1MTZA

Crystal structure of the tricorn interacting factor f1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 113
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mtzA00
2JEYA 3DKKA 4DIUA 4OUKX 5EHXA 1A88A 1MAAA 3GROA 2ONCA 2JGKA 4E15A 2GBGA 2BJHA 4ZRDA 2XUDA 4TGLA 3FOBA 3FBWA 2OQIA 5ISMA 3LCRA 4X3CA 2OCIA 3FCXA 4G8DA 2QMQA 5D3KA 1EB9A 2WIFA 4U2GA 5HF6A 1K6EA 4ARAA 4Q34A 5CH5A 2BUCA 4BDTA 3I1YA 4X71A 2XUOA 1XZLA 4UBJA 2DFPA 4W1QA 3BDVA 1CUAA 2OCLA 3V48A 3WWEA 2QXTA 1VZ3A 2FJ0A 2C0QA 5FPQA 1GQRA 4QLOA 3ESDA 2WIKA 4KE6A 3MUNA 5K3CA 1AURA 3OG9A 1WB5A 3WL7A 1JU3A 4Y2SA 4K6HA 4BP9A 3A2NA 1W76A 2XMZA 2FJPA 4BP8A 1N5RA 4YX9A 4UFPA 1KEZA 4PQEA 3E4DA 5AK5A 3A2LA 2VA9A 2YASA 3JWEA 4IHAA 5E2IA 3AZOA 3IVMA 4RNCA 2O2IA 4CG3A 3EQ9A 2OGSA 4DGQA 2DSNA 5HQ3B 2HM7A 5K3FB 1CFJA 1BU8A 2HADA 1LGYA 1SOMA 1Y7HA 2W22A 5FOQA 1BCRA 2C5FA 3PDCA 1LPOA 3D3NA 2O2GA 1MX1A 4WFJA 4BB0A 2VF2A 1PJAA 5T4HA 3C5WP 2QS9A 4LKOA 1UK6A 2XLCA 3TGLA 4Q3LA 2HA5A 3ANTA 3S8YA 3E1GA 1ORVA 2GBIA 3FSGA 2CUTA 2JGMA 4CI9A 3DYVA 4QEKA 1IVYA 5LKAA 4NS4A 4HVTA 3M83A 4B81A 3OTQA 1GKLA 5ALTA 3VISA 1XZDA 2XI4A 5A7FA 1VXOA 4Q3KA 2PKYX 1CRLA 1Q0ZA 1CQWA 3A2MA 2AJDA 3I2JA 4BAGA 4X6XA 2EDAA 4DSAA 2QKYA 3L1IA 3WK5A 3F98A 3STXA 1A8QA 2QVBA 4CG2A 1RP1A 4MYSA 1BRTA 1YS2X 1VE7A 5JAHA 1UOQA 2PU5A 1ZOIA 3U0VA 4CIBA 3WL5A 4M0MA 2WU4A 2AJLI 3DDUA 4DYHA 1BN7A 1E89A 4PSCA 2XT0A 4J0CA 5BWBA 1JMYA 4DTCA 4Y2VA 4EB0A 4DSZA 5A7GA 4A16A 1DWQA 3MUOA 4H7DA 4CCYA 3Q0TA 3I6YA 1LPSA 5ALWA 2XUGA 4QDUA 1HPLA 3HYSA 3M3DA 5IVIA 1W75A 2QRUA 2V97A 1H2WA 2ACEA 1X2BA 2AJBA 4DMCA 2V96A 3WL6A 2WHQA 4W63A 4BZZA 2Q0XA 4N8EA 4X95A 1EVQA 3QVMA 1R88A 4KJXA 3G02A 4FFVA 3H2JA 3H2IA 5HF9A 2C58A 4UBKA 3PE6A 4QLAA 4C4ZA 5AM5A 1ZI8A 1W1IA 4RE6A 5AI5A 4I3FA 5HF8A 4Q82A 5HQ3A 4GEGA 2H7CA 2HRQA 5AKJA 4HXFB 5K3FA 3VXKA 4DM7A 4PSUA 3EQ7A 4JYMA 5IVHA 3WK6A 5AI9A 1DQZA 1DWPA 2XUKA 1GPKA 5I8PA 3W9UA 2Z3ZA 2ZYIA 4OPMA 3K2IA 2DCMA 4H18A 1XZHA 4H7KA 2XLBA 1TKRA 2V98A 4EY5A 1A8SA 4BVJA 4FBLA 4UFOA 1SCKA 1B41A 5LIPA 1GXSA 1N5MA 2HA3A 5F4ZA 2WHRA 1UKBA 1C7JA 4UFNA 4G8BA 5AM4A 3FVRA 3TJMA 1GPNA 5ALEA 1THGA 3R41A 4QDTA 1JJBA 2WM2A 2GZRA 2WKWA 3H1BA 4D9JA 2AJ8A 4NMWA 3G0GA 3NUZA 3GELA 4B84A 1CUXA 4UBOA 5JZ9A 4UBNA 1LLFA 1VJ5A 3OM8A 3SWWA 4WDQA 4Y7DA 2XMCA 1B6GA 4X93A 1BEZA 4IH9A 4EY6A 3HACA 4P93A 1DTEA 4FTWA 1F0NA 1WHTA 1YA8A 1N1MA 1QIMA 1WPXA 1TK3A 3STWA 3BF8A 4WFKA 5CT5A 5LYYA 3IBTA 1ISPA 2ACKA 3DD5A 1U8EA 3TEJA 3VDXA 3PI6A 4ZXFA 2WJ6A 1ETHA 3R3WA 3W06A 3W9BA 5H3HA 2WUEA 2O7VA 2Y1KA 3F97A 4KR0A 1QGED 3WMRA 3R3XA 2VSQA 3WWOA 1T4MA 4UBLA 3STYA 1IUOA 1U4NA 1CV2A 3H17A 3NGMA 5AI6A 1CVLA 4FDMA 4W9RA 5ESRA 5CT4A 3W2TA 4CG1A 3AJAA 1ZJ5A 1QIGA 2Z8ZA 4P08A 5K3BA 4AMYA 4FFWA 4Y9SA 2RAUA 1L7AA 3H2KA 3O0DA 5K3EA 1CUUA 5D3ZA 1TRHA 1JKMA 1IZ8A 5FLKA 4BRZA 1HDEA 4X90A 4AZ3A 1EI9A 1FFBA 2QUBA 1HKHA 1EVEA 3IIIA 4ZV7A 5EHQA 1CEXA 1EDBA 4XWGA 2CEKA 3KSRA 3WJ2A 4INZA 3FLAA 2WTNA 1J06A 1QIDA 4RGYA 2WIDA 3KOOA 3EIOA 3HXKA 5JAOA 4QDXA 2GYVA 3R3UA 3QM1A 1XRNA 4EY7A 4H7IA 2X5XA 3WKEA 4OB7A 5DYYA 4FLEA 4ZI5A 1WM1A 2PX6A 3CCBA 3HEAA 1DX6A 1IUNA 2G5TA 4FLFA 3FYUC 1LZLA 1W6RA 1UFOA 1ZI6A 4GI1A 1VZ2A 1RYYA 2Z3WA 4FLMA 1HL7A 3YASA 3F67A 1O6FA 1LPMA 4LXIA 1Z68A 3O95A 5JD4A 1HBJA 1UXOA 3M82A 3WWCA 4YK7A 2VATA 4UHCA 2R11A 3V1NA 4U2CA 2X76A 4U2DA 5DTJA 2IIVA 3ZLVA 1YSCA 1AUOA 4K2AA 1AKNA 1ZD2P 5SYMA 3BJMA 3QMVA 2PSJA 4DNQA 4C01A 3I6MA 1GQSA 2BGNA 3I2HA 1VOTA 4ZWNA 3GA7A 4EZIA 1HQDA 2PSHA 5JZBA 5ALQA 4IH1A 1QO9A 3OOSA 4QA9A 4WFIA 1EA5A 1O6GA 1XZFA 4M0FA 4J0IA 1NU6A 1EX9A 2XE4A 3N0TA 3BIWA 4AO6A 3C6YA 5ALNA 3QBJA 5KWIA 2WIGA 4BVKA 3WWPA 2HRRA 3C43A 4YPVA 1QZ3A 4A5SA 1UOPA 1R9MA 3I2IA 1GKKA 3R0VA 1CR6A 5AM1A 1EINA 5E4YA 1CQZA 4J0DA 4B9EA 1XZBA 3T52A 2PPLA 4G4JA 4DMKA 3WIBA 2VJCA 1H2YA 4Y2PA 1FFAA 5AKYA 4N5HX 2GZSA 4JYPA 4GHWA 3RKSA 3W04A 1Q0RA 1PFQA 5AM0A 4XX1A 2HA4A 4CCYB 4X91A 2AJCA 2NW6A 3GUUA 4BCBA 5DWDA 1LPPA 4G4GA 4FKBA 2GBCA 3ESAA 3D2CA 4UHHA 3QPCA 1ZD5A 4WDRA 4C88A 1BROA 1EB8A 1XQXA 3U1TA 4QE3A 1TCCA 3A6ZA 4X97A 4ARBA 3VJKA 2XQJA 3V1KA 1LBSA 3F96A 1MPXA 1CUBA 2WG1A 1CIJA 3O9VA 5E4TA 5IVKA 2XUQA 1R9NA 1ZJ4A 2DHEA 1QTRA 4X6YA 1XRPA 2XUPA 4OCZA 5AJHA 2C7BA 3LIIA 5CH8A 5I7UA 1X2EA 2DHCA 5ALUA 4BVLA 3H2GA 4X7BA 1G42A 4MWSA 1R1DA 4GBGA 3AFIA 5FDFA 5CT6A 1QOZA 4Q05A 4L72A 1TCAA 4BCDA 2B4KA 1E5TA 5HK8A 2B61A 3MVEA 2QTBA 4FNGA 4B85A 4M0EA 2QZPA 5CT8A 4UHFA 4EY4A 1JI3A 1XZEA 2BKLA 3IUMA 1XKLA 5ALLA 1J2EA 3H18A 2DQZA 5ALZA 5HF5A 4N8DA 2WUGA 1Y7IA 1G5FA 5YASA 3DKRA 3G0DA 4H7EA 2WU3A 4MXDA 1MJ5A 2XQGA 1OCEA 4P9NA 2VJBA 3QPAA 5JYCA 3D5EA 5JATA 4C89A 1AX9A 4PNZA 4MQMA 5AK6A 3G0IA 3WK9A 1SCIA 1XLVA 4FHZA 3AIKA 5JALA 2VAXA 3WYDA 2JGJA 2V9ZA 1XLWA 2PSDA 4E11A 3I2KA 4X92A 3BIXA 4X94A 2CZQA 4LYEA 4FNMA 3GBSA 2WIJA 3O4HA 2OGZA 2IX9A 3G0CA 1TQHA 4F21A 5ALMA 2DR0A 4HRYA 1CUFA 3V1LA 3BWXA 2JIDA 5HCUA 4YASA 5JASA 5ALDA 2ECFA 1E8MA 1P0PA 1MO2A 1EK1A 1CUSA 2VAVA 5LP1A 3B3QA 4B0OA 4UHBA 5JADA 4OYLA 4W1PA 3BL8A 5AICA 5ALOA 3WKCA 2H7YA 4C87A 5JAPA 1QIHA 1UKCA 2O2HA 5FUMA 4X85A 4J03A 1G4HA 2HA0A 1YAHA 3K9BA 1ACJA 5BWCA 1MTZA 1JMKC 4LXGA 4NZZA 1EK2A 3L1HA 4BC1A 4K6KA 3JYHA 4QNNA 4XJVA 4C6HA 3C6BA 4V2IA 1YR2A 5AKHA 1BN6A 1CUVA 1F6WA 3LIPA 3UUEA 4B7ZA 4JH0A 3WL8A 3NWOA 4BCCA 4J0JA 4ITVA 1BE0A 1UK8A 2ZSIA 5C8XA 5JD5A 3KXPA 2JGFA 5T4FA 2I78A 1VA4A 2CJPA 2HA7A 1TIBA 3ESBA 5DNUA 1DINA 4UBMA 2HFJA 4DNFA 1QIFA 2WUDA 2WJ4A 4PSDA 4J0HA 4K6GA 1TCBA 3A70A 3IDAA 3HRHA 2XDWA 1VXRA 2XMQA 3KWJA 2CKMA 4I4CA 3GZJA 3O4IA 2J4FA 4EBBA 4KAJA 4GECA 3R3ZA 4U2FA 3H19A 1P0IA 1OILA 3FCYA 3S2ZA 4HXGA 1FJ2A 1G66A 4J0GA 3ANSA 2JBWA 3G9XA 1QIEA 5JIBA 3T4UA 7YASA 3VKFA 4OU5A 3VJMA 1BS9A 5AHXA 3FYUB 1XLUA 2OXEA 4BAUA 3D59A 5AKXA 3OC0A 2XMDA 4LYDA 5EIHA 4DNOA 2XUHA 3AZQA 3HJUA 3PUIA 3V9AA 5LZ4A 4Y2XA 5FXMA 4L9AA 2VQ6A 3F8SA 2J3DA 2H7XA 5CT9A 3DL4A 2WLSA 5C8VA 4B9AA 1XROA 3I2FA 4DMHA 1H2XA 3C6XA 4EHBA 3FYTA 2R8BA 2XMSA 4BRSA 1BEEA 5J3JA 4NVRA 4CFSA 1CUZA 1LPAB 5AK4A 1DT3A 2PUJA 1XRMA 1XZIA 2I3DA 4H35A 4HRXA 1SFRA 3CN7A 1KU6A 2WFLB 5IVDA 1XRQA 1EHYA 2XUAA 3I28A 4S0XA 3NOXA 1GPLA 2AXEA 4B82A 3C8DA 3CXUA 5AKIA 1CUYA 5K5EA 2WJ3A 1WCYA 4AO7A 5I9IA 5JANA 4GXNA 3BDIA 3E3AA 5HKAA 3QH4A 3HLKA 4B6GA 3HZOA 2K2QB 1XQVA 4BYMA 1ODSA 4KE7A 3H2HA 4BTVA 4F5ZA 1XZGA 1CPYA 3QMMA 4BE9A 1S8OA 1MNQA 2RGUA 5ALVA 1QLWA 1AC5A 1VE6A 1J07A 5AIAA 3E0XA 4QDOA 1OXMA 4HXEB 3C6ZA 4N8SA 3D4LA 1ZI9A 4LHEA 1JJFA 3EF3A 5BV7A 3UMJA 5KWJA 4J7AA 5C8ZA 5AKKA 2E3JA 4IO0A 5FPPA 5LKRA 1AMNA 3ZLUA 4H77A 4AB1A 2EDCA 1THTA 5AOBA 2HA6A 3KWFA 3ZLTA 3ED1A 2QXUA 2ZYSA 4WJLA 1XZKA 1FSSA 1F0PA 5LLSA 5EFZA 1R50A 1ODCA 1QIKA 5ALKA 2OCKA 2RHTA 1AZWA 3IURA 3V1MA 2HL6A 2GYWA 1UZAA 2UZ0A 3FYUA 3VJLA 5CTAA 4CIAA 4F60A 1XZMA 3QPDA 3DLTA 5T4EA 2I3ZA 5LZ7A 2ZSHA 5ALIA 3LLCA 2ZYRA 5DYWA 1ZGBA 3ZI7A 4E14A 3QYJA 2WQZA 1EXWA 5AM3A 5AOAA 4P92A 4ROTA 3B5EA 3DOHA 3G0BA 5DNWA 3AIMA 1NX9A 1ODTC 5A2GA 5ALFA 4EY8A 3I6ZA 5JAUA 3HI4A 4AQDA 4BDSA 1JT2A 5ALSA 4G9EA 2QJRA 3DEAA 5HK9A 4L0CA 1FFEA 1QFSA 2WFLA 2PVSA 5ALJA 3FWHA 4G4IA 3WYNA 1VLQA 1A7UA 4Y2TA 1MAHA 4EA6A 1CUDA 2OGTA 4PV7A 3WI7A 1K5PA 3IUQA 2G4LA 1XZJA 3RLIA 2ROQA 4AZ0A 1NU8A 1KU0A 4EUSA 4BTLA 1IMJA 4C4YA 1X70A 2PSEA 3WK7A 4WY8A 1EH5A 4Q3OA 5DJ5A 2C5GA 4UBIA 5JZSA 4GLBA 3ZPXA 3G9ZA 1LBTA 3LS2A 5AO9A 3BJRA 1QTIA 1U65A 4CCWA 1YASA 2RIPA 5CRIA 3PFBA 4ZV9A 4QZVA 3WZLA 1BCSA 1JFRA 3IUNA 5T4BA 3HC7A 4UPDA 5DTIA 1CLEA 4ZREA 1JU4A 2CB9A 1QIIA 2G63A 2XMRA 4MEAA 4WCVA 3FVTA 2XMGA 3IULA 2DHDA 3I2GA 1USWA 4KRYA 2HFKA 2XQFA 3G9UA 1TAHA 3RARA 5EGNA 2OAGA 4MWTA 2Z8XA 2G5PA 3B12A 2BUAA 1QONA 5JARA 2FX5A 3STVA 3PUHA 1YB6A 4E46A 4W1SA 5IH7A 5AP9A 4GDMA 1LNSA 5C81A 3D0KA 4Q1VA 3P2MA 2HIHA 3W05A 1EDEA 2HU8A 4J3JA 2HU7A 3Q8WA 2BAGA 3KD2A 2JGIA 5FV4A 4FMPA 5EHNA 4N5IX 1C7IA 1ACLA 2XUFA 4AMZA 1UT6A 2BCEA 2PM8A 1RWQA 4OSEA 3STTA 5DNVA 1VKHA 2P8SA 5CXXA 3WK8A 4QWMA 4BE4A 1E8NA 3CCCA 1J1IA 1WPRA 2VJDA 5AIBA 1QJ4A 4J0KA 1Y37A 2WFMA 4X6UA 2JEZA 3AIOA 4JUIA 1XRRA 1YA4A 1ZIYA 2WTMA 3RK4A 1W4LA 2CBGA 4TVKA 1ZD3A 5E4JA 4TPKA 5AKLA 1MX5A 1LZKA 1UOOA 3HABA 4IQ4A 5A7HA 2BGRA 3QZUA 1WHSA 2HU5A 4JEIA 3DNMA 1QO7A 3DS8A 2RONA 3WA6A 2BUBA 3WWDA 4XVCA 2WHPA 4DLNA 1YB7A 3ILSA 3AINA 4OB8A 4W1RA 4Y2JA 2QUAA 5AI4A 4FOLA 2D0DA 3ICVA 4C4XA 1SCQA 4G1FA 3DJYA 3PF9A 1K63A 1F8UA 5LZ9A 1ZICA 3ESCA 3H1AA 4JNCA 5ALXA 5ALRA 1CUJA 1YS1X 4KACA 3VVLA 3RM3A 1DWOA 5CBKA 2VTVA 3WKAA 1CUWA 1I6WA 3BE8A 1DU4A 2Y6UA 3I1IA 2QT9A 3DOIA 4UHEA 4KE9A 1UWCA 5KREA 5ALHA 5DYTA 3PFCA 2YXPX 1W52X 3O9MA 4U2BA 2Y6VA 3QITA 1N8SA 1H2ZA 2WUFA 1FFDA 3WIOA 1QIJA 3BF7A 1R3DA 2WFZA 3FSGD 4OU4A 1L7QA 3R3YA 3SX4A 3WQHA 1CUIA 1UKAA 4MYDA 3DL7A 4KRXA 1Q83A 5IKXA 4XIIA 2YH2A 5A62A 5CMLA 1K4YA 2WG2A 5D7BA 4Z49A 3HSSA 3BXPA 4BC0A 2PSFA 3WJ1A 1WB6A 1XKTA 2HA2A 2XB6A 2WSLA 4HZGA 2GYUA 2QJWA 3WLAA 3D2BA 2HDWA 2QR5A 3FLEA 1GZ7A 3F9CA 4FWBA 1AQLA 4AX4A 2D5LA 4MEBA 3DQZA 1UK9A 3ZWQA 2OG1A 5LZ5A 4DMFA 3FNBA 2Y2VA 5LZ2A 4LXHA 5HFAA 4QWWA 3WA7A 2W6CX 3G9TA 1CUHA 4KYVA 1MU0A 3WZMA 4K5QA 2VEOA 2ES4A 3IB3A 4KAFA 5AM2A 2VT6A 4DNPA 1H23A 2Y2UA 4G5XA 3TRDA 4A23A 5EHZA 3PICA 4OD0A 2X8BA 4AO8A 3O4GA 1XFDA 1MN6A 2PU7A 2VJAA 4BAZA 5A6VA 4B80A 3FAKA 2XUIA 5FRDA 3C45A 4LIPD 3UUFA 5CH3A 5HKBA 1YAJA 2ZYHA 5HFNA 2LIPA 5BOVA 2OAEA 3IA2A 1IZ7A 1WOMA 3AILA 2O7RA 1GT6A 1MNAA 3G7NA 3M81A 5CURA 5CW2A 3QMWA 2B9VA 4BATA 5AKEA 1E66A 1D07A 2B20A 1A8UA 2RI6A 2H1IA 3O4JA 2C4HA 4H0CA 1JJIA 1ZIXA 1E3QA 2EEPA 5AKZA 3LP5A 3R40A 1PV1A 3IUJA 1P0QA 2PL5A 2H9YA 2J3QA 4OYYA 2J4CA 2RHWA 4GWLA 4Y2UA 2ZVDA 1P0MA 4H7FA 5ALPA 4UUQA 2FUKA 2HHAA 3JW8A 2JGEA 2ORYA 4OB6A 4X00A 2PUHA 1K8QA 1DT5A 5FP0A 4KE8A 2XMBA 5AKGA 3H0CA 4RE5A 3X3HA 4H7JA 3N2ZB 5DLPA 4IH4A 1U2EA 1CUEA 3CN9A 2OPHA 1QFMA 3G8YA 4F0JA 3K6KA 3D2AA 2IITA 2WG0A 4KAAA 1YCDA 6YASA 3ZV7A 4KEAA 3EBLA 4I19A 2ZJFA 5K3AA 4Y2RA 4GW3A 4AN0A 2BFNA 4AXBA 1CUGA 1MX9A 4B0PA 4HAIA 2ZJ6A 1VA5A 4PO3X 4L3WA 1WB4A 4ZGBA 5HZGA 1E8DA 2WILA 5C7YA 2XQKA 5JD6A 3KDAA 1H22A 1CUCA 3AUKA 4QDZA 5EIEA 1ORWA 1ZGCA 3PF8A 3DYIA 5AI0A 4G8CA 2XQIA 5FKJA 5SYNA 4MQLA 1AGYA 1XQWA 1IUPA 3WKBA 2CMFA 2I03A 3C5VA 4WY5A 1MT3A 1LPBB 4Y2QA 3C70A 5LZ8A 2OQVA 4H7HA 5ALGA 5AOCA 4BZWA 2DQYA 3DCNA 3VVMA 2JF0A 2JGLA 3WK4A 2Z5GA 4RPCA 3WKDA 1T2NA 1DX4A 1HLGA 2OCGA 3GFFA 3SC2A 3R3VA 3AZPA 3OURA 5AH0A 4FBMA 5ALYA 4G9GA 3OPMA 4U2EA 3MGAA 4MJ3A 5CXUA 4AN1A 3D7RA 5EIAA 1LPNA 5D6OA 4HTAA 2GBFA 3H04A 3FLBA 1L7RA 1ZD4A 5A71A 4B83A 2YYSA 1XRLA 3C87A 2C0PA 1EDDA 5KBYA 5AI8A 5EI5A 5K3DA 1UK7A 1M33A 2VT7A 1XZAA 3C8HA 3EQ8A 1R4ZA 3L1JA 1QE3A 1XZCA 2PBLA 4HS9A 3STUA 2ZJ7A 5AK3A 1XQYA 4BBZA 1Q84A 4O08A 2WHPB 2XUJA 3ICWA 2QOEA 4PW0A 2OLEA 3SK0A 1FFCA 1GGVA 4ETWA 2QM0A 1SC9A 1C4XA 4UHDA 4PF1A 4Y2YA 1DQYA
chains in the Genus database with same CATH superfamily
2JEYA 2ZTLA 3WHKA 1W25A 4LBWA 3HDHA 5C7IO 4DIUA 1Z0ZA 4X1YB 4XAQA 5I45A 3OJXA 4H1VA 1WXDA 4W5QA 2GK4A 3HNPA 4R05A 3W9SA 4BO5A 2BJHA 1JILA 3H16A 3THWA 2FSVA 1TM7E 4TLEA 3IV6A 4D4MA 4L6CA 4MPPA 4I6JA 4P54A 3AUJB 4LN1A 1I6LA 4M0DA 5EJAA 1TYCA 4HLQB 1V8PA 5AXDA 1TLLA 3RW9A 3U09A 5EXDA 4GAEA 1OLSA 4ZD6A 2WLTA 3IJPA 5ISMA 5K6AC 2YCBA 4X3CA 2JHPA 3Q4GA 3VSDA 2OD2A 4KQWA 1L5NA 3DBLA 3RV4A 5BWMA 2V7BA 4KDEA 4L8GA 1KQOA 1JFFA 1UC9A 1TPYA 1Z16A 1EB9A 1YHZA 1L8QA 1ZL0A 2RHGB 4U2GA 5IF9A 2DQKA 1C7ZA 1K6EA 3PUXA 1VG9B 2JIPA 5TPZA 1KZ7B 2BTOA 2DBVO 3FPBA 4IHQA 1PJZA 4ILKA 2AVDA 3VOBA 4ARAA 4YMWA 2FSSA 4TMXA 6REQB 2F48A 3RREA 1F4VA 4X71A 4AWXA 4W9MC 2XUOA 1PLJA 3FGZA 1K1EA 1CNMA 1T8PA 4H3SA 5B3AA 2CJYA 3TLGA 3NU1A 1KWGA 3V8BA 2DFPA 3ICOA 2BH9A 4K3UA 3HJBA 1WX1A 4PX2A 1L3IA 2Z2XA 3M2PA 3BMOA 2IX3A 1ECCA 3JQFC 5K8LA 2YR0A 3FJOA 2OCLA 4X0EA 1EXMA 4ZMRA 4ZXPA 4URHA 1YIDA 1VPLA 2HQ1A 3OAAA 3TRFA 3ZQJA 3V2IA 1AS3A 3ZU5A 3HFSA 2TMYA 4FCTA 4QLOA 4Z4EA 3QWHA 1BXZA 2SHKA 3IB6A 5K3CA 5AW9A 3WB1A 1Q7TA 1XA3A 4C05A 5I7HA 4KR6A 1L8XA 2Z95A 4FNOA 1KQGA 1HR0B 1JU3A 5FFFA 3ZJUA 1IB0A 3DHWC 2N1BA 4GRDA 4K6HA 2VXOA 4BP9A 3ER8A 3AONB 5BWLA 4LI0A 2IYAA 4BP8A 3CLTC 5K09A 1KOGA 1ILWA 1NXVA 4AUEA 4BY9E 4B6FA 1H2AS 3KSDO 4PQEA 4XH9B 4JSTA 4RA6A 4CM9D 2FN3A 5C8YA 4Y6RA 5AK5A 1QFYA 4KPUB 1GG9A 4FYIA 4KPFC 1SB9A 2VUSA 7MDHA 2JIMA 3U7HB 2LNDA 3IPXA 4P3YA 5DYNA 1GPH1 1LSSA 1T6ZA 1ZGAA 2YASA 4N5DA 4KMSA 1V96A 3OCVA 1ODJA 1L7DA 4GNRA 2O2JA 3KETA 2ZPTX 3LLUA 3U4HA 1FNDA 2D7CA 2DFKB 2OHXA 1VE3A 2Z4SA 3CF2A 3U9TA 3Q72A 3VR6H 1XTRA 4CG3A 2OGSA 2A88A 2BJVA 2DSNA 3LNTA 2HB6A 3LRXA 3JYOA 1MC1A 4MUXA 1NVEA 5HQ3B 3EY4A 5LP6A 1L7EA 3A8TA 1CFJA 3JAKB 4XYBA 5JDCC 1YKSA 1QP7A 5C4GB 5KYXB 1N9GB 3FZQA 5LMZA 5C51B 3DGEC 1F2UA 1GZUA 2W22A 3CRZA 5KNDH 1YR3A 1BCRA 2LIVA 2MSNA 4GFDA 1E3IA 3C24A 3RF7A 4HFJA 3V4FA 3ZD7A 5JS8A 3TZEA 1Z6PA 2GM5A 4YAUA 1G8GA 1M9NA 3UWDA 1C1DB 1Y4AE 4CCSA 1CSEE 3DPUA 4BKPA 4KX5A 2ZR0A 3AW8A 4N6OA 1ZQ1A 1ONOA 2H0AA 3D8TA 4DUGA 3DZFA 2XLCA 2I6FA 1DMRA 4ON9A 4O0MA 1JIQA 4QUHA 4IHKA 2ERXA 2VPPA 2Y92A 3S8YA 1NNEA 1GU0A 3FIJA 1ORVA 3Q15C 2ZWIA 4JVOA 3FWZA 3QSYA 1ODKA 1JHMA 1WTCA 2GBIA 1UFVA 3WK4A 3F6YA 1YA6A 1JSLA 2W2OA 3RRNA 3WDSA 4R6WA 1AY0A 4P53A 1JTVA 1ZU5A 1M1UA 4ZPJA 4CI9A 5BN5A 4O1HA 3NM4A 4K46A 4YQEA 3HB5X 3LKBA 4QQKA 1QZXA 3P8ZA 1N2CE 5JXJA 3KOXA 3AWDA 1FL9A 2R4TA 4RTLA 1GKLA 3H5OA 5ALTA 3DVLA 3SQNA 1EVJA 4NJEA 5IN4A 2CLEB 1L0BA 4RACA 1CQWA 2H3HA 4GP6A 2AJDA 1NR5A 2C3OA 1G20B 5HRCA 4EKGA 1QS0A 2CXTA 3KPWA 5FBVB 2EDAA 3P2YA 1RJFA 3TLKA 4DSAA 1D4ZA 2NYUA 4Z1MD 3SZ3A 3L1IA 3WK5A 4MICA 1Q7GA 5KCMA 3NBKA 2YX1A 2FE4A 4IUYA 1FY2A 4BRWA 4B5KA 2Z6AA 3FNQA 4FOPA 4JD5A 2P3LA 3CS3A 4JDPA 2AMLA 3VYTB 3DMHA 2MU1A 3B9RA 5BR4A 1KK1A 4R54A 3D5TA 4CG2A 4N9QA 3M1IA 5ITZB 4P7KA 3T9DA 4F4DA 1R6UA 3UUGA 1T6BY 2HIMA 3NHWA 4R7ZA 4ZCQA 5JFOA 2V4UA 1IHYA 5JD3A 4J0QA 4DJFC 1UOQA 2XQVA 2X2OA 1S2MA 2IXGA 3L41A 4NE7A 2UUCB 1ZOIA 5EIFA 3P0JA 4PINA 5FBZA 4E2YA 1J6UA 1EE1A 4MKFA 5MGBA 2D6FA 1NQWA 4KOAA 4MRSA 1M3SA 3OKCA 4M0MA 2WU4A 2ODWA 3H8WA 3IT0A 3IV7A 3SEQA 2QP9X 4LZOA 3FXAA 2AJLI 2RHMA 4N0EA 4EELA 1BHJA 1PNOA 4QRIA 5HS4A 1AKQA 3GUVA 4DY4A 3LKVA 4O02B 4YRIA 2IZOA 2ODNA 1KAOA 1W0JD 4NK4A 1Q7RA 4QODA 5IP5A 2W2KA 3JAMA 1EEXB 4QTUB 1T0HB 1GT91 3LSTA 3SQMA 2DCUA 5I9NA 3O92A 1R8QA 4EB0A 5JR3A 5A7GA 4A16A 3QPVA 4RBNA 5AHWA 2D1FA 3GJSA 5ARCA 3L6EA 2HF2A 4AJPA 3MUOA 1O96B 2A4MA 4N39A 1EJ0A 2QRHA 2X7JA 2XTNA 2XEXA 4KXLA 3HBJA 4LZAA 2XUGA 4QDUA 3A1EA 3OOHA 3U4IA 3HYSA 1V3VA 1CB0A 1IJFA 2J59A 3LDUA 4MR7A 3CLTD 3L06A 1IVSA 4J1SA 1J0EA 4RQUA 1OPRA 2GPYA 3H9JA 3CNBA 5FYQA 4BNVA 1X1QA 5HA5A 4UEJA 4E0BA 3ONEA 3PQEA 4UOEA 1K5HA 3UJ6A 3AJ9A 4IWNA 3K1AB 3KAQA 4O4LF 1RRVA 2YIDA 4JBHA 3E9YA 1ZH6A 2C92A 1FSFA 3PJFA 4LJ7A 1TU3A 1WCWA 3EA0A 2DPMA 4DMCA 5LQJA 1CRWG 3K20A 1MBZA 3OKFA 2VJMA 1L4NA 3GJ0A 2V8OA 4YNBA 2R48A 5DSZA 4B1FA 4A2QA 3NETA 4R31A 3PXGA 2YYYA 5I7VA 1B2RA 1MVLA 3OX2A 5F5NA 3QPWA 4QO7A 3L79A 3TR6A 5B1YA 1CZUA 4D0NA 4A36A 1R88A 4IIVA 1NBHA 3ZXSA 1CF2O 1VGQA 1T0PA 2R8PA 3JSXA 3W77A 4FMDB 2CDBA 4UC0A 4FT4A 1A97A 3U39A 2EX4A 2HZBA 1M8JA 3BE6A 2CNWA 1UBFA 1GL9B 1UJ6A 2ZJ3A 2ZUDA 3H2IA 5HF9A 5K51A 3COYA 5SICE 5L3VA 4MVJI 1KYXA 2Q8NA 4F5WA 5DNYB 1E1CB 1ZFNA 2C58A 2MSLA 3AFMA 2CMDA 3PBKA 4UBKA 3LFHA 1IJKA 1E2IA 5E6UB 4D42A 4R3UC 2FWRA 4D4JA 4AWBA 1QC5B 5AVSA 5L4LA 2BI8A 3Q3IA 2VPXA 5CJJA 5AM5A 1KZ4A 3KT3A 4J9VA 2OUKA 2AOUA 2CC2A 3UWKA 1SUSA 3ADKA 2FWBA 4GICA 1NUHA 4RGQA 4MR8A 2CT8A 4EHAA 1IM8A 1FXSA 2VPTA 5HF8A 1OGJA 2DJIA 2PQ0A 3JQQA 5DK6A 2A7XA 4W99A 4GEGA 5I4IA 2H7CA 2HRQA 3U4DA 1UBSB 4L7QA 1U0BB 2EZ8A 3I8OA 3GAAA 4JLAA 4RLFA 4ZYWA 1W59A 2FW1A 2LWIA 2AZMA 5IVHA 3LBHA 4EA7A 3PEFA 1DQZA 3T1NA 4O63O 3ZVRA 1U5AA 2OHJA 1YRLA 1QWOA 1VBKA 1BHQ1 2XB9A 2YWEA 1C0KA 5FQOA 1QQAA 3EXHA 2ZYIA 1EEHA 1RPNA 3NUQA 4LRUA 2JCVA 2AD1A 5F78A 1N32B 1T8RA 4IXTA 1NPDA 2PV0A 3H42B 1U0SY 4AF6A 1TKRA 4CYMA 1GRNA 2ZIWB 4FK8A 5CDFA 3R7AA 1ZONA 3SIWA 3CVYA 1A1SA 3ZV4A 1IZYA 5DGIA 3GY0A 1IG0A 1U1IA 1A8SA 5ILOA 4DR7B 5EP2A 4JI2B 2ZRHA 4NG4A 2NXWA 1G9XA 1HGXA 2IKQA 1SCKA 3G23A 1NMEA 4R98A 4UFOA 5DI3B 2P5SA 3RS3A 1V7ZA 3UJ8A 2OVFA 3UT5A 2H2WA 3WDKA 1GXSA 3T5AA 3CX3A 4OJTA 2GEFA 3RUAA 1H8EA 4LJ9A 4IIDA 4G8BA 3ZYCA 1BGXT 3FVRA 2CFTA 2ZBUA 3EIQA 1IJBA 1CDZA 4NZ9A 4CR8A 1THGA 5KWEA 4CEJA 1L5OA 4OXIA 4QDTA 4M1OA 13PKA 2EBUA 3MN1A 2NN3C 3CNEA 5JAQA 2GZRA 2IS6A 1PR6A 1S2NA 3NNDA 4WLFA 1MHPA 4M0LA 1KSGA 4BB9A 4AC9A 3QUAA 4D9JA 1Z07A 4PRZA 3SFZA 5KNBH 3H0KA 1FUUA 4HNVA 2D7DA 1GQOA 4XFKA 4LOIA 3Q5DA 1T2DA 3T1TA 2J6CA 5ICEA 3GOHA 2UUOA 4UXHA 5H81A 5M29A 3JTMA 2EZ9A 4NENA 4C0WA 5LWHA 2HPAA 2ZR8A 4F6RA 1ZZEA 5B1EA 3QEBZ 3OCUA 4RV5A 2ZQ5A 4ALJA 1L3BA 3HDVA 4EGAA 1TA4A 1ODLA 2FF7A 5LFAA 3GX1A 4W5RA 4OOEA 3PPWA 2W8ZA 3X1KA 4WDQA 5A05A 1JZSA 1O97C 2IW1A 1B6GA 1BHSA 3Q87B 1DFIA 4IH9A 1OV6A 4X93A 1FJGB 3K0EA 1HTTA 5FPSA 1RHUA 2AWOA 1M6NA 1GNQA 2O14A 3HA5A 3MMNA 4FTWA 1MABB 3VZCA 1KI4A 4HO1X 3PP8A 5C2JB 1W35A 3KZNA 4URUR 1N1MA 4XPIA 5CXSA 3DCYA 4YVFA 4YIHA 3VH4A 2QN3A 1TK3A 3NT2A 1I30A 4IMJB 4JLSA 3AXSA 1E7YA 4JIGA 4KTVE 2LKCA 1FTSA 4QVGA 1QHNA 1A9SA 1QH8A 1XTPA 3STWA 1PJSA 2CGEA 4WFKA 4JP3A 3QVWA 3ICEA 1KMHB 3PNKA 5LYYA 1FVXA 1VG1A 4BUZA 4YP1A 3IBTA 3L6UA 1XP8A 2JLXA 4LBYA 3QBTA 1V6AA 3TEJA 2GEDA 2X9GA 1G5TA 1R0YA 3S2GA 4ZXFA 5FEUA 2NNLD 2VYVD 1ULSA 2DUNA 4Y9TA 3THRA 3V33A 3JSAA 4Q9HA 3W06A 5A5GA 1FSPA 3PXXA 1XK6A 3QWFA 5H3HA 5IDXA 1GDDA 2Q1UA 1PJQA 3ZJTA 4Q9LA 4KR0A 4F4HA 3UPDA 3C97A 4EG8A 4DV4B 1PO7A 3I3OA 3HKCA 5FYDA 4CKCA 2ZZMA 5JISA 4TYWA 1E2PA 1GNVA 2YVLA 3OJEA 4UE6A 3NORA 3M7IA 5CLGA 3FCUB 1AV6A 5K3SA 1YDWA 4D4HA 1U4NA 1CV2A 4HG2A 4KQGA 1M83A 1ML4A 2OMKA 3HVIA 3L6RA 5AI6A 2D62A 4FDMA 3ZDDA 1VL6A 1NF8A 2QQFA 2ZB7A 5A4DA 5CCXA 4TKZA 4DA0A 4F3KA 1B6TA 3IR7A 5EYPA 5KVAA 5KX5B 4IFEA 4AN4A 4K9OA 1SXQA 1SU7A 1KNQA 2VSXA 2ZBPA 4K28A 4BV3A 1FQWA 2FW6A 2HWXA 4QXOA 2XT9A 1Y81A 4PN7A 2ID4A 3O4RA 1A5SB 1H1LB 1P18A 1PZEA 2CY0A 2QRZA 2Z8ZA 3AEUB 5EQJB 5K3BA 3VVCA 4UQOA 4HRVA 4AMYA 1E4YA 2H2FA 2XDAA 3CTPA 1DAIA 2F64A 3LBFA 4JGIA 4QEDA 4RUKA 1L7AA 4TXLA 3PPVA 4QPCA 1T8WA 1YQXA 3AGPA 4RDCA 4ZYVA 1DQNA 2HPHA 3CUSA 1E0SA 3EEYA 1TRHA 2B4YA 1C81A 1DAEA 1O3YA 4PYLA 1O58A 2FPIA 2MINB 1SRRA 1DBPA 4J1QA 1UMDB 3PHJA 3H1EA 4EVRA 3AF1A 1LK5A 1IRIA 1RJ9B 2WPNA 2QUBA 3HMKA 5CB8A 3DV0A 2BKAA 4LHXA 3REFA 1NDQA 2P9BA 4F8YA 2H9IA 3AFGA 6ADHA 3NDBB 4LYYA 2H4ZA 4OFZA 5EPEA 2W7TA 2PFSA 3TTWA 4UNIA 3VPFA 2LE0A 2GD1O 3TD2A 5I48A 3QE3A 1JR6A 3AESB 4AROA 2Q9CA 3BH7A 3VX3A 3WNZA 4PPYA 1DIRA 2BGKA 3BL6A 1CJVC 4BZPA 5AD1A 1LK0A 1WZNA 2O9JA 3EMBA 4QPJC 3H9UA 2PGXA 4AULA 4PCLA 1J06A 1R4NB 3QXHA 2HDNB 2B8TA 3EIEA 2P41A 4ARZA 2Y1XA 1ICIA 3DB1A 3DNPA 1V43A 3QA9A 3ZY3A 3HXKA 4WZAA 2R6DA 4HLNA 3OLWA 1CZRA 1NW7A 4MS4A 4XQ0A 3SJAA 1ZD8A 2VTEA 2GYVA 3VPGA 3ZNNA 3P19A 2RGAA 3E4CA 5DM70 4UU1A 5HMMA 1HRKA 2WVJA 3C1UA 3T41A 3EWAA 2O2SA 1YZUA 2ZWMA 3ZHSA 4NZOA 4WTOA 1BKSB 2JK1A 1F6BA 2QRJA 4H7IA 4EY7A 1YB4A 2Q5LA 1H9AA 1WG8A 3PUJA 3UO8B 4G41A 2H1HA 2XCUA 4ZMBA 1DEAA 1FA9A 2QPOA 1J7JA 1PK8A 4HNHA 5IANA 1Z63A 4ZCLA 2G9VA 4ZI5A 1T9KA 3OJ0A 2JGAA 4L50A 2HX1A 2VBFA 3VR5D 3INGA 4A10A 4C4OA 4NDNE 3T3DA 5LXTB 3DEFA 4XD7A 3CH6A 2YBDA 3IOCA 3TQCA 3VR3D 3GVIA 3OIYA 2CDAA 1PHRA 1M6EX 3PHBE 3O3NB 4B40A 1O97D 4EITA 1NY5A 1W6RA 2I9KA 3MYYA 1Q16A 2NAPA 5AJUA 1U0RA 4RTMA 5E95A 3EYAA 1J0DA 4L5CA 3M0EA 1RYYA 4F92B 3ABRB 3EZNA 4IJUA 1PAUA 2IHVA 3YASA 3V3KA 1O4VA 3K9LA 5FI3A 3R76A 3UATA 1E2NA 1Q1NA 2P4UA 1MMFB 5ER6A 1MAWA 2OXRA 2F43A 3DTNA 1ZH8A 2BFDB 3M4YA 6GPBA 1Z4MA 1KP3A 5DLYA 3IODA 5JSKA 3NV7A 4ANFA 5ERYA 5KQMA 2BHLA 1UXOA 3A11A 2BEUB 3M82A 1SK8A 1MB3A 1W5EA 4INOA 4X7MA 4YK7A 5AVUA 2FMUA 4LXUA 3OFVA 1FZTA 4KQMA 4U2CA 1U3VA 3GCZA 1PS0A 3O8OB 3T5TA 5HWSA 4G8JA 4KSBA 4U2DA 1XMSA 1NYRA 5JC8A 4X8OA 1KDYA 1XD2A 2FFHA 1Z12A 3E2MA 3EY9A 3AM5A 1SHUX 4PC6A 4XE5A 2HSGA 3ZCRA 5AUPB 5DCLA 4EYOA 1E2BA 4LTDA 5JH7F 1GFIA 3GP3A 3SNHA 2X0JA 4ME6A 5FTNA 5GADl 1ZD2P 3DZJA 4JC8A 1KOJA 3BJMA 3QMVA 2PSJA 4O1IA 4OMDA 4MUFA 3ZKWA 4C01A 4YMVA 3REOA 3SQXA 4G1BA 1XWIA 1OWLA 1USIA 3I09A 2VC2B 3SS8A 2FW9A 4AP5A 5I8ZA 4K9KA 1GFSA 1XALA 3HKDA 5F98A 1AXRA 3KB2A 3NT5A 2G9QA 3HBNA 1HEIA 2PUFA 1EZ1A 2CUZA 1EUCB 1HQDA 2O1SA 2D5CA 2H85A 4O4LA 1Z47A 4OHZA 4C4AA 4ZO9A 4CMEC 3R6DA 4LEIA 4QA9A 2W0MA 3KQKA 2GAOA 3UBTA 1H8HD 1OTXA 1TIKA 4FX2A 3K92A 1K98A 5LU9A 1EA5A 2VFAA 3RBAA 5MGNA 3DDSA 1DVRA 3OZCA 2FFRA 1XZFA 4L3OA 4QXQA 4R8KA 3ILXA 1L5YA 4M2LA 5CVEA 3B1ZA 3ROMA 5JQWA 3ZD9A 5GONF 2BRUA 2XAAA 3FUTA 2D1QA 1L1RA 3A9RA 3GBPA 5JEEA 1XCPA 3O91A 3I1FA 5FO0A 3TQHA 2WWRA 1XC7A 2P5UA 3EZ2A 1VL1A 1NU6A 2CVPA 1D2AA 1EWKA 2XE4A 2AIRA 2VP4A 3QSGA 1EFRD 1PJ4A 3R6GA 2XBLA 2Q3DA 4KXNA 4TWJA 1BMQA 4XSGA 1ZX1A 1S02A 3KAJA 2P65A 4U9HS 4UTVA 1U63A 4BNFA 5H3CA 2GPWA 2JFUA 3THYB 4AJ9A 4Q4JA 3P2IA 3ORYA 2W8BA 2ZRNA 1EGHA 2Y4NA 3QBJA 2V4MA 4BZXA 4CHGA 2R8OA 1YGPA 4ARCA 2O8FB 3LVFO 1NVTA 3CQ9A 1PW5A 2HBRA 2GLUA 1SZJG 1KGSA 2JIOA 2OV4A 1ECLA 1YOBA 1WCXA 4U7HA 2QV0A 5ESXA 1PIWA 4HI0E 8ATCA 1AH2A 1GA4A 4QBIA 3WWPA 1FJHA 2YINC 3II6X 3LM8A 2W6OA 5ERGB 4EP1A 3U3ZA 4EA8A 2PVPA 2Q6KA 4N6NA 4WKBA 4J76A 1UOPA 3X2FA 1Z4LA 1FRFS 2HNBA 1NBWB 2V03A 3GJ4A 1DFHA 1R9MA 1MRSA 3R6LA 3ZWCA 1O08A 5LD2C 1M74A 3DT6A 3IPYA 4E1VA 3S70A 2W6JA 4EKIA 1PT7A 3RSLA 3PGMA 3C15C 3D7SA 3DOUA 2ZBGA 1B76A 3RTGA 3HVRA 4HEQA 3T52A 1GPUA 1WXQA 3HL0A 3GAZA 2PPLA 4B3HA 4PQRA 2NADA 3W5UA 4M8LA 3B3JA 5I7EA 5EJ7A 4U7WA 2V6IA 2E89A 4Y2PA 1HLFA 2CL5A 5AVQA 4RVOA 5CU7A 1N2BA 1GV0A 4YAOA 5CYFA 2OK8A 4TL7A 2C4UA 3WQSB 2CHVA 2PMCA 3UXMA 4H1TA 5KEIA 1D6NA 1VSUA 1DO2A 3JPYA 3NAGA 3ZXIA 4CN8A 1E2UA 4D41A 4PLHA 4U6QA 3CURA 4Z6KA 5AM0A 4WOBA 1ZCFA 4XX1A 4CCYB 4DLKA 2E4XA 1EP2B 1RXEA 2OESA 3HJAA 1SZPA 2L18A 3RRFA 1G21E 5J4YA 4X91A 1O57A 1TYZA 3CB4A 4TRJA 4XUCA 4MYTA 3HN7A 4JQSA 4BJ5A 4QFMA 1G9SA 4LCEA 4BCBA 1ABEA 4OK5A 4RH3A 4DR3B 3EZXA 4D0RA 1JV2B 2HLNA 3OFNA 3Q10A 1R6XA 2F1RA 3RAPR 2JARA 1T0UA 4D2IA 5ADWA 1MT0A 5E0OA 1FB5A 2GBCA 3ESAA 2Q29A 3KSUA 3HL4A 4MZDA 3R5KA 1ZJ6A 4WDRA 3VHLB 1F7VA 2BGMA 4DIOA 2D2FA 4L4YA 3QU7A 5B1IA 3SBXA 1N3LA 2I2WA 3U1TA 3A6GA 4ENSA 2Q2QA 2ZBVA 1TCCA 3GL9A 3BGVA 4PLZA 1G4AE 1E1YA 1O2DA 1Q3HA 1TL7C 1G7SA 1TUBB 2XQJA 1N2HA 1U8UA 3CNLA 3I45A 3LC2O 3QNWA 1PJ8A 5EHIA 4BMYA 3KSBC 3JARB 3EAQA 3H8VA 2W4QA 4M1ZA 1KO5A 1HNNA 2ANCA 2PZLA 3NAMA 5CITA 3OT1A 3K6SB 1IPHA 1X1BA 4LDAA 5JPCA 4S1VA 2WG1A 4MUHA 4CV2A 1GU7A 3IUBA 1K3FA 3WLFA 1OYVA 4OI4A 5E4TA 4YGXB 3O6VA 1FDWA 1USKA 3DLAA 5KMGB 2AKEA 1ZJ4A 2DHEA 1GGHA 3UKOA 4DXDA 1VJDA 1VJ1A 3H3FA 3K5HA 3VGJA 2XDQA 3EGEA 2O20A 1E6LA 3TBKA 1XRPA 5L3QA 3ESXA 2XUPA 4OCZA 3NXKA 1X77A 2V9PA 3W6UA 3WGZA 1LVUA 4IWXA 4Q24A 2FHSA 5I7UA 5KVQA 2QTVB 1PCXA 1WMAA 4YPFA 4BFVA 3VH2A 2ZTHA 4BVLA 4C04A 2NO7A 1WF3A 3TFWA 2UZ4A 3WMGA 4WNAA 4JA2A 4JMLA 3D6VA 4F91B 2ACWA 1NP6A 2X2EA 3MC1A 1IN1A 4B87A 1RP7A 4AJIA 4R3WA 2ZUFA 4ALKA 3OZDA 3BBPA 3Q12A 2VLBA 2B1JA 4YJHB 4UPVA 3AKCA 2VA8A 3AFIA 4RLHA 1ZGJA 1R15A 1U5BA 1K8YB 1R10A 4OHXA 4P6VF 3TZKA 2SECE 3VAYA 5HM6A 2EHDA 1G2QA 3CRMA 4NICA 2AXNA 4WRRA 3ZNQA 4X1KA 2YFKA 1S3SA 2BFEB 1KOLA 1UJNA 2BEVB 2I6XA 5E6RB 2BZ0A 5HK8A 2X4LA 1A69A 1XWFA 3H3JA 1OZAA 2QW0X 3CX4A 1FX1A 1OYYA 3LT4A 3O1HB 4WXRA 3UXEA 3N2GA 5JHHB 3ADPA 4MOWA 4BYGA 5C5EA 1Q0LA 5BMOA 3ZEIA 5L45A 3GEPA 2MSEB 4US1R 2NU7A 4YAEA 1OREA 2QZPA 2YWBA 3VSAA 5KYYB 3EGXA 1GN9A 4M38A 3W5DA 4INJA 4EY4A 4PVCA 1ZMXA 3GNSA 1SCJA 1JEOA 4IDGA 3SZUA 1ITZA 5JEDA 2QA5A 1TVKB 1ZK4A 2D1TA 3K5PA 1X1TA 3BCHA 3RSGA 3CUYA 1E9SA 3ZE7A 1VPEA 1AQ6A 2QTMA 1J2EA 1D7AA 1P61B 1Z62A 2F8LA 2FPGA 2ON6A 2YC4C 3NHLA 3QEKA 4IDEA 1NBMD 4L6IA 4WA7A 5ALZA 1KA9H 2ODBA 3KQLA 4HL6A 1MHTA 1NG1A 2HW8A 1QAOA 2ZBQA 1S2IA 4N8DA 2JLWA 2YIMA 1GTMA 1H0KA 2EIXA 3LPLA 1RXWA 2NZ2A 1T34A 4JI7B 4DBLE 4TMKA 4B4DA 3DKRA 1OLXA 2BFCA 16PKA 1Z6YA 3BWVA 3E61A 1E60A 5B7NA 3PKZA 4HATA 3G0DA 4MVJG 1WPGA 5CGQB 3EYWA 3MWDB 2IHNA 2Q7OE 3ELWA 2QSUA 2PXHA 3QKTA 2VDRB 5EJ9A 1E9EA 3Q7RA 1MJ5A 3U7QB 1O9HA 2F9FA 1GU1A 2Q27A 3K53A 3PCRB 1OCEA 2ODPA 4NP6A 3RIHA 3NO4A 4PLYA 1QO0D 3G2JA 2NXCA 1ESNA 2A0YA 3E2PA 2IH5A 1EVYA 3IMFA 3BXGA 4V3CA 1YGYA 4MS3A 5FV7A 4C6TB 5C1DA 3NWPA 4F3YA 2BKUA 5JYCA 3PHGA 1P6XA 3DAHA 5JATA 4RXTA 4BJ1A 4X20A 3UMGA 3OQ1A 4L16A 1JT9A 1HFJA 4F8JA 1AKTA 1WEHA 4WL0A 2A30A 5AK6A 1KAEA 1V4BA 2JIZA 4DAEA 1C30A 3WGYA 1FUEA 2WJJA 3EC1A 2UXBB 5JALA 3WYDA 1VJCA 3A0RB 2JGJA 3OJCA 4YFVA 1J21A 1OROA 4CLOB 4DLPA 1E64A 2VTDA 1V3QE 4E11A 1H4SA 2HHCA 1GPYA 2ADFA 4X92A 4G86A 3F73A 2NO0A 1SVSA 3N0XA 1E2HA 4HDRB 1KMNA 2CZQA 3ENNA 2EF0A 4LYEA 4UUOA 4YEDA 2ZSKA 1YZNA 2MWMA 1R0RE 2HLHA 2XWQA 2GXUA 3G59A 2WIJA 3MJSA 2B5OA 1HI9A 2OGZA 3DZ8A 3O4HA 5AJYA 3ROQA 2VT3A 2FX3A 3THXB 1U2RA 3G0CA 3IAHA 1H94A 2FSUA 3MRSA 4F21A 2J41A 3NG1A 3BCSA 4KO4S 5ALMA 4HNUA 5KNDA 3AUYA 4KVFA 1UBUS 3IP9A 2JI7A 3BWXA 5IBPA 1F20A 1E9RA 3M6MD 4OBBA 3I42A 5IJ9B 4GPIB 1ISHA 4YASA 3K0CC 1W96A 5TR9A 5F73A 4EO9A 4DIKA 1E8MA 4HNRA 1FYFA 1MO2A 1BA3A 2QVCA 4B7CA 2CSXA 4IIUA 1O5TA 3DBVO 1QH0A 1S8FA 3MINA 3GZNB 4KAXA 2A0WA 3T99A 3KT8A 2D0IA 5LP1A 3IEPA 3LYUA 5IT5A 3G1WA 4HUTA 1NRXA 1C80A 2VRBA 4OYLA 3B6IA 5AICA 1N6PA 1QB7A 1TYAE 1KXZA 4KO8A 1T1SA 4YUZA 2YNMA 2P5TB 1W85B 5FUMA 3MUEA 4X85A 2ASVA 3IIMA 1SIBE 1BKDR 3DHYA 2WP8J 4LYHA 2QL5A 1ZN7A 2F3UA 2ZGVA 3A14A 3BWEA 4WHMA 5J2UF 2XNCA 3NIDB 4J90A 1ACJA 2MJLA 1KZ1A 1TFUA 5JH7A 4WZBB 5L51A 3CIFA 2ODAA 3VPCA 4LXGA 4M8NE 4GBJA 1FZQA 3R0QA 4XUGB 1KC3A 3V6MA 5IS2A 4E5MA 2JLUA 4UJ5A 1EIWA 4BC1A 1SOAA 5KNBD 4E13A 3LQQA 5KNCD 3PDIB 1QF7A 3EXFA 2AH5A 2YS7A 2AK2A 4S1NA 4XASA 5TQ0A 3M9LA 2ZTSA 2B83A 4XI9A 2ZI6A 3SC4A 4GYWA 4B3CA 3DL2A 5LSAA 2Y0CA 3B82A 1XXHA 2B8JA 5IC6A 1BMDA 2EXXA 2OHIA 1KYTA 4TXNA 5B1SA 1L5HA 4W5NA 4GSYA 2P9GA 4GPEA 3AEZA 1NP3A 3Q2IA 3TNYA 7GPBA 2YFQA 1D2MA 4RVFA 5FA5A 5KHAA 1MA0A 4AI6A 3R5TA 4AZVA 2R751 3JVUA 1TI7A 4EUFA 2BPOA 3RT1A 4NCKA 3VSCA 2AG8A 3WL8A 4UNRA 1KSJA 4L0DA 4MJLA 1QAMA 4QYMA 3RS5A 3P4YA 4ITVA 1IN8A 3ROXA 1U3WA 2J5KA 4MDHA 3CR8A 6CHYA 2GCOB 4G81A 2X77A 2NNWB 3HWWA 3L40A 2CLKB 4M9UA 4G1CA 2UVDA 1O6BA 2G9UA 3ZI0A 5C8XA 2C7QA 1GQYA 3TLAA 2JGFA 1T4CA 4Q7EA 5T4FA 1VA4A 2HA7A 4M55A 3N74A 4MVJH 3ESBA 3MWJA 5DNUA 1ORTA 4YFYA 4P0PB 4QGHA 3PGA1 5JSYA 4J7UA 5CFMA 2WJ4A 1VBNA 2ZUVA 4J0HA 4K6GA 3B85A 1DCMA 1IEVA 1KYWA 3A70A 3BRWA 3IDAA 3OLYA 3UAZA 3ADBA 1HLDA 1N3YA 2QD3A 1N8NA 3MOSA 2YHUA 3WLIA 2XGMA 2WD7B 1EBFA 1L7PA 3LX4A 2XMQA 2A5YB 3BWMA 3KWJA 1HQCA 3MJVA 4K03A 4MWGA 1I4OA 4JVLA 3VNSA 2FOLA 3D3WB 2RKWA 3H9GA 5KU7A 5LR6A 4LQCA 3RYCA 2ZRCA 3FYCA 1LNQA 5EKUA 4EFNA 4K6OA 5I7FA 4MS1B 1W44A 3AT1A 4PYIA 5FBHA 1XNRB 4Q4HB 4OYRA 3R3ZA 2UVPA 4IXDA 1YJAA 1GDHA 3H19A 1P0IA 5DWQA 2C54A 4UOQA 3OIFA 4FIZA 4WA8A 3SBDA 1ONNA 4AURA 1JHRA 2X1VA 1KJ8A 1HNZB 2JJ2D 1G66A 4IGAA 2P2CA 3I32A 4B3IA 3UJ9A 5HBRA 4J0GA 3AR5A 3ANSA 1V11B 3AEQB 3Q5EA 1L5FA 1NSTA 2JBWA 1FOEB 1NUSA 2EW1A 4BKMA 2NT3A 1FFXA 1ECBA 2CVZA 2HMUA 2V55B 4WNCA 2IOYA 4NABA 1BS9A 2BE7A 3DMFA 1B93A 3FYUB 2OXEA 2ZJOA 1VCOA 5GJVC 5IM4F 3EMDA 3A3PA 3KZKA 2D06A 1XTSA 3D59A 2E4YA 3AR6A 1ZMOA 3OCWA 5HKLA 3N2EA 2G0NA 1UJ5A 1BYIA 3EA4A 3QHPA 3ZCQA 5I8WA 1BGWA 2XUHA 1AN0A 4JLBA 1XA4A 4XWKA 1Z82A 5B36A 3V9AA 5ETJA 3UAVA 1DKOA 1NI4A 2X1LA 3DO6A 4CW7A 5LZ4A 1KGDA 2PANA 4L9AA 2VQ6A 1C3OB 3D8SA 3PD7A 1RIIA 4BQFA 4IXNA 4X6LA 5H7XA 5JNWA 2C3PA 4P58A 4FCWA 4KDFA 3KYDA 1RMTA 3ERCA 4DUPA 1RBZA 4BO0A 3RWBA 3ZDQA 1U02A 3DEYX 3DL4A 3H75A 4HH0A 1VLLA 4ZZ3A 4CMIA 2V0NA 3DDZX 4LNHA 1H66A 1BE6A 3IJ5A 4FFDA 4TQGA 1JU9A 4JAVC 4PC1A 1ZVMA 3PC6A 3VO1A 4E7PA 4WGGA 3L6DA 1B6SA 1COWD 1TVMA 3AB3A 4O3FA 4BFCA 2IW3A 1YJCA 2ZITA 4PQYA 1E2FA 3NATA 1RYDA 3UOGA 3U17A 4Y18A 3GIDA 4XFDA 1PSZA 2O4CA 3PEYA 4U5QA 2D1RA 4O2LA 4BRSA 2V7TA 2I6UA 2VNSA 4MW1A 3MYRA 2WWXA 2AOTA 1U7XA 2Q99A 5G4LA 2GD6A 3GI1A 2C00A 3C6QA 1DT3A 4AAYA 4TKVB 3GLFA 1GCOA 1XRMA 2C57A 2I3DA 1NF2A 2GLXA 2RB5A 4DLWA 3SZRA 1BXRB 3HCOA 4O4IB 4XUDA 5AFSA 3G68A 4OQLA 1II0A 4MUYA 3LL7A 4WN9A 3TNFA 5LYJB 3EARA 3DE7X 3IIKA 4NDAA 3EHDA 4EBFA 4F93B 2JNWA 2BGTA 1TUGA 2WFLB 1XTVA 2ZSDA 5IVDA 2IYLD 1AB5A 3I28A 4KPGA 4P36A 4S0XA 5SY9A 5DGTA 4DIFA 4R8SA 2Z57A 4TT8A 3T1HB 3CLVA 3OZUA 4XB6B 4B82A 1GPMA 2AR7A 3C8DA 4QBFA 1CUYA 1M34E 4R83A 2FV8A 3P2EA 4PYJA 2RKBA 1A5TA 2J5QA 2WU1A 5KJ1A 4OMCA 3KELA 3TRHA 1U7DA 1CY6A 5A0VA 3ROKA 3EN0A 1SXJC 3LRPA 3KSMA 4LVUA 2VDLB 1E4OA 1VB3A 2H59A 2LXNA 3AVPA 3E3AA 3QOFA 3HLKA 3LUJA 3W1WA 2GBLC 2HMAA 3CLUC 1U0JA 1YZTA 3WX0A 3ZHZA 4KSYA 5KTRA 1ODSA 1DELA 4H4CA 1USVA 1J2TA 1E69A 3O38A 4N3CA 2VXCA 1Q95A 4OOFA 4BTVA 4UDXX 1KMIY 3BQ9A 1XZGA 1CPYA 2IWRA 1C7RA 3DZCA 3LYAA 2WT8A 2HQRA 2IP2A 4OXNA 2YVUA 4BE9A 4KREA 2GXSA 3HCWA 2G9ZA 4N41A 1ZK2A 5ALVA 1DEKA 1ELOA 2Z2ZA 4OX9B 2VCYA 2TSYB 3M6AA 3K1ZA 1VE6A 1CYEA 3D0QA 3HJRA 2DMRA 1J07A 4FYYA 3UW1A 2Z6UA 2Q4DA 5EWJA 5CLLA 5JYEA 2WR8A 1UT5A 1X7DA 4QARA 4J3FA 1XLTA 3A7EA 3CW2A 4WXMA 3T12A 1CEEA 1K7CA 3C8MA 3K72B 5B58C 2XWBF 2Q5CA 3C6ZA 4PIVA 1ZI9A 1V8DA 1GPJA 3ZU3A 2R60A 5I01A 3U6BA 4K3VA 1PRYA 3EF3A 4KK4A 1PW7A 5BV7A 5JCPA 1TQ6A 3JQGB 3UMJA 3MT8A 3DC2A 3HZRA 3TRIA 3M34A 4FFSA 4HGPA 2ZJ8A 4MW7A 1Z0DA 1C0PA 4CCAA 5CDFE 1SAYA 3HN6A 2DULA 1T8SA 1XEXB 4XLTA 3GPLA 3HB7A 5J2TF 3RSOA 2A4KA 3NP7A 3AY7A 5BR7A 1AQUA 1XEWX 2YY5A 1U0EA 3DHNA 3WGMA 4NXNB 2R6CA 3CZ5A 1GUFA 3CR3C 4OHMA 2JJ1A 2YJZA 3NRJA 1DI0A 2EDCA 1KXJA 2GVNA 4IQFA 5AOBA 3OQHA 2YOFA 3FNEA 3ON5A 2JBAB 3RABA 3TW0A 3JZAA 3ZLTA 4AJ4A 4KFUA 2ZYSA 3CPJB 3AB7A 4B35A 3RADC 1W4ZA 2J3HA 3MTJA 4IG9A 4WJLA 3HBMA 3M4JA 3V9PA 5JMWA 2ONJA 5FQNA 4YQZA 1Z5GA 1QHIA 3KQQA 3TMYA 1G1MA 1IXYA 2RK4A 1QIKA 1PR9A 1ZOLA 2IP4A 2QTZA 3DTTA 4AP9A 5IXSA 3GLTA 3Q3EA 2VRNA 5HJ5A 1B8PA 3L4BA 3BBLA 1V4NA 5ALKA 2RC6A 5IAOA 4IDDA 2RHTA 1MAVA 3DFZA 2YYAA 3MW8A 5I4BA 4M0CA 621PA 4GX0A 1VP9A 5AVTA 3PXUA 4RLSA 1TJPB 3NTRA 4UTXA 4RDXA 4F4JA 3KKKA 2GYWA 3LAWA 5CHEA 4UU0A 1VKJA 5KO2A 5JTUA 1K88A 1VYVA 3VJLA 2L69A 4BQSA 3FCOA 2P9HA 5BRAA 4I6EA 1XZMA 1L5LA 3DLTA 5G3YA 2XZDA 5T4EA 3UICA 5K20A 4RY9A 2ZSHA 1FW8A 3DMNA 4MI3A 1OT3A 4MB6A 3VHXB 5ALIA 5HFJA 1PFYA 3LLCA 4GYYA 5AVVA 1CZOA 1I0LA 3PFNA 4CKZA 1KDTA 1U8AA 3N2KA 2L17A 4WLNA 2VZEA 2AFIB 3QYJA 2XTMA 2YJ3A 3KKLA 1DDGA 5KOJB 5LCXA 2LCQA 2Q1YA 4NXMB 1DKQA 4AFNA 3B7GA 3WRWA 3F1KA 2QP3A 1FUKA 1XVLA 1ZMRA 4JC0A 3H2YA 5AM3A 1WLSA 3OY7A 1KHTA 4P3PA 3ZHYA 1N25A 4ROTA 4KI0A 3A1CA 1JSRA 2AG6A 1Z4QA 2JFWA 4KQFA 1UWLA 4BZQA 5DNWA 2A2ZA 5JJIA 3P4XA 5B2EA 2CUNA 1M6YA 1P1HA 2QUHA 5K0JA 1NX9A 1I5OA 1RXCA 5J9FA 3O7WA 1HWYA 2V5UA 4JKIA 1E3JA 4PZAA 4KUGA 4DM4A 4FWIB 4LE2A 3ZLJA 3RVDA 3LQ1A 3UQYS 1IFXA 1SXJD 4Q9DA 2JIBA 3EXEB 5BN4A 3T5MA 5J2UA 4A0RA 1X39A 1MO3A 2XA2A 4V2UA 5BNFA 3UGTA 1BWRA 1ADGA 2I87A 3HU2A 1X3LA 4QAJA 1DAHA 3TIVA 2HPZA 1UOEA 2ICAA 3DKIA 4I4TB 3CLUD 1QRUA 1M2KA 4ICIA 2XAUA 4US0R 5FH9A 1CD5A 3KUXA 4BX2A 2H1FA 1NVDA 2BDUA 4RZ2A 3TX2A 2XVMA 3CMCO 4MGYR 3MB8A 3LVBA 4NV3A 3ZW9A 3I39X 2W2VA 1KI7A 5C4IA 1ANKA 3DEAA 4BFLA 5HK9A 1JIVA 4L0CA 3U61B 3HDTA 4LF4B 4ALMA 1VTKA 2GKOA 3LH5A 2J5XA 2OCPA 2IZ5A 3HI6A 4YP9A 2HD4A 1NSYA 1R66A 2HDOA 4E30A 5AW2A 2Q5EA 1VYHA 3C74A 2GZDA 3OQVA 4J1NA 2XCSB 5CX1A 3ZWNA 3RUFA 2OGTA 1SQFA 1F7UA 1TJNA 2XHZA 1E5QA 1VFNA 3HJTA 1IJEA 4BTEA 2CNOA 5JSQA 4WEQA 3DCJA 3IUQA 4RA9B 1MGOA 5FLEX 4WMLA 1LLDA 2B2XA 4ARUA 2AQIA 1W88B 8OHMA 3ODGA 1RM5A 1N1EA 2COUA 3CZ9A 3L4JA 1KU0A 1VSVA 4HR7A 4K40A 4WUVA 3RSQA 1J8FA 3WDLA 2PWBA 4QG3A 1CDEA 4PCVA 4CM4B 2Y0BA 2YRXA 3QE4A 4JT4A 4ND4A 3S2UA 1E3WA 1KJQA 1ORDA 3ZV3A 3EPKA 1VMAA 1LF0A 2MSWA 2R6JA 3DWIA 3P32A 4FGWA 3SEZA 3KHTA 1Z5PA 4G0XA 2ZIXB 4GX2A 2YXLA 4QPDA 1EH5A 1R9JA 3PYXA 4Q3OA 3TUJC 2C5GA 3G7SA 3DT8A 3KJXA 1G3UA 4G4SP 5COBA 1JRLA 2W6MA 5EXSA 3W8FA 2VF5X 3T6KA 4AG5A 5JZSA 3BOSA 3NM6B 1XAGA 1IY9A 2GZ1A 3G9ZA 5JJLA 5F3RA 4QOHA 5A4JA 2BP7A 5AO9A 3LZ6A 2NVBA 5JWHA 2Y0EA 1YU6A 1IIBA 3BJRA 3VKWA 4BEJA 1OAAA 3DEHA 1LQUA 4B3BA 3U49A 2OO5C 2L19A 1XTTA 3LWBA 4PSVA 4D45A 1QTIA 3B3FA 1Q17A 1YASA 2RIPA 1M6HA 2QB5A 5CRIA 2IH2A 2YUTA 4FE4A 5HDQA 2C61A 2QTLA 3WGLA 3U4QA 3VTKA 4RC9A 4PNHA 1O03A 4DM3A 5JQGB 3TNDA 1GZVA 1X7HA 2QLTA 3ODPA 4EW2A 2CL0X 1MCZA 5I6DA 1H2FA 5CD1A 4IJQA 4CL3A 1WUKS 2JVIA 2J9GA 1FLDA 4QO8A 3C3JA 3R44A 4C5BA 3GW8A 2YJNA 2QYTA 2OSBA 3AI2A 3N0WA 4LHWA 3UMYA 2HO4A 2R97A 2XNJA 5KNCH 2WA1A 2J9FA 1NDUA 1R6TA 4JP8A 3ZTTA 5JXHA 2YFYA 3BGIA 1T2FA 3GJ6A 4UPDA 3AF5A 2YHSA 2B82A 3FHLA 2NM0A 4IAOA 2CB9A 2XB2A 2N75A 2GEVA 4MQ4A 3VZRA 3WY9A 1GQ2A 4CMGA 1P4JA 2V7WA 4MVJF 3GMSA 4JROA 1HSZA 1M7BA 5IG2A 5EJ8A 4EWLA 4RWEA 4BNJA 1SELA 3L7KA 1IC6A 1QTNA 1SU6A 4OSOA 2FPSA 2D5AA 3KE8A 4YDHB 4B33A 2VH5R 4LUCA 1USWA 4P7FA 2C04A 1LUAA 1Z38A 4P5PA 2HFKA 2XQFA 3QX9A 4Y6LA 4DJTA 5MHTA 2XXAB 3TDKA 2IE8A 3P9IA 4QNMA 3BD9A 3OY2A 5TGDA 3RARA 2HUNA 2OAGA 4D46A 4RTOA 2OCDA 3VPHA 1PQUA 3UGQA 2Z8XA 4F9FA 3SP1A 2QV7A 3DMTA 3PHIA 3VRHA 1UDXA 2QRVB 4KKVA 1QONA 2FX5A 2IHJA 3GAMA 1G17A 1XJ0A 3JYNA 3TBHA 4E46A 3UC5A 2XX3A 4R4JA 5DTMA 1P5FA 5LQUA 1YT5A 4QOJA 4W1SA 2FN7A 2W5UA 2ZRMA 3L43A 2NP6A 1NV9A 4P0TA 4RULA 3VR0A 3IAM6 1XKQA 3IAM1 4C0XA 2MR6A 3BMQB 3KUKA 1ZM9A 3VUEA 1N0UA 4ZCIA 3A3YA 821PA 1JKJB 1K66A 3N1UA 4JB2A 1KSHA 4N0PA 1J0CA 4OAPA 4QAQA 4Q1VA 3LBYA 1X0VA 2XXBA 1A4RA 2GR9A 1CYDA 2H65A 2V3VA 2QUZA 2HIHA 2VJPA 2WYUA 1QG4A 4Q9AA 3UJPA 2GLTA 3OOYA 5TRTA 2CLCX 4J16C 3I73A 3BEOA 2HU7A 3BE5A 5KKNB 3KD2A 4OFWA 4PFSA 3UA3A 2R65A 2CN1A 1NPTO 3NYWA 3ZD6A 2G25A 2V5VA 2B4QA 4NG5A 3AGQA 1U2GC 4DLUA 1R0ZA 5DNCA 5B3KA 3VO2A 4H08A 3MUFA 3KEGA 4JB3A 4KXYA 3VKUA 4F46A 2H2GA 2HCBA 2H5EA 4EIWA 1UT6A 3EW9A 4DJDC 4MV6A 4ZDJA 3HCBA 5IXYA 1MFPA 2FCRA 4C03A 4RJKA 4FFRA 2ZTMA 1D2GA 4GRAA 2I7DA 1WKBA 1DKRA 2Q1SA 3GRRA 2P8SA 2R87A 3IHTA 4GVLA 5AWFC 5LYJF 1KO8A 3A0UA 5K8IA 3DUWA 1EFDN 3G49A 2QN6A 3RF6A 3FPJA 1E8NA 3PIDA 4JWKA 3ZXUB 1KYYA 3AP3A 3ZGYA 3QG1A 2Y1WA 5L40A 1EFPA 1ZM3A 3QMPA 1LW6E 1V5FA 1DC6A 1J1IA 1U2SA 2A8YA 3AV3A 4OVKA 3HVKA 2HOQA 1JDSA 3A28A 3KAPA 5ERXA 5FI5A 3RUHA 1U9IC 3TXYA 4QYXA 4OHKA 1DBWA 2C2XA 3DD1A 5DHSA 1Y37A 3K96A 1C2TA 4X6UA 1JDVA 1KMMA 5FL3A 2YN0A 1CDOA 4PGHA 5F52A 3AIOA 1XA0A 4II3A 1NX6A 2F1IA 2FPXA 4OHUA 1P31A 3LBIA 4V0RA 1VI2A 1NIPA 2AUMA 4C2TA 1ZIYA 1FDVA 4F5EA 2G0TA 2PUVA 2CFSA 2YMMA 5TS2A 1W4LA 3ZI4A 3V4RA 3HS3A 3EVGA 3L49A 2RH9B 4TVKA 1ZD3A 2PNJA 2B99A 4JT2A 5BYAA 1N0WA 3H6GA 4J91A 3JQ8A 5AKLA 4FEGA 1MX5A 3BWDD 5G02A 1O0BA 3V7NA 3R5XA 4QOSA 2WHXA 2XYPA 4TL6A 4IQ4A 4W9NA 2BGRA 3E48A 1F5NA 3C3CA 1JQEA 3O3MB 3OU2A 3ANYB 2HRCA 3HR8A 4OL0A 3ZZ1A 4HN9A 4D4GA 5KYTA 2QIPA 1CS0B 1D8TA 2WMNB 1ZLYA 1R00A 1LD3A 1G5PA 1ZITA 1QO7A 1LBHA 4KWHA 4PZ9A 3DS8A 4JMPA 4UZFA 2C84A 4XSHA 4Q03A 3RVRA 3UWMA 1V8ZA 3V3TA 3SXPA 3ROFA 2BUBA 4W5HA 3X1DA 4BLOA 2IU4A 4A0SA 4XVCA 4YRPA 2HK6A 4KNWA 1NBME 3FOZA 2R1VB 3AKEA 2IPAB 2WU8A 4KDCA 1PT6A 5F5LA 3ILSA 1DJPA 1VHWA 2FPMA 2R4QA 1JEEA 4K81B 2C2MA 3MCWA 2IU6A 3QLUC 3GN1A 4OREX 3FETA 4RK4A 3KHSA 1NVGA 3A1NA 3T3PB 2YJ4A 4Q3DA 1JWAB 2GA9A 2M32A 5BN1A 1PBTA 2X41A 3HO1A 4G1FA 2Q49A 1CY1A 3LP8A 1R6VA 3N9IA 3ESCA 2QMYA 3P71T 2BZGA 1E62A 4O2BF 2I8LA 5K9ZA 3IEVA 4D9FA 3MAAC 4O33A 4RPLA 2GHRA 3T7RA 1PQPA 3U7JA 2NV0A 4KACA 3SKVA 3GMTA 1OLUB 3IMCA 1UFRA 4MB2A 2X40A 1E1RD 1K9VF 1P5HA 4LFAB 3FFXA 1VMDA 2DQ4A 4QPPA 4JA0A 4ZOCA 1OH5A 3JAWA 4ESEA 4PZCA 2FG5A 2FDRA 2VTVA 4X61A 2MSKA 3U2QA 2VK1A 2OOKA 2OZPA 1CUWA 3WKAA 1OTYA 3T15A 1JHQA 2FRDA 4BNYA 5DMHA 3B2NA 1YFJA 4YRDA 3RU2A 3AHJA 2I3GA 2Y8EA 4WASA 1FRNA 3ZBQA 4BQIA 3U4GA 1UWCA 3A36A 4FD2A 4UMEA 4DLRA 3MJ4A 5B5SA 1IHPA 3T3EA 3A7DA 4IDOA 5CNIA 4DCMA 2JIRA 1GKUB 4DDTA 1M0TA 1ZLXA 5CFQA 1XMXA 2JZNA 5B30A 1QYCA 3A9UA 2XODA 4HAWA 5F77A 5BR1A 3OETA 3H1FA 5I47A 2IL1A 5BURA 1H2ZA 2WUFA 4FU0A 3CISA 4MR9A 4P4TA 2IVFA 3GLGB 3W78A 1R74A 4LWZA 4S1OA 5AMXA 3H9EO 3AB8A 1M1YE 3GRUA 5I9SA 5DCWA 1RTKA 2IC5A 4QGFA 2GEKA 3ZWDA 1L7QA 3K31A 1G2OA 3K4PA 1FQKA 4UDOA 4EZEA 3C4VA 2J07A 1JG6A 1LI4A 1RQ2A 2WTBA 4GGOA 1UPXA 4LC1A 4R5MA 3BRSA 3VFDA 2PH5A 4DCJA 1KZYC 1O6CA 1PGPA 4LOAA 2ZYVX 1I9CA 4KRXA 5KZMB 5F2EA 5L4NA 3WBFA 3UCXA 4B17A 2YH2A 3NTOA 1J42A 5DE3A 1XDDA 1KPIA 3QV1A 4ILEA 2QL6A 4R69A 3HLTA 4XGQA 5D7BA 5CK5A 5AVOA 2G8NA 1AS2A 4TSFD 1JXOA 4EG6A 2F1HA 3UJ7A 4TXHA 1R0WA 4YV0A 3NWJA 1SQ6A 4KFSA 2V1XA 2WINI 4JOQA 2BFMA 3ROGA 1GYRA 3LTNC 3NH6A 1CCWA 3LX5A 5IMBA 4OJQA 4TVBA 4W6QA 2F90A 2VN8A 4O29A 3DZGA 3E1SA 3PVSA 3OM1A 3NDIA 3LUHA 2GYUA 2X58A 3EQ2A 4QUKA 5AJZA 3F74A 3T7KA 3WSVA 2J85A 3FLEA 1DPFA 3LECA 2Y4OA 3HGTA 1GZ7A 1ZK1A 3O75A 4DNXA 4FB4A 5IABA 2QAGA 3F9CA 4IO1A 4FWBA 3ANNA 3G3EA 4CM8A 3TSZA 5JYBA 4TV8A 2ZSBA 3BIOA 5HILA 1PQWA 1E7RA 4QTZA 2G71A 2FPKA 2LR0A 1JDUA 5DT9A 1UK9A 3TQOA 5JXIA 5LOVB 1QG0A 5HOQA 2PX4A 6AT1A 4MGHA 3LNCA 4ZIRB 1RI1A 4B2LA 2W2LD 3EGVA 4KNVA 3VM6A 1GVHA 3O8LA 5LZ5A 1S7CA 4NFLA 4NSNA 1I8TA 1Z4IA 2X9VA 5DULA 1BW9B 1SHZA 2RHOA 3TCNA 5KTPA 2PO5A 1TYEB 3FNBA 3QLJA 2JRCA 3SF0A 3DH0A 2YY6A 2PMFA 2JFGA 2ZE7A 5HFAA 1PFVA 3OZGA 3SQLA 2ZEJA 4NF2A 1U7ZA 2IQIA 2W6CX 4ZAVA 3LCCA 3DXZA 2OENG 5EZQA 5B3JA 1NFFA 2HHJA 2VEOA 1Z73A 4RLQA 4S3MA 3L8CA 3PI7A 1ZC3A 4CZ2A 3KQNA 1KOFA 4RS3A 1E6KA 1SVIA 2QX8A 3H86A 1JAIA 4X7RA 4DNPA 2GMWA 2Y2UA 4MUBA 1NKTA 1LQTA 3UXHA 3WGVA 4QT0A 4W8GA 4URXR 2W6NA 2BBSA 3TWOA 1H1TA 3IOMA 4MDYA 5EHZA 1KEEB 1RHQA 1TZ2A 3TM5A 5KTTA 2BEJA 1IQPA 2EGGA 4JHXA 5FNVA 5H80A 1YL7A 3AOEA 1Y3CE 3CT4A 3OU6A 4ISCA 1B3BA 5KPDA 4RTSA 2NMVA 1MN6A 1RRGA 4YO7A 1QQTA 4AUNA 1VLVA 1CR4A 2PT7A 3T5PA 3FWYA 3MOIA 3ZBUA 3ZW7A 1E96A 2HIGA 4BMNA 4B80A 3ELDA 4LJ4A 5C53B 1P4HA 1X9HA 3HB4X 4TXJA 2JW5A 2XUIA 1JPVA 1S3FA 3HYNA 4FEYA 4K7JA 5FRDA 3SC2B 4QBHA 3H5VA 3QU5A 5I9BA 4F7DA 4LDZA 1STOA 2WAOA 1PJ2A 1Q1GA 4MVJA 1EFVA 1YAJA 2C3UA 3OI7A 3SDBA 4BX8A 1QVRA 5CAEA 3T7AA 2R8ZA 2YJGA 5CD9A 3EG9B 1Y5RA 2ZU0C 5D51S 3OP1A 4TKMA 1HEYA 2ORVA 4HGNA 1GEEA 5DM0A 2OAEA 4AMGA 2H1OA 3D6AA 3OHPA 2RH4A 1YONA 4AYTA 3ONWA 3OQ6A 1WOMA 3CF4G 4MHOA 2NU6B 4BNDB 4CL0A 1GT6A 1MNAA 5FTKA 3TAUA 2VCEA 3PUVA 3RD5A 1T3GA 1JKFA 4ETIA 4IVPA 3NALA 4JLJA 1SUEA 1SU8A 3Q7PA 1TKAA 3GRVA 5CW2A 4CMBA 3QMWA 1T5HX 4C78A 5J4HA 1E99A 3F5FA 2EW2A 3OQBA 2GEJA 5JZVA 4DABA 1FP4A 1T36B 2CFCA 2CLOB 4YLEA 2PGAA 2LCFA 2IY7A 4K6CA 3ELBA 2ZDHA 3S6JA 1HMPA 1A8UA 4MRNA 3HPQA 4D9KA 1BH6A 2H1IA 4M7WA 1FMLA 4TM7A 2QTRA 3A6FA 2C4HA 3ECSA 4CM7A 5JAIA 1RKQA 3IOEA 5DXJA 1RRMA 5FBLB 4FONA 2AJTA 1JG2A 1ZIXA 5BQFA 5JAMA 1ADCA 1ENYA 4HY3A 2RGNC 2J32A 3COJA 4Y6GB 1PV1A 1N2CB 2JH8A 1E1QD 2ERCA 2OEPA 3KG2A 2PKRA 3BILA 3LY9A 4MV9A 5FHQA 3NVMB 2IY8A 1ZUNA 3A3OA 4I3HA 1PZFA 4M1TA 2B6HA 3RYTC 3MWEA 3H11A 3QLTA 1RLTA 2OWEA 1TTHA 3FF1A 2O1EA 2NP7A 1Q1EA 1GITA 2CHGA 2ZVDA 3FOAA 4WERA 2RIRA 1UODA 3A1UA 3T94A 4DV7B 1OC2A 5GM2A 4IJMA 3OMWA 4E2ZA 3LCUA 4RPIA 3TLBA 3SOZA 1P0MA 3WWZA 2VBGA 3BQMB 3IEMA 5KPJA 5ALPA 2B7BA 4UUQA 4DXHA 4B31A 3RS4A 4FB5A 3AR7A 1EU1A 2JGEA 2YXEA 1L5SA 4BQQA 4OB6A 4R2JA 2QF7A 4X00A 5DLEA 5K2OA 2J9ZB 3NANA 4JQZA 2HLDD 4QUDA 3VMFA 4REQB 3WG9A 3EGDA 1M8FA 4RE5A 2NVUB 1CEQA 4I6GA 3A9TA 4EVQA 1B1AA 3MRXA 1KHHA 2QBYB 3DE0X 4A3SA 3IS3A 4P80A 1O54A 1Y34E 3CNHA 4Q3NA 5DIZA 2PLAA 2WVGA 1N0HA 3PT9A 1UMCA 1V9CA 5DHPA 3I9V6 4BO4A 1MG5A 3I9V1 2VNJA 3G8YA 3W5CA 1Z5OA 1J7KA 3A6HA 2XYQA 3NW9A 1L8AA 3KKMA 4QYWA 2WG0A 4ZK2A 1YCDA 2GJ8A 5D2CA 4EF4A 4DSUA 1ABFA 3E15A 1JFTA 1LRJA 2WMDA 3LT0A 3KU4A 3CRW1 3T1QA 4DRXA 3K2BA 3QVJA 5JWOA 2EFGA 3L04A 4CODB 3TTXA 3EBLA 2GJ4A 3LL4A 3PNPA 4KXMA 3TW6A 4F97A 1YRYE 2C8KA 4ZO7A 5G1OA 1Q6ZA 3OEED 3PITA 1I4TD 3SHVA 1NOJA 4HXYA 3HYLA 4NPCA 4UTPA 4ZJPA 2R7AA 4B0PA 2IYQA 3GUYA 1UJCA 1G64A 3FRHA 3GJQA 2Z1DA 3GJ8A 4HAIA 3KR1A 3ZGLA 3ICPA 1VA5A 1VHLA 4PO3X 4R2MA 5B1HA 1U98A 3OTWA 3ZE8A 2W83A 1MAUA 4L3WA 1E79A 4NR0A 4RTNA 3BKWA 4CU5A 2ALJA 3QUTA 3FMOB 3OD5A 4BPRA 3FKSD 4BNTA 3WFIA 4IGFA 5JT1A 4K9NA 1BEUB 2YHIB 3MTGA 3SJ7A 1OSNA 2B8NA 4V0MA 3S40A 1EJBA 3L8DA 1BWQA 1T25A 4YR7A 1VQ1A 4YR9A 3OQNA 5K7SA 5C7YA 5B2ZA 4K8OA 2G0AA 2XQKA 3V4LA 4FQ7A 3MFYA 4KN6A 2CYBA 5IULC 1MZPA 3COZA 3AUKA 1JWBB 3DXFA 3O2QB 3N7UA 1TD9A 2CJWA 3PF8A 2P30A 5BYKA 2WJZB 1Z0JA 3PFKA 2Q28A 3DYIA 4L5AA 3R7WB 1A2QA 2VUHB 4G8CA 1GVNB 2ZZNA 2P91A 5SYNA 4MQLA 4Y2HA 5KWVA 4G65A 3U19A 5DBGA 1PR1A 1NUQA 2YRWA 3T1VA 5KOHB 3I64A 4GDFA 1OFVA 3QF4A 4V24A 3ZW8A 5KCZA 4G2NA 1IUPA 2H2AA 3VZSA 5KYGA 2P6UA 4O2BA 3C5VA 4ZCPA 4QOEA 5ABPA 4KXFB 1BRMA 3PSHA 5I7SA 5B55A 4WCFC 3MXOA 1NXTA 2FWIA 2RGXA 3C70A 3NB0A 4BO7A 4GMGA 1MR3F 5IC4A 4NECA 2I6SA 3AK4A 3CVVA 3PX3A 5AOCA 4PTLA 3SHWA 4BZWA 2DQYA 3LVRE 1TZKA 5E7QA 5K3OA 1IZ9A 2X3FA 1J33A 4I4NA 1I01A 2JGLA 1R12A 1OFUX 1GFWA 3KOZA 1I4WA 3WKDA 5I5EA 2XSZA 1JEYB 1WVGA 1VE5A 2PFGA 2CNDA 4BMOB 4D6PA 5I9LA 2CXSA 2P0YA 3FDZB 3AL2A 4P4SB 2QAIA 2JCGA 4LYJA 4M0KA 4MP3A 4C6RA 2E85A 2VQDA 1NUTA 2WEKA 3CG0A 4B8YA 5IAKA 1L4EA 1N6I