1FUEA

Flavodoxin from helicobacter pylori
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
163
Chain Sequence
b'GKIGIFFGTDSGNAEAIAEKISKAIGNAEVVDVAKASKEQFNGFTKVILVAPTAGAGDLQTDWEDFLGTLEASDFANKTIGLVGLGDQDTYSETFAEGIFHIYEKAKAGKVVGQTSTDGYHFAASKAVEGGKFVGLVIDEDNQDDLTDERIAKWVEQVRGSFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Crystal structure of oxidized flavodoxin, an essential protein in Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Electron transport
total genus 52
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2000-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fueA00
4H6PA 4Y7CA 2XOEA 4LTDA 3W77A 1TLLA 2XODA 4J8PA 1T0IA 4ICIA 1CZOA 4CF6A 4YAUA 2AMJA 3D7NA 1OBVA 3KAPA 3OJWA 3W7AA 4Y9UA 2V9CA 3HR4A 3FNIA 4FGJA 1YCFA 3OJXA 1GG5A 2QX9A 2BMVA 2QMYA 2ZKIA 1B1CA 2BN4A 2QWXA 1AKTA 2B3DA 2Q9UA 2V5VA 3B6IA 5LBTA 3HLYA 2BF4A 1SQSA 2KQUA 4QOHA 2MTBA 1D4AA 5TGZA 3NLLA 4YALA 3NHFA 1CZNA 3KEGA 1YRHA 3FX2A 2BPOA 1ZWKA 4CETA 4DY4A 4BMOB 1YOBA 2ARKA 3TZBA 1AKQA 3SVLA 1KBQA 3GFSA 1T5BA 4QODA 1J9ZA 3L9WA 2QX6A 4C76A 4QOIA 3GAMA 3W78A 4XDGA 4ZVMA 3KAQA 2Z9CA 1CZUA 1F4PA 3F90A 4C14A 4XDHA 4ZVKA 4BMPB 4NLLA 1FLDA 1DXQA 4YAOA 1ZWLA 1FUEA 3G5MA 2Z9DA 3JSXA 4PTZA 1QHEA 1RCFA 2MOKA 2RG1A 3K20A 4LAFA 2N1MA 3FW1A 2Q62A 5B3LA 2WC1A 3N3BC 3EYWA 1XYYA 3ESZA 4C0WA 1FLAA 3O73A 4F8YA 1H69A 3NHYA 2M6RA 1E5DA 3F6RA 5LVAA 4C0XA 3NHSA 1AMOA 3N3AC 1J9GA 4LTNA 3QFCA 3TE7A 1AZLA 2F1OA 3F6SA 4DILA 2QX4A 1YKGA 2QX8A 1JA0A 5F4BA 3HA2A 1XT6A 4FGKA 2OHIA 3OWHA 1QBGA 5ULLA 5F51A 3NHKA 2FZ5A 3NHJA 3ESXA 1RTTA 1AKUA 1FTGA 1ZX1A 1YDGA 1WSWA 3L9XA 1NNI1 3UXEA 4H2DA 4HS4A 5B3KA 1CZKA 2V5UA 1XI2A 4ZVLA 3KLBA 4DIKA 5JROA 1J9EA 1QRDA 4GQIA 1BVYF 4N9QA 1AG9A 2OHJA 4GR9A 1X77A 5BUCA 1JA1A 3GFRA 1CZHA 4GI5A 1DXOA 3N39C 5EA2A 5FX2A 2X2OA 1D03A 1SG0A 1CZLA 3OX3A 6NULA 4N82A 4LTMA 2GSWA 2FAXA 3RPEA 1J8QA 1I1OA 1FVXA 3LT5A 3W79A 2FCRA 2OYSA 1FLVA 2FLVA 1AKRA 2FDXA 3FJOA 3S2YA 1QR2A 2HNAA 2FVXA 2FX2A 1FX1A 1YCHA 3NHRA 5NLLA 3OX2A 1AKWA 1VMEA 5NULA 4U7FA 4YAWA 1H66A 1KBOA 3O2NA 3OX1A 1C7EA 5A4KA 3UXHA 1AKVA 5FA6A 1RLJA 4U7HA 3FVWA 4U7GA 2A5LA 1TIKA 2Z9BA 1DX9A 3NHWA 3GFQA 2MWMA 4Y9RA 5LMCA 5LJLA 3NHPA 2FZVA 5EAIA 1V4BA 3R6WA 4S24A 3K1YA 4PTYA 4ZVNA 4QOFA 3OWXA 4QOJA 3ZHOA 5EMNA 2HNBA 1XYVA 2OHHA 4ESEA 2M6SA 4QOGA 3B6MA 3LCMA 5LBUA 5F12A 4YAFA 1OBOA 1CZRA 2BZSA 2MT9A 4PU0A 2Z98A 4LA4A 3U7RA 4YQEA 4R81A 1C7FA 3NHLA 4N65A 4QOEA 3NFRA 2QR2A 3U7IA 2KLBA 3ESYA 2R96A 3TEMA 3P0RA 3OVMA 5LJIA 2W5UA 2X2PA 3EDOA 4FGLA 4D02A 1AHNA 3ES9A 2HPVA 1RLIA 3QE2A 1D04A 5FUQA 4HEQA 4OXXA 2R97A 4NULA 1FLNA 3B6JA 3QFRA 1WSBA 2QMZA 1OFVA 3F2VA 2D5IA 5LLDA 3NHUA 4FX2A 1BU5A 2FOXA 3B6KA 1YCGA 4M0CA
chains in the Genus database with same CATH superfamily
4CDMA 1VZ2A 1F38A 4WESB 3TNDA 4J4TA 3DZFA 1QP8A 4ZHQA 3DLBA 1H0KA 2WJ3A 4G1VA 3AVWA 3A3YA 2XUZA 3PXCX 1GPH1 1UFRA 3G6KA 3KLMX 1MX1A 2W6QA 3DVAA 4FBMA 4YMIA 1R4MB 3V5NA 2I6TA 5AKJA 3TSWA 1VA5A 2V7WA 3T7DA 5BUQA 1ZU5A 4LTDA 4RE5A 3RANA 4GWKA 4W5HA 3A58B 2A1UB 2VH2A 4TWIA 3RRYA 3GV0A 4WEOA 3GOHA 5K6TA 1JMYA 1OXXK 4WHMA 5L4SA 2RGGA 3QOFA 1UOOA 4N0MA 1E4EA 1TCVA 4DUGA 4TYWA 1II0A 2B4YA 1Q6YA 4HEHA 4B8ZA 2PNFA 1HUQA 2RGXA 1QG0A 3HDQA 2ZU0C 3N7UA 1WEHA 2BFEA 2QB5A 4K88A 3SQDA 721PA 3QFTA 3V1NA 3U9LA 2Q0QA 1W75A 2FEPA 3UMFA 4B80A 2WQ6A 2YYYA 1F8FA 4NH0A 2YFHA 1U8YA 1EESA 2E49A 2LTAA 5ETJA 1E2FA 4PM4A 1B0PA 3DE2X 4E09A 1QF6A 3CSDA 2Q4EA 3T4XA 2XUJA 4COOA 2P2YA 2CLDX 4IJ5A 5FULA 1U1CA 1UDRA 1YBAA 2WLSA 4B17A 1Z9BA 3N6RA 1CDZA 2ZVQX 1UODA 5TQ2A 1TXGA 4BQEA 1E0KA 2ENWA 2GSDA 4EY5A 4ARIA 1RHRA 1I9CA 3QF4A 1DEXA 5MHTA 1PCXA 1GA6A 1LNZA 2CHEA 3HLYA 3VSBA 1YDHA 3N58A 3GGDA 4RA6B 3T4UA 4LRTB 4X64B 1WY7A 1HE3A 2A30A 1SBNE 4HD8A 521PA 2C95A 4MQBA 4EVQA 5ADVA 2MTBA 5P21A 4V0RA 1EGHA 4JSYA 1MTZA 1RAIA 1T0BA 5EE1A 3T3IA 3QKSB 3AL3A 3K0EA 1NVUQ 4C6HA 1MG5A 3LXUX 4W8GA 4ZFNA 1V16B 1ZH2A 2G72A 3HGQA 3LNCA 4HP8A 4MRPA 4QJ4A 3ZXUB 4ZANA 3X1KA 2XQFA 2AJ8A 3CNEA 2X0NA 3CEMA 3FX2A 4RC9A 3FMIA 3UAXA 2JW5A 3N0VA 4G65A 4IFIA 4MR9B 1I2ZA 1N8KA 4RHUA 2EARA 1C0PA 1CJSA 1ICIA 4PZ9A 4R0VA 4X8LA 3JQGB 1AQYA 1XMVA 4N3CA 3ORHA 3JS5A 2R7AA 4XOIA 1YR6A 3E9DA 1R18A 2O0MA 4L51A 5JC1A 4KZPA 2F2TA 5D01A 3QKIA 4O4IF 4P54A 4D9BA 3OPYB 1FFCA 5CM2Z 1BFKA 1SCJA 1UC4B 2ZRIA 1NW8A 3AR9A 5HMMA 3WWEA 5H9WA 3JQEA 1CIPA 2G4LA 1YR7A 4XM2A 2W6ID 4ME6A 3FFAA 5CT5A 4B45A 2EFGA 1NE7A 4HK4A 1WMBA 4UAJA 4B6RA 1RRMA 3R0XA 2VK2A 3F4BA 3FR8A 2UYCA 5JSHA 1MG0A 2PGNA 5C37A 1VSBA 5JATA 4FDTA 5T3UA 1XZCA 1QH8B 2HPAA 4QDKA 4JVSB 3G8YA 2H5EA 3BMCA 3BD7A 3NV7A 5AVSA 2OXFA 4GZMA 2P68A 2F43B 1MGPA 3IALA 3O90A 3IQEA 1EE9A 2PVPA 1ECJA 4GMFA 1TUBB 3WA6A 1P4GA 4B4VA 4HMQA 4QRHA 3E61A 1W76A 1YRBA 3FYUA 4P32A 4X7RA 3R7SA 4C2AA 5KYNA 1L1RA 4RTPA 1H2FA 3QUBA 4NCKA 3RK1A 4C14A 1L7QA 4QE3A 3O1JC 4ZVKA 3MCWA 3B52X 3SKXA 1E1QD 4A82A 5CHYA 1JG2A 1P0IA 1XNGA 2A5FA 1DS6A 2BFOA 3OPVA 5H82A 3U6BA 2N75A 3FYCA 2JB9A 3HP1A 2X9LA 2Q9AA 3PXBA 4MULA 4DC1A 1Z82A 2XF8A 2Z9DA 5BPHA 1NW9B 3R8XA 1K86A 3JYQA 3SHOA 1XEXB 4XASA 2LIPA 2NU6B 2EFCB 3DJFA 4FLMA 1V7PC 4J7AA 3BHJA 5J5VA 5U9CA 1VYHA 4AX8A 4O4HA 3PQ7A 3QBTA 3PDHA 3H7AA 3CE9A 1GNRA 2GEBA 3W5UA 3BL8A 2AI2A 1NW4A 2LVBA 2MIIA 2RAVA 3DEHA 4ZDJA 3L92A 3GF4A 1QSGA 1UKCA 3UJ9A 2Q50A 3FW1A 4V2UA 1JSXA 5T8KC 4P3NA 4TVSA 5C1OA 3V7NA 2VR1A 2O8CA 1HDGO 3SC3A 3PQDA 1V7QA 2NTNA 4I81A 4MEJA 1FLAA 1IPEA 3EODA 1CB0A 3TMYA 3DBVO 1U5BB 1M2EA 1N2EA 3GCXA 4I5GA 4RCZA 3T15A 4G37A 1F0YA 3TTUA 4B48A 4F4FA 1L5LA 1RE1A 4TXHA 2B3TA 5GVSA 5HS4A 3DPIA 4CKCB 3VR6H 4KE9A 1EX1A 4AN0A 3I3SR 5H16A 3VMFA 1JLHA 2GPTA 3DAPA 4E46A 1RFLA 1XTKA 2VSXA 4KI0A 5CFMA 2O8DB 2HIGA 2WSIA 1BHJA 2B2CA 3DXYA 5L3QA 1AMOA 3DBLA 1IPFA 2IYEA 1S6YA 1J9GA 3SHQA 2VLIA 4LTNA 5HDQA 3TQQA 2DKFA 1J70A 3BK7A 3P2OA 3THSA 1MORA 1HXHA 1OZGA 5KYKA 2GJKA 5KNDA 5ENVA 1SC3A 1IUKA 2SCUA 4FFLA 4G8DA 4LCJA 2JGIA 2RHMA 4PFKA 1DCMA 3CWQA 2FWNA 4J1SA 1ETHA 1ESDA 4OGGA 1MZVA 1TU3A 5DT9A 2QX4A 1EDDA 2RB4A 1WMSA 1NC1A 3HNRA 1UKEA 3QY0A 3ZDFA 5HKKD 4NSNA 2B6HA 3TQHA 1IB6A 2VP5A 4FGKA 3W7VA 3WL8A 4LG1A 2I76A 3OCUA 4EKYA 4EFLA 3I23A 1WULS 3GFOA 3K5IA 1NQAO 1NKTA 2R1ZA 4I1VA 1I4LD 5E38A 3T94A 2IDKA 5EP3A 3WGQA 1ISMA 4O1HA 3RJMA 4LGYA 5FNVB 2YTZA 2AQKA 1A5ZA 2MYTA 2OORA 3SSOA 2P35A 1M34B 4NDZA 1SVUA 4ZJPA 3Q9SA 1Y5MA 5HJ2A 1JF8A 4OHOA 3UMGA 1PKEA 1V26A 1YFKA 1OH5A 3DOCA 1M5UA 2OCPA 4EG6A 2H2FA 3LFUA 2ZZKA 4XQEA 1VBKA 4I55F 3TD2A 5HTKA 4WLFA 1KZ1A 5G53C 3VKUA 1U2RA 4H7EA 4TUYF 1ZR4A 1FOEB 1HZJA 1SD5A 3DXFA 3P7MA 2IF0A 5AJHA 3RFTA 4BVFA 3OFKA 1Y7PA 4Q34A 1MFPA 4BAZA 5B3JA 2OHVA 4HDKB 3PWZA 2HJHA 5DZSA 1Z25A 1GNPA 1EINA 4F72A 2G4VA 1DT5A 4Q4AB 1K5GA 5AK5A 3MSXA 1YE5A 2YMPA 4TTQA 1H8HD 5AUPB 5AK0A 1SMKA 3U4QA 1TK9A 4CG0A 2OA0A 3S2FA 2F67A 1Z0SA 1EHCA 3UTDA 4A03A 1JXQA 3VPDA 1MZPA 5B5SA 2FMIA 2FMUA 3N9IA 3BQ9A 4JQSA 4DMCA 7YASA 4AYWA 3T54A 3MJRA 1G5HA 1IM8A 1QOPB 3ACCA 2DETA 3K2IA 1JEQB 4KSCA 2V3WA 3D4BA 2QW8A 5BQ5A 3REQA 5BWCA 3C3MA 3HBLA 3QWHA 3R0VA 4MRSA 3A27A 4AUEA 1T9KA 3EGEA 5GJVC 1FDTA 4JEHA 4YGXB 3OCCA 4EW6A 5D00A 1HT1E 1JZTA 4M9RA 4P33A 2QD3A 5DLEA 3AETB 2LCIA 5JCPA 2B4TO 2E6UX 1BMFD 1NJ1A 1W0CA 2DPHA 4JI2B 4OBEA 5WRFA 5J59A 2VJBA 2ZCUA 4X65B 1P2FA 2I87A 1ZJ6A 3O4JA 4LW8A 4HAZA 4QUAA 3AQIA 4H59A 1E2LA 2QD2A 4WFKA 4GDMA 4N1AA 1QFSA 2GA9A 4NOLA 4D81A 1JYFA 2GX6A 4NV1A 3I0MA 4PWZA 5ESRA 3T12A 1SQGA 2IXTA 3D31A 4Y30A 4MGEA 1LWOA 1TIBA 4KVAA 2XA2A 2ZWAA 5DYYA 3PQ5A 2WJHA 5DLDA 1DMRA 2DQKA 2Z58A 2Q4RA 3HUEA 4MW0A 1QNFA 4I9HA 4ZOLB 4HLDA 4KUGA 4PSVA 2HU7A 4KCGA 2W22A 3FMFA 1FTQA 3RSCA 4I5IA 5AR1A 1A69A 1XRMA 3S2YA 1JBKA 5I7OA 2OWEA 1FP4A 1YAHA 3HFJA 3I9MA 2ODNA 5AOVA 3U13A 4BO3A 4ERNA 4QUIA 3KT0A 3VZPA 4WLVA 4REQB 2HFKA 3W3AA 4F5ZA 5BUZA 4RE6A 3LQYA 4HWTA 4RVNA 2OHGA 5AHKA 3G9ZA 1L7AA 2VHZA 3CV3A 4K6HA 3Q9NA 5TT1A 3SICE 1DKPA 5CJ2A 1L6IA 1VMEA 4PSAA 2QOEA 5T57A 4TQGA 2IH2A 1J1IA 2SKDA 4D9HA 4Z0PA 4EQ6B 2QAGC 1WAMA 3BIXA 4EP1A 5JYCA 1RD4A 3HACA 1AKEA 4XVCA 2ZVJA 1BGVA 3WMWA 3PCXA 4A0QA 5KREA 4G4GA 4JFRA 4DCGA 2BTEA 1L9XA 1JIKA 3P9QA 5L8VA 3GROA 3BXXA 4JP5A 1V9SA 4IJMA 2X22A 1M2HA 2JAOA 5D3QA 4M0MA 2EBFX 2XXAB 5IKOA 5HEKA 5I8WA 3B89A 4LRWA 4J0KA 1U4NA 3UMVA 1KDZA 4JGGA 4N47A 3HCEA 2FWBA 5DPMA 2O5CA 1K3FA 1N3BA 4O2AB 4AY3A 2IXFA 1RLJA 4FYWA 4CDNA 4GPAA 1PV1A 1X7WA 3OM0A 4QEZA 5EIXA 3WMFA 3EVCA 4D4LA 4ZD6A 2GVDC 2R85A 3OIDA 2A5DA 2PE5A 1AXGA 2NTYC 1GYPA 3OCXA 1B93A 2XIJA 1WXXA 3MERA 3O83A 1TMOA 3EEQA 2FZKA 3L05A 4YRTA 1HM5A 2YVLA 5A3SA 3T7SA 1WZ2A 1K5PA 3GLIA 4XDYA 2VAWA 5D1HA 4L02A 3Q87B 2HRZA 2NO6A 1UAGA 2CL5A 3LIIA 4Q4HB 3RQSA 3NNNA 4FE3A 3KT3A 3PNSA 4NTZA 2DERA 1XVLA 3C45A 1OZFA 3D2AA 1V4BA 4MV0A 2H5LA 2IOFK 4PX3A 4BB9A 3MN1A 4W5TA 4UQOA 5M34A 4S1NA 4AJ2A 1L4UA 1IUNA 2V58A 2VA9A 4ZIRB 2GRUA 4NQZA 3C6KA 1RMTA 3DEZA 1Y8AA 1W48A 3A9SA 3VPBA 4DMMA 1IQRA 3EWSA 4HTFA 2WF9A 2WYVA 2Q9BA 2BM8A 3FNGA 4MOWA 1PF7E 4J4HA 4A8PA 4EJFA 4L27A 4MW9A 5CH5A 3E15A 4ZAGA 4HB0A 4ZCQA 1LTQA 2BL4A 2FUG1 2OHHA 3NEYA 1A5SB 4HRAA 1QM5A 4TYPA 5CVVA 5EXPA 5EIAA 3ASUA 4XM0A 3ZXIA 3BSFA 2CEKA 4OMCA 3TTYA 1A71A 1XALA 3SM9A 4YCMA 1SU4A 4FQ8A 5HQJA 8LDHA 5FPKA 3Q1KA 3SR3A 1L8AA 3F5QA 4HJRA 4AMGA 1HNZB 3VKWA 1WTAA 1SXJC 4WL0A 3ZY4A 1XIVA 5JNRA 1Z6TA 3OKFA 1T3LA 4KIUA 4L7QA 1TMYA 1NI5A 2FSUA 2W2KA 4ARBA 1W1WA 1X80B 2ZRGA 3U37A 1H65A 2P4UA 1MRNA 2M1ZA 1O6FA 4MWOA 5F2EA 5BN4B 3UKOA 4Q1EA 3W1VA 3N70A 5IC4A 3K7EA 1RXSA 4HEA1 4TKUA 3UJDA 4ZQFA 1ID8A 1DAEA 4E3ZA 2PBZA 2BFWA 1IVNA 4FXOA 4ZOBA 4DJFC 5I5GA 4DRXB 1E98A 1MX5A 3EZXA 3HP7A 3FF1A 2WZBA 3M4YA 1LB1B 3OHSX 4R2KA 4US1R 4LA4A 4ND1A 2QTMA 4G4SO 4G1EB 1Z8DA 1TYEB 2Q5OA 1PQ4A 1ESCA 2YWFA 4LYGA 1O8BA 4N65A 3VR4H 5AM5A 3B9RA 1A7AA 3HSKA 5DGHA 1Q44A 3M5PA 1EG2A 2BHSA 3E22A 3NFRA 3ZWQA 3IP7A 1BVRA 2VBIA 2BGUA 3H9JA 4OM8A 1DIHA 4NATA 4RNDB 3A31A 4A2QA 3NM5A 4IYRA 3F7TA 3IAM1 1DIGA 2P5UA 5DBIA 3ZX5A 1KOFA 3SYKA 4H9GA 4NZYA 4UC0A 1ZMXA 2G1AA 2A4KA 5FKJA 2D00A 5HBRA 5F64A 4DLKA 1K0UA 5IDVA 3ZCPA 2VTDA 1MAHA 1LVUA 3HXTA 3AOGA 3PI7A 4G0VA 3K0AB 4KBYA 4GT1A 3GNQA 4I1OA 4WKPA 1RJWA 3DE3X 3WWDA 1FLNA 4YRJA 5JS6A 4BCBA 4C6TB 3QFRA 3ZD9A 4R2IA 4J43A 4Q7JB 5ADHA 1PYGA 3F2VA 4LVCA 3F5FA 2JD2A 1H4TA 1NF8A 2JH8A 2YVKA 3UJ7A 1JAXA 2IBSA 2FJPA 4L4YA 1OLOA 1V3TA 1BHQ1 2L18A 1SU6A 2DY1A 3K96A 2YUTA 4GXQA 4Q4JB 5IEBA 4BBJA 5A5FA 3U6KA 1BEUB 1IN1A 1AGYA 2IPNA 1H2AS 2IS6A 5LKAA 2AG0A 2QY6A 3BBPA 3GJQA 4WESA 4TS4A 4WNCA 1TOAA 5K3SA 2VHUA 3RJTA 5INTA 3MJFA 4WAUA 4GX1A 1CX9B 1C7IA 2VWHA 3IKLA 4G0OA 3UYLA 3T38A 1Z6YA 1L4GA 2QJOA 4XLZA 4B2PA 1JBQA 4AMZA 4KUEA 5IC5A 2WVAA 1XTIA 3OTWA 2IH5A 2ZB8A 4FYKA 1A4XA 2PK3A 4ITUA 1UF9A 3M49A 1L5HA 2KI5A 1FL9A 2NW6A 4D3SA 2D13A 1AMNA 1DAGA 3IO3A 5DOZA 3D59A 2JGDB 4QUBA 1DELA 1ZOIA 3HDJA 4ZCSA 1FNDA 2UZ3A 5F1PA 3SXUB 3UMJA 4DKJA 4JMLA 2IHKA 2ZTLA 3AB3A 4JBYA 3JQ8B 1R9NA 3QP9A 3CH6A 5J58A 1U0NA 1WIWA 1IH8A 2H48A 1K6IA 3IT3A 3MW8A 4Q12A 4Y2YA 1W52X 4KXYA 2QLMA 1I3OA 1RXUA 3OCWA 1YQWA 4L2IA 3W7AA 1V8FA 2JHCA 2FCAA 1KDVA 5JSQA 2ZT6A 1M5RA 3OJEA 3FNIA 3ND6A 4UPEA 4MV8A 1DDOA 2ROQA 3CLRC 3GLUA 2Z1NA 1E3LA 1SVLA 2E4XA 3U17A 2FW8A 1GR1A 1GZ7A 1KXJA 3A10A 3Q8WA 1OKKD 1DBQA 4BO2A 3TD6A 3ZGNA 3NTQA 5I9NA 3IAHA 4RULA 1VG0B 1J0AA 2B98A 1T8UA 2IYNA 3PG5A 2CL0X 3CLTD 1LPPA 2RBKA 4K03A 4NJOA 4PV7A 1P4SA 2PZMA 2VPTA 4TV8B 5F5NA 5KNLA 2GDZA 4L07A 4WJZA 3W5IA 4JUBA 2BCEA 1JXMA 2V6BA 1JR3E 4KC0A 4RVOA 4LF5B 1JE1A 2Q5IA 3MJDA 4HH1A 3TFWA 2R6DA 2H1VA 1UBRS 3VZRA 4JDUA 3WXBA 3IE1A 5BSMA 4MUYA 3OMXA 3ADKA 4OMFG 1JT2A 3O84A 2HSWA 2X8JA 3K09C 2VHEA 4DRYA 3HDVA 1J0CA 1RBYA 3D2BA 5L3RA 1NBEA 5D7BA 4C04A 1KEVA 5J4KA 4DDVA 4AYXA 2VQ6A 1EFRD 1OW3B 1X2EA 3LKZA 3EXG1 4LMPA 4YMTA 1Y3IA 4FNMA 5A9TA 2WHRA 3T3MB 2QRMA 2YIJA 3VHRA 2CHFA 4XX0A 3E81A 3JQGA 1R9JA 1RYEA 1Y80A 2AUNA 4UNSA 5DK4A 4JJIA 2AOTB 1V0JA 3LP6A 4KRYA 1F48A 1Q3KA 3OZRA 4XYMA 3H4TA 2VTVA 4G0UA 1GYQA 1AHHA 3BMQA 3LI2A 3PLRA 1EI9A 2J0VA 2JFYA 1IEWA 4D6XA 4IV5A 2EJWA 3GBSA 1G16A 2VIIA 3E23A 2HRDA 3HCCA 1Y4DE 2J41A 4OBXA 4EKEA 1ZISA 2DQYA 2KBEA 4EWLA 3D1LA 4OAOA 5HR5A 4Z0TA 5DGDA 1L4KA 3TZBA 4Y6OA 4RJIA 1QH8A 3ED5A 4WERA 2GEVA 4IS2A 3D43A 1PR3A 3ROEA 3VU3A 3KE9A 5J5CA 3WWOA 4BQRA 2VSQA 4JXXA 2KSQA 1W36C 2NAPA 2ZI4A 1CUVA 5IJAA 2ZXEA 1JQJC 5BQOA 1HEIA 1JL3A 2SKEA 4ZVTA 3LO8A 1XPJA 1L5FA 4J9UE 4PGAA 4XGQA 2R00A 2A9JA 3EUAA 4OHZA 5BOSB 3EJWA 3TOZA 3UWDA 4DARA 1QH9A 4EKDA 3ZKWB 1XELA 2C5HA 2JFQA 4F5YA 5IAAA 4CMEA 3RREA 4YQYA 5BPFA 2INGX 5EIBD 4UTPA 3GAZA 3QU5A 2DPYA 2WF6A 1PFWA 4OIMA 1R64A 4B3XA 1NFFA 1N5DA 1OIVA 1J39A 3OZAA 4FONA 4BO1A 5HK9A 3K6JA 4A8JC 1UWVA 3EEOA 4C87A 1SHLA 1USWA 1ELOA 1UBFA 1EVZA 1P1CA 3AHIA 3KOUA 4H7FA 1DG3A 5KYXB 3BGWA 3ETHA 4NLLA 2IPXA 1TEXA 2QG9A 4BLQA 4BEBA 1DJLA 5EIHA 4XUDA 1F8XA 1FRZA 3HA5A 4FYPA 4UARA 5JDIA 3PGKA 4FP9A 1T2DA 1XZLA 2PRIA 2VRNA 4MB2A 1GO2A 1JEDA 4HN4B 1U1EA 4OU5A 4RWEA 4YRMA 3IEVA 1SGWA 4ESVA 4L8VA 2P1DA 4LHXA 3KJGA 2WM3A 3ILXA 5TRTA 3LQ2A 4ERXA 5EFOA 4HXGA 4ZYXA 4MGKR 4NHEA 2W6PA 2PEYA 1P0CA 3K20A 1WX1A 2OQ2A 1Z0AA 1G6Q1 4D82A 4KMSA 1PI3A 1ZZGA 2N1MA 4H7KA 4YJHA 5IJXA 4ASUA 4EX6A 5BXQC 4IDEA 4UCXA 1M0TA 4W1RA 3LUDA 5JO0A 2GDJA 4Q7KA 1E6WA 4FR0A 5H7XA 3EYWA 3JVDA 4C03A 4CW7A 1DMSA 2B7BA 5JPIA 1KO8A 1NYLA 3QI7A 5GMOA 4C0WA 2B5VA 3E0XA 5JH7B 1T5DX 2JIQA 1YTLA 4MXDA 1TUIA 2IELA 5FNZA 3MELA 2WABA 4KXVA 3ED1A 4JN6B 1XEFA 4R1NA 3C8HA 1OLSA 1EYZA 2FKNA 3GN1A 3A6KA 5DT2A 3A2KA 3DDUA 4DOMA 1WZCA 3RODA 2ZRCA 3KD3A 1W88B 3VI3B 2G25A 3TLAA 1RRGA 4FIDA 3LDAA 3MF4A 1PBTA 4ILKA 3SBXA 1TL7C 4MHOA 4FDAA 3EF3A 4ODIA 3IJRA 1TJNA 4PPQA 1YZNA 3GXOA 3TCNA 2P3OA 4UFNA 1KNXA 1OJ7A 2I33A 1RC1A 4FHCA 2GAIA 4OXKA 3ROKA 3RRNA 1C2TA 4U8GA 4K86A 5DHAA 2I65A 2C7QA 3OZSA 1CHNA 1GPKA 3R4CA 5DHSA 3HCBA 4W1QA 4RF5A 1M0SA 2V7UA 3FKSD 4UU7A 3WMEA 4DILA 4U6QA 1DTWA 3S81A 1LPNA 621PA 4OI2A 2YWJA 3M3DA 3IUPA 1E2QA 2DBQA 3UK1A 2II6A 3HMQA 3T06B 5B6IA 1GSIA 3W2EA 1OR8A 2C9OA 4J9VA 1MC4A 3BXPA 3CMCO 3FF4A 1Z4LA 5EE3A 3ZWCA 4JSTA 4PFJA 5HIKA 4BCDA 4PEVA 1U81A 2H8KA 3B6EA 3RSHA 1S8NA 1PNQA 1AZSC 2KBFA 3GPCA 2ZJ7A 1NN1A 1VE5A 1Z35A 4GMXA 5CP8A 4ZPXA 3NAGA 4H6XA 3EVFA 4ZK2A 3GDOA 5D85A 4M6WB 5F77A 5FR2A 1ZNZA 1H6AA 4PQEA 5FOVA 3PS9A 2WTBA 4F92B 4Y1FA 1J0DA 3BE6A 4YP1A 1QCCA 3OCVA 1UK8A 1WSWA 4IXTA 1H6BA 1I4OA 1FSSA 1ID1A 1WMFA 1IN6A 2KB0A 2GAJA 2PKXA 2AJDA 4TN5A 5DGXA 4I66A 4C9BA 4HRVA 2A0YA 4XPZA 3I6QA 4W6QA 3OHMA 2GT1A 5BMVA 2FXVA 3CYFA 4LJ4A 5A05A 2UUPA 5JAHA 4L4ZA 4H2DA 2C2OA 1RHJA 3MS2A 4KXMA 3UMCA 3DXXA 5CM9C 4ZARA 4DCSA 2GFIA 2MINA 4LRXA 1IOWA 1U9IC 4BN5A 5TT0A 2P9CA 4EL0A 3NH6A 3PXUA 4GEGA 4IZOA 1GZSA 4ALIA 4D79A 2PG3A 5JXIA 2R48A 1HY3A 2JLYA 3GFBA 4Y67A 4R9NA 1IY9A 2O50A 5CLGA 1CIJA 4D0NA 4K5QA 1C0IA 1DWPA 2EWWA 2O4CA 1BX1A 3TAHA 3BH6A 2FPKA 2PBRA 2Q28A 1GPNA 3F9RA 4QXRA 3G68A 4ZCLA 3U39A 3W9UA 3GRVA 1DRJA 2KMLA 4FR5A 4LBVA 1VG8A 1RLTA 4U9HS 4IDOA 5DHTA 5ALFA 4HWKA 2Q7OE 3TL2A 4DBLE 1NVTA 3JY6A 2QSUA 3RGGA 3SF8A 1P1KA 1IHPA 1GPBA 4JL5A 4KDRA 4REOA 3W3AD 3FUXA 4A6PA 1JX6A 1UINA 2FMKA 1CUYA 1E7QA 5EMLA 4B8YA 4GI5A 4GX2A 4Z4QA 4HZUA 2RGYA 3L4BA 2X2OA 3FCAA 3IEPA 4N3AA 1GDHA 4YB8A 3RYCB 2CV1A 1FMJA 2GPNA 3KHSA 2OFOA 2D7DA 5AVVA 2BTQA 3GRAA 3IA7A 1E5TA 2REQA 4URWR 2R7LA 1Y3HA 2GD0A 4X93A 1S89A 3ZDXB 4PTLA 3CPEA 2VKTA 1HTBA 3FZNA 2WSBA 3HLTA 3D6AA 4DJTA 5BV0A 1C3XA 4ZOLA 1IG3A 3WBFA 5TIIA 2HF9A 5FNVF 4N0EA 2NVOA 3K8ZA 4OI4A 2F9FA 5ICMA 4HNTA 1GSAA 1RAGA 5BR7A 3UMYA 1V1JA 1KTVA 2BDUA 2RHLA 3DE4X 2BE7A 2I3DA 3MMSA 5CXXA 4ZZ0A 4AZTA 2QUHA 3VPFA 3K70C 3L5OA 5CITA 3VNVA 4KBFA 1PWXA 3E4CA 3RG2A 1G7RA 4C5CA 4EGAA 4ZOEA 1CQIA 3SZRA 2BZ1A 2H2GA 2A3RA 1AX9A 4QNRA 4CQJA 2Q6LA 2BT4A 4M3NA 3ZHZA 3MTGA 4KTVE 2RC6A 2DKOA 1O95A 3L77A 3R4VA 4PYJA 2JJYA 2C59A 2ZJAA 3HB9A 1W2GA 1U28C 2RAUA 3F6CA 3LD9A 3DHVA 4FFWA 4KPGA 4YAWA 1GZ6A 3FHLA 3OO1A 1SEVA 4S2EA 2P90A 4MP6A 4FWIB 1M33A 1T43A 2A0FA 4FOTA 4KN5A 4M55A 4NOJA 3KYCB 1E2HA 3LQQA 4ZOQI 2HBZA 2CEAA 3HBAA 2G3YA 1SXJE 3KOWA 4QDJA 4ZRDA 3AR6A 5BSUA 1J2UA 2FG7C 1Z08A 3B13B 1NF9A 2RDMA 2W83A 3I01A 2I4IA 3PX2A 4PGFA 5AKXA 3GDHA 2XXAA 2BLNA 2DBRA 2NO1A 2OV8A 3G2MA 5KSWB 4L5CA 4RLQA 2ZSBA 4JLBA 2PAFA 2QGZA 1NATA 1UFQA 2N1BA 4IJVA 4O2AA 3GCDA 1Q0LA 2FUKA 4FB4A 2OZLA 2GD1O 1ZD4A 4KO8A 4OQFA 3E70C 4GKKB 2RD2A 1P29A 1Y0BA 6ABPA 3QU7A 4QYXA 4NZMA 4U4AA 3NYQA 5HZMA 5AM3A 3H9UA 3MWDB 1TIKA 5E6UB 4ZVVA 1P2BA 3DVRX 5REQA 4AW9A 5BXYA 5JWOA 1EHIA 5LUBA 1G66A 1DG1G 1HNXB 4RHEA 4JBGA 3IBTA 3RUFA 4F4CA 5LZ2A 1U8ZA 3A06A 1QG4A 4M89A 3WL3A 2MWMA 5KYWA 5EIEA 2IC5A 3I2GA 4RYDA 4EI7A 3L07A 1WQ3A 3AZOA 4FDUA 1B42A 4HH4A 4LDJA 1C9KA 3HI6A 2VDMB 3IRUA 3V4FA 1QP4A 1DADA 2QX7A 2OAQ1 2Q5CA 1ISFA 2X0KA 2AKAB 4ISBA 4OSPA 5ALSA 1UIRA 2L17A 3TKLA 1NLMA 2HAEA 4NK5A 3PSAA 1ZD3A 3CUUA 1T3ZA 1GUYA 2JD1A 4MQUA 2QXUA 3PFWO 3AR5A 5ALXA 3F9IA 2J87A 2ZYVX 2Y71A 4RO0A 4YI5A 1S2GA 1NBME 1SU7A 1FRVA 4G81A 4L95C 4QNNA 5EC8A 1IAQA 3G0BA 3PC3A 3SLKA 2XIQA 1W4ZA 1J0BA 4C6RA 4UMDA 5C8ZA 4HUJA 5CNJA 2F59A 3GIDA 2I8CA 4M1ZA 3TR0A 4HGQA 3GDGA 2J59A 2NQ8A 1I3NA 2IYTA 3D6UA 4BVJA 3MBOA 4OREX 5JY6A 1FB5A 4C0QC 2C9BA 3H17A 1F14A 2PGIA 1IQUA 1C9MA 2WIAA 4LJRA 2DHCA 4BRSA 1ZQ9A 2LKCA 5E4TA 4MGHA 1QB8A 2XCTB 2RGRA 3FBGA 4W5RA 4F84A 2XCIA 2PSHA 2IKQA 1EWYA 3URKA 1OTHA 3NVMB 3TLZA 3VTZA 1JKJB 1C0LA 3NASA 2Y1FA 5HPYB 3QYJA 4BJ3A 4KO3S 1T0HB 2WYOA 5JJLA 4OHUA 5A0VA 1L8QA 2G5CA 3OIGA 4HMOA 3KRTA 1KQOA 4U9UA 2ZRPA 1JHPA 1OYVA 1N2SA 5ALNA 3VGPA 1KY2A 2ODPA 1J20A 4QOEA 1KYZA 2ZJBA 1U2SA 3ECCA 2E89A 4KVZA 4O2AF 1OI3A 4CDRA 1J2TA 3MLBA 4J0FA 1C1DA 2JLWA 3CF4G 5E9JA 4B83A 5LQMA 2XE4A 2HO5A 1M1YE 2R96A 2WAXA 3LUAA 1CQJB 5EQTA 4M49A 3TEMA 3V32A 5HHTA 4RTJA 3H8SA 2HQOA 2UVPA 5JLAA 4EABA 1FSPA 5FAKA 4KGVA 1BQ3A 4FKBA 3TKAA 1XD8A 1UEIA 4OQNA 1FSGA 3RU9A 1ZH4A 2CFCA 1NL3A 4HG2A 5M29A 2NZWA 4KR6A 1H3NA 3LRPA 4KNVA 1VJDA 3X1JA 2IQIA 2GHTA 4AX4A 1TT7A 3H1TA 3K8YA 4HDRA 2HPVA 3KHKA 4CU2A 3JARA 2WWYA 1GZDA 3OTIA 4C6TA 4CQNA 5DEIA 4Z1MA 4IG4A 1GCUA 3IUYA 1PG5A 1T9CA 4A1FA 3RVDA 5CJJA 3KOXA 5TQVA 2R1UA 1DOZA 4XSHA 3PJEA 1ENYA 1UPFA 1F2UB 3SS7X 5T64A 1BDJA 4JWTA 1Y9EA 3NHUA 4PHFA 4J4BA 4PLPA 4EJMA 4DR1B 3NT4A 2AVNA 1RW4A 2XSZA 1R66A 4Q3DA 4TXLA 3IMFA 4WOCA 2JBHA 5ALHA 4OXNA 2I6GA 3P71T 1CUJA 2QMHA 2BP7A 3HBFA 4ARAA 3DDCA 1EEXB 4KHZA 1ODKA 3AUJB 3EQ2A 5G4KA 1A2OA 1T2CA 4LY6A 2VAVA 3B1ZA 3QRWA 4W7SA 3RYTC 1QZUA 3DCIA 4CL0A 3ZGZA 2V65A 2Q6IA 3NHMA 4DPLA 2PUJA 2QPLA 3A2NA 3PYXA 2AQHA 2GLUA 2EKDA 2R84A 4AO6A 2HA6A 3GWGA 1VYVA 3IP6A 4G0MA 3RYIB 3IXMA 3WSVA 3COYA 1Z4JA 3NIFB 3PTAA 3DOOA 3FPJA 1J8YF 2XZTA 3GCWA 4FR2A 3AVTA 4JKYA 1BFDA 2PKYX 4LBWA 3JQ8A 4G8CA 1PKXA 3MOSA 4I4TA 1E1RA 3O4VA 3FIJA 4FDMA 3GZNB 4G67A 4E22A 2UYYA 3OJFA 3TGPA 4A23A 1KERA 4XVQA 3NIWA 4O4JA 3BSSA 1W46A 4QT4A 5KS2A 4MMXB 4CV0A 4PANA 6CHYA 5HKOA 1QZTA 3ND9A 4RDIA 1M0EA 4F3NA 3RK0A 3OG9A 5JG7A 3ZGOA 3HR4A 3EXHB 3KZVA 4DMGA 1S5PA 1ZHHA 2QTLA 1HYEA 2IZ0A 2PFSA 4NENA 2D7CA 2KJQA 4UVHA 1G41A 3BRSA 2XDQA 1W1IA 2QMYA 3K9NA 4LJ9A 1IL0A 1ODSA 1RBQA 4LPSA 3UPTA 4YP0A 2J9XB 3GT7A 1U0RA 2Q3EA 2XR1A 3HPRA 2B7LA 3MSCA 4WXHA 1GGJA 3LX8A 1GFIA 2B3DA 2WWRA 5JC8A 3QEOA 4UATA 1FFYA 2WOOA 1IWBB 3EW9A 1EFAA 1DIBA 5FOSA 2PZEA 2ZQ5A 4YWJA 2YWCA 5SY4A 4BCCA 2P9EA 4EM6A 2IL1A 5IKEA 1T4BA 1U7ZA 3S99A 1H1TA 2ISQA 3WB1A 4N76A 2QE7A 2QW0X 1AO3A 2DFKB 1GTG1 2XMCA 3FCUB 3TL3A 2OZVA 4KITB 5KTPA 1WPRA 2FW1A 3V7YA 4MVXA 4M0KA 1YIAA 4QOSA 4MGZR 1E96A 1IQPA 2FVYA 1RI3A 2VDWB 2Z8YA 3HL0A 3I6BA 2QK4A 4P4NA 4WXRA 1P2GA 5KOHA 5LQJA 1Y1TA 1C4KA 1AS2A 1NQVA 1VMAA 4PBRA 3NEAA 2FV8A 4FSHA 1XEAA 1CZNA 4X71A 1T24A 1TKBA 2GUGA 2RMKA 3ZQKA 4AZSA 4D98A 1VPWA 5JOQA 5AW1A 4P3YA 1AM4D 2C8VA 1OFIA 4L5JA 4DQVA 5HQTA 3DNFA 3TS1A 4ARCA 5GJCA 5JS2A 3MGKA 2EQBA 2J46A 3RR2A 3GLHA 2G0TA 4P2BA 5FWAA 4BJ6A 3IOCA 3VOTA 2IPLA 4PR3A 4AIRA 1H9BA 1U8FO 4ZT2A 5H1YA 3CB4A 2QTTA 1JDBC 3F6BX 4GAEA 4C88A 5FL3A 4Y2GA 2X14A 3WIUA 1ORVA 2V9PA 2O48X 3EZYA 2ODBA 2R79A 4TN1A 5DGTA 3BE4A 3I61A 3BXFA 4GP6A 4ZO4A 2YXBA 3FTCA 5JMWA 2RI1A 4IIGA 2WUWE 1PR9A 3NIGB 1PE0A 1I1NA 1YONA 3RBXA 3V2IA 4RDHA 1DQNA 2WFLA 3PPYA 4GD3Q 1TK3A 3MLAA 3IMGA 4XD7D 3IE2A 1KRHA 1IATA 4MPDA 2HYIC 2P5YA 4V38A 2CHVA 3SMVA 1W5AA 3EASA 2O8NA 3BJEA 3FHOA 3FHTA 1BWSA 1T35A 3LVBA 2DTDA 3IVXA 4U7TB 1SUBA 2DFNA 3CU5A 4FDLA 4BNDB 2Q45A 3PFBA 3KKQA 4CCAA 3FH0A 2JAPA 3EZGA 1UBUS 3NTRA 1DBVO 4C0AC 2DUUA 2HMAA 1CNEA 3L1KA 5KHAA 3KAQA 421PA 4F6LA 5F1KA 4IICA 4PLHA 5CLIA 2M32A 2YS6A 5BSFA 3UA3A 2LD4A 4MQ5A 4JI5B 4TV8F 3DZBA 4YMWA 2QV7A 2ZYRA 5EERA 3VC1A 1WQ1R 3EG9A 1K7CA 3GUCA 4ENQA 3K35A 2IUYA 3J7AC 5AW5A 2HF8A 2WU0A 4ZV9A 5E0KB 1R50A 1CF2O 4ND2A 5C32A 3WQBA 2MMGA 1OI4A 2BKUA 2Y93A 4OVKA 3QLVC 5I9SA 1VE9A 4DQ0A 4BV8A 2F8TA 1Z7YA 4E11A 4WSOA 1SC1A 1G9TA 3AJAA 3FDIA 5JPCA 2OZPA 1CEXA 2WF7A 2JJ1A 2MOKA 3E05A 4AY6A 1L5VA 2V9ZA 3G5LA 3SS9X 5F23A 4Q21A 1VFNA 2AK2A 2NU8B 4OJNA 4ZQBA 4D0SA 3VJKA 3VYTB 3D4NA 1Q0ZA 5KQLA 3ITDA 2Q62A 4IF6A 1Z17A 4YBRA 5HOEA 1JR2A 4LSZA 4CU5A 3E0QA 3EAQA 4CZ2A 1Q0TA 1DXYA 1KMIY 2OLKA 4RV9A 4GX0A 1TU0A 3NZEA 2VHJA 1XO1A 2B20A 3FZEA 4OIFA 1CRPA 4RZ3A 2Z4TA 4A8HA 1HE4A 1H5QA 4MGIR 1MVOA 4RMJA 3E1GA 3NNSA 5D6NA 2GJ9A 5LXTA 3ER9A 3HCFA 3BF8A 5LVAA 5AW2A 3ETGA 1A7JA 3R3HA 5FBQB 4GX5A 4C0XA 1PZGA 2JAXA 2XTJA 1Z88A 1YRAA 4NX2A 3C6YA 4DMUB 2C3OA 1A1SA 2I6SA 2OV1A 4DLUA 3U60B 1XTUA 2IYAA 5EJGA 3I5UA 3WL4A 4RKQA 1OV4A 3O1HB 1D2AA 2PMCA 5JMOA 3MS4A 3N2EA 4RK4A 5CEFA 4EQZA 3OTOB 4FN4A 5LZ7A 3F6SA 1M1NA 3KBOA 3IKTA 4XWWA 2GXSA 1ZI9A 2VYVA 4J0QA 4GUDA 3X44A 3CIFA 4S12A 1J09A 4XR4A 3IIKA 3KUDA 4J0JA 2F48A 3L0SA 1VCIA 4AUKA 2V4ZA 4I50A 2X5JO 3DHYA 4JH0A 3MMPA 1QBGA 1K4YA 3L1UA 3ZWKA 2R1TA 2QN6A 2QLTA 4B6QA 4C7XA 4ECAA 1D4OA 4GWLA 1SM4A 1SN7A 3I4LA 1PJAA 2H4YA 1P2DA 3K1AB 4LV8B 3GDFA 4XJVA 5ARBA 4NIMA 4LZAA 4BVLA 3M33A 2J33A 3DB2A 3FMPB 4C30A 2HIMA 3FR7A 3G2HA 1PR0A 4BXOB 5DNEA 1X7ZA 1HT2E 3QFHA 1VKOA 1QG6A 3LECA 5DNVA 3WYEA 4S04A 2DU8A 3PX3A 3AVOA 1Y1KE 3NKLA 5AJVB 4C6SA 1DKQA 1DSSG 2O59A 3IJ5A 2RHCA 3TQCA 3ZEIA 4DE5A 3DKRA 3CG4A 4PHTA 3GOQA 4BMVA 3LCRA 4WLOA 2AMFA 4KHPB 3PFNA 2HW8A 4YT8A 4UU8A 4YRZA 5AJZA 1U1FA 1DBWA 1GRVA 1OAKA 4Q1VA 5C8YB 3HJTA 1X1EA 3DE5X 3CO5A 3BSYA 1IZ0A 2FR1A 5CDFE 2O8VA 4KYIB 1SPXA 1O54A 1I5RA 1PS8A 1QX3A 3DOIA 3QUQA 1QIMA 5JH7F 5JSFA 5KU1A 4RXMA 4AG3A 1QU3A 3O2QB 2CFTA 3RTEA 1NMSA 3AR2A 2CXUA 2QGNA 2YWXA 1LW7A 1P7PA 5ICSA 3QVWA 4OTZA 1PGOA 1VBMA 3OE5A 2UKDA 3QGMA 4LQCA 2O0LA 1PTKA 2ODWA 2WHYA 4PGGA 2GUWA 3FPKA 3WKBA 4N9QA 2AQIA 2ZYSA 1GDDA 4TOIA 3VV2A 1IHYA 2H4WA 5HSGA 3CW9A 1X77A 4LZNA 2NUBA 5A06A 4YI3A 3CXRA 3DTYA 2QJRA 2QRGA 1CZHA 4Q82A 2WT4A 2W43A 1WXEA 1O94D 5CA0B 5CDUA 4JJAA 4Q1BA 1N5MA 3NANA 1WABA 3BHNA 4NFHA 1Z22A 4E2ZA 1PZXA 1II8A 4QKQA 3FB4A 4F2PA 1CZLA 2A8YA 4CJXA 5L3ZA 4CIBA 4PZLA 1IK6A 3ZDAA 3O3CA 2VUTA 2NV6A 3FMGA 5LR6A 3BWCA 3PI6A 1Q3TA 3Q5DA 4QX6A 4WNIA 5KNCH 2BGMA 4N54A 1CF4A 5T7BA 2ERYA 2PPLA 5H59A 1X39A 1ZA2A 1GUAA 5IX8A 5HZKA 2ETXA 4RH3A 5FLEX 4N0DA 1JHQA 1LQUA 4ESHA 3A6JA 4DIMA 1VKNA 1G55A 1UMKA 2FFBA 3NOVA 4NP6A 2NUAB 1FA9A 2VJAA 2N42A 2RARA 2IRWA 1TLTA 4KTTE 5AYVA 1TF7A 3NB0A 1KH3A 5BVGB 4JYAB 3KOMA 3WNVA 3JQAA 1XRRA 5CFOA 1ATZA 2W00A 2WLTA 3IURA 4IVPA 4EPYA 1WXFA 1X19A 5E2IA 4EY7A 3T5GA 1N8TA 4KRXA 5EPEA 2BC9A 3QM1A 4ER6A 4UM5A 5FL7A 4PO8A 3PFCA 5IBPA 3WIEA 3B1JA 2X6RA 3A25A 1T1EA 4HDSB 1XXHE 4NVRA 1S1CA 2NSDA 3U4AA 2BKEA 1UJ4A 1LI7A 4E32A 5IABA 3BGDA 4B3RB 3KYCA 2IPOA 3RKUA 4J2HA 2HV8A 3KJEA 4AQDA 2BKAA 4AP5A 1ZUNA 3MTEA 4LK3A 3KLOA 4MTCA 3TR6A 4MUBA 5K3AA 1VSUA 3R77A 2YIDA 3UQYS 3O8LA 2I6FA 2B92A 3RU3A 3SYNA 6PFKA 1HMPA 4N5HX 2ZI9A 5J5AA 3HNOA 2FK8A 1SVKA 3QJGA 1NVXQ 2FR8A 3GZTB 4KE7A 2FZ4A 2J08A 3IVAA 3GEPA 2BFCA 4J1TA 4QVGA 3ZS8A 3F6PA 2BLLA 4DR6B 3OUZA 5DI3A 4LXUA 4AQ7A 2YDYA 3UXHA 1XPOA 1Y1LA 1TMGE 9LDTA 2K2QB 5IKMA 1PG2A 4DR7B 5I8PA 1L4FA 1XRJA 1AH2A 2NGRA 3PHGA 4HNAB 5BVHA 3UTCA 2K7FA 1HDOA 3KD2A 1Z28A 4HN2A 3RFXA 4V2IA 1VI2A 3AVYA 3UW1A 3HZHA 4Z4IA 4W8OA 3QPWA 5EIFA 1HFKA 2FZLA 5AP9A 2L2QA 3R23A 2QVZX 2ZE8A 4HADA 4LYEA 3S29A 5DRYA 1JFLA 1LX7A 1VHDA 1JJAA 3L06A 1CUWA 1MAWA 1TK2A 4JQZA 3LF1A 5T4EA 3IT0A 2WM9B 3NUGA 1NDUA 3R09A 5AICA 1RKXA 1G5TA 4LYFA 4M7OA 3IV7A 1JI3A 4A36A 2ZVPX 4AP6A 2HQRA 3VU9B 1X86B 5EYPB 1XTSA 4RVUA 4UHFA 3ZHQA 3AM5A 2I7TA 3G0DA 2LBPA 1M1YB 4IKPA 2OAP1 4QU0A 4CFSA 4G0WA 1W9MA 1V45E 1XNRB 3TRKA 1RWQA 3KB8A 4GVLA 4BX8A 2VCEA 3EMDA 4DR4B 3JZAA 3X3HA 1EE1A 5K51A 3W2HA 4IQFA 3KYDA 4JB3A 4EY4A 1U3VA 4OLAA 1ZBQA 2GRJA 2R11A 3HXKA 4JUIA 1GNTA 1EFTA 4C4RA 5AK3A 4OHKA 1EKXA 3N5CA 2BBOA 3ON5A 4CKZA 1MT0A 1YE3A 3PXGA 3SU8A 3H97A 3SBOA 2AYYA 1TB4A 2E2WA 4BFTA 4WCFB 4IDGA 4BO6A 1TAUA 3W9SA 2A86A 3M83A 4WT7A 4WUVA 3OZUA 1FYFA 2OFXA 1RVDA 1SOMA 2FP3A 1FXUA 5ITSA 4R98A 3UNXA 3G8BA 4P84A 2ZJZA 3RS3A 5G0TA 3QXCA 3TX6A 1XCLA 2PO5A 4QDZA 3H1GA 1M2OA 1O89A 3NRJA 4UTVA 1SVSA 1SBCA 3S2GA 3LBHA 3TFOA 2FMHA 5EKDA 1NN0A 1WHTB 2KW5A 5FO1A 2XSZD 3EFEA 1ZS9A 5FPPA 1C7FA 3FPBA 4EPWA 1IHOA 1E59A 1JRLA 1A3CA 4DHEA 5DCLA 3Q98A 2DFDA 3K16A 2QR2A 3PJDA 1OWLA 1CQJA 1T0UA 2QW1A 2WMNB 4LCEA 2QNRA 3A28A 3ESAA 2AXQA 2KLBA 3F3KA 4ND4A 3WSTA 1UMBB 5I8ZA 1BE6A 1GT6A 5D3MA 1Z83A 1NXSA 4FK8A 4BGDA 3QBJA 4B6JA 1N5JA 2ZI7A 2YICA 3GVPA 2W5UA 3JASB 1HYGA 4JC4A 3REOA 4AJIA 1DKNA 4U6SA 2YWGA 1AS0A 4LBZA 3C1AA 3NTOA 5DSTA 1AHNA 1W4RA 1H3EA 3MAAC 1E5LA 2W6JD 4G5QA 2V8OA 2GXUA 2XB9A 3PQEA 3K6SB 2HWYA 1P9OA 1NXPA 4L78A 4JLJA 1DHRA 4I7EA 4EPXA 2R6R1 5A4KA 4HQNA 4EVSA 1D8AA 2P91A 3GQVA 2O05A 3LUCA 4H1TA 4IOJA 4F93B 1U63A 3P96A 3RVNA 2DB3A 1UJMA 3C3CA 1IOLA 3OMLA 2FOXA 5B1HA 1Z75A 3EGXB 1YFZA 2WQZA 5D87A 5TQ0B 1O4WA 1E5VA 1G3RA 2XMQA 3GMTA 2JI8A 3IPRA 3RI3A 1Z4NA 3JW8A 5KINB 3F8SA 3G0OA 2DLDA 2W2TA 3CPSA 3F3SA 4BATA 1R5OA 5ARCA 2V8BA 3PUJA 3BGIA 1Q7GA 4NBLA 5F33A 1T0PA 4HGRA 4WJKB 2WUVA 2JL1A 3FYDA 1F2DA 1E1KA 2YRFA 2VP6A 5SICE 3R7FA 4A15A 4REMA 5SY9A 1NJ6A 4LHSA 4UUAA 1PSDA 3HVIA 1VCMA 1WJGA 2G9QA 4QXQA 2ZSAA 3G85A 4NAVA 4DZZA 1PWEA 2YKGA 4PCVA 3IUMA 1ZONA 3HGMA 2LW7A 2VKQA 4AG6A 3SZLA 4ZCIA 1QHFA 4JLOA 3IBYA 1IRIA 3EAFA 3NT2A 2ZUTA 3T4PA 2OCKA 3T7CA 1K66A 2BD0A 3IB3A 2IZ7A 2YOFA 2FETA 2GQ0A 3I1YA 4GYWA 4MW6A 4Z4HA 1GP2A 1PFQA 1X6VA 3MFQA 1HH4A 1IEXA 1YR3A 4QBHA 5B1YA 1O58A 3OE1A 4BNYA 2X15A 1KK0A 4NS1A 3TSAA 3TLKA 3ONDA 4OYRA 4YRAA 1SWVA 3EAGA 3OZ7A 4X8OA 5T8KA 4LWPA 2V9CA 3WOVA 2G70A 1YCFA 4NYJR 3DOEA 5DM60 3ETEA 1J8VA 3OPMA 1Z2CA 4YRNA 3U7GA 1WKCA 5CG2A 3WFZA 4S35A 1SHZA 3FPAA 5JXHA 1JDZA 2QM3A 1OX4B 5C81A 3ZIDA 4B3HA 1DP4A 1PUJA 1RYDA 2G36A 2ZDGA 3KTFA 3Q8XB 1OOEA 5ALYA 3ZR4B 5C53B 1NXVA 1QR6A 4MYCA 3CNHA 2E48A 2PT7A 3MJTA 5KTMA 2Q9UA 3UJHA 3FY4A 5TF0A 1A7UA 2GYWA 2PSFA 1YULA 2XLCA 1DBIA 2Z09A 1SQSA 2VQSA 4A6XA 2XZDA 1JB1A 1YHNA 2HX1A 1VSTA 1EEHA 2PGDA 3C3YA 3NONA 4IGEA 4LDZA 4DLAA 4EPVA 1U7OA 5CAEA 1IBSA 1ECCA 5L53A 2OCIA 4CYMA 1L7BA 4D6YA 3WSWA 2PWZA 1QRTA 3QW4B 2Q2VA 3STWA 1T91A 4FCVA 4KQCA 1B6SA 1I0ZA 4W7HA 4YCNA 1RPTA 2C7VA 2D0PB 3HWSA 5A9RA 1XRLA 3M5DA 4C7BA 3STHA 1QPZA 3V8BA 1HG1A 2GLTA 4WTOA 4OPMA 3ZY6A 3JSAA 3RSQA 3CEHA 2IU4A 2JJ2D 1BROA 5EJ5A 4I4LA 1FXWF 1ODJA 1K5HA 3R7WB 4CNBA 4MEAA 1Z4QA 1VXOA 2EBHX 2ZIXA 2Z6UA 2IHUA 3K1TA 5A6SA 1DQPA 3STVA 4B6OA 1V1RA 3RKSA 3AHGA 3FN4A 4HUQA 4JB8A 5J3JA 3BMOA 2J1LA 1GGMA 3KG2A 5DSXA 3S7TA 2O5EA 3TM4A 1RQ7A 1DOHA 1SG6A 4OL0A 4CM9A 2F1HA 3SIXA 4LC9A 1U8EA 5IJWA 4CGZA 2Q3DA 3QLUC 1CUCA 3LT4A 4KO2S 2D5AA 3IKVA 1MJGA 3OOWA 4TLEA 1PQPA 4MRMB 4RZIA 2XXJA 2QTNA 2HA2A 3SVLA 4RD1A 4P08A 2GN0A 3MK31 5EWMA 4CV3A 3HV0A 2Y1LA 1CJKC 1JSRA 2JJ1D 2IGBA 3W4IA 2ZE5A 2FW7A 5GVRA 1FQWA 4MWBA 5FLKA 1RJGA 3ZV4A 2FPPA 5IXJA 2YY7A 4BNDA 2WTUA 2JEZA 2QUJA 4BO9A 4RXTA 4C76A 2AOWA 4L3OA 5CHEA 3U61B 3RC9A 2QL9A 5ICCA 3E9MA 4Q4LA 3QX7A 4TTTS 2HCFA 5HVNA 4WY2A 1DFHA 2ZRAA 4JJ6A 1WR8A 4TWJA 2PU7A 1AB5A 1WVMA 5K1ZA 4ATNA 3PC8C 4EY8A 2ZIUB 2OCGA 5BSVA 2OHXA 3BWBA 1NOJA 4EUHA 4HLQB 4R6WA 2JVJA 3F90A 5MFPA 3LT0A 4EMBA 1LC0A 3I37X 3LGAA 1J7JA 1DV2A 1NV8A 3OJOA 4MUHA 1OHHD 1V5EA 1ULTA 2BFBA 3AJ9A 1V95A 3H2JA 1ZBDA 3WQQA 1FS5A 1UPAA 3S5UA 1J24A 5B55A 3H6KA 3R7AA 2R6ZA 4BMSA 1S9HA 1E2UA 1P9WA 2O2EA 4JP8A 2XMDA 5I7EA 1E62A 4ER5A 2Z08A 1W5TA 3CONA 3FLBA 4F9EA 4P4SB 1HKHA 2Y9MB 1NJGA 2XB6A 3FNEA 3G2KA 3RVMA 1V6CA 4BKMA 2IP4A 4RBNA 1DDGA 2RGUA 4MI6A 3AUUA 5AESA 3KYIB 3T5TA 1D2NA 1FF9A 2H2AA 3BTSA 1P9LA 2O7RA 3LBYA 3ZDCA 2VYVD 4OLHA 5BNZA 1OREA 3TOVA 3H9QA 2B4QA 2YY6A 5CNKA 2H4ZA 1C9NA 2PUBA 1YRWA 2B36A 2NPFA 1CERA 3TF5A 1ZD2P 5G1OA 1GITA 4DJDC 3EPHA 1X1DA 2V6FA 1KKLA 1Z62A 3BMNB 1MO4A 3O8QA 3DWGA 3M4NA 1QS0A 4NE9A 4QHTA 5EVCA 3V4OA 4BU0A 2R6HA 2X7XA 3V2GA 2ANBA 1GTL1 1IPHA 1JUDA 4PQRA 1FRNA 5J4VA 3CSUA 4HMPA 2J48A 5DB4A 3FLEA 1DWOA 4NPAA 4CM5A 1G3UA 2XUGA 3ZBTA 3ET5A 5TV2A 5LQNA 1W49A 3T0FA 2M6RA 4LOHA 2IU0A 3D6JA 4I1IA 3ZIUA 2DH6A 2V4MA 5GOTA 4DNXA 5ENZA 4CPDA 3P0EA 4CUZA 2Y1OA 3CG0A 1G9XA 2V6GA 5B1IA 5CVJA 4C7JA 3G23A 2BBWA 2ZBVA 4YP9A 1PV2A 3ZNNA 1NURA 5LQDA 3P0JA 1Q14A 1KI7A 3NTXA 2ZRKA 2HD4A 1F6WA 1NVAA 3KPWA 3P45A 3PITA 4IOMA 5FI0B 4M54A 5JI3E 4ILEA 1PZEA 1VHWA 3D4LA 3PQ6A 3INYA 1GU7A 4KV9A 3QE3A 2QAGA 4IP0A 1J49A 1H1LB 2OL4A 1DZ3A 1V8ZA 4PSDA 1R2QA 4PY2A 3FJYA 4Z0NA 2Q7XA 1GLNA 1V8PA 2QRPA 2EFDB 3LX5A 2JKVA 5JT1A 4RSGA 4OQPA 3MWKA 3A1SA 4MHSA 3VSEA 1G19A 3PHCA 2XB4A 1NVVR 1KSFX 5IUNC 4F91B 2BUCA 3CX4A 1VL1A 1UXOA 5JRJA 3ACBA 5K0EA 3KETA 3NDPA 3VDQA 1V96A 5EUBA 2A92A 3FMVA 4LF8B 3EA4A 3O9VA 3PQ3A 1X7XA 4G4SP 5JD6A 3VRHA 2QTVB 4BMYA 4EF5A 2YFYA 2EGUA 3UPUA 1NUQA 2G1JA 2Q6VA 3K2EA 3ESXA 1QDUA 3E7DA 3LQRA 4H0FA 5DBHX 3VAAA 4HVLA 5I9IA 2OEPA 4IUCS 4BE9A 1N78A 4HVTA 2CK3A 4KNYA 3F8TA 4PAQA 1S8FA 1EZ4A 1L7MA 1PQYA 2ZWOA 2B2NA 3QPVA 5CPBA 3K71B 1C9JA 2QUKA 3D0QA 4KFTA 4RSMA 1MX9A 4PG7A 1DBPA 4N6NA 2AEMA 2P30A 1PLKA 4U5XA 3R9IA 5LD2B 3KZ1E 1RRFA 2WV9A 2H5IA 3OAAA 4YTEA 5J1SB 1JJBA 1CEYA 4DV0B 2ALJA 3C6MA 3UANA 7MDHA 5A4JA 1PFVA 3HL4A 3JZIA 1TGYA 3CS3A 3MWEB 2J3DA 2JHPA 1NLZA 2XHEA 1Q22A 3NKFA 4LY9A 4IDPA 4NF2A 3KBBA 3LV8A 2IEDA 1ZM2A 4Y0NA 4A2CA 4FYJA 3LUKA 3R0JA 3O3NB 2A0XA 3CX3A 2GARA 2H5JA 4CF5A 2DP4E 3EEFA 2XWSA 5HUHA 2Q5EA 2G5TA 4DIKA 3DO8A 3COSA 2C0QA 1TTHA 2FRDC 2VYNA 1OH8A 1DAKA 2E37A 2WD8A 4PS1A 4BUJA 4EB3A 3CTPA 1DAFA 4B84A 3F5DA 3KQVA 1AJEA 1ACJA 1OGYA 3EHEA 2C9MA 4IUDS 1W35A 2GWHA 1PJ2A 1AG9A 1WCIA 1XXHB 1KP2A 2I7DA 4O8CA 5DTRA 3SR4A 1YJXA 4IRXA 1X38A 2I4OA 5CA0A 2FDCA 1NTOA 3CNBA 2BEWA 1SXJA 2HJRA 3DGFC 3MBIA 1RADA 3P0HA 1LA2A 3FTNA 5LDDC 3TPZA 1YRYE 2PJDA 2ERCA 5FX2A 1OVGA 2JI9A 4DY6A 1V9LA 3J81k 5AW9A 4YRIA 1KEEA 1CLUA 4E5DA 2GCIA 2H4FA 1TKRA 1L8LA 2AZDA 2O5RA 3IEMA 5IC6A 2CT8A 1XWWA 3EXG2 3JQRA 3T9AA 1EQAA 3WYFA 1RXYA 5K0ZA 4RIHA 3PNQA 1ZN7A 5EMMA 4A10A 4DIOA 1NBIA 1U3UA 5GV7A 1CEQA 4EHHA 1JLRA 5B53A 1XVUA 3FCSB 2F3RA 4A2WA 1J22A 3S1AB 2JBAA 2GEKA 1UMDB 2W7TA 3P2YA 1NN3A 4NZNA 5CVUA 5JAPA 2QRLA 1H2YA 3VC2A 3JQDA 2RG7A 4DSZA 2GZ1A 1IIRA 4F56A 1E3MA 1ORDA 4FHFA 4I0WB 5GGXA 1L1FA 1GKYA 3BZUA 1E3DA 3ZOZA 3G17A 4LDAA 4TRRA 2RAFA 5A4DA 4LJ6A 5J2UB 5G1NA 2DR3A 2E5FA 3RT7A 2VK8A 4RTLA 2Z5GA 2CL7X 4RNCA 4ZALA 3JQFC 4B34A 4WZBE 3PSHA 1XTBA 1E1LA 1Y9ZA 2V7QA 3AW8A 3G2JA 4ANFA 1PS9A 1EFDN 1EGQA 1OC4A 2E1PA 3QNMA 3R5SA 2Q3BA 4Z8YA 1FUYB 3K30A 1HPLA 1KO1A 2WJPA 1N5RA 3IIIA 3OWOA 3DYBA 5HS6A 3LCUA 1MF7A 3OX2A 4AK9A 4PN3A 1KJ9A 2C9DA 3N75A 4IJKA 4U7FA 1U0EA 5CVEA 2HA0A 1FUIA 4X20A 1O97D 5CX4A 3KQTA 4D1YA 1NBMA 4LWOA 1U7UA 3CT4A 1H66A 5KI6A 3WZ2A 3BMXA 1KI1A 3FVTA 1V6SA 3NXKA 1BWQA 3OFJA 4GOOD 4NU8X 5E6RB 4JUCA 5H81A 5C8YF 2RIPA 3CZMA 3ENNA 4YHBA 1YQ9A 5JDCC 1WP9A 2IFTA 5LNK6 3HGTA 3PXAA 1X1CA 1B74A 1DBSA 1X7HA 2AH5A 3HA3A 4MUIA 5AM0A 4GPD1 1G1AA 3NATA 1UEJA 1SCAA 4ARZB 1KR5A 2FA9A 3C3AA 2PTGA 2YOHA 2H51A 3DP7A 2FGJA 3BVPA 4QQKA 1R6TA 2I54A 2A33A 5TE9A 4HNQA 4WBNA 3S27A 4DS3A 1N3LA 4MVJP 1P5FA 5FA6A 3LGSA 3DF7A 4X1YB 3CH5A 5EMJA 5JJ5A 2DFLA 3WZLA 3GJSA 2Z9BA 5D1NA 3PGVA 2J3HA 3ZZ1A 4NJMB 2GKSA 4MDYA 1RMYA 1GY8A 3IMCA 1E63A 3UUWA 5CA0F 5BW5A 1M2VA 3OLYA 2KHZA 1HOXA 4LMRA 1AV6A 2MR6A 2HA7A 2QTHA 4NU6A 2B30A 4FFVA 1R0KA 3D4PA 3ZDEA 2HLNA 5IDYA 2F62A 3D7SA 2JLAA 3KYBA 5EPOA 2A1TS 4BJHB 4IPTA 1Z5ZA 1GAEO 2Y8EA 4YIKA 3ZBPA 3B85A 3M2PA 1TW3A 4BE7B 3INTA 1MQSA 4DSNA 4KE6A 5AVRA 3RAGA 1FSZA 3L6BA 2JCGA 4BFSA 1LNSA 4FD2A 4LNUB 2OP0A 4GVXA 1ECPA 2QIOA 4M99A 2PS3A 4MMZB 2VATA 4WKCA 3VDNB 4F46A 5EHQA 5E4JA 3AP2A 4QOJA 1DQZA 4RJTA 3OIFA 4G07A 4JEUA 5G0WA 4D25A 3LL7A 4NMHA 2A67A 3K32A 4D5EA 3ZE1B 1V9CA 4D4JA 4TKLA 2P0EA 5C7YA 1MEEA 3VR3A 4LY3A 5EZYA 2XF2A 5BRNA 3B6MA 4JBIA 2OFFA 3UHFA 1E9RA 2EFHB 3MGAA 4JS0A 2GO1A 3ETNA 1NG9A 5BRJA 4YJGA 5L7WA 3CNQS 3H0KA 4DSAA 3NVAA 3HB1A 4JZYA 5CB4B 1DFIA 2FF5A 4LOKA 3RVQA 2DSNA 2O2XA 3KALA 5JNLA 4BKOA 2CSXA 1SZJG 5BYJA 3K2QA 4GQAA 5FOXA 5FWDA 2H52A 3FD8A 2G63A 3HZOA 3K09A 4L5BA 1WHTA 1Y5IA 3ENKA 2I8LA 2YXNA 3HABA 3TTVA 1CZRA 3W8DA 1CEEA 5DM1A 5FWXB 3H4VA 3I73A 4ENVA 5JISA 5LQUA 2AFHE 3ETJA 1RI4A 3OD5A 2APJA 5J2TF 2AG8A 1E0SA 2QLLA 1JR3D 1B2RA 2JASA 2PDAA 3N8NA 4B6PA 2AB0A 1O96A 1K63A 3FYHA 3KP1A 1N7GA 1JSLA 3BG5A 4F6RB 3GU3A 5JNUA 3BUSA 3GL9A 4EIWA 5CD1A 1FJXA 3SJ7A 4B79A 4P5DA 5HRUA 4DVGA 2QKYA 1CU1A 4IRUB 3L6CA 4XIGS 4BNJA 1QX4A 2LKDA 3K94A 4L73A 4LDRA 5GIOE 4Z3OA 2PNJA 2W8BA 4DV2B 5AJXA 1FDWA 1IBRA 2E3JA 3L8YA 2VRCA 4AXXA 4F4UA 5IWAB 3VR6D 2BHTA 1PS0A 3OF5A 1FDIA 4MUNA 4OV6B 1MENA 1GTJ1 4MWGA 4IQ8A 1WSBA 2FMXA 4L5AA 1P6XA 1NQ5A 1X1TA 4XH9B 4YH1A 3VU8A 1N3YA 1WS6A 2CJFA 2DWQA 3QKWA 4K1XA 5E4FA 1SKQA 4OHXA 5I7AA 4BMZA 5SYAA 5TQ0A 1GYRA 3ISJA 4W5QA 2OCLA 3KJNA 2Y1XA 5D84A 3VNRA 2ACKA 4RKRA 3DBHB 4QLBA 3QKUA 3BDIA 3D4IA 3B6KA 3U81A 4JA0A 3RUDA 1SCUB 2GH1A 4KXLA 4CKCA 3N87A 1MEOA 4DQXA 1A8IA 3EX7C 2WJYA 1VIMA 3RVJA 3WLHA 1QFXA 4J49A 1M1ZA 1V7CA 1UQUA 2PCLA 4QG7A 4Y1RB 1DJNA 1ZK4A 3O8BA 3UWSA 2QQEA 3VKVA 3PFIA 1FW8A 4C21A 4A8JA 5FRDA 3FFTA 4Y7CA 5IJ9A 2ATIA 3TZQA 4ZO7A 4MA5A 1NU6A 1Z0JA 4O29A 5DX8A 4DDMA 2F3SA 3AERA 5CX1B 5A7GA 3UXMA 2PV0A 3ELWA 1N0HA 4BP8A 3PWSA 5CB8A 4L76A 1XLTC 1TE2A 4CHTA 4OHRA 2XODA 1CR6A 3KKNA 2REBA 5JZBA 1OIWA 2FWPA 4UDYX 2P7HA 2R7NA 2AIRA 1KPIA 1PT7A 3K1ZA 3CWCA 3N2YA 2FPUA 1XF1A 1V39A 4F97A 5CD9A 3MHTA 3N2NA 1OF1A 5IHPA 1T36B 4ZO6A 2C3UA 3E35A 4HQKA 5CDGA 1K7SN 3SQNA 3E3OA 4BV9A 1ZRMA 1BCRB 2IPMA 1C3EA 3HU1A 3QXXA 5KAPA 5DU2A 4C0LA 3A3PA 2GASA 4FGUA 3TQFA 1IJEA 3U7QB 4KWIA 5JNSA 1SVNA 3F0TA 4WK2B 4YJDA 1BA2A 4E5SA 1Q1EA 2C92A 3OJXA 4PCAA 1CRWG 4B0OA 1E9EA 2R8ZA 1MNQA 4HNGA 3UUFA 3BRCA 1WW8A 2XVMA 4H08A 2Q6OA 3JWEA 3L0DA 3WQRA 2JLXA 2ZRJA 5E95A 1XHEA 4Z86A 1TJYA 4GI7A 4FW8A 1SKYE 3E27A 3LSTA 2I1WA 3VO8A 4UQPA 4CKWB 4ZTUB 3RQIA 2XB2A 4HY3A 3ENZA 4ND8A 5IDXA 3ID6C 3RHZA 1X13A 3MCAA 3ZE8A 1WCV1 1ZEJA 3EGDB 3PL5A 2IYZA 4RQUA 3ZWWA 5JZVA 1BDMA 2AX3A 2KQUA 4MWCA 5JE8A 3SHWA 4G1MB 3T34A 1NGSA 1CK4A 3ZE0B 2I4RA 2EYQA 1GTRA 2NP6A 1TW2A 4UUBA 4DMKA 5LWQA 1UBCA 2Z3VA 3ZKAA 3BFXA 4I2NA 1NXQA 2VHWA 1FS4A 3FPGA 1QO0D 3AEKA 1JHYA 2ONZA 2B34A 5A0FA 4ACAA 5B7GA 3PE6A 4F4DA 2HSEA 1L4NA 5PNTA 5JZMA 1TTTA 4HDNB 1XUOA 2ZDHA 1BMDA 1G98A 3E2PA 1CUEA 1K4MA 4M1EA 1LLCA 3AB7A 3R7WA 1KI4A 5DV9A 3SSAA 1PX0A 4GLJA 4NBNA 1VJ1A 3COJA 2EAUA 3DL4A 1OA0A 2MDTA 4B6FA 2QUAA 1F5NA 1ZWKA 1BE8A 3MD9A 4XVUA 4HR7A 2P6RA 1CULC 2IVFA 2ZYTX 3MWFA 3HE3A 4B4WA 2A1IA 3TRHA 4NPCA 2VUUA 4IDHA 4I6EA 1GL7A 1FRFS 4W9NC 1QH1A 1ORWA 7MHTA 1TM2A 2YJTD 2OB1A 3HRHA 3PVSA 3N6XA 2ZWVA 4XSVA 1FFBA 4XIYA 5KKAA 4D5GA 4UOEA 4L8FA 4F8JA 1P0MA 4GNRA 3DDWA 4XGNA 1IXZA 3VUEA 4GBED 4MWTA 5ALEA 4C4XA 1U6IA 2I2FA 3G6WA 4LECA 1O77A 4EW1A 1OASA 4WDQA 3EXAA 1MHTA 3GPIA 1YCDA 1DO0A 1P77A 4DJJA 1XF9A 3GLIB 2YINC 2G88A 4MW2A 3A37A 2YUIA 1E3WB 4FD3A 2FU5C 4MAAA 5B7QA 2IT1A 1U9IA 3C3PA 2ZSKA 3FDJA 5EINA 2F4VB 1K6JA 2R6FA 3I53A 1XZEA 1MB3A 2C78A 2VDNB 2XKJE 2Z0MA 4HPWA 1T3HA 3KOZA 5KMGA 1VMKA 3AQ4A 3DLIA 1LX6A 2YZKA 2HHJA 3FPSA 3I5AA 5AOCA 5CGQB 1AE1A 4EB0A 2FSIA 4XDHA 3X2SA 1XNJA 3U26A 1QOQB 5IAEA 3UT5B 2AXPA 1Z6AA 16PKA 4UHEA 3VX4A 1FLDA 3TN7A 3FUVA 1WMDA 4P4SA 4CMKA 5EGNA 4B31A 2OYRA 3UG7A 1NUTA 3STTA 1U0FA 1CR0A 4EYQA 5EIBC 5E1MA 4KYVA 2E1RA 1AVTA 4FTWA 1QVVA 5HTOA 2QXTA 2G08A 4US0R 4A16A 4PRYA 1M8FA 4BNFA 1T0JB 4P4LA 3TCXB 3QPBA 2YJNA 3P52A 3PHBE 2A6PA 5CRIA 3AIMA 4PZUA 3TPFA 3TQRA 1WF6A 5ALUA 2WC1A 4C4YA 3PDCA 3EZNA 4QXMA 1O9BA 3UAWA 2H1RA 4BV2A 2D1FA 7GPBA 1KC3A 2AV6A 2MSEB 4FKZA 1Z63A 1EFCA 1RT9A 4IVRA 4H6VA 1KA9H 4F38A 5JLJA 2CNDA 1JH8A 3K6KA 5KTSA 1ISIA 2C5SA 2EJVA 4RFVA 3TW6A 3M5CA 1QZZA 4QC2A 5FUWA 5K8LA 5CLHA 4ZDIA 1LGYA 3L8MA 2XZLA 4LJ8A 1EPUA 1NYQA 3O1IC 4QICA 5FPYA 1R6BX 2GD2A 1SB9A 1BD4A 2CK3D 1JLLA 1WCXA 2GRAA 3CR8A 4TMVA 2G04A 3RS7A 1O87A 4ROSA 1KL7A 8OHMA 2ZYHA 5CDFA 4E4RA 2ZUFA 5C52B 3DOHA 1LDNA 3MAJA 4Q24A 3TO5A 1U28A 2C9YA 1GQFA 3ROFA 3HVHA 2J9RA 4YS6A 5IH7A 4DA9A 4KREA 1DO8A 1JQDA 4RKEA 1F0NA 3DKVA 5KWJA 4EF4A 3RU7A 1YS6A 4K87A 1L7VC 2ZE7A 2WNSA 4X84A 4DR2B 3P27A 3RYHB 1NP7A 1QNLA 4UD6A 5HM8A 4X3OA 2WHPA 4CMJA 4IV8A 1EQ2A 1KO5A 4FBLA 4BFUA 4X92A 821PA 4E21A 3OWHA 5KO2A 2J9FA 1L4MA 5AJYA 2VYND 3PHIA 3LHFA 1GXSB 4R2XA 1VA4A 1M1UA 1VKRA 3AFHA 2EZ4A 4FZ5A 1A9TA 3VR4D 1HC7A 4W4TA 1QAMA 4PC7A 3VO2A 3HN2A 1WUKS 1U2TA 1SXJD 2WG0A 5AXBA 4FS3A 1V47A 3F5MA 4C1NA 4EG0A 4HT3B 2I2XB 2P9ZA 4HWRA 2DPLA 2ZJ2A 1SCBA 5FF9A 1I01A 1RMQA 1EE2A 2AN5A 1VGQA 3ADOA 2CCJA 3R3ZA 4MSUA 2JS7A 4QGGA 2E87A 2JGJA 4Q7LA 3UXEA 2QD5A 3FOEC 1GPMA 1HDRA 1W30A 1C5KA 2RHHA 2CNLA 1ADYA 1BYIA 2GEFA 3EXFA 4GMKA 2PR7A 2XRMA 4RFSB 4B2LA 5E3IA 3CLHA 2PXAA 4QXAA 3BTUA 2COUA 4G0QA 5PGMA 1C1XB 4JP1A 3T1VA 4ENSA 2VNAA 3AM4A 3OESA 1G8HA 2ANCA 4WZBB 1CRLA 1RXEA 4DKXA 1C3VA 1V7ZA 3DD5A 4NR0A 1XZJA 2F3UA 4J76A 2MMCA 1CVIA 1L4HA 1J97A 1RIFA 4K3VA 2VCYA 3FBWA 1AS3A 4IFTA 1YV9A 4D8TA 1YU9A 5LU8A 1ISJA 5F3WB 2C97A 5IKPA 1CDDA 4KPFC 3OZIA 3T41A 2V7QD 4EITA 1WPGA 3B3AA 3D1JA 1YO6A 1QZXA 3RTDA 2OVBA 1ZI6A 4DNOA 3ER8A 1MAUA 1SQ5A 1XZFA 2A0KA 4DFDA 1QO7A 4LJSA 1NU8A 5CXSA 1LEHA 2W2QA 4ZQGA 1CUSA 3F97A 3A1VA 3KCQA 2HHAA 4FT4A 4I5FA 5C4IA 4Z4EA 3V4SA 1H9CA 1B00A 3I5YA 3JQ7B 2XKBA 3OLWA 2Y2VA 2ZCJA 3CF0A 1Z5GA 3ZW7A 2OXCA 1NBMD 2QZZA 2XUPA 3GJRA 3UC5A 1ZU4A 3F6YA 4QZVA 1M75A 3WGGA 1NBAA 2PQ2A 6NULA 4UBNA 2GGSA 1MJFA 2ZM6B 4R7ZA 2R2AA 3BEOA 4H6WA 3FCEA 1FTSA 1NTRA 3ZDBA 2QZ4A 1I2BA 3SIPA 2VZEA 1CUDA 3QELB 1YVUA 1BXGA 4Q7QA 1TIPA 2LIVA 1ZL0A 1I3LA 3GLVA 2P1ZA 4LXQA 4JBNA 1E2KA 2C4WA 2JGMA 4PZEA 3DZIA 1SRRA 4X61A 3ORRA 2G06A 2ZR0A 1ZDMA 2YC4C 1P1IA 1QWOA 3A7EA 3PHJA 4NV3A 3ND8A 4QYSA 4R69A 2J0EA 5FA8A 3SSNA 3EJ6A 4MS1A 2DEUA 4PNZA 1JAIA 2UXBB 2AOVA 2XH8A 2C42A 4JROA 4OXYA 2P9TA 3LAWA 2QLFA 4XEHA 5JEDA 4FEYA 5AUOB 4JJZA 4TXNA 3M5WA 1WEKA 2F90A 3U3ZA 4M1KA 1A27A 2X77A 3QYPA 1FX1A 1YCHA 2YCBA 3AJRA 2CZGA 1ZNQO 3FNQA 3HFSA 4KMRA 4N4AA 4N6GA 4WNYA 3ZWNA 4DQDA 4EW3A 1B23P 4HWSA 5BQFA 3MQ2A 4BN0A 4UW9A 5FIUA 5MN4A 4WZ6A 4YUWA 2LGJA 3FNHA 2JAQA 1TYZA 1E60A 4FPXA 4XRGA 3R0IA 2FZWA 4QQFA 2R5FA 3TECE 1CR4A 1NHWA 3NEJA 3P0FA 3OQ6A 3ONNA 1KI6B 2EG5A 1I5OA 3MWGA 4GBGA 1KARA 4Q3BA 2PMDA 4OP2A 4RKFA 4J7CA 1PL8A 1G7SA 2W37A 4EZIA 3FLAA 3X1WA 1Q11A 1MT3A 4IIJA 2GHQA 4CLOA 2PGAA 4EK9A 5IDQA 2YHIB 3TAXA 2J5KA 3M0EA 1E92A 1HI9A 1JA9A 3HVRA 1NZDA 5EP4A 2H1SA 3EXIB 4DG8A 1W5BA 4HF7A 4HZIA 5GP1A 3IC5A 1U2DC 5SZKB 2A5LA 4HPXB 1E1DA 1OBFO 1QIFA 2VJLA 1ENZA 1S2MA 2DT5A 5DIZA 4BWVA 1IJFA 3JD4A 4DB4A 2WP8J 3ITKA 4BNHA 2ZRDA 1AKMA 3PU6A 3PUWA 3TBHA 4DA6A 5E7JA 2XWPA 2FSVA 4EEXA 2C03A 2J32A 3N2KA 3AINA 3MCVA 3N7AA 3O92A 5T67A 3SDZA 2P5TB 3PE3A 5KYUA 3DO5A 2DECA 4LZWA 3V34A 1YDEA 2C0CA 3GP5A 2NMVA 5F4ZA 1YQUA 2IEZA 4URYR 5CTAA 4M36A 3RTAA 1EG7A 2GBCA 2NZUG 4LNUA 4UBIA 2C4KA 5JJKA 1VFPA 1Z3CA 2ZFUA 2PRYA 1EGAA 3GD5A 2WW8A 3B7PA 3IPXA 4ZU3A 1GAJA 1RWPA 2YWBA 4MJLA 1T1SA 3RG8A 4K6GA 1NY6A 2H9YA 5EL0A 5J2UF 2P8JA 1US8B 4JDPA 4LV5B 1J2YA 5EMNA 1JNYA 4Q16A 4BNLA 1KS2A 2OG2A 3CQ9A 3K5HA 1S2IA 1YJ8A 3PRYA 4IBOA 4MPTA 2EXXA 1V11B 2X9GA 2Z1DA 2P9JA 3NAMA 3WGYA 3EVTA 4M9CA 3ZZ0A 4BFYA 5EJ6A 5JHHB 2A9OA 2GM9A 1UQTA 4G85A 3RARA 3CE6A 3KEOA 3ZVKA 1EA7A 3VVCA 4DCTA 1JG6A 1YB2A 1BW9A 1W73A 4O6VA 5E7IA 2VRCD 4C2BA 3IP9A 3QYAA 4NY1A 3TVDA 3WWPA 3DE7X 1C3OB 3WNDA 1CC1S 5DFAA 1UMCA 2OLJA 5ALWA 2JH9A 3QVGA 1RHKA 1YJCA 5FWXA 5EKTA 5TJHA 2ZZMA 2PRJA 3ZCXA 5BR8B 2PX4A 4KX5A 3HYRA 4AL4A 4IDQA 1QKKA 2CHQA 2HU5A 4G9GA 3QE0A 2IZ5A 5FBLB 1PJ3A 3FDXA 4RK5A 4JASB 2PL1A 3U7HB 1HURA 3V8RA 4CTKA 5CLQA 4Z54A 4NS4A 4JX8A 3AGQA 4MPPA 3WGIA 2BOVA 1LJ8A 2WVGA 3KXLA 2X6TA 1S3GA 2N9UA 3SY8A 5JNVA 2AN1A 4TTIA 1Z4MA 1CWUA 1PL0A 1Z33A 2WYUA 4G0YA 4R1LA 1M72A 1DARA 1VM6A 1G21E 2G9VA 1UBEA 3MCZA 3OURA 3WJ1A 8ABPA 5HJ7A 1A1VA 1XZQA 2Q4DA 5CW1A 1P33A 1KYYA 1R0BA 3LUJA 4HLUC 4CL3A 2CLHB 1MJ5A 4UVGA 4B3JA 4HFNA 1D04A 4IJQA 2IYYA 3AVUA 1DG9A 5IN5A 3HCPA 2CC2A 3FDZB 3QU4A 5AHXA 3IO5A 5FH9A 1ULUA 1MJHA 3CC8A 4YUVA 1YMVA 1MVNA 2FPXA 3FWYA 4EGQA 2IBTA 1VRVA 3ABRB 4GM0A 7REQA 4O2LA 1H3FA 2JK0A 2PD3A 2C77A 2Q3FA 2ECOA 2AFVA 3DBHA 3EEBA 1XAJA 4RH0A 3SX4A 4PLTA 1H5UA 4PYIA 1SCUA 4DXHA 1KU6A 2IV3A 4F3TA 4M21A 1CVRA 5EHNA 3S2UA 2C5FA 2FSGA 3HDTA 4NBUA 2JFXA 1X3SA 2XGSA 4ID9A 4XGKA 5K3FA 4AJ4A 4ZEVA 5I6DA 4NH4A 5KEIA 3JVVA 1NW6A 1TA9A