULA 2DBZA 3K9BA 4HMPA 4LX0A 2AG0A 1VG9B 4QARA 4XWAA 3UUEA 1P5FA 1M2FA 4D9FA 1Z6PA 4Z1MD 2RMKA 5DM1A 5HXAA 4RDHA 2VDJA 1CY2A 4CMIA 4BZPA 2NUTA 4LE1A 3TGLA 4H3SA 1FE8A 3JWJA 4G36A 3ON5A 4X54A 1OXBB 4GWLA 4V03A 5FO0A 1EDZA 2HCBA 2WTBA 3BVPA 3LFHA 1A9OA 3MJSA 5J4VA 2YDXA 3CVXA 1KERA 2OWEA 3TL3A 1WP9A 2TMDA 2D1RA 4DLAA 3RPEA 3LCVB 4NEQA 3DYVA 5EERA 1FP7A 1DAKA 1THMA 3EZLA 3GEGA 3DMNA 2QL6A 2XNCA 1N6LA 1L7VC 3PWSA 4MAAA 4JU8A 4CQNA 3H0CA 3ZQKA 3ILYA 3I52A 3L93A 5JCJA 2XXJA 3OCVA 4CEHA 2XNDA 4H6VA 2ZS8A 4I66A 4PWZA 1CUHA 3LYAA 4EO7A 4NZMA 1AN9A 2G80A 4CIYA 5TQ0B 3EFOA 4YCAA 4XAQA 4UUOA 1CY1A 4WN9B 1I6KA 4J2TA 5TEWA 3ZZ1A 5CLQA 3D1LA 5H68A 3A1CA 3EGOA 1EDBA 2FVXA 4DM3A 2A5GA 3NDPA 3BXHA 4OUDA 1KP2A 2X2OA 2IC5A 3GPIA 6PFKA 3DMGA 4BXOB 1W73A 1FRZA 2BSQA 4PEVA 2PKYX 3FCCA 3AUTA 3G9ZA 4FC6A 5KJ6A 1RW4A 4JL8A 2IS6A 1T2DA 1Z5PA 3MCWA 4XX0B 1OW3B 4R68A 2EL7A 4OKIA 3ZHQA 1IULA 1Z62A 1V6SA 2O6LA 2Y0BA 3CZMA 1Y7LA 2CLEB 4IWXA 2ALJA 4FZVA 5DULA 4BCBA 4D3DA 3W2GA 2OAP1 2ZETA 1SC3A 2AF3C 3FJ1A 4EPXA 4CM8A 1VCIA 3CNNA 3D7SA 4FNMA 4DG9A 5H02A 4BNUA 3LUCA 5E1MA 4XPIA 4FVTA 3LC1O 4GC5A 2XUKA 1QIGA 4FYIA 4ZYTA 1I4OA 5HW0A 1X9HA 2B3TA 3KR2A 1USUA 3A14A 4KVAA 2Z58A 5K0SA 2HDHA 1IPEA 2YJTD 3JQ9A 3CGWA 1Q0UA 4I4TA 1L5RA 3VUEA 4RPJA 3SI7A 3UJPA 1SKMA 2FWMX 3FJOA 5ER6A 4WKBA 1I2BA 3ZNNA 2EEZA 2K6GA 4NS1A 3V2UA 4JR1A 1ADBA 3D6JA 2J9ZB 4G1VA 4PRZA 3CVUA 1SG0A 3EZYA 2Z2YA 2AR0A 2LIVA 3VH4A 3BAFA 2PYDA 2PTGA 3G68A 1IN4A 1SB8A 3PDWA 4HEHA 5ALEA 4A0HA 1XALA 5EZYB 2JB9A 3RG2A 5IXSA 2F55A 4LZNA 4RHUA 4TV9F 2E5FA 3SAJA 5CK5A 1S7GA 3WXMA 4ETNA 5AM3A 2L69A 4IUBS 5GONB 3DOOA 4IJWA 2ZUEA 3WWZA 4O5AA 1EESA 2NSDA 1GNTA 4K9MA 2RH8A 3WP0A 1SOWA 2W6CX 2ZKIA 2Q3LA 1LH0A 5EZ5A 1Z4LA 2IRWA 3OEED 1MT0A 4JT8A 4PPYA 3I9NA 4FSHA 4UM9D 1D2EA 2EWVA 1SNYA 1MOZA 3FDZB 3M2TA 5G4LA 3U3XA 3WRVA 1KTIA 1G17A 1K5GA 4FWBA 1V6AA 1E2NA 3QG5A 3K4PA 1RE1A 4M54A 1SU4A 4DVGA 1RZ3A 2JHCA 4GPZA 3V1LA 3IBYA 1ZL2A 4GP6A 2CCKA 3CNLA 1E2FA 2GJSA 1BQEA 2JI7A 3BL5A 3FW1A 3HA7A 1OFTA 1GNPA 1KY4A 1L1RA 2RGXA 4EJMA 2C8LA 2J85A 1T1JA 3G3EA 1GUBA 2WTEA 2OGSA 4MWZA 1PGQA 1G8FA 2P6PA 3VHLB 5I7OA 4EVSA 3LX8A 8GPBA 2ZPAA 3EHDA 4O25A 5JS1A 1XK6A 4C0JA 3Q0EA 3AUXA 1OJLA 2VHXA 2C8KA 4M21A 4ALIA 1HG0A 4ZZ3A 4B3MB 1LRJA 4QHTA 3N2YA 3RRBA 4QYWA 3MMSA 5KHLB 3ZU4A 4NG4A 1QH1B 3HN7A 2PSHA 1SVIA 3HCAA 3THYA 4F84A 3WLJA 1PN3A 1Q1NA 2HJGA 4C0KA 2PT9A 3RSQA 4ED9A 2ID4A 1BGWA 4IJMA 2H85A 4LZJA 4YAIA 3RAEC 3G2NA 1C0EA 4IIXA 4F2PA 5TQ2A 3C24A 1NG9A 2VZ9A 3UNXA 2H5LA 3GVPA 5JZVA 5HKKA 1X6VA 3AERA 3IKJA 3AF5A 3RIMA 5L40A 1Z2EA 4OH1A 4UU7A 5I48A 1V37A 2EBWA 2W2LA 3KHKA 2J7PA 1M2NA 3ZDDA 4QBKA 3N74A 2E9SA 2JFNA 4OFXA 4N7RA 2W0MA 1OXUA 1J8QA 1PK8A 1OKKA 1Q0SA 2QLJA 4KTTE 4NTZA 5ENZA 2VTBA 4F56A 2OORC 2OCPA 3IMCA 1V48A 2WT4A 1KI9A 2VYNA 1JV2B 2FHPA 3OU6A 1V3QE 3PEEA 1R8QA 2ISCA 2I6XA 3SYLA 2CWWA 2WF8A 4QHYA 2BSXA 1V9CA 3W5VA 3O8LA 1U0SY 4JUCA 5CK4A 1X19A 2A84A 1EYZA 2FJUA 3EVTA 2P3QA 4DOMA 1LQ2A 3KG2A 5A9TA 4RK1A 1IXSB 4LBZA 2XUAA 3CSSA 2IUTA 1G3RA 3HA5A 1GUFA 3CPJB 5DWQA 3I2GA 2QN8A 1ODKA 1KAEA 1Y8RA 2WB4A 1N5OX 1YH3A 2WU8A 3LXRA 4MRPA 5HQ3B 4EI9A 1QKKA 4NV1A 5FOTA 4BDSA 5LD2C 1GZ3A 1D1PA 1FFCA 1P4RA 1PZFA 2YHSA 3UAXA 3BYZA 4I4CA 5BP7A 4LDAA 1Y5IA 2Z98A 2R5WA 7MHTA 4XWTA 5J1SB 1MO3A 4YUVA 4EI7A 1XD8A 2P65A 1IK6A 3FPHA 4P5DA 1TAHA 3AF1A 4IHJB 4JHLA 3WIOA 4CIDA 2H06A 4LE2A 2JGFA 3G85A 2IOQA 1KO4A 3NALA 4L9RA 2IHYA 1N36B 1PG5A 2Q1YA 2NYUA 5DXJA 3WDLA 2WLTA 2X42A 1ZEJA 1PJ4A 3C45A 4QD3A 4B6GA 2UUPA 2J3DA 3F6PA 3WP1B 5LZ9A 1O94C 1TZJA 2HK9A 3MFYA 4BLTA 4HFNA 4EG1A 2EP7A 3W3AD 4YV0A 3RHFA 1SWVA 4GM0A 3ZD8A 4CM4B 5LQCA 3GWZA 4KQHA 2BYTA 3FETA 1RXEA 3ELDA 2CHGA 1YACA 1K8QA 2HRCA 2VQ6A 4DAOA 1N0UA 1LLUA 4DA0A 4XYEA 3T5TA 2ZRQA 1HFWA 1U04A 2WSYB 1R0RE 3N07A 2OYRA 3UH0A 3ORQA 2E0IA 2Q9AA 4O02B 1KJWA 3BGOS 5I5GA 5J9FA 1FL9A 4YJ2B 4N7JA 1NUPA 3S2FA 3PQ2A 3ZE7A 1P77A 3BE5A 4BX2A 4GVLA 5GTDA 1TC1A 2NSHA 2V4UA 2CXQA 3V2HA 4TUYF 1F0NA 4ERXA 2HREA 1D9ZA 3KJNA 4TWAA 2I7XA 1IN6A 1O8BA 4BV9A 1PV1A 3ZE6A 1P61B 2C7GA 2OCDA 1DO8A 4ARSA 4EGQA 4KITB 1E7WA 1DDOA 1YWGO 2XZTA 3SSOA 1NW5A 4W5TA 2BI4A 3N7UA 1TYDE 1GITA 1NBWB 2EWMA 1SKYE 2ONCA 3AEYA 2WWWA 1G2OA 1YCHA 4M9RA 4MLPA 5JPDA 3AWIA 3EMVA 3NDIA 4MA5A 3IV7A 3UCFA 3UPUA 2YXDA 4AKTA 3BN3A 2VUSA 4TWRA 2HQ1A 1TZKA 4NU0A 3VYTB 5DNCA 3C8HA 5EE1A 2LCFA 2Y92A 1WMSA 2PTHA 1CIJA 1H1LB 1PQWA 3O47A 1VYHA 2C5BA 1IB6A 3QUAA 4PYKA 4XJXA 5FXMA 5AO9A 1WCIB 2CKDA 2BELA 1T9BA 2ACEA 6LDHA 2XB2A 2BTOA 4LK2A 4LBWA 4HB4A 1CUXA 1RRPA 3RSHA 3SXJA 2XUPA 2J9RA 4FS8A 4O4IB 1YXMA 3S2YA 3BL8A 2HO5A 1LPOA 3FPLA 3RFFA 4BP1A 1KGDA 2V0GA 5L9AA 2E4UA 2P9GA 1CC1S 1L4LA 1KYWA 2ZJ5A 1QF7A 2NZYA 4BGIA 3KKZA 5LB2A 2O4UX 4PQEA 4QOIA 5C1OA 4I7EA 1TTPB 1YS2X 4Q15A 1R0KA 3T7KA 4BS9A 4RADA 3AR7A 1Z8FA 4H31A 4CQJA 2C4UA 1NXXA 4L72A 2DUNA 3WV5A 5JHGB 1IHOA 2XUQA 4HLNA 3GXBA 5HFNA 4JLNA 4LOHA 1JPJA 3G7SA 2A88A 4LRYA 3V7UA 3K6SB 3S29A 2CVOA 4MIKA 3K2BA 4KK3A 4QNNA 4RAQA 2CFSA 3N3BC 2BEUB 1RWNA 1TPYA 1PL8A 1NA5A 2GRUA 2QD5A 3RGWS 4BYMA 5LWHA 1WUIS 3HJHA 3IBCA 3FPEA 1T2FA 1TIBA 4U7PB 1IQPA 1RJFA 3EEQA 4RFVA 3EEOA 3VV2A 3ZDAA 5IKXA 3TQIA 1OAOC 2F2TA 1AV7A 2GA9A 5A7GA 1QKIA 1FUYB 2QTVB 2BBOA 3NTUA 3PWTA 1DJQA 4ZT4A 3T15A 1IK4A 3P8ZA 4URUR 5M2QA 3KT0A 3EQ6A 1U1CA 3CRQA 4NDZA 4EEXA 1T25A 1YL7A 1HNXB 3H1AA 5AM4A 5C5DA 4YRRA 2J1LA 1E79D 5JJKA 1KHTA 2WUEA 1YQQA 2FI1A 4A8PA 1XVVA 3IBSA 4E07A 4JLJA 4LDRA 2BM1A 5I8PA 3AL0C 4PXYA 4E5DA 521PA 3AU9A 3RVLA 4C0BA 3RF7A 2A6PA 2WAYA 4GMXA 4IS2A 3DKPA 4WESA 2FX2A 4Y7CA 4ZHQF 2AMFA 4QNMA 4B81A 1WB9A 2ZRLA 3UMMA 4PG8A 4MI1A 3B53X 2PPVA 3H5OA 3NHJA 2UZIR 2QNRA 1IAQA 2YHUA 3U62A 2PFSA 2ZU6A 4BLPA 1IBLB 3FZYA 2GNPA 1M8GA 3A2NA 1SCIA 1PDOA 1MJGM 3DZKA 3VBEA 3VR1A 2PZAA 2Y93A 4PQYA 5TSDA 1ZYUA 1MVNA 1CCWA 5ITVA 2XBMA 5HK8A 3R8FA 4ZK2A 3QWFA 2CJPA 2PUTA 3FIUA 2R8RA 2ZVPX 1Y6FA 5K0FA 2Q6VA 3MILA 5A4KA 1QZXA 3PD0A 4M98A 2X15A 2E5LB 3GRYA 4KGDA 5IDWA 2YNMC 2B1JA 4QO8A 1P3DA 2XECA 4C01A 2Q3BA 4QDTA 4AJ1A 3E7PA 2PWZA 4PSDA 2WJJA 1JHOA 4V39A 3VSAA 2ZCVA 1ZLYA 2PXXA 3KSMA 3S8YA 2A33A 5DV9A 1L5LA 1E58A 3PJDA 1Q6ZA 1RWWA 3KUXA 5EMJA 1M54A 4OXQA 3U1BA 1L5VA 4JIGA 5A2QA 2M1ZA 2PYIA 4KR3A 3AJ9A 3A3YA 3OFSA 1P81A 1BC5A 3AKEA 3JQAB 2ISSD 1LI7A 2HHCA 2PNJA 4BN4A 5C4MA 5JXIA 1NJ8A 5LYJB 1BXGA 3KQHA 2C3PA 2QVXX 5EI5A 3C5WP 4MMZB 2NX2A 3GJ4A 4GT1A 4LOIA 1DJOA 3CH4B 1P6UA 3HFSA 4HAVA 2CLMB 4BMOB 4DRZA 5LSAA 2A0UA 1WVGA 4NCIA 2BFDB 3HG7A 4IGAA 3UAYA 3ZGVA 3T41A 1YZFA 1IZ9A 1EXWA 3TECE 1X9IA 4GLOA 5E9JA 1H1DA 3SYTA 1SB9A 3SC6A 3A9WA 5DYTA 1NBEA 3FLBA 3BQ9A 4H6WA 4LYAA 4XEUA 4E08A 1Z0IA 3U7FB 5BXYA 1CJSA 3GY0A 4ZQFA 3BRWD 3H5AA 1IZ7A 4OBXA 1Q22A 1XHEA 2ZUTA 3HZOA 5CDUA 3P2IA 1RYYA 4KI7A 1Q2UA 1R5BA 6REQA 1XUOA 3Q10A 1IL0A 3K0CA 2OBNA 4F4UA 1J0EA 3JX9A 1M83A 3K92A 3MRSA 3N28A 4G97A 4JEIA 4J07A 4J3NA 2ZYDA 2IEGA 3OBBA 5EC8A 3U40A 2PKCA 3LC7O 2NP6A 1D6JA 4MRMB 3MLBA 4J03A 3MAJA 4FYXA 4D6YA 4IYJA 3EDRA 4GO1A 3RC7A 1ZGAA 5CH5A 3WLMA 1XNQB 2QXUA 4NE9A 5E38A 1J0AA 2EKZA 3NMUF 5CT4A 3DKIA 4RCVA 3FMIA 5BPFA 2NU9B 2DCMA 2DGDA 1GTRA 1Y0BA 2JLWA 2HSGA 5K6AC 1GSOA 2B4QA 5COBA 1XX6A 1VI2A 1VPVA 1U1FA 1FNMA 4WBNB 1YI1A 3LHSA 3DV0B 3M33A 4PNEA 5FOSA 4U3JB 1ZHFA 4C3VA 1MF7A 1ULBA 2J3LA 3KZOA 4W1QA 2NO9A 3IAAA 3IJ5A 2HA0A 1P9RA 5EKTA 3KQTA 1TC2A 4G5RA 3CRW1 3PL5A 1QJCA 4F9EA 4D2IA 4CHTA 2YMMA 1R4MA 1ECJA 3T5BA 1CF4A 4C05A 2XA1A 3S1AA 2I3ZA 2OORA 4D56A 5I6DA 2NQTA 2ZCJA 1XTQA 3PDCA 1SIOA 1F60A 5EL0A 3AV0B 3ZHSA 5EMKA 1M75A 2O1SA 5MGBA 2JGDA 1NONA 2EHDA 3ITKA 3HH8A 1CXZA 3E8XA 1Y3DE 4FB5A 4KE6A 4LSMA 1IN1A 1Z7YA 4BL5A 3ZEAA 2PPLA 1A9PA 5ELLA 2IXAA 2WSLA 3ENVA 2POCA 3HTXA 1T1GA 2AG1A 4L5CA 3UHOA 5IXYA 3N7AA 3FDJA 1JYSA 3H86A 3ONNA 4GYKA 4YRJA 3FPFA 5JR3A 3RUFA 1OAKA 3AIKA 1W96A 2CXOA 3P27A 2VRBA 2WA1A 2VSYA 2COUA 4UBJA 1LTKA 1GOTA 1CYDA 3PICA 2GASA 2VTEA 3LDFA 3MQFA 4IFEA 4AT1A 5D1NA 1Q7GA 2VDRB 3ADCA 3I1YA 5AI4A 3IRUA 2DX7A 1NJ6A 4JITA 3L4KA 2QY6A 3GMDA 4EGSA 3R20A 4NMHA 3J81A 1PUJA 1G5QA 1JLKA 3LAWA 1ISHA 5CVDA 1BX0A 4MB2A 1LI4A 3PIRA 2COEA 1BZYA 4ZQIA 4JR2A 3OKCA 2PO7A 2X1LA 3YASA 3NCHA 3UCEA 1J20A 2NO1A 4GMDA 3WMGA 2AUNA 1RXSA 1IY1A 3A6GA 3ZXUB 1O94A 2NQ8A 2CLFB 1P91A 3AEQB 3KKPA 4I5DA 4UDOA 4KSYA 1HSZA 3HM2A 2PX0A 3WFJA 3EYWA 2Z4SA 2CZCA 1L3IA 3KT6A 2GZHA 3O82A