1MTZA

Crystal structure of the tricorn interacting factor f1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
290
structure length
290
Chain Sequence
b'ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 113
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mtzA00
1CQWA 5IVKA 2ZYSA 2WHRA 4UHCA 3R3VA 4FFWA 2WTNA 2WFMA 2RGUA 1QOZA 1GPKA 1Z68A 4BCBA 5JAPA 1CEXA 4C4ZA 1LPOA 4BTLA 1P0MA 3KWJA 3MVEA 4BRSA 1MX1A 4N8SA 4JYPA 1QE3A 2JF0A 4FBMA 1YAHA 1A8SA 5AKJA 2Y2VA 1G4HA 2E3JA 1CUAA 4HXEB 3WKBA 5I9IA 3A2MA 4KAAA 1W1IA 3WK8A 3Q0TA 2ONCA 2VSQA 3OOSA 1QJ4A 4Z49A 4UFOA 3D3NA 4WDRA 4QA9A 4D9JA 4U2CA 3V1LA 5JANA 1Q83A 3C5VA 1LNSA 1UK9A 1R4ZA 3STUA 3ICWA 1XLWA 4EY7A 3WL5A 4B9AA 4TPKA 1LBSA 5HF8A 2XMSA 2WHPB 4U2DA 5DNVA 1DU4A 1MAAA 4G4JA 3IUNA 5HF6A 3T4UA 1E5TA 4B7ZA 2Y6UA 5AOAA 4L72A 1ACLA 2UZ0A 1LPMA 1OILA 3B12A 3WI7A 4ZRDA 3IUMA 1XRMA 4X93A 1UK8A 1YASA 2AJLI 3DL7A 4GW3A 2V96A 2WFLB 2WIKA 2WQZA 3AILA 3G0GA 2GYWA 2HA5A 2HU5A 2H9YA 3FBWA 3IDAA 2BCEA 4WFJA 3C5WP 3E1GA 3KD2A 2HA3A 1C4XA 3BL8A 1CQZA 5FLKA 1FFEA 1H2WA 1Q0RA 2XQFA 2CKMA 1CRLA 3K9BA 4PSDA 3IBTA 3P2MA 3F97A 5JASA 3E0XA 2CJPA 4Y2UA 3CXUA 2PUHA 1THGA 3WWEA 4KRXA 4KYVA 2XQKA 3HACA 1ZD5A 4QWMA 4H77A 3DL4A 1U4NA 3N0TA 2QUBA 1CUBA 1GQSA 3GROA 4FLEA 5AKYA 2DQYA 4AN0A 3FLBA 1UFOA 3OURA 1J1IA 2W6CX 5A62A 3A70A 2WJ3A 4UBIA 3WQHA 3FNBA 3G0CA 1DINA 3UUEA 3PUHA 2DQZA 2JGLA 3V48A 1NU8A 2IITA 2O2HA 5JARA 1UXOA 1NU6A 3QVMA 4A16A 2XE4A 1PFQA 1AURA 1HLGA 4MQLA 3L1IA 1PJAA 4W9RA 5AI9A 1EX9A 1ACJA 4KAJA 3ZPXA 4N8EA 2O2GA 3K6KA 1VLQA 2HRQA 3I2IA 3QMMA 3SWWA 5DTJA 2XUAA 2WIJA 2CUTA 2XUHA 3SC2A 3STTA 2QR5A 3AJAA 1P0IA 1TAHA 3WK4A 2QMQA 3I2GA 1A8QA 1R9NA 2HU7A 2NW6A 2X5XA 2G63A 5HF5A 3PI6A 1VKHA 1XZDA 3AFIA 1WPRA 4G4GA 5CH3A 4C4XA 3L1HA 2XQIA 3S2ZA 1JJIA 5K3FA 5I7UA 1T2NA 2EDAA 2XMDA 4X90A 4C87A 2FX5A 1BN7A 4HXFB 5IVHA 5HK9A 2JGJA 4KE8A 2QJRA 5C81A 5IH7A 5AI6A 1GXSA 5AKKA 1VA4A 1XRLA 3QPAA 1DWQA 4AZ3A 2WFZA 1DQZA 3D2BA 4GWLA 4OD0A 4XIIA 3KSRA 5E4YA 1KU0A 3A6ZA 5ESRA 4FDMA 3DYVA 4HZGA 1EK1A 3FYTA 1CUVA 4G9GA 3PICA 3AZQA 4AO6A 3KDAA 1OXMA 4H7IA 4AO7A 2QXUA 3U1TA 1QFMA 5AM1A 4QDUA 5YASA 4HXGA 1WCYA 3BIWA 4JNCA 3WKCA 3GZJA 3WZLA 1ZD2P 3IVMA 1MNQA 3M81A 3BIXA 2BUAA 1N5RA 4P92A 3D7RA 4P93A 3FCYA 5AICA 1CUWA 2OG1A 2PSHA 1CUXA 2HIHA 1FFBA 3FSGA 4WFIA 4ZV9A 2WIDA 3EBLA 4C01A 1WB6A 3B5EA 2FJPA 5HQ3B 4GDMA 1E8MA 2WIGA 5AH0A 2WLSA 3C45A 5F4ZA 1WB4A 4DNPA 3DLTA 1R50A 2Z8ZA 4J0IA 4Q82A 1VJ5A 4MWSA 5ALOA 4ZV7A 3G0IA 4U2GA 4BYMA 1ZIXA 4NS4A 1F0NA 2XLBA 3H17A 5ALDA 3G9XA 3CN9A 4WDQA 3KWFA 5LYYA 1QIKA 4CG2A 2RONA 2IIVA 5CTAA 2ZYRA 5LP1A 5FV4A 1CUEA 4DNQA 4RE5A 4DTCA 4CG1A 3LCRA 5CH5A 1ORWA 4IQ4A 1S8OA 5C8XA 3RLIA 1MNAA 5AM0A 2JGEA 3YASA 1CUFA 1ORVA 3BWXA 5ALWA 4XX1A 3I2KA 5ALIA 1ODCA 3G9UA 5D3KA 5HZGA 1KEZA 5AO9A 1IUPA 2OQVA 3O4GA 1F0PA 4LYEA 1YB7A 2Z8XA 1RYYA 4LYDA 4OUKX 3WMRA 2OLEA 1AX9A 3BXPA 1IVYA 4EB0A 4X00A 4ROTA 1R3DA 4LXHA 3HJUA 1YR2A 3HI4A 4EY8A 4Q1VA 5FPQA 3GELA 2D0DA 5ALSA 4H7DA 4B85A 2QKYA 5D3ZA 3FLEA 2AJ8A 5ALTA 4Y2XA 1LZLA 2XUIA 5T4EA 4I3FA 5ALJA 1WOMA 1MU0A 1ZGCA 1H2XA 4X92A 1CLEA 2EDCA 1VXRA 2PPLA 2FJ0A 5AI8A 4OU4A 3UMJA 5JZBA 1B6GA 1MX5A 1G42A 1JJFA 4FOLA 2HRRA 1FFAA 3RKSA 1XLUA 3K2IA 3FWHA 2C4HA 1JFRA 4DNFA 5LKAA 3B3QA 2PL5A 4BBZA 3F98A 1DTEA 3STWA 4B0OA 1JI3A 1AZWA 2D5LA 1XZCA 4BZZA 3PUIA 4FLFA 1JMKC 3G9ZA 3D5EA 5AKGA 5ALLA 3VJKA 2QVBA 4MYDA 2JGMA 5AI4A 5EHNA 4ZGBA 1EXWA 2WG0A 1YSCA 4B81A 2HFKA 3G7NA 3C8HA 1H2YA 1L7QA 2XUJA 1GKLA 4Q3LA 3S8YA 4KJXA 4WCVA 3VKFA 1HKHA 3HLKA 5K3CA 4B6GA 5ALVA 3DNMA 1JT2A 1YCDA 2O7VA 5A7FA 4H7KA 5DLPA 3IULA 1C7IA 2GBFA 2XMCA 1DX4A 2VT7A 5CW2A 3CCCA 4GEGA 1DX6A 2ZJFA 2WSLA 4HRYA 3VJMA 1ZJ4A 2BGNA 2J4FA 4WJLA 2C58A 2VEOA 4CFSA 3RK4A 1BEZA 1CV2A 2WU4A 5K3BA 4OU5A 2I3ZA 4U2EA 1XZMA 5AKHA 4F0JA 3QH4A 4ARAA 5JZSA 2EEPA 1QTRA 3I2FA 4J03A 1IZ8A 2BUBA 2HA6A 4RNCA 4FLMA 1ZD4A 5A7HA 4X71A 3A2NA 4JEIA 1JU3A 1AKNA 2JBWA 5FXMA 2HFJA 4KRYA 1VXOA 1SFRA 2WJ6A 4WY8A 3WL6A 5JATA 1F6WA 5CT9A 1P0PA 1XQYA 2I78A 3AIKA 3QPDA 5FOQA 4QDOA 1VE7A 1BROA 2DCMA 3OPMA 2Z3ZA 2PKYX 5T4HA 3PE6A 2GBCA 5AM5A 4BC1A 3EIOA 3FYUA 5AI0A 4NZZA 1AUOA 4I19A 1BU8A 3QM1A 4LIPD 3I2HA 4AN1A 1LPAB 5AI5A 1XZFA 3AUKA 1YB6A 4UBOA 1CPYA 1T4MA 2O2IA 2VJAA 4X7BA 3FLAA 1MX9A 3FOBA 2VAXA 1WPXA 3TEJA 4L9AA 1E3QA 1VOTA 5CT6A 4OB6A 4EY5A 1LPSA 1U65A 1BRTA 3V9AA 3FAKA 4OCZA 1THTA 5CXUA 2WUGA 2DSNA 4UBJA 4ETWA 4QLOA 1XZLA 1XRNA 1XZKA 3ANSA 1U2EA 5DJ5A 1CIJA 3R40A 4E15A 2WUFA 4P9NA 3WJ2A 2OGTA 5DYYA 1Q0ZA 4X94A 1W4LA 3I1YA 2HA7A 1J07A 2XI4A 4MJ3A 4KR0A 4QDXA 2J3DA 2WHQA 1N8SA 1XZJA 3G0BA 3VXKA 2G4LA 2QZPA 2JIDA 2VJCA 5FP0A 4EHBA 1RWQA 3D2CA 2QUAA 1EB8A 4BB0A 4AMYA 4UHBA 2OPHA 3O0DA 5HKBA 5SYMA 3C87A 5HFNA 3WIOA 3G8YA 3AZPA 3V1NA 1X2BA 4XVCA 1GT6A 3D59A 2VJBA 1VZ3A 4A5SA 4UFNA 3VVLA 1BCRA 3G9TA 5ALEA 3VVMA 3O4JA 3LIPA 4WFKA 2JGIA 3H0CA 4BDTA 1CUCA 2Y2UA 3R3WA 5K3FB 4LKOA 4UBKA 1ETHA 1TCAA 2PX6A 3AIMA 1AQLA 4FWBA 5JZ9A 3H2IA 4MWTA 5A71A 3BE8A 2WFLA 2RHWA 5ALYA 5ALFA 2ZVDA 4UHHA 4PQEA 5EIAA 4M0EA 1CFJA 1XKTA 1LPBB 4KAFA 5ALQA 5AKZA 2ZSHA 4UPDA 2YH2A 3ZLTA 4ARBA 4U2FA 5HKAA 2WUDA 1QONA 4OSEA 2C0QA 2QXTA 4QWWA 1O6GA 4FHZA 5KBYA 4PSUA 2BJHA 1ZGBA 1ZD3A 3O4HA 5KWIA 1ZICA 2G5TA 2PUJA 4ZREA 3DEAA 1D07A 4MXDA 2WTMA 3QITA 2XDWA 4QDZA 4NMWA 1XZIA 4YASA 4TGLA 2BUCA 3I28A 3DKKA 4CIAA 4M0MA 4W1SA 5LZ2A 4DIUA 5IVDA 4DNOA 5AP9A 3FCXA 4ZI5A 5LKRA 3NOXA 2AXEA 2XMBA 3C6XA 3G0DA 4L3WA 5DWDA 5HFAA 3WWPA 2I03A 4W63A 2HDWA 1XZAA 5AKXA 2OCIA 2RHTA 1E89A 3V1MA 2VTVA 3WK7A 4OYLA 1XZGA 1QIHA 1QFSA 2JEYA 2PSFA 5JD5A 1EINA 4Y2YA 1UOQA 2JEZA 4K6GA 1LGYA 1CUDA 1USWA 4NVRA 1SCQA 3WL7A 3ZWQA 5AHXA 5BOVA 1O6FA 3WZMA 3HSSA 3R41A 5AIBA 1TK3A 3FSGD 2OQIA 4EY4A 1XZEA 1A7UA 4FTWA 3RM3A 2QM0A 2PU7A 2JGKA 3DCNA 5D6OA 5C7YA 1EK2A 4BP9A 2PSEA 2VAVA 2OAGA 1IUNA 3ESCA 4IH9A 4ZWNA 5ALHA 1P0QA 2BKLA 5KWJA 3QMVA 2ACKA 1N5MA 3WLAA 4HS9A 4UHFA 4CCWA 3DD5A 5AKLA 2XLCA 4AO8A 2V9ZA 3KOOA 2C0PA 4PO3X 1BN6A 2K2QB 1HQDA 1MN6A 4GHWA 2ZJ7A 1B41A 4IO0A 2CZQA 3D4LA 1W52X 4BDSA 4BVJA 2PU5A 5DYWA 1UT6A 2QT9A 4EA6A 6YASA 5DYTA 3KXPA 4FNMA 4DMHA 2DR0A 1CUIA 1QO9A 2OGZA 4G8BA 2LIPA 3BF7A 3ESAA 1EI9A 3JWEA 4OPMA 5C8ZA 2HA4A 4HVTA 5JD4A 4CIBA 4K6KA 4CCYB 1QIGA 2Z3WA 1VZ2A 4N5HX 3BDIA 3O9VA 2PVSA 5CBKA 3HEAA 4PF1A 4QE3A 1ZI6A 2GBIA 2ZJ6A 1ODTC 5ALRA 2XMRA 3STVA 3H2KA 4GBGA 1BEEA 3O95A 2VF2A 2QOEA 4XWGA 4J0GA 5EGNA 1QIFA 4G5XA 3H2JA 4HAIA 4LHEA 4X6XA 1YS1X 4DM7A 5LIPA 3W2TA 5HQ3A 5ALNA 1XRPA 4J7AA 1K5PA 5A7GA 4F60A 1TIBA 4K6HA 1XRRA 2V98A 1J2EA 3T52A 4BP8A 3WWCA 3SX4A 1NX9A 3H04A 2GYUA 4Q3OA 2CEKA 2HU8A 1LPPA 1GKKA 2DHEA 3F67A 4H35A 2DHCA 1TQHA 1UOPA 4V2IA 4FKBA 4DMCA 2GZRA 2XMQA 1MO2A 1QIDA 4Y2TA 4AQDA 1MJ5A 3W05A 5T4BA 3HXKA 3M3DA 4H0CA 4UBNA 2CMFA 1VA5A 2RIPA 1TKRA 5E4JA 4IH1A 7YASA 3WA6A 4W1RA 1K63A 4Y2QA 4UHDA 2FUKA 3MUOA 1BCSA 4ZXFA 1AGYA 5C8VA 1QZ3A 4UHEA 3R3XA 1X70A 3EQ9A 3GUUA 3WK6A 4DSZA 3EQ7A 1UKBA 1CUJA 3EQ8A 1H23A 4E14A 1YA8A 3MGAA 4Y2SA 1HBJA 2VT6A 2C5FA 1R88A 4QEKA 3C6YA 4PW0A 1PV1A 4LXIA 2OCKA 4QLAA 4DMKA 1QIEA 4MQMA 3IB3A 3L1JA 4Y2JA 2CBGA 4LXGA 4X91A 1HDEA 4C6HA 1YS2X 1F8UA 2WG1A 4J0HA 3CN7A 2YASA 5EHZA 4BVKA 2C7BA 2OGSA 3LIIA 5EI5A 3HABA 5AK5A 4BAGA 3GFFA 3IIIA 1OCEA 1M33A 5EIHA 4W1QA 5BV7A 4AMZA 3UUFA 1UK6A 1FJ2A 5ALXA 3WA7A 2WJ4A 4BCCA 3DQZA 5ALMA 4OYYA 1HL7A 4J0KA 2DFPA 4MEAA 4DSAA 3DYIA 1DWPA 5CT4A 1I6WA 1UKCA 4EZIA 2X8BA 1TCBA 2OCGA 4M0FA 3R3YA 4KE9A 4JYMA 3STXA 2GYVA 3QPCA 3STYA 4B83A 5AKEA 1MT3A 1Y7HA 1GZ7A 5LLSA 1SOMA 5AM2A 5K3EA 5JAOA 3M83A 5ALGA 1ZI8A 3C6BA 1FFDA 1EVEA 4BCDA 1JU4A 3N2ZB 4CI9A 5FRDA 2Q0XA 3WWOA 4H7HA 1L7RA 4B9EA 2B9VA 3H2HA 3AIOA 4N5IX 4TVKA 5AOCA 1ODSA 4IHAA 1MAHA 1SCKA 2C5GA 3U0VA 5CXXA 4UUQA 3FVRA 4E11A 3IUQA 1DWOA 3LP5A 4Y2PA 5DNWA 2QJWA 5EHQA 3LS2A 1GPNA 5JAHA 5CURA 4Y9SA 3SK0A 4YK7A 3DJYA 3QYJA 1Y37A 5H3HA 1QO7A 3F8SA 4A23A 1RP1A 3HRHA 5JAUA 5AK3A 1UZAA 4W1PA 1J06A 4MYSA 4C89A 1GGVA 4BTVA 3PF8A 4Y2RA 4Q05A 3E4DA 3MUNA 2VATA 2AJDA 3O9MA 4RE6A 5LZ7A 3HZOA 2HADA 3IA2A 2H7XA 1X2EA 4HTAA 1E8DA 5CT8A 2RI6A 1LBTA 2HM7A 2RAUA 4B82A 4F5ZA 4L0CA 2XT0A 3VISA 4EUSA 4G8DA 1GPLA 3CCBA 3F96A 1ISPA 4X6UA 2VA9A 1G5FA 3ZV7A 5IKXA 1ZOIA 5LZ5A 4X3CA 3TJMA 2B4KA 4INZA 5ALZA 1XQVA 1SC9A 4J0CA 1IMJA 1UOOA 3GBSA 1XQWA 2I3DA 5KREA 1XKLA 5FPPA 1K8QA 1W75A 4J0JA 2VQ6A 2ZYIA 4ITVA 2XUDA 4N8DA 1QGED 4X85A 2WHPA 5CH8A 1K4YA 1H2ZA 3PFCA 3BDVA 4BVLA 2VJDA 4GI1A 4UBLA 5A6VA 4PNZA 3ED1A 4AXBA 2GBGA 3OM8A 4G4IA 3IUJA 3ICVA 1EDEA 3G02A 3WWDA 5K3DA 3NUZA 4AZ0A 4BATA 4BAUA 4B0PA 2XUKA 4BE4A 2YXPX 2X76A 5ALPA 4DMFA 5E2IA 4JUIA 3DKRA 2QTBA 5K5EA 3RARA 1CUZA 1WM1A 5AM3A 2H7YA 5HK8A 1A8UA 1MPXA 2WILA 3WIBA 1VE6A 4GXNA 4CG3A 3H1AA 2Y6VA 4B84A 2ORYA 2XB6A 2G5PA 1QTIA 1XLVA 4H18A 2JGFA 3W06A 3TGLA 3I2JA 1UKAA 4KE7A 1JMYA 4J0DA 5JADA 3R3ZA 1R1DA 4O08A 4HRXA 2WM2A 2CB9A 3QBJA 4YX9A 3I6MA 1MTZA 3ANTA 3V1KA 2W22A 5FKJA 1TRHA 1WHSA 4BRZA 3FYUC 5EIEA 3WL8A 3W9BA 3ESDA 3LLCA 1AMNA 3OG9A 5LZ4A 3M82A 5CRIA 3DOIA 3WK5A 5CMLA 1EDDA 4FNGA 5DTIA 5EHXA 3R3UA 1SCIA 4FMPA 5JYCA 1ZJ5A 4J3JA 4X97A 3I6YA 4PV7A 3ZI7A 2WKWA 4I4CA 5HF9A 5DNUA 5LZ9A 4MEBA 2QRUA 5ALUA 5FDFA 1JJBA 5CT5A 3O4IA 3A2LA 3H2GA 4XJVA 1K6EA 3TRDA 2GZSA 1YAJA 3HYSA 1WHTA 1EDBA 1QIIA 4PSCA 2H7CA 5AIAA 2XUGA 1TCCA 1R9MA 3C70A 2R11A 1IZ7A 4G1FA 3WKAA 3EF3A 3FVTA 3I1IA 1XZBA 2AJCA 4Q34A 1C7JA 3WYDA 5JIBA 3ZLVA 5IVIA 4Y2VA 4AX4A 2PSJA 1YA4A 5SYNA 1A88A 4QDTA 2R8BA 1CUHA 4OB7A 2BGRA 2ES4A 1GQRA 5AOBA 2XQGA 4BAZA 3WYNA 3D0KA 1LPNA 4GLBA 5D7BA 3GA7A 2WUEA 1QLWA 2B61A 1G66A 3F9CA 1ZIYA 4P08A 3X3HA 4UBMA 4F21A 2HHAA 2ZYHA 2B20A 1U8EA 4U2BA 3DOHA 3I6ZA 4Q3KA 1QIMA 4G8CA 2V97A 2PM8A 1L7AA 5AK6A 4H7FA 1IUOA 4BZWA 2XUFA 3BF8A 3IURA 3AZOA 3C8DA 2H1IA 1CUUA 2HA0A 2PBLA 2ZSIA 4KEAA 4C4YA 4BE9A 1QIJA 1LZKA 4FBLA 4S0XA 3WKDA 3PF9A 2OAEA 1XRQA 4RGYA 1CUGA 2Y1KA 3E3AA 3W04A 4E46A 2XMZA 1BS9A 5A2GA 1DQYA 2DHDA 3D2AA 1EVQA 5AK4A 5EFZA 3ZLUA 3C43A 1CUYA 1N1MA 5JD6A 4UFPA 3WKEA 1Q84A 2WU3A 4X95A 1JKMA 1ZI9A 4H7JA 2IX9A 3PDCA 1HPLA 2J4CA 2AJBA 3H1BA 3BJMA 4AB1A 5JALA 2PSDA 2QS9A 3QZUA 1EHYA 1Y7IA 4YPVA 3AINA 3NGMA 4B80A 1UK7A 2YYSA 3ILSA 3W9UA 3DDUA 5HCUA 2OCLA 5K3AA 1BE0A 1DT3A 4OB8A 5ALKA 1WB5A 5E4TA 4C88A 4Y7DA 1H22A 4KACA 4DGQA 4CCYA 5AKIA 2XMGA 2BAGA 2BFNA 4H7EA 1XFDA 4EY6A 3DS8A 2ECFA 4WY5A 1CVLA 5I8PA 2XUPA 1W76A 2OXEA 3NWOA 1AC5A 4K2AA 4BC0A 1XQXA 3BJRA 1KU6A 2XUQA 5T4FA 1XROA 1EA5A 4FFVA 4K5QA 1XZHA 3OC0A 5AM4A 3QMWA 5ISMA 2WG2A 1CUSA 2O7RA 3JW8A 2ACEA 2J3QA 4DYHA 4QZVA 4X6YA 4G9EA 3R0VA 3WK9A 3WJ1A 3H19A 3JYHA 2XQJA 4DLNA 5BWBA 1UWCA 3VDXA 3ESBA 5J3JA 3HC7A 4QNNA 1FFCA 2ROQA 3VJLA 4RPCA 3FYUB 3H18A 2P8SA 2HA2A 5LZ8A 1W6RA 4KE6A 5AJHA 1EH5A 1CR6A 1DT5A 2WIFA 1EB9A 3C6ZA 5FUMA 1E8NA 1FSSA 2Z5GA 5BWCA 1LLFA 3PFBA 2XUOA 3Q8WA 1E66A 4IH4A 2HL6A 4GECA 3OTQA 4JH0A 4EBBA
chains in the Genus database with same CATH superfamily
5K4HA 4X62B 5A9RA 4S1OA 2JC3A 2WHRA 2B2NA 3NIGB 3BD6A 2IJGX 4RETA 1AQYA 4FFWA 5DRTA 4DA4A 2PYDA 1OI4A 3PPXA 1HSOA 5EJ2A 1DO0A 5J5VA 4D2IA 1REQB 2EFDB 3RC3A 1T2FA 3HUEA 3MTEA 3PS9A 4ITUA 2PT6A 1GZDA 2FXIA 2G77B 4FHGA 1QAQA 2YIDA 1JLLA 3ABRB 1Y9AA 3K8ZA 4CTOA 2JLVA 1VFNA 3KSUA 5FPYA 1V7ZA 3RHSA 4IRXA 1KZGB 1S96A 2BFEB 4BTLA 2J9RA 1ZG3A 3M6WA 4N8SA 4B7CA 1Q20A 5FX2A 1DBPA 4J43A 3PYMA 4J8PA 4ZEMA 3BRQA 5LDHA 2Q8QA 1YNSA 1GU1A 1PL7A 5EMLA 5F73A 2LIVA 1LCIA 2E3JA 4R1NA 3FMPB 2WD9A 4P54A 3THXB 3SF8B 1TO1E 3MGBA 4BUJA 3D54D 5D3MB 2VQEB 3IHLA 4I50B 1KFCB 1NRXA 1W1IA 1OWOA 1QM5A 1O58A 2Q3BA 5DSZA 1IDOA 2VSQA 3A6DA 1RYDA 3OOSA 3P0EA 5K6AC 4EB6A 3R9XA 3VZPA 1QJ4A 2WJGA 4IJQA 2FPGB 1CY2A 2ZRLA 4UFOA 1U3UA 1U63A 4H4CA 4QA9A 2D06A 3ELBA 3S7TA 4BNXA 1FNBA 2XKBA 7REQB 1E1RA 1Z0AA 4HAVA 3GLFA 3GNLA 1ADBA 1B00A 5KJ6A 2O0JA 3ZIUA 4YIKA 1QRSA 5HWSA 3GV0A 3EJWA 2V7QD 2PZEA 1Q83A 3RIXA 3C5VA 5JANA 4DR5B 1N32B 5JJKA 2XJ9A 1WZCA 4IIDA 1JL3A 1Y6JA 3PHIA 4TSRA 5D6NA 5L8VA 1XLWA 3TR6A 4OX9Y 1SUIA 3UO8B 5HQTA 2Q41A 3GAMA 1VL8A 1SK8A 1PK8A 2XYVA 3IEPA 3L4JA 1P5ZB 3L7LA 3WL5A 3E6AA 2GXQA 3I9JA 1JR6A 4JJ7A 4NESA 4KV9A 3EZ6A 4QARA 3SBDA 6LDHA 4HPXB 3TKLA 1LBSA 2UUBB 2WR8A 1JVNA 1K75A 3DMNA 1DU4A 5KNLA 3IUNA 3M9WA 4HUTA 3DG9A 1QLHA 3FRJA 2RHLA 3LGSA 2DT5A 1XD2A 4CR7A 2WVJA 4F4UA 2YWFA 5IJ0A 1QQAA 5KTRA 1QVWA 3GP3A 3PUZA 3CH4B 1EXVA 2OHIA 2BEVB 4H0NA 2CUZA 1V11A 2C77A 2CHVA 1MORA 1ACLA 2RBKA 3A1WA 1LF0A 2UZ0A 3INYA 3LKZA 1E9VA 1X80A 3QQ5A 4MS3A 5DHQA 3VR2A 1SEVA 4ZALA 4J1SA 1WBDA 2GD6A 3FIUA 2GN1A 1JHVA 1NAHA 1F1JA 1Z5UA 2IH2A 1UAGA 4ND8A 3H9CA 1DHTA 1PJZA 2JD1A 2JK1A 4PZLA 5FBLB 4B76A 1YQQA 4US2R 1EFTA 2X0IA 3HA3A 5LMZA 3O4RA 1UK8A 2AQ8A 1R4NB 1T5DX 5JAQA 1WUYA 3DL7A 3EGEA 2ZTHA 2YWGA 3AQIA 4PZ0A 2WYUA 5EJ6A 5L53A 3UV6A 5CYFA 1T0UA 2WWXA 2J3IA 2WIKA 3BFXA 2C4KA 4ZODA 1NY5A 3RC2A 1VJCA 2C94A 3VUFA 2VZ8A 4F5YA 1BXZA 1K3FA 1ZEMA 4B6EA 2VYND 3ROFA 3R5KA 1YHYA 2C04A 2OCDA 4UD2A 3QBEA 1VE3A 2FEOA 3A1FA 3CEPB 4GP7A 3U7JA 3EH1A 4TL7A 1L7BA 3U80A 1C8KA 2FFQA 2GSDA 2IPLA 3BL8A 2NO9A 3IELA 4TN1A 5EFOA 2WZQA 2JJ8A 5EXSA 2IOFA 3BMCB 3KO8A 4JJ6A 3HP4A 1FFEA 2UUCB 3NHFA 1RRFA 2QV0A 1Q0RA 3OU2A 3PHLA 4H1WA 1KZ7B 1UXIA 4XWKA 2WZBA 3RSLA 3ISJA 4YMUA 1BKDR 3KQKA 1Q21A 1KBZA 3IMFA 1G20B 2O1SA 1F8GA 1DCKA 1OLSA 5C1OA 4MROA 3JALA 2OWEA 3JSAA 3ASUA 3NG1A 1VSTA 1KK2A 3B36A 5JNWA 4MARA 5DGXA 6GPBA 2QP3A 3P2MA 4G5YA 1Z47A 4KXNA 4EGQA 1KI6A 3DDSA 2NZJA 3V46A 2D59A 1KJ8A 3HSYA 4M21A 1N3YA 2J5QA 5IW8A 4CE6A 1V1RB 4IXWA 4TMFA 1A9XA 5B64A 3CXUA 2PUHA 3L1VA 4KYUA 2HPZA 1LDYA 5ESXA 2NUAB 2WMNB 3IIKA 4D3SA 4RU1A 9LDTA 3WWEA 4KRXA 4RSMA 2XQKA 4X3OA 5AW5A 1WUTA 1ZD5A 1B23P 1P8AA 2BE7A 4RD4A 3DL4A 3AF5A 3V80A 2C7VA 4JN6B 3N0TA 4D4JA 3AHCA 2Q4DA 2QUBA 5JSQA 3FI9A 1GQSA 2Q5CA 4KP7A 2RB4A 2DQYA 4YO8A 4A10A 1WVGA 3FLBA 2PYIA 1OX4A 4BQNA 4BECA 5J4HA 4GX5A 5TC4A 1LSJA 1ANKA 3DDOA 4JJFA 2W6CX 1JRLA 2FSHA 2ADFA 3HUDA 1T3GA 3BWVA 4HC4A 4UBIA 4X0EA 3WQHA 1RQNA 4A7PA 4HN4B 1DINA 3MPOA 3UUEA 3LUDA 3UJ7A 1RZRD 5LPNA 2EW8A 4AI6A 4XM1A 1YVPA 4IKOA 5HGJA 3ANXA 1FE8A 3PUHA 4IL5A 4RXMA 4TV9F 5A3VA 2WPDA 1OR8A 3GRVA 3HZHA 1T3SA 2KHZA 3INGA 1NAIA 1DKPA 2O2HA 4HEHA 4URYR 3P2OA 1Z29A 4XD7A 1EZZA 1F17A 1SC1A 1UXOA 1S2IA 3VU8A 4A16A 4ZHQA 4OHZA 4ZI7A 1GTRA 3MTJA 5BN3B 1HE4A 1PFQA 4QODA 4BLSA 1KDTA 3NO4A 1JDBC 2FUCA 3X1DA 1FVFA 3PR1A 1G55A 2V55B 3DKVA 3IKMB 2YYYA 4W8GA 1UXKA 3PQ6A 1KS2A 2AMJA 3MILA 3HL0A 3K9WA 3GU3A 2D2IA 1PJAA 3CKKA 3EYAA 4W9RA 3D7NA 1EX9A 1UQUA 3LFTA 4K0KB 1OFVA 1PGNA 4BKMA 4S1VA 2B36A 1DQPA 3K6KA 2FR1A 3VPDA 1CF2O 1PK9A 5TE9A 3KKZA 2X4LA 4EI7A 2HRQA 5JYBA 3I2IA 1ZWKA 4E6PA 3KU1A 3CJTA 2HF9A 1NJGA 1Y3DE 1NVUQ 1TM7E 2YYZA 1QF6A 1XXLA 5D85A 3F74A 4JXZA 1HQKA 2PBFA 1WMSA 2CJXA 3KELA 2ZPAA 4XCVA 5IH3A 3JQAD 3L5KA 2EFJA 2R7AA 2JFVA 2P6RA 2CK3A 2FPSA 4L0QA 4GOLD 4MUYA 1FB5A 3D1JA 5WRFA 1OFGA 4PIVA 2EVWX 3LWBA 4KWHA 3WK4A 1QVRA 1KO1A 4E30A 2MR5A 4Z4EA 2QMQA 2PZAA 3OQ1A 4I5FA 5EVCA 5TGDA 4ZTBA 2R7LA 2V6FA 8ABPA 1R9NA 4CMBA 1QGUB 1ZX1A 4EO9A 2X5XA 1O5TA 3UUGA 1J2JA 1N75A 3EPHA 1VKHA 1L1EA 1PJQA 3PTAA 1Z3CA 2VJMA 2IDKA 1WPRA 1CNFA 3KLMX 5DOVA 3HBMA 3M3PA 5FCDA 4YCNA 4Y98A 1TCVA 1IG3A 1KY2A 2DPMA 3IR7A 5CK5A 1VKRA 4ZCPA 2EWVA 5BV0A 1UJMA 1YJBA 1X1AA 2ET6A 2R25B 2V6IA 3QKSA 3R2JA 2SKCA 5DULA 3QXHA 1C30B 3KZKA 2EDAA 5A5VA 5I7UA 3U5TA 3LPDA 3OZIA 4IDPA 4B3JA 1AHHA 3KQNA 3QLJA 1BN7A 5C1DA 3BS4A 1RQ2A 2R79A 3LOQA 3ME5A 1RHUA 3RJ9A 3QJGA 4FFSA 2V6GA 3ROQA 5HK9A 5IASA 1AD2A 4KRGA 4TYQA 4UDNA 2JGJA 3LWDA 4P53A 2IBSA 1RPTA 3AG6A 4D43A 1GNTA 2D1QA 4B2IA 4F2PA 5JV5A 1LSOA 5CAEB 4Z0TA 2CBZA 3QOFA 4J1QA 4UM5A 3KJGA 4GR5A 1U04A 1EXNA 3R1IA 2AFVA 2X14A 2PZLA 3GDHA 4FCCA 3I8SA 3JQBA 5CP8A 2QTVA 4IHKA 5K09A 5EYPA 2QZJA 1P31A 5IVPA 4P5PA 2X9VA 5K7SA 2HQRA 4C9BA 1KU0A 2H07A 3A6ZA 4CEHA 2VTEA 4GQIA 3DYVA 4M1ZA 1RAIA 2DP4E 4LJ5A 5FBWB 2WD7A 2IP2A 4DR7B 5L7WA 3SR0A 4NCAA 1CUVA 1O8BA 2IY7A 3DLPX 3MQFA 3AZQA 4UCWA 2PX2A 4D8UA 3ONNA 2JKYA 1B74A 1DL5A 1OXBB 3HCWA 2AQKA 1OXMA 3G9QA 3TAXA 3RIYA 2YS6A 4IIJB 2CVOA 4DLUA 2ETXA 2OOSA 1Q0TA 1CU1A 1QH9A 3EVZA 4ID9A 3OFJA 1DFGA 1QFMA 5AM1A 4QDUA 2PZMA 4YLGA 3V6MA 5C5CA 2CBXA 5KCZA 1XMPA 4BUCA 1HG0A 1RXSA 5I9NA 2NZXA 4DVGA 4CLOA 1VGQA 2DPXA 2QQGA 2ZQYA 2WAXA 5A0VA 3LJKA 4BQIA 1CY6A 2G1JA 3TTXA 1JQAA 4P4LA 1DUIA 1FP6A 5TSDA 3GYGA 1NVAA 2AT1A 2WM9B 4CM7A 1N8KA 1TGYA 1S2OA 1U9JA 4JI4B 2R4QA 4LZOA 4WZAE 2R1VA 3L8HA 1E79D 3V3TA 1CVRA 3JVVA 4NZPA 4F1KA 1JYFA 2OMEA 1EWYA 1U9YA 3R5FA 4P3KA 4GMGA 3QMPA 1FSFA 1ZD2P 2FG7C 1QF9A 5CA0F 1OZGA 1YQEA 4D44A 1NLUA 3IVMA 5KHLB 2GILA 4TKVB 1ETUA 4MB2A 1D8TA 5JMPA 3M81A 1SBCA 3RLFA 4LNHA 5LP6B 1M66A 1T2AA 3DZFA 3OJCA 3HZZA 2Z83A 1OD6A 3EWIA 2DPYA 4XX0B 5FHQA 3L04A 1OB2A 4ZQBA 5L95A 1M2OA 3C3JA 3D7RA 4YHHB 4EW3A 1S7GA 1CUWA 4M0LA 2OG1A 3U7QA 4DG8A 1MV8A 3H75A 1P44A 2PZKA 1A76A 2PSHA 2VDOB 1OZAA 4CKCA 1TKBA 3NPAA 1FFBA 4NOJA 4R7GA 2HWWA 3KT8A 4WASA 2FWAA 2W6IA 1IY8A 1Y4UA 3RFTA 2WIDA 4C01A 4P7KA 5D8DA 3KPJA 2WOJA 1KFBB 3HB9A 1SIUA 3D3QA 2FJPA 1TTHA 1MRZA 1UBTS 1G5HA 3QLUA 1RFLA 4IX9A 4M1OA 3UMCA 3TL2A 1PK7A 3I6QA 2QTAA 2WIGA 4TTVA 3LXMA 1GPBA 4IIUA 2D3WA 4PNEA 1KI1A 4C5CA 3T4XA 3U9TA 1JAYA 2FGJA 2D6FA 2VF8A 4FIZA 4R83A 2G25A 1UZLA 1WB4A 2H2FA 4GQBA 2YVAA 4CQJA 1U2RA 3H84A 1R50A 1W9HA 2Z8ZA 3M9LA 4FNAA 1VJ5A 3UMMA 2BGUA 1XN4A 4MGKR 3OOEA 3FWPA 1Z0JA 3HH8A 3VHRA 1G5PA 1T6YA 5LBTA 4EFMA 1UUFA 1M1ZA 5TT0A 4BYMA 5JCPA 4ZOLF 4KI7A 1MOPA 1RLTA 2ZRDA 3GA5A 4KFTA 4Q3NA 4ZKDA 3ONEA 3DZGA 1PG5A 2NT3A 1T8YA 1TD9A 2DR3A 2GFQA 4MYHA 4XYBA 3AEKA 5ALDA 3C3KA 2H54A 4KG7A 2O4CA 3CIFA 3CN9A 1AKTA 3A6EA 5SY4A 3NKLA 3ZU6A 2CF5A 2H3HA 2R66A 2NO5A 3GUYA 4FSHA 3V7YA 4EELA 4M3NA 4KMOA 4Q24A 4V0RA 3P52A 4KO2S 2ODAA 2AFHA 3JATB 3K8OE 3ZIDA 3HTXA 4M89A 1AS2A 1U2GA 3EIQA 1D2HA 4L0MA 4Q3BA 3L4BA 5IAKA 2SCUA 3HDVA 5BUSA 2P1ZA 4YCSA 1Y8AA 2VHJA 2J87A 4ZTZB 2VAMA 3JD4A 3EK2A 4JP5A 5JTTA 1UQTA 1Z4IA 1L5HB 3VHXA 2ORWA 4MW0A 1RWMA 1CUEA 4JDPA 4RS4A 5BN4A 3JQEA 3WJAA 2NZ2A 4EG1A 3I3OA 4ZT5A 4G84A 1R10A 3OZ7A 3M1AA 4RTJA 1Z4KA 3LCRA 3WX0A 5CD1A 3NLLA 1Y3AA 4HP8A 1SHZA 5C8XA 4AUNA 4GXTA 3LG2A 1V9LA 3TLCA 1NXWA 1V71A 3BEDA 2J9ZB 3ENVA 4FI3F 3H2YA 1QRAA 5B55A 4WXRA 1YRHA 1EQUA 1Y8QB 1UXJA 3LL7A 3WC4A 1B8PA 4W5TA 3ZJYA 1RWXA 4QYIB 5G0VA 2WAAA 3BWXA 1N7JA 3K4HA 4MYCA 4XX1A 4P2GA 3KKKA 5ALWA 5L7YA 3X44A 3EGDA 1ODCA 1SB9A 2YCLA 4RWZA 3R6LA 5AO9A 3I6IA 4KMMA 4QXMA 2PZJA 1AUPA 1KZ1A 2J41A 3O4GA 1NFFA 3EVGA 4O4IF 2XHZA 2ZRAA 4MO9A 4YYZA 4TYYA 3B82A 5JTUA 2ZRCA 3GMTA 1MVNA 4FC7A 3M6AA 3UJNA 3RSFA 1P1HA 4JBHA 4V0SA 1JDTA 4UPVA 3GPDG 4FEYA 1AX9A 3TOZA 2GKOA 1WRBA 4XUCA 4GR4A 2D00A 2NQ8A 3I0MA 4L57A 3RUEA 4FXOA 3DLCA 3DOJA 1IVYA 1EAYA 1PYOA 3DV2A 4P3OA 4X00A 3WNVA 2UKDA 1GSHA 1RLMA 4O4LF 4FN4A 3AW9A 4TMWA 2DUWA 4JI6B 2E82A 3NFYA 3AP1A 1M7GA 4TLAA 4HBZA 1NNUA 1WW8A 1UBUS 5BQPA 2RB5A 2ONKA 5U9CA 2ZAOA 1TQ4A 4IDDA 2WMDA 1BS1A 2QRPA 3ML1A 2JAUA 4K2HA 3WLEA 2CLIB 4H7DA 1G2OA 1ML4A 4D9GA 3RVPA 5GTDA 4IEFB 3TZEA 3ZD8A 2A9PA 1ZN2A 3FLEA 3KS9A 3AHIA 3TQSA 1U5AA 3W1WA 2OKGA 1KORA 2CC2A 2HDNB 1XVUA 3LQ2A 4LV6A 1WBBA 1UKZA 4Y2XA 2ATIA 3RT9A 4MUBA 4ALIA 4CM9A 5EIBD 4JI7B 2DBQA 4CDGA 2YVUA 3WLTA 4DCNA 3HFRA 3A05A 5CTJA 3VU1A 4EL5A 3M5DA 4I3FA 4WBNF 4PSAA 4Z7OB 4BNYA 1ZGCA 2QLLA 4W99A 4B3FX 1V1MA 2PMFA 1LDNA 3LQQA 4LAFA 3WLMA 3ZQ4A 1R2QA 3KL2A 4CU2A 3HCEA 2FQWA 1U1CA 3HN6A 2M6LA 3V1UA 1TRKA 1E20A 3ZDDA 1O95C 2WWWA 3SN6A 3CYFA 1AV6A 3VO1A 2BN4A 2GZMA 3RSCA 3A1VA 5K6TA 3DL2A 2I34A 1ID8A 5JZBA 3M3HA 4WX2B 3I4CA 2OSVA 3CONA 1E9FA 2HZBA 5HKKD 5FOXA 3F49S 1A96A 4U5XA 1IHPA 3FYCA 1A2KC 2OVBA 1G42A 4QREA 2IOHA 2AZXA 3FFWA 3GFQA 1JJFA 5L7TA 1FX0A 1ZR2A 1JA0A 4TXJA 3RKSA 5EZ6B 5HE9A 1SU4A 3K2IA 3KUXA 5IYZF 1N2CA 3ZTTA 1RC1A 3CMCO 3PVCA 1ZHHA 3OLXA 4CL3A 2ERYA 3B3QA 3HDHA 2PX4A 4DDHA 5IXSA 1GCGA 1U8TA 1YRYE 3E61A 1YZUA 4YRJA 4F4DA 3QSYA 1X0XA 4GWKA 2FQ1A 2IQIA 2C1EA 3GB9A 4G0YA 4ZVVA 5K4GA 1FTNA 5KTMA 1L4HA 1ECJA 2D5LA 1J23A 1Y33E 2JGRA 2VO1A 3G9ZA 1D2CA 3SR3A 1USGA 3WRVA 2Q28A 3B70A 4I8DA 3VR4H 1JEDA 1DDIA 4Z9BA 4EKIA 3NRBA 1AM4D 3MLAA 1Z0DA 4KSCA 1P77A 2V74B 4GNRA 2XRYA 2H2AA 1H8EA 1RM4A 2BP7A 3K16A 4IWXA 4GRDA 3VJKA 1EUQA 2G28A 2Q4RA 5DOZA 5ECDA 3ZDFA 1TPYA 4Z54A 1JP7A 3KG2A 2GMWA 2AN1A 3ZXYA 2XNDD 2QTHA 2FOXA 2IYLD 5AI4A 3GAAA 1F8XA 4ZGBA 2X3FA 2X1VA 1J9EA 2QT0A 4NE2A 3KQUA 2FOLA 1H2YA 2UYQA 2XUJA 3IOCA 1EFVA 3BIFA 1JWAB 4LCJA 2UVQA 4RIIA 5KHOC 3NOVA 4OI0A 1E1NA 1SOVA 4BQRA 5KPDA 3S8YA 4D8TA 2XCTB 4TOIA 3WOHA 3WNBA 5FBZA 2Q29A 1J7JA 2XNKA 3L0PA 2RMKA 4MRNA 3TOSA 2HWUA 4B6GA 3GLFE 1TT5A 2FEKA 1Q6ZA 1E2LA 1RP7A 5ERYA 3HV2A 2O7VA 1W4CA 1IBRA 5EESA 2RSLA 5F1YA 4RIGA 4S2EA 1VIAA 2ZE6A 2P5UA 4FIDA 3M2TA 4E5VA 4DSUA 2R8ZA 1LBQA 4N0DA 3PLAE 4JT2A 3SZUA 4DR2B 1DX6A 2FU5C 5D00A 2ZJFA 3LBHA 4HRYA 5TQ2A 1OROA 3AUYA 1TD1A 2BGNA 2LNDA 1CRQA 2CVHA 4XYEA 4WJLA 2C58A 2BFFA 4ER3A 1NBOA 3FWYA 1DV1A 2EFHB 3UB2A 4DXHA 1OAOA 3BXZA 3KU4A 1BKSB 1AS3A 4FGWA 1YFLA 1H9AA 2ZUSA 4EG3A 4LZWA 2H0RA 5J4YA 3CTMA 4P38A 2I3ZA 3VNQA 4XLTA 4AO8A 1H4SA 1MQSA 2PKRA 3O8QA 3PNPA 1MV5A 5JWHA 3UKJA 3LHFA 4NICA 4MS4B 1GOTA 3QH4A 3EPJA 3E9MA 1V8ZA 1BMFA 1Q1ZA 3C3MA 3DW1X 4QFCA 4RUKA 3IAXA 4INJA 1QQ7A 1IZ8A 1WP9A 3E7PA 3EMDA 4WN9B 4IXDA 2YS7A 3FOAA 3G1TA 2XB9A 3LCJA 1PIWA 2Z9BA 3WP1B 5F9HA 3JR7A 1W30A 3MT0A 1E1RD 4R41A 1PT8A 1E2MA 2P3LA 4PIMA 3ZXUB 2VUSA 2CHEA 5DP1A 4XIGS 3A6KA 5A4IS 4JEIA 1AKMA 2E18A 3B3GA 2Q0QA 3DDZX 4J90A 2J0UA 4YTEA 4QQFA 5G41A 5CVDA 2W5UA 4QNMA 1N6KA 3PGLA 3RVKA 2I54A 1UBCA 1Z73A 1ADGA 5TPWB 4BNGA 2WJ6A 5E4FA 5K2MA 2ST1A 3R5TA 5HEKA 2I78A 5B1IA 1BWRA 3ASYA 5J2UA 1CB7A 3U4CA 3KTAA 3EZNA 3OBIA 4DLPA 1UDWA 1VJGA 4L5CA 4F7WA 1S1CA 3BE6A 3H5WA 1ODLA 1T9KA 4IDCA 2WU1A 3ZS8A 4PSVA 4GI5A 1T4GA 2H5LA 2XADA 5T4HA 3WJ7A 2IZ7A 3CFYA 4BBAA 1PT5A 3QBDA 4K81B 3VR2D 1J25A 5CJJA 2D7DA 3OJ0A 1P4HA 1ZUWA 2LBPA 4JS0A 2ZE5A 5B4UA 1SQ6A 2REBA 3LKBA 1OFUX 2JL1A 3KEMA 1O89A 1NW4A 1P5JA 1R6TA 5ITZA 5HXAA 3H5RA 3L8GA 1LV8A 4DDMA 5JC1A 1R5JA 3W5CA 5K8VA 4HYTA 4QOSA 1PUJA 1UBLS 2ZRPA 2X42A 3VNRA 2G76A 3QE3A 5DM60 4OQYA 2AN3A 3E9YA 3I9NA 3MK31 3WRWA 3KVVA 1E0DA 1ESCA 1LU9A 3CNHA 4S1TA 1XP8A 3AUKA 4ZOAA 1YUBA 4A26A 4UEQA 1QH1B 1L3IA 3OETA 3B9RA 3PDJA 3UB3A 1FUYB 1KDVA 3FTFA 1RE1A 1CJTC 1FCJA 1J8MF 1CPYA 4Y8VA 2C2BA 4PGFA 3SHVA 2O2IA 2GS9A 3I01M 1DO8A 4XPIA 4YGXB 4ND4A 4DRZA 4WV3A 4DA8A 1EGAA 2Y1DA 4HQNA 3FLAA 4B5LA 2A94A 3VZDA 4L85A 1VYHA 3S3TA 2P91A 3FOBA 1SD2A 3FCUB 4NCJA 4PICA 4RACA 4WW0A 1PW5A 5FI3A 4DIFA 3U19A 2FMKA 5EXTA 4YP9A 1Z5WA 3TW0A 1KYXA 1UXGA 2L82A 3T1HB 1ZAYA 2IUTA 4HMOA 3FHTA 1G9XA 4R0MA 4AURA 2OV3A 1M1YB 2XTNA 5LXTB 1VPDA 1VOTA 2FHPA 5E0OA 3V8EA 4RTQA 1CRPA 1F14A 4FHEA 4D0NA 1TFUA 1REQA 2F59A 5C7OO 3KUDA 4QEDA 3QIVA 3OZGA 2RGDA 2HDOA 4MAFA 5T57A 5KC8A 4OCZA 1AQJA 2BFEA 2I6QA 2WWTA 3I61A 4XM2A 3ABZA 3T3NA 4L9SA 4F8EA 2YUTA 2J6BA 3DJFA 4YCDA 2LZ0A 2P9YA 4C6TA 3DHYA 4HDNA 5IT0A 2GNPA 1QYRA 4IS3A 1CY1A 2FFHA 4WK2B 2X3YA 1U2EA 3RS8A 2P2GA 2DHRA 2IVFA 2G04A 1HYBA 3RF7A 3THXA 4PFQA 3LWZA 1VQ1A 4Q21A 5IN5A 4E15A 3PGXA 1VPWA 1ZCFA 1GADO 3WJ2A 4ESHA 1ZKDA 2A9OA 2CLOB 3MAJA 5D3MA 5DYYA 5AXBA 2CV1A 1E7WA 3EXG2 1ZAKA 4PCUA 5A1TA 1N7GA 2G09A 1ZINA 4KR0A 2B7BA 1R6UA 1QDEA 1X0VA 2D5CA 4LJYA 3BC1A 4ARZB 2FPGA 4QDXA 4AY6A 2YHBA 1YVDA 1N8SA 3I5AA 3KKPA 4E1BA 2G4LA 2P9HA 3T5TA 4PAQA 1Y8CA 7REQA 1SU7A 1A5ZA 1F20A 4PZZA 2WPDD 1IN6A 3E7DA 3ZVRA 1WKBA 1CS4C 2V1XA 1HE8B 3D2LA 4TWIA 2BGKA 3WIVA 2J8ZA 4AMYA 3ZCUA 4EX7A 1NOKA 2Q07A 3JWPA 4ZAXA 5FUXA 3B1KA 3HSKA 4Y6PA 1GV1A 4IEIA 4XD7D 5HFNA 4BKUA 5DCYA 1YQUA 3K4QA 1PWZA 1VFPA 2IPNA 3NYRA 3PQDA 1IOVA 2J85A 3AZPA 4LWQA 4MP8A 4Q9LA 3NOOA 3A3NA 3ER8A 2MCFA 1OXVA 2AL7A 1PTKA 3D59A 2FKNA 3UK0A 4DIBA 1NNLA 1DDOA 1E9CA 2OC9A 4O29A 4A5SA 4BQSA 4PAOA 1YIOA 3AR3A 1QCDA 4XWOA 1OYVA 4P58A 3QU7A 1KIAA 3NH9A 3G9TA 3QG5A 4BGUA 5BV8A 1F4PA 1QK3A 1V4NA 4UTVA 1EK5A 2JLSA 4M6WB 4MGZR 3R7NA 5C80A 1B0PA 2COKA 4WFKA 5ELMA 4IGIA 1UM9B 3DMTA 2DBVO 4MJ7A 1WMBA 3HYRA 3FAZA 4RQBA 3BJZA 4BHTA 3PPYA 4IV0A 4CIVA 1ZNXA 4OXKA 4YJ3B 1FMTA 4HX9A 4MX8A 2P9EA 2R47A 3INNA 3W2IA 1GUBA 1T6XA 2CHGA 3DT8A 4LTDA 2PR2A 1E3WA 1ETHA 4RPHA 2EFEB 4UBKA 5EUBA 5FWDA 4D8VA 1TCAA 4QTYA 3ICQB 3SOPA 3KQLA 4BTEA 3FD8A 2NUPB 4WKOA 3GRKA 1R4NA 4FPXA 4FWBA 3SHQA 4TYNA 1QAOA 2YMPA 2X1LA 3D8RA 3IQDB 3LCCA 4OJTA 4AJ4A 1PU2A 2CXTA 4OHBA 2VQ3A 1XZNA 2QL5A 5ALFA 4UHHA 5IDQA 1IB0A 3CXRA 1CFJA 1XKTA 1LPBB 2B82A 3Q3JB 3UNXA 1FTSA 1IN7A 2B37A 4C03A 5IANA 1JG7A 3HB7A 4U0KA 2P4HX 4MI1A 7ABPA 2AW3A 3K5IA 3JWHA 5I48A 1E1MA 4ADSG 3D8HA 1E1CB 1LKZA 1M6HA 2X6QA 3KBOA 3QOWA 2E37A 2CLMB 4O4HA 4UC0A 5ALQA 2KWIA 3RTEA 3KEQA 3WLSA 3PNQA 5CB4F 4EJ2A 2I3GA 1LQ2A 2NXEA 2O23A 5FPSA 4ARBA 1DADA 4PGHA 2DECA 3KB8A 3BMCA 1IVSA 2YNMA 2C0QA 3S2YA 2I1LA 2DF8A 5ARCA 2Q7DA 2QLBA 3JQPA 3RS0A 5BWLA 3H4VA 2YXDA 4H3KB 1DXOA 4QWWA 3TIIA 4PSUA 1GNPA 1Z15A 1ZGBA 3ORQA 3PPIA 5DVZA 1G20A 1HMYA 1VL1A 1KQ3A 1FU8A 4B6JA 2AYXA 1KVTA 1UKYA 3ESXA 2G5TA 4UTZA 3ASVA 4KKXB 3SEZA 3VOAA 1TI7A 3SIWA 2GVZC 1N0IA 4MXDA 1G8PA 4KVZA 4AJ1A 4QDZA 1Z4MA 4YP5A 4YASA 3IKLA 1V1RA 2FWMX 1B14A 3NHKA 3OD1A 4UASA 4YQFA 2BUCA 5EINA 3I28A 4YLYA 4M54A 1RKBA 3DKKA 4RF3A 3VPGA 3COJA 3EY9A 5LZ2A 3HR4A 2AVDA 3ZG6A 1N0WA 2H59A 4R8SA 1XPUA 5TVGA 3R23A 5IN4A 4XTCS 5M04A 5IVDA 1G64A 4FB4A 2NV0A 4DNOA 4F3KA 4JB2A 4FILA 3D8TA 2QMZA 5T7BA 1CIVA 3ZZ1A 1JDJA 4YMIA 1IMOA 4EFKA 3F6BX 1I30A 2B2CA 3LDHA 1G8HA 5B6IA 4JBWA 1E4OA 5ER6A 3DHVA 3QLTA 3C6XA 2VPIA 4JVMA 1I2CA 1M2JA 2GN9A 3AR7A 3OPNA 5EWMA 1GL9B 1V8BA 1T6NA 3AT1A 5T3YA 5SY9A 1G4AE 1BVYF 4L3WA 1DHRA 3GGJA 4MUHA 3CM0A 1JR2A 5LUBA 2PUEA 3UHOA 5CNMA 1TF7A 2GF2A 3SQMA 1UWVA 5BR7A 4W63A 1JILA 2X8WA 1N8NA 2OCIA 2JLQA 1NE7A 1JHZA 2RHTA 1E89A 4PZYA 5DEIA 2PKEA 4BVBA 5IKOA 3HFSA 2DH5A 5D1HA 3U7FB 3C3XA 1KR5A 3T7EA 3SLRA 4PYLA 1P17A 3CRRA 1MO6A 5KVQA 4DV6B 1ZJJA 3K0AA 3E2PA 4OBWA 1ZIPA 1D9XA 1G8KA 4UU1A 1QFSA 2G9RA 2OFPA 2PSFA 3L1UA 3QPWA 4HRAA 3BMOB 3PCRB 4G5SA 4Y2YA 3BYZA 3TE7A 3WMFA 4OG2A 1EVJA 3NHZA 1YMVA 1X19A 1H93A 2AOWA 4FFRA 4BO4A 1LGYA 1PQYA 2RGRA 4GGMX 1M8PA 1GLVA 3CR8A 4E32A 2WJPA 2QD5A 2GPBA 3AO0B 1T2CA 2JJMA 1TVKA 4BV8A 4A0RA 1OASA 3D5QA 3GWGA 5D1NA 4DWOA 1JHAA 2N47A 3KLBA 4QHSA 4C4AA 2EF1A 3QHPA 5C46F 5AHXA 1KYWA 2NVOA 3LA6A 2IXAA 1IH8A 1O6FA 2I62A 4HFJA 2VBCA 4TXLA 3WZMA 5TMPA 2YC4C 1OV6A 3P0RA 1NUTA 3G5MA 2VQSA 3NDRA 4OQEA 4BQPA 4XGQA 2QT1A 1NC1A 3AEUB 3PR2B 3CJQA 4P35A 1Y1PA 3ZX4A 4PYKA 2TSYB 2AFHE 4LJ7A 4UDYX 5KINB 3AVWA 1K4KA 1ESMA 1ZD8A 2W6ID 4FUQA 3REQB 4EY4A 5A3SA 1A7UA 3AXSA 1TMYA 1W5EA 1V35A 4FTWA 4I4TB 4L08A 2F1KA 4R1MA 4E1VA 4EAAA 4QGHA 4XUEA 2JGKA 3DCNA 4LXUA 1SG0A 3PVSA 2B83A 3GNTA 2QRMA 1EK2A 2VP9A 4BP9A 1H4TA 2EW2A 1T2VA 1Y6QA 2PSEA 1HK7A 1A5TA 3MM4A 2O2DA 4IQ0A 4MWEA 5HP4A 3ZX5A 1JB1A 2KPOA 4GU5A 4YCCA 3B85A 3LY5A 1L1RA 1GUFA 4PG4A 3VR4A 2IBTA 1Z5ZA 1Q3HA 4RMHA 1PV4A 1GQQA 1HDYA 3B9PA 1OW3B 3AI2A 4RD2A 2C00A 3WDSA 2N0SA 4JL8A 4A1FA 1AK1A 1I4LD 5ALHA 3KUUA 1KQOA 4RYLA 4F72A 4MQFA 3QMVA 2ZKLA 1PEDA 5BRAA 1P9WA 4NK5A 1R0BA 4R9RA 4UHFA 4CCWA 2B8TA 5CVCA 5AKLA 3I04M 5DHRA 2V9ZA 4F86A 3WTCA 1JFVA 1OBHA 1UWLA 3D6MA 3WBJA 3HBNA 4Q7KA 3PC8A 1YF3A 2C98A 4B75A 5BOSA 4MUKA 4JELA 1HDRA 1ZUD1 2CMKA 1RRKA 4I55B 2IS1A 2Q1WA 3U4GA 1HQDA 1PJBA 4H1UA 3FNIA 1T1EA 4PE5B 4XJXA 2DAPA 4IW3B 3DFFA 3GPCA 2QJOA 4JYZA 5HMLA 2ZJ7A 3L4KA 1M10A 1UEXC 2X13A 5CNIA 4MDEA 1SO8A 2FP3A 2YN0A 2CZQA 4PAGA 4QUBA 3RUAA 4QVGA 1D1TA 1FYWA 1E2UA 1GU7A 1DELA 2GSWA 4QLBA 1T1RA 2FPXA 1A7AA 4BZQA 2F8TA 2Z8YM 1MOZA 4TLCA 2VPZA 5DYWA 3EH2A 3ILXA 2WABA 3TEFA 1UT6A 1NV9A 3S1SA 1V5IA 1F2UA 1X7ZB 3W6NA 3H13A 3OD5A 3NHYA 2ZYDA 5ITWA 5FWYB 1FTYA 2Y1CA 4FNMA 3BA6A 1ZN8A 1NYQA 2VDVE 4K7JA 2ZJYA 4PHFA 5TQVA 3WLJA 1Y98A 4TS1A 1CUIA 2UVPB 1J0EA 5LOVF 1V5EA 2GHTA 1AGNA 1VG8A 2O7SA 3H1TA 3JYNA 3QF4B 1GCOA 3ZY3A 5HJEA 5I7FA 1C7EA 1O97D 4IIJA 2R8RA 1U7TA 4JT4A 4XEUA 4V2UA 2CB0A 1P9NA 2C29D 1DB3A 1XSEA 3BB3A 3UK2A 3E3MA 2NU9A 3LZ6A 4CLXA 3ODPA 5C8ZA 1SVNA 2PRKA 5GGXA 2OFXA 1OX6A 1WCWA 4DJTA 2PMEA 3G2IA 3PQEA 4RESA 4YJ2F 1JBQA 4LBZA 3OPYB 4CKWB 4GGOA 4QG7A 1B8VA 1IBMB 3Q5DA 3ZCQA 1JHDA 1T0IA 3C5HA 2OQ2A 1QG0A 1V5WA 2Q5EA 2VSNA 2VSXA 3PC6A 1VZ2A 5L6LB 3T4EA 4K6CA 5E1MA 5MN5A 3ZCPA 5BYAA 4DA0A 3HEAA 4E3WA 5BW8A 4BPRA 4QE3A 4C4SA 5A3QA 1UPCA 3FR8A 1S0UA 5AMXA 5G02A 2WYWA 4AULA 2FOIA 4PCAA 2C9ZA 4JHLA 1EDZA 4DQLA 1OOEA 4P80A 4TKVA 5I3CA 1FPMA 1TCUA 1X9HA 2EEZA 2R6AA 4KJZA 5ALRA 4XX0A 5LP6A 1K7EB 5H83A 3KOYA 4ZIRB 2A5JA 1I0IA 2ADMA 5HE8A 1N2CE 2VXYA 1ZM4A 3H2KA 1LFAA 4GBGA 5JYEA 5HIJA 2VWPA 1Q16A 1QO0A 3NNDA 4HNGA 1BEEA 4G2TA 4CL0A 4MW9A 2VSOA 2XGSA 4N47A 3JQ7A 4G3XA 3A4IA 4YJKA 4KR7A 2NPIA 4LHEA 4KC0A 1I7NA 3JV7A 4V0MA 2PKQO 4X6XA 2OKCA 4WCDA 1N34B 4CM9D 1K7FB 4B4WA 1LLDA 1ZNWA 4ZCQA 4NDNE 3KVOA 5FL7A 4GLJA 1TIBA 5JMWA 2A35A 3EVTA 1GTL1 2D0IA 5HCIA 2G1KA 1M2HA 1Y4DE 3D0QA 3D7KA 4BY9E 4K9NA 4PZCA 4AG5A 4FGSA 3SX4A 5B1SA 4Q3OA 1XA0A 3I30X 3W3AH 2GUGA 2I4OA 3FPGA 4UOEA 1P72A 1XPOA 4BNVA 4JIMA 5AVUA 1JW9B 2TYSB 3SM9A 1GKKA 2JAQA 1HY3A 2X0RA 2PLWA 2CMGA 2ECKA 2J0VA 2YWBA 1E2EA 1ZK1A 1JG3A 3F67A 5IDYA 1ADYA 1T2UA 3ADBA 2D2EA 1KAQA 2V7WA 3B6EA 3VJRA 1E6WA 1IDN1 1TQHA 1I4WA 4G0QA 4MYTA 1RXEA 4QPJC 5CK4A 4DLKA 5LQMA 1TM1E 3C74A 1EVYA 3DVQX 2BI8A 2XD9A 3L7MA 5AT1A 3UJ6A 4D98A 1YFJA 3DNFA 2Q3MA 1QAMA 2WYVA 4Q9JA 5FH9A 4ZK2A 5I7OA 3OC6A 3GZ4A 2QGNA 1RM5A 4DMCA 2VSFA 2ZRKA 3CMMA 1N3LA 3L6EA 2YXNA 2OAP1 5ABPA 1P1FA 1UPTA 3MTIA 4PGAA 1XDSA 1H6BA 4AQDA 2X0DA 4D9EA 3AKYA 3EIXA 2Z04A 3IJ5A 4IOJA 4DXDA 3N2IA 3C15C 4AY2A 1TTQB 1RJDA 3B2QA 1Z16A 2VHTA 4FFNA 5G40A 1ZUNA 3I23A 4BO6A 1PR4A 2I6GA 1BGXT 4NIMA 4Y18A 2KE5A 4TLLB 1H8ED 4YJGB 4S24A 5DF1A 5B7GA 1GPDG 3LVRE 4NBKA 2Q6OA 4L8WB 1KSFX 4YRIA 2ILTA 1FW6A 3UC5A 2AMFA 4F8JA 4RLQA 4YQYA 4IH1A 7YASA 1PT7A 2VCYA 4RDCA 3WA6A 4ENTA 5IT5A 3EPRA 3NBUA 1C8VB 4PLHA 4QUGA 4OUDA 5FFMA 4JWKA 3G6KA 3D6NB 2ZT8A 4RLHA 1VCOA 1G3QA 3S8MA 4Q3EA 2SKEA 1Y8QA 3ASZA 4NYMR 2GLTA 2H29A 3MNFA 1ZITA 4PG8A 1ILEA 4Q15A 4C1BA 4J75A 4QYIA 3KDPA 10MHA 1Z28A 3L7KA 1QZ3A 2VZLA 1T35A 3TE6A 4UHEA 1AGXA 2EQBA 3KQMA 4JUAA 1GLNA 4FW8A 4NG4A 4DQXA 2XYRA 1WIWA 3EQ7A 4BKOA 4DF3A 4LOIA 1FDTA 1VI5A 3MGAA 1HBJA 5IMBA 3VTKA 3NBAA 2O3UA 1JG4A 3UKOA 5ICEA 2X22A 1H1LA 3PNVA 4MZXA 4PR3A 1R88A 3RTCA 2OG2A 5HSGA 3C6YA 3JU3A 4Q39A 4Q19A 6CHYA 8OHMA 1C0LA 1X8KA 4LXIA 2OCKA 2FH5B 1DIGA 3IILA 4IM7A 2A67A 3CKLA 4JKYA 3OX3A 4MQMA 1IRXA 1Z07A 3AJEA 5EPEA 2ZWPA 5A1JA 3K2BA 4QU5A 3JTEA 3GEPA 1TLTA 4L6CA 3QFRA 2CBGA 3A4MA 4LXGA 2QN8A 4TL8A 3U4AA 2CFSA 5E8RA 2VP6A 1OMOA 1HDEA 3T9FA 4CMIB 3EXEB 2G5GX 3B7PA 3H97A 4C07A 4BLUA 4OQZA 2J48A 4J0HA 5K8TA 2W6PA 3PCTA 2YASA 5C8YF 4PXSA 2R5FA 4OJKA 1FYFA 3COSA 3GDOA 3NYIA 4OREX 4EF4A 2C7BA 1BMFD 2VAWA 3E8XA 2Z4TA 1YACA 3HABA 1T0PA 3G2HA 3RUDA 3LP6A 1J49A 2Q1SA 2HLDA 1D09A 5F5LA 3GFFA 4ZEXA 3T5PA 4OJNA 3HPQA 2AG6A 4MV1A 4RZQA 5EIHA 4MMYB 1GG8A 4L7VA 4LW8A 1XVAA 3RIGA 2Q46A 1PQWA 2BJVA 1U0BB 1NW5A 1A69A 1ISRA 3N74A 4L9RA 4E0BA 2I87A 3PC7A 3Q6MA 4IHJA 4PSKA 5DYNA 4BCCA 1SUWA 3DQZA 2FLVA 3D7MA 1H2EA 3U5ZB 4FMBB 3PXBA 4J0KA 2EWMA 1V2GA 3FNGA 5TEWA 5JLAA 5M7EA 3LOUA 4L8YA 1W87A 4P34A 2WE8A 3ZR4B 4DSAA 3EDYA 1ONBA 3DYIA 4OA5A 5IJXA 5BSHA 2BRUC 3NWJA 4FYJA 1I6WA 2FZGA 3RS5A 2BBWA 2QX8A 3DPSA 4J0EA 4CYMA 4ZYYA 2FEWB 3PRHA 1VBKA 1RWBA 1TCBA 1VYTA 2IKSA 1ZRNA 1LNZA 3R3YA 4KE9A 4JYMA 4XGNA 1KO4A 3KIPA 4EVRA 2CXHA 2E48A 3DAFA 2GEDA 4JQSA 1W93A 4WJZA 4TKUB 4YDHB 4AJOA 2PE5A 4FJ0A 1U9IA 2RAPA 3ROEA 5IRCD 1EWTA 2AN5A 2CD7A 1PZMA 1U2SA 4QQKA 2FDCA 3AVXA 3UW3A 3Q11A 1EJ2A 2C83A 3BULA 2Q1UA 1S6YA 3EXHB 3HS3A 1M7HA 4L5YA 4OQNA 5AVZA 3QHAA 3CVWA 1V3TA 3C6BA 1YQGA 2HHJA 1FFDA 2ZRGA 1EVEA 1ECBA 1GAWA 1UWKA 2GEJA 1BFDA 3BD9A 3ZKWB 5ILGA 1GUAA 1KJJA 3AJRA 3N2ZB 1EZ1A 1P2DA 3A3YA 1TW2A 4YCAA 3U3KA 4BX8A 1CEQA 1RM0A 1KE2A 4QGFA 1N57A 4RY9A 3WWOA 4H7HA 2P8JA 2O4UX 3GXOA 3AIOA 3WMGA 3CLRC 3MJFA 2QW1A 4MKFA 4TVKA 1PNQA 1Y63A 3BK2A 3S29A 1SQFA 4GRIA 2I2AA 5G0SA 1LH0A 1ODSA 2GHQA 2IPMA 4E7OA 1RXVA 2OHHA 4EEKA 5DDIP 2XYHA 4PXYA 4XKJA 2C78A 4OQDA 3SQNA 5FQOA 4Q12A 1KF0A 2IYXA 1S8NA 1DAHA 4RKQA 1LK0A 5FFNA 1EE1A 2A1IA 2GI4A 2LGJA 2P5YA 5K51A 3A0UA 3K9GA 2R2GA 4LJ8A 3R5HA 5DKFA 1F5SA 5CXXA 1MA0A 1ZXBA 4G01B 1PWXA 3DZBA 5AXDA 1L5KA 3RUIA 2BMEA 4KGDA 4E11A 5NULA 4KXMA 4C76A 1G38A 4Y2PA 3T9CA 3N8NA 4DBLC 1G19A 3FCAA 4RAQA 3ADPA 3ZDXB 4CQLA 1XLTA 3HE3A 3OT5A 2LKDA 2EU8A 4K86A 5BUZA 4YIHA 4L75A 3RTDA 3C1TA 3FMVA 3FNRA 4WEQA 5AXAA 3IEMA 2V8BA 3P94A 2ORVA 4YK7A 3OQIA 3QYJA 2C8JA 2VBFA 1U9CA 3F3KA 1XEFA 4WINA 5H3HA 2O3SA 4AJJA 4LYAA 5IF3A 5DNCA 3PK0A 4CR6A 1FZQA 2EG9A 3QKWA 2J31A 5JAUA 4NBTA 1XJ5A 4NOKA 1Q0UA 4LBYA 5AK3A 1FJGB 5D84A 1KXZA 3UGKA 1KZ6A 1SA0B 4MYRA 5THQA 3ROTA 4C7MA 1QRDA 4ZXPA 4JGIA 2HI0A 3PZBA 1VDMA 3E1SA 1TC1A 1UC4B 1I51A 3CJRA 4MS4A 5FUQA 1M34B 3MJDA 4Q05A 3ON5A 4ZHSA 3HM2A 4XFDA 1FSZA 5DYGA 2I4IA 4EPTA 2ZAGA 3HZOA 1VYUA 4G41A 3B1VA 1CIPA 2GJKA 3VRHA 3VVCA 2NPOA 4FB5A 2VHYA 4A0FA 1E8DA 3VDMA 4OSOA 1BXGB 4OF4A 2AOTB 2BSQA 4WGFA 2ZGVA 4BMOB 3HWSA 5CFPA 2I6XA 5FL3A 2O20A 4L0CA 2AV6A 1IL0A 3UFBA 3W5AA 4EUSA 3ZE9A 1JIIA 1V3QE 3A9UA 3L8YA 4L5BA 3MCWA 3QVKA 4RVFA 5CDSA 4EW1A 1KDPA 5AVVA 5JO9A 3AP3A 2IEDA 2IEYA 4KQ9A 4KOAA 2CNOA 3QG1A 2G71A 1SXIA 2A0UA 2P1DA 2VA9A 3GFGA 3HI6A 3W4IA 2O2SA 2I91A 4MS1B 1W46A 1IHOA 5HMMA 3EVCA 1RVV1 3DVAB 2XCLA 5COBA 3ANYB 1CKEA 4UW9A 4B7UA 3IDZA 3TDNA 3TW8A 4A5OA 3I9FA 1WF6A 4WH0A 1P3Y1 1TUBB 2P1RA 4OXIA 1YI0A 1GA6A 4QTZA 3L8EA 1G0OA 5DX8A 4FYIA 5ALZA 4F3YA 1XQVA 1GTG1 1ZYUA 4JT9A 5B3AA 1SC9A 1Q0QA 3DLAA 1Y1LA 5F51A 4MIOA 4JEUA 1IMJA 2VYQA 1O0SA 3A31A 3JVDA 1W2WB 4E7PA 4GSYA 4LC1A 2R62A 1NV8A 2YJ5A 1DQSA 1P6XA 4ZQGA 1MGOA 2I3DA 1P5RA 3FB4A 1XKLA 3R0ZA 5DM1A 1Q57A 1G20E 4XOIA 1CY4A 1JBKA 4HPWA 4IJKA 4C22A 3PC3A 1M75A 4KUHA 5SV2A 3TZKA 3CQ9A 4JR2A 5I7AA 3MFQA 5EWJB 3LI2A 5FOWA 5HFJA 1QU2A 2VA8A 1JIVA 3SCZA 1WDKA 3QY9A 1DWUA 1W4AA 4LOJA 2ZIVB 2ZSUA 1E99A 2YWXA 3Q72A 1QVVA 1TK2A 2OCXA 2XUDA 4ARCA 1T0JB 2A0WA 3LAWA 3W9YA 3WRXA 1SZJG 2BPOA 2I22A 4X85A 4KW7A 1LI7A 3C8MA 4RXTA 2C9BA 1RJ9B 2ERXA 5FUVA 3K70C 4QAJA 1L5QA 4LRYA 1QH1A 2Z2ZA 3TYXA 1Z8FA 2OZVA 2W2NA 3KAJA 1K6MA 4RV5A 4UBLA 3W5VA 2H08A 2PANA 2LCQA 3K0FA 4FVTA 2PKCA 4I1UA 3HGMA 3PUYA 2Y1LA 3A28A 3AR9A 2YIMA 3FMFA 4GKVA 4JLVA 4D3DA 5D2CA 2Q1XA 2ZZMA 2BFMA 2OK7A 3LLVA 2CJFA 3OHMA 2YNMD 4TTRA 1H4VB 5DXJA 2TMYA 1NOJA 3FETA 3P8ZA 3ZXIA 3DGEC 1M1XB 1Z2NX 5KWVA 1IBCA 1VIDA 5H1YA 4B0PA 2R6R1 3GR6A 3LFHA 3A37A 5A0TA 2X76A 4MWBA 1SQ5A 1TJNA 2A0XA 4DMFA 3E15A 5E2IA 1E5QA 1K7CA 2J3HA 2RGNC 1U3GA 3AETA 3O31A 5FYQA 2QMYA 3VBEA 2OPBA 2BHRA 3IT1A 4HDRB 3CX3A 2QTBA 3AFGA 4OIFA 2NPFA 4AMBA 4M83A 1IJKA 4D9FA 3T5GA 3A4TA 2HCJB 2R7NA 1SULA 2H7YA 1EM8A 1ENPA 1JHXA 3I76A 4BGEA 1A8UA 2X5KO 3B2EA 1CR4A 3SSAA 5B1YA 3BJEA 1UJ6A 3V55A 4XIYA 1VE6A 1KO8A 4YALA 4BJ1A 2YYAA 5FNZA 2OQRA 1A9TA 5BRNA 3RRMA 3RVRA 4CG3A 2OBLA 1Q11A 3NH6A 3I39X 5TGZA 2G5PA 1JPUA 3MS7A 4MPJA 3TTSA 1KPGA 3SXUB 4G85A 1U2DC 4H18A 2H9AA 2JGFA 2FEMA 4OQLA 5KTYA 1N0HA 2PH5A 3JD2A 7GPBA 1L7XA 2G0TA 3I2JA 5KYYB 2AB0A 4TVOA 2VHZA 4QBHA 4E5YA 1RDFA 3E8MA 1VRWA 2NNWB 2ZG6A 4ARZA 1JFFB 1KAHA 1R1DA 3TIFA 4Y3UA 4HNTA 2UYGA 3BRCA 1FNMA 3EZFA 3U48A 3SSMA 1JZQA 1T34A 4DZRA 2J0QA 3RS9A 1NW7A 3PEVA 3N5CA 3H86A 2IZ5A 5B2ZA 1HMPA 1U0SY 1GQOA 2FWRA 3U6BA 3DTYA 1QNFA 3WYAA 4R7ZA 1QUEA 3ANTA 4F6RB 5EL0A 2NO7A 2X0KA 3LCMA 1TRHA 4PHHA 3A9VA 3M9XA 5FKJA 4BFCA 1F12A 1XN1A 2NM0A 5GONA 1DOZA 2VJYA 3T3HA 3ZBTA 1KVRA 4KREA 1IJFA 2XWQA 2WU8A 3FYUC 4BRZA 4JB0A 4COOA 3CIOA 3W9BA 4HQOA 3ESDA 2YKGA 3MUFA 2B21A 3MBKA 1PGPA 1J8DA 1ONOA 2ANBA 3FF4A 3OG9A 2EP8A 4D0GA 2OHVA 4LSZA 5ENVA 5CRIA 1JJAA 1L4FA 3TFQA 5LR6A 3WK5A 3VKUA 3I0NA 1QFJA 4ZHQF 3JZAA 4ZI7F 1JUDA 3W3AA 2OORA 2FN9A 5DTIA 3KPVA 5IAAA 1EX1A 1RWNA 1VIYA 2I1VB 1JSCA 5GV7A 4LN1A 4OOEA 1U3WA 4ER5A 4KLZA 3ZW9A 3CCFA 1J8FA 4CMCA 2CYBA 2ZBUA 5JYCA 1ZM7A 4YJ3A 3KWLA 4Y2HA 1E6UA 5EJEA 4MCJA 4JXXA 1GGJA 3JWGA 1M72A 1S1MA 2E1PA 1A77A 4GIBA 3SQOA 1PP4A 1VIVA 3EXHC 3FYHA 4Q66C 2NUPA 2F4NA 3B1WA 2I2XB 1R4MB 2JHGA 4DR6B 4MTCA 3I9KA 4G37A 2MYUA 2RGCA 5A05A 3CZCA 4NYJR 1XDGA 5HF9A 2DPHA 4YS6A 2NOAA 4UKDA 4MEBA 2AZMA 5E8JA 1L4BA 1E2BA 3OY2A 5JDCA 1BW9B 3NKVA 4YRAA 3VR4D 4LDRA 4RCZA 4BMNA 1C1YA 1JKJB 1QKJA 2PQ2A 4PO8A 1O5IA 3TIGA 2IUUA 1UR5A 3UA4A 3ZJVA 4Q02A 2GZAA 1J8YF 3R7FA 3SU8A 3H5OA 1X1SA 4ND5A 1GZ3A 5CT5A 4F04A 4RJJA 3ESQA 3KE8A 4XASA 4XJVA 3BXFA 1NYRA 1Z33A 1ULTA 1X8XA 2CDRA 3ACCA 2ZBVA 3GD5A 3K4PA 3OFNA 3ORSA 1FSPA 2ZYUX 4MI6A 1IZZA 1WCIA 1XEXB 4BNHA 3I4FA 5AIAA 1FMCA 2IV2X 1ZU5A 4JL6A 2Z08A 1LJLA 5IJ9A 4Z9AA 1J42A 1F2TB 2XNSA 1EMDA 3SVLA 5CJ2A 1XDDA 2PH3A 1XTSA 4Y6GB 2O3TA 2R11A 3PRJA 1AQUA 1IYZA 2W8BA 4M87A 4MVWA 1GYRA 1NIPA 1Z6ZA 5G4KB 2CV2A 3DXYA 4YROA 3O8RA 2QRHA 3P9CA 3DOUA 4J0FA 2WY2D 1T1IA 2WP8J 4RHUA 3RK1A 4XYLA 5JBQA 4QD3A 2AJCA 4Q34A 1C7JA 3U16A 4PFSA 4ILKA 1I3OA 4UCQA 5K0TA 5ILQA 5DT2A 1ZOOA 4C3OB 1HNWB 2B9EA 4FFBA 3OOJA 4JP3A 3H9EO 3DFIA 3WQQA 4XAQA 1YA4A 6ABPA 3B5JA 1CZLA 3AVUA 2Q6KA 2VXOA 2WINI 4GKKB 3NEAA 3FSRA 1OTYA 2XZDA 4UAJA 1SBYA 3HJHA 5I8WA 2H2HA 2N9UA 4DV5B 3OMXA 1E2FA 2BGRA 2ES4A 4OB7A 4KX3A 4UMVA 5EZYA 3FTEA 1G6KA 2PA3A 1G8FA 5A4FS 1E6LA 1PJCA 2WSSA 4BAZA 4W5RA 1RXWA 3IAHA 5B3JA 1T1GA 3LBYA 3ZTWA 2UZ1B 1GG9A 3D8BA 1Q2XA 3D0KA 2DKNA 3G2PA 1P5FA 4UVDA 3PGKA 4GLBA 3BGOS 1DNPA 4K46A 4M76B 4V0ME 3OLCX 1EGMB 1QLWA 3U7RA 1N77A 3T6KA 1JSZA 2B61A 2VXBA 3PDWA 4KL8S 4LJ6A 3TL6A 1WXEA 4UUBA 1G66A 5IBCA 3A9CA 5T67A 4M7RA 4P08A 1K89A 2J32A 1FFXA 2BGTA 4HYYA 5ECGC 3OM0A 2FSUA 4KLAA 1LQTA 4LZNA 1L5NA 3WFZA 3E7WA 4C3VA 3IQXA 4X41A 4KO8A 2FSPA 3VYRB 5C4MA 4G81A 4UXIA 3P4XA 1GR0A 4N0EA 4GKBA 3FX2A 4QM6A 4K9OA 1B42A 3IV9A 3P0HA 3DOHA 4QL3A 3G2KA 1ZU4A 4Q3KA 3V2HA 5KNBH 3PL1A 4YUXA 1LV7A 3E5RA 4II7A 1GR1A 1L7AA 2IQ5A 4RA9A 4WE3A 2H2GA 3MSCA 2BM9A 3TIVA 1MABB 5HOQA 1U7HA 3L4SO 4H7FA 1FTGA 3PXAA 3D4NA 4HWSA 4BZWA 1XPRA 2GUWA 4PTLA 3WGOA 2QYTA 2XUFA 1Z13A 1JH8A 1VKOA 2I7CA 5KWSA 1NVKA 1L8OA 1YE5A 2JI7A 1DAKA 2HEIA 4TWAA 2XVXA 2BD0A 1K9SA 2D13A 3FF1A 1FS5A 3K73O 1H66A 1QO0D 1C0KA 2H1IA 3HR7A 4GMKA 3TJRA 1DARA 4D9CA 4ZT3A 2ZSIA 3AEUA 4UTXA 3SHWA 4B31A 3ECAA 3QOXA 2D7JA 1QIJA 2Z6VA 2JPDA 3MGKA 4RADA 4TKLA 4RGVA 3ZE7A 4F9TA 1JLSA 4CGYA 1EWRA 2N1MA 2W6MA 4FBLA 3REQA 2PUCA 2OBXA 3FBTA 3A27A 4I4TA 8ADHA 3C7KA 2XB2A 3P7MA 1BJTA 1XRQA 4RGYA 1DAIA 1JHRA 3VBCA 5EE3A 4DWVA 3NPMA 5IX8A 3PC2A 3SKYA 3OLWA 4OFBA 2O3RA 1HZZC 2OD9A 5FL7D 1U2QA 2XX3A 4S3MA 5K03A 4I6GA 4R2LA 2C7GA 1XVVA 3QVGB 1ZC3A 2Q50A 5IC5A 2QEQA 3WLFA 3HU2A 2JGDB 2VRWA 1GPWB 2NZYA 4JC0A 1IK4A 4JYCA 2Q3JA 3Q2KA 5IFKA 3JY6A 4QBTA 2DHDA 3D2AA 1UBSB 4LI3X 3P26A 4W6QA 4HQFA 1LDBA 5AK4A 5EFZA 5JR3A 4ACAA 4A03A 3MD9A 1TIKA 3KEFA 5ED0A 2P5TB 2A9QA 1ZOLA 1YCGA 1NUHA 3ZGOA 3E3LA 2H9IA 2YFKA 3BL5A 5FPTA 4AW9A 4E21A 4UFPA 5HTOA 2ZQZA 4BN5A 3RRFA 4K9DA 1JIQA 3PDHA 1WP4A 3CF4A 3T12A 4L4RA 3ROGA 2G9NA 2PDAA 3JD3A 4I55A 1NC3A 4TS9A 4EJ6A 1QHIA 5GOTA 4CTJA 5F3WB 3FRIA 1JJ7A 2WWFA 1ZDMA 3WGYA 1BE6A 2R4TA 4LDQA 1YL7A 4EBFA 2HU2A 4M8NE 2BE9A 4YH1A 1ZI9A 4G24A 4BNIA 5ITSA 4I3HA 1JLKA 1F3LA 4ZP1A 4BFSA 3RC8A 1YBVA 2BIFA 1CHDA 4L5AA 1Z17A 4FCVA 1AGPA 1LC3A 2J4CA 4DMRA 5ALYA 4KI0A 1G21B 1SXHA 2GZ2A 4EO7A 2H5JA 4RDHA 2QTNA 1I5OA 1X7ZA 3JQ9A 3ZH9B 2WJWA 4HQKA 2R2AA 4O59O 5DNEA 2IC5A 4JD5A 3WB2A 4RELA 3G2LA 5FWYA 3K09A 3BQ9A 4EX6A 3D31A 2EBHX 2CNDA 1N2GA 2FK7A 2PYZA 1T5OA 3MF4A 1GG2A 1PSDA 1Y7IA 2UVPA 3BWBA 3UPTA 5H3CA 3AINA 4BPBA 2ESRA 2I5PO 3QF4A 1E7RA 3K9NA 3Q98A 1X3LA 4JBGA 4JLKA 2YYSA 4DREA 1E2PA 1TO6A 1WXDA 1TFRA 4FWIB 6REQB 3N28A 4M22A 3VZQA 2V9CA 3LVQE 1ZEJA 2LXNA 3CE9A 1XQ9A 4KBGA 2AUNA 2V9PA 4R2JA 5FI0B 5HCUA 2G80A 3UVEA 3Q8KA 2QMEA 3KQTA 2YZ7A 1FFSA 2LTAA 1AN0A 4Q3CA 4R3UC 4HBGA 5FADA 2B1JA 4J0QA 5I6DA 1DT3A 1WB5A 5TQ0B 4CKWA 5C51B 2GBLA 3K0CA 4MKZA 1SQSA 2ZVJA 2VL7A 3ERCA 2PGDA 3MEQA 3KKMA 4LF4B 3CZMA 1XZ8A 3L8CA 4BO9A 2BAGA 1HOTA 4YRGA 2V7TA 1PJLA 2P0YA 1RRMA 2J3EA 4FX2A 4DLBA 1P7YA 4L50A 4NCHA 3AHHA 1VECA 2ZRNA 5TY0A 4DM3A 3H65A 2F9LA 5GJVC 3WLLA 1NDHA 4L4SA 2XUPA 3C4QA 3JVEA 1N8TA 4FMDF 4ZIRA 1AMUA 1V6AA 4JSYA 1R9JA 1KVSA 1XAJA 3QVTA 3R0IA 1A5SB 4YWJA 3W5IA 4URVR 1DV2A 2MMCA 4PYNA 1K8XB 1WF3A 4UMEA 2CXSA 1E9SA 2WMOB 1Z6GA 4TRJA 3ZVLA 1EQAA 3E70C 4YXWA 3H16A 5LU8A 5T4FA 1QG6A 2DWQA 4CUZA 1XROA 5IC4A 3NEYA 3T38A 3K9LA 1E6KA 3OLYA 4KQFA 2YJ4A 3P4YA 5B53A 1RPZA 1LQUA 2PWPA 3I34X 1WE2A 4JZKA 2EP5A 3EG5A 2IE0A 2HLDD 1A4IA 1NVBA 3K9FC 1A1SA 3HMKA 3BJIC 5KZMB 5ISMA 3H5NA 4TV8B 1XTTA 2V54A 4GE0A 3JQ8B 2O7RA 4HFNA 4JQOA 5JSUA 1HQCA 3IL2A 1JVBA 1RQPA 1YR3A 2NN3C 1FP1D 2W43A 1SVUA 2A5YB 3FY4A 3JW8A 3QWHA 5EJIA 4QBFA 3AV0B 4DYHA 4YR7A 2C1XA 5J5AA 3LPLA 1WR8A 2ZJ3A 3OEWA 3T9AA