3SK0A

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant dhaa12
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEFHHTEVAEEQDHAEAARETFQAFRTADVGRELIIDQNAFIERVLPGGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGALIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Dynamics and hydration explain failed functional transformation in dehalogenase design.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
total genus 111
structure length 308
sequence length 308
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sk0A00
4N8DA 5JAHA 3NGMA 4Q82A 3B12A 3O9VA 3WK9A 3H0CA 1ZI6A 1XRQA 4U2BA 1VXRA 3H04A 3FOBA 5AO9A 5JD6A 2HA4A 3K2IA 4CIBA 2OQVA 1T4MA 5KWIA 2AJDA 4J0JA 3ESAA 5D7BA 1E5TA 2CEKA 4FWBA 4OU5A 4Y2SA 2OCLA 3TRDA 2XT0A 1YS1X 1ZD3A 2XMRA 4BCCA 3C8HA 3ZV7A 1A8QA 3O4IA 4OSEA 2GZSA 1IVYA 2GYUA 2H7XA 2ES4A 3KDAA 5AP9A 1SCKA 4PQEA 2WG2A 1JMYA 2OGZA 5HKAA 3H2IA 4AZ3A 4IH4A 4J0KA 3ESCA 5HK9A 1AC5A 5HFNA 5FUMA 5AKGA 1VZ3A 4RE6A 5A71A 3LIPA 2PSDA 5EIAA 1IZ8A 4G8BA 4JEIA 5HK8A 2WTMA 4MJ3A 4ROTA 1ZD4A 2HRRA 2AJ8A 4ZWNA 2XMZA 4PV7A 1Q0RA 4MEAA 1W6RA 4XJVA 5AI5A 2CJPA 4Y2UA 5IVHA 2RHTA 4DSAA 2X76A 1W52X 3WL7A 2WFZA 5AIBA 4QWWA 1NX9A 1XKTA 2RI6A 2CMFA 3B3QA 2VJDA 4ZXFA 4WY8A 4FLFA 4L3WA 4UBNA 5K3FA 2PU5A 4YX9A 1XZIA 1LNSA 4G8DA 5HF6A 3WK7A 1EX9A 3EIOA 1ZI9A 4WY5A 3D2BA 3EF3A 4RPCA 5A7HA 4UUQA 3I2KA 3G9XA 2OGTA 2HL6A 5CXXA 1QIIA 3H1AA 4HVTA 4E15A 5ALFA 1FFAA 4GEGA 2JEZA 1VKHA 4H7JA 1UOPA 2OAEA 5AI6A 1AGYA 5AM1A 1MX5A 2WG0A 4FTWA 5LZ9A 2PBLA 1GXSA 4NVRA 1Y37A 4U2CA 2QR5A 2XLCA 2JGIA 1XQVA 5FPPA 5LZ2A 2H1IA 5ALPA 3S8YA 4UHDA 5K3DA 4JH0A 2H9YA 3BE8A 1QGED 1VJ5A 2WIJA 4EHBA 3C45A 1TCAA 3A2NA 3WYDA 3OOSA 4AMZA 4FLMA 2HADA 1LPOA 2GZRA 1ODSA 2XUAA 2ZJ6A 1P0IA 5DWDA 1PJAA 3O4GA 1NU6A 1L7QA 1KEZA 1O6FA 4J0DA 1DU4A 1XZDA 3ZPXA 1R50A 2WM2A 3WLAA 1ZJ5A 4QDTA 4GWLA 1YCDA 1XZCA 4GW3A 4DMKA 4DMHA 2WSLA 4G4GA 1E8DA 2DQYA 2XDWA 4XVCA 6YASA 3LP5A 1W4LA 3PICA 1CFJA 1XRPA 1P0MA 4G4JA 5CTAA 5T4EA 3W05A 1CUIA 3STYA 4C88A 3O9MA 1OXMA 1YR2A 2RIPA 3F67A 5T4FA 1H2WA 2ZYSA 5D3ZA 3AIMA 3B5EA 3GELA 2R8BA 3DKKA 3WZMA 1CVLA 2JIDA 1LPBB 4Y2RA 4KJXA 1XZLA 1PV1A 4Y2VA 1R9MA 2QUBA 2HU8A 1W76A 1EH5A 5HF8A 5AICA 4PO3X 2QJRA 5HZGA 4B0OA 1W75A 1ZOIA 2OQIA 3ESDA 5AKLA 1USWA 4AB1A 3CN7A 3R0VA 2XUOA 5ALGA 5JZ9A 1K63A 3DL4A 3IUQA 3W9UA 2FUKA 2XUHA 4I19A 1BCSA 2PUHA 4X97A 5BWCA 2WUGA 4HAIA 3STUA 4C4YA 1XZHA 3CCBA 1XLUA 4BAGA 4HXEB 2RONA 4H7IA 2C0PA 2NW6A 4UHEA 3FLEA 5SYNA 2VF2A 2LIPA 4H18A 4PW0A 4RNCA 2XMGA 1P0PA 4H7HA 3DJYA 4BRZA 3G7NA 1YSCA 4Y2JA 3H17A 3C43A 5IVIA 2RAUA 3FCYA 2X8BA 4UFOA 2WFMA 1AKNA 4GBGA 4IH1A 2AJBA 4CG3A 4J0HA 4KE6A 1RYYA 4OYLA 3QZUA 5DJ5A 3QITA 3X3HA 1FJ2A 1CUJA 4E11A 4KE8A 1R3DA 1XQYA 5ALYA 1QTRA 1YB6A 3WKBA 3WKCA 2O7RA 3GUUA 4NMWA 1DT3A 4CCWA 1ZGCA 2UZ0A 5SYMA 1S8OA 2PSHA 2IIVA 1MNAA 1IUOA 3BDIA 1PFQA 3S2ZA 4P93A 5LP1A 1LLFA 2QS9A 3F98A 2PKYX 3G0GA 5DNUA 4CFSA 4NZZA 1UXOA 5LZ5A 3WJ1A 2GYVA 3K6KA 4Y2TA 2AJLI 4P08A 1QLWA 2HA3A 4ETWA 1VE6A 5C8XA 4B80A 4Q1VA 4C87A 3HSSA 2G5PA 3BJMA 1Q84A 1XZJA 2HFJA 5AHXA 2R11A 4EY4A 4A23A 4E14A 1CIJA 4BZWA 4H77A 1KU6A 1WHSA 2ZJFA 2RHWA 2FJ0A 3WA7A 4IH9A 4G1FA 3TEJA 1DTEA 2QMQA 5A7GA 1K8QA 1QIDA 5CXUA 2G63A 1CR6A 3BWXA 4BCDA 3FAKA 1J07A 3SC2A 3I28A 4BYMA 1JJBA 1N1MA 1YASA 1XZKA 4P92A 4FKBA 5AK5A 2OG1A 4ZREA 3DCNA 2PSFA 4LXIA 4AO8A 1SCIA 4X92A 2HU7A 4B0PA 3BL8A 3C6XA 5ALEA 3C5WP 1HKHA 4QDUA 2XB6A 5C8VA 4BVKA 4U2GA 2ACEA 1CRLA 2HA2A 5LZ4A 1TCBA 7YASA 1DQYA 2HM7A 2HDWA 4WFJA 3ICVA 2HA7A 1C4XA 5ALLA 1UK6A 4IHAA 5AJHA 5AK4A 5T4HA 2HHAA 2Y1KA 3KWFA 3CCCA 1EHYA 2C58A 3FBWA 5AIAA 3LIIA 5BOVA 4MEBA 1ISPA 4V2IA 3IUJA 4X93A 2HA5A 2WHPB 4GXNA 1DINA 2D0DA 4RGYA 3M3DA 4GI1A 3BXPA 5JAOA 3GROA 5AKZA 2J3QA 4DNQA 2QJWA 3V48A 4F60A 3PUIA 5C81A 5C8ZA 3AIKA 3UMJA 3PUHA 2QXTA 4PNZA 3I2FA 2C7BA 5FRDA 2XUGA 3YASA 1QOZA 3H2HA 1XLVA 3OURA 1L7AA 3C5VA 2OCIA 4OD0A 1U65A 4UFPA 5YASA 2GBGA 2O2IA 4DYHA 4UBLA 1ZD5A 1G66A 1F0NA 1HLGA 2XUDA 1M33A 3BF7A 1ZICA 4QLAA 5LYYA 1UFOA 2H7YA 1AQLA 4M0FA 5ALSA 5JYCA 4BVJA 1C7JA 4MQMA 3ZLUA 1QFSA 2RGUA 3I6YA 1BS9A 1XZMA 2PU7A 3L1JA 4KAJA 2HRQA 5K5EA 3W04A 2CKMA 1TQHA 3OPMA 2VJCA 3HI4A 4WDRA 4B81A 4FFWA 2J3DA 2ZYRA 4LKOA 2Y6VA 2WHQA 3DL7A 5HF9A 4GLBA 4Q34A 3AZQA 2JGMA 2WU4A 2WIDA 4Q3OA 3D0KA 5CW2A 1N5MA 1CUBA 3Q8WA 2IX9A 1ZIXA 2XMBA 4M0EA 1H23A 3VISA 2EDAA 1LPPA 4KE7A 1JJFA 4Y2XA 2XUQA 1MTZA 2WU3A 1QFMA 1NU8A 4A5SA 4HTAA 1AUOA 5K3CA 2QVBA 3FYTA 3HZOA 2WUEA 4PSUA 2Z8ZA 3FVRA 3HABA 2VT6A 4PSDA 2Z3ZA 3WWEA 4HXFB 4X00A 3FLBA 4KR0A 3H2JA 4JYPA 2JGFA 4QEKA 2J4CA 3GA7A 3RLIA 3AZPA 2DHCA 1ETHA 2ZJ7A 2ZSHA 4MYSA 3ICWA 3A6ZA 2I78A 4X6UA 4U2DA 2QT9A 1XROA 4BC1A 5FOQA 4FNGA 3QYJA 4QDOA 3C6ZA 3FVTA 1UK7A 4IO0A 3G9UA 4BTLA 3I2GA 4QE3A 2QOEA 1MU0A 4X85A 3G02A 2JGKA 4WCVA 3ANSA 2WQZA 5ALNA 4IQ4A 3ILSA 1A8SA 1UT6A 2JBWA 2WUDA 1YA4A 4C6HA 5BWBA 2V98A 1IZ7A 4BVLA 2WILA 3DYVA 4KE9A 2XI4A 5AI0A 4NS4A 4FHZA 1QE3A 3WZLA 1CUVA 4KEAA 5CH8A 5BV7A 3D7RA 1EB9A 1LBTA 4KRYA 4UBJA 1JMKC 3H18A 1A88A 2QTBA 3G0DA 3E0XA 5ALKA 2YXPX 4KRXA 1HBJA 3DEAA 1U4NA 2XQFA 1QIFA 1UKCA 3PI6A 4Q3LA 4FFVA 5CURA 3WWOA 3AUKA 3KD2A 1K6EA 3AJAA 3PE6A 5AI8A 5LLSA 3HC7A 1AZWA 5AM3A 1GGVA 5C7YA 3WKAA 1ZGBA 4YASA 3CXUA 1CUDA 1G5FA 5A7FA 3QM1A 1EDEA 5EHZA 1QIMA 3IULA 3HYSA 3WWDA 3L1IA 5K3BA 5IH7A 4QWMA 3STWA 3JWEA 5DTIA 3M81A 3LLCA 4B83A 3LCRA 4X95A 3IUNA 3FYUB 3E4DA 1XKLA 3IUMA 1N5RA 2C5FA 4GDMA 4KYVA 3DDUA 1EXWA 3E1GA 5K3AA 1BEEA 3IA2A 4OB8A 3VDXA 4BAUA 5ALQA 2Y2UA 2HU5A 1WPXA 4EUSA 2I3DA 4X6XA 2VJAA 3DOHA 1F0PA 3K9BA 4FLEA 1CUGA 1MT3A 1VXOA 2BAGA 4I4CA 4OCZA 2VAVA 4WFKA 2C4HA 3HRHA 2XUFA 3IVMA 5CT5A 4HXGA 3WA6A 2OGSA 3VXKA 5DNWA 2B4KA 3F9CA 3U0VA 5LIPA 1H2XA 1YB7A 2B20A 3WKEA 1WM1A 2YASA 4BB0A 2DCMA 2BUAA 3I2JA 4BAZA 2WLSA 2VAXA 2WHPA 3C87A 4OU4A 3AZOA 4B84A 5AKKA 2AXEA 2XQKA 5ALMA 5AM4A 1UOQA 1GPNA 2D5LA 4W63A 4XX1A 3PF9A 2XQGA 1J1IA 4FOLA 1MNQA 2QRUA 4B9EA 4TGLA 4GECA 1THTA 1D07A 1JFRA 1X2EA 4MQLA 1DQZA 4BRSA 4WJLA 3VVLA 4DMCA 2ECFA 3QMVA 4DGQA 1XRMA 3D3NA 5I7UA 3DS8A 3QH4A 4B9AA 4M0MA 4KAAA 3IIIA 3ZLVA 4EZIA 4B7ZA 1E66A 4DNPA 1XRLA 1HPLA 4J3JA 3V1MA 3I6MA 3VJMA 1AX9A 3LS2A 2OXEA 2E3JA 1XRRA 4LHEA 1MN6A 2ZVDA 2V9ZA 5DYYA 3W9BA 1J06A 1AMNA 3ED1A 1TIBA 1QO9A 2HA0A 3QMWA 2DHEA 2YH2A 1L7RA 3DLTA 3QPDA 3AFIA 3FSGD 2VQ6A 4Y2PA 2XMSA 1CQWA 1R4ZA 2WIKA 1GQSA 2GBFA 1ACJA 2OLEA 4LXGA 4UBMA 1MO2A 3WK8A 2ORYA 2W22A 3EBLA 1ZJ4A 1CUXA 5E2IA 2XMCA 3R40A 4H7FA 1QONA 5ISMA 3HXKA 1IMJA 4HZGA 1CLEA 4L0CA 1VOTA 5IVKA 3OG9A 1G42A 1XRNA 3DQZA 1E8MA 2FJPA 1FSSA 4FMPA 4N8SA 3IURA 3VJKA 4ZRDA 4BBZA 3F8SA 4HRYA 3WL5A 5DTJA 3D59A 4QNNA 5JARA 5EGNA 1MAAA 3H2KA 1UKAA 2WUFA 2DQZA 2JGJA 2ZYHA 3PFCA 4F21A 3R41A 4G9GA 2G4LA 4C4XA 3BIWA 4MWSA 5HFAA 2V97A 3WMRA 3WIBA 2XE4A 5ESRA 1VA4A 4G4IA 4X90A 1WOMA 4YPVA 1B6GA 5JIBA 3P2MA 2WTNA 5D3KA 3IBTA 4AMYA 3G8YA 2PSEA 1R1DA 2VSQA 4J0IA 3WK4A 2CB9A 4G8CA 5CH3A 3SWWA 5ALWA 2HA6A 1R9NA 5JD4A 5ALUA 2AJCA 2DR0A 1XZAA 4F0JA 1QTIA 5AM2A 2VA9A 4P9NA 2GBIA 5E4YA 3KWJA 5CMLA 1DX6A 3MUNA 4K5QA 3GFFA 5AI4A 5EIEA 1H2YA 1ORVA 1Y7HA 4ZV7A 3MUOA 3SK0A 1MJ5A 4BTVA 3OTQA 5CH5A 2K2QB 1TKRA 5CRIA 3EQ9A 3C6YA 3I6ZA 4CIAA 5JALA 1QIEA 3WL6A 2Y2VA 2JGEA 3G0IA 1DWQA 4UHCA 3U1TA 3CN9A 3FYUA 2ZSIA 3GBSA 5KBYA 4C01A 4H0CA 5ALXA 5EIHA 2I03A 3RK4A 2B9VA 3DNMA 5J3JA 3T4UA 4PF1A 5JASA 4N8EA 2BUBA 1GQRA 4J0GA 1QO7A 3H1BA 4K2AA 1LPSA 4BC0A 3V1LA 3EQ8A 1CUHA 4S0XA 1YAHA 2JEYA 4H7KA 4QDZA 5FPQA 4TVKA 5AK3A 4QZVA 2XUIA 3DYIA 3WK5A 4JNCA 2QKYA 1LGYA 1UKBA 4W1SA 2PPLA 3QPCA 3Q0TA 4EY6A 2ZYIA 5ALZA 1CEXA 3G0BA 5D6OA 1TAHA 2PUJA 4K6HA 4DM7A 4ZI5A 1BROA 1XZEA 3AIOA 4X71A 3C8DA 3MVEA 4LYEA 4CCYB 4ARAA 3R3XA 1CUFA 1EA5A 1UK9A 2XMQA 1XZBA 4QA9A 1SCQA 3GZJA 2WIGA 4I3FA 4UHBA 5AKIA 2EEPA 2CZQA 3IDAA 3R3ZA 1GKKA 4KAFA 5I9IA 4EBBA 4FBLA 4EA6A 2J4FA 5E4JA 1K4YA 5AOBA 1QIKA 1XLWA 1BE0A 5JD5A 2GBCA 5DNVA 4X91A 1J2EA 5E4TA 2CUTA 1TK3A 5AOAA 2OCKA 3HLKA 4BP9A 1RP1A 1P0QA 3O4JA 2Z5GA 1E89A 2BJHA 1UK8A 4J0CA 3W06A 4BATA 1UOOA 4OYYA 3FYUC 1N8SA 1WHTA 3H2GA 4W1QA 4AN0A 4OB6A 4LIPD 4UBIA 4MYDA 3FSGA 1QIHA 1TRHA 1CUSA 4X6YA 1I6WA 1LZLA 4K6GA 3D2AA 3MGAA 4C89A 4Y2YA 4X94A 1GKLA 2QM0A 2PSJA 4MWTA 1SFRA 4FDMA 1Q0ZA 4U2FA 2VATA 1DWPA 4DTCA 5DLPA 3A2LA 1GPKA 4AN1A 1MAHA 5A6VA 3TGLA 2WJ6A 3G9ZA 2ONCA 1W1IA 2OCGA 1F6WA 5CT6A 3ZWQA 4L9AA 1EB8A 1EK2A 1BRTA 2WFLB 5ALOA 1JU4A 1FFEA 3WJ2A 2WJ4A 4B82A 4DSZA 1X2BA 5ALHA 4G5XA 1F8UA 5FLKA 1H22A 4DLNA 3D2CA 3WK6A 4A16A 5AK6A 4AQDA 4B6GA 3WL8A 2OAGA 5HQ3B 5FXMA 5LKRA 3HEAA 4J7AA 4LYDA 5F4ZA 3QPAA 2W6CX 3R3WA 2JF0A 2HIHA 2V96A 2BFNA 5JATA 2XLBA 1YA8A 5AOCA 4W1PA 5CT4A 4D9JA 3BDVA 3O0DA 2O2HA 4N5IX 3V9AA 1EK1A 3G9TA 4DIUA 2OPHA 4Y2QA 2BGRA 4LXHA 3D4LA 3JYHA 4DNFA 1ZD2P 4BP8A 2XQJA 5FP0A 5JAUA 3DKRA 1WB4A 1ODCA 1A7UA 3BIXA 4RE5A 5EHXA 1CUCA 5HCUA 2XMDA 3EQ7A 3C70A 2C5GA 1Y7IA 5JZSA 5A62A 3ZI7A 2QXUA 1THGA 1KU0A 3NOXA 3STTA 4QDXA 1VE7A 3WIOA 2O7VA 3WI7A 1QZ3A 1EINA 4MXDA 1XQXA 2JGLA 1MX1A 5CT9A 4UBKA 4CG1A 1ACLA 3AILA 4UHHA 5LKAA 1Q83A 3M82A 1CQZA 3WKDA 1CUEA 5KREA 2BCEA 5I8PA 1LZKA 3PFBA 1FFDA 5JAPA 1JJIA 4WFIA 4HS9A 1E8NA 2XUJA 4O08A 4EY8A 2WJ3A 1WB6A 3KOOA 5CBKA 1T2NA 2XUKA 1A8UA 3UUEA 3I1IA 4K6KA 4BZZA 3D5EA 4OB7A 4Q3KA 3FLAA 1BN7A 4INZA 3C6BA 4OPMA 4TPKA 1XZFA 1CUUA 1BN6A 4X7BA 2VT7A 3RARA 4FBMA 3I1YA 1BCRA 1MX9A 3QVMA 2HFKA 2WHRA 4ITVA 5K3EA 1B41A 1LPNA 5EFZA 1ZI8A 3PF8A 2YYSA 2EDCA 5EI5A 4BE9A 4BDTA 4WDQA 3A70A 3NUZA 1C7IA 3E3AA 5HF5A 3T52A 3F96A 4N5HX 1AURA 1JT2A 3H19A 1BEZA 2BKLA 3N0TA 4H7DA 2DSNA 2G5TA 3DD5A 2VEOA 5DYWA 4EB0A 1ODTC 1JU3A 5AKYA 4AX4A 3V1KA 4F5ZA 4UFNA 2P8SA 4BDSA 1XFDA 5ALTA 1OCEA 1CPYA 1UWCA 5CT8A 4J03A 5T4BA 3ANTA 4Y7DA 2GYWA 4W9RA 5K3FB 1H2ZA 4AO6A 2X5XA 1VZ2A 2H7CA 1CUWA 1DT5A 4ARBA 1SOMA 1QIGA 4CCYA 4UPDA 3WWCA 3ESBA 3O4HA 5LZ8A 3KSRA 4G9EA 4JYMA 4UBOA 1CUZA 4HRXA 1IUNA 3RKSA 1Z68A 5AM0A 2XUPA 5ALRA 2ROQA 1QJ4A 1GPLA 1SC9A 4PSCA 3A2MA 4H7EA 3M83A 5EHNA 1WPRA 1XZGA 4AZ0A 4Y9SA 3VKFA 2DFPA 2XQIA 1VLQA 1ORWA 4B85A 5H3HA 4XWGA 2PVSA 1GZ7A 1ZIYA 1K5PA 3F97A 2QUAA 1HDEA 4CG2A 2I3ZA 2VTVA 4BE4A 1TCCA 1GT6A 5A2GA 2WKWA 3WQHA 3PDCA 1WB5A 1YAJA 3I2IA 2PL5A 3IB3A 3G0CA 2Z8XA 5JANA 2WG1A 1X70A 2WIFA 2CBGA 1U2EA 3QBJA 2IITA 4EY5A 3FNBA 3KXPA 5IVDA 1XQWA 1OILA 3HACA 1QIJA 4H35A 4Q05A 1G4HA 3W2TA 1DWOA 5JADA 3UUFA 4UHFA 3NWOA 4DMFA 3HJUA 1WCYA 3SX4A 1CUAA 4FNMA 1YS2X 4W1RA 5AKJA 3L1HA 1EDDA 5AM5A 3WYNA 3ZLTA 2PX6A 3OM8A 5FKJA 2QZPA 1CUYA 3BF8A 3FCXA 3RM3A 3WWPA 3VJLA 1DX4A 1EVEA 4YK7A 5HKBA 4X3CA 2ACKA 1BU8A 3VVMA 4Z49A 2O2GA 2DHDA 1EVQA 4ZGBA 1IUPA 1JKMA 4U2EA 1EI9A 2B61A 5IKXA 4EY7A 4BCBA 1VA5A 2WFLA 4OUKX 5AKEA 2VJBA 4XIIA 4QLOA 4AO7A 1MPXA 5FDFA 4GHWA 5AKXA 3I2HA 4ZV9A 4C4ZA 1LBSA 5FV4A 5JZBA 3OC0A 1UZAA 5LZ7A 1EDBA 3AINA 3BJRA 4CI9A 3O95A 4AXBA 3TJMA 5EHQA 5HQ3A 2BGNA 2C0QA 3DOIA 5ALJA 1FFCA 1O6GA 2BUCA 3V1NA 4JUIA 4L72A 3STXA 1U8EA 2PM8A 5DYTA 4DNOA 5ALVA 1HQDA 1RWQA 1HL7A 5ALIA 1LPMA 3STVA 3JW8A 3FWHA 1CV2A 2FX5A 1JI3A 2Z3WA 4KACA 5KWJA 3R3YA 2Q0XA 1R88A 1LPAB 3QMMA 5AH0A 5AI9A 3N2ZB 3R3VA 1FFBA 5ALDA 1E3QA 5AKHA 4E46A 3R3UA 2Y6UA
chains in the Genus database with same CATH superfamily
1FZTA 1JSRA 1SK8A 4BUJA 2K7ZA 4M8LA 4G1CA 5JQGB 5K0SA 4N8DA 4RKWA 4KAXA 3SOPA 4IKPA 3BKXA 3CTMA 5JAQA 6REQA 1U9IA 2WYHA 1K5DA 3GLHE 4M1MA 3S7TA 3V8NA 4CCSA 4ZI7B 4PAWA 1K5GA 4D4LA 3UG6A 1ZI6A 3QE4A 1XRQA 2IE8A 1C3OB 1YULA 1JG4A 4I55A 4U2BA 3AEUA 1W5AA 2SHKA 3EHDA 3H04A 4NYJQ 1DQRA 1SUPA 3VO2A 1R6UA 1NMYA 1SVOA 3AUAA 5GVSA 1FCJA 3FSRA 4DCGA 1CJTC 4RVUA 3ZHUA 3H5TA 3DWGA 3SAJA 4WNCA 4YY3B 5BYBA 1PZHA 1JXOA 1BS1A 1GQFA 1T5IA 3IV6A 5LMZA 2J9XB 3IOBA 2F90A 3ESAA 5D7BA 1R5OA 4QGHA 2Z04A 2OAP1 3OQJA 4FWBA 3DTYA 3IAUA 3HZHA 3CVUA 2HK6A 1FB5A 1HFKA 1SZCA 1VBNA 4Y2SA 3TD2A 3U4QA 2MMCA 2OCLA 3A1EA 4JQOA 4Z4EA 1ZIOA 3HDYA 2RGGA 3X1MA 3P27A 4UVGA 5JSZA 5IF9A 2XMRA 4RESA 1Z2AA 4BUCA 4MPRA 3PRHA 1A8QA 4OSEA 4DT1A 1BZYA 4LJRA 1MHTA 3HR7A 2H7XA 3TE7A 2GYUA 3TZHA 4P5DA 5SY9A 4TKLA 4JVNA 1PQPA 4G07A 4KLZA 2HLHA 4C0HA 1JMYA 4ZQCB 5J2TB 4KV7A 3IE0A 3BPSA 5HKAA 4NJMB 1E6MA 3JQ9A 3FPAA 5EIOA 2HMYB 4HUJA 4BASA 4RTPA 1V6AA 4FFDA 2ADOA 3PDUA 1QX4A 3CLUC 4B6EA 1RRVA 4J0KA 3HNRA 4KIJA 3BH6A 1T2FA 3I4FA 2AR0A 2QL9A 3OT1A 4K3UA 3VR5A 4WBNB 5FUMA 2ZT7A 2XNJA 4QAQA 2CK3D 1N9GA 1UDXA 1VZ3A 1Z7YA 2B3DA 2QROA 3KB1A 3WLOA 2YJ4A 4RE6A 2X2PA 2IHKA 3Q8XB 4DLYA 2I5PO 3G49A 2VP3A 5KDLA 2C4UA 4Q1BA 1Z6YA 1YZYA 3AR4A 3G5TA 1IZ8A 3VTFA 2WICA 3SHOA 3X44A 3ISJA 4JEIA 3O75A 4D9FA 1Q2XA 2L2QA 1Q16A 1S2MA 2K87A 2VHZA 4IX9A 4J2HA 2VJPA 4JKIA 5J2UB 3NLLA 3T1QA 4B1FA 3BD7A 2QQ5A 4PXAA 1N3IA 2REXB 1ZD4A 3TZQA 2FEAA 3HDHA 4GSYA 4J49A 4HGQA 4LE2A 4FS8A 2AFIA 2C2HA 4R1LA 2XMZA 3BJIC 2ZTUA 3E9QA 2AGVA 1F5NA 3C3CA 1L7PA 4JLKA 1I36A 4PLGA 4PQRA 4XTCS 4D42A 1OI4A 1I7PA 4GX2A 5DMHA 2IPMA 4HSEA 3UJ8A 4MEAA 3KIPA 2K6GA 3NT2A 5CFOA 1KH2A 1YL7A 4LRYA 4QD3A 1RLIA 4J0FA 5AI5A 4WOCA 2CJPA 4Z0TA 2SCUA 3IAFA 4KSBA 3H2YA 3LY9A 4Y2UA 3TINA 1QVWA 1IBKB 2ZAGA 1XZNA 3D3WA 3BD6A 1M8GA 1H69A 4U8GA 2OOSA 2W2XA 1CVIA 3D8HA 3U3RA 4ZHQB 4N39A 4ZAFA 5EXDA 4OUDB 5IKPA 3GA5A 1G5IA 1H6BA 4RJ2A 4EYQA 5ELXA 1S2NA 2FW8A 4RM3A 1GCAA 4TTTS 4AULA 5AIBA 4EF5A 4II3A 3NIDB 4QWWA 5LCXA 1NX6A 3LM8A 1NX9A 2VPYA 1LRKA 2RI6A 3QVUA 2XOKD 3GLIB 3BE4A 2DEUA 1UMKA 2F64A 1IWBB 1LCIA 4J6FA 3NT5A 4ND1A 2YZKA 4N9WA 4ZXFA 1Z4QA 3M4YA 4TVSA 2N1MA 4RSHA 4QHTA 4KR9A 1XZIA 4MICA 7ADHA 1SXGA 5HFJA 1SD1A 4E7OA 2AFHA 5BQ5A 2GEVA 3N7TA 3SN6A 1OWNA 1TDJA 4C4SA 1R4NB 1WG8A 2Y9MB 4KLRA 4OIMA 5HF6A 3L5KA 1S1CA 5CPFA 3VTZA 1KYIA 3W34A 1I6KA 2I4OA 1EP9A 4GBJA 4O4IB 1EX9A 3AESA 2JGNA 4JJ8A 4QRIA 3FUTA 4R83A 5DDIP 4ESEA 1ADBA 1JTFA 1UJ4A 4JL8A 3CH7A 1CIVA 4UMEA 5BORA 3HJHA 3MW8A 3EF3A 3SP1A 3E3LA 1V11A 3M6VA 2GCOA 4MMYB 1QHYA 5HSGA 2P6NA 3A3KA 3EGDB 2UUPA 4FMDF 4C0KA 3PPIA 5KQRA 4CNQA 3U7QA 5FHQA 3DMHA 3G9XA 1P5JA 4XCXA 2XAUA 5CB0A 2ZM5A 5LQUA 1NVAA 1TM7E 2X7HA 1A04A 5T67A 3T7EA 1H0HA 2QAJA 3KT0A 2FWMX 4TTVA 1XZ8A 3GXOA 3H1AA 3T15A 3T34A 3TAXA 3PUZA 3OQHA 4GEGA 2OEPA 2YV1A 4KU4A 3D43A 1NM5A 1JG1A 4H7JA 1Y8CA 4LYHA 2G72A 2OAEA 2FPWA 3FNGA 1Y5LA 3JZDA 5AM1A 2CXUA 2V6IA 4JQCA 4B3GA 4Y0AA 4LZZA 2B7CA 3MTGA 2VK4A 3T54A 2JCXA 3O0TA 4TUYF 1GXSA 4MW5A 2DQSA 1EM6A 4RHUA 1TEZA 4MVJG 4J8PA 4Y9DA 1HTBA 1RTTA 4LMRA 4Q1FA 2VP2A 1M0WA 1EX1A 4NI5A 1EFVA 1G9XA 2Q3EA 3SM3A 3UT5B 4DEXA 5FPPA 5JHHB 5FBRB 3ZU3A 5M7EA 4K9NA 4JMLA 5K6TA 1RM3A 3W9YA 4PSCA 1L5YA 3TW8A 1RABA 4EGCB 1FMLA 1CZLA 4X1YB 1E1KA 2E49A 3DP7A 5K3DA 5FQOA 5HS4A 1BC5A 2D2VA 1NJ5A 4WLNA 1C30A 1TB4A 5KKCA 5M34A 4G9BA 1VRCA 3BE8A 5EP1A 3HV0A 4CQJA 7REQA 1MT0A 4G1VA 2BTEA 5TGDA 3OE4A 4AP6A 4EHBA 1RI2A 4K9DA 4DV0B 1YJ8A 1M10A 3Q3IA 3DBHA 3Q6MA 1DAKA 3T99A 2CWWA 4TYQA 1A7KA 1AKMA 2RH8A 2P7HA 2R8PA 1UDWA 2BSXA 3OOSA 4M1ZA 4N12A 4OP3A 3DOUA 4AMZA 5HRCA 2FW9A 3FCOA 1MC8A 3N8IA 3HDTA 1IY1A 1ODSA 4IUBS 2XUAA 2Y93A 1P0IA 3G7UA 3VNBA 5IM4F 1XMSA 5AVTA 4XXHA 2ZUCA 3NH6A 3JALA 2IY8A 5KQPA 1FUYB 1N6NA 4LJSA 1U0OC 1Z26A 4R1NA 1A9YA 1GRRA 3AFNA 2CXSA 4UHJA 2YWXA 2PVPA 1KEZA 3VVBA 3INGA 3VJLA 1HDCA 4W99A 3VSDA 1Z8DA 1QZZA 1QV9A 2HC9A 4YXWA 3R7WA 1MX3A 1NNLA 1O6FA 2P78A 1TADA 3AUFA 1Z9BA 4WLFA 4YALA 2CCGA 3HP7A 1Q44A 4LHXA 5EUCA 1XZDA 3BWDD 4HV4A 3ZIUA 1QP0A 3N05A 3BB3A 1V2GA 4CQLA 2JDIA 4R2WA 6AT1A 4YMUA 2WV9A 3LG2A 2VWPA 2IY9A 3JQAA 3WLAA 4TKMA 1IXSB 3LK6A 4TV8A 1X1BA 1R7RA 2QYHA 4P7KA 4RD3A 4QPJC 4YJ2A 1HRDA 3BERA 2J3JA 1IRXA 1NXPA 3DC2A 3PYLA 1X86B 3CKKA 1QAMA 1UC8A 2A5DA 2W2MA 4Q03A 4ZQBA 5DLEA 4PNEA 3A1NA 2PGNA 2A67A 4JLVA 4G4GA 4UCXA 1QRTA 3IIJA 1G8YA 4B4OA 4D1YA 1OXUA 3ZU2A 4DR5B 2DT5A 3LP5A 1USVA 1U2RA 1HDGO 1CFJA 4QEZA 1WSWA 3KQHA 1ZD9A 1QHIA 3OT5A 4PCUA 2V7GA 1F8FA 3H6KA 4YS6A 3ND8A 2Z6VA 3AUUA 1H3FA 2AOTB 5I9SA 5GV8A 1W1UA 2Q2VA 1U6JA 1EP2B 4JFAA 5T4EA 4ZAZA 1O6CA 3DQQA 4K88A 4C4XA 3DUFA 2HQ1A 3HBFA 3W05A 3GFGA 3UUGA 4TLLB 3STYA 3K0EA 1EUCB 3Q5EA 2O06A 4WRRA 4CN8A 1ZS9A 3L8HA 3RC2A 4LSZA 2JFBA 5H3LA 1NXOA 5HXAA 3S27A 1ZJWA 1L9KA 3L7BA 1SGWA 2RAVA 1OKKD 3HNOA 1PBTA 1V96A 2NADA 4N3CA 3RF7A 1Z73A 3Q98A 3HJCA 5D85A 3EVGA 3OPYI 3O5AA 3SFZA 4M0PA 1H2WA 3S68A 4AF8A 2ZI5A 5E1MA 3D64A 4ER0A 5DTMA 3N7UA 1NBOA 1DGQA 2B4QA 3N7AA 4M7WA 4U7DA 4IKOA 1K88A 1OREA 3ZKWA 4E2FA 1CVLA 1VI6A 3ICOA 3NGLA 5KJCA 1R4MB 1LPBB 4Y2RA 4KJXA 2MR6A 3U7GA 1RAHA 4AZ3B 2ZP1A 2G76A 3O38A 4KRGA 3WGJA 4BX9A 5H9VA 1YZUA 1RHMA 3B1ZA 3ROZA 4D9BA 3ADBA 4UTVA 4JB2A 1PV1A 3KZNA 2OXFA 4Y2VA 4A6PA 2QUBA 1W88B 2FQXA 1ZSNA 2HU8A 2P62A 2IH4A 4R2JA 2WTBA 1CZUA 1EH5A 1W76A 2AE2A 5SY4A 3GJ7A 4AYWA 4BEWA 4KP7A 2VK2A 1QHNA 3HLTA 1KI3A 4PO3X 5FFMA 5P8WA 4XDHA 3S70A 4BU0A 5A4JA 5CHYA 1A5SB 3V4LA 3KAKA 4YIKA 4E7PA 1W75A 4KGDA 2XYQA 2V5VA 2OQIA 3NKFA 1BH6A 2QJTA 1SU6A 4PYIA 3N87A 1KRWA 1FLNA 2XYVA 4AB1A 3TGPA 3CN7A 3FROA 2XUOA 3ON5A 3TLBA 4MVJI 4ZDWA 3UY4A 3WNZA 4M1YA 2EJWA 1GZ4A 3UAXA 1TM4E 3IPLA 3IUQA 3U17A 4EKYA 5A4FS 3DF7A 1GRCA 3H1EA 4IIJB 3AO0B 3ONNA 1C9DB 4FBGA 2I91A 5B7NA 5MFPA 4IHQA 4RSRA 2BPOA 4IGEA 1F2VA 3OT4A 1E96A 3MOGA 3DE1X 3FTQA 3GLHA 4I19A 3Q9SA 1L5GB 4OKSA 1BCSA 2AK2A 2TMKA 4KPEC 2JFGA 2W6ZA 2O2SA 1PGOA 1XNGA 3OZGA 4ENTA 4HVLA 4BEJA 3IHKA 3EMVA 4ZT5A 3WYEA 4A1FA 1Y33E 3MBOA 4OMCA 2BFBA 2IOYA 4YCDA 2G9NA 3PCTA 1KQ3A 1Z35A 1VL0A 4MMZB 1U3GA 4N82A 3UJHA 3HDGA 5C80A 4BAGA 3QVOA 1U8AA 4FEAA 3TTVA 4H7IA 2C0PA 1VPWA 2RK6A 3ELWA 3GJZA 4LDZA 4DREA 4IGAA 5KWSA 1A72A 3NS7A 3F1KA 2DHQA 2VF2A 3MJFA 2HQOA 2RIRA 2VDMB 3PQEA 3UBMA 1T9HA 2GCGA 4P98A 3P94A 5ILGA 3RHSA 2A3NA 2QTGA 3F5MA 3HB1A 5EA2A 4CMIB 3UAYA 1DIGA 4FCWA 1PSWA 1T0BA 2NQTA 2X1HA 4UEWA 2QVCA 2RGNA 3VR6D 1D1QA 3WFZA 4D8WA 1EJ6A 5SZJA 1PZGA 4JEMA 2PKCA 4DWWA 4IJUA 1U8FO 3IP3A 1AK2A 2XB4A 3TUZC 1YSCA 3DE5X 4IRMA 4CV1A 4Y2JA 3P19A 3QW4B 3ETEA 1Q7EA 3PHHA 1OFUX 1IJKA 4GZ6A 5KWVA 4UUPA 1SCNE 3LA8A 1ZZEA 4PYRA 1ZAYA 4D9HA 1U7XA 5BWNA 5JAZA 1EU1A 4BEBA 1T3GA 2E1RA 3DCIA 2FOXA 2JCBA 4CG3A 1SZPA 1WEHA 1JDZA 2V1XA 4KE6A 4O1MA 1XRJA 2PKQO 1TQ8A 4JI5B 1HL3A 1ODLA 1Y4AE 4B3RB 5BP7A 3QZUA 4GXTA 3FZNA 1YR1A 2VP0A 4UQLA 2X6TA 3FFBA 3SEQA 3COZA 1TKCA 5LOVA 3GYBA 4OHVA 1CUJA 5AVYA 3I5MA 1P5FA 1YIDA 3FWNA 1XQYA 3A4TA 5H9WA 4G56A 4NHEA 4HZUB 1J2YA 1UBFA 3CTPA 1QTRA 2QZSA 3EOBI 3T7DA 4YRKA 3OVMA 1YB6A 2IZZA 3MWJA 5FADA 3WKCA 1T8UA 1ZU5A 1CJKC 1A69A 2X8WA 3D6AA 3LP6A 4NMWA 5ENDA 3VV2A 1TUBA 1NUTA 1LK5A 2ATVA 3B13B 1DT3A 3JWJA 3QUSA 4CCWA 5KYUB 1W36B 4O2BB 3C85A 1IZZA 2PSHA 4YECA 4TT8A 5A9TA 4EP1A 5LQRA 1MNAA 4KIGA 3ZEIA 5KJ6A 1PCXA 1UMCA 4FKZA 2QQFA 4WOBA 3S2ZA 5CFMA 1R6BX 1QQAA 1Y3AA 5F2EA 3GFBA 1LLFA 3RGGA 1SELA 1L4FA 1U2ZA 1W36D 3EMDA 3T7IA 3V42A 3ES9A 1R0YA 5FWXA 2FZ4A 5DNUA 4F04A 4EPVA 1KI6A 2X1LA 5C8YF 1QAOA 2BFEA 4MLZA 2HPZA 2LCFA 1EA7A 1BKYA 4NZZA 4O4JA 3C3BA 3CCFA 4JKOA 2JLQA 5IS2A 3VV3A 3K6RA 4DRZA 2L17A 1XR3A 4YRGA 1JQDA 3FZEA 3H6GA 4Q16A 4HD8A 2OKGA 2GM5A 2B2CA 3M6XA 1TEXA 5BSUA 1DFGA 4ZA2A 4AWBA 1M1YE 2CNKA 3D02A 2Z6QA 3RAJA 3DXZA 4AZTA 1SQSA 4UTXA 1QLWA 4MMXB 4JVSB 1PZEA 1JNYA 1ND6A 2PS1A 3KVVA 5DNDA 1TM1E 1VDMA 3ZHBA 5JCJD 2ZAOA 4N49A 2ZTMA 1JEOA 5C8DA 3DHYA 1N5IA 2QIPA 1BW9B 1Z7GA 3PBKA 4B80A 2WTEA 5HP4A 3CUKA 4CLRA 4I7EA 3DWFA 1C4KA 2DPGA 1Z18A 2OZLA 2ETXA 3CSSA 3BJMA 3IHWA 5ECWA 2XE7A 4ZT6A 5L7TA 1Q84A 2VAPA 1YMUA 3NVMB 1XZJA 1YGYA 3OZTA 2X5OA 1ABFA 1OFGA 1T0HB 3B1FA 3ESZA 2W4QA 1V2HE 3BB1A 3L7MA 4B6RA 4EY4A 4E14A 1DE0A 1SUSA 3SXUB 1QQ7A 1ILWA 4BZWA 1A4XA 3NBZC 4JJEA 4E2YA 2VF7A 2ZQZA 1KU6A 3TLGA 5JYEA 3LYUA 1RYDA 2IZ7A 1T10A 2H11A 2GRUA 1TU4A 3NP7A 3PEUA 1VL8A 2Q5FA 5LP6C 1S6YA 4G1FA 4HQFA 4LQDA 4PLHA 3TEJA 4A3SA 2R8EA 4CF7A 2IH5A 2HHLA 3GLVA 3WV5A 3KR2A 1QKJA 3GVCA 1B0AA 4FSHA 5A7GA 3W79A 3FPKA 3V4RA 3EDRA 5DHAA 3PGJA 5PGMA 3T4PA 3P9IA 2OFOA 2YWRA 3SC2A 3SQXA 4JK3A 1R9GA 2QLFA 1N1MA 1YASA 2BSQA 1WMFA 1BJTA 2F3UA 4N0EA 3I4CA 1U0GA 2WHXA 3JWIA 4M87A 4HHEA 3U4CA 1UBGA 4DLLA 4L8LA 4M9RA 1EXDA 3PUYA 4HPWA 2G4VA 1WZ2A 5AK5A 2I2WA 2XHZA 4MRMA 3Q9LA 3L05A 5JRDS 4ZO6A 2IH2A 5E2AA 3NHYA 2QWXA 4TRMA 4PGAA 4EMSA 3PDIB 5AW0A 3ZE6A 4QLBA 2DY0A 3OZXA 5E6SA 2AMLA 1T8WA 4RVFA 4P54A 1P1FA 1ID1A 2X8LA 3CMCO 3MJTA 3BL8A 1M2OB 4ON9A 3C6XA 5ALEA 4A0GA 4R51A 3IXQA 3N0VA 3DB1A 2NVWA 4XAQA 3R77A 2O2ZA 5IZCC 4P0TA 2ACEA 3K5WA 3L06A 2FQ1A 4O8ZA 1Y8QB 2JBAA 4E1AA 4NPAA 4MGIR 2HA2A 4BNNA 3LT1A 4RK1A 2NXCA 2YWDA 3P4UA 5BY2A 1ZW1A 1QQBA 2PMFA 4HUQB 4EFMA 4HC4A 4F4CA 4MUXA 3LLUA 5GJWC 5DZSA 2IPNA 3R5TA 4D7AA 2QZ4A 1QQ6A 4LK3A 3O7MA 2AQIA 1M2EA 3D1VA 1JP7A 3GAFA 3FPBA 4LJKA 2FV8A 1OR8A 4MWOA 4LCEA 1L7VC 3V4ZA 3EEOA 1ECCA 1FDOA 1UK6A 3LDHA 5BVGA 1RAFA 3P2EA 5F5LA 2I1QA 4IHAA 4DA0A 4DQVA 4R0MA 1XD9A 4P4SB 1G8JA 3IT0A 1P4RA 4BB9A 1UBCA 4A26A 1EHYA 3L1KA 5FWNA 5K0GA 3RU2A 4MEBA 4JBLA 1ZJYA 1NXSA 1QTQA 3CYFA 5AVSA 3I2YX 1XNRB 1QORA 5IAJA 2P6RA 4LNUA 1WNFA 4V03A 2CL0X 1F0YA 5I9TA 2HJRA 3EIFA 3L7LA 2A1UA 3WRYA 4RIEA 1DINA 4HNVA 2YFHA 2GPJA 4CDNA 3M3DA 1I13A 1U2SA 4GI1A 4U6SA 2WI8A 2JIZA 1RI4A 5AUOB 4X45A 4XQGA 2R48A 2V55B 5BPFA 1QRSA 3BFPA 5BMVF 3NH9A 3M9LA 4OGFA 2V1UA 1YZKA 5BQOA 4NU6A 5EQJB 4KMSA 1JU9A 2HRBA 2P9EA 3FRHA 5ITVA 2DKNA 1HG1A 2FLKA 3I1JA 4TRNA 4MVXA 4Q3NA 4CDGA 4HUTA 3W3ZB 3RVBA 2E5FA 2PQ6A 4TLDA 1C9EA 1QXSA 2HMSA 3LPDA 3U13A 5L3QB 4YMHA 2CN1A 1X38A 2OCXA 3KLNA 3QFFA 4YI3A 2REOA 1EHCA 3NHWA 4RXMA 3QTBA 1J8QA 1IN4A 1T8RA 3RBVA 4U6QA 1ZD1A 2HB6A 5EWJA 4ENQA 1Q91A 2IS1A 2OL4A 3I2FA 5CXSA 2C7BA 1N5OX 5FRDA 3JPYA 3NBAA 2X0RA 2BMFA 5A3RA 5B7PA 2XKKA 1DWUA 1VSVA 3RYHB 3ETGA 3WYBA 3L8DA 1WVIA 2XA1A 3KQWA 3OURA 3LECA 4HMOA 2P41A 3C5VA 4U7FA 4MQ6A 1LV7A 2WSSA 1PZNA 4LJYA 2NUTA 4MWCA 4K6OA 4KRFA 2OFPA 1HH4A 3UJPA 2A5YB 3PE3A 4WCFC 3THYB 2GBPA 3N76A 5FUWA 5HIJA 5A4IS 3IA7A 4BNUA 4WA8A 1B93A 2E4ZA 5B1HA 3F6RA 4D9IA 1G66A 2MSDB 2XUDA 5KYXA 4AKHA 1UFQA 4F96A 2HIGA 2QB5A 5C32A 5HPYB 5LA6B 1ZH0A 1PSZA 2J5XA 3G2OA 3MBIA 4J1QA 4LOKA 4QLAA 2NVBA 3BUSA 3ED5A 4H60A 3TEFA 4ZCLA 4C6RA 1ZM9A 2OCPA 4IIXA 1UJBA 1QDLB 1V1RB 5JMWA 4E94A 5JYCA 5A9SB 1C7JA 4MQMA 1PVDA 3TVYA 3I6YA 5LQKA 3PE4A 3GGCA 1U8TA 2MINB 3TUJC 4ENVA 5IC4A 5U4XA 1DJPA 2MSWA 4IDHA 3BE6A 2VP6A 4IJMA 4LVOA 4MV3A 5REQB 2XZOA 5G0SA 1M34B 2DB3A 1TQHA 4AX8A 5CB4F 1EVJA 2ZYWX 1EEHA 1W48A 3WLSA 4B3FX 4GGOA 5EKTA 4WDRA 2Q3MA 4GKAA 4HBZA 4QOGA 4RF5A 5ED4A 4F5EA 4FD2A 1FSFA 4FFWA 5EPEA 1H5QA 2O3UA 2ZXEA 5BSFA 3IL2A 4A10A 3SE0A 1L1EA 2VNHA 1Z0ZA 4D3ZA 5JDCA 1SCDA 1ZRMA 1WUHS 1HE8B 1XCMA 2QZJA 4BLUA 2FVXA 2MIIA 1C3XA 5BSVA 3D4NA 1EXVA 1C1DA 5A2QA 3EFEA 4RYLA 4KXWA 2VTKA 1E1CB 1V7CA 1AF7A 2C03A 3PUKA 3SYKA 3P0IA 4IIFA 3Q8WA 3LHSA 5CFQA 1WU8A 1GP2A 2XRMA 1T13A 2I4LA 3HN7A 4H1TA 4EVQA 1ZVQA 4M88A 1KFEB 4GP7A 1ZIXA 4RETA 3K8QA 2HIAA 1ISFA 1TI7A 4REOA 1F17A 1WXHA 2A0WA 2A6PA 1SZJG 3BSFA 4KK4A 2JL1A 1FS6A 2W6MA 4I6JA 2D4AA 2D74A 5FI0B 2JA2A 1Z63A 3HE3A 2VXOA 3L0OA 4PE5B 1R66A 1TVMA 2F00A 1MTZA 2O23A 2PRKA 1F4LA 2V6FA 2XUQA 2E4WA 3F9IA 2OUKA 3NEYA 4JZYA 1EZ4A 4Y3UA 5FBWB 2Z6UA 2FUCA 2IYVA 1EG7A 1COWD 1GCOA 5K4GA 1E2LA 5IT4A 3G2HA 1MAWA 2QPAA 1SG6A 1OI3A 2ZRCA 2R7LA 3ST7A 4A5SA 2PFSA 1Q12A 3MCWA 4HTAA 1ENYA 4M6WB 1OTXA 2J9ZB 3P9RA 3QY9A 2OESA 1WS6A 2WUEA 1E7RA 4JCCA 3INYA 3W3AH 1H9BA 2F1KA 3OJEA 3GR6A 4PSUA 2Z8ZA 5HKLA 1OLSA 2Q0SA 4NYIQ 1GGFA 3EVCA 2V4MA 3M34A 3IP7A 2ZCUA 1B0PA 1FW6A 2IUYA 1N75A 4YHBA 2WU1A 3FLBA 4X00A 4KR0A 2OENG 4BLWA 2W6PA 5KPJA 1QUEA 3DFUA 1G21E 2MHCA 3ZDEA 2J0VA 5K0EA 4DKJA 2J4CA 3NBQA 4PAOA 3I0NA 2GFIA 1CHNA 2ZSHA 4OAPA 4PYQA 2PRJA 5EYPA 4Z1OA 4OV6B 3KAPA 1U2GA 1KYXA 4PIVA 1IHYA 2XB9A 3JQ7A 1E3IA 1Q5PA 4MEJA 4BFCA 1ORIA 4WN9A 1LI7A 5DX8A 4QIHA 1P9OA 4GOJA 1X7YA 2ZEJA 4XJXA 1NBEA 4BP3A 4FNGA 3D6UA 2FP4B 3QYJA 3HEBA 4J7UA 3C6ZA 4GG1A 1PR1A 4QDOA 4TTAA 1W5FA 1S96A 4YAWA 1O0SA 2JAUA 3G9UA 3ZTWA 3I2GA 2H2FA 2QOEA 2VYND 2X6RA 1HT2E 2OQ2A 3FDIA 5EJ2A 3RTGA 2J9FA 1NLYA 5LBIA 1HE4A 5TPWB 4KR3A 2O6HA 4RHEA 7AT1A 4PZAA 1FUKA 3WO1A 1BEUB 4G1EB 3ZCPA 2W2KA 1UT6A 3I5AA 2FPRA 4B7CA 1IEQA 4PS1A 1Z6QA 2C07A 2QXYA 4LE1A 2DUMA 2J46A 3HFJA 1XEFA 3QFHA 2H85A 1T6XA 1XMJA 3VTAA 2CLEB 3VX3A 3DYVA 3VYRB 3TW4A 2VJOA 3EMKA 1C81A 2ZKLA 3R6TA 4KE9A 2QYTA 2XI4A 4A8TA 3GCGA 5AI0A 2CVQA 3MJEA 4FOPA 2QMYA 2IW3A 3AHIA 3GJ6A 3PFWO 1NOJA 2C61A 3R8CA 1RBQA 2A9OA 3SVTA 4DWJA 3REFA 2ZI6A 3P9ZA 4FHZA 1EFPB 3WZLA 3QELA 1U9CA 2QW1A 3ZDRA 1BMFD 2DERA 4FUQA 1JSLA 2UV8A 3LYLA 2NYRA 4FGWA 4MUEA 5FJJA 1KF0A 1XMPA 2A5JA 2VJMB 3IAS1 4Z4QA 2VDWA 1OYOA 3NTRA 1JZTA 3SI7A 2RH9B 1VG9B 3NWJA 2O14A 4YAGA 2B4AA 3E2PA 1E2BA 3CO0S 4UBJA 3UJ7A 2HD4A 2G7ZA 3W5CA 3E0XA 4TN1A 4DAEA 4HNSA 2YXPX 3U37A 4BVHA 1KK0A 1HEYA 3AVXA 1GZ3A 1HBJA 1KFCB 3J80A 2TYSB 2IOFA 3U3MA 4RMIA 2FJUA 5JNVA 4Q7JB 1XDDA 3PI6A 2ZJ5A 4Q3LA 2KBFA 3I5UA 4HMQA 1C0PA 2HN9A 3RIEA 2BN4A 2JAPA 3K9NA 1W0KA 1XN4A 2V45A 4NBRA 1YHYA 1U0FA 3IOMA 5CURA 2P11A 2OMEA 2PYZA 1M1YA 4OLJA 4ND6A 2RCNA 3D5TA 4ZMSA 4HQLA 5EMLA 1EUQA 2OHOA 3URMA 1ZHHA 1K6EA 2FX3A 4MS4B 4X1IA 5AI8A 3MS7A 1L5HB 3GCDA 3RYCA 3SLKA 4DYVA 1W6UA 1IXRC 1M3SA 3IAHA 2NPOA 4UUMA 1K27A 4GPD1 5F52A 3WKAA 3UXHA 5CDYA 4RTSA 2LP4Y 4X65B 4JXKA 4BQRA 1G59A 3EXAA 4HDOB 2X9NA 1XD2B 5CFNA 1ID8A 1K66A 2SBTA 2VSFA 2R65A 1P8AA 4EQZA 2BEJA 1EBBA 3Q41A 4TXMA 3MWFA 4RDHA 1LSJA 3I6IA 5FQNA 3W78A 4LVNA 2FXVA 3E1KA 4ND5A 2BCGY 3KB2A 3TBHA 4R9UC 4BO4A 1XIVA 3A9TA 4GKVA 1GG8A 5DTIA 2E4YA 1HNNA 5EG5A 4DCUA 2FPPA 3WBKA 2VYVA 1SIUA 1X74A 2R44A 4J91A 5D5PA 3LLCA 4N9QA 5J23A 3NPAA 4B83A 3FUUA 4I1IA 3LCRA 4YAFA 5JD3A 2J6BA 2Q4TA 3U7FB 2ZS8A 4NK4A 3E4DA 1G2IA 4TZ0A 1W44A 1XKLA 1NFQA 5B7QA 1N5RA 4PINA 1E3WA 4GDMA 4UE3S 3DDUA 1QHHA 1EXWA 3AYZB 4KSYA 1W4AA 1ADCA 2J9RA 3GAAA 3KHTA 1FYDA 2CXRA 5KZMB 4M36A 1YBMA 4GKJB 2YQ4A 5ALQA 4MJLA 5GAJA 1YI0A 4KXQA 1WWKA 1QOQB 2AQ8A 2JGRA 4QBGB 5I9BA 1AQJA 4A9AA 2Y2UA 1HDYA 4XEUA 4ZVMA 2I3DA 5CLIA 1J9EA 3L0CA 3R5JA 1C9YA 1JR3E 2YJZA 3KAQA 4WGGA 4Z2YA 5LPNA 1Y8RB 1F0PA 3K9BA 3L8ZA 4Q3AA 1EWKA 2QPOA 1AN9A 1RKQA 4XYEA 4KN6A 1CXZA 4FLEA 3V1TC 3ZCXA 1CUGA 4NYMQ 3PPWA 4P84A 2AUTA 2VP9A 1ODIA 2JFQA 2DKOA 1KY3A 3EOAI 1F14A 4MPPA 4ILKA 2AI2A 1IRIA 2JRCA 2H1HA 3DDHA 4RANA 2ZVPX 2C4HA 4EPXA 5CT5A 3IR5A 4OJYA 5K0NA 2PGOA 2WDZA 4JJAA 4ZVNA 3HA2A 2JJ2D 4TZKA 3MA0A 3ZIAA 3IEKA 4LECA 4QO7A 5FPSA 2IZ6A 4BQOA 4UMDA 2QLLA 3OWHA 1FSZA 3FZGA 3H3FA 3LX6A 4JJ6A 3WRVA 3RUDA 4F4JA 1BVRA 3P97A 4JLOA 4EVSA 1N7JA 3OCJA 2AEJA 3G23A 1YB7A 4MB0A 3GT7A 3WKEA 1PW5A 5KNCH 1IDN1 1BVUA 3ZBPA 2D0PB 3WXBA 1J2TA 3Q3VA 1WQ1R 4FYPA 1T6BY 2P4HX 2PL9A 2DCMA 2OZEA 2YASA 4FHGA 4TQGA 3TRHA 1N33B 3QEAZ 3O7WA 2A0KA 4B84A 4ATNA 1N0IA 1WBBA 3CR3C 4A2WA 1KAHA 2B98A 5AKKA 4DCOA 2FPUA 2J09A 2UKDA 3KXKA 2QLMA 1D2EA 3KKLA 4MINA 5AHOA 5NLLA 3T1NA 3TQOA 2VXYA 4W63A 3BT7A 4HNAB 4NBTA 1IOZA 3LTNC 1MNQA 3EISA 3USES 5C5EA 4ARUA 4B9EA 1C0KA 5BN4B 5BYAA 1ZVJA 3KEQA 3PUJA 2O2JA 2I6TA 4CV0A 1X2EA 1IEXA 1EIWA 2ATXA 1E3SA 2EKZA 2JLAA 2Q3JA 2W4MA 4Y1RB 1I3OA 1HQCA 1T9KA 2IF2A 5B12A 4KVAA 3ZZTA 5I7VA 2ECFA 5HM6A 1MEEA 2J67A 1N2CE 1M54A 1T9ZA 1XRMA 2G08A 2JHCA 2W8ZA 4PLTA 3SY8A 3D3NA 3E5HA 1WDTA 3DS8A 4TQUS 1LLQA 2PUVA 1F8GA 4HLDA 4P5PA 1BX0A 4LZOA 3UUWA 5E1BA 1LK0A 1II0A 2ATCA 3P32A 4NJEB 1NBME 4M89A 4G3XA 3GEIA 2JZNA 3WGTA 2C5HA 3G2LA 3KKZA 4HKTA 5DYIA 3TIVA 1DC3A 1Y1LA 2QL7A 4BZQA 4LRXA 4BO5A 1HT1E 1P7ZA 1XRLA 2B9EA 1NHGA 2GF0A 5FBHA 2BV3A 2XZPA 4L74A 1NSTA 4X1KA 3ZBQA 1U31A 1QNLA 2GFHA 4Z5XA 1OJLA 3V1MA 3WS7A 4RTQA 1V5FA 1VIYA 4MRRA 5CAEB 1UXIA 2CZCA 1RQNA 1WHTB 1HYQA 5H81A 2QAGC 2J41A 4WNIA 1T8YA 4X61A 2E3JA 4CIDA 2AC2A 1KOGA 1IHOA 4FT2A 3ND7A 5D86A 1TIKA 2RK4A 3IQEA 3QP9A 3VDRA 3A4VA 3A1FA 1KMQA 1ETUA 1LFDB 2V9ZA 3OQIA 4OO3A 4YWHA 4BV9A 4U0KA 5ER6A 1JEJA 4FYHA 4YLYA 4M9CA 2TSYB 5CYFA 4GLJA 5G4KB 3MWEB 4MW0A 1KGDA 4D41A 1EGAA 1ODKA 1U99A 3C4VA 1DZ3A 5J4LA 3GYGA 2DXIA 1ZKDA 2YX1A 3DLTA 1G291 3AONB 3ODPA 4J43A 1PR3A 2GF2A 3B20A 3BK1A 2IYPA 4F6RA 3JAKB 2VQ6A 2ID8A 1U2TA 1KHTA 4JBWA 1J0BA 2VJNA 3VKUA 3U5TA 3KM0A 2ZS9A 1EBFA 1CQWA 1L5FA 4KXYA 4DXDA 3A9RA 4V1CA 2ETVA 5JS8A 3CG0A 1QZUA 1JG6A 1BJRE 1EQUA 3GVIA 3NG1A 1F5SA 4M22A 5KYYA 1FUUA 1C80A 3GEMA 4JP2A 1K7EB 1FX0A 3MB5A 3NR2A 3EXEA 2BW0A 1ACJA 4CKWB 4NCJA 1BXKA 3ZOKA 2R6DA 4AG3A 4ZMRA 3NJRA 1FUEA 2HF8A 4JT2A 4K2HA 4M1TA 2V0GA 2EQBA 3AXSA 1XU7A 2VFAA 4UBMA 1IHDA 1L5WA 3EODA 2PH5A 5T3UA 2BI8A 3INRA 4KWIA 6ADHA 5TEWA 1DI0A 5C8YA 3TQIA 1I80A 2BFMA 4CTKA 3LCMA 2FEXA 3SIWA 3HQ4O 3QKSB 2ZRGA 3UPTA 3A7EA 2UUOA 2NXWA 1P2SA 1H05A 4EI8A 1BD4A 2XMCA 3NANA 4MQEA 5BVHB 5L53A 1NSYA 2CLDX 2FPMA 4P38A 2ZIVB 4RMGA 2QX4A 3F6YA 4YRIA 5HS6A 2ZSAA 2OO3A 3D6TB 3SEAA 2OXTA 3CURA 1R8JA 4BBJA 1D6JA 2C2OA 5H82A 2LR0A 1Z34A 3FRJA 4E4RA 4JDPA 1JAZA 3HB4X 4MJ7A 1DAMA 2OSBA 2YHSA 3W7VA 2Z1NA 3BD8A 2XD9A 3NOQA 4Q4CA 3GOQA 5DULA 3M9WA 2FG5A 4NDNE 1D6NA 3IEXA 2R00C 3Q6IA 4L0CA 5B3JA 4RTJA 1IBMB 1G42A 2P9BA 4FXOA 3T0IA 4EHDA 5G0WA 3UAZA 4TWAA 4OHYA 3WQBA 2ZZKA 1D8TA 4HEA6 1KI4A 1SCAA 2V0CA 3ZBTA 4F8EA 2CXTA 4P81A 1XWFA 5HZKA 3MXOA 4IRUB 1W1WA 2AYYA 4RF2A 5DXAA 2ZIFA 2KJQA 3ZS9A 4B6FA 1OD6A 4WBNF 1WTAA 5DP2A 2GLXA 1JHRA 2AH5A 4BBZA 2ZK7A 4ETIA 2FSSA 3RYTC 2O8BA 2DWOA 3KT8A 3NIWA 4GEKA 1ZUD1 2VYQA 1UBJS 3H8SA 3G7SA 3MMSA 1Z8FA 5JBIA 1M2NA 2UZ1B 3HKEA 3AU8A 3GF4A 3WL5A 3BHMA 5DTJA 3WX0A 5CLGA 2PIAA 3EF1A 5AVJA 2X4DA 4DRXB 1R64A 2B30A 2PKEA 4ND7A 2PEYA 1GG5A 2EW8A 2CJYA 4GC5A 3LWNA 4DOMA 5ICEA 1XYYA 3ETDA 1X80B 4I8IA 5FTMA 4C07A 2WMYA 2YQZA 4DHEA 5I7FA 3F74A 2WUVA 5K8TA 4BVFA 4QELA 4V0ME 4NXMB 2E5WA 1EESA 2WUFA 4US2R 2ZYTX 1CERA 4PO1A 3CNOA 5BW8A 5FR2A 4PBRA 1SD2A 3LSYA 5BQPA 5L4SA 1DOAA 2IV3A 1XG5A 2ZYHA 3NOVA 4WCFA 4JP3A 4F21A 3X1ZA 1GUAA 1XEAA 2GPWA 4RQBA 3ROMA 3W5UA 1OAOC 4J7XA 4EB3A 3IXMA 1XTKA 3BIWA 2I6FA 4U00A 4YUVA 2C5SA 1FXWA 2JBHA 3QFTA 3ZN2A 1ZUNA 2YHUA 3WMRA 1SBHA 4LX8A 1QV7A 2FRXA 5JFOA 5JTTA 1EE9A 4DCSA 1V41E 4HAUA 4P3NA 3MJ4A 3IE1A 1CULC 2QVYX 2WJHA 4ZCTA 1I0IA 5LWHA 1NHWA 5ESRA 1VA4A 5DW3A 4ZAGA 3CWCA 4AY3A 3CZRA 3LF1A 4OYHA 4OBWA 4UTPA 2DX7A 4BGVA 2JCVA 3EC7A 1NXQA 2C4WA 2WTNA 3S8MA 3Q3EA 2FN9A 4FYJA 1T2DA 2P9FA 2B83A 1N36B 1UADA 2GJSA 3L84A 1Z47A 4GOLD 5E38A 2H07A 4C4AA 1P45A 3O21A 2PSEA 1R1DA 2GN0A 2BKEA 1IULA 3PDJA 4PG4A 4R71A 1KQPA 5DE3A 1ZIDA 2A9PA 4I5DA 5A4AA 4P6VF 3E53A 2G70A 4OBEA 2QRHA 4ZOAA 3VPAA 4G8CA 4C7BA 5CH3A 4DCTA 3I34X 3CPJB 1GGKA 1AY0A 4W8GA 1FPQA 2D1YA 4P4TA 1ECGA 1UMBA 3WDKA 2NYAA 2BFCB 3B51X 3WQRA 5L8VA 5A5FA 1R9NA 4KQCA 2IEAA 1XZAA 4O3FA 5BMVA 1KFJB 5DWQA 3IR7A 4GLLA 2OBFA 5C34B 5EIFA 4Y7CA 5AXAA 5LU9A 4BLOA 4Z53A 2VA9A 2VNAA 3R9XA 1YVUA 3CONA 1NVVR 2GBIA 3WAKA 1FDTA 3FB1A 4J16C 1X7XA 3QEJA 2LBPA 4LWPA 3AQ4A 4F72A 3KWJA 1HE3A 4QXAA 2I9KA 2BYTA 3O2NA 1VI5A 3K9HA 2WMOB 3KTDA 4YI5A 1CZKA 1DJOA 5AI4A 3V32A 1KEKA 4Z3KA 2QRZA 3G9QA 3QUAA 1ZM4A 3VO8A 1ORVA 2WWXA 2QGFA 1OBFO 3ZWVA 5TVGA 1DIAA 3QXCA 2IBTA 2YJNA 1DAOA 5FLEX 1MJ5A 4QUAA 3OY7A 1CD5A 1RYBA 1E0KA 1SQ0A 3LW8A 4MROA 1LJUA 1VRVA 2IEDA 5E4FA 1U8YA 4YQZA 2QUKA 2ZAIA 2K2QB 5CRIA 3C6YA 2XQVA 2RKOA 4ZAXA 4PQGA 2V6GA 3I6ZA 1NFFA 2A0FA 5JALA 3Q2IA 2G6BA 2O0KA 3WL6A 1WZUA 1KKLA 1BCRB 1XU9A 3V7NA 3L0SA 4P0QB 2BI7A 3C1UA 2XVXA 4GYKA 4EITA 3FYUA 1N1DA 1S7CA 1DCKA 3GBSA 1A2OA 4MP8A 4F5WA 4YR9A 1R0ZA 2J0UA 2ZYUX 1XXHB 2A8YA 1X77A 3BXHA 3CEMA 4H0CA 5EIHA 1DJQA 1QFXA 3Q5GA 3TCNA 1UZLA 1UDRA 4Z51A 4OAQA 4PR3A 2PANA 2PGDA 3TBKA 3KLOA 7GPBA 2C3YA 3REQB 5JASA 4AY4A 3ZDBA 5FBVB 4N8EA 1JE1A 2XTAA 3KSDO 1V1JA 2D54A 4MAAA 3DR5A 1SKAA 4QUDA 4KFCA 4K2AA 2UVDA 3VPDA 3QX3A 2CLCX 2YIJA 3EHEA 4EHIA 3EQ8A 5HUJA 2MR5A 5CB4A 3LUFA 4B6QA 3TB4A 2FSVA 2QUIA 4ABYA 1JBQA 4PFSA 4D80A 2GH1A 3R7LA 5EZQA 3QXGA 1V8FA 2HUNA 3FUCA 2WZQA 5AK3A 4Q47A 2EWWA 3F6BX 3ZNQA 1P72A 2R1TB 1O94A 4WZBB 2BKVA 2MSKA 3RAPR 3GPCA 3OE5A 4HSGA 3DYIA 1KJWA 1IE3A 1N2ZA 2QKYA 3WWYA 4Q7EA 1VM6A 3T3IA 2K7FA 4N5DA 3UB4A 1SUAA 2BGLA 4BQPA 2QX8A 3VZQA 2O8FB 3Q0TA 3ZHRA 1P6XA 2PIDA 4EY6A 3U3KA 3RS5A 3N2IA 3ML1A 3HG7A 4DLVA 3PNMA 3FA2A 2C59A 1ZK0A 1TAHA 4K6HA 4DM7A 1JEQB 3NHPA 4BB6A 1BROA 1XZEA 4XM0A 3SQLA 5FPYA 1AD2A 2WD7B 1EM8B 2QVLA 3MVEA 3ZGNA 2WP8J 2DR2A 4GDFA 1ZNQO 4NQZA 1E69A 1MTOA 4ARAA 2I8CA 1EA5A 1UK9A 3HU2A 1GTRA 1QP8A 3VBCA 4OHBA 2ABWA 1L5KA 1Z6TA 2BBSA 1YOVB 4RVSA 1BX1A 2JFHA 3RKRA 2J08A 4QT4A 1QKKA 5JQWA 4QA9A 4RKQA 2FW0A 3QF4A 5JYDA 2C4TA 5IAGA 4IGIA 3RYIB 2FCAA 5AESA 3CZ9A 1UZMA 3BBLA 3KZMA 4LVUA 2LUOA 2P2GA 5J1SB 2C99A 3N1UA 4IMJB 4XD7D 5CJ2A 5AVZA 2ZSJA 3IDAA 3KUUA 4GSLA 1G20E 4K1XA 4XQCA 1KDZA 2PE5A 4EBBA 1GGJA 1YGPA 1MB4A 1KOJA 2OFWA 3M6FA 5FWYA 3LO5A 5E4JA 2X3UA 1M7HA 3DEFA 4RD4A 1QIKA 1TJPB 4YLEA 1PJ4A 4LISA 3CEJA 2X0JA 4N54A 5IAAA 1Z29A 4QNRA 5E4TA 3AF4A 2W2LD 4R81A 1KK1A 4P0PB 4BFXA 5AOAA 4FNAA 4AZ0B 2IS2A 1CEEA 3JS5A 5JMTA 4RZHA 4CM9A 1W5BA 4NCIA 2IYYA 4UEQA 3UCFA 1RLJA 2GNPA 4BQFA 3CRZA 2C20A 3M6AA 3QLEA 5F35A 5HZMA 4OLFA 3FIJA 1P8JA 4DPKA 5BO5A 4Y0NA 1FFHA 4ZVTA 2NUAB 3EVEA 4C2BA 4GR9A 3VU8A 1CRPA 1QCYA 3KUKA 3QUBA 1FS4A 3DDCA 4GICA 2E7ZA 4J0CA 3KQKA 5KVVA 1N6IA 4W5TA 4D45A 1UOOA 2W6ID 3EIEA 3QYAA 1J20A 2VPPA 4KGZA 3TOZA 1JH9A 2QE7D 2FZLA 5I7HA 2DWPA 1VKJA 1XA0A 3BXEA 3H2GA 4XTRA 5CLHA 1T6ZA 4PPFA 1U0TA 3I5XA 3L6BA 3OUTA 4ZHSA 4DV4B 3EE6A 4H08A 4HQOA 4LPKA 5H4HA 4MKRA 4X24A 3IQIX 3QA3E 4TQ9A 4UU1A 2QD2A 5I01A 1HYHA 3HDQA 3MT0A 5L9AA 3GLFB 4LIPD 1M2KA 2FPXA 4EB6A 2Q4EA 5BN3A 5BUZA 4RD6A 2I76A 3MQFA 1XVVA 4FE3A 4FFNA 1OSNA 4KBGA 5L3SB 3O6VA 4CLDA 3LUKA 1SWVA 2AVNA 3LHIA 2YMMA 3OPQA 4NTZA 2PNJA 5LM3A 3W6UA 2QRQA 3ZDFA 3UGJA 1AXEA 4KX5A 2Z9BA 3CISA 3IVRA 2JI7A 1ZMTA 5C1DA 3WGOA 4MW6A 3B9PA 3JQ8B 2BFWA 2YVUA 3HUTA 4OA5A 4Y2YA 4GE3A 2IJGX 5JG7A 2IDJA 2QM0A 3HY3A 3NO4A 2FSFA 4J2OA 3NVKI 2FU5C 2NUPA 4FDMA 1Q0ZA 3PL1A 4FCTA 1BS2A 3GG9A 3HMQA 4BNVA 1LLDA 5KTRA 1NZJA 4W6ZA 4DTCA 4MWBA 4AUKA 2CDNA 5DLPA 3A2LA 4F11A 5KX5F 1GPKA 4AN1A 5A6VA 1RQPA 1JDSA 2YHAA 2RSLA 3OMWA 4MYRA 4RA6A 2OECA 3G9ZA 3IVGA 4DQ0A 1KQFA 2WWTA 3FKSA 2OCGA 1F6WA 5CT6A 3AOGA 3ZWQA 3NC1C 1R4AA 1EB8A 1E7MA 3IJPA 1IN7A 1Z5WA 2FFRA 2ZDHA 4YYZA 1KC3A 1P3Y1 2C8KA 2B25A 3GEDA 3I58A 4MW2A 2JJMA 1K2VN 4IHJF 2HOQA 4MQ5A 3M3PA 1UJ2A 4B48A 1C7QA 2P4SA 4KQHA 5I9MA 3VUFA 5DTQA 2FRVA 1FFEA 1Y6RA 3C7TA 4H3KB 4MYTA 3WJ2A 4B82A 4NYJR 4V38A 5CBPA 4YP5A 1E2IA 4DSZA 4ZEVA 1X2BA 4YAOA 1JDJA 4CR6A 2PJUA 4PBSA 2X4IA 4C03A 4GO1A 2AC7A 3TKYA 3ZHCA 4ALLA 2EYUA 2VJYA 3ZZMA 1T5SA 3TDKA 2XVMA 1VKNA 3OF5A 3PTLA 4YRNA 3EW7A 3FYCA 4QFCA 1JQ5A 3W6ZA 3PGLA 4GYWA 4AQDA 3L4EA 4DSUA 3QQ5A 3TMAA 3SQWA 2F8LA 1KZ9A 2LTAA 2EHDA 2O4UX 3AHHA 4YPOA 4ITUA 4C1NA 1J90A 1WMBA 2Q6VA 4CM3A 5LKRA 3HEAA 3NFYA 3PP8A 3ZJYA 3QPAA 2CFOA 3AF1A 1CY1A 5I8WA 3W5JA 1N8KA 3HUFA 4GL2A 4QU5A 2ZJAA 2PJDA 1FJGB 4L5AA 4BN4A 1QNFA 4ZO8A 1IIBA 2Y1EA 1VL1A 2FRDC 2XLBA 3ABSB 1YA8A 2KSQA 2VWQA 3EQ2A 4W1PA 2OD9A 1NGSA 2VUUA 3T5PA 4EYKA 3TRJA 2Y4NA 5DBGA 3T3GA 3UHOA 1FRQA 1S7GA 3OQVA 1MORA 1IXZA 4E5KA 1LUAA 4LOAA 3ZZUA 1EK1A 3G9TA 4JU8A 4O2BF 5FWAA 2GNAA 4X20B 1U5AA 2FZWA 3AB7A 3IUBA 3KKEA 3THXA 2WM9B 1J9ZA 3L40A 4DIKA 4BMNA 3U4IA 5G41A 4OGKA 1BU5A 3IDSA 4WASA 5BSMA 5MN5A 4V0MA 3EBPA 4PTLA 3E3MA 1PQ4A 4WK4B 3RTBA 1GQYA 2CLHB 1OWLA 2QBYB 1PO7A 2I54A 1E20A 2IUEA 2YYAA 2VNJA 3D4LA 4B47A 1FU4A 4PFQA 4CF3A 1KO7A 3P5SA 1MG0A 4BP8A 3I6BA 3L4BC 5D1HA 1FTNA 2BHTA 2XQJA 3K09A 3NRBA 3RKUA 1FF9A 1U6KA 2RHGB 1X94A 3OAAA 3DKRA 1WB4A 1V4NA 1TK2A 1U11A 2Y1DA 5G0UA 4LGMA 4DCMA 5IKMA 3BIXA 1QG6A 3TRFA 3CRRA 1OH7A 2YFKA 4RE5A 5BN1A 1LSSA 2GTIA 1HETA 4A8JC 5EWMA 2H2DA 3A25A 4G4SO 5EY5B 1CHDA 2IXFA 4L6CA 4S1WA 1U7DA 5JY6A 4EQ6A 2ZQYA 2C5GA 4EHFA 4F12A 4FGUA 5TMEA 2CYBA 1WP9A 1NVTA 1H4QA 1Y7IA 4TYWA 2AUMA 2EYQA 3L6DA 5A62A 3I01M 3ZI7A 2ZIAA 3MELA 4DVJA 1THGA 2GXSA 2HRZA 1OOEA 4GZ3A 2BLNA 3WIOA 1FDRA 1KMCA 4W5HA 4YV2A 4B4WA 2Z4TA 2Q4DA 5DM0A 1DAFA 2NN3C 3SHQA 2R7MA 4UOEA 2V6MA 5CW1A 421PA 2NGRA 1BOOA 4OQNA 4BVGA 4KNVA 6REQB 3CR7A 2FW1A 4LBYA 1JIVA 4MXDA 1XI2A 2X13A 4OK5A 2Q5OA 1M8FA 3MWGA 3UV7A 4AS3A 1QRUA 2A9VA 3V4SA 4PXSA 4UBKA 4XFJA 1J2UA 1OFTA 3U6KA 5CVEA 3NNSA 3AEUB 1REQA 3R0ZA 1ZG3A 2GZHA 4IMIB 4P7FA 4Q00A 2Q7OE 1TTPB 3N07A 1C1YA 4AF7A 3ANNA 1CE8A 4HN9A 1Q83A 1Z0JA 3M82A 3PR2B 4RY8A 2E87A 3COPA 3HR4A 4BMYA 4K9QA 2Q3CA 2B34A 5I8PA 2AN4A 1C0LA 2WWFA 2HDNB 1UP7A 3DZIA 4YTEA 4D46A 4HQKA 1JJIA 4WFIA 1C8BA 2UUAB 3LE8A 3FDXA 3A3PA 2QG6A 3JASA 5HIIA 4CCAA 4IJQA 2EAUA 4HQ6A 4BECA 5IEJA 3U4QB 2PHZA 4O08A 4QXOA 4C2TA 4KDEA 1SC6A 4MI6A 4YMTA 4PC3A 4EY8A 2FKNA 4DIBA 4S1VA 1KZYC 1PEAA 1Q7GA 1WMDA 4DT1B 1JG3A 2QVGA 3VHXA 4ZU6X 4RAOA 4D6YA 3BK2A 4OXRA 4R1QA 1F4VA 4M1QA 2EL7A 1P31A 4Q3KA 4E5DA 3LSTA 3FLAA 1E1MA 4N41A 1CR2A 1EFHA 1UH5A 1NXWA 1XEWY 1IY2A 4INZA 4L5JA 5AVKA 3SOZA 1ZNYA 4GR5A 1U0EA 3F6EX 4MYUA 5CLQA 4EFNA 5B55A 2NZUG 1Z5GA 3ROGA 3ZD6A 3Q3HA 2PN1A 3LZ6A 4QREA 4HEJA 3OT1B 1A9XA 3ZQUA 3WLQA 2HF9A 1XN1A 2HFKA 5E6RA 4RVCA 1N9GB 4UZFA 2VHUA 2WHRA 2K2WA 3GI1A 5DIFA 1KDVA 1EIZA 3WGZA 4TMYA 5K3EA 4IWYA 1LPNA 1OQAA 3PD7A 4FFPA 5EFZA 1YV9A 5FTJA 3T9FA 1LC0A 2QTNA 3VR5D 3MIZA 5G4LA 4P4NA 2ARKA 4A82A 2NZVG 3GPBA 2JNWA 4K81B 4UHKA 1N3LA 3AR6A 2O2CA 2W0SA 4DA7A 2PKWA 3GLGE 1CBUA 1V8DA 4OHRA 2XT9A 2RJ3A 4ZKEA 4EEZA 4KPYA 3OEYA 3T95A 4JI1B 1HX7A 2AFIB 1JHPA 3PNPA 1M73E 1C7IA 1QGOA 3W3AA 3ZWYA 3CKMA 4D9GA 5K01A 3I30X 1KVQA 4KBYA 2X7XA 4L02A 1PJ3A 4Z86A 2M1ZA 2H1RA 3OZRA 4Q66C 4AD8A 4ENWA 4YQFA 3ADDA 1BEZA 4H7DA 3N0TA 1XDSA 2SCUB 4NX2A 2VG8A 4EJMA 4B3HA 3W2EA 4BQQA 2YCBA 3Q9NA 3EGEA 2E21A 3D3WB 1MO3A 1XWWA 3DE7X 2QRKA 4ACBA 4EB0A 3WXMA 2BBTA 3SMVA 2IP2A 1JB1A 4IUCS 4CZ2A 3V1KA 2FN8A 4X60A 4K0RA 4AM8A 4XWOA 1AB5A 2XRYA 4M46A 4AICA 4X8LA 1KP9A 1EK6A 1NUUA 4BDSA 2PX0A 1K7CA 5E1OA 3JQEA 1Z8HA 2BGTA 1T2UA 3GGGA 3O47A 2XJ4A 2VDNB 4H1WA 16PKA 2WJAA 1W30A 3IQZA 3KR1A 1NRXA 3RDPA 3IQXA 1SRRA 4FYWA 5GZ3A 5IRCD 3CX7A 2VHWA 3DDOA 4IJ6A 3EFHA 4YRFA 3KWLA 2AFHB 1YDMA 3H87A 1WKCA 4EARA 2ZAMA 2IYQA 1SMKA 5DHRA 5JBNA 3IAEA 2YIVX 3VYWA 4KPGA 4UPDA 4N5LA 5BSTA 4YMVA 2JIQA 2QN3A 4KQMA 3R8FA 1SVUA 3HUDA 4NR0A 3O4HA 5LZ8A 3CZ4A 1GL3A 1CYDA 3HWRA 3KSRA 4G9EA 3AESB 4UBOA 3FJ1A 8AT1A 3WB0A 2CMHA 4IY1A 1T0UA 5KHLB 1V11B 1G20A 4ZYTA 1PS8A 1VHDA 2GCOB 1DCMA 1J2JA 3D4PA 2F43A 3BSYA 5DM60 1GPLA 5C31A 4D02A 3U7QB 2EWMA 4ZYYA 3WRWA 3H7AA 5T5QA 3K6SA 3M83A 3A6KA 3UJBA 1UDBA 3RPEA 3IUYA 3S2EA 1QPGA 2CKDA 1WX1A 4UU7A 1FW8A 4OHCA 5KO2A 1KI8A 1P0CA 1XZGA 4L0MA 3T3HA 4J16A 4YP9A 3MCTA 5E8JA 2F62A 2WT8A 3PJDA 4OJQA 1I3LA 4ZOEA 5K4HA 1KDTA 1KAQA 1T2EA 1FNSA 4BOYA 2H2AA 1QTNA 2PKRA 3G2NA 4G86A 5H3HA 5DWVA 1GXSB 2PVSA 4PTZA 1W4RA 1FDVA 1ZIYA 4ZVUA 1MB9A 1NQVA 1KS2A 3VDQA 1HDEA 2VNSA 2RB5A 4JEUA 1JKJA 4YJHA 3U4HA 3LHDA 2VTVA 2Q3DA 1EFVB 4IOKA 4KFTA 2YWCA 1GT6A 5CD9A 4IIVA 1J23A 1PG0A 4MJXA 3LPLA 4X7RA 3P9NA 3UKOA 5M2QA 3TW8B 3WR5A 4PO9A 3HB9A 1KMMA 3IB3A 3BRCA 4LY6A 3RD5A 2GK4A 5FULA 4DMUB 4R1PA 1C30B 4O2RA 3B9QA 4GMXA 3E7PA 1X70A 5LQSA 3PFGA 1W4BA 1XYVA 2GTHA 3FNQA 7REQB 2CBGA 4AJ9A 3E9DA 2BEWA 2GERA 1YMQA 2FWIA 3H5LA 4HAVA 4U02A 5DI9A 2ORVA 3LLSA 4ALMA 4D0RA 4BNMA 3KXPA 1XQWA 2XOKA 3Q7IA 3RSOA 3CNHA 4Q05A 3DBHB 3H0EA 3LUBA 1K9SA 3O2SB 3ORFA 4FT4A 5BNWA 2REQA 2YDYA 4RSMA 4UHFA 1KYVA 4DMFA 5K20A 3SX4A 4LVCA 4P83A 1WDWB 3OEWA 5DI3A 4C3OB 1A76A 2PXCA 4OHOA 3L1HA 2X3YA 3K0SA 1SQFA 1JHYA 4LRWA 3ENQA 3LKBA 2PZEA 2AKYA 3JALB 3WRXA 1IVNA 3PR1A 4FU0A 4LHZA 4ROSA 3FMPB 4C14A 1MIOA 3H1PA 1XEWX 4RVHA 4ZFNA 2H4YA 1RHUA 2VJKA 1A9RA 4B79A 4HXYA 4DIOA 3CJQA 4BZPA 1TYBE 3PTAA 4X3OA 2E0IA 2J32A 3I4LA 4RGBA 3R7WB 1NOIA 3WWPA 4DLBA 3A2KA 1TAQA 1E32A 3CRNA 3EDQA 4FE7A 2PCJA 4KGXA 4YK7A 5HKBA 3I5YA 3SDBA 2P77A 3VR1A 3P9QA 1BU8A 2EU8A 1LSOA 4CQLB 1G16A 2PA0A 3RT9A 4NIMA 1DAIA 4PPQA 4R9SA 5BT9A 1XCOA 3RS0A 4DCCA 4MYHA 4EO9A 1JKMA 1G7SA 4YXWD 4U2EA 3JQAB 1KO8A 4UCWA 3B60A 4HFMA 4PLVA 2OD2A 1T24A 1EI9A 3JD2A 1C4OA 2B61A 4NZPA 1J4AA 4TKUA 5GY7A 5IKXA 2I4MA 1T5HX 4Q7KA 3TE6A 2Q9CA 3DLPX 3KJNA 4YJ2B 5L40A 5AKEA 4D97A 2WU0A 3BAZA 2JDID 4XIIA 2EG9A 4FIZA 2EFJA 4QLOA 5AXCA 4TTSA 5AW8A 3P2IA 4B3SB 3GT3A 3I2HA 3DGFC 3JQAD 4EG4A 1V7QA 4G24A 3EDYA 5DV9A 4ZV9A 3W5HA 1YZNA 5ESDA 2FMKA 2R7AA 2HF7A 5KI6A 4PU0A 4JWKA 4PRYA 1EK0A 3FOAA 1Z5OA 5E8RA 5F3WB 1JIKA 1H5UA 1SIBE 2CJFA 2KMLA 4HLCA 1EDBA 3PQ3A 3WNQA 3OZVA 2PT6A 3UB3A 3VR3A 1E6WA 3BJRA 4CI9A 5FEUA 5K99A 5H3CA 4JLAA 5JEDA 2ZWIA 3N53A 3TBFA 2I6XA 2ZCVA 3TJMA 3B6MA 4C76A 4DDUA 1THMA 3DUFB 3RU7A 1Q1QA 5DCLA 5B64A 2C0QA 2Y71A 4AJEA 3ZJVA 3PHBE 1PJ8A 1ORHA 3IJRA 1CVRA 1F8XA 4BQNA 3H86A 5AJVB 1ECJA 4IJ5A 4MUFA 4UAGA 4WK6A 3VPFA 1FFCA 4F4HA 3MOIA 3HCDA 1YUMA 3I0ZA 4XWKA 5FAKA 1PQUA 1Y7TA 1GAQA 1T25A 1FOEB 2Q6LA 3H9BA 2A1IA 3K15A 4M0KA 3V1NA 4A8PA 1SKYB 4IILA 3SF8A 4AKTA 1SBNE 4JQYA 1PNQA 1DRUA 5ALVA 3LFTA 1ICEA 3H97A 3M4NA 2YYZA 4FSDA 1L3IA 1RWQA 4JR2A 3PCRB 3ZKWB 4GOKA 4HEA1 1Z82A 4JJKA 1HL7A 4O0MA 1DCTA 2BFFB 4F3CA 3BIFA 4FJ2A 3L0YA 3CRMA 3UMMA 1BFDA 1DBPA 4GMGA 3JQFC 5BRJA 2GEJA 1MP0A 3RREA 4AAYA 3LOQA 1E3MA 3LVBA 3JW8A 1FP6A 4A6DA 3W7BA 4XJSA 5IT9A 2POCA 2CVOA 1C8VB 1E0SA 4MS1A 4AJKA 4WKCA 3HO1A 1UXJA 3V6MA 4UQOA 4EKGA 4EUKA 2VPQA 2RE8A 2JANA 4UCQA 5LXTF 4MCIA 3DO5A 4C4TA 3HKBA 4B71A 3OQNA 3H2SA 2JIOA 1X9IA 3T3DA 1FJHA 2DT8A 1DG3A 2HCTA 5K2OA