1MTZA

Crystal structure of the tricorn interacting factor f1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 113
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mtzA00
4PW0A 3RM3A 3WIOA 4RNCA 1XZCA 4KAAA 4CCYA 1THGA 3BF7A 1XZHA 1E8NA 5JD6A 5HKBA 2ZYHA 5LZ8A 4P08A 4J0KA 3LCRA 5CXUA 2H9YA 4HXFB 1FJ2A 1QZ3A 4Y9SA 4ARAA 3PFCA 4LKOA 4WY5A 4FOLA 4X71A 5FP0A 5ALOA 2B4KA 1FFAA 3GZJA 3O95A 5AKZA 3O9MA 1DQYA 2XLCA 1XRMA 3AZOA 1UOOA 3WJ1A 1JI3A 3WK9A 2VJDA 4AQDA 4M0MA 1MX9A 1YSCA 3R40A 2VSQA 1E89A 1BROA 2G4LA 4DYHA 4IH4A 5EHXA 4QDXA 3IUJA 4MWTA 5CH5A 3O4GA 2EDCA 4Y2UA 3WQHA 4BBZA 4UHCA 3M3DA 4D9JA 1W1IA 2WG1A 1W75A 4Q34A 5DLPA 4UHBA 1F6WA 5FKJA 1UZAA 5IKXA 5EHNA 3KSRA 4C89A 1ODSA 5ALDA 4C4YA 4DTCA 4AMYA 1JT2A 2O7VA 1XKLA 3HC7A 3MGAA 2ES4A 5KWJA 4KACA 2QJRA 2XUOA 2XUGA 2HA4A 4GECA 5EGNA 2XQGA 3AIOA 3BE8A 1VXOA 3DOIA 5LKRA 3WWOA 1P0IA 2FX5A 5AOBA 1QLWA 1XZAA 2HM7A 3WWCA 3QYJA 1R88A 3M82A 4AX4A 4UBOA 5JD5A 4UBKA 5CT4A 2GYWA 2JIDA 4E14A 3VVMA 3IB3A 2DQZA 2VQ6A 2DQYA 1UXOA 1ZGBA 5T4BA 1PJAA 4BATA 1YR2A 3UUEA 4H35A 4G1FA 2XUQA 1CUGA 1JJIA 3KXPA 3VJMA 3H2GA 4WCVA 5DNUA 5CH8A 2OPHA 3VXKA 2I03A 3HI4A 2O2IA 1JJFA 4UUQA 1QIKA 3FLBA 4PV7A 4MXDA 2XMQA 1XQWA 4A16A 4BTLA 2P8SA 1B41A 1U65A 5DWDA 5T4EA 1XLVA 3DD5A 3ZV7A 4BZWA 4P9NA 3UUFA 4F60A 3WK7A 4HTAA 3JW8A 4N8DA 1EB8A 3M81A 1QJ4A 5ALSA 2AJDA 3G0IA 4QDOA 3DKRA 5HKAA 1T2NA 1AZWA 2J4CA 2OCIA 4ZV9A 2JGIA 3FLAA 2RAUA 2E3JA 1GQRA 3K9BA 1Q0ZA 4PO3X 4EA6A 5IVKA 3V1MA 4MYSA 4ZI5A 5FLKA 3GELA 3WL7A 4Y2VA 5EHQA 4DMCA 2C0QA 1DINA 1TRHA 1CUJA 5T4HA 3WIBA 4BC0A 4EY5A 2PM8A 1XLUA 3L1HA 5FPQA 1EXWA 1TCCA 4OYYA 3FLEA 4N5HX 5DYTA 3AFIA 1KEZA 1QIJA 5CTAA 3IBTA 2CUTA 1S8OA 4MQMA 1EHYA 2QJWA 4Y2TA 3DYIA 2WKWA 3KWJA 1QO9A 2J4FA 4Q3LA 4BYMA 2RHWA 5IVIA 2QM0A 1MNQA 4OU4A 4G5XA 4L72A 4U2EA 2VJCA 4J0CA 1E3QA 4EHBA 2VAVA 5LZ7A 2X8BA 3F98A 3VVLA 5HK8A 1R4ZA 4JH0A 2XUKA 3WJ2A 5LZ5A 1USWA 4JNCA 3MUNA 1WHTA 5D3ZA 3STXA 3H1BA 4UHDA 3D2CA 2J3DA 3R0VA 4DSAA 2WUFA 5JANA 5A71A 3C6YA 4H7EA 4AN1A 4C6HA 5HFAA 4WDQA 4AO8A 5E2IA 3OTQA 2XMDA 3DOHA 4GI1A 5C8ZA 4WY8A 5AK4A 2QVBA 3QITA 2WHPB 3HXKA 3S2ZA 2R11A 2RGUA 3KD2A 5J3JA 5LZ4A 3WKDA 5JAUA 3OPMA 3V1KA 1HLGA 3BXPA 3ESDA 3B5EA 4OCZA 5A2GA 4HZGA 4GHWA 1NX9A 2XMBA 3WL6A 1DTEA 3AJAA 5AKYA 5AI0A 1P0MA 2RHTA 5HK9A 2PUJA 4OB8A 3E1GA 3W04A 4I3FA 5EFZA 5LIPA 5LYYA 3T52A 1VZ3A 1CUCA 3WI7A 1ODTC 1WPXA 1QTIA 4EZIA 4LIPD 4BCBA 3FCXA 3QVMA 2JBWA 2HA7A 4LHEA 2O7RA 3ZLTA 4DMKA 4UBNA 3C70A 1OILA 5JZ9A 4B83A 3SWWA 4QA9A 2DCMA 1ACJA 3EF3A 3F8SA 5C7YA 4GBGA 4UHFA 2BKLA 4DLNA 1HL7A 1XLWA 2XUJA 2CEKA 4DM7A 1DT5A 1A8UA 5AKEA 3HYSA 1R1DA 1R9MA 1LPSA 2BFNA 3VDXA 3C6XA 1RWQA 4UFPA 4B9EA 2C58A 2CMFA 1LNSA 1BCRA 3DDUA 2XUHA 2HU8A 3STVA 2HIHA 3L1JA 2ZYRA 1CQWA 1XZEA 4H7JA 4J03A 2HA6A 5CW2A 5AM5A 3A70A 4GW3A 1GZ7A 2QOEA 2HDWA 4HRXA 3HZOA 3HEAA 4C4XA 1TCAA 2VATA 4G4IA 3IULA 3R3XA 1XZMA 1XFDA 5AM4A 4GEGA 4M0FA 4E11A 4AZ3A 4IH1A 1HBJA 5FXMA 3RK4A 1HKHA 1U4NA 2IX9A 3A6ZA 5JAOA 1JMYA 2I78A 3F67A 2WTMA 4X93A 3W05A 3FVRA 4K5QA 3IUQA 2EDAA 5JAPA 4OD0A 2R8BA 5CT6A 2HA3A 3WA7A 2OCGA 4NS4A 1AKNA 1AMNA 5CMLA 4BAGA 3HLKA 3F9CA 1MN6A 2WJ6A 1AQLA 1O6GA 2WG2A 2UZ0A 3E4DA 4QLAA 3O4JA 1WB5A 5E4TA 1JU4A 3FYUC 2ECFA 5AH0A 2WIDA 3SC2A 5LZ2A 4XX1A 2FJ0A 2HADA 4W1QA 3PDCA 3C8DA 2QXUA 2ORYA 3I2JA 2PPLA 2PU5A 2QUAA 1IMJA 5T4FA 1GKLA 2W6CX 3EBLA 3X3HA 1H2WA 3KOOA 1LPAB 5D3KA 4WFJA 5DYWA 1X70A 2G5PA 4FDMA 2PX6A 4ZV7A 1PFQA 1AC5A 3NWOA 2QTBA 3GROA 3OOSA 3N2ZB 1GKKA 2AJCA 4W9RA 2D0DA 3BF8A 4UHHA 5E4YA 2PSDA 1W76A 5AI8A 5HFNA 3ESAA 1XZJA 4MJ3A 4B9AA 2GBGA 1L7QA 1ORVA 2DFPA 5DYYA 1ZOIA 4J3JA 4H18A 3PFBA 4BZZA 5AI6A 3FBWA 3H17A 4E46A 1ZD5A 5CRIA 3DJYA 4CCWA 3AINA 1RP1A 2BJHA 4CFSA 5LLSA 2RIPA 3ZI7A 3ZWQA 4Y2YA 4C4ZA 3WK6A 1DQZA 1XZKA 4X94A 1CUVA 1YAHA 3OC0A 5AKKA 3S8YA 2ZJ7A 3FYTA 1P0QA 2VJBA 1IUPA 1AGYA 4S0XA 4FFVA 5AKXA 3ZLUA 4QDUA 3I1YA 3QPAA 2H7XA 4KAJA 2XMZA 4U2BA 3G9XA 3CN9A 2ACEA 1XRLA 2ZYIA 3SX4A 4H7IA 1TCBA 3MUOA 5H3HA 3RLIA 5CBKA 2BAGA 3FNBA 3QZUA 1KU6A 2Z8ZA 4PF1A 3WMRA 3DQZA 1QIHA 3BDVA 4MEAA 3FSGD 1E8DA 2OGTA 4OB6A 4ZREA 5AI9A 4F21A 4X6UA 1R9NA 1GPLA 3WL8A 3C6ZA 4NZZA 3WWEA 1EX9A 4BRZA 2GYVA 2XQFA 2OCKA 1UWCA 4IH9A 2PVSA 3WWPA 3DL7A 4J0DA 3N0TA 4Y2RA 3GA7A 1FFBA 3V1LA 2QXTA 2IITA 1Y7HA 4DMFA 4BDSA 4EUSA 3CCCA 4MWSA 2WUEA 1CUIA 4KAFA 4BCCA 1LZKA 4HS9A 1SC9A 4NVRA 4B6GA 3W9UA 2HFKA 2GBFA 1IUNA 4H0CA 3FAKA 3ILSA 2WILA 4QZVA 3GFFA 4QDTA 1YB7A 3CCBA 4CG1A 5FOQA 4HXEB 5I9IA 4KRXA 2X76A 3LIIA 4IQ4A 5K3AA 1K5PA 5AKJA 4JUIA 4Q82A 4NMWA 1VJ5A 3A2LA 4DMHA 2C4HA 3UMJA 4J0IA 5HF6A 3AILA 2XT0A 3HJUA 4H7FA 1BRTA 1UOQA 3PI6A 2XMSA 1VLQA 1EINA 3MVEA 3DYVA 5C81A 5EHZA 1BN6A 1K8QA 3BDIA 4MYDA 3G0DA 2WSLA 4I19A 4AXBA 2PU7A 3RKSA 4BE4A 3C43A 4W63A 4BVLA 5K3DA 1GGVA 3WL5A 2JEYA 1L7AA 4ZGBA 2XMGA 1UT6A 5AICA 3STWA 2Y2UA 2HHAA 5AM2A 3G9UA 1CQZA 2VEOA 1C7IA 4Y7DA 4X6YA 5A62A 3C5VA 3WKCA 3R3VA 1O6FA 1R50A 1XROA 4XJVA 4OUKX 1A8SA 1EK1A 3D0KA 4EY4A 3C6BA 1XQXA 4XVCA 1VA4A 1AX9A 3I28A 4P92A 4EY8A 4V2IA 1BU8A 3H18A 5HF9A 3R3WA 3E3AA 3H04A 1CRLA 4FBMA 1W52X 3F96A 1QIDA 2Z5GA 1QE3A 1UFOA 2QUBA 3G02A 5JZSA 2OQVA 4HRYA 2H7YA 5C8VA 2WQZA 2ACKA 4AZ0A 3WK8A 2O2GA 4KE6A 1N8SA 1WCYA 3A2MA 1TQHA 1CUAA 3R41A 1H23A 1QIGA 3WA6A 3G8YA 4PSDA 4PQEA 1UKAA 4G8BA 4K6HA 3STYA 2JGFA 5K3EA 2C5GA 5EIAA 3IDAA 1DWQA 2BUCA 5HF5A 1MAAA 5ALRA 3FSGA 1XZFA 4BDTA 3FVTA 4A23A 4ARBA 5IVHA 3LIPA 3D59A 2W22A 4BAUA 2AJLI 3G0CA 5EI5A 4RE6A 4UBIA 3EIOA 4IHAA 5I7UA 2WFLB 3O4IA 3TEJA 5AJHA 1BN7A 4LXGA 5AIBA 4FMPA 4UFOA 4L9AA 2HA0A 2WU4A 3A2NA 3WKAA 4FNMA 1D07A 1CUXA 3D2BA 2PSHA 4TGLA 4BCDA 1XRNA 1YA4A 1QIIA 5JASA 5DNVA 1YA8A 1IVYA 1XRPA 5CURA 4XWGA 1XZGA 3EQ9A 3VJKA 3PF9A 4PSCA 4Y2PA 1YS1X 2PUHA 1JU3A 4MEBA 5A7GA 1CR6A 2WHPA 3C8HA 3IUMA 2PSFA 1KU0A 1DWOA 4CG3A 1LBSA 3IIIA 5FPPA 1X2EA 4J7AA 4Q1VA 3BIXA 5JD4A 3C45A 3V1NA 3WKEA 4AB1A 4MQLA 4H7KA 3M83A 2Y6VA 2ZSIA 2XMRA 2OGZA 1H22A 3HABA 4KR0A 3FYUA 2XMCA 4BVJA 4B0OA 4BTVA 1FFEA 3I6ZA 4Y2XA 2G5TA 5K3FA 3QMWA 5AKIA 4B81A 1SCQA 3AIMA 2V98A 5AO9A 4Z49A 2V97A 5HQ3A 4OPMA 3QM1A 4ZXFA 1R3DA 2YH2A 4B82A 4WJLA 5CT9A 5ALHA 2I3ZA 3G7NA 4KJXA 3Q0TA 1BE0A 1QFSA 5A7HA 1IUOA 2WIGA 1XRQA 1HQDA 2X5XA 4G8CA 1EA5A 3R3YA 2OCLA 1JJBA 1VKHA 3I1IA 3OM8A 3LP5A 4UPDA 2QZPA 1RYYA 1LPNA 2XUPA 2J3QA 1ZI8A 3LS2A 2C5FA 3WK4A 3H2IA 1G66A 1CUHA 2WFMA 2G63A 3H2KA 2JEZA 3ICVA 3I2FA 4X90A 2B61A 4U2CA 1WM1A 3EQ8A 1OXMA 1Y37A 5ALEA 1FFDA 1ZIXA 2OLEA 5BOVA 4UBLA 4C88A 1U8EA 5KREA 3W06A 5ALUA 5K5EA 3T4UA 3VJLA 2BUAA 1EH5A 5A6VA 4X6XA 5K3CA 5JAHA 3PUHA 4JEIA 5YASA 4HVTA 3VKFA 2IIVA 1FFCA 4M0EA 1N1MA 3TGLA 5IH7A 2GBIA 5ALTA 5HCUA 2HFJA 4X7BA 3ICWA 2BUBA 5HQ3B 1ORWA 2AJBA 1ZIYA 3AIKA 3TJMA 3BL8A 1J06A 2PBLA 3H1AA 4FHZA 5DTIA 3PF8A 5JARA 4RPCA 3IUNA 4K6KA 3U0VA 2Y2VA 1X2BA 2ZJ6A 3QPCA 3BIWA 1EDBA 1F8UA 4OYLA 2FJPA 3G0GA 1AURA 2Z3ZA 4W1RA 1DU4A 4YX9A 4IO0A 1ZD2P 5AKHA 2GZSA 4B0PA 1XKTA 4DNOA 5FV4A 1XQYA 3Q8WA 3HSSA 3K6KA 5ALNA 2XUDA 2WU3A 4LYEA 2VTVA 3SK0A 2Q0XA 4AMZA 4QE3A 4ZRDA 2GZRA 5I8PA 1W4LA 2XQKA 5ALGA 1BEZA 4X95A 5EIHA 3B3QA 2CZQA 4EB0A 4LXHA 5AM1A 2VT7A 1TIBA 2QR5A 1QO7A 3WWDA 1WHSA 4WFKA 2WFZA 3D2AA 4FTWA 1UK7A 5JALA 3C5WP 3D3NA 2ZVDA 2K2QB 3STUA 1NU8A 3H0CA 2RI6A 4GXNA 4G8DA 3BWXA 5BV7A 1Q0RA 5HZGA 1ZI9A 1ZD4A 3K2IA 2DHEA 3I6YA 4X85A 3DNMA 3AZPA 2H7CA 2XUIA 3ANTA 4L3WA 1DX6A 3G9ZA 1UKBA 1YS2X 1CUDA 3DLTA 1OCEA 2WIKA 1LZLA 4PNZA 5ALIA 5FRDA 2XE4A 1BS9A 4DGQA 1W6RA 4K2AA 1QTRA 3ESBA 2ONCA 3YASA 1NU6A 4UFNA 2DHDA 2JGLA 5AKGA 1QIFA 2YASA 3O0DA 5AI5A 1DWPA 2WTNA 1QGED 5CH3A 1SCKA 3QMMA 3R3ZA 1H2YA 4F0JA 1F0NA 2O2HA 5FDFA 1F0PA 2EEPA 2DSNA 1EVQA 1ETHA 4N8SA 1CEXA 2DR0A 2I3DA 1C4XA 3LLCA 1UK8A 1UK9A 5LZ9A 4BP8A 1YB6A 3HRHA 2XUAA 3E0XA 2QS9A 1MU0A 1WB6A 3CXUA 1CUUA 3ESCA 3QMVA 5CT5A 4W1SA 4BC1A 5JIBA 3F97A 3DS8A 1TAHA 2XQJA 1LPOA 5AOCA 1ZJ4A 4FLFA 1XQVA 5AM3A 2XDWA 2WLSA 4FLMA 3V48A 2WIJA 3AZQA 3JWEA 3CN7A 4BB0A 5BWCA 4YASA 1XZDA 1LPBB 2XLBA 4OSEA 4OU5A 2CJPA 2QMQA 3FCYA 5DNWA 2PKYX 5ALPA 1JFRA 2WJ4A 4X91A 4Y2SA 3G0BA 1VE6A 4KYVA 2VAXA 3BJRA 1N5MA 3H2HA 3DEAA 3WK5A 5AIAA 1P0PA 1GQSA 4I4CA 1H2ZA 4U2GA 3EQ7A 4CCYB 4FNGA 5ALMA 1A7UA 1YCDA 3DL4A 4G9GA 2XI4A 3AUKA 4H7HA 1GXSA 4W1PA 4B84A 4X3CA 2CB9A 3H19A 1LLFA 1L7RA 1GPKA 2CKMA 2V9ZA 5AOAA 2WJ3A 4TVKA 3WZMA 1BEEA 5AKLA 2JGJA 4GWLA 4H7DA 4CIAA 3FYUB 1EB9A 2WHQA 2WFLA 4HAIA 3NGMA 5AK3A 1VZ2A 2HL6A 2B20A 4J0JA 3H2JA 1ZI6A 1ZD3A 2VF2A 3G9TA 1CLEA 5ALFA 3QH4A 4L0CA 2AJ8A 3IURA 3NUZA 2HA5A 3STTA 2BGRA 2C7BA 5D7BA 3I2IA 3JYHA 2VT6A 4BVKA 2QRUA 5EIEA 1MJ5A 2JGEA 2ROQA 1MTZA 4QDZA 7YASA 5ALQA 3IVMA 1CUWA 2XUFA 4B80A 2YXPX 2ZYSA 3V9AA 5K3BA 4X97A 4FKBA 4INZA 3GUUA 3PE6A 5DJ5A 1JMKC 4ITVA 4U2FA 1ISPA 3W9BA 4EBBA 5CXXA 5HF8A 3PUIA 4BE9A 2PSEA 1CUFA 4JYPA 1K63A 5FUMA 1E5TA 2LIPA 1DT3A 3D7RA 5ALKA 2PSJA 5ALJA 1CIJA 2Z3WA 1UK6A 4E15A 2BGNA 3O9VA 3WLAA 1TK3A 1FSSA 2Z8XA 2OG1A 1G5FA 1T4MA 1LGYA 4CI9A 1GPNA 3ZPXA 2XB6A 4C87A 4LXIA 4DNQA 4A5SA 5A7FA 2VA9A 3FOBA 5JZBA 4WDRA 3ED1A 4U2DA 1VE7A 1ODCA 1ZJ5A 5AK5A 2AXEA 2NW6A 4QEKA 3ZLVA 1MX5A 5DTJA 4EY7A 1WB4A 5AP9A 4KE8A 1IZ8A 5ALXA 1DX4A 4H77A 4BAZA 4LYDA 4DSZA 2DHCA 1CVLA 2JF0A 1M33A 4AN0A 1ACLA 2WIFA 1ZGCA 3I2KA 2HU5A 1GT6A 4AO7A 2C0PA 4UBJA 1J07A 4G4JA 2HRRA 4ROTA 2WHRA 1XRRA 4X00A 4GLBA 1CPYA 1Q84A 2HU7A 5AI4A 1A88A 5JATA 1EDDA 1XZLA 5AM0A 1MNAA 1JKMA 4CIBA 1C7JA 1XZIA 2WUGA 1QIEA 2D5LA 1QONA 4FWBA 4QWWA 4Y2QA 1QOZA 3O4HA 1YAJA 2OXEA 2YYSA 3D4LA 4RE5A 2OAEA 3KDAA 1H2XA 1B6GA 3TRDA 4KRYA 1MAHA 1SCIA 4YPVA 5LP1A 3HACA 4HXGA 4BP9A 3WZLA 1CUYA 5KWIA 3I6MA 1VOTA 4JYMA 5JYCA 4YK7A 1UKCA 1AUOA 1SFRA 1U2EA 4GDMA 6YASA 3B12A 1MPXA 3IA2A 1I6WA 5E4JA 3I2GA 2OQIA 1ZICA 4FLEA 3QPDA 3WKBA 3C87A 5ESRA 4QLOA 1CUSA 2RONA 1J1IA 3ANSA 3OG9A 2XQIA 3PICA 5ALZA 2B9VA 1IZ7A 5JADA 3WYDA 4K6GA 1N5RA 1K4YA 4DNFA 3D5EA 1BCSA 2Y6UA 4FFWA 3DKKA 4KE7A 3RARA 3DCNA 1MT3A 2HA2A 3L1IA 4DNPA 1J2EA 2ZSHA 5K3FB 5SYMA 1MO2A 1TKRA 4Q3OA 3VISA 3KWFA 2WM2A 4Y2JA 1LBTA 4EY6A 4XIIA 1XZBA 5BWBA 1WOMA 4N8EA 2BCEA 4QNNA 4J0HA 4BRSA 4G4GA 1EDEA 4J0GA 1E8MA 1EVEA 3R3UA 1G4HA 1HPLA 2GBCA 4WFIA 3BJMA 5CT8A 5LKAA 1Q83A 4FBLA 4Q05A 5IVDA 1CUEA 1QFMA 3NOXA 1MX1A 5AK6A 3P2MA 5ISMA 3I2HA 2QKYA 2FUKA 2CBGA 5F4ZA 1PV1A 4QWMA 4TPKA 2V96A 4P93A 4X92A 2PL5A 4C01A 1CUBA 2JGMA 4O08A 4Q3KA 1LPPA 1CV2A 1THTA 5C8XA 2OGSA 2HRQA 5D6OA 5ALYA 1CUZA 1HDEA 4KEAA 5ALWA 1YASA 2VJAA 4ETWA 1A8QA 1Z68A 2GYUA 1LPMA 5ALLA 4ZWNA 1VA5A 4B7ZA 4KE9A 4DIUA 1WPRA 5SYNA 1QIMA 2ZJFA 3QBJA 4OB7A 1EK2A 4N5IX 2WUDA 3OURA 4UBMA 5ALVA 5AHXA 1CFJA 1E66A 4CG2A 2Y1KA 4B85A 3WYNA 4PSUA 4G9EA 2OAGA 2JGKA 1UOPA 2WG0A 1Y7IA 1K6EA 4AO6A 5KBYA 3GBSA 3FWHA 1EI9A 4UHEA 3U1TA 1VXRA 2H1IA 4F5ZA 2QT9A 4RGYA 1SOMA 1G42A 3W2TA
chains in the Genus database with same CATH superfamily
1G9XA 4LV8B 1SZCA 1UXHA 1V3VA 1SULA 1BFDA 1NP6A 3ESQA 3WIOA 2IW3A 4JBIA 1HO3A 1ZMTA 3BF7A 3KHUA 3OFNA 2ZT8A 5DXJA 2YDYA 5FWDA 2FDXA 1E8NA 2AOUA 4N5DA 3CKYA 4C7KA 2ZUDA 4N0MA 1HUQA 3CZQA 4MYRA 1GTZA 4QD3A 4N03A 1JHMA 4B5LA 4DSNA 5HKBA 3MTJA 4I50A 4ISBA 4KRFA 1OI2A 2HPAA 3IDZA 4HGPA 1WXGA 2G1KA 4P08A 5CXUA 3G89A 3ZTWA 4XZ3A 1GFZA 3F5QA 4Y9SA 5BQ5A 1MB9A 4ARAA 1JEQB 2G7ZA 4MYCA 3SZOA 4R8LA 4FDVA 4W8GA 3TS1A 1XZQA 3ZCVA 4LKOA 3U7QB 3GXOA 1W5BA 4UREA 4CIDA 5IAEA 4PLZA 2NU6A 3AWDA 4R8VA 1RRGA 1NXOA 1YTUA 4FOLA 4CRWB 3L8GA 1UJ5A 5FP0A 4RSRA 1DBWA 1BX1A 1WR8A 1C1DB 2X9QA 3DMDA 2C20A 2I4OA 3IGFA 1FFAA 1PKEA 3IAFA 3O95A 3PE4A 4UCXA 1T9HA 2VUHB 2XH8A 4WUVA 4M8IA 2AOXA 4PX3A 3O9MA 4FZJA 3WLRA 3M5CA 3HA3A 3HYNA 2WYUA 4MV5A 2XITA 3AZOA 2WTAA 2J7PD 2O48X 3N58A 3HFSA 5ABPA 4DIEA 3ZU2A 1EEHA 2DQKA 1YJAA 2QVGA 2XXAB 4E5VA 2VJDA 4AQDA 5LSAA 1T1EA 4WKGA 2PS3A 5E6RA 3AM4A 1MX9A 4FI3F 4BNFA 4ZN6A 2F8LA 1UMCB 2ZRCA 3PSHA 4BQFA 4KR3A 4ZT5A 2XIJA 4QTYA 2BF4A 2COUA 1E89A 2KBFA 3RUIA 3AVWA 2GBLA 1ECGA 2QTRA 5FBWB 4F6RB 4MNTA 4INOA 1GKYA 2HTEA 3OQMA 3I9MA 4WOKA 3FYSA 3A3OA 3IUJA 4HFJA 4MWTA 4QDXA 6REQB 1SGWA 4PZEA 3L1UA 2IWHA 3GLFB 4K1XA 4O4JF 1U1EA 4LF5B 2ZJYA 3WQHA 2HCTA 5JBIA 4RVSA 1MB0A 1ADGA 4UHCA 5EVJA 4DKJA 1M75A 1RQXA 2X5NA 2PD4A 3I1JA 4D9HA 3IC5A 4LRWA 2GZ1A 1JXOA 5DLPA 4FHCA 4UHBA 5BYKA 3IT3A 4RENA 4LYGA 3J7AC 5EHNA 4KR7A 5HIJA 1HDZA 1NBME 3KAPA 1Y4SA 2H85A 3KSRA 4DIFA 3ZXYA 4DHEA 1WUKS 2VXCA 3VR0A 1FYDA 3C6MA 4Q1FA 1ZXLA 2VHWA 1Z0AA 3IT2A 4LXTA 5ALDA 4IWXA 3FTCA 1O97D 4AMYA 5K6AC 2DPHA 3KRTA 3R09A 1QQ5A 4WBNF 2QSUA 4FHDA 1GVHA 2R87A 3O26A 3Q0EA 4TS9A 4MO2A 4YQYA 5FTWA 4OAQA 1G8AA 2ES4A 2GZAA 2J3HA 4JUFA 3QY9A 3L0DA 3O7MA 4DEYA 3DBIA 3MELA 1E2BA 2BMVA 3AL0C 1T8PA 1V71A 1JLLB 1LWOA 2X14A 3MUFA 4M54A 2XQGA 1Z0ZA 3I37X 1NRXA 2IHKA 4FZ5A 4NMHA 1SHZA 1BGWA 3AIOA 1U90A 2X0KA 3BE8A 2VKTA 4ZOLF 1DJLA 4EH1A 7AT1A 1RZRA 3DOIA 4LJ5A 3IAM1 2FWNA 1SU4A 3ABQB 3C1TA 3NQ41 3IEKA 3P94A 5I9TA 4AP6A 1E63A 1KJQA 3T5MA 4X63A 1CHDA 5CEEA 1JN0A 2O06A 5CPBA 1QLWA 2I7TA 5AOBA 1L7PA 1LJLA 1X94A 3P2JA 5CDYA 4IQGA 1P1IA 4GLLA 1XTZA 4JLOA 5G0VA 3TZQA 1SUFA 3PKZA 4EWLA 1VHTA 3VU0A 1R88A 1ENYA 3Q3EA 4OVKA 1DRUA 3GW8A 2AN9A 2OCPA 3HYRA 3A6FA 4UBOA 1WSWA 1NM5C 4UBKA 5FPTA 4PZ9A 2XCTB 1XVAA 1YJCA 1ODFA 3ESXA 3HMQA 4EKEA 4NYIQ 1NPTO 4PYMA 4PFSA 1GTMA 4E14A 2J6BA 3GVPA 3LT4A 4RZXA 1U8FO 2QMEA 3HCWA 1JF8A 4CM4B 4E88A 3CEHA 4EGCB 4NDAA 4GUDA 2YYZA 1PJAA 3O3OB 4C03A 4C5AA 5IJ0A 5G0WA 2D2IA 3TRIA 3P4YA 3UUEA 3O4VA 3TINA 1AT1A 3O21A 1REQB 1MABB 2FG7C 3JU3A 1LCIA 4DN6A 1G6OA 4EBFA 2BMJA 5BPFA 1CUGA 1ZDMA 2BM0A 2PO7A 3VJMA 3DWEX 3T06B 3CF4A 1AY0A 3QE0A 2NUPA 1PS9A 1UBEA 2V7WA 3K8QA 4NZMA 4PX9A 1IZZA 2UXCB 1JG1A 4MUNA 3U44A 4NNPA 4O4HB 5CH8A 5IANA 4CBVA 3C3WA 2XZLA 1X77A 2BGMA 4C3UA 1H0KA 3VR5D 1FVHA 3AQIA 1IPHA 1RYZA 1QIKA 1XB2A 3FLBA 3O47A 2LZ0A 4KAXA 3A1DA 3FZGA 4MXDA 1IYZA 3CNBA 1V7QA 3HKCA 1XQWA 3ND5A 2UZ4A 1S1CA 2GERA 4JT4A 4A8TA 1XCLA 4QGSA 2P6RA 5BURA 1B41A 1ZONA 3OEWA 5IC5A 3LL4A 3JWJA 3DD5A 1MDBA 3IP7A 4BZWA 3OZBA 2WOJA 3CLSD 3LT0A 4Z7OB 2JVIA 3I5AA 3SYMA 2O1SA 1M6VB 2OBNA 3HBJA 5AESA 1EK0A 3GT0A 4GBED 1EB8A 1L4FA 1SB8A 2BBOA 1CR1A 2O20A 4WZAB 1TTHA 4C20A 4E30A 5JCOC 4YWHA 1WE2A 2O5VA 4M1TA 3WNDA 2PE5A 1KEVA 5K6RA 3DEKA 5HKAA 3D1VA 3EDMA 1CQIB 4GRAA 4W5JA 1HDYA 1UBTS 1AZWA 4NJEB 3SE7A 4BBAA 3HM9A 2CE2X 2VPPA 1DCTA 4DF3A 4WBNB 1KQNA 2RAUA 3Q7IA 2ATXA 1JSZA 1DE0A 2H8KA 2GO1A 2RHCA 2ZRPA 3BFJA 4MX8A 3UPDA 2J0EA 3CPSA 1YB1A 2G6TA 4BNYA 4EA6A 4POOA 5E8JA 2KHZA 2AOTB 1V41E 2PMFA 1PZNA 4LNUB 4Y9RA 2XOKA 3IBFA 4MWGA 2ZRFA 2JKYA 3WL7A 4PC3A 4CU2A 4Y2VA 1IWPB 3W5AA 2IUSA 5EHQA 1ZNXA 2DWQA 1TRHA 2NXWA 2OXFA 2NO4A 3V2UA 2WSIA 5A9SA 5U9CA 4TQUS 4MA0A 5T4HA 4CL3A 1OF1A 3WIBA 3AFOA 2EFJA 4BC0A 3FPGA 4EY5A 1XD2B 4WXEA 4Z5XA 3PC7A 3N05A 3V8EA 1JV2B 2YIJA 3K8ZA 3KYDB 4ND4A 1F7VA 2A57A 4LF6B 1GU7A 2GEFA 4XDGA 3LSYA 1TCCA 1YBAA 4HN4B 5A2QA 3M70A 2P65A 1YVUA 3HEMA 4H3KB 1RW4A 4U5QA 3D7LA 5EEGA 1RWVA 3SEFA 4CTKA 2NP7A 2GJ9A 3PQ4A 1QIJA 2OCYC 3MRXA 4QOFA 2BELA 2AUMA 1PHPA 2LUOA 2RHDA 4MEJA 4ASUD 4IXWA 1Q0LA 3E1KA 5CTAA 3V4OA 1GY8A 1D2NA 1R12A 3RDPA 4H60A 2YC2C 3V97A 1NKVA 3VNRA 1DXQA 4OMUA 3CCFA 5FUQA 2B3DA 1JIVA 4LSWA 2CN1A 4NENA 3DYIA 2D4HA 4P3NA 4ZANA 1PYOA 1HFJA 1RM5A 2NM0A 1NVKA 1ISFA 3NXSA 5TIIA 1GAEO 3COYA 3WGNA 4W5OA 2QZZA 2RHWA 5EJAA 2QEQA 4P86A 4I50B 1HT3A 4FFDA 1OX4A 1JR6A 4BO9A 1GYRA 1MRZA 8ABPA 5GONB 3LA6A 1BFKA 4RXUA 1JEEA 2ZRMA 1PV2A 1VGRA 4R5HA 1E3QA 3ZDEA 4U2KA 1W1WA 3NKVA 1N7HA 4EHBA 2IOHA 3CKMA 2CV0A 1NIPA 1DX9A 2RJNA 5BWLA 1L2TA 2X8BA 3F98A 3RGWS 2EFHB 1R27A 5IW8A 5HK8A 3JWGA 3RAPR 5IKEA 3NBUA 2MHCA 5MHTA 1SKBA 2Z57A 5I9NA 4FGWA 5B53A 3WJ2A 2DY1A 2X13A 3HA7A 3RIXA 3M7IA 1S2GA 2AWOA 3R5FA 3U48A 2IS2A 1HYGA 5C53B 4ESVA 1HOXA 2DYKA 2ZJBA 2B4QA 1KO5A 1V4NA 1Z5NA 3LOQA 4JNCA 4D1YA 2C2ZA 2XV1A 1T5TA 2O2EA 2Q3EA 4IOKA 4K9OA 5EJEA 2IBSA 1EGHA 2C00A 4B2PA 5KYYB 1V4VA 3TR0A 3L0BA 3H1BA 4C7OB 4YCSA 1D8AA 2BGGA 1QOQB 3QVWA 3HPQA 1G2IA 2H1CA 1F2VA 2V7PA 2HB6A 4IUYA 4EY3A 5H8WA 3R0VA 4BNWA 2WUFA 3OLVA 5A71A 5JANA 1B1CA 3Q6IA 3B5JA 4XKJA 2J48A 2BF7A 4QYSA 4UTNA 5HJ5A 3ILYA 4DG8A 1RC1A 2QBYA 4MSUA 2C9MA 2NSHA 5DT9A 5HFAA 1V5EA 3I76A 1WRBA 4WDQA 2M2IA 4R8KA 4Z8XA 1A04A 3ZVRA 2FR0A 3FRIA 3EXFA 5EZSA 1RI2A 3WLPA 4FE7A 4L8YA 6REQA 1CBUA 1UKYA 4LTDA 3ZHTA 3ZWKA 1AF4A 3LF2A 4JXKA 4Y18A 1XVUA 5C8ZA 5H7XA 2JJQA 1UMBB 3PQCA 1SXJB 5DB4A 4A0HA 1I6LA 3QITA 4RCVA 4JB0A 2Z95A 3FPBA 4LWZA 2XY4A 3V46A 4TMTA 2HQBA 2GNPA 2RGUA 1CEQA 3K05A 4JLPA 5FWYB 4ZI7B 3KQVA 2NXNA 4RZSA 1MVLA 1M1UA 4OLHA 1LBEA 3NHBA 1LI4A 4QNRA 4W7HA 1ZQ1A 3TG8A 4PVCA 3A04A 4KMMA 4R1NA 3GRRA 2C4TA 3B5EA 1C1HA 2NQ2C 1DEAA 3V4FA 4EZEA 1GL6A 4IIFA 1L4HA 1XMXA 3C3EA 2AQKA 2WHXA 1SPXA 3COSA 3VR6A 4FYPA 5ES4B 5FBHA 2XMBA 4IHQA 4LCJA 1DTEA 1EBUA 5ERXA 4UW9A 5AI0A 4IDFA 3W9YA 3WLIA 2RI1A 1X1TA 3KTAA 1DQPA 1SIOA 3LUCA 2V6FA 4J7UA 2ATCA 1UPBA 3DEHA 3ZDDA 2OP0A 3CJRA 5E9JA 3WSWA 5FYDA 4JLJA 1Z17A 4UMDA 4LF7B 2IDKA 3DHNA 4LQDA 1PUJA 2NOAA 2JFXA 3EHDA 2FP4B 3KUXA 3ZW8A 4I3FA 4HNHA 5EFZA 4F38A 1HYQA 1W0KA 2PKRA 4JQCA 5IUJC 1YBMA 1D1SA 2D8AA 2WV7A 5D8DA 3T52A 4WXRA 5DDIP 4B33A 2WPDA 1HLFA 1AKRA 1XXHA 2GOYA 4MUBA 5CLHA 1OSNA 1ULZA 3CPEA 1TF7A 1Z15A 3D4PA 4RSMA 3VRHA 2PZAA 4AVYA 1GM5A 1YQ9A 5DBIA 3K9WA 1G8KA 3HJNA 5CR9A 1D04A 1EUZA 3JQGB 3OZEA 3JTMA 5DIZA 5BN4B 1KMNA 5GPBA 4G23A 2YUTA 1UM9A 4N7RA 1NQUA 4E08A 4EFNA 1SUEA 3FOWA 4LIPD 3ASZA 4CNQA 1HG1A 3A4LA 4GWGA 3WLTA 4FWIB 2WJHA 2H7VA 2PUFA 1AKQA 5JJLA 2HA7A 2AYXA 3UWMA 3F0TA 4DDMA 3NFRA 4R1UA 3CZMA 4JSTA 1DV2A 2FR1A 3EPJA 1IQRA 5J5AA 5JJ5A 4LHEA 4B35A 1OX5A 1P80A 4XW2A 5K2MA 2ZIVB 2X8LA 4L5JA 1H4QA 1GN9A 4MRNA 4AWBA 2A9JA 1E2QA 1QZUA 4IDGA 3AONB 3DAHA 2RB5A 3C70A 1OXUA 4B83A 2AI1A 3NG1A 3TCKA 1DB3A 4H1WA 2DCMA 3GV0A 1VRVA 4EITA 3L4KA 4IHJB 1MXFA 2XYGA 4RIHA 1F2TB 4GYYA 4C6RA 4EJ0A 1JUDA 2XNSA 3QEAZ 2QV0A 4PANA 3PK0A 2BKLA 4L95C 1GDDA 2FETA 3NH9A 2OYSA 4JJ4A 4OK3A 4WZBA 2AR9A 3T7CA 1X1BA 1M2VA 3VTFA 1XG5A 4DMUB 3HYSA 4HAWA 3MS4A 1R9MA 1Y7LA 2RFLA 2NTYC 2XTZA 3F3YA 4KZPA 3JQBC 2FQQA 2BFNA 1GA6A 3QELA 4FDUA 4MDYA 4QU8A 4M1KA 5HUHA 1REQA 3Q3HA 2JI4A 1I7DA 2NXCA 3KVYA 1HDXA 3G2MA 2V59A 4KR9A 4LUCA 5F98A 3T15A 4H1HA 3MQ2A 4DLUA 1AUVA 1W8DA 3BGIA 1CS4C 1XV5A 2J3JA 2YN0A 4IIHA 4PRYA 2RHJA 3JQ6A 3ND9A 3UJ6A 4RTSA 3MRTA 4OQZA 3TWOA 2XHZA 2YRFA 4Q37A 1OPRA 2VDRB 3I58A 4KB5A 4B7CA 4L73A 2JLSA 3OZDA 3R8CA 4RD2A 3L7IA 3QHPA 3GEPA 1PG2A 4XPIA 3AEUB 5FAKA 3WL4A 4M87A 4IYJA 1Z4OA 3H1GA 3ULKA 3H5RA 3T3GA 1B4DA 5IJXA 3RWOA 3LHKA 4FT4A 4G0UA 4JV5B 1Z6ZA 3F74A 3A9SA 2HLDA 4Q1BA 2PGIA 1A69A 1Y33E 3IVRA 4HSGA 2FZEA 2GHIA 4WA7A 1J9EA 2NU8A 1M6VA 3HZOA 5NLLA 2M1ZA 4U7TB 3UMMA 1KYIA 2Y66A 3QLEA 1YI1A 2Q4DA 3SC3A 3DF7A 1CY4A 5DU2A 1KDZA 3ZU4A 1WB9A 1SD5A 1VIMA 3K71B 2PKQO 2SICE 5FQOA 4E0BA 3B6ZA 1PL7A 1PUXA 3GLIB 4HDSB 2QT1A 1PWYE 4BNHA 3P9KA 3ETCA 2JFGA 2WF9A 4G4IA 4JL5A 1XFDA 3TR6A 5J4LA 3SSOA 5LDGA 5TX7A 4EHKA 1JKXA 3ITEA 4IXTA 4X7RA 4IH1A 1HBJA 2FWMX 1DNPA 3DV9A 3PRYA 3KXIA 3SVTA 4IUCS 3Q9LA 2DUJA 4QSMA 1DSSG 2Q1TA 4TYMA 3F47A 4AJLA 1J21A 1JMYA 3C7CB 1GD1O 2CXOA 2I7VA 4DEXA 2WSBA 3G2JA 1E4YA 2ZUEA 3F67A 3ZWAA 2FRDA 4UU7A 3GBPA 1X1RA 2E0IA 2WWIA 5CHYA 3IUQA 3PC4A 3KYDA 3UATA 2Z2KA 3EOBI 5CLQA 3BDAA 2V4MA 3WC4A 2QAGB 5IC4A 2Z2XA 5E3IA 1N77A 2C4VA 3Q7SA 3HU2A 2PX5A 4M9SA 1GPBA 1PZFA 1IB6A 1U3VA 3FWNA 2HR1A 1OX4B 1OHHA 4J90A 4UUMA 4V39A 1JHOA 1M0WA 3COZA 2NYAA 1OLXA 1PVOA 3RRMA 3R24A 4PSKA 1Q11A 4LZPA 4D4IA 4HH1A 5I9SA 1SIWA 3PQ6A 3ZIUA 2PMKA 3F9CA 5L3ZA 5LA6F 4Z4CA 4DJJA 1J2JA 3KQQA 2Q6VA 1NI5A 3FCUB 2FA9A 4RDIA 2UZ0A 4H3SA 1PT9A 1PSZA 3E4DA 5AXDA 5CLFA 4DOMA 1V11A 2V4UA 3RT9A 3O4JA 1AQJA 3S81A 3DC7A 1XRSB 1H6BA 1B0PA 3MWDA 3O0TA 3PJDA 3GJ0A 4H0NA 2Q6OA 4MGEA 3FTFA 3SC2A 5HQTA 3GFBA 2QF7A 4RD6A 5LZ2A 4XX1A 2YV4A 5CCBA 4W1QA 4Y6LA 3KEFA 4EHNA 4Z7NB 2FZCA 4FSXA 2ORYA 4BFSA 4JOCA 5FL7A 1X39A 4PU0A 4FC6A 2W6IA 1Q22A 3E8MA 4CQMA 2UYYA 1JU9A 3ZXUB 1G59A 3EGXA 2ZAIA 5HILA 2FSHA 3UGQA 1PGPA 1CU1A 3DOFA 1QFXA 4L2IB 3BMCB 5P21A 4C2UA 1ISGA 1V3TA 4OXNA 2X9LA 3F7NA 1NF3A 3K5PA 4JHLA 4N3NA 1N3BA 3X3HA 4AX8A 5BN3A 5KQGA 1IZ0A 2QBYB 1LPAB 2D4AA 2Q1SA 1W88A 3IQFA 3GGJA 2D06A 3FPCA 5ED0A 4JEMA 2VBIA 1P1HA 4I55A 4IIJA 1RAGA 3VGPA 5KPDA 3TOVA 3GP8A 2YJ4A 3ZJ4A 3BAFA 2PX6A 4QTZA 1PT5A 3PFKA 4ZQCB 2VDWA 5DNEA 4EO9A 1U8XX 4MVCA 4TV9A 2BKUA 3WWZA 4ZV7A 3Q8MA 1N2SA 3T9BA 4BKUA 3BT7A 2ZWAA 2XB4A 2QTBA 3LCCA 1E7MA 1J0EA 5CB6A 3AESA 1X8KA 3TPFA 3W3ZB 2AJCA 4K9PA 5G0UA 2WWRA 4E5MA 3O3MB 1BFUA 3ECAA 5C4GB 1Z6PA 3F1KA 4MCIA 1W76A 2KBEA 3LVRE 4YLGA 2P5YA 1ZHHA 2IYRA 4YR7A 1J1UA 3UK2A 3GLHB 4GQIA 3CJTA 2REXB 4M0KA 1Z8HA 3CE6A 4ZYLA 1XZJA 5I9BA 3TD9A 4XTRA 4OGWA 4TN1A 4E2FA 3UN1A 1P6XA 2AEJA 1ZY2A 5BUQA 3HO8A 3QKSB 4GNRA 2DFPA 4I6EA 4UVIA 5DYYA 4JLSA 5GADl 1QK4A 3CC8A 4ML3A 4KITB 4H18A 1YFJA 3PFBA 4BZZA 3AHGA 1P7CA 5AI6A 3V55A 5F7XA 3KTFA 2CV2A 3CB4A 1XEXA 3G7UA 1Q1AA 2ACVA 4XGKA 1YU9A 1XIVA 1DJQA 2Q4RA 1SCBA 1NVMB 1SXJD 2OVBA 3EF1A 4TV8F 1ZD5A 4ZO6A 1DRVA 4DQ0A 4R2XA 3JD3A 3JVUA 4ZAZA 5AW9A 3OQPA 2B6NA 4GF5A 1TLTA 5C7OO 2W8BB 1Q57A 1RP1A 3FR8A 4CTMA 2O5EA 1PJSA 1UIMA 1H5QA 3FUUA 4C0WA 2EEZA 1FDTA 1WZUA 4JUCA 2PWYA 2P75A 3BHMA 4OI2A 2Q5QA 4YP9A 1E9DA 3GVXA 4LBYA 4OMFG 1TTTA 3ZWQA 1FPMA 1P0CA 4C4ZA 1D5WA 2AUNA 1F17A 4RABA 4RLHA 1DQZA 1V1RA 3P0IA 1Q15A 2QQEA 3JASB 3A1WA 5CD1A 3AL2A 1DC3A 2NUAB 3ZZMA 5AKKA 1IH8A 2ZJ7A 3N74A 4GI7A 4XOUA 4RIFA 3QUQA 1NDQA 3T5AA 2E4XA 4RZQA 4LWQA 2ZU0C 5DM4A 3OFSA 1JPNA 2ZRKA 2ZIXB 1IUPA 4YJ2A 3OEHD 1AGYA 1DC6A 4S0XA 1NR7A 1KI6B 2VNJA 2W0MA 4IW3B 4IMRA 3SNKA 2EU8A 3IQWA 2IEYA 4FFVA 4QDUA 3C1UA 1U3TA 3HE3A 1Q7TA 5FA5A 2O0JA 5FOSA 2WVJA 3LLMA 5TRTA 4IMJB 3HUDA 4COOA 3G9XA 3D7KA 1KI2A 3N0XA 5KNDA 2D3WA 3KVRA 4BQIA 5IXYA 5MGBA 4FFSA 1F2TA 4LK2A 3NBZC 1T36A 4H7IA 2IELA 4BNIA 2GN8A 3X1YA 5C5IA 1XEFA 3B2NA 4C6TA 2CLLB 3R7NA 2WJVA 4ERNA 1KS2A 1KI4A 1U7XA 4G0WA 1GRNA 2PSSA 4LZNA 2K4MA 1RNLA 1T3SA 2RK4A 5FUYA 3UICA 1K06A 1TA9A 1NSYA 2PRIA 2BV3A 4HYTA 4P3PA 5C1IA 5ENZA 1PNQA 5PNTA 4D3XA 1FIUA 4UQLA 3IDSA 3NDBB 5CITA 4ZP1A 1GAJA 2OGTA 4DWJA 4AUMA 2AXNA 1CG6A 4ZK6A 1V6AA 1WVMA 4BN0A 1QFJA 1G7SA 1XD9A 4X6UA 2CXTA 1GL3A 1ZM2A 2ICAA 4WBSA 4TYYA 1GRVA 2R6HA 2XZDA 2DPXA 4TZ0A 1J70A 1NXQA 1GPLA 1UPAA 3CLUD 4WZZA 2I4NA 3OQJA 1VSVA 3QE2A 4Z4EA 1EX9A 3NVDA 3OFVA 2GYVA 2H5LA 1KY3A 3QEMA 4RPLA 4AURA 4QYMA 4DY6A 3IEUA 3MJHA 4JP1A 1UEXC 1Q1BA 2AQ8A 3LP6A 3QLVC 3UO8B 3VBCA 4A82A 4AQ7A 3Q9SA 3AG6A 2YXDA 1M2JA 2EZUA 2DTDA 2XVMA 4NBSA 2PVSA 4EB3A 2XYRA 3NXKA 5DYIA 5H9VA 3NKFA 4JN6B 5FV7A 3S27A 1NZFA 3QWAA 1UF9A 3DL7A 4UVDA 1UDRA 4P0TA 1FFBA 4UDYX 3UV7A 3MTDA 1DMRA 3A4MA 3C3CA 3GQBB 3RUFA 1SVMA 3ETLA 1Y1PA 1CZUA 1YRLA 1K89A 4FNAA 4Q02A 5DWVA 3VV2A 1PJBA 2QXTA 1MQ8B 3AK4A 5IABA 4D9FA 1OWMA 4GKAA 1GQFA 1MTOA 4DMFA 2J6HA 3M4ZA 2XADA 1UOEA 2Q3FA 2HEGA 4PAGA 3FDJA 2X6RA 1FLDA 4MWSA 1Y9ZA 5AW5A 1CUIA 2A9OA 3FLMA 5L7YA 4MUXA 3T1HB 3DZGA 4EHHA 5CA0F 3FI0A 5KNBD 1CP3A 1F5SA 4QM6A 5CEFA 4AJ9A 3SJZA 5IN5A 1FUUA 3HXQA 1V2HE 4TQ9A 1JYSA 2BRUA 1PBNA 5CFNA 5JQGA 3D1JA 1DOZA 1OAAA 4ZT4A 3MK31 3KEQA 4S12A 4Q01A 2OD7A 4K9LA 3H2YA 2EZTA 1QLHA 1W48A 2V7XA 3P32A 5JCJD 2GBFA 5EUQB 9ATCA 3MMSA 3FAKA 3ILSA 4QQNA 1R4AA 1WMAA 1MO5A 4LCEA 4GP6A 3G6WA 3V1YA 1A9YA 5JY6A 4S05A 1AB5A 3LX4A 3WIDA 1BD3A 2VPTA 2ZQZA 2ZWPA 4M7RA 5JS1A 5ERYA 1SG6A 3KHSA 2V7EA 3A0UA 3T9FA 2IYEA 1ZJJA 4A8PA 5I9IA 5DLDA 4Z4GA 1XHEA 2I6TA 4K81B 4EL0A 2IYQA 3LVFO 2C31A 4RVOA 3HWWA 1YBVA 2P27A 4QGFA 2B30A 3RNLA 3QGMA 1M2NA 2FRDC 3BWCA 3F78A 3NHLA 3TIFA 3WG9A 3AKDA 3HKBA 4DLAA 4B32A 3NOVA 5CFPA 4Z2YA 1U2DC 2N46A 3DYBA 4ETNA 2RHRA 3MWFA 3HXPA 5K3AA 2YIVX 2QTAA 4DREA 4EHFA 1V5IA 3EPPA 1SN7A 2UAGA 4A0QA 1I6KA 5FNZA 4BNXA 4ENQA 2BSQA 1UPFA 3NTLA 1PGNA 1Z0FA 2I1QA 3IFSA 3FAZA 1C4OA 2W4QA 3NRJA 3UMJA 3P52A 1NYTA 2J09A 1Y3FE 3WFIA 3OTOB 1QDEA 2QGNA 1U3GA 3AILA 3C4JA 3NBYC 4KP7A 3KLPX 4LJ7A 2QI9F 3TNJA 2AWNA 2GEVA 4Q3AA 3TCNA 4MDEA 2PV7A 1H9CA 5IK2D 2PCLA 3L8FA 4J76A 2ODTX 4QPNA 5HCNA 5B1SA 4G0VA 2YMQA 3AV0B 3R8XA 1VLQA 4EG3A 5KSWB 5L4LA 3MVEA 4MWCA 2HPZA 1EBFA 3F9RA 3F73A 4URZR 2A6PA 2GK7A 2ZZKA 2Z4SA 3GEIA 1R3UA 4MVWA 3RHTA 4GEKA 5EJMA 2DJIA 4TV8A 1I94B 2JJ1A 3L07A 5KWEA 3G0DA 1P19A 2YJ6A 5C18A 3RYCA 2WSLA 3BGSA 3D2LA 3UJ3X 2CWWA 3F8TA 3MC1A 4CR6A 5ICEA 3DPSA 4L6AA 1NZDA 1IG0A 2O52A 1MAUA 2B5WA 4FCTA 2PU7A 1KDYA 1NHGA 3MT7A 3RKSA 3ZNNA 4AY5A 4XWYA 1O77A 1RFGE 3IP5A 4UUOA 3KBOA 1H1LA 2W9XA 3C43A 2Q4BA 4Z4QA 2AEEA 1LB1B 4C4AA 2R62A 4LF4B 3GLHA 1Y8CA 1DO2A 1XTBA 2JEYA 5CVCA 3O75A 1L7AA 4ZGBA 2JFYA 5L7TA 1UT6A 2Z4TA 1HQYE 4HDCA 4IZIA 3IR5A 4JGIA 3QP9A 2DEUA 1DCMA 1GVNB 1N0VC 3E18A 2FW6A 3OIFA 2P0YA 4U6NA 3HXOA 2HBZA 1UH5A 1ZUNB 1MOPA 4OMCA 3K0CA 3LQFA 3WNVA 2FSSA 2XODA 3IAS6 3M1AA 2I3AA 2KS6A 1A9XB 1GUZA 3MLAA 5EJ7A 2VDWB 1LK7A 2FG6C 2OYCA 5HRAA 4D9NA 3KKLA 4E32A 5L9AA 2OHXA 4X6YA 3K4QA 3WRYA 1KWKA 4X44A 3AFGA 2UVDA 4L0MA 5HDBB 2EKZA 1ITZA 2R00A 4X3PA 2V7QD 3O8BA 3FB4A 4NXMB 5IRCD 4NJOA 4OUKX 2GB4A 4DR3B 2AJTA 3LC0A 1KARA 2JASA 2H63A 4XWOA 5DMXA 3JQAB 3M4NA 3OFKA 3ASYA 3IQXA 4XFDA 4XVCA 4GVLA 2RK6A 2D7CA 2YV5A 3L7MA 1JTEA 3ZE0B 3BQNB 2TMYA 2LBPA 1RC0A 3S2EA 4RF5A 2NWQA 2A84A 1ZCJA 3UTDA 1X80B 1DUIA 3H04A 4WLNA 2O3UA 3N8IA 4JJ7A 3EIHA 1R2QA 4CMIA 3GLFA 3X1WA 5IN4A 4EUKA 4JITA 2P35A 3LDAA 3ZDAA 1TTPB 1W52X 1EDOA 2JFHA 3F96A 3M1IA 3PVZA 5COAA 4RIEA 1X3SA 3ZH9B 1UFOA 1OZGA 1SVUA 2GFHA 2Z1MA 4V0NA 5I7EA 5JZSA 1SRQA 2F3PA 3FYDA 2OV4A 1BMQA 1SK9A 3HCCA 3RS2A 1N6IA 2FHSA 4UOZA 4K0KB 2QL6A 4A1OA 1ZMOA 2WAAA 5C8VA 3OJWA 2JAWA 1ZZEA 2O2GA 4URYR 2JH8A 2CXPA 3QQ5A 5JPIA 2CNBA 1ADCA 4KXMA 4MVJF 5KX5B 1SQGA 2R8RA 3DWFA 2EWVA 5EERA 4D79A 1CJMA 1NZJA 1TQHA 1CUAA 1E6CA 3TNLA 4IGKA 1PJLA 1AVTA 5K8VA 3LP8A 2G71A 3TW0A 3EARA 4QRHA 2VP5A 1PW7A 1FB5A 3ORSA 2RHBA 4KFCA 4G5GA 3QBDA 3HY6A 1G5HA 3JASA 3D7MA 3L4BA 1AA6A 4K6HA 1YONA 4PYKA 4YALA 2MCFA 2IHZA 3STYA 5BXYA 5AXBA 4E03A 1UJMA 5EIAA 3CRRA 4F5EA 1SR8A 2F48A 2HJSA 2PJZA 3GLQA 1VPDA 2IPNA 3OQ1A 4X3OA 4GR4A 4OX9B 4X1IB 2F1IA 4FS8A 3VYUB 1PQPA 4GX2A 4NK5A 1B2LA 1HETA 2QD4A 1C9MA 1ID1A 1Z25A 1WP9A 4XYLA 1RM0A 4ZZIA 3ZIAA 1OY1A 4FFRA 2G36A 4WLFA 2HSWA 1UBOS 2PMEA 3WRWA 2X0JA 4RMNA 3SIXA 4BDTA 3OZVA 4R98A 5T5QA 2IU6A 4ARBA 3FNIA 2AK3A 2QLBA 4HZIA 2JCXA 4DJAA 3H5LA 3UPTA 1KR2A 5HRUA 1NJ8A 4I1UA 1Q50A 3L8HA 1HT1E 4EDFA 1BMDA 1Z0DA 3BFVA 2LP4Y 1JHXA 4G07A 3ANYB 3ENNA 1B7GO 3BCSA 1C0PA 2E4WA 3E2PA 2H4YA 1VBNA 2V8OA 4UKDA 2XE6A 3EIOA 4YJKA 1XWFA 3BJZA 2G0NA 3BKXA 4HADA 5CG1A 3HBNA 4HAUA 4AZ0A 1U4OA 4PR3A 1ZCZA 2AD5A 4MLDA 1V96A 4B75A 3EIWA 5AJHA 3SC4A 1KO8A 1NUUA 4PC7A 1VKRA 2W2OA 3CVWA 4XVHA 1ULSA 4C21A 4UFOA 4L9AA 1OBCA 2HA0A 1ZNQO 2P67A 4FGUA 3AF2A 5TMEA 4UTVA 3RUEA 1D07A 2PMBA 3EVBA 2PSHA 4BVAA 3E23A 4BCDA 4HQRA 4DMGA 4D4MA 1VG8A 1YA4A 1XUOA 2BE9A 1UZMA 1Y34E 4P7GA 1LVGA 1MO4A 4HLCA 3T0IA 2P40A 2WKPA 3U4IA 4BGEA 4EELA 5EXTA 3WYFA 4Q4CA 3GEEA 3F7MA 4LA4A 3A05A 3F2VA 3JQDA 4EPVA 1IVYA 4PZPA 5KVQA 4DS3A 4EENA 2GUWA 2Z9DA 1XZGA 5DPMA 4JQZA 5D1HA 3IPCA 4CHGA 1HSZA 2YINC 4S1VA 2REBA 1KOFA 4BFYA 5C5EA 1BHO1 2D0IA 1JU3A 2ZXFA 4AROA 1FP2A 1CR6A 1ZJYA 2QN1A 2PSFA 5T67A 5I5EA 3HM2A 3R75A 2JI6A 3D4BA 3LCJA 4FU0A 1OGJA 2P4EA 4TXHA 2A5JA 4NMLA 5K8JB 1ZIPA 2PNFA 4A36A 1ZA1A 3DMFA 1I7QB 4IP0A 4NJEA 1PEYA 4QUDA 3FTPA 5IYZF 4TTVA 1L5KA 1U8CB 3RJMA 4B6SA 1BMFD 4J7AA 5I7AA 1ODIA 3WNZA 1W36C 4Y67A 2RGNC 1OH6A 5JD4A 3GVHA 4U02A 3MAJA 1OA1A 2W83A 4WKNA 3V1NA 5B1EA 3N8HA 3DEFA 4BZXA 1T4CA 3M83A 2XGMA 4EB6B 4IEIA 1R6BX 3AY7A 1RJ9A 1SKYE 1TO1E 2Q9AA 1KPIA 1KY4A 3B2QA 1WETA 2HF8A 2EHJA 2H1SA 1TTQB 2IBMA 2UYCA 1N34B 3M1LA 2J30A 3OZAA 4RCZA 4BHTA 4CLEA 5CDSA 2PL3A 1AGPA 2CHQA 4OQNA 1FFEA 1XTSA 1QF9A 4YRGA 3N2IA 2OLKA 4V0OA 5T57A 1NC3A 5L3QA 2IE8A 3VZDA 5C1DA 1XX6A 5JRJA 4HUJA 2YZ7A 4N18A 4P4GA 2R8YA 3FSJX 2CZCA 1IJBA 4BLWA 3T95A 3A3NA 3TRKA 5AO9A 5B12A 2NYRA 1DPFA 1UEJA 1TJ5A 2PVPA 3JYLA 621PA 2P9CA 4WUTA 1KKUA 1X6VA 2Q4OA 1OB2A 5THKA 2BZGA 3QM1A 4OATA 1JVBA 3HGTA 4RY8A 2YH2A 2BEUB 5CT9A 2ID4A 2IHUA 3LPCA 1FDVA 3W79A 3L77A 2XRFA 4M1SA 1BE0A 1L3CA 1VSBA 1W85B 1B26A 1YBFA 2I2CA 1O08A 1OAKA 2J7KA 5AJZA 5J63A 4D02A 4D4GA 1O89A 1HQDA 2O0MA 1EA5A 3QBTA 3I5MA 3R3YA 4CIXA 3I5XA 4YJ2F 4KBGA 4UPDA 1CY2A 2QTLA 4KWTA 3FGOA 1UP7A 4GKJB 3T4PA 1K5DA 1LPNA 2DETA 2QI9C 2CL6X 3U56A 1ODKA 2Y99A 1T0BA 4UUNA 4NY1A 3VH4A 4AU1A 3MXOA 2XWPA 3WK4A 3NWJA 1A1SA 2IYWA 4M8NE 5CHEA 3HVIA 1CUHA 1P1BA 3NNNA 4NQRA 2O07A 2AI2A 3G3EA 3H6HA 1Z82A 3OIUA 3WTCA 2EERA 3ICVA 4YVFA 4BFTA 3AR2A 1KTIA 1UBJS 1SU7A 3ZZ0A 1XXHE 4LHZA 1TL7C 1PJ3A 5ERGB 2C59A 2AHOA 4U3JA 1TMYA 4K9QA 2PLNA 4YV0A 1M1YE 3QXHA 1K66A 1ZUNA 3E53A 2DXIA 1T25A 1T15A 1THMA 1UJBA 4RWZA 5AVRA 1WM1A 5HBRA 1OXMA 1G2OA 1UJNA 4V0QA 1RWOA 5TQ2A 4OYRA 1CC1S 4BASA 1YTLA 5ALEA 1FFDA 3BFKA 1OYOA 1IUKA 5TE9A 3QX7A 1D6JA 1PQWA 2CJFA 2GQ0A 2WM8A 2W70A 4XH9B 4HX9A 3WLSA 2I33A 1JRLA 1DEKA 4B2IA 5KKNB 4HO1X 3O2SB 1PR1A 4FKZA 3CZ9A 4HDAA 2GWRA 5ICGA 5IVPA 3RAFC 2OV1A 5JFTA 1GNTA 3TYXA 4BWVA 5E4FA 1FC0A 2JBAB 1KFKB 2AMVA 2YJ3A 1VJ0A 3B7GA 4GMKA 4OSOA 3O1HB 1YQEA 2PH7A 3GBVA 4ZYWA 4CMJA 4D96A 1JQ3A 4TSFA 1T24A 5JAHA 1RC8A 2CLMB 2CLDX 4V1CB 5ILOA 1ZLXA 3AEYA 4ZO9A 5BSFA 3THOA 1YMVA 1KQFA 5CAEB 1K3TA 3SS8A 2CC2A 1EG7A 1UMBA 2Z1DA 2I2FA 1XA4A 3MBOA 3UT5B 1UC8A 1UAAA 1I9CA 3Q8LA 1H42A 1ZAYA 3IV6A 3NEAA 2IIVA 2PKWA 3K1TA 2K87A 5DXAA 1M7GA 3P5SA 4NBKA 1N9KA 1TM2A 2AXQA 2BFDB 4KLNA 1L5HA 5LYJB 2C2WA 2LNDA 1VHQA 2NNLD 1ONBA 2MIIA 3OF3A 4P7BA 4OX9Y 2GBIA 2G40A 3CT4A 2BN4A 2WWYA 3VKVA 4XWWA 4QHYA 3KJFA 5D87A 4BQOA 3ICWA 4C1NA 2ZKIA 2J5QA 1SA0A 3DTVB 5DBGA 4RLFA 4OLFA 2R6FA 3LC7O 1JL3A 1M2HA 2Q9CA 4HSEA 1P9RA 1V47A 2P9ZA 2VPXA 2X9NA 3JVEA 3O9ZA 5LBIA 1TMOA 3AIKA 3MWGA 1QBGA 1V43A 3RPEA 1ZH0A 1P44A 3U3MA 2JFUA 1NFRA 2R2AA 3KLOA 1EFVB 3TJMA 5IDXA 5G1OA 4P22A 4EHAA 2JLXA 4EJSC 3I01A 1H3FA 1YDFA 3ZBPA 5KNDH 1X74A 1IN6A 4ZAWA 2WK1A 3BBLA 3I6QA 3LQRA 3NM5A 4ENVA 4Y0NA 3OIWA 2OMEA 3RJ5A 1E96A 2WRZA 2WYOA 1ATZA 1YZLA 1UKVY 3PF8A 2HRZA 5HFJA 1E92A 4Q19A 2DRIA 3WQQA 1UQRA 3IUNA 2IV7A 3TRHA 5H3LA 3PS9A 1YQXA 2FFAA 3MTBA 3UH1A 1UWKA 1DIRA 2BCJQ 2PEYA 3G0GA 1ZW1A 1AURA 3W5DA 3OZSA 5IZ4A 3DM5A 5G53C 3ZZUA 4M9UA 4HNUA 1YE8A 4CLRA 5FH9A 1A4XA 1W8IA 4O6VA 4O4IA 2QAGC 3JZDA 2ESRA 4I8IA 3AEKA 1VGQA 1JR3D 5DVZA 2G9NA 4D9IA 2XBUA 2GZSA 1JSCA 1N9GB 3TH5A 1WKCA 4DILA 3W90A 3T3HA 1P3Y1 1AJEA 4X20A 3ZX4A 3TTTA 2BONA 4JLKA 4YLYA 1J0AA 3EXEA 1MFZA 3NVAA 2QRKA 1NBMA 2D2VA 1YVDA 2PZ8A 4I36A 2GVZC 4LYYA 3GEBA 2FSVA 1NN1A 4OBBA 4P7JA 2Z2JA 2ADMA 3L7NA 4E1AA 2WU3A 1DADA 4LJ9A 1XTVA 4N12A 4TRNA 1B6RA 3PNKA 1QAQA 4BRWA 4KQIA 4Y30A 4B7XA 4ZC8A 2R5WA 2P8JA 2Q0QA 4ZO8A 3PENA 3ZKWB 4F4CA 4B3TB 1O96B 5EJ5A 5I8PA 2P11A 1JFVA 2HJHA 4E09A 1WKBA 1KJNA 2PHZA 3E22B 4D8VA 1S89A 2XQKA 1DS6A 2H57A 2BFPA 1RJGA 4LGYA 2ILVA 3B3QA 2E87A 3A1VA 3ES9A 4X95A 5EIHA 2AN5A 5AM1A 3TOSA 3WBBA 2VUSA 4OQQA 3C41J 1R5OA 4K9MA 3SEAA 3WWDA 3I23A 4RIGA 1AUXA 1NF9A 3VR5H 3FROA 1GGJA 4UM9B 1N3IA 3OCVA 4RZHA 3EXHB 3PR2B 4CETA 1SD1A 2QRPA 3D2AA 2JGRA 3JQBA 4O33A 3TM5A 3UMYA 4H0FA 5JALA 4RTNA 5C9ZA 1JJAA 4E4RA 1XL1A 1JEOA 2O8BA 3COVA 3N75A 4RSHA 1G3MA 2K2QB 4C07A 1C8LA 4P35A 3STUA 1JWBB 2X23A 4J0EA 2VOJA 4CCSA 3GPLA 1SRRA 2A94A 2F90A 3IKVA 3K9CA 1XU9A 4QVKA 3T5PA 3MTEA 2NADA 5KYXB 1Q17A 5J4YA 3HXLA 3IPRA 4B4KA 1VG1A 1Y1LA 1JG3A 2ZTSA 3GZ4A 1ZI9A 3RJ9A 1ZD4A 5HZGA 1I5EA 3W1WA 3AF1A 3N2LA 4X85A 4EDHA 4D8TA 1JR4A 4UAJA 2J4DA 2IEGA 1U9ZA 1QK5A 2ETXA 2M1XA 2UVQA 2XUIA 2JFQA 3AZPA 3PFGA 4HGNA 3I45A 1HDIA 5IZCC 4MGIR 1G17A 3AJ8A 3FHLA 2F9MA 1P62B 3EVCA 5F1OA 3W77A 3G9ZA 3OPQA 3RVRA 3PUKA 1EEXB 3FGZA 2VA8A 1DFGA 1FNNA 3DLTA 2PJDA 3BSYA 3CH4B 1RHQA 1SBQA 2A1TR 3K0SA 2WB2A 3RS0A 4F1WA 2QNIA 4PCVA 4PNZA 5DRTA 4D92A 2B3TA 2NPFA 2H4FA 2XE4A 3L1KA 2QYOA 4OFZA 1QTRA 5LLTA 1RACA 3AOEC 1NU6A 5JO9A 3LHFA 2JRLA 5ARDA 1JA0A 1UDCA 2FF7A 3GRPA 2GPJA 3UV6A 1BC5A 3EFBA 1RWNA 3OWHA 3H5IA 3P20A 3IOEA 5DYNA 5EUMA 2VXBA 1WTCA 4PCUA 3TDMA 3BICA 1SG0A 1RT9A 1PTJC 2VPQA 5B3KA 4N0QA 4NH0A 4PYNA 3RRYA 1AQ6A 3Q10A 3KSDO 1CB0A 4AFNA 3PWSA 4ESHA 1KJIA 3H2BA 3O0DA 1NOJA 3IHKA 1P31A 5JXIA 5CNKA 4YO8A 2NZWA 3I4CA 2ZTHA 3UTCA 5KYGA 4JB8A 3HL0A 3LHIA 2RBKA 2ZIAA 3PHCA 2O2ZA 3HA5A 3CT6A 4ZO7A 2WU1A 4YJHA 2AW5A 1I3CA 1TD9A 1AXEA 3LBHA 5E0KB 3DP7A 1QPZA 5AUQA 2O2HA 2VDUE 1V37A 4ZDIA 3ZOKA 1DJNA 2E55A 3F7OA 3NBFA 4HUQB 4BX3A 3OQNA 3BAZA 1GLGA 4E2ZA 3EASA 1Q95A 4N8SA 4H59A 2DUNA 4WEOA 1F5NA 1B0AA 2ZJAA 3H7IA 1UK9A 1E2FA 1DMSA 3LZ6A 4BP8A 4R9NA 4ZTBA 1YB6A 5CX1B 3HRHA 3J80A 3FHOA 3DJFA 2XUAA 1ZOPA 3L7DA 2ZJOA 1LW7A 3V32A 5DP2A 5GY7A 1EM6A 4LE2A 2EJTA 4OXQA 5TVKA 4UPEA 3ENQA 3NZEA 3QVVA 1RTTA 2C1XA 5HIIA 2XTNA 1CUUA 3AOGA 3UOGA 2XOKD 4XQ0A 3HN2A 4O8ZA 1KEKA 4K87A 1WHSB 3MFQA 4TYNA 2ZRIA 4NG4A 2X4DA 2GM5A 1TAHA 1J24A 1FQKA 1FUEA 1QH1B 1R15A 2G9VA 4ZO4A 1FMJA 2FSIA 3QMPA 4OHMA 5KMGB 1YXMA 1ZC4A 4FLFA 4UVHA 4GZLA 1W0KD 3ETGA 5DSZA 1OU0A 2ODWA 3BOSA 1XQVA 1FP4B 2H0RA 4DLYA 3DOJA 4JT8A 3LPAA 3Q41A 4O3MA 2FN3A 3GMSA 1PEDA 4BB6A 2XYQA 1P4RA 1PJ2A 1U0JA 2QVLA 1U2ZA 2R96A 3A9TA 2C7RA 2GAJA 1HE2A 4KTTE 5BWCA 1QNLA 2BFCB 3IAM6 3OQIB 2BFFB 2FB9A 1M7HA 2M98A 4CMBA 5CB8A 1UBUS 1BOOA 4G8JA 3SY8A 3AP3A 2H2WA 2QX4A 4I55B 3RR2A 4DKXA 5K99A 4AJOA 4C7MA 5GIOE 1PNTA 4GX1A 2QW8A 3RJTA 2DC1A 5K1ZA 1ND5A 3RC3A 5K0BA 2R1VA 2GZMA 5KYVA 1KA9H 4G97A 5EXEA 3PRHA 1ODJA 3Q98A 2PKYX 3PI7A 2YBDA 3H7AA 1JLHA 2FP3A 4TT3D 4UU0A 5KWSA 1WDLA 2PANA 5JR3A 4MQ4A 3KD3A 4J7XA 1RKQA 3I9LA 4ENPA 1ZVVA 3ZQKA 3VU8A 2JEOA 3A6KA 2WJ4A 1UDXA 4X91A 3ZGNA 4KBFA 4Y2SA 4DABA 1WVIA 4O5AA 3VR2D 4EGSA 1E5XA 1K7FB 1VE6A 4N7MA 2I0FA 2WPNA 3SBEA 5KMGA 2XZTA 4R84A 1XEAA 1SEPA 2EX1A 3MCWA 4DC9A 3AKCA 4MLZA 5KSPA 2I7CA 4PTLA 5JWHA 3DEAA 3T1TA 1F3OA 1LWNA 3AH8A 3Q6NA 4X60A 4AWAA 4C08A 3S2IA 2D5IA 2JAPA 1I7LA 2W5UA 2CMDA 2D54A 3KUDA 5AIAA 4FFBB 4B74A 2QB5A 3AUFA 2EARA 4I4CA 5EFOA 1XCPA 3VBEA 3UAGA 5CAEA 2NZJA 5FUWA 1OWPA 4OGFA 3GMTA 3LG2A 4FNGA 2AEMA 3ZXXA 2CNLA 5HVNA 1A7UA 3ZWVA 1QQAA 4G0YA 4G86A 4WLEA 1XNQB 2JFBA 1YCDA 2CDRA 1KDVA 5ER9A 3U3JA 4IDCA 1U98A 1TU4A 2G67A 1A3CA 3MN1A 2ZYDA 3P45A 4GSKA 4DV7B 4RHYA 2ZJ3A 4AC9A 4NE7A 1V48A 1TAUA 1GXSA 3DBHA 1TUEA 3IAS1 1R10A 4GL2A 2VYQA 4ZCSA 2W90A 3KU1A 4H7PA 4JVMA 1J00A 3DEJA 4BNGA 1SU6A 1MENA 4NYMR 2XA2A 1GA1A 1K5HA 1A97A 1PX2A 4XDYA 1LLFA 4UE2A 3QI2A 3R3JA 3RSLA 1L7RA 4D0RA 1H6CA 1NWCA 3PDIB 4G4SP 4NC9A 1E2NA 4YREA 4G1MB 1Z6QA 2EFDB 2NUAA 4FD2A 4GP9A 4RFLA 1YHZA 3TFQA 4HGYA 1O95D 5DK6A 1FSPA 3ZYCA 9LDBA 4Q4HB 2P2DA 2PGDA 2ZAGA 2JGJA 2FVYA 1E62A 2X3YA 3FNGA 4GWKA 3FYUB 4H7DA 4HEA1 4QXPA 1EE9A 4CIAA 3AHCA 1BSVA 3QVKA 3L0ZA 4HRAA 1L5GB 4RY0A 2WHQA 4M6WA 4I9FA 3ACCA 4TWIA 4RY9A 3WGJA 3OM0A 3AVPA 3BB4A 3JQCA 1BE6A 3ZQJA 4J0FA 1ESZA 1TVMA 3WGLA 3W6PA 2CDBA 3GYGA 2BEVB 3IUSA 3K9GA 5BO5A 4KPYA 2P41A 4UUBA 4PGMA 3ZKWA 2MMCA 4TUYB 3JQQA 2MYUA 1UMCA 1Y1TA 1RAFA 1D2GA 2FWRA 3B89A 4FJ0A 1ZD3A 1P5ZB 2Z9CA 2REQB 4J07A 1IAVA 4IXMA 4X62B 5HTOA 1U94A 3DMRA 4JU9A 1TW2A 1KSFX 4MUAA 4ZFNA 3IEVA 3OSZA 5ALFA 3V6LA 3VZSA 1ZEJA 3QH4A 4L0CA 3B85A 3IRVA 3W0LB 1RS0A 2QZJA 4D0GA 1L5QA 3E7XA 3PD7A 4I9UA 4H08A 3VDNB 4BECA 4I0WB 2VJOA 3I9KA 3PQ5A 4OM7A 3EXEB 3EXHA 3STTA 1DKQA 2BGRA 2FOLA 1QVWA 4EJSA 2C7BA 3MB8A 2VEDA 4GI2A 5K0NA 3H5NA 3SF8A 3RBXA 4PM4A 1NBOA 1FF9A 1DG9A 1GNPA 1SQ5A 2OCBA 4JBXA 5D7BA 3JYHA 4ZEOA 1NUPA 1YZ3A 3GJSA 2A3NA 1U3DA 2OG2A 3UB3A 4FQ8A 4MVJA 3UGKA 2AG8A 4YROA 1YZYA 1YS6A 4LJAA 2H2DA 1JE1A 1ZOOA 1JDBC 3EUFA 4OHBA 2ROQA 3IQIX 5CX4A 4GOOD 1MTZA 1OFUX 2O50A 1DKLA 1C41A 3BRSA 3IVMA 1HSOA 3IQEA 3VNSA 3GAMA 1CUWA 4FK8A 1MP0A 2D2FA 4QFCA 5CVTA 2XUFA 2OHJA 5D00A 1UPTA 3HLTA 3V9AA 4JCOA 2SKEA 4QATA 1T2EA 1MMFB 1RRKA 4X97A 3WB9A 1Y7PA 3CEJA 3RYIA 4V3CA 1TQDA 4HT3B 5DJ5A 1JMKC 4EFMA 1EE1A 1RQRA 3W9BA 4BQRA 4BV2A 1IBCA 3WX0A 2CFTA 5DP1A 1RVV1 1MORA 3OKCA 5EKTA 4HV4A 1NE2A 4PYIA 1FCJA 1K3UB 5EC8A 1KHHA 4I5FA 1T0HB 3O31A 4AS2A 1TADA 4N40A 1XPRA 1FXUA 4O2BB 3A1SA 3RNOA 3CSSA 4R7GA 3QLUC 1A9TA 4C0BA 1UC4B 3AY3A 3MILA 4LYJA 1DT3A 4NL4H 1BHQ1 1U3UA 4P5PA 1GZ5A 2A9QA 3RHFA 3HV2A 3UWDA 1O9BA 1NQAO 1TVCA 4EG0A 2CFOA 5KYUA 2BGNA 4PS1A 2Y1EA 2C96A 1TKBA 1CP2A 1P2TA 5FT9A 1QCDA 1XA0A 1K1EA 1L1EA 2QVYX 4ATNA 4RZIA 1Q3TA 2WJZB 2QRGA 4L76A 4R3UC 4YRAA 3K0FB 2XT6A 1XF1A 3NWEA 4CI9A 2XB6A 3EZ6A 4AMBA 3TQSA 3UWSA 3MA0A 4HFNA 4L27A 4GI3A 3TVTA 2VA9A 1VM6A 1G63A 1LSUA 2GXSA 3FOBA 1JP7A 3A6EA 5PGMA 4WDRA 5JZBA 4W7IA 3L0PA 3CWZA 1E69A 3FBGA 3O92A 3OKAA 2BMWA 4HUQA 4NS1A 3W6ZA 1DLIA 1Z13A 2Q46A 3ZLVA 4AUKA 3P5BA 4BO1A 2VP4A 3QUAA 4CF7A 1K7EB 2CHVA 4ZALA 5AP9A 5JSQA 3BJEA 2ONKA 3HCOA 4AJEA 1DX4A 4FUQA 4B3BA 1Q7CA 1ZXBA 3IL2A 1IK4A 1KZ7B 4PHCA 4REOA 3T3MB 4GMHA 3VYVA 5CFQA 3MWEB 1LFAA 3TUJC 4DGSA 1G3UA 2O2DA 2JF0A 5BVHA 1MDFA 4AN0A 1U0GA 1YFZA 1O5IA 5TGTA 3BX1A 4DLXA 1G98A 2J3IA 3WR5A 3DB2A 4HWTA 1YDGA 1Y1KE 1YZNA 3AF6A 1R6TA 5TF4A 3FVWA 2ZM5A 2ARKA 4AO7A 1Q1ZA 2WJJA 2C0PA 2J31A 2WI8A 4YT8A 1J07A 4G4JA 3MRSA 1E1RA 2HRRA 3EEFA 3IDOA 3H83A 1D0VA 2GLTA 4UC0A 3PLAE 1C0LA 3BXFA 1P74A 1ZU4A 1LTKA 2D5CA 3W3AA 4TLAA 2VI5A 4PLHA 4B8ZA 3E3OA 1UAYA 2HU7A 3RYFB 1IAQA 2HLDD 2AOTA 1BVUA 1KMQA 3KDSE 3B9BA 1UMDA 3OU6A 3ONEA 2QX8A 3C3DA 1XZLA 4FZ3A 1ZUIA 5A9SB 2CEAA 2YBEA 3SIWA 3FVVA 4O2AF 1MF7A 1KZ9A 3U19A 4RW0A 1HTTA 1C7JA 2RC5A 2NO0A 4DR2B 1WIWA 2V58A 4CODB 4FDLA 2QZSA 4OQLA 2V65A 5KYYA 4RQUA 3LUKA 2O05A 2D5LA 1QONA 2DUWA 2NVOA 3IJPA 4FWBA 3Q2OA 4ZT2A 4DBVO 5KTYA 1FP4A 3ZUGA 2QMYA 5CG2A 4MLCA 4IKPA 3DE4X 1WSBA 4WZ6A 4BPBA 4FINA 1HQKA 3ZWBA 5LIRA 2PA3A 1B6GA 3TRDA 3R6WA 3K30A 2Y1OA 1NVWQ 4G0NA 1V26A 2XHEA 3IVAA 1P2UA 1SCIA 3KPWA 4WESB 5KWVA 3HACA 3VJRA 2QPLA 1I01A 3X2FA 2XYVA 4DVGA 1G19A 4UDXX 2QUJA 2Z4RA 5EWJA 1R66A 5BN5A 3N6VA 1PF7E 2ONZA 2WZBA 2WZCA 4FFBA 4Z0PA 2B1RA 2QXYA 4ZT3A 3RFVA 4C7BA 1K7YA 4EAAA 9LDTA 3I9V6 1JQKA 4GM1A 3S40A 1USVA 4U0KA 2RG1A 1ORTA 1SFRA 2VYND 1HG0A 3NNDA 4TRRA 1S1MA 2NPOA 1NXXA 4YAWA 1U2EA 4GDMA 3K53A 3EPRA 5GM2A 3M2PA 2CKDA 2JJMA 1W4AA 3O8LA 3AP2A 3TG2A 1N0UA 5DBEX 2OQIA 4UAUA 1N7JA 1CNEA 4FLEA 2I7XA 7MDHA 1TC1A 2AFRA 2QQGA 2R00C 3TLKA 3WKBA 3C87A 4IDNA 4IIUA 1KDRA 4CM8A 4NYMQ 2OV6A 1K08A 1QGZA 3E1SA 3QUCA 3RVLA 2H11A 4IIGA 3PV0A 3ZE8A 5K4GA 3TTSA 2EKPA 1WZEA 5JADA 3KTAB 1A9SA 4B6QA 4AMUA 2EFCB 4K6GA 2RH5A 4HDNB 4QC2A 5KTMA 1RQ7A 1RR6A 3D5EA 2ZUCA 3KWLA 1FS5A 5FIUA 3DQPA 4L08A 1BCSA 3SSAA 4C0JA 2X2EA 4U7DA 1YD7A 3DKKA 4KE7A 3A1FA 3RARA 1EJBA 1HM5A 2IU0A 2QRZA 3WNCA 2HA2A 3L1IA 1N8NA 4RMJA 4WKBA 2AR7A 4QYWA 3TIGA 5LOVB 3SBDA 1FYFA 3M33A 4HKTA 4MPRA 4GMXA 5B1IA 1WBJB 1IJFA 4I5GA 4LBWA 2JLQA 1MO2A 4WK6A 5K3OA 4CM9D 2PH5A 2BEVA 3TX2A 4ZVNA 2TECE 3KWFA 4J29A 4QXOA 4Y2JA 4C05A 4FYKA 4YO7A 1Z06A 4EY6A 4W4TA 5IJ9B 1CZKA 4TUYA 1YR9A 4XIIA 5BWBA 5LP6A 1J8MF 3B20A 1WOMA 1LVUA 4E6PA 1NJ1A 5BR7A 5BQFA 4BBJA 2GNOA 2GO7A 3HDYA 3EC2A 2QE6A 3I6BA 1SCAA 4U63A 1GGNA 2DBRA 3PPYA 5EY5B 1D2AA 4V0KA 1KRXA 1FP7A 1C0KA 1E8MA 1QCZA 3GIWA 4URUR 3ZQ4A 1G4HA 2VTEA 4C0SA 4YACA 3EGOA 2QJOA 4DA8A 1RFLA 2HYDA 1EK6A 3FOAA 5TQ0B 4BBPA 4BMPB 4CV0A 3CX6A 1KORA 1JDUA 4N7JA 3E9RA 1FDWA 5CT8A 5LKAA 4YRQA 1EPUA 2D1SA 1Q83A 3COWA 4FBLA 3OO0A 5BRJA 5I7SA 1X7DA 2P6UA 3OA0A 4M1WA 1QVAA 1QFMA 4EJSB 2Z6QA 4BGIA 1ZOLA 4FILA 3VR3D 3DKVA 3P2MA 1OGYA 2BP7A 3I2HA 5ISMA 3PNVA 4HLUA 4HQ6A 5FPYA 1D7AA 2NT4A 3E48A 2CBGA 2DPYA 1N2EA 5TS2A 3TUZC 4Z1OA 2J32A 2HW8A 4CF6A 2I6QA 2JHAA 1GZVA 1I4TD 1QQ7A 3I0NA 4TPKA 4D4JA 4E13A 3A9UA 3JAWB 4MR9A 4PHGA 4P93A 5L53A 3WAGA 2O59A 2PL5A 5KAMA 4C01A 1PU2A 1CUBA 5I51A 1XCGB 3ONDA 2LVBA 4A2CA 4CG0A 1D6SA 2JGMA 4WNYA 3ORRA 2C97A 4O08A 4JLWA 4OGGA 2OBXA 3EMBA 1LPPA 4RYLA 5FPSA 4ARZA 5FWYA 4BO5A 5LYJF 5MF6A 1N25A 5IKOA 3UJAA 1H8HA 1NLZA 3UFBA 4PXAA 4RDCA 1II8B 1PVDA 4BVGA 2XRZA 2RGXA 3ROMA 1NUTA 3ZHSA 2A0UA 3ZVLA 3SF8B 4LW8A 1H69A 1O8BA 3WLFA 2VH2A 3RHSA 4XVUA 1Z6XA 4OHKA 1TPYA 3HI6A 3PJGA 4MV1A 5FBRB 3QX3A 4GPTA 4DA4A 2LD4A 1N2CE 1QHGA 1JHPA 1Z68A 4JMLA 2FP4A 4JXZA 5ALLA 4NCIA 1VA5A 2ZQYA 4J91A 4F7DA 1KH1A 1IBRA 5I7HA 4LF8B 3ILVA 1Z7YA 1UQTA 2MYPA 1ADFA 3ILHA 2FUG1 4FHFA 4M1QA 1XALA 3I8OA 1VYHA 4XSHA 3C16C 2PIDA 4YMWA 3QG5A 4S1TA 5SYNA 1H65A 4I4TB 3QBJA 2Q29A 1Z6AA 4WY2A 3B1ZA 1CS0A 4NARA 4RS3A 3CLTC 4UBMA 5ALVA 3M6FA 5IM5A 5LQUA 4UZEA 3RFTA 1N7IA 3TSWA 4G1VA 3ITDA 3PD0A 1KI7A 3GHHA 1IXRC 4A0GA 4EA9A 2JJYA 2XW6A 1JEYA 2ZPTX 1YU6A 4PSUA 3D3EA 2LCIA 4MHTA 5AR1A 1BWRA 1NHWA 1ICEA 1RCUA 1PNVA 1KRHA 2W2XA 5EJIA 1Y7IA 3HR4A 2G9RA 4BNDB 4BZQA 1SXJE 2BDUA 2XB9A 4JJAA 5EIBC 1JZTA 2JL1A 3T7IA 2G4CA 3PQ8A 1GFWA 3ZNOA 4C3ZA 1PK9A 3KUCA 4UHEA 4PAOA 1G3QA 3C39A 2WINI 4F4FA 5F2NA 1GQQA 2H1IA 5ES3A 2PH3A 4HQOA 4F5ZA 2QT9A 1SOMA 2HNAA 5BSRA 3PJRA 1EFDN 4ZKEA 1W2HA 2DH5A 3R7BA 4PW0A