3SK0A

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant dhaa12
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
b'IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEFHHTEVAEEQDHAEAARETFQAFRTADVGRELIIDQNAFIERVLPGGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGALIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Dynamics and hydration explain failed functional transformation in dehalogenase design.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
total genus 111
structure length 308
sequence length 308
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sk0A00
4IH9A 1CUYA 4X6YA 5ALWA 2WHPA 1K6EA 2Z3WA 1WHSA 2VSQA 1HLGA 4N8DA 4PSUA 3G0CA 5AKEA 2AXEA 1YS2X 3KWFA 4FLEA 5SYMA 2GZRA 4FOLA 1DTEA 1UFOA 3FLAA 5AKHA 2HA5A 5BWBA 3QPDA 2XMQA 2VJAA 3ZV7A 1YS1X 2AJCA 3R41A 4PO3X 4B82A 4KRXA 2R11A 4I19A 1QIIA 4AO7A 1A88A 3U1TA 4BP8A 4DTCA 1AGYA 4FNGA 1XLWA 1KU6A 1WB4A 4CCYB 2JGFA 1CV2A 4C4ZA 2IIVA 1ZJ5A 4U2DA 1PFQA 3DYIA 1JMYA 3E3AA 1CUDA 1EI9A 5JYCA 5ALRA 5ALOA 3RK4A 4CG2A 3IB3A 5CW2A 3STUA 3FYUA 4WFKA 3CN9A 3LIPA 5AOCA 3STYA 2Y2VA 4M0FA 4PF1A 3WL6A 4BE9A 5AKLA 2W6CX 1C7IA 4Y2UA 2XUIA 5D6OA 2HIHA 3MUOA 4CCWA 4MQLA 1JI3A 5HKBA 3SC2A 1CQWA 3I28A 4N8SA 4UBIA 4G4JA 2OLEA 2BFNA 2VAVA 1QIMA 2O7RA 1PV1A 4I4CA 1H22A 2HRQA 3M82A 1CUSA 2B20A 3FVRA 2X5XA 4XVCA 3V48A 3WWEA 4WDQA 1BROA 3EIOA 3WL5A 4F21A 3H2GA 1IZ7A 4G8DA 3HXKA 5KWIA 1N5MA 3FNBA 1CPYA 2RIPA 4V2IA 1ORVA 2CUTA 1ZGCA 2X76A 4DNFA 3G0IA 3GROA 1MAHA 4P9NA 5DNWA 2DR0A 1ODTC 4UHEA 2CB9A 4P92A 1SCIA 2WHQA 3WKDA 4WDRA 3IA2A 5H3HA 2ECFA 4DNPA 4FMPA 2D0DA 2BUCA 4J0HA 4PSDA 1JT2A 1PJAA 4Y2TA 1MNAA 1ORWA 4LXHA 2WG0A 3A2MA 3W9BA 4H7IA 1LPMA 1ZGBA 1QTIA 5CBKA 4I3FA 4QDZA 1XZCA 5DJ5A 4ZV9A 1ZD5A 2GBIA 3O4JA 4B80A 3ZWQA 2XMDA 4BBZA 1VZ2A 5AKKA 5E4JA 5DNUA 3BWXA 1LPSA 1WM1A 4G5XA 4X95A 3C87A 5EI5A 4FWBA 4HXFB 3L1HA 1YA8A 4BVLA 2G5PA 1XQXA 2WIJA 1UOQA 4GHWA 4TVKA 3QPCA 5EHQA 5JALA 1XRMA 3IULA 2GBGA 3BDIA 1CUXA 5JZBA 2XUKA 3V9AA 5I7UA 1K63A 5AI4A 3PDCA 3W05A 2WFLB 1Y37A 2B9VA 4BRSA 1VE7A 3M83A 1ISPA 2QJRA 3C6BA 1LPNA 2ES4A 2QTBA 5K3AA 4W1RA 2GYVA 4ZRDA 5CRIA 1MNQA 2ZVDA 3GBSA 3ESBA 4G8BA 2WG1A 3FAKA 3UUFA 3B12A 4AMZA 4EUSA 4GDMA 3WKBA 2ACEA 3WIBA 4OUKX 4H7KA 1EVQA 2PL5A 3D59A 3QYJA 5FV4A 1F0NA 4FFVA 1FFCA 4XIIA 3U0VA 4B9EA 3F98A 3WL7A 4H35A 2LIPA 4INZA 4BDSA 4JH0A 5BWCA 3C6XA 3QMMA 4C4YA 4UHCA 1P0IA 3D3NA 3G9ZA 3H18A 1EDEA 3K2IA 5AOBA 3SWWA 3BE8A 1BRTA 1VA4A 1ZIXA 2XUQA 1HDEA 4BDTA 3F9CA 3NUZA 1U2EA 4LXIA 3WI7A 1UOPA 5JD4A 3I1IA 1TQHA 2C7BA 5ALJA 3H2HA 1CUWA 3LIIA 5AI5A 5JZ9A 1JKMA 5EHZA 3ANSA 1XZGA 5ESRA 1FJ2A 2PU5A 5ALHA 2PBLA 4Q3LA 3AFIA 3SK0A 4FFWA 4EB0A 4PNZA 4E14A 3H2KA 4ROTA 1IUOA 4ARBA 4BAUA 1XLUA 4U2CA 4H7FA 1EINA 1FFAA 1VKHA 1G5FA 3HEAA 3ZLTA 1Y7IA 1XZAA 4M0MA 5EIHA 1N8SA 4UFNA 1S8OA 4H77A 4HTAA 4AO8A 5AM5A 1CUJA 3D0KA 4ZV7A 2W22A 2GYWA 5LZ7A 1E8NA 2Z8ZA 1H2WA 1WOMA 4NS4A 1LNSA 3FOBA 1Z68A 5T4EA 1E66A 3V1LA 1T4MA 1OILA 4C6HA 4FHZA 2PU7A 5JASA 1WHTA 4KR0A 3HI4A 4MYSA 4WY5A 1CUFA 3R3WA 5AI8A 3H17A 4E46A 5CH3A 5EFZA 5AKIA 5A2GA 4AN0A 2HADA 1AC5A 2VT6A 4B6GA 1HL7A 5HF8A 2QUBA 3KOOA 1QTRA 3PE6A 1CR6A 3R3VA 1CUZA 3KD2A 4YK7A 2OG1A 2OGTA 5FOQA 2HHAA 4DMHA 2WUFA 4J03A 3V1KA 3ZPXA 4JNCA 5EHXA 4X91A 4Y9SA 1J2EA 1BN7A 5DYWA 3EQ8A 3QMVA 4DGQA 1MTZA 1ZD2P 4B9AA 1NU6A 2ZSHA 4B85A 1UK7A 4ZI5A 3AIMA 2I3ZA 2I78A 3G7NA 4ZGBA 4HAIA 5AHXA 2B4KA 4W1QA 3E4DA 1R9NA 1RP1A 3WWDA 4WJLA 3ICWA 2WQZA 3IBTA 1WPRA 2BGNA 3IVMA 2PSEA 1EDBA 2J3DA 2ORYA 3HYSA 3H1AA 3WWPA 3V1MA 2WTNA 3PFCA 2FUKA 3UMJA 2AJLI 1MO2A 1QO9A 5LZ5A 2HU7A 2Y6UA 3CN7A 2PPLA 1E89A 1CUGA 4YPVA 4BZWA 5BV7A 4NMWA 1I6WA 2H1IA 1UZAA 1XRQA 1QZ3A 5ALIA 4L3WA 3BDVA 5CT9A 3NGMA 3T52A 4MYDA 5CH5A 1EVEA 3AILA 1YAJA 2VT7A 4K5QA 2QXUA 3VKFA 3IUMA 5DNVA 1FFBA 3ICVA 4EY6A 1UXOA 4X94A 1DU4A 2XQGA 2WIFA 5FRDA 1H2ZA 4UHHA 1AUOA 2QXTA 5ALZA 1MAAA 4HZGA 1LGYA 2HU5A 3MGAA 1JJBA 1LLFA 3AIOA 4JUIA 5ALTA 4W1SA 1MX1A 2JF0A 2ZJ7A 5ALMA 2GBFA 4H18A 1K5PA 3FCYA 2HA4A 2ZYSA 3EF3A 3WK7A 2C0PA 3WK5A 2RONA 3RARA 4AQDA 1SFRA 2XE4A 1LBSA 4X85A 1RWQA 4BE4A 4A5SA 3AINA 1TCCA 4X71A 4HXGA 3WZMA 3I2HA 4U2FA 5ALQA 4CIAA 4DNOA 5HFAA 2RAUA 5JANA 4AN1A 1MN6A 4QLAA 5K3CA 3FSGA 3WA6A 3T4UA 3C8DA 3C43A 4X00A 2OGSA 4IQ4A 4F60A 3IUNA 3O9MA 2VEOA 3D5EA 3WYDA 2ZSIA 4UBNA 4CIBA 4PW0A 5AIBA 2WIKA 1JU4A 3DYVA 1XKTA 1UKCA 4QLOA 5D3KA 1R4ZA 1JJIA 3VVLA 1M33A 4BC0A 5AI0A 4LXGA 4OYYA 3A2LA 2WUEA 3AZQA 5AI6A 2XMSA 3DEAA 1QOZA 1JFRA 5AICA 3M3DA 1W1IA 3H1BA 3HLKA 1UOOA 4J3JA 1EB8A 3UUEA 3ED1A 3R3UA 5IVHA 1XKLA 5AKYA 1E3QA 1WB5A 4X90A 5IVKA 2EDAA 4J0GA 5CXXA 5DYYA 3W9UA 4NZZA 2WHPB 2BUAA 3FYTA 5FXMA 4KE7A 4EY7A 2ZYRA 1MU0A 1Q0RA 3H0CA 3GELA 1QIJA 4QE3A 2BKLA 1XRNA 4IH1A 4KAJA 3VJMA 2RHTA 1GQRA 1MX5A 2HA0A 3EQ9A 1LPAB 4J0DA 2DHCA 2WJ6A 3A6ZA 1J07A 2V96A 2QJWA 3VISA 4H7JA 2HDWA 1VE6A 4FTWA 4YX9A 4OSEA 4BP9A 3DQZA 1HPLA 3LLCA 3R3ZA 2EEPA 4TPKA 4UBMA 3STVA 1J06A 2BCEA 3WL8A 4J0JA 5AM0A 2V9ZA 2QZPA 3I2KA 2PSJA 1W4LA 2JGIA 5K3BA 4EHBA 1DWQA 4E11A 3DKKA 3QM1A 4B0PA 1VLQA 5AJHA 3FYUB 1TAHA 2GYUA 1DT5A 5KWJA 2PX6A 5CH8A 4UBKA 1YB6A 2JBWA 3PICA 3RLIA 4FDMA 1XZLA 5LZ9A 5K5EA 1CLEA 2HRRA 2XB6A 5C8VA 3TGLA 2DHEA 2H7XA 3WWCA 4F0JA 1AKNA 1BN6A 2QOEA 3WWOA 2X8BA 2HM7A 4KACA 4EBBA 3DS8A 4L9AA 3BL8A 3O4GA 4FLMA 2Z5GA 2ZJFA 4OU5A 1XZJA 1TRHA 1EA5A 1XZBA 4DM7A 1ZD3A 3R3XA 1QO7A 4K6HA 3D2CA 3F96A 5HF5A 2I3DA 1GZ7A 2WFLA 2EDCA 2J4CA 1L7AA 1GQSA 3AJAA 2VTVA 4UBLA 2O2IA 1GKKA 4OU4A 1CEXA 3B3QA 4XJVA 1XQYA 2VJBA 5BOVA 1XZFA 4Y2SA 4LKOA 4X97A 3AZOA 4AZ0A 2WTMA 2OXEA 1XZMA 2IITA 4PSCA 3AUKA 4L72A 1R1DA 1CUIA 3HSSA 1YAHA 3G0GA 4HRYA 3CCCA 3FSGD 4H0CA 2CEKA 1LZLA 3BIWA 2C58A 5FPQA 4DLNA 2WFMA 4KAFA 3OTQA 1E8DA 1N1MA 1D07A 4GI1A 2H7CA 2WM2A 4FBMA 5JD6A 1LBTA 4DMKA 1XZDA 2DQZA 1UK9A 2GBCA 1TIBA 2XUHA 5K3EA 5HFNA 1IVYA 5ALPA 5FP0A 3DDUA 1EDDA 4AZ3A 5IKXA 2QUAA 2C5FA 1QONA 2XUAA 1OXMA 5AK4A 1UWCA 5K3FB 5ALEA 1DX6A 1EK2A 5JIBA 1QIFA 1CUHA 2CMFA 4W9RA 2XT0A 1F0PA 5A71A 3WIOA 4MQMA 2ACKA 3DL4A 5A6VA 5AK6A 1U65A 2XMBA 4FNMA 4C88A 2XLBA 1P0PA 4Y2RA 2C0QA 1XRLA 3O4HA 3RM3A 1GPNA 3JW8A 4Y2XA 1AMNA 4Q05A 2Y6VA 4UBOA 4X6UA 7YASA 5AH0A 4C87A 2PSDA 3MUNA 4BZZA 1A8QA 1QGED 2XMCA 4EA6A 2G63A 1XZHA 1JMKC 2HA3A 3IIIA 2HU8A 3OG9A 3WQHA 3I2JA 5EIEA 1BEZA 2UZ0A 3BJRA 3WMRA 2XUOA 5AKZA 1L7RA 4HRXA 4DNQA 4FLFA 4GWLA 4UFOA 4KYVA 3DL7A 1VJ5A 4Q82A 1O6GA 3KDAA 5D3ZA 1DQYA 3K9BA 5EHNA 3C70A 4J0CA 3C45A 1G42A 3KWJA 1XROA 4PQEA 1UK8A 1QIKA 4Y2JA 2JGKA 3C5WP 2J4FA 3ZLUA 3ESDA 3GFFA 4KE6A 4X6XA 3CCBA 4G4GA 4UHFA 4BRZA 3FYUC 4BCDA 3I6YA 4QDTA 1DWPA 1HQDA 2J3QA 5CXUA 2O7VA 4BB0A 2VAXA 1T2NA 3VVMA 4QA9A 3BXPA 3WKAA 2I03A 4RE5A 5DWDA 1FFEA 1YB7A 4X7BA 1YA4A 1BU8A 3G9XA 5LZ2A 2AJBA 2OGZA 1CUBA 4OYLA 4B7ZA 4ITVA 5HQ3A 5DLPA 3STTA 3VXKA 2FJ0A 3GZJA 2PSFA 4RPCA 4KAAA 1KEZA 2BGRA 4J0KA 1EK1A 4WFJA 4UBJA 5ALSA 1GPKA 2OAEA 3E0XA 2XUGA 5K3DA 2PUJA 5CURA 2OPHA 5HF6A 5ALXA 3WKCA 1QFMA 1XZEA 1TK3A 5ALNA 3CXUA 1R3DA 3N0TA 2O2GA 2NW6A 3H2IA 2PM8A 1Q84A 2V98A 2Y2UA 1DWOA 1FSSA 3FVTA 2QS9A 1P0MA 1TCBA 1Q0ZA 1VOTA 1LPBB 1XLVA 3VJLA 5HCUA 4X92A 4KEAA 5ALFA 1XZKA 2GZSA 4G9GA 4Q3KA 3KXPA 4BVJA 2CBGA 4U2EA 4LYDA 3DNMA 2XUPA 5CMLA 4UPDA 2HA6A 1DINA 2P8SA 5YASA 3NWOA 2XDWA 5IVDA 3FLBA 1KU0A 2WILA 3MVEA 4RNCA 2WJ3A 2ZYHA 3QBJA 5HKAA 5AIAA 5ALLA 1E8MA 5ALGA 4FBLA 3TRDA 5AKJA 4AXBA 5F4ZA 1XQWA 2C5GA 5ALUA 4KRYA 2CZQA 3I1YA 3S8YA 5AI9A 3HACA 1BS9A 3KSRA 4GW3A 1NX9A 5EGNA 1VA5A 2DCMA 4DYHA 3WZLA 3R3YA 3WK6A 3DOHA 5JARA 5JAOA 3FWHA 1SCQA 3D2BA 4WFIA 1ZOIA 1ZJ4A 4ARAA 4OB8A 4QDUA 3TEJA 1HBJA 1B41A 4IO0A 1MT3A 4HVTA 2D5LA 2YASA 2JGMA 1QIHA 2V97A 3O95A 3NOXA 1SCKA 2JGLA 1EX9A 2DSNA 5AKGA 5FLKA 1WCYA 3IUJA 3LS2A 2OAGA 2XLCA 4DSAA 5JADA 1DQZA 3HJUA 4OB7A 1G4HA 4BAGA 4EY5A 2YYSA 3IURA 1CUCA 3WYNA 1QE3A 4IHAA 5LZ8A 5DYTA 4ZREA 4B83A 1VZ3A 1F8UA 4CCYA 5AM1A 3G0DA 5I9IA 1UT6A 4G1FA 5AOAA 1B6GA 3C8HA 3E1GA 4GXNA 3DOIA 4B0OA 1TKRA 4OD0A 1YCDA 4UUQA 4KE8A 3W04A 3IDAA 3QITA 5AO9A 2Z3ZA 4O08A 3A70A 3DKRA 4OB6A 1IUPA 4Q3OA 3I2FA 5LZ4A 5C8XA 4CFSA 4QZVA 2HL6A 3HC7A 1AQLA 5T4FA 2B61A 2ZYIA 4RE6A 3C6ZA 1ODSA 4OCZA 5HK8A 2JEZA 5LP1A 5CT5A 4P08A 2QM0A 5A62A 4D9JA 2OCIA 4GBGA 1W52X 3BF8A 4Q1VA 3R0VA 1CQZA 2RHWA 5I8PA 3D4LA 3ILSA 3QPAA 2WG2A 4MEBA 4BTLA 4YASA 3WJ2A 1ODCA 4EY8A 5AM2A 3LP5A 4K2AA 4C89A 4U2GA 1K4YA 2XMRA 5JATA 2YH2A 2IX9A 3QVMA 3WK4A 2JIDA 3S2ZA 1ACJA 5ISMA 1EHYA 2AJ8A 2JGJA 4M0EA 3ZI7A 5ALYA 4QDXA 2XUJA 2WHRA 2R8BA 1HKHA 4J0IA 3VJKA 3H19A 4HS9A 3AIKA 1MPXA 4KE9A 1ZIYA 3L1IA 1CUAA 5E4TA 4C01A 1WB6A 3YASA 1R50A 4G4IA 2WFZA 4CG1A 2WU3A 5LLSA 2WIDA 4E15A 3I2GA 5SYNA 3W06A 4CG3A 4UFPA 1EB9A 4MEAA 2O2HA 1ZI8A 2PKYX 5KREA 5C8ZA 5E2IA 1GXSA 1QFSA 5JAUA 1GPLA 5ALDA 2QKYA 3PI6A 2VJDA 1J1IA 5C81A 2K2QB 4AX4A 1A8UA 3BIXA 3H2JA 2DQYA 2ROQA 1A7UA 1VXOA 2XQKA 3QZUA 1X2BA 4AB1A 1THGA 5CT8A 1YSCA 4U2BA 1BCRA 2HA2A 1BE0A 1QIDA 2Q0XA 3P2MA 3AZPA 1XRRA 2YXPX 5AK5A 3V1NA 1XFDA 4QWMA 5FDFA 1GGVA 4ZXFA 2WJ4A 2VF2A 3G8YA 4W63A 2H7YA 5LKAA 1X70A 4JYMA 3OPMA 3DD5A 4QNNA 2QVBA 1E5TA 2OQVA 3PF8A 2ONCA 4QWWA 4Y2VA 1H2XA 3FCXA 4BAZA 4OPMA 3R40A 1EXWA 2BAGA 1MX9A 1X2EA 1THTA 4BC1A 3PFBA 3STWA 4DIUA 4GECA 4Y7DA 2DFPA 1GT6A 5K3FA 2QR5A 3EBLA 1MJ5A 1K8QA 2HFJA 3WK9A 1A8SA 4JEIA 3HRHA 2XMZA 1W6RA 1ZD4A 3Q8WA 4K6KA 5HF9A 2BJHA 5JAPA 3O9VA 2CJPA 4X93A 1U8EA 1UKAA 4MXDA 3H04A 1UK6A 1EH5A 4X3CA 2OCKA 4WCVA 4BVKA 3D2AA 3QMWA 4AO6A 3I6MA 4BCCA 1ZI9A 2E3JA 4GLBA 5J3JA 3WLAA 2WKWA 4LYEA 2XI4A 4H7HA 4EY4A 3OC0A 3WKEA 1QIGA 3WK8A 2AJDA 3HABA 4N5HX 5A7FA 2C4HA 2XMGA 1OCEA 4QDOA 3I6ZA 3LCRA 3STXA 5JZSA 3DLTA 4AMYA 1TCAA 1R9MA 3C5VA 3ZLVA 2WIGA 5D7BA 4H7EA 1C7JA 4MWTA 4C4XA 1BCSA 1CUVA 2G4LA 2HA7A 4TGLA 3TJMA 1CRLA 2XUFA 4Y2PA 1DX4A 2Z8XA 3C6YA 3ANTA 3A2NA 4Y2QA 1LPPA 1H2YA 4WY8A 1FFDA 5HK9A 3GUUA 4HXEB 2DHDA 3F67A 4K6GA 1YASA 4XX1A 1SC9A 4FKBA 1Q83A 2OQIA 3G02A 4N8EA 1Y7HA 2G5TA 4B84A 1CIJA 3FBWA 4W1PA 3W2TA 3O0DA 4F5ZA 4DSZA 3N2ZB 2FX5A 1XZIA 3G9TA 5IVIA 5T4BA 3WA7A 2WLSA 2Y1KA 4GEGA 1YR2A 1H23A 5AK3A 5HZGA 3BJMA 1GKLA 3G9UA 5AKXA 1R88A 5DTJA 3EQ7A 2JEYA 3X3HA 1BEEA 4L0CA 2WUGA 5LIPA 4Z49A 1ACLA 3G0BA 1P0QA 3GA7A 4QEKA 2OCLA 5ALKA 1JU3A 5JAHA 2VQ6A 2JGEA 3JWEA 1USWA 4BYMA 3PUHA 3FLEA 3QH4A 2PUHA 4UHBA 5DTIA 5AP9A 4BTVA 4KJXA 3B5EA 2QT9A 1CFJA 3WJ1A 4BATA 3IUQA 4ETWA 3ESCA 6YASA 4XWGA 1W76A 4LIPD 1QLWA 5AM3A 5KBYA 2FJPA 2RI6A 1O6FA 2PSHA 1AZWA 4JYPA 3DJYA 4G9EA 1UKBA 5CT4A 1F6WA 1VXRA 1W75A 2WUDA 4H7DA 4MJ3A 2RGUA 5FUMA 1IZ8A 2HFKA 4B81A 5LKRA 3RKSA 3D7RA 5T4HA 4A23A 5HQ3B 3OOSA 1ETHA 3K6KA 2XQFA 1L7QA 2XUDA 5EIAA 3JYHA 1CUEA 5ALVA 1NU8A 4LHEA 1CUUA 1IMJA 1CVLA 2VATA 2XQJA 1WPXA 4IH4A 4RGYA 1LZKA 5CT6A 2CKMA 1SOMA 4Y2YA 5C7YA 1AX9A 1RYYA 4CI9A 5FPPA 3SX4A 3I2IA 2PVSA 2WSLA 5A7GA 2VA9A 4N5IX 2QMQA 1QJ4A 3PUIA 5JD5A 3F97A 4BCBA 1N5RA 1XQVA 4DMCA 3Q0TA 2ZJ6A 2OCGA 3M81A 1ZI6A 5LYYA 2VJCA 2QRUA 2H9YA 4A16A 2XQIA 4Q34A 5AM4A 5IH7A 3L1JA 1XRPA 4UHDA 1DT3A 1QIEA 5FKJA 1G66A 3HZOA 4P93A 1LPOA 1JJFA 2WU4A 4DMFA 4G8CA 5CTAA 5A7HA 1C4XA 3BF7A 3ESAA 5E4YA 3OURA 4PV7A 2BUBA 1IUNA 3O4IA 4NVRA 3F8SA 3OM8A 4J7AA 3DCNA 1U4NA 3PF9A 4ZWNA 3VDXA 1AURA 4MWSA 4EZIA 1ZICA 4S0XA
chains in the Genus database with same CATH superfamily
2IDJA 3GZNA 3KPUA 2ZUWA 4KWTA 1KDOA 1PG5A 3K72B 1IY0A 3P2EA 1K8XB 3RR2A 1CUYA 2JIOA 2LXNA 2NSLA 4JWTA 2KW5A 3IAEA 2ZJ0A 2CXNA 1DBRA 3KL4A 4ZAFA 3WYCA 2HSEA 4DLLA 2Q6VA 3HFJA 3KUCA 1G21E 2VN8A 3RROA 4X41A 1BVRA 2GCEA 2VSQA 3BMCA 1UF9A 1V3UA 2W6MA 3B89A 3EUEA 4N8DA 4XTRA 1T26A 3F47A 3OQNA 2W42A 4FXOA 4QVGA 3W9YA 3SLGA 2YUTA 3GQVA 2C2WA 2C5HA 2VUTA 3IP6A 3K15A 4N6OA 4TKLA 3BXHA 5AKEA 2AXEA 2N46A 5JFGA 3L6DA 1YS2X 1M6YA 3KWFA 3NU1A 4LHXA 5SYMA 1SKBA 1RWMA 4B75A 1DTEA 1K88A 2O1SA 5GTDA 1EMDA 1UFOA 1ZFNA 1ZH2A 4G9BA 4IOLA 3FCCA 1OW3B 2HA5A 2XE6A 3EXHB 4KO2S 3SQLA 3N7AA 5BWBA 2Z1MA 3QPDA 3FHTA 3AR8A 4O29A 1YZKA 4HDAA 3UK1A 4QHSA 1PYOA 2A9JA 3ZV7A 5M29A 1CYDA 4XWYA 4MVWA 3WGNA 5A1JA 3R41A 4PO3X 3ER9A 4TTTS 5BN5A 4WACA 4DJ5X 4JEUA 4J1TC 4B6SA 1J2TA 2G04A 1PWHA 1KZ6A 4ZT6A 3ADKA 1DOZA 1LKZA 1NVUQ 2FPKA 2IEGA 2YRFA 1WUTA 1AGYA 2N1MA 2WAAA 1NKSA 1XLWA 3KPYA 1KS9A 3M34A 4L16A 2FW1A 4M4SA 1R4MA 3V3TA 3QV1A 3G1WA 1A77A 1WB4A 4UEOA 3SEQA 3AC0A 3PDUA 2CWWA 1FFXB 4FFRA 4RL6A 1CETA 2AF3C 1EVYA 2C1ZA 2QY9A 2Z57A 3FHJA 4EITA 4Z3OA 2HLPA 1PFQA 3DYIA 2IZOA 2AZDA 3V34A 3N8KA 4MA4A 1CUDA 5COQA 2GD2A 2RHMA 1CG6A 1ZH8A 1LJUA 1NW5A 3A6LA 1KMCA 3DTVA 4HLQB 5ALRA 5FA5A 3LPMA 3ZXXA 4FB4A 1N7IA 1C3LA 1W35A 1ZVKA 3EQ2A 3FOCA 4PWZA 3DTNA 3F9IA 3STUA 4XLZA 1QPBA 4D99A 2XCUA 1L8OA 5TS3A 4L8LA 1WDWB 3LG2A 2IU6A 3O93A 3CN9A 4WFKA 4XIFA 2QM3A 5I7FA 3FZNA 2V5AA 1D3AA 4CF3A 2OCPA 2Y2VA 2ZI6A 3KKZA 3QTTA 1U3CA 4YWJA 3RUEA 1FP4A 3H4IA 5B2FA 2BLNA 1RADA 4G23A 1RM3A 4DC9A 2IH5A 2CXTA 5L95A 1K06A 3BILA 1PT6A 1VSBA 2HV9A 2XUIA 4JCOA 4LRQA 1N25A 3OP4A 5L4SA 5A4JA 4TMFA 5IZCA 3EY4A 4GXQA 1OSNA 3H5NA 3QKTA 4V0OA 2VPXA 1YR9A 5KTOA 4GM0A 5HKBA 1CQWA 5KPDA 3K96A 4HZUB 4UTPA 3IVAA 4D98A 4ECEA 7MHTA 3LQ1A 2C5BA 3K1ZA 1WSDA 3WGUA 2VYNA 2OLEA 3GEEA 3EVTA 3GAAA 4YJGB 3VGPA 1QIMA 2O7RA 3FZQA 3NH6A 2BFMA 4DT1B 2CBZA 4I4CA 5D00A 5IM4A 1VLJA 1H22A 2BFDA 1CR0A 3M82A 5B1IA 4L8WB 2B20A 1ABEA 2X5XA 2O23A 1C4OA 2DYKA 2I0FA 1G0OA 5AW3A 3UK0A 1MHPA 4CUZA 4F21A 2BGLA 2DTDA 1RXSA 3H2GA 3IR7A 5KWIA 1UZMA 5F2NA 6GPBA 2I6GA 2NVOA 1RP7A 3NO4A 2BM0A 2X4GA 1GRRA 1UMDB 1CULC 2Z43A 2QRGA 3JYLA 3FPSA 3QPVA 1NQTA 4RK7A 2Y66A 3RT9A 1NUTA 2CUTA 3SFTA 4RPHA 4QXOA 4DB4A 1ZGCA 2X76A 1FDRA 1HL3A 4BIMA 1MFPA 3NVKI 5T57A 3CKMA 3L4JA 4UUBA 2G83A 3WWYA 1W36C 2WHYA 3ZWAA 1GZSA 3F73A 4ZQCB 5CYFA 3GU3A 5DNWA 1YBVA 3JATB 3PRKE 4R1MA 2E4AA 2WHQA 1M1YB 4ZYZA 3D8UA 4WDRA 5K6AC 3A1FA 2P2NA 3BHMA 1DEAA 1QFZA 2HJGA 3HEBA 2Q1SA 4Q48A 5CDFA 3UG6A 2R6R1 3OU2A 2GPTA 4PN3A 1ZXLA 5DDIP 3NH9A 1WCIB 1D1QA 3F8WA 3HBAA 4ZOBA 4WI1A 4HNTA 3NORA 4OO3A 1TZMA 3K09C 4PPGA 4Z3KA 4XH9B 4Y2TA 1QHNA 5ARDA 1JIXA 2GF2A 3ZKWA 4QQNA 3U7HB 4CLDA 2GPBA 4IIJA 4CM9D 1TQ6A 1MENA 4H7IA 4BNKA 3W5VA 4BWGA 1ZGBA 1S8AA 1YCHA 4HQ0A 2JZCA 2VSOA 4BOYA 3OOWA 1EAYA 2J3HA 4GICA 2Z08A 5DNEA 3R6TA 5DJ5A 4ZV9A 2ZM5A 2SKDA 3O94A 2JIQA 1JKJB 1C3OA 1KC3A 1M6WA 4KQHA 1J49A 4M9CA 2XMDA 4JLAA 4BBZA 3BMNA 4R9RA 1VZ2A 2GPYA 2J31A 4CL3A 3ILHA 1SBZA 4HFMA 5AUNB 5LM3A 2B25A 2EIXA 3WB2A 4UDOA 5FPTA 4Q3AA 4HQKA 3ET5A 1O58A 2O1XA 5FNVA 4EPXA 1CB7A 1Q1AA 4M83A 4MKIA 3RNLA 1WM1A 3IMKA 3EIEA 4AY5A 4X95A 4DWWA 5BV1A 4UMDA 3VO2A 1LV8A 1SK8A 1X1EA 3UY4A 1GGJA 4LI3X 4Z0HO 5KNCH 4DUZB 1QMPA 2HQ1A 3AM3A 1GEEA 2NV6A 4E5MA 1BX0A 4BNLA 2FFHA 5CHEA 1YA8A 4G0OA 1G64A 1E1QA 1O94D 3NJ8A 4AG3A 5HZMA 2BDEA 3A4VA 1V4NA 1XQXA 3RS0A 3SHFA 2OFOA 2RHRA 2PUGA 1GXSB 4WKCA 3B6JA 4D4GA 1D1TA 4TVKA 3QPCA 5EHQA 1DJMA 4E2XA 1XRMA 3IULA 2GBGA 2II6A 2JAWA 5ICEA 2IZ6A 4OBEA 1KZHA 1S2IA 1CUXA 1H3FA 4K1XA 1Z47A 3BAFA 3PXEA 4MWDA 2FPIB 5F9FA 2PUTA 2FDRA 4E30A 5I7UA 5BYKA 4DR2B 2W2QA 4LC9A 3HZHA 5DHQA 3ZX4A 1EHIA 3ZTWA 1A2BA 1GVNB 1VHLA 3W05A 2X22A 4BX2A 2ZZNA 3TPZA 2FHSA 1ISMA 1RYDA 2O14A 2BHLA 3BD8A 2C94A 4BRSA 5CA1B 4DIEA 4NMXB 1RHUA 1D04A 3M83A 5KKAA 2IU0A 3D6NB 2FLWA 2PDAA 4MGHA 1LQUA 4Q7EA 4AY2A 1LPNA 2FHPA 3OZFA 4K9KA 4QREA 1RYBA 1Y3AA 4H1HA 1KSJA 2X19A 3VFDA 3W4JA 5DV9A 5CRIA 3SR4A 3WYBA 2JCSA 2Q6LA 2X8WA 3ESBA 3IAM1 4G8BA 2WG1A 4YDHB 4CWAA 4F6RA 3UUFA 1KEEB 3E58A 1QUEA 1TYZA 3BEOA 4ERNA 4NZOA 3F5FA 2RAFA 4ZI7F 3WKBA 1XV5A 4GPAA 1UFVA 2I1VB 3TL6A 1L4NA 1QV6A 4LZNA 3LGSA 3CB4A 1W85B 1EVQA 4C1BA 4FE4A 4MRRA 4NCHA 1I32A 2JGNA 3TCXB 1Q1EA 1RHMA 3D59A 4O2AF 1PVVA 1Q74A 1RQPA 3KU1A 3QYJA 4FZVA 4J49A 3RC2A 5DTMA 4BNXA 3FIJA 3X1MA 3WQBA 3DV0B 3U1BA 4Z3DA 5BR1A 2OB2A 2SCUB 4NAUA 5F9MA 3OQMA 3A6EA 1A8IA 2FSPA 1ZQ9A 1YD7A 3LDFA 1PQWA 3DDWA 4GVPA 2KI5A 3SZGA 3LHDA 1VE3A 3IO5A 3P9XA 1OWOA 3AU8A 5KB3A 1M8FA 1C1XB 2J3KA 2LIPA 4QU8A 5JS2A 2D74A 2IHUA 1RR6A 3ET4A 4JHXA 2VNSA 1FBNA 1IZ9A 3KWLA 3HYTA 1Z8HA 5BYBA 4UHCA 2P7HA 1P0IA 3ABSB 3EA4A 3EUWA 3D3NA 3KJXA 1ZN2A 3H18A 3I9LA 2QVCA 1EDEA 3G59A 3MT0A 2KSQA 4N39A 4R7ZA 3BE8A 5AOBA 1BRTA 3DE7X 1JHOA 1ZIXA 1OGIA 1J33A 1FYWA 3KR1A 1HDEA 3N2NA 4ALMA 4G36A 1CP3A 4BDTA 3KB8A 3F9CA 1FZTA 1S2OA 3T0FA 2QYSA 3ZWNA 3MBOA 4LXIA 4QRHA 3WI7A 4AYXA 1FYXA 3N2EA 4MLCA 1K7XB 1O6ZA 3OM1A 3VBEA 2GJSA 2IVZA 5JD4A 1N0IA 1VJGA 1YKGA 3I1IA 3K9NA 2RK4A 3FWZA 4KQFA 4RV4A 4XQEA 2PGIA 5EWJB 5K6RA 1CUWA 3LIIA 1JDJA 2IHTA 5JSKA 3HKCA 1WW3A 3E48A 4DV6B 2QSUA 3LUDA 2I4MA 1HETA 1CRZA 1EBFA 1T91A 1W96A 1XWFA 3PB3A 4QASA 2AZ4A 5ALHA 3Q5GA 3NDIA 3AFIA 1U3DA 3M1LA 1V8OA 3SK0A 4OKSA 1JPUA 3ND6A 5K9ZA 3GLFB 3KQUA 3T9CA 4LJRA 1NBHA 3FPEA 1HLFA 3GRKA 5DOVA 1VIAA 2BE9A 3TSWA 4ROTA 1NLMA 3SEAA 4CHTA 1BVYF 4RSGA 5ITWA 2BMEA 3DFFA 2X86A 2XB2A 1L9KA 3E9RA 5H68A 4G24A 4ZT5A 1P33A 1VKHA 4BIIA 3U56A 2BSQA 2QP9X 2AWOA 3MOGA 2OHXA 4JX8A 4RACA 3UCXA 2NYVA 4LUCA 2HZBA 1S8OA 2AVDA 4X20A 1VIYA 5AM5A 1I4LD 3JQ7B 3MHTA 1JYFA 3LP8A 2G3YA 1JEJA 3PHBE 2DKOA 1CUJA 2FKNA 2YQZA 3D0KA 3A9UA 2HHJA 4ZV7A 3TW6A 3ZTYA 1RU3A 1Q14A 4PC6A 4A0RA 3N07A 2GYWA 2W2XA 2R3SA 3AHHA 4KIJA 2XE7A 1NR7A 1H2WA 2BZSA 1UJBA 1RKXA 3C7CB 3FGZA 3SZUA 1GDHA 2C7OA 1Q0UA 3KHKA 4FUQA 1Z68A 4W7SA 4F71A 4MUYA 4B7XA 3H8SA 4JT2A 4HBZA 1TNDA 3IQIX 5T4EA 4DANA 1E66A 4LCEA 4P83A 1VBKA 4EHAA 4CEJA 3ZD9A 1PQ4A 4BZQA 2O3QA 3PZBA 5JNTA 3VU8A 2DLNA 2Q0SA 4PHTA 4OLBA 2X8JA 3DBLB 3U7RA 4M9RA 5JU6A 3OQHA 4MGKR 1Z12A 1BSVA 3CLHA 2XT9A 3SM3A 1J9ZA 1HKUA 5BPFA 2EZ8A 1P3Y1 1XX6A 2QLBA 4I5FA 4WKPA 3L18A 5AKIA 3L06A 5JAMA 1BYUA 3IL2A 5A2GA 2HADA 2R00A 4RFSA 4UTRA 1HL7A 4MV3A 2V03A 1H9BA 4GLJA 1ONBA 1KJWA 4LJLA 3OZSA 3V7WA 1LK5A 5CLQA 4OHRA 4KQCA 3KYDA 3WLSA 1N36B 3R3VA 2BZ1A 2FW6A 3QUAA 4F4DA 3SCZA 2OGTA 4FBGA 4CIYA 1B76A 3K4PA 5K03A 2HEGA 2R5NA 1ZJYA 4K9QA 4PINA 3DLHA 2ZAOA 2WUFA 5JAQA 5DLQC 2QVZX 3O5AA 1LC3A 3QKSB 9ATCA 4X91A 2VT2A 4YJDA 3D7KA 1IM2A 1AS3A 3OETA 1OH7A 1XTIA 3ZDBA 3MMPA 1XNJA 1BJRE 1N32B 3HCBA 2HSWA 3I8OA 1GTG1 2CJFA 3LQYA 4RKRA 4EJMA 1BN7A 5TPWB 4W99A 2X5OA 3L46A 4FNOA 2YHIB 4PAWA 5A06A 4L27A 5KHAA 3TTSA 3ZXUB 1FTYA 3QMVA 1T0JB 1PKEA 3HNOA 4B9AA 1T0BA 4ZCMA 4B85A 4Z7JA 7GPBA 3NBXX 3S2YA 2AMJA 3AIMA 4XVQA 3VPHA 1AKQA 2FK7A 1W49A 2I78A 3KXIA 1C3XA 4G0NA 2ZUUA 3O26A 4I7EA 1YI8A 2FWMX 4R3UC 5DPMA 4C7XA 4ZGBA 2ZDGA 3WLTA 2VSYA 5AHXA 2Q3BA 2H1FA 1FDWA 1KO1A 4F2DA 4W1QA 1R9NA 1RP1A 4FX2A 3WWDA 2FWRA 2XHEA 5IWCA 2FW8A 2NGRA 3MJEA 4C76A 1GZVA 5JYEA 2XCSB 5LXTF 2C4NA 3GEBA 1UMBB 1IOWA 1O8CA 2BGNA 2W2LD 4G4SO 3VUEA 2D4HA 1OZ0A 1V35A 1TZKA 1OIWA 1T6BY 2PSEA 1EDBA 4AJKA 2XVMA 3AY3A 2FEWB 2ORYA 2B3TA 4OQLA 1J8DA 4LW8A 1N9GA 2QQ0A 2QYHA 2H5IA 1DE0A 4M1MA 5EIWA 4G0YA 3P8ZA 2XKAA 4JOSA 3CKYA 5E0OA 3RVLA 5EE0A 3LQKA 3AQIA 1Q2XA 4EG5A 4RDXA 4KHPB 3PFCA 4M54A 1VJDA 2XVAA 2FUKA 4IGIA 3UMJA 5DK4A 2AJLI 2WRZA 2Y1DA 4JUCA 4RHYA 4XE5A 2A3NA 3O3MB 3VTAA 5DSTA 1NBWB 3DYBA 3BH6A 1YB5A 4XWTA 4DVJA 2HU7A 2EU8A 1DADA 3VYTB 2Y6UA 4Q9IA 2QJOA 5AQ1A 2Z9CA 4V0RA 1VLZA 4RLHA 1K5GA 2C3OA 2IZ1A 2XTJA 5KI6A 1MBZA 1L5LA 1Z37A 2YNMC 1XEXB 4RDIA 1A4UA 3S68A 3PJFA 2RB4A 3U31A 4BL5A 5HEKA 4I4IA 2CVZA 4IZIA 4HGQA 1Y8QB 4L8GA 3RFTA 3LBNA 4DIMA 1I6WA 1S9HA 1YQGA 4Z1MD 4CLRB 2DPHA 3KQNA 1Y5MA 2HDNB 2AOVA 2W90A 1EZ4A 4MW5A 1ESNA 3LK7A 4NV0A 4W8HA 4INOA 2XZTA 4XGKA 3BRSA 1QGAA 2ZDQA 4CDMA 2ZYVX 1YJXA 3QEMB 3R8CA 2V5UA 3V8NA 3NV7A 4L3WA 3MGCA 2XPCA 4ZT7A 1L2TA 3L79A 4CIVA 4YH1A 5BVHA 1NIPA 1HDYA 4Q7KA 1E3IA 1NT4A 3ND7A 3NGMA 3PJEA 1KH1A 1JQLB 2JAUA 5WRFA 4PZDA 5C8DA 4DDVA 4NX2A 4NJOA 5CH5A 2PKQO 2IUUA 5LDHA 4GBMA 4YIHA 1EVEA 4EKYA 3UAYA 3ZQKA 4KWIA 1TU3A 2GPWA 4OP3A 3FMIA 3ITDA 3RK0A 5F98A 4N0DA 5KKCA 3HFGA 1GKIA 1RRVA 4TL9A 5EMMA 1Z8DA 1MVNA 1P8JA 4CKCA 3M9LA 2ZGVA 4E3ZA 1A98A 1KR2A 3A6KA 3P0HA 3LFHA 5HILA 1QYIA 3BGOS 3JQ8A 2K6GA 2QW1A 2AF4C 4OEHA 4Q1BA 4EY6A 5L3SB 2I65A 2OFWA 2I7DA 1AV7A 3TI7A 4BEJA 4K6CA 2ZI4A 2HMVA 4WT7A 4IICA 2WIFA 4MJXA 2Q2WA 4YRMA 5FRDA 4BEVA 4HDMB 1E3LA 3AEYA 1RXVA 4F4CA 4REQB 3RSLA 2B30A 2PBFA 4HZGA 2QMHA 4YCNA 3DGEC 1KH3A 1NW9B 2PZ8A 1QR6A 4HQFA 2X2FA 2YV4A 4M0PA 4ZZ1A 1HSZA 3MTQA 5EZYF 3RAGA 3AIOA 3WOVA 5ALTA 4WCFB 4EJ2A 2PKRA 3CLTC 3IIEA 3S99A 5DI9A 2JF0A 2JLBA 4DV0B 1K5PA 3ML1A 2RE8A 3FCYA 2YHAA 2H1CA 3W8FA 2HA4A 3EF3A 5TEWA 4PYLA 5FFMA 3WLLA 1UBNA 2C0PA 2DZDA 1QZZA 1VPLA 2VHQA 4F1JA 3WK5A 2ESRA 4GT1A 2WFAA 5LOVF 2DWCA 3TN7A 1QXSA 1MQ9A 1W88B 3PHCA 4DIOA 3FB4A 1A2OA 3PFIA 4A0HA 1CWUA 3D7SA 2VLBA 1SM4A 3SJCA 2XRZA 2QTZA 1KFBB 3B52X 2NXEA 1RWQA 4HDCA 4NARA 4ND2A 1P9RA 2HSDA 4M1TA 1C3EA 2E4WA 1KJ8A 3AINA 5GGXA 1ZW1A 2KHZA 4QG7A 3F6YA 3WP1B 4X71A 1AQJA 3CY6A 1AKWA 3WZMA 5KSZA 2IZ5A 3PEEA 4NMHA 1O03A 2FUEA 1UDAA 4E5SA 3UGKA 3MELA 1E5LA 4PRYA 5ALQA 3WGQA 5HFAA 3DZJA 2IWRA 2DPYA 2RAUA 4CIXA 3JZAA 4AC9A 4YRNA 2PX5A 3IDSA 1UWKA 3L07A 3VO1A 1Z5PA 3DO8A 1J97A 4QPDA 2VNHA 3WC4A 4ND6A 1RZ3A 5D3MB 2ZZMA 1BA2A 2OECA 3SOZA 1RT9A 3FSGA 3UHPA 3WNDA 3WA6A 4YRIA 4OJYA 2A5DA 2JZNA 3T4UA 2NXJA 2YVUA 4NLLA 5JO0A 4FCCA 2OGSA 4UNSA 2ZTHA 1YC2A 2J6HA 4HH3C 2BMAA 4YRLA 4CCAA 2ZWVA 4EW3A 3G1UA 4P82A 5L45A 3OA0A 1USKA 5BSGA 4OVKA 2O06A 4NAVA 2RC5A 3HGMA 4NG5A 3KQLA 4DF3A 4MGYR 1PR3A 1OLXB 2WSYB 1EGVB 1NDHA 4OQMA 4AF7A 1DQNA 3TFOA 1G8YA 2WOOA 4N4AA 1G21B 4CIBA 3PUXA 2JCYA 1GU0A 1SU7A 2ZG6A 3HXTA 3JYQA 5A7FA 5D3KA 5I7HA 4EPTA 3U44A 3EIHA 5K0ZA 4IGFA 1ZKMA 3OQIA 3VVLA 3OLYA 1PV4A 1M33A 2CFSA 3SFZA 1YJAA 4R4JA 2JK0A 1B6TA 3BL5A 1G63A 3B8HA 1JDNA 3PC4A 4E94A 5JTUA 4U7JA 3A2LA 2FPWA 4NOLA 4CR8A 4URUR 2LUOA 5BR8B 1S3FA 1NL3A 4JT9A 4EKIA 1O96B 3A3YA 4DL9A 1CDOA 2X7XA 3IHWA 1K8ZB 2XMSA 1U1GA 2EL7A 3DEAA 3OMWA 4IIUA 4MGIR 3TQFA 5KWSA 1R0CA 2QI9F 3KNZA 2G8LA 4MRSA 5CJPA 2NXCA 3G2PA 5JH7B 3CT4A 1I3LA 1GPDG 1EXNA 4ARIA 3OZ7A 1NRXA 1KAMA 2JAQA 2WHXA 2V7UA 5DW3A 2GN2A 2P5SA 3O6VA 4BNYA 3WDKA 3DLCA 4KQ9A 5I4KA 1MHTA 1A9OA 4MWOA 3DO5A 4RQUA 4RNDB 1FNDA 1PS0A 1X1CA 1NJFA 1OTYA 2FQQA 2JHCA 3E7FA 1EWKA 2XZPA 5HR5A 4O4HF 2O20A 3ED1A 3R3UA 4MMYB 1DC3A 1XKLA 1X13A 5FDFA 2DGDA 2XB4A 3S7ZA 3LO5A 3FDJA 3CVUA 3GZNB 4J0GA 4LN1A 1ND5A 4LY6A 1IBKB 2BBOA 4Q15A 4MQ4A 2WUWE 1UJ2A 4IJ5A 5FXMA 1L8AA 1ZRSA 2J3JA 2AOWA 4KE7A 1E1RD 3BMCB 3NXKA 1AQIA 1Q0RA 4KN9S 5CVUA 4EY7A 5DHAA 5CB4B 4GVXA 4BFUA 5IAOA 3IVXA 4WRRA 4Q3CA 1Y1LA 3GELA 3VYWA 4DUPA 2C2YA 2GF0A 2NWQA 4MUAA 2OY0A 5BW8A 1X87A 2PZBA 2ZRDA 4KAJA 3KXKA 1MX5A 1E77A 1SQFA 2AUTA 5FUBA 4MUHA 2PKCA 3FMOB 2IV3A 3X1DA 4WBNA 1ATZA 2D7JA 1DSSG 5TB5A 3K0CC 3T1HB 1R6XA 5B2ZA 1ZH4A 1PZXA 2P9GA 3RIGA 3VAAA 3VM6A 4F4HA 3OM0A 2WJ6A 2PJUA 3CX4A 4A7PA 4D9KA 3OE5A 2GCIA 1YNOA 2V96A 3VISA 1YL7A 5TQJA 4GE3A 1LVHA 1IZZA 1PUXA 1N1DA 4I4TF 2JG3A 2H4YA 2ZDHA 4IIVA 2FSSA 4G5OA 1ZOSA 2OFFA 3HR4A 1FUEA 1A72A 3C3XA 3IRVA 4MWGA 4MVJF 5I3ZA 4BP9A 1XRSB 1QWOA 3DQZA 4IQGA 3N0WA 4UXHA 5LP6A 1JAXA 4D9MA 2EEPA 4PAQA 4UBMA 1UQUA 4BXOA 1KJQA 1KTVA 2BCEA 4BQEA 1GZ3A 4M9XA 3DDHA 5EKSA 3PIDA 4EA7A 4LNUA 3ZC3A 2FPGB 3I2KA 2JLWA 4YRSA 2C96A 1QR2A 2PSJA 3BIOA 3RYFB 4BGEA 4MQFA 1EBBA 4X9XA 3VR6H 2FOXA 2IUEA 3DTVB 3B6KA 5BSRA 4IFIA 5IN4A 2OO3A 3KZVA 4TV8A 2IY7A 3ZVMA 4TS3A 4YACA 1C1YA 1VLQA 5AJHA 1OYYA 1UZLA 1H8HD 2QUKA 4KDRA 4WOCA 2O59A 4A1FA 4MIOA 4HX5A 2C4UA 2PRJA 3GDHA 3BZUA 4FMCB 1VL5A 5JJKA 1JYEA 3NASA 5DCYA 9GPBA 3WIVA 1IHYA 1YB6A 4RVOA 2ZT5A 5BP7A 5I7WA 4AY3A 1FP4B 5TPZA 4XGRA 4G1VA 5EFOA 4I3HA 5K4HA 1XAGA 1G8SA 4EELA 1C5KA 3TFQA 3DBHA 1NATA 1XCPA 2IDKA 1XNRB 3MJRA 4X6LA 3ZZUA 5F5LA 4IS3A 7AT1A 1V7QA 3FFAA 1V1MA 3GFPA 3HJNA 4HH4A 2I4NA 3UCEA 5MDHA 3TRKA 3PC6A 5LYJF 1XB2A 1GNVA 4QUGA 1LSSA 1RAGA 3RC7A 3ZBQA 4G09A 1X3SA 4RETA 3ZK9A 1NYRA 4RHTA 1WZEA 1IE3A 2O7NA 5LIRA 3WGYA 3EXG2 4V0LA 4ZJUA 1NWHA 2GUWA 3L7LA 4BVHA 5MN4A 2EBFX 1TYDE 4RM2A 1L3IA 2JA2A 2BFDB 4MI3A 1F2TB 2IXBA 3IILA 1P0CA 2Q5QA 1MW9X 4LNAA 1GA4A 1T1RA 1ECBA 2ZP1A 1E0JA 4S1TA 2E4ZA 4V3BA 4A1OA 3A4YA 4L9AA 4OP1A 3FUWA 1NP7A 4MUIA 1NVVQ 4QC2A 2VJOA 3WFJA 4LF9B 3TIFA 2PL9A 1G3UA 1XJ0A 2P1RA 3GN2A 4IEIA 1XCOA 1WV1A 1NN0A 1ONSA 2ZETA 5CLIA 5DWVA 1C8VB 2H5EA 5EPOA 1XZJA 5ENVA 1P60A 1WNFA 3EPPA 3HCRA 3W2FA 3ZIDA 4EG0A 4L6IA 1DHTA 2W7TA 1XZBA 4C05A 3ZJVA 1JHMA 5FD8A 4B8ZA 4XWAA 1T6NA 4KPYA 3JVVA 2PGOA 1CCWA 1RRPA 4QOSA 5HNKA 3DDSA 2BLLA 3S1SA 2BTQA 1Z16A 3EDYA 5LWQA 5F3WB 1Z18A 4RLSA 2JKZA 3WV5A 3UT6A 3Q8MA 5L7WA 1T8SA 1CJUC 3UO8B 1E20A 2BFPA 2C9ZA 5F12A 2QTNA 5TX7A 3TFWA 2W5UA 4DCGA 2WFLA 1TUBB 2GPSA 4H60A 3DUFA 4JL6A 2EDCA 3DEKA 3VHQA 1L7AA 3U4HA 1J1UA 2VTVA 1KBQA 3K0FB 3WICA 4CI0B 2GJAA 2X1VA 3ONDA 4M21A 4NK5A 2RHDA 4XZ3A 1Z88A 2CNLA 4F7WA 3S1AA 3GLGA 1LNQA 2ZVJA 4FILA 4JBNA 3UJNA 3ZKWB 2QL7A 1PL6A 3CNQS 3I52A 1F8FA 3A4MA 1QH9A 4TLLB 4AMVA 4C7KA 1YFJA 3M5DA 1EEXB 3RTGA 4L02A 3ACDA 4FGJA 5B6PA 2UKDA 2YW9A 4PX3A 1MUUA 4II3A 3KWMA 4M1SA 5KWEA 2F9MA 4B6RA 4Y2SA 4LKOA 1T8YA 1N5IA 2FR1A 2WT9A 4DCUA 3CLRD 2ZJ8A 1VRWA 3AZOA 5CX1B 4P3YA 4AZ0A 2RMKA 1KIAA 3O3CA 1U98A 5KYKA 3CH6A 2WTMA 4TM7A 1IDN1 1PX0A 3DFZA 4AJOA 4F11A 1ADYA 4Z1OA 4QU9A 3R5FA 4IJ6A 4QXAA 2IITA 2VTKA 4PSCA 1ZCJA 3AUKA 1M7HA 4IV5A 3BMNB 4IJUA 4NEQA 4RMJA 4DM4A 1KHTA 2O7QA 3IJRA 1XTBA 3EGDB 3KR0A 2EW2A 2OA0A 4WTOA 4CG0A 1YAHA 3H16A 4JB2A 5FNVB 1X8KA 3V8VA 2FE1A 2JGAA 4HRYA 3EVGA 1Y48E 1O87A 1Q15A 1RPNA 3DCJA 3FNRA 3WSVA 1LVUA 2IBTA 2CEKA 2PN1A 3AGPA 3AWIA 3SHWA 3QPUA 4ALKA 3NPMA 4X1IB 4XUEA 3BIWA 4LY0A 2C58A 2AFHA 4ZVRA 2X3YA 4JASB 5EJGA 5FPQA 1X7GA 2Q8QA 3U80A 1DL5A 2AMVA 5TGDA 4AF6A 1FS5A 4U7TB 3L0PA 1DOAA 4JR1A 2DF8A 2D8AA 1L5YA 2RIRA 5BSFA 4QPJC 2R65A 5HPYB 4ZYTA 1D07A 3BTSA 4H15A 3KQWA 3VKGA 1LF5A 1SOAA 1MA3A 1HMPA 3N70A 3JAMA 1QC5B 4RF3A 1YFLA 1BE8A 2Q5HA 2ID8A 4YMLA 1XK7A 3BRWA 4ZYWA 2R7NA 3U19A 1G19A 5B36A 1IH8A 2JIMA 3CZ4A 3IXMA 1C1DA 1NW3A 2H1VA 2D3WA 5KU7A 5IANA 5JVDF 2XUHA 3B9BA 1BDJA 2CSUA 3DL2A 5FPHA 5CDSA 2A1TR 4I9NA 4R2LA 4FOPA 1BS2A 2QORA 4C08A 3KD3A 4MYHA 3DDUA 4NXNB 3PUYA 2EFYA 3JQAB 1EDDA 4MQEB 4Z5XA 3ZHQA 2G67A 5KVQA 2HJRA 5TF0A 4A2CA 3O31A 5IKXA 2C5FA 1YZ3A 1M34A 1CBUA 2IBMA 2A0YA 1KFEB 1G2QA 3QKWA 4AYTA 5C35A 2VDMB 4F6RB 2E0IA 4BGVA 3BG5A 3OOJA 1VI2A 1K1EA 3X1JA 3I5MA 4GNRA 3KOUA 4GOXA 1PS8A 4BWYA 4DGSA 1AGNA 3D4OA 1AO0A 4TKVA 5G4KA 3MQ2A 3AHDA 2BISA 3L6BA 3E8SA 3UW1A 3N2LA 1V1RA 3F2VA 3H13A 3HCCA 2EZ9A 1AUPA 3VOBA 5JIBA 1QIFA 3FOEC 1V3QE 1PBTA 5BUZA 2Q6KA 4AG6A 2BEUA 3BFVA 4BO3A 3I6BA 5TV2A 2XT0A 3L6CA 5ANRB 3D9QX 2I29A 2WE7A 1DFHA 4IEEA 3U1VA 3WIOA 3TRIA 3JQPA 4AJ2A 3SVTA 4MQMA 2MR5A 3A10A 3QUBA 4EFMA 3LWDA 1J7KA 3A1NA 4MUEA 1VHQA 2XYVA 2FK8A 3FB1A 3UB2A 4J1TA 3C7KA 3TNDA 3FTDA 2C7RA 3L41A 4UHJA 3ANYB 3PL5A 2O8VA 4RH1A 4HG2A 5B1HA 3HM2A 1WE2A 2QTLA 4LYHA 1VKRA 4OXIA 2R7MA 5J2UF 1MH1A 1EP1B 3ANNA 3ONNA 4LJ6A 1N0HA 1XPOA 4RK0A 3D3KA 3T3IA 3SKYA 5B37A 3FGOA 2YWRA 3UJPA 4C29A 1I3NA 1U0RA 3DTVD 3V2GA 4KQ1A 4F12A 4QD3A 1P81A 1RQXA 1V2HE 1X0VA 2ZQZA 1OAAA 5EL0A 2UXDB 5EMJA 1V48A 1N6NA 4FYXA 2VDJA 1VB5A 4R8LA 3VZSA 1B15A 2QRLA 1C29B 3QE2A 1XJ5A 4RVCA 4CUJA 4KCGA 1FUYB 3KK0A 5JZVA 3S81A 1RRGA 4IM7A 2NYRA 4KRFA 1DAKA 2X9VA 4LECA 1L8LA 2J7KA 2ZRHA 1E59A 2I22A 1P5JA 1Z4IA 1Z06A 1G2IA 1J23A 1W6UA 2KS6A 4YAOA 4XYMA 1Z9BA 1GGKA 3D43A 3DVQX 3HKCB 1JMKC 3PYXA 1B3BA 1PGJA 2HDHA 2VTEA 1F2DA 1JSRA 2GK4A 4N9WA 4UTXA 5GPBA 5AWFC 3TIXB 4F91B 4FMDB 4M9QA 1PYGA 2BM8A 3GRYA 3O1LA 1RHRA 2UVPA 4D41A 2O8FA 3QW4B 5DM4A 2UZ0A 3BJRA 3TQHA 5BMVB 3ICQB 1EG2A 2DPXA 1JG3A 1TYCA 2W00A 2BP7B 3A6PC 2B94A 1O8BA 4GF5A 1ZDMA 5TQVA 5LQMA 1F3OA 2W37A 1VBMA 4MULA 2VYND 2KLHA 4DA9A 2QX8A 5HUHA 3TOCA 2IS1A 2VUUA 5K3OA 4MA5A 1P5FA 4CKBB 4GWLA 2C4MA 2OL4A 2Q6IA 3TD6A 4QBKA 4D9FA 2SNIE 3AG6A 4JJAA 1F6BA 1J0XO 3OEYA 4KYVA 3JD4A 2Q62A 3REGA 4BEBA 3BMQB 2VF5X 4RV5A 3GBPA 4B73A 4ENVA 4MUMA 2J3EA 4XWOA 3B6EA 3KDAA 3QKIA 4TTRA 3H3JA 1YGYA 1HDZA 1NA5A 1ZC3A 3MZ0A 1X7XA 4X20B 4X66B 1FF9A 1I2AA 1ZOOA 1NXWA 3ZWPA 2WPNA 4PSVA 5EHNA 3TX6A 1JF8A 2CD9A 3PQ7A 1SZDA 1ISJA 3LLMA 5IXJA 4KXUA 1U1DA 3NEAA 2QJTA 5C8YA 5CEEA 5KJ1A 4N0PA 5CW1A 4KR2A 3FM9A 4PG5A 2JS7A 1RE1A 4G37A 1UK8A 3BGWA 5B57C 1N2IA 1SCDA 4BVEA 2JGKA 5JBQA 3AHJA 4M87A 3LXRA 4HB0A 3ZLUA 5JEEA 4CEJB 5EIBC 2VC2B 4OATA 2Q4OA 2I4OA 1X1SA 3G2LA 4RJLA 4EFKA 1OGYA 2WMDA 3GFFA 1H2FA 3K8QA 2XGSA 1KI8A 3L5OA 3CCBA 3OZRA 4BMZA 4BRZA 3H5WA 1Q17A 3FYUC 4KKVA 2HSGA 2XEXA 3ZIUA 3BGSA 3DKVA 5J4KA 3BFKA 5LQRA 3UAXA 4ZO4A 3NT2A 1QHIA 5IRCD 1NT2A 1JR3D 3AVTA 5A5FA 1T2NA 2NZJA 2WJYA 3PWZA 2PXCA 1S8FA 4L1KA 3PA8A 1OHHA 4F96A 1R0SA 1N3IA 2YXEA 5B3AA 4GGMX 4L4RA 3PFHA 3K09A 1SGWA 3DP7A 3WKAA 4CMEC 2A5LA 1SWWA 3AM4A 4RE5A 4EP1A 2NSDA 4C2BA 1L7OA 3U49A 3DE5X 1C0PA 1QH1A 1YB7A 1YQDA 3RAJA 2AZMA 1FX0B 4RTLA 1WUIS 1CHNA 1YZGA 4PNHA 2JGRA 2N1BA 1POXA 2OGZA 1CUBA 3LX5A 5U4XA 2ZTLA 1XUOA 3WYGA 4B4WA 4B7ZA 1V9LA 3FKSD 3G82C 1XD8A 3T38A 4QXPA 5CD1A 1P44A 5HQ3A 1QYXA 2PGNA 2PIDA 1XJQA 1KVTA 4OHKA 4YT5A 5G02A 4PPQA 2JHPA 2VTDA 4RPCA 2WWIA 1LDBA 2QDXA 1PLLA 2BN4A 2GPNA 5FOVA 3RSQA 3WGJA 4A8PA 1UEIA 3EY9A 5DIZA 1GPKA 2P0EA 2OAEA 1GZUA 1KYXA 2XUGA 3E0XA 3NBZC 4HEJA 3G49A 4XYGA 1T9GR 2QPAA 1NLYA 4B74A 5HF6A 2GA8A 3ESYA 2RG1A 3UJ9A 5ALXA 3L3BA 3OIUA 1E1QD 3SXUB 4NOKA 4EQZA 3C1UA 3N0TA 3U17A 2N75A 4R3WA 4E13A 4PANA 1I6LA 1F9AA 1VIMA 1ZD1A 4WA7A 1J09A 5I01A 1V71A 2JL1A 1JG7A 3ANLA 4IMPA 1RCFA 1SQ6A 2ZYAA 4KR9A 4NCIA 1RJWA 4IUDS 3N8GA 2F3PA 1ESCA 3LYLA 1DVRA 2AI1A 2J4DA 3RUIA 5BQOA 2C78A 3IUYA 3R9XA 1Y80A 3QEKA 1HYEA 1N9GB 2E4XA 1HT2E 3O8OA 3PQDA 4Q4AB 4QELA 4DSUA 3KQTA 3BSYA 2LD4A 1WMBA 4FQ7A 1THZA 1ZM4A 3NBQA 4IG9A 1Q0ZA 1OWMA 1GYPA 2EHJA 2PKEA 1LPBB 2WDZA 2WIAA 2X4DA 3OX3A 1XLVA 4GMXA 1Q0HA 1ZOLA 2ZVPX 3WP0A 3LCCA 2UVQA 3ZWCA 4XDHA 1DIHA 1M73E 2WV9A 3UMYA 2QQFA 3LGXA 3VJLA 5HCUA 4EUHA 4X92A 4FGUA 1C4KA 3WMEA 1UQRA 5HKLA 1OIXA 4AU1A 4IDEA 1T3HA 4N7RA 4NBTA 3DTTA 3ORSA 1SXJC 3WGLA 3WADA 1US8A 5JY6A 2XEDA 4MPPA 2BOVA 2V5VA 1QKIA 4HDRA 2OEPA 4JLMA 4Q3KA 4HPJB 1FTQA 4AKGA 3CTPA 1J0BA 3CRW1 5EUBA 1Q95A 4GKKB 4U2EA 3SQXA 1X86B 3PXCX 2XUPA 5SZKB 5I3CA 3PWKA 1OV6A 4IYRA 4UPDA 3ZYZA 3R5XA 2MSLA 1P2GA 2IGBA 3W77A 4D9CA 3OI7A 5I9LA 3HY4A 4DA0A 1K86A 1I1HA 1ZSNA 4I1PA 2H1WA 3KOMA 5BV2P 3FLBA 5JV5A 2DQ4A 2TYSB 1KU0A 1SMKA 2FG7C 2WILA 2FMIA 3C6KA 4QT0A 1ECGA 2YR0A 2Q7DA 4C0XA 2GASA 3I73A 4B79A 5BVHB 1C2YA 4ZCTA 2WJ3A 3E6AA 1OLSB 2GEDA 2ZYHA 3CS3A 2JFZA 1RD4A 2PMFA 4B46A 4DLXA 3GJ6A 5AIAA 1J39A 3R77A 3PCTA 2PY6A 4P80A 3GJ5A 1ZCFA 3PGMA 5AKJA 4Q01A 1DXOA 2LCIA 3LF2A 4DLWA 1HF3A 2I9KA 3UQYS 2C7GA 4CT5A 1AZLA 4CKCB 4B6JA 4UNNA 4BQRA 4EO4A 4XVUA 4DLVA 2HF9A 5AI9A 3HACA 4Z54A 1BS9A 4BFLA 2YIJA 4R7TA 4Y1FA 3AGQA 3K31A 5JFTA 1V26A 1BXGB 1E1MA 1I1NA 4KGZA 3HV0A 5AW8A 1DC4A 1NX9A 1DAFA 2VFAA 4RD3A 4ZRNA 2QAGC 1I7NA 5EGNA 4RO0A 5LUAA 1KP2A 1RPAA 3R3YA 5CYOA 3KBBA 3ZV6A 1EIWA 4YJ3A 3U7FB 3QMPA 3INYA 3MINA 3DXFA 5EEHA 1HRDA 3FWHA 2JH8A 3D2BA 2IU3A 1ZJ4A 2IHBA 1XAJA 1V7PC 4NI5A 2WVGA 2YN4A 4UMEA 3AVWA 3ORQA 4LSMA 4OB8A 4Q7MB 4QDUA 4RSHA 3TEJA 5BPHA 3SZLA 1E2JA 2LP4Y 5EC8A 1B41A 1RI1A 2FZ5A 2HCRA 3L7YA 4FR2A 3WLIA 2XSZA 4YHHB 1HEIA 2JK1A 2D5LA 2YOGA 4FT4A 3KJEA 1ZM7A 3NOXA 2G7ZA 3LT5A 2PX3A 4GUAA 4L3OA 2GS9A 3UAWA 5KYUB 4TMVA 1LUAA 4E5KA 3UMMA 4PX5A 1JIJA 3PG5A 2PLRA 3E9CA 4WJKB 3R5HA 2EJUA 1I2MA 1YZUA 1SVLA 3GMSA 2X2PA 1N7HA 1HC7A 3LZ6A 5AKGA 3C41J 5FLKA 1XWWA 5KNCD 4BNUA 3KCNA 4UVDA 1R37A 3DT6A 3EGIA 3HDTA 3OZEA 2AMLA 1N7GA 3ZQJA 4CMKA 2OYCA 3W6OA 4AF8A 4CEHB 1Y1SA 3V42A 4N3CA 4RJKA 2XLCA 3CNNA 4UREA 5A05A 5BMOA 1DEXA 5JADA 5AXCA 1EA7A 1MZVA 4OB7A 3WNVA 4CQNA 2BKUA 4KDCA 4NHOA 2WWWA 3SXPA 1UWLA 4ZEOA 1NBMD 3AEQA 1GUYA 3WYNA 4OBBA 1WF3A 4OHCA 1OR8A 2FSUA 4I9HA 4M49A 3GPLA 1G9SA 2BI7A 2PL3A 1H2BA 5F7XA 5KYYA 1Q0SA 5KX5B 1OWPA 4JC8A 3TTXA 2EBHX 4BX8A 2JFQA 4WADA 2B9EA 1O1YA 3G0DA 1M2HA 3KQMA 4OV6B 5AM1A 1XQ6A 5EVJA 4CEIA 2QD2A 1GGFA 4FM9A 2OZLA 2PKWA 4DTIA 4O4IB 4RTRA 2JJYA 2CB0A 1W87A 3G0HA 5CFLA 5LMNB 1QVRA 1TJNA 3E1GA 1HTWA 3EYWA 5DXAA 4R40A 4B0OA 4E6PA 5M2QA 4KH0A 2W11A 4UNPA 4OX9B 1YCDA 4UUQA 1GHTA 4JJEA 1RHKA 3W04A 1GM5A 1POWA 2HPAA 5EUQB 3VU1A 3IDAA 4G1CA 1MO5A 2NU7A 3W8EA 4H0NA 2Z3ZA 5FI0B 3IALA 5FPKA 3CZQA 2ECOA 2HJVA 3MWEA 3T3PB 1Q1GA 2HHHB 5CXQA 2EKLA 1ZAYA 3IA7A 5TE9A 4EHHA 3S2IA 1JPVA 5KVAA 3OQIB 3BK1A 5EHIA 4Q3OA 3SG0A 1Q7CA 5LZ4A 4UC0A 1Q3KA 2AS0A 1B43A 1UBUS 2PLAA 1LJLA 3B1VA 3N8HA 3TSAA 4CFSA 3HC7A 2AHRA 5B3KA 1NOKA 1L5HA 4X45A 2UUOA 5K6TA 1H0RA 2R8OA 5IAKA 2OBBA 3KKNA 1EJ2A 4RTSA 1HDXA 4HEA6 5EIXA 1ARZA 1XPJA 1SXQA 1NF9A 5FO0A 1CSEE 5TDHA 3VX3A 1FC0A 1W47A 4N5NA 4P81A 2JEZA 1ZKDA 3GNTA 1QVAA 3QTBA 5MFPA 2NO5A 4PZAA 4GR4A 3NX4A 5CT5A 4P08A 4MZXA 3DZHA 5DX8A 1Z63A 4HDKA 2FV8A 2OCIA 2R86A 2WTAA 4K88A 5ITVA 1W52X 2V0GA 1SUSA 2MJLA 4EPYA 3SBEA 1I3MA 1CQZA 4ESEA 5JBIA 1Q92A 4O02B 2QUIA 4N5LA 4BNNA 3OLQA 4K9NA 1YK0A 5L7YA 3RSHA 2R8ZA 4NU6A 1F4LA 3C4VA 3ENVA 4K6FA 4XM0A 1RBMA 1WP9A 5B1SA 4OYRA 1K27A 3ILSA 2Y27A 2D2EA 3BXEA 4OQZA 5CB6A 4I1OA 4J4BA 1YBFA 4OSOA 4CIDA 3ECCA 2C04A 3IV6A 3OPNA 3EQ6A 3PXBA 1K7FB 3EAQA 1V4VA 4LV5B 4YASA 4B4DA 1GG5A 1ODCA 4F1KA 1SIOA 1YZHA 2AG5A 3ELBA 4YNBA 4EY8A 5K0TA 2OT3B 2R6FA 1N6HA 4CT4B 2M6RA 1HFEL 1GUAA 4K2AA 3SS7X 4C89A 5KIAA 1V9SA 1FDVA 1L7NA 3ZWVA 4HS4A 1DUIA 2BR4A 1XCGB 2OLKA 1XXHE 2WOJA 3HBFA 3RANA 4F92B 3S2ZA 2WYWA 3PNQA 1IBLB 4WBNB 3TVTA 2IQIA 1B00A 1YOBA 1WXDA 2H2AA 5ISMA 1KEUA 2JFPA 4RHXA 1J0EA 5IUJC 2IYZA 5C2JB 1CY2A 5IYZF 4C7JA 1EXDA 2KBFA 1D9XA 5HKKD 3G2HA 2P30A 2ZUVA 2JLAA 5FORA 2FQWA 1EWQA 2ZIAA 1QP0A 1G6Q1 4YP6A 4J4HA 2B1QA 1VB3A 4IGAA 1HKHA 1XLTC 1CZOA 1KYZA 3V7UA 2YNMA 1SPXA 1MPXA 3CT6A 3MSXA 5C37A 2D7CA 3QIVA 4GSYA 2AXNA 2JFHA 4GLOA 1GG9A 5CVTA 4ABTA 1HG1A 3L1IA 4K8RB 4Q16A 1CVIA 1MJHA 4UCQA 4CFYA 3ADBA 4ZJPA 4RELA 5FYDA 5KJCA 1DIGA 3WXMA 1LFAA 3H3XA 3ABIA 4LNUB 1DBQA 5EJFA 2X5JO 4PM4A 2GHRA 4DJJA 4CG1A 5LLSA 3L8MA 2JCGA 3U3MA 1VGRA 4IL5A 4GM4A 1PEYA 1MF7A 1PJZA 3PD0A 5F64A 5SYNA 4C78A 5LVAA 3QFHA 1WXEA 1KPIA 1VE9A 3A1EA 3CZMA 1EB9A 3ZH9B 3M33A 1ZI8A 4I8IA 3O1IC 4NYJR 3ZUPA 5B7QA 3HKBB 4OBXA 3Q0IA 4TVSA 5KREA 3TZHA 4EGQA 1P2BA 2VI5A 1R0YA 4XB1A 3LO8A 4ECAA 3GW8A 5IC4A 2H59A 1M3SA 3I23A 1FJGB 4FSXA 1DEHA 1YU9A 4GP9A 5BRAA 5C8ZA 4AMGA 5DBOA 1E2KA 3D1VA 3DBHB 4L4ZA 1NONA 1GPLA 4M1EA 5B1EA 3LNCA 4JUDX 4G5FA 1VPDA 2Q9BA 4WPGA 1ST2A 4YRCA 5JY1A 3U4DA 1EE2A 2OSBA 2A92A 2W6NA 2YZKA 1AQYA 4RKQA 4DPKA 2Q4DA 2DQYA 1U94A 1NZJA 1RXCA 3KRTA 3M1AA 3SHQA 4LF8B 2VAWA 1OIVA 4H7PA 3S27A 3Q72A 1VXOA 2BKEA 2Q46A 2NQ8A 1DBWA 2ZTSA 3FPGA 1SG0A 3D6HA 3GIWA 5I8WA 3A05A 4L2IA 2H8KA 4OYHA 2JFUA 3ETLA 5F52A 4P3OA 4GP6A 4JLOA 5CDFE 2JJQA 1YSCA 5JS6A 1U2SA 4RD4A 2HYIC 4NV3A 3K5WA 4X8OA 2RH8A 2JAXA 3FCOA 2AFIE 2VOJA 4Z8YA 5HTKA 5TQ0B 1WZUA 3CKKA 1JR3E 3OQVA 5F1OA 1SXIA 3P2MA 2MSNA 1Y42X 2VG8A 2YXPX 1FVOA 5DI3A 4GX0A 1YNSA 4JDPA 3S7TA 2ERXA 4JXZA 1BG6A 3SLRA 4BNGA 4BNTA 3FHOA 3DHEA 4BP1A 1KTIA 2R1VA 3AXSA 3INGA 2UYOA 1YJQA 3EGWA 1I3CA 3LUBA 1XJCA 1YV9A 4IUBS 4KBGA 4PCUA 4ZXFA 4DW8A 2WJ4A 3MXTA 3SJAA 2V7GA 3L8CA 3TDNA 3HCOA 1SC1A 3OEHA 1ZCZA 1LWOA 4MVJH 5MN6A 2Q5IA 4JYMA 2QTCA 3DD5A 2YJTD 2HWWA 2QVBA 1SU6A 4YAWA 2DB3A 3DUFB 4BN5A 2Q9CA 3PF8A 1IBMB 2CLEB 1E64A 3SDSA 5CNKA 3VR1A 3GXBA 3GLGB 2ETXA 2BHRA 3FHLA 4G85A 3ZHOA 3TD2A 3CVXA 2BAGA 1TJPB 2NUTB 2ZBEA 4NNJA 2IKSA 4DEVA 1MX9A 1B6RA 3B78A 3R0XA 4NFSA 2IW3A 4X1YA 4BU0A 3GLIA 3EH2A 3ACCA 4EABA 3ZKAA 1M7BA 2VDVE 4IIDA 2M2IA 2ZRQA 1ZM2A 4ND7A 4BC1A 4AAYA 1UOEA 2XR1A 4EAAA 3STWA 4WOJA 1TYBE 3FPLA 2WABA 4GECA 4TTSA 1I2CA 1RYZA 1UMCA 5LMUB 5K3FA 1P1RA 2Q4RA 1MJ5A 4G3XA 4AZ0B 4J7UA 5H5JA 4RZSA 2A0XA 2Q45A 3FROA 1NW4A 4PXYA 3WK9A 1QTQA 1EESA 3DQPA 4B35A 1NBEA 5J5CA 1A8SA 4IHJB 4D3ZA 5F51A 1H1TA 2ODBA 1R6BX 1WX1A 4LMAA 4P3NA 4K6KA 3Q8WA 2P65A 3OCVA 4R69A 1C4WA 5DYIA 3EBOA 4HT3B 4DNXA 2YIVX 4RH0A 2ZI7A 3SVLA 3BFPA 2ZBQA 3HKDA 4CR6A 4GKAA 3CKLA 5B4UA 1TRKA 4EG6A 3KT8A 5KTYA 3JV7A 5JJLA 3NETA 1J4AA 2D62A 4J0EA 4WE3A 5CFQA 4K9OA 2AXQA 1W0KD 2YWFA 4U7GA 1JVNA 4R1SA 5E95A 3UG7A 5KS2A 2X1HA 1UK6A 1DJQA 5SV2A 2OCKA 2V7QA 3C5CA 4Y9RA 4NCNA 4JR0A 4BVKA 3D2AA 4BS9A 4Q9DA 4TYPA 4Z4FA 2IX3A 2JEOA 5UKDA 3IT2A 4Z7QB 1BC5A 4F8EA 1UPBA 3SAJA 1FMCA 4BQIA 2YVQA 2EFDB 3FAZA 4D3DA 2WBLC 3KM0A 4KB5A 3IEPA 1CR2A 5GY7A 4P58A 5DNDA 4LYEA 4S0ZA 4DLSA 1H9CA 5T6BA 4PYJA 1QDUA 1F51E 2QRNA 1C1DB 3DMTC 3DPIA 2VQEB 4BFWA 2WD9A 4WZAB 4OHPA 1GKUB 4C2UA 1GGEA 1TQ2A 5ECWA 1YR1A 3OC0A 3EDMA 4JKOA 4R1PA 4MR8A 1RC8A 3JQGA 1QG0A 3R0QA 5EJ4A 3BRQA 3WK8A 1XU4A 2GHQA 3CEMA 3H1TA 4NP6A 5ADWA 4DV7B 1NI5A 4DIDA 1M34B 4Q18A 1JDVA 3PHLA 3OQPA 4K2HA 1R74A 1OCEA 1SVOA 5IK2A 4EH1A 1ILEA 3EVBA 1KBOA 1QHEA 3B1YA 3PS9A 4HGZA 1TGVA 3W34A 4PHGA 5DBIA 5JZSA 3F4KA 2IUSA 2GBPA 5CXSA 3ZWXA 4TKVB 1LB1B 5E3JA 5G40A 1EWRA 2OQ2A 3MWDB 4OKNA 1K7SN 1UXJA 1V1RB 1ZEMA 4EEXA 2QNIA 2J9RA 1X8JA 4Z4HA 1REQB 2VAPA 4J94A 3KVVA 1BVHA 1FTNA 2CHQA 2V7VA 3K0CA 3EODA 4H7EA 4PGGA 1YCFA 2QBYA 1C7JA 1AM4D 1INLA 4ACBA 2MTBA 4U7WA 3ADDA 5TGZA 2CJWA 1CIVA 2PA3A 4JLPA 1MGPA 1U8UA 1XCMA 2QP4A 2VZ9A 3CRRA 4QNMA 3ZWDA 2XUFA 3PGA1 2I6UA 3GRRA 3NHRA 3W3AH 4YYZA 2Z8XA 3D3QA 1DJOA 3D3WA 5LLTA 4GOND 1P2VA 2AZTA 3K8ZA 3OUUA 3DT9A 2EQAA 5BNTA 1LPPA 7ABPA 2QIPA 3ZY3A 4JFRA 3VAYA 1WB9A 1T9AA 4PCLA 4JLVA 3GUUA 3LVBA 3WLJA 1DBIA 2X0DA 1Y8RB 1T9HA 4E3WA 4BGDA 3DE6X 4TROA 1OE0A 2YZ2A 2PZMA 4FKBA 4KSYA 1Q83A 1RWXA 2I66A 1FYEA 2Q50A 4Q7JB 2HKIA 3LOPA 1KSHA 2EVWX 3BWCA 3DE1X 4I5IA 4AT1A 4YAKA 4WD3A 1JHAA 4QO7A 3RVMA 1AU9A 2GR9A 1Q11A 1KE1A 1XMIA 5BYJA 4UEWA 2YYZA 4F5ZA 2REOA 2BEVA 1JVBA 2I80A 1QK3A 3ZHSA 3G9TA 4YN3A 4BQQA 2GXAA 1KH2A 3SF8B 1MTOA 2HUNA 3W7BA 2FEOA 1M6VA 2P8JA 4F2HA 1MEOA 4ZV4A 2I7VA 4W9NC 3BVPA 3R9WA 2UVPB 4GX1A 3CCFA 2O8FB 2CGEA 3CUSA 2XJ9A 1YQ9A 1ZM3A 2C00A 1NBME 2CVQA 2W8ZA 1KYIA 3TM5A 4D42A 5CTJA 1RTKA 2GD6A 2MSCB 4HUTA 1QS0A 1GKLA 2TRSB 1AF4A 5KCZA 1GTRA 4DR7B 1XDGA 3PNBA 4MIEA 2VSXA 1TYEB 4DCPA 2IUTA 3HN2A 3PP8A 1YOVB 2QL5A 4G2NA 1EE1A 2I7XA 2WT4A 3T7JA 1JAIA 3PFNA 5LBTA 4K03A 3WGZA 1ORHA 3R4CA 2J85A 5ED4A 2FQXA 3D64A 4D5EA 2H08A 3P0JA 2OCLA 4DQKA 3Q1KA 3P2IA 3I1JA 3Q3HA 1EFKA 1X7XB 3A06A 4J91A 1AKTA 1KY3A 1L7XA 3QJGA 3PE3A 2HF2A 4EARA 3VOSA 1AA6A 3U60B 1Z56C 1E9EA 4GOJA 3UA4A 1H1LB 2RK6A 4BYMA 2HXYA 2ZANA 3PUHA 3TL2A 3PFKA 4XGIA 1KI9A 5C8YB 2ZRFA 3DE0X 4LEIA 3RADC 5J23A 5BVGA 3IUSA 3NP7A 3L7DA 4TM8A 5FOXA 3VPFA 4K1LA 5M3BA 3EJ6A 3VVCA 1FXSA 4OL0A 3MA0A 1LBHA 9LDTA 2N3ZA 2MSEB 4KWCA 1MOPA 1DUVG 4I1SA 4O4LA 4JK3A 2QT9A 3RRBA 4BNVA 1CFJA 2B5VA 2CXSA 1OBFO 4QUBA 4BATA 1N3LA 1RLJA 4PGMA 3IH5A 5TMBA 1U0BB 3I37X 3ESCA 1W36B 4FFNA 2BGMA 4RSMA 3G7UA 3QEAZ 5L4NA 1ADBA 5FX2A 1ZD9A 3REQA 4MH0R 4PBRA 2DWPA 1GCGA 1U5BA 2YQ4A 3PC7A 5FL3A 3RC9A 4QICA 2ZB7A 4LOIA 5IDQA 4W5NA 4NC9A 3ZVLA 2M98A 5FB3A 3WNZA 1L5SA 3ZR4B 2VH5R 1N75A 4GYKA 3VRHA 4FS3A 4K3VA 1AZWA 2MR6A 2EEZA 2ZFUA 2FUG6 2CFTA 1T8UA 1NBOA 1U9CA 5T8KC 5IJ9A 2YOFA 3GOHA 5CT4A 3VU0A 1WPQA 1J8VA 5H9VA 5JXIA 3TNFA 2C7PA 2AC7A 3GPDG 5HIAA 2WUDA 4MJ3A 1QH1B 2A9PA 4CIWA 4QBIA 4Q4CA 4OHXA 2VDUE 4RVHA 1J21A 1IZ8A 1J6UA 1XIVA 3GJSA 4G81A 4LY3A 4MR9A 4DG5A 2KPOA 3D4IA 4INPA 1W73A 3GG9A 4LYAA 5U1PA 2CXQA 1FPQA 4MMZB 5E4FA 3ZW7A 4B3MB 1PNVA 5HQ3B 1DKUA 3GF4A 2TMKA 4IDNA 3STHA 3WGVA 1XG5A 3HP1A 1JDTA 4QIHA 1XDZA 5EIAA 2XUDA 3MGGA 5FBHA 1QKJA 1ZIPA 1U2DC 3JARB 4BMNA 4CU2A 5K51A 4OUDB 1FQOA 2XQJA 3IPAA 2H00A 5FUVA 5K05A 5K99A 1N5LA 1RI4A 5JT1A 2QRJA 2W2VA 2JLRA 3ENQA 4DILA 3KDPA 1LZKA 4OK3A 2VJPA 3GT0A 5I45A 3PGVA 4URVR 1VMDA 1T5TA 2CKMA 3I5UA 5EZ6B 1SRQA 1SZCA 4N3BA 3HJGA 2ZQYA 3KC2A 4IXTA 2XYQA 3I2IA 2IJGX 3EVNA 4FGZA 1D2CA 2FEPA 3OPYB 1NVAA 5A7GA 3RNOA 3DONA 3WGIA 1E0KA 3EEIA 1RDFA 2PGLA 4NONA 4PWYA 4MDEA 1EVJA 3K2QA 2PX2A 3FVQA 1JDSA 5AUOB 1FXUA 2XTZA 1QJ4A 3UBTA 4JI1B 2Q3EA 2NQ2C 2VSFA 3W2EA 4MV8A 2GEKA 1J9GA 4MDYA 3T5TA 5AW2A 4NYIQ 5FBRB 3O8OB 1D5CA 3IAAA 5IJAA 2P6OA 2VPTA 1JEYA 2IVFA 4LBVA 5CA1F 2H51A 1OU4A 3LPLA 3PUKA 4YVFA 2ZQ5A 2ZRLA 4AJJA 1XQVA 2PBZA 4FDAA 1T0IA 3HO6A 2FR8C 1PW5A 4G1MB 2YMQA 3M81A 4HAXA 5DP2A 3L7BA 3QENA 2G07A 4GAEA 4RYLA 5BQXA 5AUQA 1Y6ZA 3HXMA 4LDZA 1FLVA 2CDAA 4TRRA 2PL1A 1KEKA 3ZDAA 3V8RA 3ZZ1A 3BM5A 2OHGA 3FH0A 1US8B 1PLJA 1Y5IA 5HOEA 5KMGA 3K70D 1SU8A 3FJOA 4WKGA 4CDRA 2H9YA 3WAJA 3V00A 1T5OA 3VYUB 1VIDA 1FFGA 1SU4A 4P7BA 4P36A 4Q34A 4RQTA 1O9HA 1GO2A 3I5XA 2X4IA 2WKSA 1OJ7A 3BWYA 1GGHA 4JLUA 1F3LA 5CT9A 3A6DA 3QHAA 1SC3A 1SOVA 3AX6A 2RCNA 4PZ9A 1TM5E 2QRZA 2NTYC 5JMWA 5IZ4A 4UHDA 4BHTA 3W5AA 1A9RA 2OMEA 1G6OA 4LKRA 3UJCA 1EQAA 1DT3A 1L7BA 1JA9A 1QIEA 5FKJA 1G66A 1DIBA 2QK4A 2O5CA 1MAVA 2XNDA 3CXRA 5KQRA 3PFWO 4ZO9A 1LPOA 3BE4A 1JJFA 5E6RA 4GZMA 1DAIA 3IT3A 5BXYA 2BIFA 1IWBB 5C1BA 2H4XA 1MV5A 3DZDA 3GUVA 5CTAA 3VHXB 4ASUD 1C4XA 1ZK2A 5HBRA 4KU4A 2OXCA 4NV1A 3UEOA 1K8RA 1PG2A 5F35A 1WCXA 1IULA 2FPSA 4BN0A 4LOJA 4PFJA 4KREA 4A91A 4PV7A 2BUBA 1HNXB 4B5LA 2MSDB 2IE0A 3A1SA 1SUIA 5JZMA 1IUNA 3PQ2A 1E60A 1WUJS 3LKZA 2FFAA 3I2YX 4KDFA 4MW9A 2RGGA 4NVRA 4ENQA 4N6NA 2VS1A 4EPWA 1E2EA 4LF5B 3CZCA 2B6HA 1ISGA 1R15A 3W1WA 1I5EA 2A88A 3DA8A 3MTBA 1U9ZA 3PQCA 1G38A 1HR0B 3A0UA 4FR5A 1R64A 2H0QA 1HE4A 2UYYA 2ZYDA 2D0IA 3E7XA 5DVZA 2UXCB 1UDCA 2WZCA 4UVIA 3NOOA 4C7OA 2DTEA 3NRBA 4Q9NA 4YJ3B 3V8BA 3DF7A 2XAUA 3MINB 1DQPA 3VDXA 3X2SA 3QXGA 2ZJ3A 1ZXBA 1I4TD 2RGCA 3D0QA