3SK0A

Structure of rhodococcus rhodochrous haloalkane dehalogenase dhaa mutant dhaa12
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEFHHTEVAEEQDHAEAARETFQAFRTADVGRELIIDQNAFIERVLPGGVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGALIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamics and hydration explain failed functional transformation in dehalogenase design.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 111
structure length 308
sequence length 308
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sk0A00
4FLMA 1K5PA 1WM1A 4K6GA 3IUQA 3HEAA 4HXEB 4EA6A 1QE3A 2V9ZA 1AZWA 4DMFA 2DHEA 3AZQA 4C89A 3FAKA 4X94A 2IIVA 1A8SA 4BE4A 5AM2A 1YASA 4G1FA 2P8SA 1QIEA 1MT3A 3WKDA 5CRIA 1IUPA 3QBJA 1QTRA 2JEZA 1CUZA 2D0DA 2QT9A 1GZ7A 4A16A 3AIKA 4FFWA 4AN1A 4CG1A 4MWTA 3DOHA 1LBTA 4X6XA 3KDAA 4RE6A 2GZRA 3DKKA 4NVRA 2R11A 4Q3LA 1ZJ5A 2OGSA 5A7GA 4PNZA 2QMQA 1E66A 5AK5A 3PDCA 2AJDA 3O9MA 1BN6A 1H2WA 3H2KA 1BROA 3C43A 5HF8A 1CUSA 2G5TA 3N0TA 4W1PA 4RE5A 1J06A 1LBSA 1FFAA 3IBTA 3F97A 3WYNA 5AIBA 2HU5A 3BIXA 4BRZA 4GBGA 2CMFA 1BN7A 4QA9A 3AINA 4IHAA 4P92A 3FVTA 1W1IA 1VXOA 2OGTA 3I6ZA 1VE7A 4KE8A 3C6XA 1CQWA 1GPKA 2B20A 4J0GA 4AB1A 2GYWA 4I3FA 2YXPX 3MUOA 5AI6A 1A8UA 2WFLB 2I3DA 1EDDA 3FYUA 4H0CA 4PW0A 3IUNA 5LZ9A 3FCXA 5AO9A 4CG2A 2WLSA 3G9XA 1VA5A 1LPPA 4N8DA 3VDXA 3DEAA 2RI6A 3BXPA 3MGAA 3GFFA 5AKJA 5KREA 3R0VA 3V1LA 1CUBA 4EY8A 5LZ2A 1ZGCA 1YAJA 3GROA 1R4ZA 5JANA 1E3QA 4HRXA 5FPPA 5ALHA 1U65A 4FTWA 4CCYB 1EINA 1GKLA 2QJRA 2HA3A 3C8DA 5BOVA 1VKHA 2C4HA 4K2AA 4C4ZA 1ZI6A 3K2IA 4UHFA 4BYMA 2IX9A 4B9AA 1DX6A 5LKAA 1EXWA 1ODCA 5LZ4A 5HK8A 4Q05A 1YA4A 4KYVA 3I6MA 4WFKA 2AJLI 1LNSA 5AI4A 5ALRA 2O2IA 2QTBA 3I28A 3O0DA 4HZGA 1I6WA 4AMZA 1CVLA 3H17A 2BCEA 5AHXA 3G0DA 1MNQA 2DQZA 2Q0XA 2WKWA 1THGA 4QEKA 3PUHA 2VEOA 3D2BA 3WMRA 4ZREA 4UBJA 5ALXA 2HHAA 3EQ8A 2BJHA 2QUBA 1DT3A 4Y2PA 3L1HA 5JD4A 2WJ3A 4OU4A 5CT6A 3WZMA 3WQHA 1QIHA 5IH7A 4OD0A 4AO6A 4OUKX 2XMGA 1ETHA 1MU0A 2J4CA 1KU6A 5KBYA 2OG1A 5ALEA 1WHTA 5JZ9A 5A71A 1TAHA 1BS9A 3N2ZB 5FUMA 4BE9A 5A6VA 1XRRA 1PJAA 1QFSA 4G4JA 5I9IA 1YA8A 4BAGA 4YX9A 1VE6A 2NW6A 5LP1A 5AICA 4U2BA 1DQZA 3AIMA 1EA5A 1EDBA 4G8BA 5DLPA 3C6ZA 5H3HA 5F4ZA 4C87A 4Q34A 5ALYA 5ALKA 4BATA 2BGNA 5CT5A 1CUCA 4PO3X 2WUEA 1XRLA 1B41A 1QGED 3QVMA 5K5EA 1WPRA 4X3CA 3EIOA 4Y2SA 2B61A 4HAIA 5C8ZA 2OGZA 2QZPA 3PICA 3QPAA 3C6YA 4DMHA 3WK7A 3DCNA 2V98A 3EF3A 2PSFA 5ALWA 1E8DA 1H2XA 3F9CA 1SCQA 4KE6A 5DYTA 1U2EA 2XMRA 4ARAA 1BE0A 4X91A 4BZWA 3NOXA 1LZKA 3HI4A 1X2EA 4XJVA 1AGYA 2OCIA 3DS8A 2WG2A 3T52A 5C8XA 5LKRA 4INZA 2OCLA 5DYYA 4UFOA 5ALDA 5LLSA 3BF7A 3M81A 4ZV7A 4M0FA 2HU7A 2PSJA 3Q8WA 4G8CA 3WIBA 5AK6A 3EQ9A 1A7UA 3FLBA 4WFJA 4OSEA 3H04A 1QIIA 3AJAA 2C58A 4EZIA 1BCRA 2HA4A 3OPMA 2D5LA 1MN6A 4DNFA 4I19A 5FXMA 3P2MA 4E11A 5FPQA 1Y7IA 5AKHA 2PSEA 3U0VA 3WYDA 1SOMA 4M0MA 4DMKA 4UBNA 4QZVA 3A6ZA 5AKXA 2BAGA 4WCVA 2WUGA 3LP5A 1J07A 4UHBA 4DNPA 1Y7HA 5CBKA 5CMLA 1W4LA 5ALJA 2I03A 2JGKA 4QDOA 3UUFA 1CUIA 4ROTA 4XIIA 3G0IA 1ISPA 4GLBA 1DQYA 1G4HA 1XRMA 3TGLA 4J0IA 3M82A 5HFNA 3HJUA 2JBWA 4UBLA 1MX5A 3BDIA 5LZ7A 5HQ3A 4UHEA 3R3YA 3FNBA 4MXDA 1GPNA 3S8YA 4P08A 5E4YA 1ZOIA 3E1GA 4AXBA 4J0CA 2ROQA 1K63A 4Q3OA 1NU8A 1IZ8A 2WQZA 4BP9A 2JGLA 3O95A 2BFNA 4X00A 4IO0A 5LIPA 2JGIA 4Q82A 3WK8A 3PUIA 2CKMA 1CUGA 5DWDA 1CUAA 4AO7A 1E8NA 4FLFA 4A5SA 3NWOA 3LLCA 4X95A 1JKMA 3FLEA 3V1NA 1CV2A 4F5ZA 2DR0A 2HDWA 1DT5A 4QDUA 1UFOA 1QO7A 2QOEA 4BAUA 1QOZA 1JFRA 1XZGA 1Q83A 3H18A 1XZKA 2W22A 1VA4A 3FYUB 1OXMA 3FWHA 4OB8A 3R3WA 4LIPD 1YSCA 2QUAA 1MNAA 2ZYSA 2XB6A 2XUJA 3WK6A 1CUWA 3A2MA 3H1BA 2JIDA 2ORYA 2H7XA 3D4LA 1WB6A 5AIAA 1TQHA 3SC2A 2ZSIA 5IVKA 2XMCA 4L0CA 4A23A 4CCYA 2AJ8A 1W76A 2WHPB 2WTNA 3I2KA 4AMYA 3OG9A 5HCUA 3VVMA 4UPDA 3UUEA 4F60A 1WHSA 4YK7A 2OAGA 2VQ6A 5EIHA 3IULA 1CEXA 3V1KA 3WL7A 2AXEA 2OQVA 4X97A 4EY6A 1LGYA 1ACLA 3BIWA 5ALUA 4C4YA 5HQ3B 1UZAA 3RKSA 1T2NA 2PSHA 1RWQA 4PSDA 4EHBA 3LS2A 2WFZA 2HA0A 3I1IA 2WG0A 3KWJA 2BUBA 3O4IA 3QH4A 4J7AA 1DWQA 4X71A 4JEIA 3R3ZA 4FBLA 2GBGA 5AKLA 1GKKA 4U2CA 4QLOA 4N5IX 1JJIA 2WIKA 4G9GA 5K3BA 3BJRA 3PI6A 1CQZA 4HVTA 3ANTA 2G4LA 2G63A 1CUJA 4NMWA 3G7NA 4ZRDA 2OAEA 4Y2TA 3W04A 5LZ5A 4OU5A 3IIIA 5K3CA 1N5MA 1VLQA 4GECA 1MAHA 3KOOA 5T4HA 3AZPA 3EQ7A 4KE7A 1IMJA 2PX6A 1EHYA 4C6HA 4WY5A 1R88A 4W9RA 1SCKA 3FSGA 2V97A 3D7RA 3I2GA 3E4DA 3IDAA 1R50A 5C81A 5ALTA 1UKBA 2Y6VA 5JIBA 1S8OA 4H7HA 2X5XA 4WDRA 2XQKA 5YASA 2XT0A 3S2ZA 3DLTA 4MQLA 2WHPA 1P0IA 5JASA 3LIPA 3WI7A 2CUTA 4WJLA 2VJCA 5K3AA 4XVCA 1LPOA 1UK9A 4GW3A 1N1MA 1QZ3A 4UFNA 3MVEA 2Z3WA 2XUKA 1T4MA 5E2IA 3IVMA 4O08A 4OCZA 1RP1A 2RAUA 2QVBA 3WKAA 4W1SA 3ICWA 5DTJA 2B4KA 2ZJFA 2X76A 3G02A 5JD6A 1WPXA 4ZGBA 2ZYHA 1TKRA 5HKBA 3WWDA 3ED1A 4MWSA 2PUJA 3UMJA 3ESDA 1XZCA 4BBZA 4BB0A 1A88A 2LIPA 1XKTA 3HC7A 2PPLA 5CT4A 4Q3KA 3IA2A 4QE3A 3QZUA 2XUQA 1Q84A 2HA6A 3RK4A 2ONCA 1UK8A 1EB9A 5AJHA 4DMCA 5AKGA 5A2GA 4S0XA 3W9UA 4IH1A 1JJFA 4DYHA 1Z68A 5JAUA 4DNQA 3WL5A 3MUNA 5AP9A 3FYTA 3HLKA 3C87A 4H7JA 2JF0A 5EHXA 3G0GA 5A62A 2I3ZA 1VXRA 3DOIA 4KRXA 4Y7DA 5JZSA 4EUSA 4BTVA 4U2GA 2HA7A 1H23A 3KXPA 4QDTA 4QWWA 3L1IA 5AOCA 1CIJA 3I6YA 1DWPA 1YB6A 2RGUA 4UUQA 3O4JA 4IQ4A 4Y2XA 4Y2UA 4PQEA 2I78A 3C5VA 2QKYA 1ZI8A 5BWBA 3DJYA 3OOSA 3DL7A 4MEBA 1H2YA 1DX4A 2ZVDA 5DYWA 4G8DA 1O6GA 2PVSA 3QPDA 1JT2A 5AI9A 4RPCA 1YCDA 5SYNA 5ALGA 4FWBA 2O7VA 5D3KA 5K3FA 2UZ0A 1IVYA 4KR0A 5ALQA 5ISMA 3DQZA 3DL4A 4BAZA 4K6KA 1GT6A 4J0JA 1XQXA 5AK3A 1AUOA 3ESCA 4TGLA 4FKBA 2O7RA 2VJAA 4ZV9A 5CXUA 4KAJA 1AMNA 1QONA 1F6WA 2PM8A 2Z8XA 3A2NA 5ALPA 2PSDA 4UBKA 2O2GA 3C70A 3F8SA 3ZPXA 3V48A 1TCCA 2HA5A 3CN9A 1CUVA 4GWLA 2WIJA 3WKCA 1FJ2A 3WL8A 3OC0A 4GXNA 1U4NA 3WWCA 1FFDA 4OB7A 4GHWA 1G66A 1QIFA 2XQJA 3L1JA 4MJ3A 2RHTA 2XUDA 3AZOA 2JGEA 1HQDA 2GBIA 2VATA 3KSRA 3STWA 4ZI5A 4BCBA 2PU5A 4QLAA 3QPCA 1NU6A 5AOAA 3G0CA 3WK4A 1P0PA 3FYUC 2J3QA 4H77A 2PUHA 2WFLA 1XRQA 4H18A 4H7EA 3W05A 2Y2UA 4BDTA 1P0MA 4KRYA 3K6KA 4CCWA 1QIGA 1CLEA 2RONA 1GGVA 2DQYA 3BF8A 1EVEA 3CN7A 3JYHA 2E3JA 1R1DA 3F96A 4MYDA 2Y1KA 1XZIA 5CW2A 4UHHA 1J2EA 2WUFA 4IH9A 3DYIA 2ZSHA 4N8SA 2ZJ6A 4LXGA 3ESBA 5I7UA 5EI5A 1UKCA 1W6RA 4Y2RA 4FOLA 3ZLTA 2QRUA 4YPVA 1QIMA 3HRHA 5D7BA 3D59A 5BWCA 2DHDA 4E15A 3G9UA 3LIIA 2HFJA 2XUPA 1GPLA 1NX9A 4XWGA 4WDQA 2G5PA 4CI9A 1EI9A 4L3WA 2VJBA 2PBLA 3WWPA 2XE4A 5JAOA 3OTQA 2FX5A 5ALMA 1WCYA 3KWFA 2RHWA 5JATA 1BCSA 4H7FA 4L9AA 3PE6A 4FNMA 1QIKA 4BCDA 1WOMA 2B9VA 2GZSA 1MTZA 3BL8A 1KU0A 3F98A 3FCYA 1L7AA 4HXFB 5ALLA 2VT6A 5E4JA 1FFCA 2CZQA 1JMKC 2BUCA 4KACA 4ZXFA 3GA7A 3HZOA 3WL6A 5KWJA 3TRDA 4DNOA 5T4EA 3E3AA 5I8PA 4X7BA 4GI1A 4XX1A 4AZ3A 4K6HA 1FFEA 1SFRA 1AURA 5JADA 1HPLA 3OM8A 4B0PA 3WA6A 4HXGA 1K6EA 3VJMA 3X3HA 2GYUA 5DJ5A 4X6YA 2WILA 5ALIA 5HZGA 1EX9A 1XQWA 4LXHA 5EGNA 4B83A 3G9TA 5JALA 3SK0A 3VVLA 3A70A 5E4TA 5AKEA 2HADA 1ODTC 2FUKA 1PV1A 2XMZA 1AX9A 3QMVA 3GBSA 1IZ7A 1F8UA 3TJMA 3RM3A 1CUYA 1E8MA 1Q0RA 4UBOA 1LPSA 4AX4A 1GQRA 4K5QA 1ORWA 2WJ6A 2XMBA 5AKYA 5LZ8A 2XQFA 5EHNA 4ETWA 2OQIA 5C8VA 5A7FA 3WK5A 1MAAA 4DGQA 1QO9A 1ZI9A 1ZIXA 4FHZA 3YASA 1TK3A 5SYMA 2WSLA 2HU8A 1OILA 3M3DA 4DIUA 4Q1VA 4HTAA 1GXSA 1QIDA 5JAHA 5CH5A 4B7ZA 2CBGA 1H2ZA 1QFMA 3WA7A 2VAXA 1JU4A 4LYDA 3B3QA 3AILA 1WB5A 1CUUA 4QDZA 4YASA 5CTAA 1BU8A 3CXUA 2XUGA 1YAHA 2ACKA 5FKJA 5K3FB 2XUIA 4CFSA 2Y2VA 1G5FA 3IUJA 4PSUA 2XMQA 4JYMA 1PFQA 5FV4A 2YASA 2QM0A 1DWOA 4WFIA 1A8QA 3C6BA 3BJMA 3R3UA 2C0QA 5DTIA 2VT7A 5AI5A 5D6OA 1UK7A 3LCRA 2V96A 1FFBA 1ZJ4A 1L7RA 1EDEA 4PV7A 1QJ4A 4J0HA 4Z49A 3O4GA 4MEAA 1W52X 4UBMA 5HF5A 5FDFA 3D2AA 4F21A 5T4FA 4HRYA 3AUKA 5AKKA 2Z3ZA 4C88A 4H7DA 4BVLA 1H22A 4U2FA 4IH4A 1UWCA 4GEGA 1E89A 2HFKA 1L7QA 3W9BA 3B5EA 3DDUA 3ICVA 1Q0ZA 3PF8A 2ZYIA 1HL7A 5EIEA 1XQVA 1JI3A 1TCAA 4G5XA 1N8SA 2H1IA 1ZICA 4U2EA 1AC5A 3R3VA 3ILSA 2VJDA 3VKFA 1XZAA 4BC1A 4W63A 4P93A 2CJPA 3DD5A 1UXOA 2HM7A 5ALSA 3G0BA 1YS1X 1QTIA 2RIPA 1W75A 4TVKA 3ZI7A 4FNGA 1P0QA 5K3EA 3K9BA 1UK6A 2W6CX 3ESAA 2Z8ZA 3IB3A 1TIBA 4RGYA 1R9NA 1MX1A 2HA2A 4FMPA 5EFZA 4CG3A 2H9YA 1Y37A 1XLVA 3A2LA 3ZWQA 1K8QA 1XZEA 2DSNA 2H7YA 4CIBA 2XMSA 3HACA 1HDEA 4J03A 3OURA 5JYCA 2CB9A 3ZLVA 3IURA 4G4IA 2ES4A 5JAPA 2JGFA 3G8YA 4PF1A 4Y2YA 1QLWA 1DTEA 1EB8A 4MYSA 3VJLA 3O4HA 3DKRA 1VJ5A 4QWMA 4FBMA 2XUFA 4PSCA 4BRSA 5IVDA 3QM1A 3F67A 2WUDA 7YASA 5LYYA 2CEKA 1AKNA 3W2TA 3GELA 5DNUA 4E46A 4TPKA 4GDMA 4JUIA 5AOBA 5EHZA 2X8BA 3QMMA 1CUHA 3D5EA 2EDAA 5KWIA 1KEZA 1UOOA 3STTA 1XQYA 1YB7A 1G42A 2PU7A 4Y9SA 4BDSA 2ACEA 3AIOA 1IUNA 5AM1A 3STVA 1SCIA 1OCEA 3WWEA 3HSSA 4UFPA 1XROA 4OPMA 4KE9A 1EK2A 1SC9A 1LPNA 2QJWA 5HFAA 3JW8A 4B9EA 1XZJA 4DTCA 1JJBA 1UOPA 1ZD2P 1D07A 1ACJA 1ZGBA 2WM2A 3RLIA 3VISA 4C01A 1B6GA 4BVJA 3NGMA 3SX4A 3R40A 4BC0A 3H1AA 2XI4A 1LPAB 2AJBA 2FJ0A 1MJ5A 3H2HA 3PFBA 5C7YA 3CCBA 5DNVA 3D2CA 2DCMA 3RARA 1THTA 5JARA 3FOBA 4F0JA 4AQDA 4CIAA 1XKLA 4U2DA 3QMWA 2XQIA 2WG1A 4FDMA 3STYA 5ALVA 5FLKA 3WJ1A 1F0PA 1ODSA 1VZ2A 2DHCA 3U1TA 3IUMA 4OB6A 1ZD4A 3T4UA 1CUXA 5AM0A 3C5WP 5IVIA 2WU3A 5CXXA 5HK9A 5JD5A 5AH0A 3WKEA 2K2QB 2QR5A 2Y6UA 1C7JA 1CUEA 5AKIA 4B84A 5CT9A 5J3JA 5AK4A 1CRLA 3WZLA 1JMYA 4W1QA 4DLNA 2DFPA 3H0CA 5FOQA 5IKXA 2C5FA 5HF9A 2ZJ7A 1TRHA 4B0OA 3E0XA 4G9EA 4AN0A 1GQSA 4DM7A 3GZJA 4B6GA 1LLFA 2C5GA 4KEAA 2QS9A 2GBFA 5ALZA 2XUOA 3O9VA 1BEEA 3BDVA 5HKAA 2JGJA 3HXKA 2BUAA 2QXTA 1USWA 2C0PA 5A7HA 2GBCA 3HYSA 4KJXA 4E14A 1EVQA 5EHQA 3PFCA 4D9JA 2VA9A 2OCGA 4JYPA 3C8HA 4P9NA 1XZBA 2OXEA 2XQGA 1C7IA 1XLUA 2GYVA 1LZLA 3SWWA 4LHEA 3V1MA 4ZWNA 1EK1A 1XRPA 5ESRA 1YR2A 1UKAA 2HRRA 3FSGD 2WHRA 1CUDA 4MQMA 2XDWA 5FP0A 3STXA 2OPHA 4QDXA 3W06A 3QITA 4ARBA 1LPMA 3BE8A 2OLEA 2ECFA 3ZV7A 2XUAA 3M83A 2JGMA 1WB4A 4OYLA 4X6UA 3GUUA 5K3DA 1E5TA 4DSAA 4DSZA 1X2BA 5CH3A 3NUZA 1CFJA 3VJKA 2WTMA 4Y2VA 4BTLA 1XZHA 3CCCA 4HS9A 2VAVA 2XUHA 1IUOA 3D0KA 4G4GA 4LXIA 2H7CA 5IVHA 4X85A 3I2HA 3I2IA 3VXKA 1AQLA 3WLAA 4EY7A 4X92A 1O6FA 3I2FA 4LYEA 3BWXA 4AO8A 5CURA 2WJ4A 4UHCA 1BRTA 1LPBB 5EIAA 2WHQA 1DU4A 3Q0TA 5ALOA 4ITVA 3KD2A 3H2IA 2R8BA 2WIFA 4FLEA 3WIOA 4H35A 1MO2A 2BKLA 1R9MA 1BEZA 4B80A 1FSSA 1JU3A 2OCKA 3FVRA 2J3DA 1ZD3A 3JWEA 1VZ3A 3D3NA 4V2IA 2WIGA 3I1YA 4M0EA 4C4XA 3PF9A 1TCBA 1XZDA 1UT6A 1DINA 1HBJA 5AI0A 1MPXA 1YS2X 4JNCA 2YYSA 4EY4A 3V9AA 2HRQA 3TEJA 2VSQA 4BP8A 3EBLA 4EBBA 1QIJA 2JEYA 2WIDA 5AKZA 2IITA 1CPYA 2C7BA 4Y2QA 2PL5A 2O2HA 5D3ZA 5AM4A 2EDCA 1XLWA 4B82A 1ORVA 2PKYX 4BZZA 4BCCA 3G9ZA 3STUA 3WJ2A 2YH2A 1R3DA 2VF2A 5JZBA 4X93A 3H2JA 3WWOA 5T4BA 3AFIA 3C45A 2XLBA 1MX9A 2Z5GA 3DYVA 3WKBA 4W1RA 2EEPA 4KAFA 3WK9A 5ALNA 5HF6A 1RYYA 1XRNA 2HIHA 3R3XA 3I2JA 4BVKA 4L72A 3H2GA 4FFVA 1HLGA 1F0NA 3B12A 1UOQA 4JH0A 1X70A 1XZMA 5ALFA 4X90A 5FRDA 1EH5A 1XFDA 2J4FA 1XZLA 2AJCA 3ANSA 5BV7A 4UBIA 6YASA 3FLAA 4J0DA 3H19A 4N5HX 1M33A 4WY8A 1ZD5A 4J3JA 1U8EA 3DNMA 4KAAA 1ZIYA 4OYYA 4B85A 5AI8A 2VTVA 1C4XA 3R41A 4H7IA 5CT8A 4Y2JA 4UHDA 2XLCA 1VOTA 2QXUA 1CR6A 4J0KA 3QYJA 1K4YA 5AM5A 4I4CA 1HKHA 1N5RA 4EY5A 2XMDA 3FBWA 2FJPA 2WU4A 4RNCA 2WFMA 3HABA 1XZFA 4AZ0A 4EB0A 2ZYRA 4QNNA 4NS4A 2BGRA 3ZLUA 4NZZA 2HL6A 4N8EA 5CH8A 5DNWA 4B81A 1CUFA 5AM3A 4H7KA 1J1IA 4LKOA
chains in the Genus database with same CATH superfamily
3V97A 4LSGA 2XTNA 2XA1A 3T1VA 1W0KA 2GCGA 1M73E 2W6JA 1NRWA 4RPGA 2MYUA 4RZIA 5IK2D 3IUQA 2X8JB 1LLDA 1QE3A 2G09A 4E5UA 1UC8A 5C8YB 2V9ZA 2V1XA 3FR7A 3W3AA 1OLSB 1JIVA 5A6SA 3PHCA 2VNJA 2OKGA 1E9RA 2RJ3A 3DC2A 3FNEA 3ROGA 4C1NA 4X65B 4N40A 1W93A 4OXKA 4HNRA 4C89A 3KO8A 4X54A 3FPBA 2QM3A 2IIVA 3SIRA 4AMGA 1CR2A 2GAAA 3H1EA 3VR6D 4BZPA 5E8RA 2HRDA 4BE4A 1FU8A 1KQ3A 3RVLA 2O54A 3HYCA 4G1FA 3JPWA 3CA8A 1WL8A 1QIEA 3UY4A 1ILWA 3QV2A 5JAIA 1RHUA 2X1MA 4CM4B 3PHIA 4Y1EA 1S96A 2SHKA 2HMSA 3OQPA 2X22A 4ZOLF 4C0SA 1L5HA 1ZCBA 3ZCTA 1A5ZA 4M21A 1F8XA 3UAWA 2YIMA 1RM5A 1FFHA 3AIKA 4EPRA 3VR5H 1ZK0A 4TS1A 2PXXA 4CG1A 2AVNA 3NIGB 4LXYA 1X0XA 5E9AA 3PGLA 4JJ7A 3QPUA 4ZI7F 4QNMA 4X6XA 3KDAA 2R4TA 4IVQA 4RE6A 1OIXA 4QOFA 4DCUA 3DKKA 3MZ0A 1KYWA 3QVJA 4I1YA 3EJWA 2R11A 4NVRA 1RXVA 4Y1RA 1SVIA 1I7SB 2QMQA 2NUPB 2VPIA 2W2KA 4AF8A 4DDMA 1U4SA 4MIEA 1A76A 1E66A 3FYHA 5FNVA 2OXRA 4OLJA 3VPSA 1U9ZA 3D7LA 3WQBA 4D8XA 2ATVA 3SXPA 3W6ZA 1GRRA 4P4TA 1DE0A 2AJDA 1PZMA 4BLUA 1UDWA 2IP1A 1M7BA 2P9GA 3O83A 2XGJA 2D5BA 2WWXA 3EC7A 2AW3A 1FLAA 2GPJA 3VR6A 3T1YB 2AF4C 3K4HA 1KBQA 4P2GA 2DECA 5FWDA 3N9IA 4CYMA 4JYAB 3OSUA 4EW3A 1NVKA 1VLLA 3OQ1A 4FNAA 4TVOA 3AONB 3UK6A 1GIAA 3CY6A 1BD4A 3A4VA 3CFYA 4MR8A 3L41A 4L8LA 2PGJA 1U8TA 1WXGA 2YBDA 3Q9LA 4KIUA 4Z4QA 4CU2A 1B8OA 2GK6A 2PAAA 5K0SA 2NQTA 4HZUB 1THMA 2QSJA 4MS1A 1WHSB 2O0LA 2CE7A 1F60A 2F2TA 4G86A 3VVBA 1HGXA 1KMIY 1R66A 2CZGA 4YAEA 3HLTA 2VK1A 2ZQ5A 1KZ7B 4RHXA 1JNXX 2YVUA 5DLDA 2Q5FA 3TLEA 1ZN9A 4B7UA 1J5PA 3CKMA 3SYNA 2QUJA 3WHKA 1H2BA 3TLJA 4AROA 5A4IS 3JZIA 4NPHA 4B2PA 3CX3A 3UJNA 3N2GB 5K0JA 4BNVA 3LQKA 1U6IA 1Z45A 3AINA 1FDUA 1PSZA 4HQFA 2QA5A 1ZC3A 3I6ZA 3JQ7B 3COZA 4KE8A 2Y9PB 2DE0X 1JDJA 3C6QA 1EKXA 1H5UA 1CQWA 3I30X 1DAIA 2CUNA 3P32A 2F43A 4H0NA 4ND6A 4F4HA 4JKIA 2P4UA 4J0GA 4RVNA 5KTMA 2UUBB 4HJXA 4IAOA 4BQPA 5A4MS 4IEEA 2A33A 4ZAXA 3VV3A 1RZRA 3HXLA 1SU6A 2PA3A 3OKAA 3V9PA 5EAIA 4DMUB 1V6AA 5JCOA 4LE0A 4F11A 4AJOA 4NDZA 2WSYB 4PLVA 5AI6A 4AURA 2WFLB 3HVUA 1EP3B 1JPVA 4B44A 5I5EA 4OLFA 4TKVB 3IUNA 4B3XA 5AO9A 2WLSA 3N86A 3O75A 4XQEA 1JG2A 3G9XA 1MB9A 4IYJA 4URWR 2H48A 4AJ2A 2MYTA 1I36A 2JL1A 4GOXA 2V7BA 3LZDA 3Q3IA 4BGEA 4EYKA 2X0KA 1BJTA 3L7JA 4Q3NA 2IXBA 3X1KA 4B3CA 1QC5B 2QJOA 2RI6A 3A10A 4M8KA 2NU7A 4ASUD 1AQUA 1OU4A 1S4MA 3E3MA 4LY6A 5AKJA 5F1KA 4BNZA 4DQDA 3MCAA 4UOZA 1A3CA 2WD7B 3MC1A 3OEED 4HPJB 5LBTA 1PN3A 3BA6A 3L79A 1Q57A 3R0VA 4QOSA 2F55A 2GSDA 4M0CA 3AF1A 2CUZA 4JLNA 4BMPB 1X1CA 3K96A 1E1QD 1N3IA 3G7UA 4GUDA 1R3UA 3VZDA 3Q11A 2NMVA 1R4ZA 3GUZA 3S2UA 2Z1MA 3V4PB 5LQAA 4BNGA 1E3QA 2RGRA 4TLCA 4DXAA 1NKTA 2PEYA 2DLCX 2AN5A 1UPAA 2M6SA 3EN0A 1L4NA 4J16A 4TVBA 5JWRA 4G0MA 2Q3JA 1F38A 2QJRA 4RCVA 4RJKA 2FFQA 1OF1A 1U1EA 3FDZA 3LO8A 4TS3A 2IYEA 1ZIDA 3K2IA 2AZTA 4WI1A 1FP2A 2QE7A 4AKGA 3PC8C 2IX9A 3K35A 1W19A 4N0EA 4ARUA 2Q3LA 1TCUA 3L0ZA 3IIMA 4G07A 3B6MA 4KXUA 5F2EA 5H3CA 4BQIA 1EXWA 3RT1A 4OA5A 1ODCA 2IHZA 4QOGA 5BN3A 1B6SA 2YQ4A 3L0IB 4HDMB 4YT8A 1DAHA 1U7DA 2C4KA 2VWGA 5KJ1A 3CKKA 4UDOA 3JQ8B 621PA 2IQ5A 1X14A 3B70A 4S2UA 3I6MA 2BFCB 1T8PA 4WFKA 5HJ2A 1TL7C 2RSLA 3HG7A 4ZT3A 3KYJB 2IUYA 3H1TA 4ZA2A 1U2SA 3JS5A 2HJHA 3L07A 4DR7B 2VWQA 1P2UA 3EFEA 4H3HB 1RAAA 1TKBA 4EMTA 1KXZA 1KK0A 1NUPA 2XV1A 3CRMA 3J7TA 3P0EA 2GHIA 1Q74A 3B82A 3L8DA 2FMFA 4J8PA 5FAXA 2C2BA 5TQ0B 1WULS 3TRIA 1CU1A 2ZYDA 3OHMA 4PGMA 2G6BA 1ZOPA 1QE5A 3I28A 5DEIA 2ZSUA 1HKUA 2J6CA 2TS1A 1N2CE 3ETCA 3O0DA 4IOKA 3UJHA 1FMTA 1I6WA 2UUCB 4O1HA 1CVLA 4KPYA 2BCEA 4XI9A 2OHXA 3ZQ6A 2IZZA 2FP4A 4M6WA 4ABYA 1MNQA 3GYBA 1THGA 1NBWB 3T4XA 5E0KB 1O6ZA 3P96A 3AHGA 1ETUA 2VEOA 4BNNA 3D2BA 4EHLA 2VYCA 1Z5UA 1VB3A 4R7TA 3UB4A 2ZQYA 1QYIA 3I64A 4RJTA 4TWZA 3EZGA 4R3WA 2X6TA 5GVRA 3CRNA 3L1HA 4OU4A 5CT6A 4HP8A 3UV3A 3LH5A 2YTZA 1QIHA 5CFPA 2IS4A 4D0GA 1UMKA 5BR7A 1Q0QA 1WQ1R 3ZW9A 4F56A 2ZBEA 2HLDA 5HIJA 3CH7A 3N7TA 3DZHA 5C31A 1M83A 1DCMA 5HG0A 5F77A 1QFZA 1X7HA 4AYXA 4BV8A 1SKYE 3AKYA 1BS9A 4MQEA 5F64A 3SP1A 1GCOA 3SLGA 1H6DA 3N2ZB 3M2TA 4BE9A 5A6VA 2PLNA 3NCTA 3KPWA 5L51A 1PJAA 1JG1A 5IM5A 2HCJB 2VF5X 2GF2A 2OMEA 3O1JC 5T5QA 4BNIA 3R5JA 2P5TB 4NR0A 4CETA 4JROA 3RS7A 2EBHX 1I6MA 1IM8A 4G4JA 3BH7A 4YRLA 1C3OB 5GP1A 5I9IA 5JNLA 2BH2A 3NBZC 1Y9JA 4IDGA 3OH8A 1HFKA 3HADA 4IV5A 3GLHB 4RMNA 3DV0A 4I9GA 4IXWA 3GVXA 4U2BA 1KI4A 3WLPA 1SCNE 4G26A 4A91A 3AIMA 4TM8A 2YQZA 5BQXA 2OECA 3LDGA 3K1AA 3KTAA 1KA9H 4P4UA 5A1TA 2KQUA 2P0YA 4Y1RB 3S4YA 1H4QA 1ULZA 2Z0MA 4G8BA 4ENUA 2RB5A 4DUGD 4TXNA 3ROTA 1DOHA 3NT5A 5H3HA 3TNLA 2GTPA 2C4NA 1F1JA 5H70A 5EZ6B 2OMKA 3VSEA 3K6SA 1NNSA 2P67A 3FNRA 1RPZA 3ADKA 2YN4A 3ETGA 4PFSA 1RTKA 5ALKA 4C3VA 5BV0A 2PQMA 1TZ2A 2BGNA 4HDKA 1YVPA 3D54D 3TCNA 3JALA 2ZYTX 5L7TA 3DMFA 3GRYA 2ZJ3A 4R2WA 2MSCB 4BV3A 1TZMA 1B41A 3TKLA 1AS0A 1G5PA 2LIVA 2GF0A 1YZHA 2GILA 1DEOA 4FS8A 4Y2SA 1N6RA 4AS2A 2X2PA 2XCOA 4GVLA 3WBKA 2PWBA 4C03A 3F6RA 4R9VA 2QZPA 3L5KA 2AI3A 1JILA 4EELA 1AO3A 1PJLA 3WK7A 5FWXA 2DP4E 3ESYA 2IYNA 2XWSA 3Q4GA 2FCAA 1T0HB 5ALWA 4D3ZA 2Z9BA 1E8DA 3IB6A 4OUDB 2P6NA 4FC6A 3LP8A 3F9CA 4JN6B 3VHRA 2AX4A 2X8WA 4KE6A 4U7JA 4JDPA 3A04A 1ILEA 1N2GA 1MG5A 1XWWA 5DYTA 1U2EA 1YVRA 3D8BA 4LA4A 1LWOA 4Z5XA 1DV1A 1WTCA 3U7GA 2BOVA 5EE9A 1DKPA 5FEMA 4WBNF 3R2JA 3V4OA 5JBNA 1AKWA 1C0PA 1US8A 4OXNA 1MH1A 2FH5B 4MUMA 1R9JA 1SC3A 1ORDA 1TRKA 2WG2A 2ZB4A 4JL8A 3VGJA 4PR0A 4E5VA 5C8XA 3DLHA 4LJ4A 3AY6A 4EARA 4A2WA 1KQOA 1Z8FA 5CVEA 2QIPA 1FX1A 4UFOA 5I7SA 5ALDA 3IP7A 1PVDA 4S24A 2X1HA 2Q0HA 3BF7A 4IIJF 2KW5A 4XIYA 5ESDA 1B1AA 3AXTA 1OX4A 4F45A 7REQB 3QXHA 4ND7A 2HU7A 2A9VA 2EQ5A 2FMUA 1JZQA 3G1UA 2CLSA 4I14A 4XWTA 3X1YA 4D9CA 2PXCA 2ZBFA 2PWAA 4R9NA 3LQYA 4MPDA 3AB7A 4RCYA 8AT1A 1GAEO 3KHUA 2XD9A 1W34A 3H86A 5CU7A 2UZ3A 1VPVA 1Z6GA 3I0ZA 1U7TA 4FZ5A 2O07A 3LFUA 5AVXA 5IAAA 3H65A 2QM7A 2WMDA 3KETA 3EOZA 1C7QA 1HC7A 2D1FA 2D2EA 1OXKB 1PO7A 4H16A 1QVAA 2FPGB 2Z6AA 4NXNB 3IX7A 4G5HA 3L4KA 4TKLA 1O0SA 3O1HB 2BMWA 2UUOA 2YW2A 4OVKA 2Q1XA 2PZGA 4RSRA 1GNSA 2VF7A 4HYEA 4PGFA 3VZCA 1PQYA 3DQPA 2D5LA 4ZU6X 1ZSYA 1MN6A 2VSXA 3O93A 3OSZA 4I19A 3ZDEA 4S1NA 1LJUA 3QXXA 4XVRA 5GTDA 3O5AA 5KYWB 2F8SA 2H2HA 4DIDA 4A15A 4LWOA 4M38A 5MN5A 3VR2D 2YMQA 2JFQA 4HX5A 4Q3CA 3W3ZB 4Z7OB 4NCAA 2PSEA 1WJGA 2YXDA 3KJGA 1VIYA 4J4HA 3SBDA 3U0VA 4DXDA 3K70B 3WE7A 4C04A 1K2VN 2VZEA 1VG9B 1G8YA 4M0MA 4CIVA 4QZVA 4NMXB 4XCQA 1E69A 3PDHA 3SX0A 1WQ4A 1E4OA 1U7OA 4OQDA 3SY8A 1XKQA 4RD2A 2BE9A 4RVSA 4BWVA 2WUGA 3GHHA 4BP3A 2HNBA 2YZ7A 4TWBA 4EHJA 3DLCA 4NJOA 3ZEAA 1TIPA 3M5DA 2A0UA 5EPOA 5GPBA 3AVVA 2HCTA 3DFKA 1DMSA 4QDOA 3RJ9A 5JSFA 2AMLA 1CUIA 3QVOA 5JFOA 2I66A 1XTVA 1RLUA 3D7SA 1ZK4A 3QY0A 2WBLC 2XRYA 3OCYA 1XRMA 1YJ5A 3DZDA 1M34E 4MINA 2ZULA 2VDVE 2OBXA 3E48A 4LX8A 1L7MA 4L0DA 4XFKA 4B3HA 5JHHB 3BDIA 1QQ6A 4NEQA 4RM2A 4J94A 3A1VA 4LPKA 3D5QA 4TV8A 2FYTA 4U5XA 3PD1A 3VFDA 2WZDA 2I9PA 5KJEA 4MXDA 4C78A 1BSVA 4HNHA 1CYEA 3IMCA 2O14A 3NHAA 3S8YA 1G8FA 5L45A 1O6BA 2AKEA 1P9OA 4BNWA 4BFYA 3UN1A 3R5HA 3AR2A 3TS1A 4GM0A 4N03A 3D8HA 3IVXA 4L73A 1GWNA 1NVEA 5JAQA 2EGGA 3CO0S 3DQQA 4J0CA 4AXBA 3AYXB 5B3KA 5BN1A 3ZXXA 5CA1B 4QYSA 1K63A 1OAOC 2BZSA 3HCWA 4RHCA 4HQRA 4A3SA 2BEWA 4K86A 5KC9A 3IT3A 3N28A 2DX7A 2JAXA 2NXEA 4YQYA 3DZJA 4GWGA 3VRHA 3FHLA 3M49A 4K88A 1UJ2A 4IGFA 3URKA 5TIIA 4ZT5A 3ONWA 1CRQA 2CLLB 4GMDA 4KQHA 4BO1A 1PUIA 1JHZA 5D85A 1N4AA 5CP8A 2CKMA 3ZDBA 2YHSA 3F49S 4GYWA 5K6RA 3EG9A 4TL6A 2XYGA 3FZYA 4ZYUA 3CB4A 2Q5LA 1Z26A 4XYBA 1P80A 3HBFA 4KSBA 3RG2A 4D8TA 5KVSA 1YFZA 5JMPA 2NTNA 1EVYA 3WRXC 5D5QA 1E8NA 3BRSA 5JJLA 5I7VA 2B78A 3PA6A 1QCYA 3D0OA 5FUWA 2P65A 4EG3A 3NWOA 2G80A 2JCVA 4IHJF 5FWAA 4PXSA 3N75A 3HQ4O 5T8KC 1JKMA 2BGLA 3NFYA 3OFNA 4YGXB 4Q66C 5LJIA 1YCHA 3JARB 1Z4KA 4B2LA 2D7CA 1W25A 1WCIB 2IP2A 3DVLA 2F1HA 4LYHA 5BN5B 3F78A 3MWDB 1OHHD 2DM6A 2O9JA 4FEAA 3UXMA 3ZCXA 2IFTA 1WNFA 1VYUA 1Z2EA 2H1RA 2Q46A 3GI1A 4AKTA 1Z6ZA 4GP6A 4N6GA 3WJ7A 3DO8A 4FB5A 4MH0R 2GM9A 2OO5A 3DE4X 3BQMB 3FM9A 1Y8AA 4XYMA 4PX2A 1SA0B 1VA4A 2GGSA 4TLLB 3MTBA 4PM4A 1EGAA 1DFHA 1X3LA 4LZOA 1EWRA 4W5QA 1R7RA 3FWHA 3BMXA 2ANBA 5D2CA 3TPZA 4G5FA 4K9QA 1L5FA 4LTMA 2NV2B 3RBXA 3TOZA 1GGEA 4B09A 4MTLA 3FGNA 4JSYA 3MEQA 1JA1A 2ZYSA 3O47A 1HQYE 1R0CA 1CR4A 1RR6A 2BWJA 2XUJA 3OPXA 3VQTA 4LNUA 3KT0A 1YB2A 1BE1A 3HB9A 2LR0A 4DIBA 3KAPA 2YS7A 2BT4A 3H1BA 2ETXA 4E13A 2ORYA 5AYVA 2H7XA 4MS3A 4EG1A 1K8RA 3D4LA 4M49A 1IULA 2ZYWX 3UJ9A 1R6UA 1WB6A 1AT1A 1ECJA 1Z0UA 4MNTA 3OM1A 3LAWA 4WKOA 1LD3A 1BHQ1 4HLQB 5DSTA 1UPBA 4RVHA 5IVKA 2W2OA 4L0CA 4A23A 2AJ8A 3EUEA 1W76A 2WHPB 1UH5A 4NONA 4IILA 3K6JA 2B7BA 3LECA 4ME6A 4RMHA 4HD8A 1B8VA 1P1FA 1AKVA 1GKUB 1KI2A 3KIPA 2RHJA 4G01B 4UPDA 3KLBA 3KR1A 4G0PA 4BVFA 4GPD1 2ZR8A 3C1TA 3DDSA 3CVWA 2OAGA 1K5DA 2ZCUA 4E51A 4P7JA 4HUTA 4ZYXA 5BUCA 2PIAA 1H2EA 5EERA 3QW4B 3WL7A 1X1RA 2QP9X 1ADFA 1KK1A 2I6XA 1M0WA 1WXEA 2I4IA 2J30A 1K6JA 3WMFA 4EY6A 5AJYA 2IV7A 3EZ9A 3B6JA 1GGHA 3O2JA 4RACA 4IMPA 1QF7A 1HNZB 3P8ZA 4YO8A 2J3LA 4AVYA 5B1HA 1JUDA 3D6TB 2QN9A 5EXDA 4RH3A 2ZVQX 4WKCA 4UDNA 2R00A 1YXMA 4GL2A 3T3OA 2CFCA 4ZYZA 1TDJA 3ZCRA 4LGYA 1UXIA 2D2VA 5KJCA 4WK6A 4BMNA 3F4BA 1OX4B 4ZAVA 1Q95A 1RWQA 5EJMA 1N57A 2HK9A 1YJAA 2B1JA 3HJCA 3LS2A 2PGLA 4RL6A 2UXDB 4RD4A 1V71A 3NHPA 3P45A 2HA0A 2DFNA 2Z08A 5DSZA 4QT4A 2FV8A 1F4PA 4NNOA 4P4SB 2KB0A 3OJLA 3LY7A 2Z57A 4DSTA 5F7XA 2BUBA 3PXGA 3NU1A 3R3SA 4J7AA 1DWQA 4AUKA 4JEIA 2YZKA 3ENZA 2YHIB 1QHNA 4E5KA 5AKLA 4E2WA 4WLVA 4WFQA 1VJ1A 3TW6A 3C15C 5BV1A 3UJCA 4EHDA 4QLOA 4N5IX 4MKIA 1FVXA 4MRVA 4RA6B 1OTYA 5CNKA 2ODAA 1MJGM 3ZNNA 1PQWA 1AHIA 3AEQB 3PI6A 4UUMA 1N6IA 4WXPA 4XSVA 1CQZA 5T6BA 3CH4B 5ITZA 4CXMA 1H9BA 1NXTA 2FVXA 3VO1A 2O8EA 3JZAA 2G4LA 3L01A 2UYHA 3W7VA 2ZUDA 1R8QA 4NMWA 4RQAA 1S8AA 2G06A 2A5JA 1KI3A 4RY2A 4UTRA 1NA5A 1UBOS 2XBMA 1Y3CE 1XMIA 2QZ4A 5GGXA 3LZCA 2X0JA 5IAJA 4DIOA 3OFKA 4FYHA 4WXEA 1NXOA 4ZU1X 4LJ6A 4QU9A 4B3DA 4Y2TA 1NAHA 1NP3A 3D3KA 4BX8A 5LZ5A 3IIIA 3PRYA 3UT6A 16PKA 5K3CA 3SFVA 4LJSA 1DXHA 4RPIA 3PGMA 3L4SO 3RASA 4GECA 4B46A 2V7QD 4H1WA 1MAHA 4A0SA 5T4HA 1EWYA 5HKKD 2B36A 3OTIA 4KE7A 4YDQA 3I32A 5EN4A 1SVKA 3IP8A 1MVOA 2PX6A 3VH4A 4A2QA 3ZR4B 3DHNA 4BBPA 3B3FA 1COZA 2NTYC 3BREA 2CNNA 1KYXA 1L1FA 1R88A 5FI0B 2VRNA 2YZMA 1VJCA 4CJXA 3GQVA 1G21B 3GOQA 2P1DA 4OMDA 2F3PA 2QROA 1SMKA 3NYRA 5BNIA 3IYLW 1UADA 2X6RA 3ND5A 4L8WB 1TIKA 5C81A 2EYUA 4CKCB 4RTRA 2Z6UA 3QGMA 3FZEA 4IJWA 3PHBE 4ZZ3A 3GJYA 2IEIA 4WDRA 1U28C 1JIXA 3BSWA 4D6PA 3C2QA 3FOCA 3WIDA 2AXQA 1UM8A 3HWWA 3A0UA 3IQXA 5GZ6A 4MQLA 4UAJA 5BUSA 2NSHA 1P9NA 1RYBA 2BJVA 2VZ0A 3MCWA 2ATCA 4P1ZA 5EMHA 4DTIA 2FLKA 4EFLA 3OJWA 4EGAA 4YIHA 3BTUA 5KNDH 1KEKA 1Y8RB 5I7WA 3CLHA 1VPEA 3CGWA 2DKOA 5CIQA 2Y99A 1P0IA 2X0DA 3JWIA 2PT9A 2BHSA 3LIPA 2KPOA 2H1HA 1X19A 2DWUA 1C3EA 1GZ5A 2O2SA 1QZUA 3NBKA 4L8YA 2CUTA 3UK2A 5BSWA 1TEVA 3LXXA 4CLRA 3M1IA 4EB3A 2VJCA 2CV1A 1D1QA 1T9AA 2C5AA 4BMZA 4KN9S 2G40A 1AQIA 2BKUA 3KQUA 3GLIA 5DK4A 1UBKS 3C3WA 1P2SA 1BE8A 1NXSA 2C99A 2WABA 1J5XA 1LPOA 1SXJC 2H57A 1CD5A 3C3XA 3PL5A 5M3BA 1DIBA 3RU3A 1LRLA 1S6YA 1A9RA 3O92A 4GW3A 5KSZA 1P7VA 2AG8A 2R751 3EWNA 2HTEA 1E9SA 3PR3A 4RWEA 2RMKA 1Z6AA 4IHKA 4L8VA 1G9XA 4QHSA 1BXRA 3BORA 1PEAA 1FJGB 2FN7A 5FJJA 2XUKA 5HIMA 2XTJA 3IVMA 1VHLA 3FSEA 4RENA 4G0VA 5I4KA 1YC2A 3QHQA 1PZXA 4NXMB 2NYVA 2P9FA 3T4EA 3ZXUB 2VYNA 4OCZA 1RP1A 1P8AA 1DJQA 4TUYA 1OLOA 1FFYA 1RRFA 1ZGJA 3QI2A 3PJDA 2PQ2A 4M9SA 1PEKE 2F3QA 2YXNA 2ZJFA 1K5HA 5HA5A 2X76A 3I6IA 1VLJA 5A0FA 2IOQA 3NJ8A 2ZYHA 3U4HA 2YWEA 4FSHA 5AUPB 1NWHA 1S8FA 3UB2A 5AR1A 3RUDA 1G41A 3VMFA 3ED1A 1USGA 1IQPA 4CF6A 4LEIA 3PK0A 4D4LA 1Z47A 1TU3A 2FW7A 3UJBA 4DNFA 3UAVA 2AT1A 2PRZA 1GUZA 2X8JA 4EL5A 4WN9A 4A4DA 2M98A 3L0SA 2Y1WA 3I76A 3VR5A 2VP9A 4F4DA 3A11A 3UKJA 4I36A 1G19A 3V32A 2ZPTX 3N6VA 5AW8A 2QIOA 4GSLA 4M36A 3BT7A 1G4AE 1OGYA 1ZIPA 2XE8A 2XXJA 3FROA 3QZUA 1ACMA 1C3VA 4QE3A 4ZOAA 4DPLA 3AESA 1JDVA 4FYPA 2HA6A 1KZYC 1U0FA 1JSLA 4C0HA 3ITKA 2COUA 1B3BA 3PA8A 4GMKA 3VI3B 2QBYA 1EB9A 4JJ6A 2C59A 3E27A 3RG8A 4EF6A 3PJRA 3PXCX 4WIAA 4UEWA 1SQGA 1L4LA 3FB1A 3H3XA 3JZFA 1GGNA 1WX1A 3W9UA 2P9HA 1N36B 4TZTA 2EVWX 4M7WA 2IQIA 3ABSB 3I04A 5E6SB 1VL1A 3LUDA 3S7TA 4BECA 3RHZA 1FU7A 3GMTA 4MV6A 3SJ7A 4QBGB 1MAWA 4A2CA 2Z2YA 3FG9A 1XAIA 2JH9A 2B6NA 1KPGA 1TCVA 2VUSA 4PICA 4H7JA 1W6UA 1NVTA 2I6QA 2JF0A 4HDNA 4I50A 1WZ2A 5KPDA 1YQDA 3IHLA 4GM4A 2Z9CA 1FY2A 3ZC3A 3E5HA 3U1VA 5JDIC 4TL9A 3LBYA 4KRXA 3GCXA 3FJOA 1XD8A 2DBRA 1KIMA 4HQ6A 1WE2A 4Y7DA 5F51A 4BGIA 4EUSA 5C4MA 4R2IA 3A1UA 4FYVA 2PH1A 4ALNA 4ZHSA 3VPXA 4BEVA 5AXAA 3NHJA 4QDTA 3UAOA 3A4MA 4DLPA 2AV6A 5I4CA 3DEIA 3QLUA 1XDWA 4KV7A 1BG6A 4Z3DA 5LCXA 1J70A 3L1IA 4ZEVA 2DUWA 2B4AA 1QFXA 4TMKA 3TSWA 5B1SA 3I6YA 1O9HA 4L6IA 3H2BA 3H84A 4LQLA 3UICA 1DWPA 1SZJG 5J2UF 1GGJA 1SBTA 2HQOA 1PZGA 2LDXA 3B1KA 3H9JA 1R2QA 5BMOA 4PHFA 2PUDA 1C30A 1JSCA 3WP1B 4QYXA 1P2BA 5CLHA 1JDSA 3A1CA 2GPBA 3O4JA 5GZ1A 5F98A 2C9MA 3IMGA 4FJ0A 1DIAA 2BV3A 4MWGA 4PQEA 4Y2UA 3ZHSA 2I78A 2O3JA 3LVFO 1MJNA 1NR1A 5LNK1 5IDWA 1G17A 3AL0C 4XKJA 5E6UB 5TARA 4LPSA 1HE3A 3ZV6A 3B9RA 4NZPA 3HM2A 3U7FB 4MEBA 4QQKA 1C1DA 4TX1A 3MMPA 5IUNC 2R6JA 1HLDA 4ZO7A 4UASA 3NPAA 1YMQA 4ZPXA 4II2A 5GJWC 1P1HA 1OFVA 3OPYB 3ZKWB 5JCXA 1FP4A 1YIDA 5FR1A 1NIJA 2V65A 1T5TA 3B8EA 2FPSA 4ZVLA 2ZK7A 1BA3A 2ZIGA 4U7TB 3AEQA 5T7BA 3VU9B 3DDWA 5AI9A 1UZMA 4L9RA 4LJAA 5FX2A 3V4VB 5HVNA 3TSAA 4R05A 3QK7A 3CBQA 4BKUA 4A6EA 3CHYA 1FDVA 1YNSA 4H6WA 3FPJA 4URYR 1NT2A 2O8VA 3GDHA 3HN6A 1M1NA 4I08A 2VPPA 4XB6B 5F2NA 5EP2A 3ICCA 3SR0A 4AJEA 5B36A 5H68A 5ALGA 5A5VA 1NN0A 2O7VA 4B4UA 3A1WA 1EFLA 3OZVA 3WHPA 1YJXA 1DJPA 2CCGA 4K9KA 4AP6A 1GZHB 4HWGA 4IIBA 4ARZB 2DG2A 1IVYA 1N34B 4LJRA 1CXZA 1CQXA 2ALJA 4G1UC 4DILA 1ISJA 1OASA 1VRWA 1FLNA 3DQZA 2H4JA 3DVQX 3EC1A 3INRA 3LVBA 4P7FA 4WXHA 4BAZA 4DE5A 4F84A 2C7RA 2B4TO 5TQ2A 2P0AA 1WZNA 3LKVA 1MEEA 4K6KA 4MVJG 3BE5A 5HCNA 2QR2A 3PNLA 3ZVMA 3VYWA 3FZNA 2ZIXB 4QOHA 2NPOA 1E9AA 2A30A 4CT4B 4TKVA 3OT4A 5J59A 4QJ4A 1GKIA 1EK0A 1DQSA 1M6NA 1PT5A 3AJDA 4A0GA 2WLTA 4L6CA 2O7RA 3B7GA 1KZ6A 1I3OA 2VJAA 4GQAA 4AYWA 2XNKA 4NE7A 5CDFE 1UJ6A 3DZ8A 2EQAA 4KAJA 1F6WA 2BP7A 1V8DA 4Z9XA 2ISQA 2DUJA 2NUTB 1DBWA 3HUDA 1J49A 3O8OB 4HHEA 1T2FA 3A2NA 4PC3A 2PSDA 3ETNA 1E7SA 2QT0A 1XEWY 4UBKA 5H16A 3HDTA 3C70A 4JGIA 3FD8A 2N47A 3EXEA 4TQUS 3GMIA 4PQYA 1KE1A 4KN6A 1HSZA 3FHOA 1ESMA 1F9AA 4R8LA 3I9V1 2WF9A 2AC2A 5DZSA 4ANFA 4CMJA 1Y7TA 2YIJA 4PYJA 2BC9A 3B6ZA 3MJSA 2R62A 4HN4B 2PD4A 4CTJA 2IBSA 1CF9A 1U8ZA 1DOAA 1L8XA 1T8SA 3ZZUA 1Q22A 4OA8A 2JLQA 3IDZA 1T5LA 4GWLA 3DWGA 3BMCB 3N58A 4JUDX 3PGA1 5F7OA 4I4IA 5JEDA 1AKYA 3U80A 1F14A 3Q7IA 3DWIA 3SEAA 3I62A 2Z5VA 2AG1A 4AU1A 5LQDA 1JN0A 1FFDA 1L4HA 2P6UA 2RFLA 3MWEB 4HBZA 4FKZA 4S0ZA 4DDKA 3A6DA 1OXSC 1G66A 1F2UA 5LYJA 3L1JA 1AXEA 1I4DD 1B23P 3BWYA 4N3CA 3NRCA 3UQYS 2PT7A 2A59A 3DVAB 5I3ZA 3DCIA 1PNOA 1Q16A 2IC5A 1ONSA 4WNYA 2GBIA 3AI2A 4GE3A 4R8VA 5GV7A 1X86B 4RK1A 5KSOA 1V41E 1ZGHA 3E9DA 2FU5C 4R2LA 4RFSB 3FKJA 3ISJA 4GP9A 2PUVA 3VPCA 1X8KA 3QFRA 2DB3A 4QPCA 4AZVA 5JZOA 1K6XA 3HN2A 2CJFA 3S1SA 1NULA 1D9ZA 5JSZB 4O6VA 4WLFA 2Y68A 2K2WA 3GDGA 2MMCA 4DY6A 3UWMA 2Z1DA 3D8RA 1JLSA 2ABWA 1QBGA 2RBKA 3ADPA 4MLDA 4ND8A 3ORFA 4A7PA 3HU1A 2NZYA 3KL2A 5AW1A 4D4KA 4H17A 1NZDA 1SM4A 5KNCD 3RHSA 5EJFA 2FWPA 4M55A 4ILKA 1SCUB 4RZHA 3CZPA 5JSKA 3TIFA 4BQRA 3U5TA 3VYVA 3RVNA 1OH8A 2JBHA 2PUHA 5KX5F 3N7AA 1VE9A 1NBME 3E0QA 5HE8A 3V7UA 2H1FA 1Y7PA 3A7DA 3DAPA 2IZ7A 4H7EA 3OA0A 4TYQA 3W05A 1P0MA 4KRYA 2XB8A 4HDAA 2R6ZA 3T7DA 5EWMB 5GOZA 3RF7A 3KC2A 5PNTA 1QIGA 3ZLBA 1Q3TA 2RONA 1EFUA 2AD1A 2DQYA 2NO6A 1ZNQO 2JIPA 2PDAA 1KKLA 5EWJB 1MDBA 4BWGA 4DHEA 4G85A 1ORTA 4PG8A 1K9VF 2W2PA 4ODIA 1EVEA 5I45A 3CN7A 4ZOCA 2E48A 1KVRA 2IPAB 5KNBD 3O90A 2E3JA 3Q2KA 2P40A 2UYYA 2DRIA 1KFEB 4YO7A 4M3NA 1R1DA 3MGKA 2XXAB 3LPNA 5SZIA 2V6MA 3WDSA 2Y1KA 5DMHA 1RXWA 3FKSA 3TO5A 3OAAA 1CQIA 2VTEA 4KXXA 2AG5A 3A9RA 5E38A 4ZGWA 3RE1A 1MAUA 1AS2A 2LTAA 3QYAA 3MT7A 4F9GA 1WETA 2QSUA 4IEIA 3UXHA 1O0CA 1S1MA 3W34A 1V37A 1NI3A 1RHJA 1Y42X 2B8WA 2X4GA 3HYRA 3TR0A 2F1KA 1D09A 3DYIA 3WB1A 3OY7A 3QE9Y 4U4AA 4MOWA 5H1YA 1CBUA 1DIHA 3GEDA 2XJ9A 3GAFA 3I4FA 5I9SA 1T4CB 4PZLA 4JUFA 2E1RA 4G6ZA 4EO7A 2ZJ6A 2RHCA 2ZAYA 4IDOA 4CZ2A 1R12A 5KWEA 1X8XA 5FOWA 3O8DA 3ESBA 1DC3A 2ILVA 4N0MA 4RIGA 5SYAA 3GAMA 1NBEA 1ESDA 3ZLTA 2PLWA 2FFBA 4XM0A 5LLTA 3HJTA 2CXPA 5DNDA 2GPYA 3HGQA 1QP4A 4PHTA 1XP5A 3H99A 4YPVA 3KEMA 5AVYA 3MJFA 2QG4A 1QIMA 1TEZA 4MPPA 2J9GA 2JVIA 4M9QA 1OOEA 3HRHA 4QFCA 2JC3A 4RTQA 5K09A 4G0QA 3JAKB 1G4UR 2P9BA 5A3VA 5NLLA 3T1QA 3BH0A 2QORA 4N3BA 3L0BA 5J5AA 1DTWA 4PAWA 5DFAA 1KXJA 1YZYA 1OX6A 1NBMA 2C4VA 3O03A 1GPLA 1NX9A 1W5AA 4QXPA 4S05A 4QULA 5LIRA 1FTNA 2VN8A 4DLTA 4V0ME 3TDNA 3UMGA 2RGNA 1E6CA 2G5PA 1KQNA 1EI9A 4CI9A 4HNTA 1K06A 3EF1A 3KQQA 3K9HA 3M6VA 3WLTA 3O73A 1MV5A 2KLBA 1T36B 5TC4A 1WB9A 1PI3A 4O4LA 3MCUA 4POOA 4AICA 4QLBA 2XYVA 3MQ2A 4WBNB 1XAJA 2X2EA 2R6R1 2V58A 2EBFX 4DMGA 1WZIA 4FONA 1H4TA 4JP3A 3RD5A 3KWFA 5ITWA 2R44A 3VGPA 4EUKA 2O8CA 4KREA 2VNSA 1E5DA 1DMRA 2MYNA 4U39A 3PE6A 4PIVA 4J2HA 5KOIA 1QIKA 1Y3FE 1OT3A 3L43A 1NP7A 1WOMA 1S7GA 3AWIA 3ORYA 1Q1NA 1VI5A 1QPGA 2B9VA 1BKDR 1O4VA 2P2DA 3FB4A 3JVVA 3QNMA 4GRAA 4IIJA 4JLJA 4ALMA 3TINA 1EUQA 4WGGA 1JA9A 3F98A 4B76A 3KR2A 2G9VA 4ZU3A 5LM3A 1GNTA 1UFRA 2VUTA 5ALLA 3RT7A 4M0PA 2NP7A 1ICIA 4WPGA 3WXBA 4UREA 3TQQA 4EG7A 1P75A 2EC5A 1WY7A 2DKFA 4JU9A 1JMKC 3GRPA 3T34A 1L9XA 4KO8A 4BQNA 5JYBA 2G8LA 3CMCO 1WDTA 3L7LA 3W8DA 5LN1A 2ECOA 2JLSA 4I5EA 4IJKA 4MA0A 3I5YA 3D5TA 4OSOA 3E7PA 4FR0A 4JUBA 4KTTE 2D13A 4P3KA 3NDRA 1NM5A 2NO4A 5T4EA 2DFLA 3ZE2B 3RADC 3QENA 4GQIA 4TTTS 4WZAB 3ZWXA 2B2XA 4C2AA 5TVGA 3FI0A 3FYCA 4WASA 4AZ3A 2C2WA 2PH5A 3DL0A 4X64B 5IM4F 1SFRA 1KJ9A 1SOUA 1U9CA 1XA0A 1NASA 5JADA 4Z9YA 2ZJAA 5JH7F 2GFIA 5KYXA 3PC7A 5EJ5A 4B0PA 4JI2B 5DTQA 4GX5A 2QLBA 3WA6A 3EXEB 1J56A 3DEYX 4HXGA 4KCGA 2BM8A 3D3EA 1T8YA 5T8KA 1FPQA 2BM9A 2RHGB 4WXRA 3OHPA 2FPWA 2ZUBA 3OX3A 3TD9A 1WVMA 3PP8A 1ONPA 2AN3A 4JELA 5KSWB 3L6UA 1K8XB 2ZREA 4FCCA 4GRIA 2QMUA 3B89A 5ALIA 3T5AA 3PUKA 1YI0A 3RIGA 3S5UA 1JHYA 5KI6A 1OA0A 4ENWA 1BVYF 3EODA 1XQWA 4LOIA 4QO8A 3MYYA 1ZW6A 1WQ3A 3OTWA 2J9XB 3EVZA 2Z6VA 4B83A 3GA0A 3L1UA 1K27A 4F1JA 3I61A 1EUYA 2CLEB 1K4MA 1KMNA 2BGKA 2GVZC 4S3MA 3GRAA 2WVGA 3A70A 1X9HA 4MA4A 1QVRA 2HK8A 3CWZA 1OKKD 1TEHA 4HRVA 4MQ6A 3M6XA 1KYZA 2EHJA 3OBBA 4Y9DA 2ZVPX 5FFFA 1L5MA 4MV8A 2K7ZA 1IN5A 1M2EA 1JG7A 1ODTC 3K16A 4ESVA 2FUKA 1NURA 1MCZA 1PV1A 2H65A 2Q3BA 3PIRA 3Q7PA 2PD3A 2XMZA 4R81A 1ZUNA 4FD2A 1ZY2A 4RK7A 1F8UA 4YWJA 5HTOA 2ZATA 3RM3A 1D2HA 4WKPA 1O95C 2IDZA 3N2KA 2Q41A 3UTCA 4I66A 3AU8A 2ZJ2A 1IEVA 1JQDA 1Y82A 4QGHA 2ZUUA 3IUBA 1QO0A 4XW2A 3EXFA 2WJ6A 2XMBA 3BHJA 5I7OA 2HSGA 3OQOA 2AZDA 2OQIA 2A94A 5A7FA 1SXQA 1J0AA 4I46A 4LZNA 3WNBA 2YYYA 4YMUA 1NVVR 2RH5A 4OO3A 3B8HA 4DGQA 1UMCB 2W37A 3EQ2A 1PNQA 2B8TA 1C7FA 5FNZA 4BO2A 1LV7A 1XMJA 5JSUA 5LQJA 3QTBA 3YASA 2ZPUA 1QYWA 1OILA 4WLOA 3AVYA 4XOIA 1EJ6A 3T35A 4HWSA 1SBCA 4V0KA 1JQLB 1GXSA 3OCVA 4AL4A 7GPBA 1QIDA 1L3CA 3ND7A 1P74A 4LI0A 4YJHA 2JATA 1T25A 4PBRA 4TROA 4J1TC 5CH5A 1GGKA 3DL2A 1L5VA 4HDRB 1FLVA 5JVDA 2O5VA 4B7ZA 4PLTA 4IDCA 2P3OA 3IAS6 2QD2A 4O2BF 3RRBA 2V03A 3QFHA 3A05A 5E6RB 4DDHA 2G83A 2PMKA 5JSYA 3PQ3A 1WUTA 3VSBA 4IOJA 2PGDA 3ZK8A 1U3DA 2C7PA 1RWVA 2VHVA 3IQFA 4QJIA 2FEXA 1AN9A 3H9QA 1V16B 3FJ1A 3I6BA 3ZW8A 4F9TA 1MB3A 3GIWA 5DNAA 5CDTA 1OIVA 2CFRA 1CUUA 3UGKA 4QDZA 1AXGA 1ULTA 4YASA 5C4IA 5E1DA 4H4DA 1NUHA 4WZZA 2BHTA 1B73A 1R18A 1WCIA 2V4MA 2AOUA 1TT5A 5CTAA 4TVSA 1P3Y1 1V8BA 1XU9A 2OV2A 2GXQA 1BU5A 1ZGAA 2AR0A 1ENZA 2ACKA 2IYOA 5K3FB 1J25A 2XUIA 4EAQA 1CZNA 2OESA 3IUJA 2KM1A 1LDGA 4YH1A 4KQIA 1MHPA 4HN2A 2Q99A 3R6WA 1G2OA 1R00A 3PE4A 1RC8A 2OZVA 4JYMA 4PY2A 3OECA 3A3YA 4W5TA 2ZR0A 3LC0A 2PFKA 2HO5A 4FFDA 4G36A 4GLFA 4OQXA 3ASVA 3AYZB 3EDRA 1E5VA 3UCEA 1A8QA 2PBFA 1XRJA 3K31A 1NYQA 3BJMA 2Q5JA 3BX1A 3R3UA 2WJJA 1WA5A 2EERA 4JZKA 1VL2A 4MV9A 4W82A 5BP7A 1WBDA 2ZP1A 3GN1A 3UW1A 2AX3A 2VT7A 1IOZA 2QN1A 3EVEA 1LNQA 1OWNA 4K9PA 3VYSB 1R8SA 4PN3A 2WK1A 2CV2A 3LCRA 2FAXA 4H3VA 3T95A 3JVEA 3CINA 1K5GA 1PUXA 1DEXA 3BSYA 2CMGA 4L3OA 4J0HA 5TGDA 2DWQA 3QRWA 2Q2OA 3QU7A 1VECA 2DEUA 1ATIA 2EG5A 2HREA 3O4GA 3MTIA 3SXUA 4LF9B 1ZJYA 1LVGA 1PUJA 1TA0A 3IUSA 4J4TA 2DU8A 3SJBA 3LW7A 3UC5A 3ZDDA 2HRCA 1NVBA 1ZQ9A 1IEXA 5T4FA 3W0LB 3ROZA 4QU0A 1C4WA 2XCRB 5HIIA 4QPDA 1NYTA 3AUFA 4GL4A 3AUKA 1J20A 4R0VA 3G49A 2BSAA 4GI2A 5AKKA 5K4AA 5EJ2A 3RW9A 4U8GA 4EJSA 3THRA 5FFNA 4DB2A 4I1PA 3AY3A 3EZNA 4NPCA 1PQPA 1SBZA 4Q9AA 5BURA 3HDGA 4IIDA 4Q0MA 2IZ6A 2VHTA 2C92A 2J7PD 3B9PA 3C6MA 3L77A 4WHMA 4ESEA 4IH4A 4ZGGA 3VHXA 1JX6A 1QAQA 1E89A 1XGKA 4TWAA 1CJBA 1JDPA 2FZCA 1O95A 1WUKS 2IPOA 2R25B 4Q03A 1HT0A 2FEKA 2N9UA 1VKOA 1KZ4A 2R6AA 3FI9A 3MAJA 1ZINA 4HK4A 3ICVA 4QICA 2C07A 5EIEA 3PYMA 3WGNA 4G5XA 1N5IA 3O4VA 3KAQA 2YMPA 3C4JA 1D9XA 3VX4A 5HM6A 1JSXA 4U2EA 1AC5A 1MA0A 2VA8A 5C80A 4CQLA 3ILSA 3EDYA 2Q50A 5P8WA 3WLQA 1HTTA 2BFEB 1W47A 3BSSA 2PMCA 3B1ZA 1CT9A 3C5EA 4RF3A 3PEUA 3R9IA 4I3HA 3RVQA 4TYNA 4RDXA 2QMHA 1VL0A 3B1XA 1O8BA 3OPYI 2VDNB 3R1IA 3QX8A 4K8OA 1SUSA 4P93A 4W63A 1XMQB 4LJ5A 1P6QA 3K0HA 5TRTA 1J7JA 4C4SA 3E5MA 5KEIA 1TQ2A 3IOYA 4KQ9A 4WD3A 3ANNA 2Z98A 5IKMA 4JV5B 2RIPA 2EW1A 4Y18A 2HSZA 2QPTA 3GMSA 3JQRA 4C0WA 4QBHA 3PPVA 5K3EA 3N2YA 3K9BA 2NVWA 3GEPA 2WVHA 4PG6A 3TQFA 2RE8A 4YVFA 4B3BA 5KYXB 1V45E 3P4YA 1S0UA 2QYOA 2ZIVB 4CR6A 3GUVA 1KAEA 4LXUA 3C41J 5CDFA 2I6TA 3OEHA 2NU9B 2GN1A 4KLCA 4Q7EA 1TIBA 4KQGA 2VXOA 4IIHA 4X8LA 4CIXA 5CB6A 1DOZA 3CF2A 1WXWA 4ML3A 4G5GA 3ZXYA 4U9HS 2CHFA 1HNXB 2DPXA 4MPTA 1CR1A 1RWWA 2ZIZA 3L84A 4ONEA 3U4GA 2O52A 1LSJA 4WW0A 4YRDA 3QEJA 5DW0A 5TQ2B 4CEIB 3KKPA 5FOVA 3W78A 2GK4A 1N3YA 3IBSA 3I01M 1X7YA 4KO4S 3UPTA 1SULA 4RVFA 1K8QA 3ZWQA 4EHHA 1IDOA 4V0OA 3TH5A 2MTBA 3MJ4A 1BWPA 4BO9A 8ABPA 2XMSA 2ADOA 2YCBA 1ZPDA 1GTMA 3HACA 2HJGA 1RCTE 5HS6A 4EYOA 4HNUA 1OYVA 1TQ4A 4J0QA 3IURA 4G4IA 4IHJA 3OLCX 4ARIA 2O3SA 3ESXA 4Q9KA 3H9BA 1Q0SA 1W4BA 1LDMA 2ZITA 5BSKA 4L4SA 3V6LA 4KGVA 5BW8A 4JSRA 4XSGA 2SKDA 4MYSA 4D4IA 3HJNA 3O4HA 5TDHA 3G88A 3NHLA 3BJEA 1NJ8A 2Q6VA 1NUUA 4QWMA 1XVTA 3G2QA 1RWMA 3C7AA 2WD9A 4TYMA 2OHGA 1LK0A 4LUCA 1KJYA 3GNQA 1Y81A 1JLLB 1ESZA 3HU5A 3IKMB 1WCV1 5H80A 2W93A 4F4IA 1JSRA 1V4NA 5CIWA 1SVNA 2OD2A 4HWKA 3EX7C 4FNOA 3COSA 1N1EA 3KBOA 5AXBA 3VU1A 4GIBA 1HNNA 4O2BB 2FX2A 1PJRA 3LQRA 5MGNA 4E46A 1UEIA 3K72B 1NG1A 4QUDA 5BW4A 5JXGA 4OHUA 4QOIA 3WDMA 5BRAA 2AUMA 1GHTA 4QBKA 3MELA 1E32A 5AOBA 3T99A 5EHZA 1RLMA 4GZMA 2FG5A 1M1XB 1H0RA 1W88B 3D5EA 3PNYA 5KWIA 3U19A 2XEDA 3NMUF 3KPVA 4AG5A 3U61B 4OLBA 1ID8A 3E8SA 3KE9A 2HW8A 9LDBA 1V2HE 2CNWA 1E60A 3FDJA 3HA7A 1HORA 1RRMA 1CLUA 1EUZA 1KPHA 2PU7A 3H4MA 5ELMA 1OYWA 4BDSA 2E4ZA 2H3EA 3U3RA 4CQJA 2QRMA 5L6LB 3AWDA 3AIOA 3TPFA 4BLWA 4MRAA 1IPFA 3CS3A 3DAFA 1GYQA 2Q2VA 2P2ZA 1FMLA 3ETHA 3TUJC 2C54A 4EYGA 4OJMX 1V3QE 3EPKA 4IOLA 3DAYA 5HPYB 2GARA 2RGWA 4IS3A 1H6CA 4XARA 2ZIWB 1A9PA 3GDFA 4JEMA 1APBA 3KZOA 3BFKA 2YRXA 1TOAA 1WY5A 4KE9A 4OPMA 1VPLA 2WAXA 3GFGA 3TXYA 5KCZA 5KOHA 5HFJA 1LPNA 4MW5A 1NAIA 4RK5A 1SD1A 4WOPA 3F46A 1C4OA 3AL2A 4JVSB 4LJYA 1ZD2P 5G4KB 5KYYA 1Q0LA 3N0XA 5A0VA 5TMBA 3CEAA 4XX0A 1O5OA 1MB0A 4MHTA 3OZEA 1B6GA 1N7JA 1X1EA 3FWZA 3LLMA 2QX9A 4ZJUA 1PFVA 4Q3EA 2Q6KA 1NMYA 3HVJA 4QTXA 5BPHA 2UYCA 1NI4B 4NJEB 1O94A 2NTEA 3OD1A 4JA2A 5FL3A 3OE1A 3AVTA 1X7DA 2Q6IA 4B40A 1T9KA 1B42A 1PT8A 3PZRA 3KZ1E 4B3GA 2D2FA 2M1ZA 1ZLXA 2AJBA 2FJ0A 3C4VA 3JCZA 4DC9A 1KDTA 3R0XA 3H2HA 3I9FA 3ZWMA 1HFEL 4FXPA 2JCSA 5DNVA 3N74A 4JVMA 1T8WA 5E9JA 3RARA 4J7XA 2HQRA 4LJ8A 3GGJA 2FFRA 4F0JA 3EFHA 3H5RA 4AQDA 1PR0A 4FFBA 4KHZA 1XKLA 1JECA 1M1UA 2DHQA 2PGXA 3A1EA 4NK5A 4TZ0A 1VSVA 5G53C 3TW4A 5ED4A 3G5TA 5CJJA 4CMEC 3L8MA 5FLKA 5SY4A 3ZD6A 3OX1A 2ZSBA 4TSRA 2Q29A 2BHRA 3N07A 3R09A 1ODSA 3GNSA 1JHUA 5KTPA 5LD2B 3OZFA 4MW7A 5TMDA 3PNOA 4CKXA 2RBGA 3IUMA 2BPOA 1FVOA 4LRTB 2G71A 4QG7A 5ITSA 5FYQA 2HDHA 3TXXA 1HYBA 2X0EA 5B3AA 6PFKA 2V7VA 1U0OC 5AM0A 5B3JC 2O59A 4LC9A 2O5CA 2CLFB 5DIFA 3HDYA 1YRBA 4D99A 4EVSA 5IVIA 1H1TA 4NYJR 3CLUC 1CIPA 3NB0A 3PQFA 4U7HA 3SBOA 4C6TB 5HK9A 1NNEA 3WLFA 1E64A 2WMYA 2EBWA 5FA6A 3OTOB 3A2KA 1QVWA 5AH0A 1I9GA 2VHXA 4CKYA 2CF6A 1KJNA 1N1DA 2QR5A 3KCQA 4L57A 3THYA 3OTHA 4Y6RA 2O3TA 1Z0DA 2XYPA 3NDJA 1G1MA 4IGEA 1M7HA 1TM1E 4C4AA 4G97A 3KWMA 1IOLA 5A4AA 7ADHA 5LA6B 1DC8A 2RGXA 2LCQA 2AIRA 5CT9A 3EIQA 5H8WA 3AG6A 3AXSA 2FEMA 3K0CC 1LRJA 4RADA 4P2BA 3PWKA 2ODPA 4DBVO 3VNUA 4W4TA 2NO0A 3EH1A 4IX1A 2NVUB 3ER9A 4BCDA 4YREA 1Z73A 1BMFD 4JI7B 2Q3HA 2ZJ7A 1NUTA 2IXDA 1Y5RA 2ENWA 3HL0A 3W5AA 4Z2AA 2LD4A 2ZBDA 4AN0A 1Q1BA 4EB8A 1GQSA 4M7RA 1A27A 4EOGA 5HUQA 4P31A 5BMVB 4E2YA 5GY7A 1G20E 1D2RA 3RAGA 4KEAA 5IXSA 1Q1QA 2IXTA 2QS9A 2GBFA 3ASZA 2DULA 3AY7A 4YJKA 1VKNA 4PGHA 4TL8A 4CV0A 2Q3MA 4RVCA 3PX2A 2H4YA 3RSZA 3ZGOA 4YLYA 4IINA 1GCGA 1S02A 1FRNA 2PLRA 1GPBA 3UQZA 1JEDA 3UOWA 4WA8A 1WO8A 3N76A 5FUQA 2JGJA 3EFBA 3PHLA 3HXKA 5P21A 2EKBA 3TB4A 4QPPA 3P9ZA 3P2JA 1DS6A 5ECDA 1CVRA 9ABPA 4HGYA 3QEMB 1ORRA 4NQZA 4NECA 3WGTA 4DEVA 4DWJA 1V4VA 2PS9A 4U3JA 1E2QA 4BO7A 3JYPA 5C46F 4D92A 5I4BA 1QHFA 1N25A 4QATA 1WMSA 2RHMA 2R0QC 2V45A 1QQAA 1IIRA 1BAPA 3H3FA 4ZZ2A 3NONA 3E6AA 4JYPA 3HU3A 4M86A 5I7AA 3HKCA 4ZVMA 2JG3A 1NXPA 1ZKDA 1HDXA 2OSBA 2AWNA 3AFHA 4MI9A 2D54A 1J8FA 1S2GA 5HILA 3TI7A 1R4NB 2CUKA 5AVUA 3RVPA 4RDCA 1V6SA 2FLVA 1D6MA 3M9LA 3HCBA 4UAGA 4DIMA 1XRPA 1EJBA 2VSNA 3DBRB 4AZSA 1XTBA 2W2VA 1JVNA 3FSGD 3AGPA 2EFEB 2VAMA 4IUBS 1R15A 3RS5A 2J6IA 1BKSB 2LUOA 1T2DA 1SU8A 2QTVB 3A9UA 2C5BA 4OOEA 4WK2B 3SAJA 4WH0A 2VTBB 4LVCA 2UV8A 3RUHA 2OPHA 1T4DA 1XOIA 1HETA 4AIIA 4RANA 3LCVB 1OI2A 3WLHA 3ZBUA 4PPFA 1PGQA 2O05A 2AOTA 2F7SA 3PBKA 3QW2A 4URFA 2W6PA 3VH1A 3ZDRA 3WGJA 4BEWA 5JLAA 2ODNA 3FCEA 5E9QA 3RIMA 4F5YA 4OMFG 3KU4A 3NRBA 5BNWA 1XALA 3WNQA 4BE7B 1XJCA 1AUPA 1ZZGA 2XUAA 4JVNA 5DGDA 3JATA 2E5LB 1YZ3A 2FDXA 3HA3A 1Z4JA 1HV8A 1SK8A 4U8HA 1GG9A 1L4UA 2CVPA 4BRUA 3UMMA 4Z4EA 3RC1A 2QRVB 4X6UA 4BLVA 1BDHA 1ZD8A 3JWPA 2XNHA 2O6HA 2ZRMA 4G41A 4L8FA 4UJ5A 5CX1A 3ZWOA 4BEJA 2G5GX 3FSRA 5BSUA 5CH3A 4XZ3A 1BZYA 4OHPA 1C9EA 2AKAB 2PWZA 1CFJA 4D80A 2JAOA 4AJKA 4Y2VA 1FJXA 4XD7A 4GBED 1E2JA 1JR2A 4JP2A 3UK0A 2BVNA 2ERCA 3PS9A 1SVUA 1TU0A 2PRSA 2GASA 3TQIA 2AJTA 1HZZA 4NPAA 4QAJA 4G4GA 4WVLA 4LXIA 5IVHA 2VDLB 5D84A 3SKXA 2PJRA 4ZRNA 3IV7A 5E4FA 5LOVB 1CEQA 3EAFA 4H6VA 5BT8A 1PYDA 2YMLA 1V5WA 2N1BA 2NG1A 4HMQA 2W6NA 1ZM7A 5FHRA 4QOEA 3DXFA 1Q5PA 3I2IA 4EHKA 3A9WA 4B1FA 2XADA 2AZXA 3T06B 3AP1A 3ZCSA 3I9KA 4NKRA 4GSYA 1R0KA 3AFNA 4OQMA 2D4AA 4P54A 3OMXA 3VO9A 2NNWB 3A6HA 2G77B 1C8KA 1MO4A 4H0FA 4N9WA 2FP4B 1BW9A 1YDGA 2C31A 2QY9A 3BWXA 4NCIA 4XWYA 4DQ0A 4YS6A 3P94A 3B5IA 2V6GA 4RJLA 4D45A 3WICA 6NULA 4V1CI 2D7DA 2WB4A 1G59A 1T26A 2GS9A 1JDZA 1K75A 2R8XA 3TAUA 5THXA 1BRTA 1LPBB 3F7TA 4EFNA 5L3QB 2ZYUX 4M8SA 4N7MA 3WLLA 1U0LA 4OHVA 7REQA 3RVRA 1ZMRA 5CLGA 4E5DA 1XTPA 4IFEA 2FWMX 4I1IA 4YNBA 2ZIXA 1Q7TA 5BWNA 4C5AA 3GLHA 4KR3A 2BHNA 5ALOA 1YDFA 2Z5FA 4B3IA 4JC4A 1L8AA 4NFYA 1ZXXA 4BMDA 3ROKA 4Y0VA 5CFMA 4Y98A 3I4CA 3OZRA 5F9HA 2PYIA 1TVCA 2G07A 1R9MA 1VGVA 2ZSEA 2ZYAA 4W6QA 4F8YA 1P9LA 2VK2A 1DBPA 3PLAE 1BEZA 2GJ8A 3UGJA 4D6XA 4YRGA 2QY6A 1OY1A 2VDJA 3O8RA 1F3LA 3V8NA 4KRFA 1QWSA 1QX4A 4BV9A 3P9RA 3RT9A 1ATZA 2OCKA 4OBWA 1MRZA 3FVRA 4OHBA 4FMCB 5ILGA 5GONB 4PWYA 3QWHA 3VR6H 3AW9A 1WEKA 4E33A 1JR3E 2P41A 2PQ0A 4M53A 4CMCA 3ICEA 3ZE9A 3WDLA 1Z5NA 3GH3A 3CCFA 1EFVA 3IVGA 5DHPA 3D3NA 1YJQA 1G5TA 1NYLA 2W58A 3LT2A 4RHTA 1Z34A 4D9HA 5TQVA 3REQB 3LG2A 1RZVA 1EUCB 2UUAB 4BYGA 3IAM1 1V1RB 3A4YA 3I1YA 4UXJA 5DEOA 4M0EA 4PNHA 1M1YE 2A1UA 1IXYA 4C4XA 4GQBA 2BFCA 4KUEA 3CM0A 1RTTA 4Y9RA 2AFHE 2CBXA 2REXB 4IZ6A 2Z2JA 4B6OA 4B71A 5JMTA 3PC6A 1JIUA 1NBHA 1DINA 4OLAA 1IBRA 4R3UC 3JALB 1T91A 3NORA 2YNMC 4PYNA 4LK2A 5JROA 5AI0A 2XT6A 5JS1A 3R6LA 4IDHA 4CW7A 4ZMBA 3THXB 1YS2X 3C7DB 1UJ4A 3LX6A 4P0PB 2Y3IA 3U56A 5LWHA 2QRKA 4MV7A 4WNIA 4P4GA 5DHRA 2GR9A 4EY4A 5EZ5A 3MIZA 3V9AA 2OD9A 4ERXA 1JG6A 1US8B 2IY7A 1R6TA 1YZUA 1JJVA 4S2EA 4EI7A 1ZOOA 2BFOA 2VSQA 2GPWA 3H6HA 3JRWA 4GXQA 3SOZA 5IT9A 1RLIA 4MIOA 1WBBA 4RU1A 3O8LA 3KQVA 3MA0A 2C57A 3EBLA 1MP0A 1K2WA 1Q0PA 2GA9A 3RJMA 2X8LA 2RGYA 4GS5A 2EKLA 2WIDA 4JL6A 1P60A 3L6OO 4F7DA 4JXZA 1KK2A 1WEHA 4ZC1A 1TUIA 2FFAA 1V26A 3KR0A 2OG2A 4FOPA 4PYMA 4WK0B 5REQA 2RGAA 3T9CA 2TYSB 1NUSA 5AJXA 2NACA 4GOOD 3VUEA 2E4UA 1XV5A 1ORHA 4LMBA 2QN6A 3LWDA 2QLLA 2C94A 1RDFA 1O9BA 5DM2A 5TPWB 3PT5A 3QEKA 2GJ4A 5AUOB 3GLRA 3CR8A 4WLNA 5DCWA 1EXVA 5F73A 5EEHA 4MVJE 4EKYA 2HEIA 3QQPA 3OUZA 5L6MB 1XD2A 1CEYA 3K2EA 2EZ4A 3HBJA 4KI7A 1MZPA 1R3DA 3A9TA 4X93A 5EKXA 3IBCA 1NJ6A 4IP0A 4OBEA 4NHEA 4F8EA 1TEXA 4KWHA 1M0TA 3F3SA 5T4BA 5D1NA 2XY4A 5L3RA 4CF3A 4PSVA 4DS3A 1G291 1E58A 5CFNA 4X20A 4V03A 3UHOA 2CXXA 3L8CA 4DCVA 5A9RA 4TTPA 3ME5A 2EEPA 2ZAMA 3WL4A 3SM9A 4EHFA 4O5AA 2ZJOA 4PLYA 4J1NA 4PCAA 1KWKA 1NJSA 3HU2A 3I0MA 1ZC4A 3NS7A 4B7AA 4D3XA 1YDEA 3BMOB 5FTMA 1UODA 2HIHA 1ZD1A 2VC2B 3K0FA 1E9BA 1Q77A 2WYUA 3FDXA 4NLLA 3DMHA 3TTUA 3W5VA 4BVKA 4DUYB 1EE9A 4INOA 3TRKA 2EZTA 4FFVA 4QPJC 2GZAA 2P11A 1GLGA 1PJQA 1F0NA 1CY0A 4D9GA 1UOQA 3IE1A 4YA6A 3OZGA 2Y93A 3PIDA 3DMTA 1ISFA 4NF2A 7MHTA 1C0EA 1X70A 1XZMA 4DA0A 2D74A 5ICGA 1ZEJA 4GPIB 1VSBA 1QLJA 1XFDA 3DM9B 3U7IA 4M54A 3A58B 3UMSA 2EV9A 1FS6A 1X87A 2F9MA 3KSAC 2XZLA 4IDEA 3KZKA 3HEMA 3WRYA 4GPEA 4WLUA 1YS7A 2GOYA 1G8AA 5JNUA 4CQNA 2AB0A 4JX9A 1U2QA 4MVCA 4GE0A 1Z35A 1Z2NX 1J39A 3DTVA 3IOBA 1HZJA 1L1QA 3H19A 1G3IA 4N5HX 4NDAA 4D9IA 5JRJA 2WQ6A 4J3JA 3BBPA 3HR7A 4MR9B 4LF6B 4OYYA 2JLBA 4HR7A 2IOFA 3O3OB 4UD6A 5EIOA 1EK5A 1SXJD 1W35A 1C4XA 4H7IA 4MS3B 1SQ5A 1T1EA 2IVFA 3F6YA 4K6FA 4LTDA 3SQDA 1RFGE 2BBWA 4Y6PA