3SK0A

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant dhaa12
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
b'IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEFHHTEVAEEQDHAEAARETFQAFRTADVGRELIIDQNAFIERVLPGGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGALIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
molecule tags Hydrolase
source organism Rhodococcus rhodochrous
publication title Dynamics and hydration explain failed functional transformation in dehalogenase design.
pubmed doi rcsb
total genus 111
structure length 308
sequence length 308
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sk0A00
4I4CA 3D3NA 3F96A 2V97A 4E14A 4RPCA 5DTJA 1JKMA 1QO9A 1WM1A 1YA4A 1AGYA 4U2CA 2VA9A 4C87A 1AUOA 4L3WA 3H2IA 1BU8A 4KR0A 5K3FA 4D9JA 1FFAA 3MUOA 4UBIA 5ALJA 2RHWA 4FKBA 4QEKA 3G9TA 4I3FA 1R1DA 1LPSA 1WCYA 1ZI8A 5HF6A 2WQZA 4EY5A 3BDVA 1UOOA 3H2JA 1T4MA 1Q83A 2WJ4A 1ZJ5A 2QOEA 3DNMA 4H7DA 4ZI5A 3D4LA 2C0PA 5ESRA 1JJFA 3HZOA 1F8UA 3C6YA 1VE7A 4E46A 3BF8A 4B85A 4HVTA 3DKRA 2FJ0A 2WUDA 3R3WA 2XLBA 1EB8A 4H0CA 3HACA 4CIAA 1XRMA 1WHSA 1E89A 4J0GA 2Q0XA 5AKXA 2XQKA 2BFNA 3STWA 1IUOA 4UBNA 3TJMA 1I6WA 3DDUA 3WWDA 1QZ3A 1FSSA 3Q0TA 1SCIA 4EHBA 4LXGA 2IIVA 2Y1KA 2H7CA 1MX9A 1XROA 3V1LA 4MXDA 1CUGA 2AJLI 4DNQA 4AB1A 3E0XA 2WJ6A 2OLEA 3FNBA 1CUBA 2C0QA 3U1TA 4Y9SA 5EHQA 5ALXA 3ILSA 2ZYIA 4E15A 3ESBA 2ZJ6A 4CIBA 1DWPA 3GROA 3WJ1A 1W4LA 1EI9A 2I3DA 3LIPA 4CCYB 3WK9A 2HA3A 2LIPA 2JGLA 3KWFA 4X97A 2PUJA 2DFPA 5SYNA 4XWGA 4QE3A 3ZLVA 1CVLA 3NOXA 3R3VA 4FLEA 5IVHA 5HK9A 2HHAA 4AMYA 4EY4A 1VXRA 1LPMA 3ICWA 4FHZA 4QNNA 4UFPA 4AO8A 3G0GA 3I1YA 5ALUA 2WM2A 2WIDA 4O08A 1JI3A 3HLKA 3WWPA 1GPNA 4GLBA 3DLTA 3NWOA 4X6XA 4X95A 3TRDA 2Y6UA 4K5QA 5AK6A 1NU8A 1F0PA 4LXHA 2RAUA 5E4JA 3F98A 4F21A 2WTNA 5AOAA 3FOBA 2DHCA 4F0JA 1DQYA 5FP0A 3QMMA 5K3EA 3AZQA 3FVRA 2PL5A 2EDCA 2GBIA 4TGLA 2OAGA 2VJAA 1AC5A 1VA4A 3HJUA 5CXUA 2ACKA 3STTA 4GECA 4M0FA 1SCKA 5A71A 2Y6VA 4J0KA 5CBKA 5A6VA 4B0OA 3HEAA 3V48A 3FWHA 3T4UA 1M33A 2B61A 4FFVA 2XMGA 3QPDA 2WJ3A 3C45A 3CN9A 3OC0A 3H19A 3FYUB 2GZSA 3L1JA 1ORWA 5ALYA 3WLAA 3S2ZA 5AI0A 5AOCA 4ZGBA 4U2DA 1GGVA 1ETHA 1ZIYA 2ZSHA 2VTVA 2XMQA 4P93A 1UKAA 2JEYA 2WG0A 3A6ZA 1K4YA 3OM8A 5ALTA 3VJLA 1CUCA 1CIJA 3GA7A 4U2BA 3R3UA 3G9UA 1OCEA 4FLFA 3X3HA 3PE6A 4BC1A 3R0VA 3WZLA 1VZ2A 3UUFA 1QFSA 1J1IA 2HA0A 2OPHA 1GXSA 4GXNA 1VE6A 3OURA 1EH5A 3UUEA 3AZPA 4HZGA 4FOLA 3D2BA 4KAAA 4H7EA 3KXPA 4KE9A 3PFBA 2PBLA 3IDAA 4Y7DA 2WILA 1GT6A 4C6HA 5LKAA 2XE4A 5CT4A 2PU5A 2QJRA 5HKBA 1THTA 1EINA 3UMJA 4BCBA 3A2LA 5HCUA 2CUTA 2ZVDA 1RYYA 4INZA 2CEKA 2DQZA 1EVEA 5LZ4A 4LHEA 4QLOA 1BCSA 1W1IA 4FWBA 4Y2UA 3WA7A 5AI4A 1AQLA 4Q3OA 1L7AA 2VF2A 4G9GA 3V1NA 3WKBA 2QS9A 4A5SA 4KYVA 4W9RA 1G66A 4JNCA 3SX4A 1TIBA 3IUJA 3VVLA 3EBLA 3H0CA 2JF0A 3B5EA 2WHQA 5BWCA 4UHDA 3W05A 2WFLB 4C89A 3BL8A 3IUQA 4BBZA 4F60A 4PV7A 5JZBA 1BRTA 1P0PA 4QZVA 1YAJA 5T4FA 1BEZA 2YASA 4IHAA 1JMYA 1ODTC 1ZD2P 5DYYA 2VT6A 3BXPA 1DT3A 3BDIA 5AK4A 4AO6A 1LPBB 4J0IA 4ZRDA 5AK5A 2FJPA 2XT0A 4UBOA 2J3QA 4F5ZA 5CH3A 2EDAA 1OXMA 2JGFA 5JALA 1FFBA 1WB4A 5HKAA 5ALWA 5HZGA 2XUIA 4W63A 3DQZA 3NUZA 4HXEB 2C7BA 3STXA 5K3AA 1IMJA 1X2BA 2PKYX 5AM0A 5E4TA 4BZZA 3HSSA 5D7BA 3ZLUA 4JEIA 3W9UA 1N8SA 1TK3A 5AKHA 5D6OA 4Y2YA 5AKIA 4H77A 2VAXA 4FLMA 3VXKA 5JIBA 1DT5A 2IITA 1MO2A 2J3DA 3H04A 2P8SA 2HU7A 2HA5A 1E8MA 2DHDA 5ALVA 2IX9A 3BIXA 1JU3A 4WFKA 4OPMA 5AKKA 4C4XA 1WB6A 5LYYA 5C8ZA 5FKJA 1QIFA 5ALDA 1TRHA 4X90A 1WHTA 1QTIA 2ZYRA 2GBGA 5EIEA 5IH7A 5DLPA 2WSLA 4MWTA 1J06A 1CUIA 4KE8A 5HF8A 3DCNA 2B4KA 3PF9A 3CXUA 2PX6A 5AH0A 4NZZA 5AM2A 2HIHA 1YA8A 5JD5A 3WK4A 3G0DA 4B83A 1XZJA 4UFNA 5CXXA 5T4EA 3PDCA 5CW2A 1YS2X 1R3DA 5FUMA 1LNSA 1GZ7A 4MEBA 5JAPA 3NGMA 2QTBA 5HFAA 3RARA 1ZICA 4Q82A 2YH2A 1HL7A 1L7RA 1R88A 3HRHA 1CRLA 4QDZA 4Y2TA 1VJ5A 3DD5A 1G42A 5AI6A 3LIIA 3TGLA 1IZ8A 2JGIA 1ZGCA 4GEGA 4MJ3A 1XQVA 5T4HA 2G63A 4G4JA 5IVIA 1XRQA 3STUA 2XUAA 3E3AA 1L7QA 2J4FA 4UPDA 5AKLA 5FDFA 1DX6A 3RLIA 4WFIA 5ALZA 3WYNA 1BEEA 4LYEA 1AMNA 4K6GA 1BE0A 5EIAA 2X76A 5SYMA 3OG9A 4EY6A 2DCMA 1LPOA 1CUUA 4U2GA 2VJDA 2AXEA 5A7FA 2WLSA 1DWQA 3WL6A 2QM0A 5ALLA 1XRLA 4N5HX 3VDXA 3C70A 5JD4A 1B6GA 1QIDA 4L0CA 3I1IA 3HYSA 5AICA 4X3CA 2PSEA 3V1KA 2WFZA 3VJKA 2OCGA 3DS8A 3D2CA 3O0DA 4EY7A 3OOSA 1N1MA 2QRUA 2H1IA 2HRQA 3FLEA 5CH8A 3ED1A 1EB9A 4W1SA 4DSZA 2QKYA 4WY8A 2OGSA 3C8HA 3WK8A 5J3JA 4AO7A 1HPLA 3C6XA 3C87A 1CEXA 1XRRA 1XQYA 3WMRA 4AZ3A 1UZAA 1FFDA 1HLGA 3WWOA 2FUKA 2XQIA 3B12A 3BJMA 1YCDA 2WHPA 2BAGA 2O2IA 5DWDA 5FPPA 2RHTA 2VQ6A 1XLUA 1XLWA 3I28A 4UBJA 1ISPA 4V2IA 3PF8A 5JASA 4ARAA 2WFLA 7YASA 5DJ5A 3R41A 1JU4A 2CJPA 3AIKA 4OSEA 3QBJA 2AJCA 4H18A 3H18A 3ANTA 1U2EA 3AIMA 4MQMA 1ZIXA 3I2JA 3SWWA 1SC9A 1A88A 1J07A 1MAAA 4PF1A 4QDUA 4YPVA 1CR6A 2HM7A 1E8NA 5AM3A 4J7AA 4YK7A 4B6GA 3O4IA 4DNOA 5FOQA 5CT9A 5HK8A 1QOZA 1DQZA 4FBLA 4OB6A 2OQIA 5ISMA 4KRYA 1A7UA 5ALOA 4YASA 2WG1A 4BRSA 1EXWA 2K2QB 1EK1A 2HRRA 3BE8A 5EGNA 4AMZA 3W9BA 5AKEA 4Q1VA 2QT9A 5BOVA 1HKHA 3HI4A 5I8PA 4HRYA 4BDTA 4H35A 1VZ3A 1HQDA 4JYPA 2W6CX 2WTMA 1FFEA 3WJ2A 4UBMA 2H7YA 3STYA 1XFDA 4Y2RA 1XKLA 3G0BA 3VKFA 1CQZA 1MU0A 4OB7A 1XQWA 2HFKA 4W1QA 1DWOA 2G5PA 3O4GA 2BJHA 1G4HA 3R40A 1JT2A 1RP1A 3M82A 3O95A 4N8SA 1U65A 3KSRA 1S8OA 2Z3ZA 2I78A 4FMPA 1LPPA 1CV2A 1DX4A 4BYMA 2BCEA 2XQFA 3F97A 1YR2A 4HTAA 1LBTA 2DSNA 2V98A 5DYTA 4GDMA 4EB0A 3IVMA 3PUHA 1QE3A 2BUCA 4BB0A 2JEZA 4RNCA 4OYYA 3WA6A 4X6YA 2XUQA 2E3JA 4ITVA 1KEZA 2HADA 1GQSA 3W04A 2DQYA 4WDRA 3MUNA 4JH0A 3DEAA 3EQ8A 4B7ZA 5KWJA 2CKMA 2XB6A 3LLCA 3MGAA 2JBWA 4EUSA 2O7RA 3GELA 1WB5A 2CMFA 2J4CA 3WKDA 5FRDA 3L1IA 5AM4A 4J0DA 4WY5A 1AKNA 3DJYA 1HBJA 4FTWA 2XMDA 5H3HA 3KOOA 2XUFA 1U8EA 1IZ7A 2CBGA 2QUAA 2WHPB 3OTQA 4GWLA 1W76A 4UBKA 1FJ2A 5ALKA 1H2XA 3IA2A 2B20A 4E11A 1GPLA 4KJXA 4G8BA 4LKOA 3QYJA 2AJ8A 2D0DA 5YASA 2PM8A 5HQ3A 2GYUA 2ZSIA 2OG1A 5FV4A 2G4LA 4CI9A 1CUHA 1DINA 4H7KA 3DYVA 4H7IA 3IUMA 2HA6A 4DSAA 1SOMA 2PSHA 3HC7A 3GUUA 1P0MA 3M83A 1TQHA 1W6RA 2V96A 4J0CA 1XZIA 4Q3KA 5LZ5A 2HFJA 1ODCA 1TKRA 4UUQA 4B9EA 1C7JA 5AKZA 1MNQA 5CT6A 4IH9A 4LXIA 1ODSA 1EDBA 3KD2A 4RE6A 3A70A 2ES4A 2VJBA 1LBSA 3F8SA 4ZREA 3FCXA 5JARA 4U2FA 3AIOA 4UBLA 1KU6A 5C8XA 1ORVA 3WWEA 4CG1A 2QXTA 4X00A 4CCWA 1QIMA 3W2TA 4BVLA 3SK0A 1ZGBA 3YASA 4CG3A 2RI6A 3H2HA 1H2WA 2I3ZA 1UOQA 3ZV7A 1CUVA 4BVKA 3WL8A 1EHYA 1YB6A 3FCYA 1NX9A 2QR5A 2ROQA 2V9ZA 3FYUC 1CLEA 2XUHA 2CZQA 3D2AA 1XZEA 5IVKA 6YASA 3R3ZA 4NVRA 1QIHA 4WDQA 3F67A 4ROTA 2QZPA 3H2KA 4OU4A 3AILA 1X2EA 3ESCA 2OCKA 4AN0A 2HU8A 2ECFA 2C5FA 4G4GA 3I2GA 1XRPA 4CFSA 3JYHA 5FXMA 3LP5A 2XMRA 5IVDA 1SCQA 5JZ9A 3QMWA 4GHWA 4NS4A 4JYMA 5KWIA 1UXOA 4BE9A 4G8CA 3MVEA 1JFRA 3BWXA 4N5IX 4HRXA 3ZWQA 4IQ4A 1CUWA 1XKTA 1X70A 5K3FB 3AZOA 3HABA 1UWCA 3IULA 4GBGA 5LP1A 4CG2A 3OPMA 2XMSA 4MYSA 2GZRA 1A8QA 4MQLA 1THGA 4QDXA 4L72A 4KE7A 4MWSA 2QXUA 4Y2VA 1A8SA 2WIGA 5F4ZA 3WQHA 1QONA 4GW3A 2NW6A 5KREA 1CUJA 4GI1A 5A2GA 3C8DA 3KDAA 5CURA 2ORYA 3CCCA 1MPXA 1ZI9A 1R9NA 5A7GA 3EQ9A 4BTVA 4KAFA 4X7BA 4PNZA 3L1HA 4Q34A 3ZI7A 2G5TA 4LIPD 3I2FA 1UOPA 4HXGA 1XZFA 4XX1A 1BN6A 1GQRA 1U4NA 4FFWA 1VOTA 3QZUA 2AJDA 4BP9A 2OXEA 3A2MA 3I6MA 4G1FA 3N2ZB 1Q84A 4P9NA 4KE6A 4QA9A 4BCDA 5EFZA 4PO3X 5AJHA 4XIIA 4TVKA 2OAEA 3P2MA 4Z49A 3D5EA 5AKJA 4OCZA 2BKLA 1XZBA 3IIIA 2VEOA 2RIPA 5AM5A 1LPNA 5JATA 3RM3A 1XZDA 1BN7A 2VAVA 2H7XA 5AM1A 2FX5A 3PICA 2OGTA 3FYUA 3I2IA 1Q0RA 3PFCA 5CT8A 3LS2A 2YXPX 1XZAA 4XVCA 4XJVA 1QGED 1AZWA 5DNVA 1ACJA 3SC2A 2VT7A 3H1AA 4BZWA 2QMQA 1MJ5A 3FLBA 4Q3LA 3O4HA 1G5FA 3C43A 1FFCA 2BUAA 1CQWA 5AKGA 4FDMA 4IH1A 1BS9A 3WWCA 1MTZA 3R3XA 3G7NA 5ALHA 1OILA 1XZHA 3STVA 5C7YA 1PJAA 2BGRA 1MNAA 2WU3A 3CN7A 3GZJA 3GFFA 1WPXA 3WI7A 3WK6A 5AI9A 2Z8XA 1LLFA 4DNFA 3QM1A 1LPAB 3A2NA 3C5VA 4LYDA 4P08A 4I19A 4P92A 5JD6A 1N5MA 2VSQA 2PSJA 5LIPA 2WUFA 2C4HA 4OUKX 3D7RA 2PSDA 4OYLA 1XQXA 4BRZA 2XUDA 3ZPXA 2PU7A 5CTAA 2W22A 3AJAA 1E3QA 3RK4A 1BCRA 4K6KA 5AI8A 3WKEA 4X6UA 2OGZA 2WUEA 3WZMA 2JGMA 1EVQA 1QIKA 1CUYA 4G8DA 1AURA 1R4ZA 3FAKA 2XUOA 4BAUA 3QPAA 5JAOA 1YASA 4G5XA 3QMVA 4MYDA 3ZLTA 5ALIA 2PUHA 1MT3A 5K3BA 2O7VA 4DMKA 3H17A 3Q8WA 2R8BA 4Y2PA 4NMWA 5LLSA 3W06A 3D0KA 5JADA 1RWQA 5CMLA 3FYTA 3C5WP 2X5XA 2WKWA 1CUAA 3G0IA 4FBMA 5CT5A 4C4YA 1R50A 2ACEA 1EA5A 3K6KA 4J03A 2VJCA 1TAHA 3IBTA 4QDOA 5K3CA 1QIEA 3WIBA 5DNUA 3QVMA 1LZKA 4B81A 1C7IA 2OCLA 4BVJA 5DYWA 2ZJ7A 1XZCA 3IURA 1XZLA 4PW0A 4G4IA 5EIHA 1Z68A 2XMCA 3V9AA 4DM7A 1CPYA 5A62A 2Y2UA 4G9EA 1C4XA 1EK2A 3LCRA 1UFOA 1VXOA 5EHZA 1BROA 3O4JA 3PI6A 5D3KA 1CUEA 3M81A 4BP8A 1XRNA 1MX5A 1GPKA 1QIJA 3FSGA 5AK3A 3VISA 4B82A 1TCAA 1MX1A 3DYIA 3WK5A 4UHBA 4C4ZA 2HA4A 3V1MA 1UK6A 1P0IA 5HF9A 5AO9A 1YB7A 3K9BA 5LZ2A 4QLAA 3JW8A 4KAJA 4CCYA 2BUBA 2RGUA 1ZI6A 3IB3A 4K2AA 1B41A 4AN1A 3E1GA 1H22A 1Y7IA 3EQ7A 2HL6A 4B80A 5ALSA 2XQGA 1SFRA 5LZ8A 1ACLA 5JAHA 1QO7A 1TCBA 3FBWA 2X8BA 3I2KA 5EHNA 5JANA 3DL4A 4BAZA 5FPQA 5ALNA 3HXKA 2Z3WA 3BF7A 2QVBA 1K8QA 2B9VA 1EDEA 5ALPA 3O9VA 1XZKA 1AX9A 4OU5A 1CUFA 2XMBA 4DIUA 4DMHA 2XQJA 4X94A 1O6GA 1QJ4A 3WYDA 1TCCA 5D3ZA 3N0TA 3K2IA 3JWEA 4UHEA 4PSCA 1R9MA 4DTCA 2C5GA 2ZYSA 2O2GA 1ZD3A 4L9AA 1ZJ4A 3BJRA 3ANSA 1E5TA 1K6EA 5JZSA 4AZ0A 4BATA 1EDDA 1VKHA 1K5PA 4KEAA 1YSCA 5BWBA 4BTLA 4Y2JA 4DMFA 3PUIA 1PFQA 2JIDA 2GYWA 4IH4A 5EHXA 4KACA 4W1PA 5T4BA 3VJMA 3VVMA 1F6WA 3WK7A 3M3DA 5JAUA 3CCBA 5HQ3B 3E4DA 3I6YA 2AJBA 1LZLA 1MN6A 4BC0A 1XZMA 3DL7A 2R11A 4ZV9A 5CH5A 1E66A 2BGNA 1IVYA 5K3DA 5IKXA 3FSGD 4N8DA 4X71A 2D5LA 4H7JA 5AI5A 1QTRA 4ZWNA 1Y7HA 5E2IA 1H23A 3AUKA 4S0XA 5C8VA 4C01A 4H7FA 2HU5A 5BV7A 1VA5A 4OB8A 4BCCA 4IO0A 1KU0A 2XDWA 3ESDA 5FLKA 3B3QA 4Q05A 2H9YA 4QWWA 1D07A 1QIIA 1W52X 4B84A 4EA6A 4M0MA 3DKKA 2Z8ZA 4DLNA 5LZ7A 1USWA 1NU6A 2OCIA 1F0NA 4EY8A 2ONCA 1WOMA 5DTIA 1UK8A 4RE5A 3DOHA 3I6ZA 3G9XA 3GBSA 1CFJA 3H2GA 5ALRA 3RKSA 3DOIA 4ARBA 4Y2SA 1JMKC 1EX9A 4OD0A 3TEJA 4Y2QA 1IUNA 1Q0ZA 1XLVA 4AQDA 4A16A 4X92A 3QH4A 2WFMA 2Y2VA 2ZJFA 4Y2XA 3FLAA 5C81A 3QITA 3AINA 4PSDA 5EI5A 2VATA 4X91A 3FVTA 4YX9A 1XZGA 4B9AA 1ZD5A 2UZ0A 3EF3A 1O6FA 1CUDA 1UT6A 4HXFB 3O9MA 4BAGA 5ALGA 4PQEA 3G9ZA 5A7HA 1W75A 2CB9A 4DMCA 3C6BA 4UHCA 4UFOA 3T52A 2GBCA 5E4YA 4WJLA 2WIKA 3G0CA 1UKBA 1CUSA 2WIJA 2XUKA 2XUGA 1LGYA 2WG2A 4DGQA 5ALFA 3KWJA 4EZIA 2QJWA 4EBBA 4U2EA 1JJIA 4PSUA 2XI4A 4BE4A 4AX4A 4WCVA 2C58A 5HF5A 4FNGA 2WUGA 4ZXFA 3BIWA 2XMZA 1GKKA 1MAHA 2HDWA 2WIFA 5ALEA 3WL7A 4HS9A 1PV1A 3ICVA 4J3JA 5JYCA 2ZYHA 3I2HA 3WIOA 1T2NA 1WPRA 5HFNA 3G02A 4TPKA 4WFJA 3WKCA 1UK9A 2XLCA 5ALQA 2YYSA 1QLWA 3R3YA 2DR0A 2I03A 4KRXA 4DNPA 1UKCA 3S8YA 4UHHA 5AKYA 2DHEA 2XUJA 4J0HA 2JGKA 5LKRA 4B0PA 5AOBA 2GYVA 2HA2A 2PPLA 3WKAA 1A8UA 4RGYA 1ZD4A 4N8EA 4X85A 1UK7A 3AFIA 1CUZA 2EEPA 1J2EA 4FNMA 3U0VA 1CUXA 4JUIA 5DNWA 3D59A 1H2YA 5KBYA 3C6ZA 1QFMA 5AIBA 2Z5GA 2HA7A 4MEAA 5I7UA 1DTEA 4UHFA 1IUPA 4QWMA 4H7HA 4ETWA 3G8YA 2XUPA 4QDTA 2JGJA 5AP9A 1VLQA 3QPCA 1QIGA 4AXBA 1ZOIA 2JGEA 1DU4A 1K63A 1E8DA 3F9CA 3EIOA 3ESAA 4W1RA 1HDEA 1GKLA 3IUNA 4M0EA 2RONA 3H1BA 1P0QA 2OQVA 3WL5A 2QUBA 2PSFA 2WHRA 2GBFA 4ZV7A 2O2HA 4HAIA 4X93A 1N5RA 1JJBA 5K5EA 1H2ZA 5I9IA 5CRIA 1Y37A 4DYHA 4A23A 1YS1X 2WU4A 5AHXA 4J0JA 4BDSA 4K6HA 5AIAA 5ALMA 2PVSA 5LZ9A 1YAHA 4C88A
chains in the Genus database with same CATH superfamily
2AFVA 1GQFA 2FW6A 3OFND 3DWFA 4I4CA 3FPKA 1DTWB 4XQCA 2YOGA 1KDPA 5DLEA 1L4BA 1GSAA 4PC6A 4PLFA 3A6PC 1VKZA 3BMQB 1CQXA 3NVKI 4WFQA 1RW4A 4KB5A 3U60B 4RPCA 1DC5A 2FP4B 2QRMA 4ZO7A 1M73E 4LGYA 1F20A 4WKBA 2RAPA 2A9VA 1U0RA 3P8ZA 2QTTA 3EA4A 2A5DA 4Q15A 4YXFA 5MGBA 3RYCB 1OC4A 5ARCA 3O73A 4QVKA 4ZEVA 1F0KA 2QMOA 2XYHA 2YVUA 3PA8A 3ABZA 4KPGA 4MUBA 4KU4A 1A9SA 4L3WA 3W8NA 1C29B 4MLDA 4Q12A 1I14A 5HGXA 5MDHA 5K3FA 3WO0A 4ALLA 3SQMA 5AD1A 1O6ZA 1B4DA 2PBFA 3WTBA 5M34A 1SUBA 1NXTA 1NBHA 1MD9A 1RMQA 5DW0A 3RSHA 4D9EA 3L41A 4HDQB 3H8WA 4XXHA 3UK2A 3LNCA 4Y30A 1ZI8A 2D59A 3DVLA 4RTLA 3T7SA 2WQZA 4WADA 4GR4A 4EY5A 3MLAA 5JMOA 4JJ6A 1AS0A 1T4MA 1YR9A 1Q83A 2WJ4A 1WY5A 1ZJ5A 4IMIB 4NNOA 4OIMA 4FMDF 5FORA 4ZI5A 4JJEA 3C3JA 1Y8QA 3D4LA 4PLHA 4YAGA 2E18A 2WKQA 7ABPA 4Z9FA 4Q18A 2GXAA 1NYLA 3HZOA 4WXMA 1IDOA 1XN4A 1JVNA 1I0LA 1P4SA 2Q49A 3TD9A 4O2LA 3W2EA 4B3RB 2C0CA 3M6VA 5EUMA 1X8LA 4L1KA 4CG0A 4B85A 1YDEA 4HVTA 4WZAE 4CF4A 1QR2A 2FJ0A 1FRNA 3H8VA 3R3WA 1IBLB 3V4OA 2OP1A 3IKMB 4DUYB 2J09A 1OMOA 3CRZA 2YJZA 2QXYA 3P27A 1XRMA 4CIAA 2CLMB 3BZBA 3AKEA 4LRYA 1ENZA 2Q3JA 4EGSA 1NJSA 4HS4A 1ECJA 3AU8A 2IW1A 2YJ5A 4ERXA 5INTA 1VE5A 1FS4A 2AN4A 3R2JA 4PXYA 4JYAB 3AEKA 1F48A 1QF9A 2JRLA 2AFHA 2JJYA 2OV6A 3IEPA 2UYHA 5HUJA 3AL3A 1XG5A 2BFNA 1SHZA 1RCFA 2XQKA 3HI6A 3PWSA 4UULA 4XYMA 3O31A 5AHOA 4YUWA 4UBNA 1U9IC 1GNVA 4XUDA 1WDTA 3L0SA 3L43A 4Q03A 4R2KA 1TYEB 2F64A 2ZBUA 1UXKA 2OHJA 1U04A 3TJMA 5A4IS 1L4KA 3D8SA 4M9RA 3AVPA 3DTVA 3QG1A 5AOVA 3D02A 5ED4A 2YHBA 1W0CA 1QZ3A 2I4LA 4N5DA 4V38A 1FSSA 3GCZA 3DZBA 1QSGA 1TXGA 3NIGB 1U2TA 1ILWA 4WK4B 3VMMA 1EZ4A 1SCIA 1CVRA 4DCTA 1Y5RA 2ONZA 2Y1KA 3KOMA 4JEHA 3F6BX 4AW9A 1XROA 2CFCA 4H0NA 4RF2A 3NETA 4G5HA 1FBNA 5KSOA 1S3GA 2R62A 1JEDA 4MRRA 4AB1A 3I52A 4GM0A 1KY4A 1RPNA 4P35A 1RBMA 2I66A 3FHTA 4F91B 1DO0A 1USGA 5CK5A 1KDYA 1OIWA 3LOUA 4FCCA 3FPHA 1OHHD 2X9LA 2FMTA 1Z4NA 3INNA 3U1TA 2CJXA 2JJQA 1D4ZA 3NW9A 3UMVA 1GPJA 1T10A 4F4HA 5JQGF 3GGCA 1WF3A 1PWZA 1DSSG 4D5EA 3PFKA 5A9SB 1ORIA 3ILSA 2HK9A 2ATVA 3GGJA 3K9GA 4LSWA 1YF3A 1GG9A 4IIYA 4E15A 2W90A 2WM9B 4YMUA 3EMBA 1U2SA 3RLFA 2GN2A 3C3KA 1I0IA 4BUCA 3L8EA 4G0MA 4AAYA 2WMYA 3AR9A 4DCGA 4ALNA 4I8DA 5K6AA 3AF6A 1B8PA 1JFFA 4BJ1A 3WBBA 4LVCA 1QH1A 5FUBA 1W4LA 4Z9YA 2DXIA 1EI9A 3E9ZA 1O97D 1V9LA 3PQ2A 5DCYA 3UT5A 2RG7A 3RVSA 2HCJB 4C6RA 5KTSA 2GUGA 5KNBA 2EFEB 3NRCA 5D7NA 4ZGWA 4PS0A 5TGZA 3QU7A 1JEYA 1ECCA 1Q2XA 2PMDA 4KJZA 2C5SA 5G3ZA 2PUJA 1FXWA 4IPTA 5SYNA 1HI9A 2G9VA 5TJ9A 3ZHVA 4K0KB 4QE3A 2DPYA 3JVIA 4LISA 1CZLA 4MTCA 5BSRA 4A15A 5ISMA 5I7WA 5EIWA 2WTAA 3NOXA 1NF3A 5CVJA 4FLEA 2CVOA 1VSBA 3AP3A 1E5QA 2I4RA 3VU0A 5HK9A 3ET5A 2R97A 1E2EA 1U0GA 4KZPA 2PZLA 4EY4A 1RZUA 3RU3A 5AJWA 1I4LD 1W2HA 4S1VA 1VYVA 3WIDA 2J9ZB 3QTLA 4ZK6A 1P77A 3ICWA 4DDHA 4QNNA 5JS1A 3HN6A 3TIVA 4UFPA 1RHMA 1DG3A 2I4MA 3DYBA 4LF6B 3ACCA 1CR0A 2I29A 1KNQA 1D9ZA 2LBPA 2WIDA 4O08A 4TS1A 1KK1A 1LH0A 1UBNA 3HLKA 4L0MA 2CXUA 1I51A 3FR8A 3PVSA 3M33A 2VJPA 5JRZA 1EFKA 3NWOA 1GKUB 4GI3A 4HGNA 1UAAA 3QJYA 2Y6UA 4K5QA 1X7GA 1F0PA 4EFDA 2W2LD 1OT3A 1JWLA 1Y9DA 2RAUA 2P4SA 1SBQA 2EP5A 2OBBA 2QTCA 2D8AA 2ZUUA 3CPEA 3FNRA 3JD0A 4H6WA 5C1DA 5JXWA 2YWCA 1YO6A 4H16A 3W34A 1PDVA 4YAOA 3JR7A 3L01A 1VG0B 1J4AA 4TYNA 5EP1A 1CEEA 2FU5C 1TM5E 1Y4ZA 4BMOB 5JAMA 3Q8LA 1MVLA 3TQCA 4BWYA 4F0JA 1IAVA 1U0OC 3IOYA 4ZVMA 4ECEA 1DQYA 5FP0A 5K3EA 1U9JA 1DOHA 4ENUA 3JQPA 3R7LA 5H0IA 4Z4CA 1W48A 4II7A 4ATNA 1PWEA 4AI6A 3UQYS 1YZ3A 3LYAA 3PUWA 1KQFA 3SSOA 3N8IA 1AC5A 4PAWA 13PKA 4TS4A 1XQ6A 4RU1A 1XNGA 3DQQA 3JWPA 2B37A 4F2DA 3L06A 3TQHA 4CLRB 1VA4A 3FAZA 3L04A 3WYCA 1B14A 4J2TA 5CXUA 3GEHA 2D7JA 2WZBA 5BQXA 3OU2A 3RH0A 5FPYA 2GJ9A 3GVXA 3ELYA 1EK5A 3HPRA 4F2HA 1US8A 5SY4A 4OQPA 5A71A 5GTDA 2Z6QA 3E5RA 4P7JA 4Q9KA 1B8NA 1KQ3A 4ZVLA 3C1UA 5A6VA 4JVMA 5AXCA 1OBOA 4D0LB 2O2JA 4RK5A 2P2DA 1EGAA 4U63A 5I9NA 1Z39A 4BFXA 3RSQA 3K9CA 1QOPB 4A5OA 2ZBQA 1JG4A 3FWHA 3V48A 4RDIA 2B61A 1W9HA 3I0NA 4FFVA 4CV1A 4Z7JA 1VDZA 5DBHX 1H5NA 4PX9A 1R5JA 3LXUX 4E4RA 1XP8A 2C3PA 3VYUB 2C5AA 1O1YA 3FB1A 2FG7C 1NLMA 3NWBA 4MQUA 4WERA 5J5CA 3C45A 1E6MA 1ONBA 3OC0A 3GFGA 1Y6QA 5AK0A 3FYUB 4BNZA 4WLNA 1A04A 2AWOA 4B7XA 3MF4A 4KNYA 5ALYA 1AKTA 2BGUA 2CBXA 2RARA 2VRBA 3NHJA 5AXBA 1EAMA 1LV8A 4RVSA 3MWJA 4GSYA 4TYMA 1IM2A 4KWIA 2Z2JA 3QKIA 5DGHA 5ICSA 5G4LA 3UM9A 5KYYA 1O7JA 3EHEA 1ISHA 1GGVA 5AHRA 3I62A 1ETHA 2VCEA 4HAYA 5JEDA 2PUWA 3AIIA 3QG5A 5DLQC 1PT6A 1XN1A 3TL6A 2VTEA 3NTRA 4LZAA 3V7YA 5T3UA 4ZEOA 4CEHA 1KZYC 1IY8A 4GYKA 3U9TA 1YZVA 4D9MA 1DKQA 2JFQA 4P93A 3T0GA 4J1TC 1E7QA 1IHUA 1T2VA 2KLHA 2QD2A 3IJPA 2XDQA 3A6ZA 5DCLA 4DJFC 3CZPA 1KI8A 1N57A 1P61B 4M1TA 4F96A 2PWBA 4MV7A 4YRIA 4BQQA 1Q5PA 4XWKA 1HV8A 2WSSD 4RMJA 5F5XA 3GV0A 5FJIA 3GA5A 3O8DA 4HDSA 1P73A 1E7YA 4FEYA 1T0UA 1XAHA 1US8B 1Z4QA 2DVMA 3SR0A 5J4YA 1KIMA 2JCSA 5CA1A 2W43A 4MVJD 3KAKA 2R66A 3QU5A 3DXZA 2O8FB 4KQXA 2NSJA 3KDSE 4JYBA 2BP7A 1MO5A 2GN0A 2WNSA 1DAPA 5BUCA 2ZU6A 3VC2A 1JA9A 1L5KA 3AYZB 4XYEA 3ROZA 4DA9A 1R4NB 3KSZO 2IH4A 1IY1A 4WPGA 3IPAA 4EKIA 1MOSA 2V45A 5B7PA 3T5MA 4E94A 1JBKA 3ZU3A 1K7YA 3V42A 4CETA 1N25A 1U1EA 2FR8A 2VKTA 3WFJA 4GXNA 2DYKA 2J7KA 2V3CC 1LKZA 4EKDA 3GR6A 3ZHQA 4NCXA 4MRAA 1SC1A 3FKJA 5CJJA 2JLRA 3O2NA 2QSUA 1QQBA 4EELA 1LSSA 4D92A 4L2IA 4ENQA 5IF3A 2A14A 1LJ8A 3CBGA 4UASA 4YRJA 1UQRA 3O1IC 1NT4A 4ZMSA 2HTEA 2G40A 3PYXA 2O7QA 3AR2A 3DTVD 2IK8A 3TZEA 3NVAA 2WILA 4KC0A 2H16A 1AN0A 2FEXA 2P1DA 3QUSA 3HA3A 4MINA 1FFYA 4P32A 3QU9A 1Y98A 2Y05A 5JISA 1M2OB 3KB2A 4KIUA 3KP1A 3W4IA 4AN4A 4BEVA 4YHHB 2V3VA 3N76A 5CT4A 4ZQIA 1P5FA 2H48A 2HREA 4HAUA 5DWVA 3ZQKA 2NZ2A 2L82A 3GEEA 3QEMB 1KAHA 5IM5A 3Q88A 3EF1A 2NZUG 2ETXA 3JQAD 4J7XA 4FYHA 4CQLA 5B2ZA 1P7YA 5JRJA 4XSHA 3ZBQA 1OFHA 2B36A 4AMGA 2CEKA 4HDNB 2JL1A 5T57A 1MORA 3OPVA 3O1HB 5DU2A 2VDUE 4LHEA 4PLGA 4ZP1A 2HC9A 2ZULA 4BIMA 4NTZA 1YWGO 4Y2UA 1E6EA 1EX6A 4UE3S 4MDFA 3LC1O 4N39A 1L1QA 2C2WA 2EBFX 3L6DA 4OYRA 4Y67A 5CVUA 3PDIB 1TUGA 1L7AA 2VF2A 3L2OB 5KNDH 4J6FA 3WKBA 1MRNA 4XD7D 4KYVA 4W9RA 3DXYA 2NXCA 4JNCA 3I1FA 2IUSA 2DUUA 3IUJA 4QEDA 3OKCA 4PYRA 4R54A 3HYTA 3VVLA 3DTYA 3EBLA 3PQEA 4KLNA 3ZIAA 4EFKA 4IDEA 4LGMA 3A37A 5FNVA 3TLZA 5I4CA 5F1KA 1V8FA 2WB2A 3EUWA 1XTUA 4E2YA 1FOEB 3EQ6A 3W05A 1AS2A 4PLPA 1JFFB 1Z63A 3V8PA 1CE8A 5D86A 1G3MA 3FDZA 3M5PA 5ULLA 3DLIA 2XNDA 4BBZA 2I99A 3PZBA 1A5BB 3DDNA 3QENA 1RM5A 3OY2A 2ZWAA 5EWLB 3SNHA 3VO8A 4DLZA 3ZD8A 5I45A 1E2PA 5AVWA 2EX4A 1ZSYA 2FGKA 4RL4A 1YAJA 2JCXA 4FVTA 4JHLA 4BNWA 4FX5A 3LK6A 1V71A 3DVAB 2OBYA 4L3VA 4I4TB 4S04A 4IYJA 1NNUA 1JMYA 2ZCUA 4ZI2A 2AMYA 4I5GA 4REQB 5DX1A 2HEGA 5JROA 4MMXB 2NUTB 3M6MD 1LDNA 2GBPA 3PXCX 3K0FA 4ON9A 1Q3KA 2WF8A 4WBSA 3R23A 4GMHA 4AO6A 1NONA 5TT0A 5CB8A 1TEVA 4DJEC 2WLTA 5HILA 1DAKA 1KQNA 1O87A 2PT5A 2R48A 3NEPX 1HDCA 1IG3A 3BQMB 2XOKD 2FW0A 3RWMB 1YMQA 4LXQA 4HQNA 2ODPA 1LSJA 3W6UA 2A0XA 1RBYA 2VRCD 4ER7A 2R7LA 2HIAA 2EDAA 3R8FA 3B3AA 2Z9CA 1U7OA 5AVQA 4I9GA 1PR1A 5JALA 1FFBA 4C04A 5E7IA 3JZIA 4PPQA 5KMGB 1O6BA 1A2BA 1B3RA 1HA3A 2AZ4A 2YWXA 5CD9A 5ALWA 3ROTA 5DSTA 2XUIA 2I54A 3R5KA 5TQ2B 1QM5A 3STXA 2AF3C 4IDDA 1C2YA 4WY2A 5LVAA 1X2BA 2EC5A 3M0EA 1TM4E 3GO4A 5KINB 3IQXA 5LB4A 2WA1A 2Z98A 4PC1A 3QE9Y 4GMXA 4HYQA 3ZLUA 2D1SA 4JEIA 4I99A 3JAKB 3T3PB 1DE0A 1Y3CE 2PJZA 1KI2A 1QP4A 3UMGA 3OI7A 3CA8A 3QVUA 2XH8A 2HSZA 2GEFA 3X1KA 5D6OA 1ENPA 1SBTA 4RFSB 4WBNF 1EXDA 1BFDA 2QZZA 2Z30A 1B8UA 4RMIA 3GAZA 3V2UA 1B0UA 1NT2A 1S2DA 4FLMA 1K9SA 4HWPA 4IS2A 4RV5A 1USKA 2YNMD 3A9UA 3NHRA 4M76B 5EKDA 4YUVA 1DT5A 1Q7TA 1BQ3A 4KL8S 3CUYA 5CLHA 1MO2A 3PX7A 1H1DA 5DGXA 3VV3A 1YIDA 4MW5A 4AP9A 1V48A 3A7DA 2P8SA 4IOMA 2C4KA 2WYUA 2Q29A 4W7HA 1GLGA 4M7PA 4YJHA 4ES6A 2WEKA 5K0CA 5EWMA 3QYPA 4XQEA 2X8JA 4IDCA 4YJGB 3OEWA 1GL7A 3UA4A 1I32A 4O2BA 4IQ8A 3TTWA 4TKVB 3UMCA 1C1DA 2VDLB 3KOWA 3U19A 1WB6A 2V58A 3DXFA 3KZMA 4ZJUA 5C8ZA 2Q7XA 1XTPA 2VYND 1EFRA 3LZDA 4R0VA 4ZU6X 3TSAA 2I6UA 3FMPB 2I7CA 5SYAA 3NU1A 2BFDB 4CV0A 1E0AA 1FDRA 1WR8A 2Z0MA 5KYXB 2V7TA 3U4CA 2HI0A 4WI1A 2EKDA 2HMSA 5EJ8A 3GLGE 2ZYRA 3B60A 3RANA 2GBGA 1NRWA 3CF2A 3MGKA 2LCIA 1FDWA 1WUHS 2E9SA 1O9GA 2D62A 3FUCA 4PZ9A 2B4TO 3E81A 3IP8A 4WXPA 4EHLA 4MWTA 4QELA 5EE5B 2P69A 3E3MA 2F59A 3LU1A 2X5KO 2B4KA 4IW3B 5DLYA 5JCJA 3U7JA 3SJZA 2IS6A 4AJ4A 4R9UC 3ZWPA 3L4JA 1XVTA 4P86A 3VC1A 3DB1A 4ZOBA 2LCFA 1B42A 3PRJA 4J2OA 1NQ5A 4NZZA 4EL0A 4G5GA 1C9YA 3NHKA 4BO5A 3D8RA 3DL0A 2EWVA 2HSGA 2MYNA 2PMFA 3E9CA 4PGMA 4WCFB 1PX2A 5TR9A 2AOVA 2GZ3A 1PGNA 2PD4A 2CYCA 4HFRA 1TO2E 2VPPA 3DO8A 5CXXA 4IDNA 4ND8B 1AHHA 3L8DA 5CIWA 4CKYA 1YZFA 1QKJA 2HLHA 2VR1A 1KOGA 1ILEA 1YJCA 3DLPX 4L4XA 5EIOA 3K20A 5KI6A 1NUPA 2IE8A 2LP4Y 4Q19A 4ILEA 2FPGB 3JD2A 3NXKA 3TTVA 3TUIC 3E5NA 3SYTA 2O0HA 2FE4A 1OGIA 4KQ9A 4MB0A 3UAWA 3ENZA 3KPVA 2DQ4A 3MSCA 1R0BA 4IDAA 4IVQA 3Q10A 3A32A 3UFXA 1V7QA 1QX4A 3CZCA 4Y9DA 3BA6A 3AHGA 3X1ZA 4Q82A 4GPZA 4YY3B 3ADDA 2DLDA 2QI9F 2AOTB 5LN1A 3I45A 3I04M 4XKJA 3TZQA 4U8GA 1L5VA 1MMFB 4Y2TA 5K0LA 3ZYCA 2IZ0A 3CEPB 2QN8A 3ICPA 1NDQA 3L6UA 1RACA 1L9KA 3LCVB 1BXGB 4L28A 3RF7A 4LPSA 5AI6A 4BLTA 4QGHA 2JI9A 1Z9BA 5H81A 5B58T 1J42A 2ZSBA 4HNSA 1QV6A 3CONA 4MPPA 2JGIA 4Q9AA 1EK6A 4W5RA 3RW9A 4GEGA 1XQVA 1YRBA 4MJ3A 5B1SA 1L6IA 3GJSA 3RC9A 3T1OA 4UQLA 3CPHA 4OQMA 3TLGB 4ALKA 3EASA 2QPOA 5MN6A 3ZJ4A 2G6TA 1WZEA 2HU2A 4TQAA 4G4JA 2BCJQ 5CA0F 5L3VA 1R5BA 2NUBA 4OATA 3TSZA 3VTFA 3OF3A 4H3SA 4F3CA 3PUJA 4JP2A 2J9FA 4EAAA 3H5AA 3HBJA 3D8TA 3ENWA 3U7IA 7GPBA 3ZVRA 2W4MA 4AG5A 3RS3A 2PUBA 2WT9A 2J4FA 2P0EA 3H84A 4MUHA 5ILQA 3L0DA 5EZ6B 3OSUA 3AQIA 3CVVA 4MZDA 4UPDA 4ZV4A 1DX6A 5JQWA 1X77A 4JLOA 2EZ8A 5DXJA 3RLIA 3DE4X 1WXWA 2J31A 3GGOA 3GY0A 4WFIA 5ALZA 2FSIA 1F8GA 1JDTA 3GLHA 5EEHA 1N4DA 2HCBA 2OHIA 4O2AB 1M8KA 3H05A 1JV2B 2BGMA 1N5DA 2ZTVA 5D5HA 1G16A 5LPNA 2NZVG 1YMVA 4KBFA 3MWLA 1JZSA 3OG9A 3UO8B 1ZU4A 1WWKA 4GE0A 2VJDA 4OYHA 2AXEA 3H7AA 3FTNA 1UF9A 3MMNA 2D1QA 4MR8A 2IF2A 3GBVA 4R8KA 2P9QA 2RK4A 3JQDA 4RHYA 3PFIA 5CEJA 1TF7A 1AGNA 2QN3A 3VDXA 2AKEA 1HWYA 1B6GA 3HL0A 4P31A 1J9ZA 1M7BA 1WRBA 3KUDA 2JFOA 4W7SA 2PYIA 3N9IA 1W0KD 2WFZA 1P3JA 3W3AA 3ZHCA 5B3KA 3DV0A 1X9GA 2C2MA 4QOSA 2Z2XA 3I9FA 4CNQA 1U0TA 2XUZA 3JV7A 2OCGA 4JP5A 5D84A 2IODA 1Q1QA 1BG6A 1Q0QA 4DYVA 1SKUA 2DC1A 4B2IA 3DS8A 1ZXLA 3TPCA 5A02A 4TXLA 1V95A 2A9KA 4ETMA 4OLHA 1D1QA 4IKPA 5U4XA 3DTNA 3CUUA 1EB9A 2CXPA 3BCHA 3PFFA 3IEKA 4QBIA 4LTDA 5DMHA 3AVTA 5J3JA 2OGWA 4YRZA 2WD7B 3C6XA 3NIWA 3RVNA 4D6YA 1W29A 3WMWA 4P7BA 1E2JA 2O05A 2HPZA 3FMGA 4O5OA 3ZW9A 4AKHA 4QXOA 2DQKA 3HGTA 2WC1A 1UZAA 1RXIA 2ZQ5A 1T2DA 5JECA 3IA7A 3ASZA 1RE0A 2WSSA 4NHEA 4RAOA 2XQIA 1KVQA 2EGUA 3M4NA 4OJMX 2PMBA 2BAGA 2O2IA 4MRSA 1SUAA 2C04A 2WKRA 3FW1A 5E7MA 4WVFA 1XLUA 4R8RA 1H0RA 1TLTA 2G1AA 2PXCA 4FS3A 4NE2A 3I28A 4RLFA 3P2YA 4UBJA 5EJFA 3O2SB 3QVKA 4L5AA 1ISPA 4V2IA 1H8EA 1KOJA 3PF8A 2GJKA 1CE8B 3W7VA 4J3NA 3IV6A 4CCSA 2H9IA 1ABEA 4EFNA 2WFLA 3FFBA 4WX2B 7YASA 3ITEA 1YFKA 2QUZA 3HCFA 2MSKA 1HEYA 3AIKA 3MINA 4U7FA 1CNEA 3V33A 4Q7LA 4H18A 1LLUA 1NP6A 5J4LA 1LK0A 3ZDQA 1TW2A 3KJGA 2C92A 3ANTA 3TNJA 3WLHA 1OLSB 1EWRA 3PQ5A 5LA6B 2WWHA 1OX6A 1LDGA 4EHIA 1Q0LA 3DP9A 5DHAA 4D6XA 4MQMA 3IT3A 2FN7A 3SWWA 4WZBB 1A88A 2BHNA 3OZCA 4BYGA 4GU5A 1ZOSA 1N6IA 1YQTA 2JDID 3QE2A 1JXAA 3JRXA 5KVAA 1X1RA 4PF1A 4DMLA 1T9AA 3KYDA 4IZHA 3U16A 1JLHA 2WUVA 4C0XA 3VNAA 1KO1A 4Y18A 7AT1A 4J3FA 1B73A 3BQ9A 4MQFA 3WWZA 3SIPA 2FG6C 3WGKA 2VZLA 5ER9A 2H5IA 1U7UA 2EGGA 2YN4A 1IAQA 3VTKA 3AVYA 5G40A 4MUNA 4J7AA 4UXHA 1MEEA 2OFFA 4LC1A 1J33A 1XKXA 3ZU5A 4EW6A 1N5LA 4LEIA 3OZAA 1N6HA 5BSVA 1F9AA 3QEMA 4QYXA 2MTBA 1UEJA 5HK8A 1DQZA 2QRJA 2G17A 4OB6A 3ZLBA 2VPIA 2BGTA 2VHXA 3PQ4A 4ZIRB 2CDBA 3CZ9A 2V6MA 3I5MA 1E9FA 3FPCA 3FCCA 4BNFA 5ECGC 5L8VA 1XMSA 4I9HA 3GD5A 1C4WA 2CJYA 1LFDB 5DO9A 3H6GA 2Y0BA 4I5FA 2AC7A 5ALOA 5LA6A 5TPWB 1YR6A 3T7KA 3A9VA 2WG1A 4OXYA 4BRSA 3TIIA 3NS7A 3EXIA 5HTOA 1JB1A 2PO7A 3WB1A 3QFFA 1UZLA 4LN1A 4Q3EA 5JSYA 1YVRA 4GX0A 1JLMA 3BGSA 3O92A 1WUTA 4N0PA 3K71B 1MC8A 4PFSA 3T9DA 5DISB 5KAMA 5AKEA 2FZ5A 1WXQA 4B3TB 1H5UA 1RT9A 1OFUA 1X7YA 5ILOA 3WRXC 1TE2A 4HRYA 4G09A 2X15A 2GBLA 3WLPA 1JEYB 2WAAA 1TJ4A 3DMGA 1KAQA 1DFHA 2B8TA 4MRMB 4UM9B 3FNEA 1L8LA 2CF5A 5EYPB 2WV9A 1XCJA 2GA9A 1HQDA 3LHDA 2WMOB 3TEFA 3H6KA 4D2IA 2Q5LA 1JR6A 3WZ2A 2Q3FA 1DIAA 2WHEA 3GBPA 3TQSA 2CE2X 1T15A 2GLTA 1FK8A 1DKNA 2WA2A 3NWJA 3SXUB 5C51B 2C59A 2F00A 3EFBA 4YWHA 4DOMA 1E3SA 1QG4A 3ETGA 1XMPA 3KOZA 3KVNA 4W5JA 4Q1EA 3B7WA 4OVKA 1G17A 4P4SA 4EDHA 3QQPA 5JJ5A 1XKLA 3ABOB 4GG1A 1YRAA 4M83A 2HK8A 3IJEB 3GP3A 1SKMA 2DFTA 3LYHA 1SULA 1F38A 2BONA 3HE3A 3SYMA 3VKFA 1YHZA 5CFQA 1R00A 2Q5EA 3H75A 4K86A 4L15A 4Q4DA 1I3CA 1QYRA 2G5PA 3C41J 1HH4A 5CEFA 1NHWA 1TU0A 2REBA 3BWDD 3O4GA 3JCZA 3I34X 3P1JA 3BMNA 3Q7EA 5IAGA 4N3GA 5KAPA 2J3JA 1F7UA 3DV0B 1JQ3A 2J0UB 3L07A 4C0BA 3K4PA 1PBNA 2QM8A 5A2QA 2JLQA 4W9MC 5A6SB 3UAZA 3WYGA 1FNBA 4CJXA 5HKKD 2PE5A 3AI2A 4EG3A 1MABB 2CLIB 2P3OA 4NENB 2VF4X 4G24A 1OYYA 1DJPA 3KSRA 1A27A 2W6ID 4XSVA 3G1WA 3UNXA 3EXAA 3VR2D 1I30A 1W25A 4BYMA 5FI3A 3ZW7A 2XQFA 1NIJA 3LH5A 3LWZA 3F97A 2V7QD 2NU6B 1OBHA 4HTAA 2X58A 1LBTA 3DBIA 1SIBE 3NM4A 2RGCA 4TMXA 4Z8XA 5DYTA 2F8MA 1KJYA 3LQRA 4M3NA 4PX3A 1M0EA 3W3ZB 2OUKA 5BNFA 3RG8A 3IVMA 1KORA 4DJDC 1PGQA 3QYAA 2YFHA 3EIWA 2ZB4A 3WA6A 5J63A 1OFGA 3EN0A 4L3OA 1AKEA 3ZG6A 5IFLA 4ITVA 1Z0FA 2PCJA 3TYXA 4EPXA 5AW2A 3EUEA 2HADA 1F17A 1GQSA 2YXNA 3ER9A 4RTSA 2DFVA 4I5DA 1XCGB 3HRKA 3ONNA 3VR1A 3V55A 1V8ZA 4YMGA 1K6XA 4WDRA 3MUNA 2COKA 3VHQA 2XZOA 2QX6A 1GVHA 3RSFA 4KGXA 3V97A 3C8ZA 2XRYA 1O58A 3G82C 2P2CA 4BFSA 4P5EA 2QUIA 3NJ8A 1KEVA 4YS6A 1HNXB 1HQCA 4DPKA 2OV4A 4AY3A 1LLQA 5JAZA 2VEDA 1RWOA 2JRCA 2R1UA 4LX8A 2O19A 3QUBA 4PTZA 3RVMA 4XYLA 5F2NA 1U8XX 2Z1MA 5IZCA 3E2PA 1G3IA 4X54A 3RK0A 2J9GA 4DLAA 2BYTA 3OJLA 3TO5A 3TG2A 1WB5A 2CMFA 3GNSA 3EDQA 4B34A 1AMOA 2SICE 1YONA 3ONEA 4PCVA 3H11A 3HU1A 4C29A 3L1IA 4WV3A 4E33A 3LY9A 3O90A 2DHQA 1AKNA 2YOHA 2JANA 1HBJA 2AVDA 4C03A 5AVOA 4FTWA 1KMNA 1W93A 4JBHA 1AUPA 1IZ0A 4OHVA 2CJWA 1AG9A 2WSBA 2JLCA 1MA3A 1A98A 1T13A 2V0NA 3R6TA 4P53A 3UT6A 1R2QA 2XUFA 3WGMA 1KSFX 4MSUA 1KYQA 2ZBEA 4UPEA 1IZ7A 1AKUA 5CDUA 4QGBA 5D00A 2WHPB 1QYXA 2FX2A 3OTQA 4TXJA 2I2CA 4EYEA 4GVXA 5JNLA 1P45A 4UBKA 4YAJA 1DKOA 1J2UA 1PJBA 1EX7A 1H2XA 3D6FA 5FNVF 4E11A 3AK4A 3HDHA 1T8UA 3FOWA 5EJMA 1PGPA 3U2QA 3PK0A 4IJMA 2WNIA 1IJKA 5AT1A 2RSLA 2AJ8A 2G1UA 1JIXA 1V45E 1MENA 1I9CA 1P17A 2QVYX 3G5TA 1NY6A 3AY3A 1YZTA 5YASA 4CRWB 3UAOA 5JSZB 2XVYA 5EZQA 3AO0B 5J5VA 4YRGA 2VH1A 2XOKA 3DWEX 2M32A 5K20A 2PUCA 5TQ0A 1H5QA 5DMXA 3URMA 1U9YA 2JIQA 1W4CA 1C7FA 4LHYA 4LJAA 1HLFA 1VCIA 4LY9A 5DCUA 5I9BA 5L53A 4IILA 1LSOA 5M04A 4DG9A 1CK4A 3BJIC 4TWBA 1NYRA 3UH1A 2QEQA 3LKVA 4DSAA 1H4VB 4F9EA 5ARBA 2XGMA 3UN1A 2WWVD 4RV9A 2IWHA 3QKRA 3C5EA 4WK2B 1DIBA 3SJ7A 1EFTA 6REQA 2ZT5A 1JEQA 2JJ8A 4BKUA 3NHLA 1WHSB 5JSFA 4Q3CA 5L40A 1U1DA 1W6RA 3UJAA 4J0CA 3JWHA 4KR7A 3AVVA 2QORA 4TWIA 3WAGA 2D2VA 3AB7A 4NU5A 2VUUA 4O29A 2QN1A 4XYGA 5IJ9B 3D4IA 2IEZA 1RLJA 3H5VA 5EQTA 4CGZA 1XMIA 4OHUA 4QUHA 3VU9A 2UZ3A 3V6LA 1N6LA 4D96A 3IUEA 1ODCA 4MVJM 4AMUA 1SEVA 3K53A 5ENDA 1MNQA 4QTYA 3C7DB 4MQ6A 1V43A 3NP9A 5EJ5A 4O6VA 1ODSA 2PSSA 4FSXA 2CYBA 2QG4A 2GNOA 4RE6A 5G0VA 4C7JA 2AW3A 2QE6A 1DHRA 1VKRA 1FP6A 1FQKA 3BD7A 2VAWA 3X2SA 4D82A 3DMDA 4IIJA 1A8IA 4GX5A 3RBXA 2IBSA 1JMVA 3FCXA 2A4MA 1GRRA 1XWFA 1NMXA 1RLOA 2PDAA 3GT3A 4V0ME 5EVCA 2IEBA 1XZPA 3L6CA 4FGZA 2IDKA 2XY4A 3FUVA 1P62B 4LFBB 4OKSA 4XDYA 4ZMBA 3F7MA 4EJSB 1W7AA 3ORFA 1QCDA 1WAMA 4CHGA 1EVLA 2VH5R 3U7QB 3EXHB 4F4UA 1C30A 1DBVO 1ORVA 1E92A 3ADKA 3DTTA 1UZNA 4HQFA 1ICIA 3TSYA 3ZE0B 3S29A 1WCWA 3LQFA 3SCZA 3ZK9A 1Z8NA 1Y3AA 2AC2A 3CFYA 3W2TA 4M0KA 1EU1A 3X2EA 4BVLA 5AVTA 5GVRA 4DHEA 1UM8A 2WZQA 4HWKA 3HKCB 5GONA 4CG3A 2BF4A 4QG3A 1T6BY 3CX4A 2RI6A 3TAXA 1LX6A 4IDFA 3H2HA 4QBHA 4QUEA 1H2WA 1KFCB 3RHTA 1FP4B 3S2EA 5SV2A 4B4OA 1JLLB 1J0EA 4EP1A 1GPWB 5F78A 3WL8A 1EHYA 1YB6A 1YA6A 2Z6UA 2C2YA 1NX9A 3D4OA 4OAPA 2VN8A 3HBLA 2QR5A 3QU4A 3WJ7A 2RCNA 2ROQA 2JLAA 3M6UA 4OH7A 4KOAA 1G8KA 3HKDB 2I91A 1JLLA 3DV9A 1SKYB 2OO3A 1FP4A 3KWMA 4IVNA 4TL7A 4XEHA 5AVRA 1QRTA 2BBOA 2H00A 3D2AA 4IKEA 1BXRB 4KFTA 5IK2D 1A0OA 2NX2A 3L1VA 3T34A 1XPUA 3IE0A 5K4GA 2BFCB 5A1JA 3UWMA 1N77A 3RKUA 2HBYA 4WESB 4DR1B 1T34A 1AUXA 4LYYA 4ROTA 2QZPA 3L8CA 3JVEA 4R0MA 2AG8A 5BT9A 1HRDA 1N0UA 1FCJA 4URWR 4PX2A 4FM9A 4KQGA 1GGEA 3TMKA 2CNOA 3NAQA 2WKSA 4RQUA 2Y1DA 4BFVA 2X77A 2OCKA 4JY7A 4JXXA 4L8LA 4AN0A 1E3IA 3ZWAA 3UMYA 1A77A 3MCVA 3ZLJA 4I4TA 2E5WA 2ECFA 4EO4A 1SA0A 3JAMA 3ZCRA 3TLEA 3JYHA 1PEAA 2BFEA 3MCAA 5TNXA 3A3PA 1V4VA 2ZK7A 1KBOA 4Q1BA 2IGTA 2ZS9A 3ZXYA 3LCUA 3LP5A 4BO7A 4YRKA 4I55B 3QVOA 4DIOA 4JJIA 4BB5A 1BC5A 3IQIX 3DB2A 4GHWA 4JBNA 1OLOA 2DKNA 1PYGA 3H2SA 3NUGA 1JWAB 4ZCRA 5IEJA 4DA4A 4Q4JA 4PAQA 3EULA 4G8CA 3MVEA 4A8JC 4DM4A 1OLUB 5HJEA 2CHUA 5LP6A 3BWXA 5D3QA 4N5IX 2HDNB 4PLZA 4D44A 1TI7A 3OO1A 2A1TS 1G18A 5TSDA 4EGJA 4PICA 1R8JA 4IWNA 5AFSA 4KWCA 1AJEA 4ICIA 4BNGA 4C0LA 3NEJA 3AZOA 1A1VA 3WAJA 1UWCA 3PIRA 6REQB 3IRUA 4R68A 4ZT4A 4AIRA 4CG2A 2XMSA 1WW3A 3IP1A 3UICA 2Z95A 3CW2A 4L07A 4LRUA 2J48A 5JWRA 3USCS 5JO9A 4D45A 3M3PA 3IBGA 1JI0A 2BJVA 3AWDA 2QPLA 2XBUA 4PE5B 2FRDA 2LZ0A 2XYQA 2XZPA 3O3NB 4MWSA 4HEQA 3KELA 2C2BA 4TQUS 1AV7A 3ELUA 3FPJA 4Y2VA 1W36B 721PA 1PKEA 1UKVY 2WIGA 2AW5A 3MLBA 1P6XA 3VGPA 4A0RA 1ZC4A 2AZDA 2WVJA 1L7MA 3NBKA 1KRWA 3RB8A 1N3LA 4MV3A 4X64B 2HMUA 5HJ2A 1MV8A 3RYIB 2Q6IA 4HNVA 3FPEA 1OZFA 3BSSA 4LAFA 2A92A 4GI1A 3HJRA 5A2GA 1BEUB 4KFSA 1DI0A 2FR1A 1ECBA 4LBVA 4BEBA 3VOTA 4D8UA 1M2VB 5KTYA 2YHIB 4D99A 4DJ5X 2FRDC 1ZI9A 3OQJA 1Z6ZA 1AHPA 4LRQA 1TF5A 4NQZA 1R9NA 3OZGA 3QX3A 5ES3A 1X38A 3HXOA 4GOKA 3UAXA 4EJ2A 1JAZA 4KAFA 4X7BA 3C0KA 3WRYA 4YXWA 2V03A 1CQPA 1NSYA 3H5WA 2Q9BA 5A04A 2AFIA 2VF5X 3G2KA 4Q34A 5F9MA 3GVHA 4IDPA 3ZI7A 1T9ZA 1IOWA 2G5TA 2H5EA 3KQVA 3QELA 5HE9A 2WQ7A 4D4HA 4W4TA 1U1FA 1F2DA 4NOJA 2YS7A 4IYRA 4UMVA 4Z4FA 1HYBA 1HUQA 1UOPA 3I30X 4JYZA 1H2HA 4F1KA 3ASUA 1NMQA 4IGKA 3ZNNA 1YZUA 5LBUA 1ZM4A 2XRFA 4YBZA 4ESEA 4DB4A 1ORHA 3QFHA 1HZJA 2EP7A 5HUHA 2FQ1A 2GN9A 1X6VA 2IZ7A 2QRZA 2VLBA 1U3WA 4IAOA 2WR8A 3PZRA 3MHPA 3R0IA 1QFYA 4U7HA 4Y1RB 4DDVA 3PXAA 4HVAA 3D5QA 4Z1OA 3A2MA 5LDDC 3OJWA 3ORHA 5CM9C 4O4JA 3N2ZB 4UOZA 2ZREA 3VR6A 4C22A 2O8FA 3PNVA 2W37A 3I53A 1JIIA 1N0HA 2IP2A 5GY7A 3SHOA 5BV8A 4P9NA 2XB4A 4KE6A 4QA9A 3HH8A 4UVEA 3A4MA 3WB0A 2SKEA 4BCDA 3B82A 4E3WA 1H0KA 5LQKA 3EA0A 1T6YA 2XNKA 1M34E 3KJEA 1WO8A 4KN6A 5AJHA 1Z17A 1Y5LA 1Z45A 1ONNA 2P4QA 4M7RA 4NYIR 4TVKA 4OI1A 3BTVA 2WT8A 3RJTA 2WSYB 1CY6A 1P4RA 1Z2NX 4M4SA 5IYZF 3CSUA 2VRWA 3IEXA 1C5KA 1IFXA 5DNDA 4B4WA 2ID8A 3DSRA 1JL3A 4MUFA 4EB6A 1SEPA 2JC3A 1G9XA 2BKLA 4LFCB 4DA6A 5I3ZA 2FWAA 4I1IA 1XDDA 1T5OA 3CEMA 3KLPX 3C2QA 1ZN2A 1TAUA 1FX0A 1WEHA 3NGLA 1LPNA 1FP7A 5JATA 4RJKA 2DQSA 4MGYR 3RM3A 3IT0A 1JLRA 3BICA 3PHIA 3VKWA 9MHTA 1IEWA 3I58A 1KJIA 1BN7A 1XZDA 2P67A 2V8BA 5AM1A 4R3NA 2HT6A 1KAGA 1N3IA 2FX5A 2QHXA 3IOEA 4U00A 4KQHA 4RZ3A 1HG1A 1SHUX 1XDUA 2MWMA 1K2WA 2OCDA 2PJDA 3OQOA 3HB7A 2V6JA 4EIWA 5F12A 2ECQA 1Q0RA 2W8BB 4ZVQA 4KAXA 1PD0A 2P7HA 4RWZA 4I3HA 2PZGA 1LEHA 1E9DA 3TLKA 1L5HA 3GRRA 4XJVA 1U2DA 2J5XA 5EG5A 4GSLA 5DNVA 1ODKA 1PVOA 2VT7A 2GSWA 2MYTA 4QHTA 4R1NA 3ADOA 3TFWA 3WB9A 4Y0AA 3AKDA 4XDGA 3ANLA 1PWYE 4OI2A 4A10A 1KPHA 3SXJA 1Z08A 3S6JA 3BKXA 4CFYA 4RQBA 4D9IA 1CQIA 1G291 1Z6YA 5A4AA 1T5SA 1VKOA 5IKPA 1H0HA 3UPDA 1U7TA 1L7VC 3C43A 3QF4A 5FLEX 4AXXA 4L57A 3GYBA 3O4RA 3V8NA 2AMVA 4ECAA 1IPHA 1PT8A 5AKGA 3THWB 1EWQA 1UT5A 5J2TA 2O48X 3VAZA 5I47A 3TM4A 2ZAMA 4H1WA 2WDPA 1QCZA 5K03A 5KWEA 3SX2A 3W5BA 3WWCA 1DUIA 2AYXA 1WDWB 3DEHA 4PG4A 3DMPA 3R9XA 4X1OA 4D9NA 4MRMA 1K7CA 3R3XA 3SVTA 3HXPA 4TTJA 4F5WA 2MSLA 1QP7A 2WWIA 1C9MA 4JJ7A 1OILA 3VMFA 4BWVA 1PG2A 2NTJA 1T0HB 1WUJS 1JG6A 2BGRA 4A82A 2AMFA 4JB8A 2J6CA 4HH0A 1ZQ9A 4TRMA 2VQSA 3ODPA 3WI7A 4CEJA 3OE7A 4K9MA 2J9RA 1HG0A 1P6QA 4FNOA 5FWXA 1S7CA 3X1MA 5JS7A 3JD3A 2POQX 1LLFA 2C1EA 3MBIA 3QM1A 4I2VA 2IY8A 1LPAB 3LW8A 2OT3B 3KLBA 2IXAA 1FL9A 4IIGA 3AI1A 1DUVG 4IV5A 3X1XA 1PW5A 1XMJA 4LWQA 3IOCA 3KQSA 4N4AA 3OHSX 5DOZA 4A2CA 3VR4A 2ZYTX 4Z99A 5DN9A 4GZLA 1XDZA 3R76A 1BIFA 2KBFA 3CEJA 3HY6A 1QH9A 1J99A 4UNRA 2BZ1A 4C9BA 2ILVA 2Z6VA 4KQFA 4L5CA 1SXHA 4N3AA 4XB6B 1U0HC 1NBEA 3OEHA 4V1CI 3LX4A 3ABRB 4CODB 4TVSA 3A4IA 3PEEA 3PD7A 1PQWA 2C4HA 2WUFA 4Y9UA 1E99A 4AF7A 1NVVR 2BFPA 4PYMA 2H57A 3WLRA 3VTAA 3DLBA 3QLVA 3W6ZA 1W30A 4NOKA 4RVFA 3ZVMA 3HB1A 2YJGA 1AT1A 4QFCA 4HUQA 3F5SA 1PJ3A 2V4UA 1FDVA 1E3QA 1H69A 1K66A 1KMHB 1P0CA 1TMKA 2FEAA 4MR7B 1Z18A 1YJXA 3UPTA 3A1SA 1E2GA 5TE9A 5SY6A 1E0DA 4DMUB 2Z5VA 2Z2KA 4X6UA 2JVJA 3U80A 1UBTS 1CEYA 2IYXA 4Q7QA 1H3FA 4ZYTA 1BDBA 2R1VB 2NYAA 2WUEA 2YZNA 2PMKA 3IT1A 5EMJA 3O91A 2EF0A 1EDOA 4WZBA 1A4XA 1JDNA 1OYVA 1DADA 1JR4A 4G8DA 5FADA 3RFFA 2VQDA 3VUFA 5KSWB 4IFEA 5D01A 1R4ZA 4K3UA 1E1MA 3QPAA 2I9KA 1QKKA 1VPEA 5CAEA 1EVYA 1LJLA 3QMVA 3A26A 1Q1EA 4Y3UA 1I1NA 1NR1A 4PHCA 3ZWMA 5L95A 4L85A 5DHQA 3HO8A 3ZW8A 1HFEL 1MT3A 1QVVA 5K3BA 3U81A 1XCMA 2IPLA 2GM4A 5COAA 3CKLA 4DR2B 1J5EB 2C9CA 2QWXA 1OYOA 3LDFA 4Q1AA 1ZIPA 5LD2C 4RVGA 3PB3A 2HJSA 2G77B 3GUZA 3MT8A 3L8YA 3KHUA 3PEYA 4FEGA 4DE5A 1D5CA 2PKCA 1ZNZA 2H2WA 3BGIA 4LHZA 5DH9A 3EG5A 1BW9A 1PUXA 3IC5A 1GTVA 1X19A 3OICA 3QWBA 1N33B 3WMFA 4A8PA 4ALMA 4P3YA 4UEQA 4DZTA 4DUGA 3FX2A 5FFFA 2ILTA 3KXDA 5BUSA 4MRNA 4GC5A 4MQEB 1NY5A 3ZJYA 1CUAA 4MKIA 3WGIA 3R7AA 2PH3A 1ZN8A 3AVOA 3LUFA 3G0IA 1IHPA 2HDHA 2IYWA 4IMRA 2EL9A 2IEAA 1CU1A 1VJGA 2VOJA 4BMYA 1RM0A 1F9EA 4EA8A 1BDMA 2OP0A 1NX6A 3TRKA 3P2IA 2ACEA 1ITZA 2VOEA 4EVRA 4DCOA 5IW8A 4EYSA 1RI3A 2GTHA 3EMKA 4OQZA 2RHJA 3WSWA 1Y6JA 4B74A 1TFUA 4MWOA 5FLXA 4GVPA 5G3YA 5EHGA 1Y4DE 1M72A 1VRVA 1E0KA 1VQ1A 4OP2A 2QZJA 4NIMA 4EGQA 1YZGA 3NO4A 2ETVA 4LHSA 2DH6A 3IAS1 1H8HA 4B81A 5BV2P 3KAQA 2ANCA 3CKYA 2ZR9A 4FDAA 1PNQA 2OCLA 1RJ9B 3LUAA 4R8MA 1D1TA 3IURA 1N5KA 2B78A 4FW8A 4BO6A 1DEXA 3ZD9A 4H60A 1VLLA 2JBAB 3SR4A 3EMDA 5KSYA 2ZBVA 3EVCA 5FA8A 2YC2C 4XGNA 3ML1A 4DM7A 1XVUA 2XXBA 3PHCA 3CINA 3HWSA 4RKYA 3VHXA 1W2WB 1WMBA 1GA6A 4ND7A 3W9YA 3PXDA 1W0JA 2HNKA 1QHGA 4B32A 1GTJ1 1SG0A 3ECAA 3IILA 3ANNA 4BBPA 2E5FA 4F56A 3WDMA 1TZ2A 2BRUC 1CUEA 4MJXA 5CB6A 5JC1A 4W5TA 3IAHA 2BOVA 4OP1A 3UXEA 3CUVA 3EVEA 3K2EA 2BFFB 2W93A 4J49A 4P54A 5GIPE 3L3BA 4AIIA 1SUIA 1KY3A 1PS9A 3VOBA 2VHZA 1WDLA 1OBCA 3W6NA 1GPKA 1RABA 4J1QA 2FZWA 3FSGA 2C2XA 1SH7A 2VBCA 1Q44A 3JQFA 3KSDO 4N3BA 1XEXB 3R77A 3VISA 1KNXA 2C7OA 3ANMA 1A9QA 4GL4A 2LDXA 4GICA 3AOEC 3QNWA 2WK1A 1J56A 3ICQB 2RGDA 1B6RA 2HA4A 1E3JA 1UK6A 3F49S 3LUPA 4MRVA 2NNLD 5JPCA 1BE8A 3IXLA 4LY6A 5EA2A 1QG6A 5G0SA 4QUBA 5HF9A 5IUKC 4X8HA 5AO9A 1A8HA 4M1WA 3TIGA 4QLAA 5LZ2A 4I1VA 3MILA 2DERA 3W2FA 3HWRA 2BUBA 3GQBB 3K35A 1QBGA 1QS0B 3BRWA 3O74A 4F4JA 2HSJA 4K2AA 1JKIA 3LLVA 2BFBB 1T1GA 1I80A 4XM1A 3T95A 3HJFA 1ODFA 2BEWB 1Y7IA 2Q5OA 3EPLA 1OB5A 4G89A 3CWQA 4ZAGA 4LJ6A 1HMPA 2P1ZA 5HDBB 3MCUA 5CJPA 3UBTA 1TJNA 2I8CA 2IZOA 4K03A 1SIUA 4JLAA 3ASVA 4JZYA 4RK6A 4NR0A 5LZ8A 3WLFA 5HR5A 5KVSA 1LDMA 3DZIA 2Q4EA 4UM7A 2C94A 3E9YA 5K8LA 5DHFA 4IQFA 1LUAA 5C7OO 4UCXA 1NVTA 3FBWA 2X8BA 5HIAA 3AEUB 4KP7A 1T25A 3HCWA 3IMEA 3X2FA 4BAZA 3FWYA 3ZU2A 3AF0A 3LBNA 1VLVA 2PRIA 4KNVA 5ALNA 3FBGA 5C80A 3GGDA 3OU6A 2X23A 3SDSA 3TLMA 1E58A 4FWIB 1CDOA 2QVBA 2YWBA 5FOTA 5ALPA 3MTEA 3O9VA 4JLBA 1GUYA 3RT7A 4L8GA 1UXGA 2AUTA 2RGBA 2PG3A 1QHXA 1X80B 1V6AA 2Q3DA 3EODA 2XMBA 1TADA 4JI2B 2AI1A 1H85A 1QS0A 2O3TA 3GQBA 4X94A 1I6KA 4GQIA 2H17A 2I67A 3FD8A 2Q9UA 2GZAA 2RB5A 2B8JA 3MJFA 2ZQYA 4F4IA 4C76A 1XAGA 3LECA 1DLIA 2UKDA 3VPAA 2KPOA 3K2IA 4D3XA 4ID9A 3U4QB 3L1UA 2OVBA 2D06A 1K1EA 3VYVA 1Z4PX 1HFWA 1P1FA 3EMVA 4IIUA 4N9WA 2XVXA 3DHYA 4PGAA 5EXSA 2VT2A 4RS4A 1XEFA 1HNZB 2O3QA 4NRDA 3LPAA 3PCRB 3KK0A 4AY6A 2QTRA 1XD8A 2VHQA 3TX6A 2AQKA 3D6UA 1Q6YA 1ZJ4A 4JI3B 1G2OA 5A5VA 1HT2E 2C5BA 4D3ZA 2GPAA 2I2DA 4KDCA 1I2AA 2Y9PB 4HDCA 2EZ4A 3GDGA 4KLAA 4UTNA 4PPYA 4X66B 1ZD1A 1JYSA 2FPRA 5JZSA 3PE4A 4G5FA 4AZ0A 1FUEA 1S9HA 1C1DB 2GARA 5C53B 3L92A 4X61A 4ER3A 5BP7A 1CIVA 1Z8DA 2QD4A 3Q6NA 4OO3A 5J4VA 4U8HA 3Q85A 4KEAA 4KO2S 2P79A 4ASUA 3FSEA 5EJ2A 3W79A 3JTEA 4LSGA 3STHA 2GHIA 4NYMR 3L7BA 5L6LB 1MHTA 1ID8A 2XB8A 4IWYA 5DF1A 4BTLA 2QF7A 4A0GA 1P2GA 1UDRA 1L7PA 1G9SA 4F3YA 4KLZA 5JUWA 1Z0AA 2JI8A 3ZHRA 3CLHA 2ORIA 2FDCA 1SELA 2DUWA 3DVQX 4GKJB 1E4VA 1B16A 1QRRA 3VPHA 2ZCJA 1ML3A 1XTJA 1UJBA 1UPFA 1G2IA 2V9PA 4U6SA 2PXHA 1YXMA 2E6KA 5CX1A 3MIIA 3P9IA 4E2ZA 2SNIE 4GWKA 3E5MA 3I05A 4KACA 2B83A 5HMLA 1DCKA 3BJZA 1BMFD 1YE8A 3R5TA 4MUXA 5F1PA 2G71A 1D1PA 1SCBA 5GADl 3SLKA 4P22A 3VJMA 1WKCA 2BFFA 2H2AA 3MJTA 4LV5B 3SZMA 2JLXA 2FOIA 1UXHA 1NFRA 4LJLA 4FFSA 1D03A 4UW9A 1Y9JA 2HPHA 3V2GA 4E1AA 1TMOA 5HQ3B 1KYXA 2NO0A 2IL1A 3BWMA 4PSAA 3WAKA 4JSRA 1IIRA 3N8KA 1MN6A 4MW2A 5HS6A 5TVKA 3QVVA 3G2NA 3SFVA 1YCFA 1LBQA 4ZA2A 4BC0A 3KSBC 3MHTA 2ATEA 4MQEA 1C3VA 3P0IA 3VR5A 1NN5A 2DU8A 4JI4B 4W9NA 4IICA 3WV5A 1Z4LA 4ZV9A 4DCJA 1TEZA 3K70C 1FQWA 1AA9A 1T0PA 2PBZA 3ANXA 4EEKA 1U5BA 2B0CA 2GN8A 5DE3A 2IHNA 1E66A 5C1IA 1P7VA 4O2BF 4WZZA 4ZAVA 5K4AA 1N0WA 1YOBA 4GPD1 1YBMA 3SEZA 2P4HX 1I1HA 1N7JA 3F0TA 3QOXA 3LK7A 4FZRA 5KJ6A 1F60A 2N0SA 2PGIA 4LDJA 4FHDA 4X60A 5D1HA 3GA0A 4ZWNA 1NQVA 3W2HA 4CYMA 3GPLA 2Y1FA 1EWVA 3FZEA 3L4BC 3WGHA 3EVNA 2D54A 2H3HA 3FZGA 1ZK1A 3ZNQA 4BWGA 4S0XA 3EXEA 3A04A 2V6BA 2VXOA 3DMTA 2HJHA 2W2KA 3GJ6A 4C01A 4H7FA 4HAVA 3ND7A 2IHKA 5CCXA 3QOFA 4P7FA 3SU8A 5ICEA 3GVIA 3MEQA 1KU0A 2WD8A 4YMLA 3EGDA 4R1OA 3OESA 1BRMA 1J2TA 4YJ2F 3AJDA 2RK6A 3CIFA 4QWWA 5MFPA 4CIYA 5I7HA 1P4GA 3A9WA 4Q4CA 3FJ1A 4P7KA 1BMTA 4M37A 1PVVA 3JZMA 1G19A 4TTIA 4B6JA 3LO8A 4QTUB 1SOAA 4V0RA 1L4EA 3UJ9A 2V7WA 2EKQA 1KDOA 4PZDA 1GTSA 2ZI6A 1N8NA 3P9KA 3R09A 2Z8ZA 3A0RB 4JMLA 4YJ2A 5C5IA 2WJZB 4ZTUB 2AIRA 5EVJA 4XRGA 5FI1B 2RKBA 4DUZB 5BOSA 2VI5A 3ZWXA 1IN6A 1BXZA 3R7DA 1NU6A 2C96A 3SLGA 3K8YA 1GR1A 1ABBA 4DV2B 3K4QA 2OCIA 1LK7A 4FEAA 1VCMA 1ZN7A 4EY8A 4CEIA 5MF6A 2ONCA 4IV0A 4R1SA 3GLQA 3GRPA 2Q2WA 5E38A 3IEVA 1SZCA 3P9SA 1E94E 1ZK4A 4EI8A 3I6ZA 4M2LA 4PTLA 3R3SA 4JX8A 3DCYA 4QU9A 4W8GA 4UCFA 5ECDA 4E5MA 5A3JA 1K88A 1NA5A 1CIPA 1RAFA 5JAIA 5ALRA 1F2VA 3JZDA 4ARBA 2H8GA 4F5DA 2D4AA 1XJQA 3HVKA 1ZUNB 5FWXB 1SNYA 1QYCA 4OD0A 5JQGA 4CLOB 1PR5A 5KYWA 1O95A 3DT8A 3CZ5A 1AO0A 2O06A 1Q0ZA 1I3NA 1H6DA 4W8HA 5TS3A 4EX7A 4QBKA 1HY3A 1DOAA 2WFMA 5FQNA 1UDAA 4BN0A 4Z7NB 1M2OA 5KB3A 1N0IA 4FDVA 4Y2XA 5F2OA 3QFCA 4YGXB 2YIVX 1QV7A 4Q3BA 3CNHA 3AINA 4JV5B 3WE7A 1Y5NA 2EJUA 2DFNA 2NVUB 2VATA 4X91A 3QA3E 2NSHA 1XZGA 1G5IA 2JIZA 2XMPA 3T1TA 1GZVA 3KFXA 1W0KA 1TIPA 1PV2A 2UZ0A 1IHYA 2QVZX 2QNIA 3E2IA 4AZSA 4ZTZB 3R4VA 4TSFD 4BKOA 1Q0TA 4X20A 4TZTA 1IQRA 1O6FA 1CUDA 4IRMA 5B57C 5LNK6 1XEWY 1CQIB 2W6QA 1SQ6A 3BE4A 1G5PA 1XI2A 3LWDA 5B58C 1K3TA 3O9MA 5BN4A 5NULA 1DMRA 1TVKB 3MAJA 3GW8A 4OBWA 3LWNA 1MJFA 1XD2A 1PGOA 2B8NA 2D7CA 3EXG1 4E5PA 2JLZA 5ALGA 4R9VA 1RHJA 1TYAE 4KXVA 2IXTA 4ZVOA 2X4IA 5A7HA 1CDEA 1JNXX 3MJHA 4DMCA 1N6NA 3C6BA 4UHCA 5GIOE 1IU9A 1G6HA 1V39A 3T52A 2X1HA 3D9QX 1PWHA 5F33A 4QAJA 1WY7A 2H59A 2ODEA 2W8BA 4FKZA 1M1YE 3B8HA 2WIKA 3LE8A 3PJGA 5E4YA 1UKBA 2ODAA 1CUSA 2XUKA 4XWYA 2Y4NA 3I2YX 1LGYA 1NDUA 1WXXA 4FGKA 1UFVA 2AT1A 1IZZA 2X4DA 4CM1A 4WKCA 4CN9A 4HAWA 3KUKA 4DGQA 5AXAA 4M7OA 1UZUA 1GZUA 1Z38A 4RYDA 2D1RA 4JOQA 1ZQ1A 4V0OA 4DCPA 2I8LA 3PJFA 4M55A 1IOLA 3PGJA 1N34B 4M9XA 2BDTA 1IL0A 2D5AA 4C5AA 2MINA 3MZ0A 2J3KA 4HSGA 4DVGA 1Y89A 5I9TA 2Z56A 3OD1A 1JQDA 4RCVA 4EBBA 3CWCA 1W44A 4CM3A 5HX7A 1DEOA 1BCRB 1YKGA 3HNRA 4LOIA 4RS3A 4YR7A 2XI4A 1JJAA 5FI5A 3CV3A 1ECGA 4WCVA 1AY0A 3WGTA 1T9KA 1K7FB 2YZ2A 4FDLA 3ORYA 4IJWA 3QLUC 3MOGA 3IOBA 2ZJ5A 2GXSA 5BUZA 4K8RB 3IPYA 2V7EA 2IYYA 1S8AA 3K4HA 4FNGA 4F5YA 3QPWA 3WYFA 3RVPA 4D8VA 4PZAA 1H1LA 1SU8A 2RAVA 3MJSA 4BEJA 4YT2A 1WZ2A 2WUGA 2CVFA 2BFMA 3H9UA 3FNFA 1NMSA 3OFNA 4LJYA 2G4VA 3QVWA 1YBHA 1JN0A 2P1RA 1HF3A 3HL4A 4HQLA 3TTYA 3FTFA 3CZ4A 1VL1A 2Q62A 4D9HA 1GKKA 1WQ4A 5ALIA 1JHDA 2EQAA 2G08A 2VDVE 4JT4A 4XH9B 1OXTA 4OKIA 5HG0A 3VR0A 4C7KA 1MAHA 4YP5A 2WIFA 3LTNC 2GA8A 1QWSA 4NU0A 4IXWA 3T3MB 1DEKA 1GR0A 1PV1A 1R6DA 2ZI3A 3ZU6A 4ZFNA 2WJWA 4YECA 2AOUA 3FFWA 3KEQA 4YAKA 1EWYA 4AQ7A 3MIZA 3AKZA 2R8PA 4QUKA 3WIOA 3RVOA 4G67A 4BQOA 1G38A 2CXQA 3MYYA 1M3SA 2VK1A 1PJQA 1VSQA 1GP2A 3COSA 3GJ3A 1TU3A 5J40A 3RS5A 1PRYA 4KKVA 4QECA 4TPKA 1NBMA 1BMFA 2D4HA 4B33A 2OECA 4QULA 5ALQA 5ETJA 1L5MA 1WBJB 2G1JA 2FMFA 1SXJC 3PPYA 4NPAA 1ZCAA 3R3YA 5ARDA 1H2RS 1O3YA 3F6YA 2NUAA 3VPFA 1PJTA 2C7PA 1WXFA 3IP3A 4DNPA 4TYYA 1U11A 4BZXA 2VWPA 1UKZA 2VT3A 3SMQA 4BJHB 5AKYA 1CFZA 3RYIA 3UUGA 2GO1A 2IOFK 3PBKA 1Z37A 4IEEA 2ZSJA 1O94D 3PGKA 4NG5A 4CF3A 4J0HA 1O95C 4IFBA 3ZDZB 1TW3A 2R5WA 5E6UB 5EQFA 3KTAA 4MVYA 2XSZA 4UAJA 2GKOA 5MN4A 4C78A 3R5JA 1L5GB 2R751 1VMDA 2P40A 2CFTA 2VBGA 1PFWA 4BGUA 1YS4A 4M1EA 5FA6A 3UGTA 5LKRA 3EWSA 5I7RA 1C7QA 4BV8A 4F3TA 2I3GA 3H5IA 3DR3A 5B2EA 2WY2D 2GYVA 1ICEA 2C42A 4Y6PA 2BHSA 4GMGA 5TMDA 2XGGA 4IMJB 2XRZA 1EXMA 3GRUA 1BTOA 1U31A 4LJ5A 2BELA 2FMUA 1GKIA 4FXOA 5AR1A 2QN7A 1RBQA 1Z36A 4H3HB 3BZWA 1G2PA 1UK7A 3T7IA 5KQMA 4GFDA 3GJ5A 2GD0A 4YACA 4AKSA 4BNIA 4C5BA 1MZPA 1QJCA 1Q11A 2J6IA 4WQMA 4YRBA 1S89A 3P5BA 1SQSA 3PTLA 3DP7A 4A4DA 1H2YA 4YJ2B 3EXFA 3NBYC 3PQ7A 2I6XA 4E7OA 2I4TA 2N9UA 2P2ZA 2QZ4A 4FR5A 4BASA 3WP0A 4DWOA 5AIBA 4C07A 3GLIA 2HA7A 5I7UA 2VQFB 2VP9A 3JVDA 3R7SA 4JBLA 3OP1A 2FVYA 3A6GA 4TV8B 3IQHX 4MUEA 2C2KA 2XUPA 4ISBA 1ZUNA 4AECA 2H1CA 2W2QA 5HM8A 5B3JC 2Q3EA 1DIOB 1P1CA 4XZ3A 3RC1A 2C00A 4TTTS 4RY8A 1ZHHA 5AP9A 3ORSA 4G4SP 3ZXXA 1VLQA 4RTKA 3L93A 2TECE 2W2KB 4HNHA 3UBMA 2WKPA 2RFLA 4KWHA 1JQJC 3UT5B 2C5EA 2FJUA 5GMOA 1ZAKA 3OIYA 4CEIB 1XK7A