4GE0A

Schizosaccharomyces pombe dj-1 t114p mutant
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
190
structure length
189
Chain Sequence
VKVCLFVADGTDEIEFSAPWGIFKRAEIPIDSVYVGENKDRLVKMSRDVEMYANRSYKEIPSADDFAKQYDIAIIPGGGLGAKTLSTTPFVQQVVKEFYKKPNKWIGMIAGPLTAKTSGLPNKQITGHPSVRGQLEEGGYKYLDQPVVLEENLITSQGPGTAMLFGLKLLEQVASKDKYNAVYKSLSMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein C22E12.03c
publication title Influence of peptide dipoles and hydrogen bonds on reactive cysteine pK(a) values in fission yeast DJ-1.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 71
structure length 189
sequence length 190
chains with identical sequence B, C, D
ec nomenclature ec 4.2.1.130: D-lactate dehydratase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ge0A00
3EJ6A 1R9GA 4B5KA 1GGKA 4P5PA 5LIRA 3BHNA 4E5VA 1C3OB 3OT1A 4UNIA 2A9VA 4GE3A 4B40A 4ENUA 3EFEA 1I7QB 3UMMA 2NV2B 1CE8B 2YWJA 1GPMA 2R1VB 3B38A 1PDWA 3PQ8A 4Y1RA 2VRNA 1GGJA 1QF7A 3L4EA 1P7YA 1PDVA 1GG9A 3EN0A 4P36A 4WXYB 4OFWA 4UCFA 3UGJA 3TTSA 1S1MA 4P2GA 4Y1EA 4B2YA 3PQ3A 1JDBC 4AUMA 3P9QA 4UZSA 2LXNA 3MGKA 1GGHA 2WJZB 2YWBA 4ADSG 1T36B 4JQSA 3PQ6A 3FIJA 1QWSA 4N0MA 3TTUA 3WFZA 4BFLA 3MIIA 1OY1A 1VCNA 1T0BA 1PV2A 3NONA 1FYEA 3P9RA 4RKYA 4UOQA 3UOWA 4ZDKA 4MTCA 1CS0B 1QVZA 1P80A 4ZDJA 1QVWA 4XLLA 2R1TB 3PQ7A 5K4AA 2ZUWA 4P35A 3SOZA 4GUDA 3TTWA 1OX4A 4OGFA 2ZUTA 4ENWA 5BV2P 5JZOA 3PQ2A 1GGEA 1SOAA 3B36A 4MGHA 3ZJ4A 2YWCA 4S0ZA 1K9VF 1I7SB 4OQ4A 4ENPA 1KWKA 2VPIA 3FSEA 4LRUA 4E08A 1M6VB 2VXOA 3M3PA 3R76A 3TQIA 4L8YA 3L7NA 4R7GA 3R74A 1GGFA 4ENQA 3TTTA 3OT1B 4L95C 1P81A 1QVVA 1U9CA 4Y1RB 3GRAA 1P7ZA 4BTEA 1IPHA 1BXRB 1OX6A 3L18A 2ZUVA 4UOZA 2ZUUA 1KXJA 1T3TA 3CZ9A 3SF8A 2H2WA 4AJ9A 5E9AA 2YWDA 2GK3A 2GHRA 2ISSD 3CY6A 1I1QB 2W7TA 3F5DA 2AB0A 4Y0NA 1VHQA 1QDLB 3N7TA 2IUFA 3NOQA 1IZYA 3NORA 4OGGA 2RK6A 2NV0A 4RKWA 1IZZA 4N12A 4LGYA 5JZMA 1C30B 1GPWB 3P9SA 3UK7A 4I4NA 3P9PA 1OX4B 3NVAA 3NOVA 1P5FA 4BIMA 4D1YA 1OI4A 4L7QA 3PQ5A 4L8WB 3TTXA 1WL8A 4ENTA 3ZR4B 3D54D 4I2NA 5SY9A 1A9XB 1CF9A 3B3AA 4OIFA 1L9XA 4AUEA 2R1VA 4ENVA 4ZGGA 3VU3A 4AUNA 1VCMA 3R75A 3CNEA 3KKLA 1KA9H 4ENRA 2AD5A 3TTVA 3BWEA 5DFAA 3SF8B 3PQ4A 5SYAA 1KEEB 2OR3A 5IP5A 4HCJA 4L78A 4I46A 3CZAA 1ONSA 2VKTA 1JVNA 2ZUSA 2VDJA 2XF2A 2V4UA 4K2HA 1G2IA 4PXYA 1Q7RA 4QYXA 4AULA 4ENSA 1KWGA 2R1TA 1OX5A 3TTYA 4QYTA 1SY7A 2FEXA 3EZGA 4ZDIA 2D7JA 1Q2UA 4GE0A 2RK4A 4Y1GA 2ABWA 1N57A 4OJYA 4Y1FA 4B7AA 3L3BA 1J42A 2R1UA 3RHTA 1VCOA 1UCFA 1O1YA 3ZJ5A 4WINA 4B31A 5SY6A 2RK3A 3F71A 3UJNA 3EWNA 3CYFA 4L8FA 4P34A 5SY4A 3ER6A 4MNTA 1PE0A 3NOOA 1FY2A
chains in the Genus database with same CATH superfamily
3WB1A 2HHAA 3GK3A 4C4TA 1MJGM 3FX2A 4IDBA 5EJ9A 1O0CA 3PX3A 1XTTA 2EWVA 4JX9A 3GVPA 4AIRA 2YC2C 4LE0A 3REQA 3IO3A 3LP8A 2PZLA 2A0XA 2J4DA 2VQ3A 4NBRA 3EVDA 3F73A 1KHTA 1YDGA 2EZ8A 2P9FA 4N6OA 2ZUBA 1GAQA 4WXYB 5IKXA 3DEIA 3LW7A 4UCFA 4HWSA 3A8TA 1DMRA 1KEWA 3OKCA 4IMIB 3JQGA 1VYVA 3KJGA 4L4SA 4TTJA 4M8SA 3LMKA 3PXUA 3ZE0B 2Y1FA 5CT4A 5KNDA 3N2EA 4JKYA 4HQFA 4KREA 1F9AA 4I19A 4UTNA 4G5XA 4AQ7A 1XTSA 1MIOB 1Z73A 2ZRHA 4JUFA 4ZCMA 3O2QB 1TB4A 1RI2A 3I64A 4RJJA 1O58A 1U2PA 3BA6A 4BX0A 1NP7A 4KE8A 3SQDA 2Q07A 1Y6FA 4XVCA 3OEHA 4J4HA 4JDPA 1RCTE 5EE0A 2EL7A 2QF7A 3C8MA 4C1NA 1N3BA 4D45A 4GOLD 3IDFA 3C97A 4FFPA 4KIUA 5IH3A 4AZ3B 2I6TA 1V9CA 3S2IA 2HA0A 3K8OE 4ZT4A 1XU7A 2GXQA 3UHPA 1N2OA 2ZRCA 4DAOA 4DLUA 4XDZA 3P9XA 5D3MA 3AUTA 1EUYA 4OOEA 4QPCA 3NT4A 4DE5A 3BMCB 4P33A 3JQBC 3LFHA 4RIGA 5AUNB 1VFNA 3RDPA 4N39A 1HI9A 2ZIUB 1XROA 3ASZA 3PD0A 1D8AA 2WMDA 3FRIA 4MGKR 4TMFA 1NWHA 1O0SA 1KS2A 2Z08A 4GO1A 4KOAA 3VR6A 5IUNC 5C4MA 1FP4A 1XZCA 3E5MA 2FH5B 5KNBH 1RR6A 2E82A 4WZAB 3RYCA 5ELLA 2BMWA 1IVNA 2MU1A 3TL6A 2BGWA 4L5CA 1NVVQ 1PR6A 3UWSA 3TZBA 1QZ3A 4X24A 3RVQA 1VRWA 2I6UA 2J46A 2QD2A 3E61A 3KWLA 4JP8A 4MMZB 5E1DA 3SNKA 4JP2A 5HIAA 3P94A 2IV2X 3PE6A 4CQJA 1RRMA 3OCZA 4YAOA 5TS2A 4EA7A 3W8DA 2WWFA 4O6VA 1L5QA 2HK8A 2FEPA 4OVKA 1QC5A 3KHTA 1TQDA 3D31A 5EA2A 5AXAA 2AUMA 1Y3HA 3UKJA 1Q14A 3H0KA 5JMTA 3L0DA 2Z6AA 4CKWA 4P2BA 2QAGA 1MDBA 3EGDA 3RTBA 4H7DA 2JZCA 5FPHA 1NLMA 3ZVMA 3K1YA 4MUKA 2IV7A 2Z04A 2C58A 1XD9A 2YICA 3TOZA 2GEVA 2JLYA 2OZPA 4G24A 4HYTA 3JQ7B 4MUNA 1JQLB 5GONA 4ETIA 3TG8A 2NYVA 4RC9A 1YFZA 3L8YA 5EWLA 1KVSA 1QUFA 4R0NA 4C5AA 2FKNA 4Q1DA 3VYTB 3RC1A 1SIWA 4EKDA 3BWXA 1AB5A 2X3FA 1W2HA 3VDRA 2I4RA 2W0SA 1IHPA 1NLZA 3V1NA 2YHIB 2GA8A 4HAYA 3WAJA 2D2EA 3AHCA 1E8NA 3M9LA 4JP3A 1CWUA 4BKOA 1G0OA 1HZZC 2WT8A 3DF9A 1I01A 2QLBA 3AJAA 4PVDA 5CW1A 2GZRA 4ZEVA 1DJOA 2RBKA 3HM9A 3RUCA 4BYGA 4DWJA 4UTPA 4D26A 1BMTA 1E2GA 4QRIA 4YQYA 3PGLA 3B8HA 2AFVA 4UE2A 2X0KA 4DV5B 1WUTA 5LZ7A 3UATA 5DOVA 2BGLA 3IUQA 3WYGA 3M89A 4HNVA 4WVFA 2PRYA 1BEZA 1UQTA 2R9VA 5JJCA 2J8ZA 1Z33A 3CH5A 3H5OA 4YAKA 5DV9A 4E94A 3U56A 3VHXB 3WWDA 3EYAA 4RF3A 1BDIA 4ZJUA 1V3VA 1XMQB 2ONJA 3ZE9A 2QSYA 3M5WA 3JQFA 5EJAA 3RUHA 4NU0A 3ZWAA 3KXPA 3KFXA 1UM9A 2HMTA 5L95A 5C53B 2M32A 2Q6OA 1OUMA 2J59A 3KJNA 3QEAZ 1CS0B 3TVYA 1N2CB 4CQMA 3B8EA 4UHDA 4C9BA 2PS0A 1AF4A 2ODWA 4W9MC 1XMOB 5EIHA 5M5BA 4OTZA 1Z38A 4UEQA 3VDQA 2OV8A 1NQVA 2Q7DA 2HIHA 4KIGA 2K2QB 2JIRA 4M49A 2DB3A 2ZJ7A 3DHWC 3LHKA 2AFHE 3D1VA 1XQXA 1QO0A 1LS1A 4MUHA 1M1NB 2RH5A 3TLKA 1K66A 1ULSA 2JAHA 2ZRQA 2C2ZA 2GZMA 1H6DA 1YB6A 5KX5A 2IXTA 1CUZA 3SEQA 3I1IA 1Z28A 2FSSA 3EDOA 3I9NA 3Q7QA 5EJGA 5JSUA 4BRUA 2OY0A 1QF6A 1BXRB 1F20A 5C18A 1IJFA 2R3SA 1CFJA 1OC4A 2GUWA 2ZQ5A 4INOA 2WWHA 2XCTB 5C8YB 1UEXC 1COWD 1LBTA 3FTCA 2OMKA 4PZDA 4DHWA 1P0IA 5E9JA 1EFPA 3D4PA 4TLDA 1AC5A 5AVKA 2CNKA 3SS8A 1BYIA 4PC7A 7AT1A 4X95A 5JSZB 3DONA 3U60B 4CTKA 3RHFA 3LA8A 3SZOA 3VH4A 3DE0X 1ZEMA 1U4SA 3O5AA 4M9QA 5C1PA 3A4YA 1XU9A 1EUDA 3HN7A 3UN1A 4B2PA 4FNOA 3EQ8A 3O1LA 1J8YF 3CU5A 1ZK3A 2JFGA 1SHJA 5CYPA 4D9KA 2XUJA 3FDFA 4J0FA 3T9BA 2QBYA 4Y2UA 5T41A 4K9OA 1RIIA 5A0TA 4EW1A 1V6CA 3I5AA 4QFBA 1EP1B 4UDNA 2HBQA 2BP7B 3NM4A 1AKWA 3SAJA 1SXJA 5CDYA 1OTYA 3C5WP 4R1UA 1TCCA 3TW0A 1J09A 4V0LA 5LQDA 5LQAA 1BDBA 2XKJE 1QIJA 3O31A 4YASA 1MVOA 3BT7A 3U61B 3FTFA 5G4KB 2UYHA 2UV8A 3ABQB 1XFAA 3N5CA 2V9PA 2VHXA 5CD1A 4XYEA 3F6BX 5DFAA 1NUUA 2G09A 2P9HA 4PYMA 4XZ3A 3N2GA 16PKA 1Q5PA 2ZR7A 3P0JA 4HWPA 2CV1A 2PHZA 4YJ2F 4BFYA 2GHTA 4FI3C 1KK1A 1RKBA 1HDYA 4V3BA 5AHRA 3JVEA 2EL9A 4QT0A 5DGTA 5J2TF 1LPOA 3W2HA 2J32A 3KYDB 2Y9MB 4O4HF 5AVWA 1RXYA 4LWOA 3ZX4A 2ADFA 2AN4A 5JVDB 2QTVA 3N59A 2XQVA 3LDGA 1YQWA 2F1HA 2RKOA 1NX6A 2OXRA 5CK4A 3D6JA 1I0LA 3WB0A 1RBYA 3IULA 1R3UA 3QLEA 1ISIA 1EE2A 3USCS 4ZICA 4AKTA 2GJAA 5KNCH 1E8MA 1UBUS 1VDZA 2AXNA 4G0NA 1I36A 3EFBA 1WTAA 2PUEA 3L07A 2A0FA 1RT9A 2BUAA 3EW9A 4HK4A 2R6FA 3OQHA 4LI3X 4D9GA 1QV9A 1MIOA 2IVZA 4QTYA 2DRIA 3DLAA 1V35A 2GN2A 4FKZA 1AV6A 4G09A 1Y98A 3PHHA 2FZGA 2X76A 2G1UA 1S3FA 1YS7A 4JU9A 3OE1A 4OXRA 3GEEA 1YOVB 3PDHA 4E51A 3QEBZ 3RVMA 1GRNA 3E7WA 3KJQA 4RKYA 5LZ2A 3EOZA 2PIAA 1EEXB 3JY6A 5FTWA 3U9SA 3N3AC 2BGTA 3FVVA 4Y2YA 2C7RA 1YH3A 5DCUA 4AZ3A 5D6OA 3I5MA 1BHJA 1O9GA 2RHHA 2C0CA 2D4AA 3CGGA 3FOWA 3KS9A 3O2JA 5IMBA 3W2IA 3UYLA 4D3SA 2CMHA 3NV7A 3FPLA 1FDSA 4A73A 2FRXA 1GGMA 1H05A 2H2GA 2N75A 2ZTSA 1JPVA 2QTWB 3H2HA 2AFIB 1E58A 3K0FB 1G60A 4IMPA 4V0MA 3RIMA 4Y2TA 2IV3A 3R9IA 5T8KC 4DQDA 1E1MA 4B6OA 1N2GA 4C5CA 4H7IA 3EIXA 1T1EA 4P0TA 2JJQA 1VSBA 2EJBA 1YQGA 1YE5A 1H2YA 2OQ2A 4QUAA 3A9SA 4F93B 2H52A 4QULA 4CM5A 4WA8A 4LF4B 2FLKA 2Q46A 4TRJA 4CV0A 4YN3A 3T5PA 3I92A 1VHQA 3TAXA 2PX2A 1GAWA 1HEUA 4MR9B 2HCTA 1PGJA 2C61A 2OXFA 1T5DX 2QA5A 2Q27A 2XB6A 4MCAA 1KJ8A 2H65A 4LGYA 5DI3A 1K75A 4ZJYA 5E7IA 5JZMA 1FDRA 4O3FA 1WVGA 5EUQB 4ZAWA 4EZEA 3K2IA 1T3ZA 2QNIA 3AR5A 3SXPA 5K20A 3KL4A 3PE3A 4XYMA 1N8NA 2AZ4A 4D57A 1T9GR 4KFTA 4NV3A 4BN0A 5KDOA 2ZM6B 4GPD1 1JXOA 5E8JA 5A4FS 4DBLC 1KAEA 3GV0A 3WK7A 2K5UA 3VX3A 2OOSA 5BW5A 3JWHA 4XCVA 3K5WA 3ZIAA 3RVRA 3M33A 1I1HA 2GCGA 4GUAA 1JIKA 3TQFA 2AWOA 5JHHB 4QZVA 1W5SA 3VU1A 4CMHA 2YWEA 2XRFA 3D6TB 3DUFA 4P3NA 1JEDA 4A0QA 4L15A 4KDFA 5BYBA 3B6IA 4NK4A 3WV5A 2GAOA 2IYOA 5B7NA 5IDQA 3KLPX 2PMEA 5A9SB 5BPFA 2PNJA 5JCOC 2NQ2C 4YB8A 2G25A 1P9OA 1RYNA 1ML3A 3OIGA 4JB8A 1NE2A 2E37A 2KBEA 2V7WA 4GOND 4HNQA 4DCJA 3P0RA 3PGA1 1N33B 1L0BA 4LVNA 1R6UA 4ZDIA 1Q2UA 2Y0EA 1MX5A 4Y1GA 3GUYA 3L0IB 3NAQA 3O74A 2JJYA 3SFTA 3BD9A 4B6PA 3HR7A 1REQA 1N0HA 1WXIA 3NEYA 1VG0B 4DNQA 5DX0A 4J3JA 1HQCA 1MB2A 3CLSD 1US8B 2PAFA 2ZRKA 3O3OB 2IHUA 1JIQA 1TQ8A 2J9RA 3FCCA 3FWPA 5BNFA 5TT1A 5AJTA 3NTUA 2NQTA 1LC0A 2YVLA 3KYCB 3IP8A 3I1YA 2YXNA 1HE2A 4F2DA 5EXXA 4NJEB 4OQZA 4YH1A 1RRKA 1JYEA 3D4IA 3K0BA 5FD8A 4OLFA 5FNVB 4YFYA 1CR4A 2XKAA 4ZD6A 3CLKA 1EZZA 4L22A 1BA2A 3STYA 3RV3A 5BSHA 1KK0A 2JASA 3NIBA 4ZZ3A 5IWAB 3C3AA 4Z4CA 3MUEA 5LL6P 4R7ZA 3FMOB 2ZYDA 4LOKA 4A0RA 1F51E 3VYUB 3QYPA 2R44A 1C7JA 1LDGA 3F78A 4HGPA 3VPDA 1JZTA 3RU3A 1GO2A 3NBFA 4REOA 3SMQA 3R6GA 2O2ZA 2X42A 5HJ5A 1U5BA 1VKJA 3ANNA 2RGBA 4NI5A 4PCUA 4C6SA 3V1UA 3T3OA 1EWQA 3QVWA 1UXKA 1RXVA 1K6JA 2EX4A 4HPWA 2BR4A 4LECA 4PC1A 2MMGA 2X3UA 3DDCA 4ZKDA 3WJAA 1JHYA 4B7UA 1TA4A 2IYSA 1NM5A 2LKCA 4WA7A 2YZNA 2Z43A 2HSEA 1BXRA 2WHPB 1DUIA 4Y6QA 3KXLA 1R1DA 1X8KA 1Z7GA 4HEA1 4G0OA 1Z7YA 3DFMA 4W63A 5HM6A 2ZJ1A 3L7BA 5CM2Z 5ENZA 5IJ0B 3FMPB 3NTOA 1PJAA 1CY0A 2WWYA 2WUWE 2WNIA 3FWZA 4R8KA 3CVUA 3Q0TA 1RVV1 3PP8A 3GCGA 1E2HA 4MHSA 4F7DA 2QXUA 3U0BA 4AIIA 4AJIA 1YQQA 2ES4A 1ZHOA 4D41A 3WSWA 2VJQA 2OSVA 1KO8A 1TU0A 4NBVA 4AB1A 3TEFA 4LX0A 4CFSA 3W5DA 1N0WA 2D13A 3AF4A 1GAJA 2MSEB 2VO1A 5FO1A 3O95A 4EITA 2XT6A 4LYHA 2JAOA 4CL0A 1RACA 3PF8A 3CPJB 4G5GA 2HMSA 4IDAA 4K5QA 3QVSA 2IYTA 3HL0A 3ZQJA 1YT5A 4M99A 4MQEA 3NAZA 2V6GA 2JFNA 4LOLA 4DYVA 3E3OA 4OQFA 5IVPA 2FSUA 2P7IA 2VYVD 3RC7A 3V80A 2DULA 3ILSA 1YQXA 3PUHA 1CVRA 1I10A 1L5HB 4MH0R 3D3WA 4EHBA 1A9XB 3AM4A 1UPFA 3EG9B 1L9XA 1WSAA 3VH3A 1M34B 3EWIA 5FWXB 1ZR2A 4M1TA 5CB8A 2GNAA 3HLYA 2B5OA 4KZKA 5C51B 4JOSA 1PTKA 2NACA 3CNEA 3V2HA 2E4YA 4BFXA 4JB0A 1E63A 3DHEA 4Q3OA 3M4JA 4A1FA 3C16C 4BQOA 3ANMA 1V26A 4GWGA 1G8FA 4L78A 2E3JA 3UH0A 1S9DA 4J1SA 3KYDA 3PNPA 2FJUA 2IT1A 4X61A 4PYNA 3FRJA 4B3DA 1S4MA 2C5GA 5JDIC 5DHPA 5FP0A 4O1MA 1KQPA 4R6WA 1CVIA 2P2ZA 3LYUA 3RC2A 3FPCA 3FOZA 5BSWA 2QHXA 2VAVA 1CDDA 4BJ6A 3FM9A 4J43A 1W93A 4LDNA 3WLFA 1DCFA 3AXSA 4XR9A 3S3TA 2I2CA 4JYPA 5FYQA 1KQOA 4AURA 1II8B 2FRVA 2FSGA 1GUDA 4CIWA 2GFIA 2I3BA 2QRVB 3HBNA 4JUIA 1PBTA 1PNVA 4UNIA 3TPFA 4BJHB 3TNLA 3OCUA 1C0KA 1EFVA 3R9XB 5CIQA 2I8LA 3AP1A 2ZSFA 1D7AA 3G5UA 2QP3A 2AQKA 3IKMB 1DQYA 3NWEA 4HGOA 2WP8J 2YFQA 4IUYA 4QPNA 5THKA 1XBTA 3GD5A 3Q3HA 3VAZA 4CIAA 3AOEC 2X7XA 4PZAA 1UUFA 3H5RA 5FO0A 4HNSA 4FS8A 4D6PA 1SVLA 1Y48E 2FFQA 4MWTA 4YIKA 3V1LA 3VTAA 7ABPA 2RGNA 1J0XO 1D4AA 4PZZA 3BYZA 3DMRA 2FDXA 1AKYA 2CL7X 3ISTA 5DTJA 4R3NA 4PLWA 1J9GA 4KNVA 4QJBA 4XLZA 3W04A 5FFFA 1GGEA 4JSYA 5I4BA 1WZEA 3EY4A 4B48A 1HA3A 4ILEA 1ND6A 4OFZA 2BFEB 3F74A 4NVRA 3Q7EA 1EMDA 1ODFA 1S01A 2AX3A 2XJ4A 4RPLA 2ZIEA 4R7GA 3TBFA 5JD6A 3A6HA 5C34B 3TDMA 4MPRA 4AS1A 1W85B 2JHFA 2BGGA 2WT4A 1MQSA 2WWVD 4MYSA 1PLKA 4TTQA 5F23A 4WJZA 1G4HA 3HC7A 2D00A 4UUAA 3VXKA 3AL3A 3BREA 3SYTA 1JFVA 2OXCA 1V1MB 2H0RA 1JIJA 2MSDB 4YJKA 4IH1A 2NZ2A 4AO6A 2PYZA 1P1KA 3ZD7A 2LW7A 4MUEA 2HA2A 3WLRA 4DA4A 3ZY5A 1WE2A 4P8RA 4C08A 2VHTA 3SQNA 4ZO4A 4B84A 4B6QA 1NMEA 3AT1A 3OQJA 4YJ3F 2OPHA 1E3WA 1Q7BA 1MENA 1MVLA 3WGLA 4OHFA 1KVQA 3ZWPA 1EUZA 4JJGA 2AI2A 3TUZC 4O4JF 3HKBB 2RCNA 1CR0A 2FN4A 2Q1WA 2Q2NA 3GXBA 3Q8XB 1KJJA 4YXWA 3LKDA 4HDOB 4C3ZA 4REQA 1EGQA 3OTWA 1UJ2A 3JD0A 1PFGA 3KCNA 3SE7A 1NXXA 2JBHA 1YKGA 2XNKA 1PWXA 1OPRA 1Y9DA 3EMVA 4PZLA 3KHUA 2FSHA 3ME5A 5FOXA 5AK4A 3VGPA 3IO5A 3H9CA 2X0IA 3OZGA 3DXZA 1U6KA 3AILA 2NQ8A 3N0WA 3U1TA 5JNSA 4FEYA 3O8QB 1CF2O 4I4TA 1Y1RA 1EJ2A 5IG2A 3ETLA 3PUKA 1XDUA 4ZEMA 3FOEC 3AONB 4XB2A 3D6HA 2QVYX 3HFGA 1PFYA 2VVTA 2WIBA 4GOKA 3QWIA 4BECA 4WKNA 3N6VA 2AFRA 1ORTA 2AJBA 3H99A 3SIRA 5LSAA 4NMMA 4NENB 1ZI9A 3W7AA 1TZBA 4TVSA 3DDUA 1US8A 2X2OA 3HUFA 1XB2A 4XJVA 3RF6A 4AKHA 3IDAA 1QHXA 1Z82A 5ILGA 2NXNA 1X1DA 5EHNA 1GEGA 3L46A 3U3XA 2RJNA 3ENKA 1KFKB 4NJEA 4PQGA 5F7ZA 4QKQA 2C2HA 1R8SA 2I99A 1UKVY 2FR8C 3AY7A 3NNNA 1X77A 4INJA 4O0MA 3COVA 2JIBA 4JGBA 4YK7A 3ZXIA 5K5EA 3TPCA 3BDIA 5CT8A 1ZPDA 3WWCA 3ZK9A 1KKLA 5K6RA 4MS4B 2R8YA 3T9FA 2FLWA 3L8HA 2EIXA 3P0HA 3ICEA 4D4MA 3ND5A 1EM8A 5DEIA 1V3TA 3UJ7A 5FTLA 3THXA 4ARZB 1E3TA 1Y1QA 4Q1AA 1UAGA 3VR5D 4DMKA 1G42A 2R7AA 2WF6A 2WJZB 2IUTA 4LDQA 2KYRA 3AYXB 1QIGA 2Q3LA 3ZE2B 1R74A 4ZVLA 4MS3A 3ZGVA 4ALIA 1SXPA 3GGCA 3IXLA 4FFBB 3MPUA 1NJ1A 4BMPB 2JPDA 2P6OA 1PQYA 3FZYA 3GB9A 1G21A 2XAUA 4IIBA 5B1IA 4YRBA 1YCGA 2HPZA 4NNPA 3L05A 1SU7A 1W2GA 2Y0DA 5COAA 1JV2B 3WTCA 3CRQA 1A8QA 2ZWMA 3C43A 2C7VA 4BMOB 3U5TA 1GAXA 3VHLB 4JC5A 2YXBA 2CMFA 3GU3A 3LDAA 5DCYA 2ADMA 2QY6A 2C1ZA 2BH9A 5H3HA 3REOA 3WTBA 1ZI6A 4G8BA 4C29A 3O83A 5HYVA 3PLAE 4OJQA 3K9LA 4QREA 1V5EA 1JDNA 2DWCA 1M5UA 1QBGA 2SKDA 2C2MA 5G0UA 2IIVA 2O3RA 1U28C 3H9GA 1R5OA 1P0MA 1L4MA 3A4MA 2ZUVA 1IXKA 4ASUD 2AG5A 4UVHA 3PDWA 3W8EA 4P0QB 3A9CA 3N2NA 1HE3A 3ZKAA 2ZRLA 4Y9SA 1FTYA 4B6FA 3F7OA 3ZWQA 4Q9HA 3FR7A 3CKYA 1AGRA 2GAFA 3RTGA 1FX0B 1JRLA 2FEKA 3CA8A 5AFSA 5DBIA 2B30A 1G7SA 1XTIA 1QZXA 1DLIA 1GLGA 2QD1A 2VJLA 2ZJBA 2DTEA 1JIUA 2O3SA 3H5IA 5EGNA 3HGTA 3M4ZA 3UUEA 1B8VA 4F96A 3DGFC 3BCHA 4CTOA 4FWTA 4IIFA 3VX4A 4Z2YA 3N6RA 3BXXA 1HSZA 1MGPA 1DKLA 3F5SA 1PT6A 2YVAA 3NVAA 3OQNA 4ZCRA 2XF8A 1RJWA 1XLUA 1RFGE 2Q8PA 3PPIA 1O87A 3T7KA 2X6RA 3NRCA 4KO1S 1KHHA 2QENA 4UCWA 3BMQA 4I1RA 1E2NA 1HKHA 3PL5A 4BKRA 5BUZA 5HRAA 4UPDA 4AUEA 4CYMA 1UK8A 1GD1O 4PYQA 1ZONA 5MGNA 5AW6A 5TMBA 3B6KA 1E64A 4EJ0A 2AJ8A 1G8GA 5CM8B 5G1NA 1PR9A 4M6WB 3KKQA 4PSCA 2VS1A 3NHLA 5T3UA 3X3HA 2X6TA 1LTKA 3QW2A 4GC9A 5KU7A 4HPJB 1A0OA 3AQIA 4DCCA 3V1YA 2LCQA 5IABA 2QL5A 3B6EA 4HGRA 1U04A 3TOXA 4TTAA 4LDPA 3EZXA 5T57A 4H16A 3KM0A 3L49A 1A3CA 3G8BA 3K9CA 3DFZA 1IQUA 3GN1A 2AOTB 3AI2A 5KSYA 4DCOA 3JPWA 5DYYA 4MKGA 1AA9A 1LPMA 4Q3CA 1NVMB 4TS3A 2JAXA 1WOYA 1Y3DE 4EF4A 5KYYA 1CUWA 4P38A 2FOIA 3C41J 1K5PA 4ZEOA 2NXEA 4LZZA 3S27A 1HNZB 1YZYA 4A15A 3R9XA 1CQZA 2BEUB 4MEJA 3A11A 3QQ5A 5DIFA 3CRW1 2PY6A 2WWWA 3L0SA 2VFAA 1LV7A 1L1RA 1XGKA 3BULA 1K88A 2PVSA 4RL4A 4BATA 3JAWB 3OX2A 1EUCB 2HV8A 4NYMQ 2WU1A 4BZWA 5BMOA 3LY5A 4BO7A 1SBIA 5J4KA 4OP3A 5ER6A 4BP3A 4FJ0A 2K2WA 3AOGA 3EEQA 4NCHA 2OCPA 3M81A 2HN9A 4UNQA 1E60A 3UW1A 2VPTA 4CLEA 2IOFK 3UC9A 1RWKA 1X39A 2KSQA 4CFZA 5KOYA 1DNPA 5IBRA 1GYQA 2DHQA 5CGZA 1R6AA 2HLDD 4QYIA 3L4KA 3GFBA 3GPIA 3EVBA 1T1IA 1ABBA 2BEWB 3PC7A 1C1XA 4MW1A 2LE0A 1P72A 2Q2VA 4P9NA 4G1UC 1B8UA 5KYXA 1P19A 2V03A 1I94B 4PZ0A 2Q49A 3F8SA 4FT2A 1E6CA 3OECA 2LPMA 1LQTA 3DE3X 1AGYA 2PIDA 3OIVA 2PKXA 3G7SA 5JJBA 1ANKA 2QOEA 2IS4A 1J24A 1KI6B 4OQLA 4C43A 1XRLA 1W87A 3NCHA 1PEAA 3LNTA 5T6BA 3HWX1 2QD4A 2RDMA 1ECJA 1T0UA 3V1MA 3PRJA 1VL1A 3R74A 2WR8A 4DJ5X 2BTEA 1RNLA 2NYUA 2P6MA 4UM7A 5CIWA 1F8GA 2DUWA 1A5BB 2D1SA 4UMFA 1XO1A 4Q66C 1GT91 2E7ZA 3CX6A 1M3SA 5HMMA 2APJA 1KAHA 3P1JA 4XX0B 1E7YA 5ALEA 5IK2A 3U7QA 4ZJPA 3T0IA 2G07A 3C98A 3K2BA 4PIVA 2EHDA 4OBBA 3MTQA 4KQXA 1M6NA 2R7MA 1RXSA 2ILTA 1X1BA 2YWXA 5B1DA 5AJVB 4ME6A 3U4DA 2RGWA 4DC0A 5FR1A 4DOMA 4B44A 3HI4A 2UVPB 3WP0A 3EEFA 1UBHS 4QVIA 4S1TA 2VL7A 3QX3A 3PJDA 1OYYA 2HOQA 4G23A 3D54D 2G9ZA 1Z5NA 3QPBA 4IJWA 4JQOA 4PSKA 5LMCA 2GN4A 4XDGA 4Q1BA 2F8LA 1U0NA 3HH8A 4AWXA 1Q11A 5C1OA 1VHDA 2YMLA 2Y4NA 1Z7BA 4HEA6 4NESA 5D3KA 5JWRA 4S1PA 3WLMA 3CMCO 3GG2A 4WLOA 1I2MA 2W2NA 5L4NA 1K86A 4B8WA 1U7WA 1HE8B 3KB1A 4C20A 1XFDA 1SVKA 3NJRA 4RO0A 3GEGA 1EWYA 1DARA 5DNDA 1P61B 1XVAA 3VZCA 4CCSA 3EQ7A 4HEQA 4Q3DA 1DBPA 2QAIA 4RSMA 1P3DA 2R7LA 3ELWA 5D5QA 3EAQA 4PC2A 3M34A 4D0NA 2NTNA 4EI8A 4E14A 3O84A 3BL5A 4HUQB 3B1KA 2GBIA 3EOAI 4IFBA 3OVMA 1PS8A 4C01A 5FI3A 3GPBA 4J0EA 1M1ZA 2M2IA 2VA8A 4AF8A 2XIQA 2JRLA 2PH1A 2OAQ1 2WHYA 3JU3A 1MC8A 1PQ4A 1PT5A 3FUTA 3A4LA 2QRKA 3EEYA 4BNTA 5JS8A 4TWAA 3O8DA 4OH7A 4L5AA 1XRMA 4NCNA 3H0EA 3CPHA 4F21A 1FNMA 2GCPA 2COEA 3WX0A 5HM8A 1C0IA 3UMMA 5BOVA 1M6YA 1A9RA 2YWJA 4V3CA 5F5XA 3KQQA 2PVPA 2HPVA 1PR5A 1OYOA 2RAPA 4OYRA 4E6PA 3N6XA 4LHSA 1R2QA 1GQRA 2HNBA 2IZ5A 3TLBA 4Q7QA 4R68A 4R7TA 4GP7A 1FS5A 1UPCA 1X1EA 1ONOA 3GLHB 5TGZA 5F3RA 2CHEA 2N1MA 4DLVA 2RJOA 3D6NB 1RHUA 2RCYA 2ZIFA 3N07A 3R0JA 4D0SA 1GRQA 1L4GA 4DV1B 1E2JA 3TTUA 5DHTA 1LC3A 2O9JA 3N9IA 3RO7A 2JLBA 1I8TA 4ERXA 3UJBA 4H3KB 3AWIA 4PEVA 3T35A 2WJIA 1T5OA 4G84A 3UOAB 5LIPA 4Z1OA 3FFAA 1E1CA 4IINA 1XTQA 1U9ZA 2VNAA 2F43B 1KMIY 1RPAA 2C94A 1GTL1 4OXYA 5K4AA 4ENWA 1JLLB 5A5DA 2V0NA 5B55A 5TQ0B 5IZ4A 3HWRA 4H3HB 3HUUA 1JKIA 3NHJA 5ALLA 3ZWNA 4B76A 5JNLA 3WBKA 4OMCA 2H08A 2WNSA 3K2QA 4NHOA 5I7VA 1E99A 3ZTTA 3SVTA 1FP7A 5FOVA 2GCNA 4HB3A 5EGSA 5AVXA 2A59A 4U6NA 4BV3A 1FDWA 1I3NA 1R9MA 2FR1A 3A1CA 1OAOC 3DLCA 3R3UA 4UTRA 2EDCA 1NBIA 3DMFA 2IGTA 3K6KA 2OORC 5LZ5A 4PYIA 1EE1A 1DX9A 3BK1A 4BEWA 1QQAA 2BSQA 1TXGA 3K4HA 1UWLA 4MB2A 2OFFA 5LFAA 4O08A 1CUXA 3W9BA 2VAMA 1LTHR 3ZBQA 4Z54A 3IPCA 1BNCA 3DF7A 1DIOB 4I6JA 1LW6E 3E18A 1OCEA 1AMUA 3RKRA 1G3UA 3B2EA 3ZY6A 4M98A 4UE3S 1SU8A 1QLJA 1H4VB 1AKRA 3EZFA 3HJBA 4LG1A 4QOGA 3HFRA 3ZCRA 1E94E 4TV8F 1ZCBA 1XTVA 4R05A 1E1QD 3G88A 2Y1XA 1N5LA 1ECCA 4RNCA 3MELA 2IH4A 2CSXA 2RHJA 1OV6A 2W6JD 3UT6A 2HJSA 3ZZ1A 9ABPA 1G59A 5BUSA 1NW5A 3FLMA 1FXSA 4QICA 5ALMA 5DULA 3U2QA 1TW3A 4TWBA 4WK0B 4E1BA 1TYBE 3F1LA 4R8MA 1UBKS 1X7YA 2CXHA 4HI0E 1Q1QA 2BJHA 5HX7A 3RLIA 3TQOA 3VU0A 3CLVA 3GFFA 5DMHA 5C31A 2CUTA 3T15A 1SUPA 4B46A 4DLAA 1L7VC 4YWHA 3A3PA 2NXCA 1UMBB 1OILA 3K30A 4J4BA 5HF5A 1WCV1 1FK8A 3D4OA 3OA0A 2K87A 1JLKA 4H18A 2IU3A 4ZI2A 2YV3A 4XOUA 2I6GA 4BWGA 2O2SA 4HLCA 2RK4A 2QL9A 1UBFA 3GT0A 1I5OA 1IM5A 1WIWA 4FS3A 2B1JA 5TB5A 3D8NA 5ARCA 1KZ6A 5ABPA 2Z1MA 5J3JA 4C2TA 1EUCA 3NBYC 5IRCD 1H5QA 3LP6A 1GTSA 1S2NA 5IX8A 1PDOA 1UEJA 1W9MA 1Y5RA 2X14A 2YHBA 4US1R 3VKUA 3WHLA 2F8SA 1XWIA 1GNLA 3W1EA 5TPWA 3D4LA 4B2LA 4JL8A 1NVVR 1NC1A 3ZCQA 1DTSA 1T9CA 2PWYA 2NUPB 3G7NA 1A82A 2VRNA 1QF7A 4WNAB 5FCDA 3RSOA 4I36A 4JI7B 2ZRNA 4S3MA 4ENTA 1S1MA 4Y7DA 3PHCA 1JBQA 2WSSD 2I67A 3M6WA 5JAMA 4JDUA 3L0YA 1UK6A 4FZ3A 3RFVA 2JIOA 3CEPB 2PR2A 4TL6A 3T3PB 2XMDA 5CA1F 1QVZA 2GCEA 3DCNA 3EIWA 1EFKA 3LUKA 4FD3A 4N7JA 3ZGNA 3IRVA 1UPUA 2KMLA 4M9RA 4M3NA 1ZD3A 4CF7A 3TCNA 1YI8A 3FOAA 1JEEA 4O2AF 4PQRA 5IXYA 5JWOA 4UMDA 2AZMA 4MVJH 2IHTA 3I28A 3IKLA 1HYQA 3OAAD 2OBLA 4KQ1A 5EI5A 4GMGA 1KXZA 4J6EA 3S7TA 4L8YA 1SCDA 2PQ2A 4HL6A 1NAHA 3KK0A 4IVPA 3TZEA 2HF9A 4ATNA 3TN7A 2C3UA 2COKA 3K05A 3OMXA 4WUTA 1XVTA 5IU6A 1EVYA 3MERA 4UUOA 3UMJA 4Z4QA 3U44A 1DCTA 2PQ6A 3VR0A 2IYPA 3M3DA 2P0AA 2YNMC 2YJZA 3AR6A 2Q1UA 5ALNA 4BNHA 4ZMSA 1Y42X 2G0AA 1AH2A 3DR5A 3VDXA 4DT1B 3IP9A 3OQPA 1K6MA 4E5MA 4PG5A 4OSEA 1Z6AA 2VZ8A 4K9PA 2FKAA 3T4PA 3VNQA 4QNMA 2R87A 3N2LA 4Q7JB 1QH0A 3T7JA 1FOEB 4JYAB 1Y1KE 1L5GB 1ZJWA 3L5OA 2DLCX 3GT3A 1XZGA 1XNGA 1ETUA 5DHAA 1II0A 4JLOA 4TROA 2NO9A 4LHWA 1RJ9A 5ILOA 3HVKA 1NIJA 4N49A 4PBSA 1NXTA 3M5CA 4A10A 1TE2A 3WO1A 1QH8A 4IIUA 2HJHA 3PXDA 4MVWA 1U8XX 3UT0A 5IYZB 4BZXA 3ZHSA 4X3OA 2AC7A 4IZOA 3I83A 1BQEA 4IX9A 1YZKA 5CVTA 2ZVPX 5KBYA 2OD2A 1H23A 4QE3A 4QXOA 1T2VA 2JKZA 4I4IA 4Q7MB 2ZKLA 4L5BA 4HUQA 5FUWA 3L7CA 4KP7A 2LR0A 5M29A 2E87A 3FWYA 1U5CA 3MWDB 4CEHB 2FWNA 3ZIUA 2Z1NA 3GXOA 1YZVA 1ZM3A 3ZDCA 4KXLA 3L8GA 3UENA 4WKCA 2A1IA 5LYYA 4EA6A 2L69A 1I80A 3URMA 5B57C 2DYKA 3HKDA 1T9GS 3IPYA 2QMUA 2XOKD 2ZQZA 3AP3A 3QG5A 4Q7EA 2H7CA 2O4CA 4HAZA 4ZN6A 1PR1A 1NC3A 1IY2A 1EX7A 2JGFA 5DN6A 3VR4H 3QX9A 1J5EB 1QZTA 4OAOA 1COWA 1WKCA 4RADA 3TECE 1QMPA 5E7MA 4HWGA 3PWZA 4MYRA 1ZH8A 1KL7A 4OHWA 5EUBA 1N3IA 2EP7A 8AT1A 1OXXK 1IXYA 2NV2B 4KJZA 4L3OA 5B7GA 4IMJB 1XJ5A 3KJFA 3KO8A 2CNNA 5B53A 4BU0A 1BE8A 3WLKX 1K3UB 4CKEA 1U9JA 3KR0A 2H1VA 4KJXA 4LZPA 4MYTA 4UEOA 4UW9A 3W5IA 2O5EA 3D3KA 2REOA 2GN6A 4URUR 1LBQA 1P2GA 2VHZA 4UCQA 5J4YA 1A5TA 1OF1A 1U8CB 3LT4A 1N5OX 4XR4A 3VTZA 4ZJZA 5BN5A 2Q1XA 3LT5A 5FUXA 1QWSA 4UKDA 3HJNA 1T2FA 1JB9A 2DLDA 1U6IA 4QEDA 3MJ4A 3IJRA 4KQCA 2NU8B 3Q3EA 3T61A 5LYJB 2C20A 5ELMA 3HXOA 1T9ZA 4C7BA 2HIMA 3FBGA 3S1AB 2VEOA 1VA4A 2H8KA 2BFWA 3KB6A 3RNOA 2ONYA 4PG7A 5GOZA 3R7LA 4JJ8A 4BB9A 1RVDA 1QE3A 3FY4A 2A58A 1PL6A 5GJBA 4OO3A 2W2OA 1UADA 1ZGZA 1BGWA 2VPIA 3URKA 4HXGA 3VZBA 3WQQA 4AP6A 1E18A 3ETEA 3ROTA 2QR3A 4D4JA 3PGJA 4YHHB 4NNOA 1CXZA 1T26A 4URYR 3F6CA 1FPMA 2DWQA 4JASB 3PNVA 1KYXA 3MXOA 1Y37A 1OX6A 1KP3A 1HT1E 2ZE7A 3KALA 1YE8A 2RAVA 4WKBA 3T7IA 4DDMA 1EVQA 4MYDA 3SF8A 1IIBA 1T9BA 2J5QA 4POOA 1SD2A 3JQCA 2JA2A 4LYFA 4WDQA 4YMIA 2YC4C 4JJZA 1OMOA 4M7PA 1RWQA 1SELA 1PHPA 3BF8A 1T24A 1TDJA 2V96A 3DOFA 3HADA 4KQMA 3AHIA 1IZYA 1SC9A 1SKBA 3JYQA 3ADPA 3L8FA 3QBVA 4Y0VA 3K0CC 4LOIA 1SCAA 4TYQA 1A72A 3E0XA 1AN9A 1CUYA 1RLIA 1GDHA 1R6TA 1UXIA 4JBHA 4WBXC 4GI2A 3HNRA 3RUPA 2C2BA 2BSXA 5LA6B 4BIMA 4NXNB 1SKUA 1PVVA 4AS3A 3OQOA 1OJLA 1Z0JA 4L50A 2AXEA 1S8AA 3PGXA 3MJDA 3KVOA 1OLOA 1KGSA 2CUZA 1Z6PA 4NMXB 4ENVA 4FQ8A 5B2EA 3E8XA 4II7A 3SEAA 1G2PA 3P27A 1XQ1A 4J1NA 1G8YA 4YRAA 3HK2A 4X54A 3W9YA 1FSFA 1MN6A 4LI0A 3KQHA 5LKAA 1N0VC 1PKXA 1ZFNA 3C1AA 3CZAA 1LBIA 1M76A 221PA 1VJ1A 4IFIA 4MOWA 4ZHQA 4ZYUA 4RF4A 3JR3A 2DBZA 4Q34A 4XPIA 5MN6A 3V34A 2HRCA 4YROA 3O8RA 3LWDA 1F7UA 3TIVA 3DVRX 1O4WA 3VV2A 5CH8A 1CRQA 4KITB 2D7JA 4DLRA 1TTQB 4MEBA 3ICWA 3IOMA 4S24A 4MX8A 5NLLA 1EVZA 1GKIA 3NVDA 2A9QA 2PTGA 2XYVA 1HQKA 5JJ5A 1ZNZA 2P9ZA 1LJ8A 2B4KA 3EULA 5EWMA 3UT5A 4WNAA 2A5JA 3KZCA 1CZHA 3EZLA 3DYIA 3LCVB 4LRTB 1ZJ5A 3HCNA 3G1UA 1NIPA 3V7NA 3PNLA 3ASUA 4GE3A 1QP0A 5J40A 2O8FA 4QM7A 2F4NA 4Z7OB 1NKTA 1ECFA 1RJFA 3YASA 4EYQA 4AROA 4WJLA 1M8PA 1C3VA 5MF6A 3DTVD 3DYBA 4RVGA 5AOVA 1W1WA 3WK6A 4P54A 1K5DA 1RKXA 4WK2B 4FZJA 4K7JA 1RPNA 3QUAA 4PINA 3S2EA 1NLYA 3UWMA 2O8BB 4KV7A 4I3GA 2B8JA 4OBXA 3MIIA 1KIAA 5BVGB 1T0BA 1WTCA 3LY8A 3ZNOA 4TMWA 3A9TA 4ED9A 1QGUB 4O2BA 4X3PA 3C7CB 1QYXA 2XRMA 3R7SA 4XLLA 2PX3A 4HDNA 4CUKA 2JLZA 5HMLA 3W7VA 1D0SA 3ZWMA 1OWLA 5BRAA 3HDTA 4W8HA 5IJAA 3RTEA 3SXJA 2QE7A 2ZSBA 2TECE 4CQNA 4WACA 3ZJ4A 1LDMA 4PPQA 4Q1CA 3PX2A 1C0PA 2YWRA 1YVUA 4KVGA 2HSGA 1CQXA 1Z83A 4WECA 5DNVA 1KDOA 4R9VA 4MUMA 4OJKA 3C6XA 5BURA 5FUMA 3GHYA 1XT6A 3TRDA 1U94A 3NYIA 2F48A 1Q1AA 2OCXA 4XGKA 1QCDA 1VKNA 2YV2A 3I9KA 1ZA2A 5CFOA 3SPXA 3IA7A 3C3BA 4M0KA 4F9GA 2XMRA 3A3YA 3BIOA 1W88A 4ZOAA 3PTAA 3KYIB 2G67A 1O9HA 1TM3E 5D51S 5A7GA 3U7JA 3UFXB 3N70A 5TE9A 1F6WA 1C29B 1AKQA 1ECGA 2G4LA 3BJRA 4QTXA 4PYRA 5ALWA 2CV2A 4QBFA 1AKTA 4F2PA 1E0AA 3QM1A 1OHHA 1CEQA 1MRZA 1W1IA 2ATIA 3TIGA 3NPMA 4QUKA 4QQNA 4XGRA 5TY0A 4XQEA 3EUWA 4EY3A 4M21A 2ODBA 1F60A 1WA5A 3CRRA 1NMSA 3DB1A 4PG4A 1GPNA 5JEDA 3CISA 4MPDA 3A3KA 4A0FA 1YL7A 2HFKA 3ZJVA 2WWIA 4LQCA 1X80B 2J9GA 2YBEA 3IUEA 5HOQA 2HCRA 4GSYA 4HQOA 2L2QA 1JEYB 1LLCA 1P7VA 4PG6A 3E35A 1ZI8A 4MIOA 4PIMA 2OYRA 4D7AA 4DCUA 3QU2A 4CTNA 2CWDA 3CTMA 2VTBA 5CJPA 4IDDA 3ZR4B 7MHTA 2PWBA 1IATA 2YV5A 4M76B 1NUHA 1DAPA 1KIMA 1MO3A 2ISQA 3UK6A 4F6RA 5KTSA 2P2LA 1NF3A 5ILQA 1BX0A 2Z3VA 3B5JA 3R7NA 3WDMA 4ESEA 2ETXA 2WFLA 3AKCA 1Q84A 3DEZA 3IGFA 4HEHA 3ZU4A 1E2KA 1NBMA 4CQLA 1IRXA 2H2HA 4RTPA 2A5FA 4JLVA 5DWQA 1NA5A 2ZB2A 3BQNB 5DT9A 4YBZA 5IN5A 3BWYA 4G0WA 1TMGE 1T36A 2WI8A 3Q7IA 2VZLA 4MAMA 3M4NA 4MV5A 4K3VA 5AKGA 4D97A 4UXHA 2NT3A 3MCAA 3IXMA 1QRTA 2POQX 2VT3A 2HZ7A 2Q2OA 4ENSA 3UPTA 2V97A 1E3MA 4EA9A 3TD2A 1VMDA 5DW0A 3ZE8A 4ZCLA 4BGIA 1C1DA 1SY7A 3HCPA 3OKAA 2XV1A 4H17A 1C7EA 4HLDA 4TTSA 2O2XA 4E07A 4JK3A 4KR3A 2XITA 3I34X 2PT7A 1YU9A 2AJTA 2WM8A 4XAQA 4Q93A 1YMVA 1PT9A 4NE7A 1IN8A 3CYFA 4RACA 5ANRB 1IOZA 5CRIA 1FBNA 2RONA 1XZNA 4IEIA 1ZVQA 3ONEA 2ATXA 2CGEA 4LE2A 2VSQA 4RJIA 1VIVA 1WDWB 4C0SA 3OT1A 2FPLA 2C8JA 1O7JA 1P1HA 2Q8NA 3NBXX 4YPFA 5K3BA 3SYKA 4DG9A 2C4VA 1FA9A 3B60A 3BTUA 3SC2B 4D46A 4EHLA 4DA0A 4R2JA 1K97A 4DJTA 1UKYA 3DCIA 1D2RA 3I6BA 2C4WA 4J0DA 3K0AB 2LXNA 1XF1A 2OFXA 3I2FA 2REQA 3NZEA 1F6BA 1HFWA 2YCBA 4IL5A 5LYJA 2QMQA 4EBBA 3ITKA 1L6IA 1U4NA 1E1KA 4K87A 5F33A 1BXKA 2H29A 4QOIA 2WFAA 4IIEA 2I22A 3KZMA 1CNMA 2BI4A 4WRRA 1EU1A 5I9IA 2RSLA 4K6CA 1EX6A 1PL7A 2PDAA 3WMWA 1FYXA 3HUEA 5JANA 5IASA 1QZUA 1Y63A 3CXRA 4R1SA 1QKJA 2NZJA 2X8WA 3WZ2A 4CMCA 2A33A 1IXSB 3HB9A 3JALB 3TSOA 2SNIE 1ZMXA 2VSNA 2YMPA 1PQUA 4JYBA 1I5EA 4FSDA 3KXKA 4GVXA 2KI5A 1FRVA 3WIDA 1TKAA 3JZIA 1FTNA 2VF4X 4IIJA 1GGFA 3E3NA 2HGSA 3BE4A 4A2PA 4JXZA 1J2TA 3RR2A 1DUVG 2NVBA 2W42A 4RPGA 4YRNA 1IN4A 5DSZA 1NW7A 2HDWA 3OZFA 2V7XA 1G41A 4FILA 4EHDA 1YR2A 3H1AA 1RYBA 4TRNA 2PE5A 4BB6A 1N1GA 2Q9AA 4HNGA 1DQZA 2COUA 1IZ7A 2B21A 4X20B 4E5SA 5HKOA 2IUFA 2OCDA 2JFUA 3C87A 5LP6B 1CYDA 1XHEA 4FEGA 4X6UA 1VLHA 3LYLA 4IMRA 4BNKA 2NTEA 1DGQA 2PUJA 3F1KA 2BSAA 2C3MA 4L4UA 4TS9A 3ROMA 2IYAA 4EGAA 3HM2A 3R7FA 1RPZA 4PAMA 2B92A 2MOKA 3EDMA 1DHRA 1DG1G 2EAUA 3QKSB 6ABPA 3NG1A 1TKCA 1UR5A 1NJ6A 1P2DA 1SULA 2JFOA 3ABOB 3C4VA 4IW3B 2FZCA 1G8MA 3CVYA 1KRHA 1F2UB 1Q1NA 2Q28A 2GD1O 3HQ4O 1XJ0A 3LUAA 3ORQA 4F85A 4F86A 4H0CA 4RIFA 2YXLA 3RRXA 3FTQA 3CWZA 6NULA 4RTJA 4FFOA 5IN4A 5EY5B 4S35A 1OA0A 1GPYA 4X00A 1MJHA 5EIXA 2R8PA 2IHKA 4QOHA 4BXOA 1Z06A 2GVNA 4E5KA 1P75A 3BZUA 4XIFA 3JQBA 2GJKA 3A28A 2DQ4A 2YIJA 4AI6A 3KZOA 2W4IA 3P2KA 2VF2A 1XEAA 2Z2IA 5LBIA 1M0EA 3S2SA 2RG1A 5F4ZA 1Z2PX 5F77A 1FMFA 5P8WA 5AM2A 1JHAA 3KUDA 2DAPA 2HX1A 2QL7A 3WRYC 3VOAA 1BWRA 2VOEA 4TL9A 4FFDA 5CFMA 5AW9A 2RIRA 2AKYA 2Z2JA 1PE0A 1PFQA 2NTJA 4I55F 3O9VA 4XRRA 2FP3A 4BBJA 2O7NA 4CHGA 2RHCA 2Q5EA 1CZOA 4PN7A 2XDAA 3R0IA 4KXMA 2PS1A 3T3IA 3EX7C 3P9IA 1YZGA 2O8BA 2EGGA 2FOXA 1XLVA 1DDIA 2HPHA 4IKOA 1KKUA 4L74A 5BSVA 1FC0A 1CRPA 3L93A 1XHFA 3EA5A 1D09A 1I24A 2A57A 2R6JA 1NQXA 3EXHC 4JJIA 4Q9DA 1P0PA 1VSTA 1NJSA 2AQIA 2O0HA 2D59A 2PH5A 2O7QA 4GX2A 4YQZA 3UTDA 5ITZB 5LU8A 3PS9A 4UUNA 3L1VA 5IARA 1M7BA 5DBFA 4ZEWA 1ISSA 5CDFA 4DRYA 2W22A 4LJSA 1YS6A 4K9QA 3OC0A 2H18A 2V65A 4IF6A 5DCLA 3OLYA 2VJBA 4FWIB 3MM4A 1NULA 1ZD9A 4YT5A 4U9IS 4OX9Y 3C85A 3DMDA 4JI5B 4XI9A 3EUEA 3ZU3A 3HMKA 1W7AA 1MOQA 1VI5A 1Z0AA 1YR6A 4AZTA 2Z1DA 5EESA 3VSCA 4R01A 4LDAA 3DDZX 1H69A 2FMIA 4ZAZA 2IIQA 2GPYA 3VYSB 1CQPA 1IN7A 1XWWA 4LRXA 4UTXA 4EG5A 2YNMD 1MABB 4GDFA 1BHO1 2P79A 2HA7A 5ECYA 1HZZA 1L1QA 1U9CA 1QGZA 2ZJFA 3V9AA 4LRWA 5DGIA 1EGVB 3QE9Y 1U90A 4RA6A 3NHRA 4RD4A 2AN9A 3G68A 4HNRA 4JR1A 3HA5A 1HG1A 4GYJA 3CY6A 1ORWA 4CU2A 2QPOA 3SBOA 2G06A 4NBLA 3S1LA 3ZHYA 4GR4A 2H7VA 1W19A 3VTFA 3DDOA 2LV8A 5K0GA 3UMVA 5A62A 4KLAA 2BDEA 2FN7A 2HBYA 2KHZA 1C81A 2MTBA 2O2GA 4J6FA 2GQ0A 2WE7A 1P2BA 3SI7A 4EX7A 2E1RA 5L7TA 2A1TR 3CH4B 3L43A 2O59A 5A2QA 2AMJA 2JEZA 3U5ZB 5JXWA 2JBAB 2HMYB 3GPLA 2PNFA 1Z18A 3R77A 1UBNA 4ESVA 2Z5GA 5CFZA 1BJRE 3IV6A 4IHAA 5DHSA 2FMUA 2W2VA 4BO9A 1T5LA 1FMTA 2QSJA 3F5MA 4FZRA 3GP8A 3BMNA 5ALOA 5UKDA 2WILA 1KI9A 4GLLA 3HG7A 4EB0A 1HRKA 1VG8A 1G3RA 1EFLA 2E4VA 1MO2A 1K8QA 3MT9A 3K4QA 3D8RA 1KNQA 2ZYVX 4E1VA 2WVAA 4RXTA 1IEWA 4N8SA 3P9NA 1YJXA 1NHGA 4XJXA 2HRQA 2BI7A 2QRGA 3I2GA 4F12A 1JXAA 3SHWA 4V0KA 3AEYA 2PL1A 4BYMA 4W9NC 1G2IA 4X90A 1XEWX 1JPNA 1JA0A 3VYVA 4GL4A 4W7HA 5FWAA 4TZKA 3T4EA 3UHFA 5KU1A 2AI3A 1L8LA 2P9EA 2G80A 2IPOA 5HK9A 4M8NE 1BXGB 4PPFA 4Y1FA 4RMIA 1N2XA 2GEDA 3TYXA 1G20B 4UM9D 3ADCA 3WKBA 4MW2A 2C7QA 1JAZA 5I7AA 4LHXA 3WZLA 4LDRA 1U31A 1ZQ9A 5CB6A 1ZNYA 3GLSA 5EKXA 3MTJA 1CUAA 1JTEA 2HU2A 4KGVA 3IDZA 4B0PA 5F9MA 3GVXA 1MOZA 5EQFA 3R0ZA 5E8RA 1C3OB 5ECWA 1S2OA 2XY4A 1STOA 1NQWA 4Z9BA 1Z4OA 3GGSA 3ZHOA 3V3TA 4W1SA 3KQTA 3AYZB 3WKEA 1WQ1R 3Q8LA 4GVLA 3GX1A 4CLXA 4NNJA 1GUYA 2CJXA 2CFSA 3OZBA 4NFYA 4PLFA 3DWGA 3TAUA 4FYWA 1IJEA 2PTHA 3DEYX 4H7HA 2P6NA 4COOA 3HHEA 4NBSA 4G1VA 1A4UA 1EDBA 7ADHA 3WKAA 2PUVA 4TZ0A 1XTRA 3ZK7A 4LV5B 5KJEA 2RHOA 3A6JA 1GQFA 4B6GA 1Y3CE 4CMIB 4K6MA 1YZNA 2QX6A 3V7FA 1RMTA 3JRWA 2B8WA 1R9NA 2XWJI 3AI7A 1CRZA 1L7PA 1PTJC 3EF3A 2ZBQA 3UB2A 1P0QA 4GBGA 4ZQCB 3ZWXA 3QWFA 1EP2B 2I2WA 5AKLA 1GRVA 4LDZA 1DWOA 4HTFA 5A3VA 1U2DC 3HU3A 5ENVA 3OJOA 5AM1A 5CT9A 1PJ2A 3I42A 3IAM1 5J4VA 4EB6A 2NUTB 2PYDA 1LV8A 4L0CA 3P2MA 5BSFA 1D5WA 3E3LA 2GJ8A 1EBBA 1ACLA 1RAGA 2G08A 2QT0A 3HA2A 1L6RA 2Z4SA 1GQQA 1K7YA 3KDSE 2KW5A 4JUAA 3BWCA 2YZKA 3QVLA 1N34B 3WL4A 1UBGA 1IB0A 3GYBA 1WU7A 3RI3A 4N01A 1JG6A 3HYSA 4DIUA 4E4YA 2VK8A 1OFUX 2ZJ0A 1I1QB 1UBRS 2VQFB 1JVSA 2O06A 2GXUA 3ADKA 4WV3A 2D2XA 3P52A 2PX0A 3ER8A 1ZOLA 2ORYA 4HV4A 3JQAB 3QKSA 3ZUPA 2OECA 4RYDA 5KQLA 4DQUA 3PF9A 5I7FA 1GCAA 4DLYA 2GAIA 2JATA 1LH0A 3P9ZA 2EF0A 1NDHA 3BHMA 2NAFA 1ZY2A 2BHTA 4F0JA 3KB2A 4RZUA 2NV6A 4Q9KA 2CVZA 3GO4A 3E22A 4HBZA 3PXGA 1ULBA 3IQWA 1C50A 1PX0A 1ZJ6A 3NBAA 4NCIA 5JCXA 3FGZA 2WA1A 2HQRA 2WA2A 3CT6A 3THSA 1U8FO 1GPLA 1RWVA 4X97A 4MI3A 4GU5A 3HL4A 5LDHA 1WB9A 2ET6A 2Z2ZA 1J6UA 5HJ2A 1N9GB 1GP2A 4FFSA 3IUMA 5FBVB 3AVVA 3H2YA 1E2UA 1OLSA 1H8HA 4TXNA 4DMHA 5T8KA 2QM3A 1W6RA 3T3DA 4DGSA 4HTAA 4IIVA 4ZYVA 4C30A 5REQB 4LWQA 4EG3A 3K4PA 2ZUSA 3HBAA 2AG1A 3ENQA 1K4YA 4N5IX 5CCBA 4KWIA 3AMVA 2VBFA 1C8BA 4UPEA 2D06A 1S3GA 3PKJA 4NCXA 4RUKA 5DXJA 1VE3A 3A6FA 1PR4A 3FZNA 3SX0A 4BQNA 3F6YA 1C2YA 3PE4A 1RYZA 5H1YA 1WHSA 1NR5A 4FGSA 4B7XA 4HNTA 5DHQA 3FHOA 3IOEA 4TKZA 2OP1A 2QRQA 4IV0A 2HYIC 4QPDA 1DOHA 1H6BA 3OCCA 2P40A 2FUEA 4FGZA 1KDZA 2QYTA 1BD4A 1QTQA 3Q7TA 2PMDA 2ZZKA 4D3YA 5JAPA 1DC6A 2R2GA 4JSRA 3QPVA 1AZTA 2TMDA 2WAAA 3U31A 3WBBA 3ZKWB 3WBJA 1BCSA 1AT1A 4P36A 1FRFS 2WAOA 4I6GA 1Q0QA 3T3MB 4RQTA 3B1FA 5LM3A 2PN1A 2W2KB 4UZSA 1ZLXA 4GWKA 2AOWA 1ZHHA 1R4MA 3CFYA 4LF7B 3OIYA 2O3JA 4RK6A 5ALXA 5KQRA 4BTVA 1E2DA 4UVIA 1GOTA 3CF2A 3T7CA 4YJHA 4ZYTA 2JARA 5I4IA 2UUOA 3W4KA 1R15A 2C4NA 4IFTA 4OK6A 3NQ41 3G5LA 4EHJA 3NDPA 5EVJA 3VOBA 3TKYA 4QOFA 2WSMA 1SKQA 2UU9B 3B1JA 4RJLA 3ECAA 2ODPA 9ATCA 1SVMA 2HJ9A 4C0HA 3ROPA 5EZYA 1AUXA 1NMXA 3HSKA 3PFWO 1NUAA 5IW8A 2UYGA 1PWZA 4BNDB 2C1EA 4B75A 5HIKA 4OLHA 1CUDA 4LCBA 1Q1ZA 1UWCA 1UOEA 2BW0A 1CETA 5HS6A 4YYZA 2H48A 4ZIRB 5L51A 1JH8A 2ZUDA 5KOHB 3VR2A 2D74A 4PWZA 4ZI7B 5HF9A 1FFBA 1SCNE 2REBA 1MAUA 1MC4A 2J6IA 3K92A 3MA0A 4FYJA 4D4LA 3OIUA 3EGWA 1LRKA 2XCQA 2CF6A 2NGRA 2C03A 3TK1A 2MWMA 2YWDA 4ZT7A 4O3MA 2C04A 2BKLA 1S7CA 2ERCA 3WY9A 4DIMA 5L3VA 2FWMX 1AZSC 4M38A 2GD6A 4QYWA 4PLGA 4LZWA 2CFIA 4F4HA 3CR3C 2OESA 4G01B 4YJGA 1NGSA 3D2LA 3OTIA 4EGCB 5GJVC 3EEBA 4US0R 5JFOA 4J0CA 3HP4A 4ACBA 4KV9A 3GDOA 4CMEA 2IOQA 3LBHA 1F06A 1QG0A 3FVWA 1BMDA 1NBWB 2F3QA 4B7ZA 1OWOA 4DZRA 1WL8A 5KQMA 3KUUA 3LHFA 1UKZA 4KVFA 4N0PA 5EQJB 1D4FA 1PZHA 4YAWA 3U81A 1Z8DA 2WF7A 2ZSDA 4OJNA 4YP5A 2NO7A 2RC6A 2QW0X 2QMEA 3K0HA 1H9BA 1V2HE 3GGDA 3I23A 3WI7A 3JQQA 1X14A 2FVYA 1E1RD 3DPSA 5A4DA 1KI1A 3I04M 3I0MA 4KGDA 2XEXA 3O6VA 1D04A 2M6KA 3OJCA 2VYND 5AD1A 1XE3A 4MLCA 4KFSA 1JEQA 3CX7A 2UXDB 1DJPA 2OFOA 4FDVA 5IAGA 5AVTA 2GM9A 2FEMA 2ZVQX 3QWAA 2JDID 1D2GA 1EAYA 2GLTA 1U0HC 1GR0A 1KYIA 2JKVA 3AESB 4B3MB 5C7LO 1GQYA 4M87A 1ZINA 1W9HA 2NU7B 5A3SA 4DEVA 1C3OA 5LZ4A 2RK3A 3EXG2 2YY5A 3ETCA 1NRWA 1F1BA 1X86B 3EEIA 3M6LA 3UWPA 3RWOA 3T5CA 2PZJA 5THXA 4CUZA 4D2IA 1NBAA 4B4KA 3QP9A 4IP0A 1J49A 1FQJA 1OIVA 1PN3A 3OUUA 3SJCA 4AKSA 1JWLA 5EXTA 3MHPA 4TV9B 1OVMA 2A9VA 1BO6A 3BM5A 8GPBA 3EBPA 4M0FA 4QSHA 4YMHA 1NMZA 2DBYA 1G6Q1 3F3YA 1TMYA 1VYTA 1I3OA 3W1VA 3CJQA 3I30X 4RV5A 2LVBA 4CPDA 5FX2A 1X7GA 2G17A 2RGYA 4B2YA 5IM4F 1NJ5A 4Z99A 4IWYA 1E1QA 4MLDA 4G0VA 1Z34A 1GGHA 2XXAA 1NJ2A 1PNQA 1UFVA 4TTVA 4U0KA 3R7WA 1J23A 1VI2A 2W6JA 4X91A 2H85A 2WU3A 3V8VA 5B30A 2R6R1 5K99A 4MQ5A 1M2KA 4WFQA 1IWBB 3CZPA 1E9FA 2VHYA 2M6LA 3G2KA 4BAZA 2H4XA 4BRZA 3THWA 1H2ZA 3ENVA 1N7JA 1FTGA 2NUTA 3TLZA 5LQCA 4BAGA 3OZ7A 1KJQA 2HNKA 4FIDA 4RJ2A 5EN4A 3H4TA 4YCLA 3H83A 5JDIA 2EYUA 3RYIA 4IH4A 1CQJA 5DP2A 1WSWA 1OSNA 5KCZA 5ULLA 5IKEA 4F5YA 1DTEA 1N2JA 3ND9A 2FN3A 2J48A 4Q6WA 4D8UA 1PP4A 2MR5A 4NJOA 5KYWB 4GGMX 4EUHA 2Q45A 5JBIA 5K7SA 3I39X 3Q6IA 1WG8A 1WF3A 2YV1A 3GD7A 4MRNA 1J0CA 1KBOA 2ID8A 1GV1A 3BSYA 4XWAA 4G36A 2VDRB 3TSCA 2WT9A 4RH3A 3IH5A 4RCYA 5BSMA 3TW8A 1YB1A 3VHRA 1YFJA 4OI0A 1WZCA 2ISCA 1F6DA 3CT4A 3RT1A 2HQOA 2QZZA 2B9VA 2C82A 2H4WA 4F3NA 4MUAA 2OD9A 4M0EA 1C14A 3IT1A 1RYDA 4OMUA 1QV6A 1M8KA 2NO0A 3AOEA 3GEMA 3I62A 5AXCA 1FF9A 5HZMA 4D9FA 2YR0A 2WV9A 4RV9A 5JNUA 4ZYYA 3OMLA 2J3EA 3E3AA 5AUQA 5LLTA 2D1QA 3PC2A 2TMYA 4CMBA 2E4UA 1YF3A 3DG9A 3JPYA 1IEVA 1AJEA 1X13A 3GDWA 1E2QA 5BSKA 3LQQA 4ZU6X 1YE3A 2PT9A 3HSYA 3C45A 3SQWA 4WFIA 2IA5A 3B6JA 3LLUA 3NDRA 2CD9A 2YHAA 1RTTA 1T5TA 1AUQA 2UZ0A 1KZ1A 3OO0A 4HAUA 3SMVA 4F56A 3INNA 1ULAA 2VNIA 2P3SA 3GCZA 1P18A 1Z29A 3T3EA 4DLTA 4GMHA 2ZWVA 3E1SA 3K16A 1XZAA 3Q4GA 2BYTA 4JROA 3C8ZA 1V5IA 5CCDA 1CUCA 3IVMA 1VLLA 2JLQA 4KUGA 4RVHA 1L3IA 2D3WA 2V6FA 1SUBA 2WE8A 4WLNA 4I14A 3GLUA 5EINA 4BQPA 2AHOA 3HCDA 1SN7A 1XCJA 2Q1TA 1U8ZA 3FCXA 4H7JA 1DB3A 4Q37A 2Q6LA 5CK5A 4AKEA 3GAAA 3IT0A 3HXTA 3IDOA 5THQA 2EZ4A 3ZKWA 3ZQ4A 5BMVB 2DKNA 3PNKA 2G1PA 1RPJA 1TLLA 1YVRA 1DRUA 1RCUA 2JFVA 2Y6VA 3H5TA 2A9PA 3NR2A 4FC6A 5SICE 1R0SA 3AUJB 3I4CA 2WWTA 5C5EA 2FU5C 1Z7EA 1YR8A 3H2ZA 4UREA 1GTG1 1XTPA 3P9KA 3B6ZA 3T3HA 5J4LA 3DAOA 4BWVA 3LOPA 1M9NA 2C2YA 2P5YA 2GPSA 2IODA 3TTSA 1GPH1 5AVVA 4YX9A 1PEYA 3ILHA 4PFQA 4DR3B 5LB2A 1XZJA 3K53A 4YY3B 2HZBA 4KYVA 4WE3A 2MSNA 2P4UA 1H6AA 2RAUA 3U80A 1GG5A 4DA9A 3VJMA 3BTSA 1ZNWA 4F45A 1VCNA 4E2XA 2ECOA 3EAGA 1KMQA 1P6QA 1D1TA 4F2GA 1JU9A 2J5KA 7GPBA 2O0LA 3GFOA 2BCGY 5LPNA 1I14A 1C7RA 1NI4B 1KEUA 3NAMA 1X94A 4QL3A 4Z5XA 3N2YA 2A30A 5AW3A 1O08A 4Q4HA 3RBVA 4EG0A 3IQFA 2AEEA 2UUAB 4GQAA 3PT5A 5GONF 4ON9A 3R6DA 3QJGA 2I6SA 3RVBA 1X7ZB 2PKCA 4G3XA 3MMZA 1TUBB 3W5HA 2DCMA 2LCIA 2ZJYA 3ESQA 2GO7A 5KREA 3V8MA 1KJZA 3BXGA 3W6PA 10MHA 4DUPA 2EFJA 3VR5H 1UBMS 1GNVA 1RWXA 2V7QD 2Y05A 4HSEA 1M33A 2E4WA 3OFNA 2Q5QA 3PXBA 5C0OE 1XEXB 2XHZA 4XB1A 4DWOA 4U7DA 4TVKA 1FFSA 2VHVA 4GVPA 3ZWOA 3DKPA 4LMRA 2GKSA 1GL6A 3DP7A 1T3SA 3CNHA 4WOPA 4WD3A 2QJFA 3P9CA 2AVDA 4G37A 4KE9A 4IS2A 4Q02A 4P5DA 1EK0A 3U62A 4UZEA 4LF5B 4RQBA 2Y0BA 3GQVA 4Z8XA 3TXAA 3SX4A 5DPMA 2JFXA 2FZLA 2BJWA 2ZRAA 4K6HA 3JASA 3PEVA 3TRHA 5TSDA 2J7PD 3H97A 3L2OB 2IWHA 1LWNA 4R51A 4XSGA 5JPIA 4F5EA 5C2JB 4LF9B 3VPGA 3U7FB 1ELOA 4AU1A 4L0DA 3UK1A 1GDDA 3WGMA 1C2TA 2C78A 3GLGE 2XZLA 1Z35A 3IAM6 3SICE 1T8PA 1P39A 3OHMA 3L6UA 2QN7A 4B85A 3E7XA 3VNUA 1GFZA 3I2YX 4C4RA 1IQ0A 3FA2A 2XUAA 1B8NA 3OEED 1GPJA 1Y8RB 2J0QA 5LDGA 4YFVA 4EGSA 1RKVA 4KQ6A 2HQBA 1KBZA 3EH1A 4M1KA 1I3MA 4ZYZA 5AVUA 1ZM4A 3MB8A 3D7LA 2A1UB 1XDSA 2VH2A 3DV9A 1RWWA 3IOYA 2NU7A 5C80A 4PXYA 3H8VA 3JTEA 1Z5PA 5BQ3A 4RTKA 3QE2A 5KX5F 2R8OA 4YRDA 3T06B 3G0IA 6ADHA 1J0BA 2ZREA 4BE7B 4GMDA 4ZCTA 5BN3B 1QYRA 3L79A 3WHKA 1J2RA 4DCVA 2NP7A 3FOCA 3CZ5A 1KYZA 4CM4A 4Z51A 3FDJA 1XZMA 4GH5A 4Z4IA 2VIIA 3LC7O 3D5TA 4BLRA 1U7TA 2NYRA 4MZDA 3OBIA 4BEJA 4N7MA 3PRKE 4PAWA 5LZ9A 4DIOA 4O33A 2GA9A 3KOOA 5EKDA 1RZVA 3DEKA 1ZUD1 2A5DA 1KARA 1M1XB 3A1NA 3IQDB 3LQYA 4MVYA 1XK7A 3UCFA 3N8DA 5C32A 5JT1A 1H6CA 3M3HA 1EHYA 1SZJG 2WMYA 4MVJI 2P27A 4WTOA 5E6RA 2GEKA 2W2QA 1C4WA 4NBUA 4O8ZA 5AOBA 4DR6B 1TPZA 4OHUA 4J3FA 3Q10A 1XCLA 1SEVA 3ACCA 1MHTA 3RSSA 2H4ZA 4H31A 1GILA 3KYBA 3A6LA 3OQ1A 1TIBA 4L2IA 2BC9A 4MRMB 3MD0A 4H4EA 3FFWA 2P67A 3NONA 4LJLA 4XPZA 5JSKA 3LVQE 5AT1A 4LWPA 4WL0A 1HEYA 2IH2A 3FYCA 4JUDX 4I4CA 4JI4B 2DPYA 4RLHA 3IE0A 2QN9A 3ROXA 1FDUA 1ZM2A 3IB6A 2QLNA 3JWPA 1Z7WA 4OGLA 1Z37A 3IUYA 1XA4A 4O1HA 4DADA 1AQJA 3LX8A 1R9JA 5KYWA 1CEEA 2RKWA 2Q3MA 2JGEA 3ZDYB 2NO5A 2GT1A 4PHFA 3KKPA 3RS8A 2B4QA 4CE6A 3K73O 2VP0A 2VRWA 1EKXA 3QKRB 5F51A 4HH3C 2PMCA 2PMWB 1OZ0A 3K09C 4F60A 1WXFA 1RI5A 4L95C 2IBTA 1FFWA 4OI4A 2OV6A 4Y1RB 2OXIA 3GRKA 1ABFA 4EF6A 1V8BA 4M7WA 4AT1A 5J2UA 3Q6NA 1WDMA 3NH9A 5CVJA 4XVUA 3VVLA 1BFDA 3QEMB 1QFZA 1F48A 2O2YA 3A32A 1Z13A 2QXYA 3FOBA 1Z4IA 3EDQA 5DK6A 5FLYA 5BN4A 3LRPA 1VKHA 2H1OA 2PZMA 3WL5A 2EFEB 2DECA 5K0SA 2Q4RA 2DY1A 2X22A 1EK5A 1BZYA 3E9DA 3ZUGA 2YDXA 1IUKA 1WDKA 5H7XA 3LE8A 4BO3A 4DCGA 1H42A 3VUFA 1YQEA 2CLOB 3NYWA 2Z9CA 1NFRA 1OX4B 2I4IA 3V46A 1JGTA 1S0UA 1G291 1TW2A 4LHVA 3VC1A 4CV1A 4DM4A 4YT2A 2X7JA 2HMVA 1YZHA 1RI4A 3BHJA 5CX1B 3E82A 2WYWA 5K0TA 4MDFA 1GXSA 1SVNA 3ESXA 2MIIA 1ZKMA 1IHYA 3K1JA 4OIFA 2RGRA 2A88A 4WEOA 2EFHB 2ZRMA 2IZOA 1BYUA 2ACEA 1SOWA 2OWDA 2QZJA 3HN6A 5TC4A 4F4UA 1FNSA 1W5EA 4M8LA 1EFUA 3Q15C 1YQDA 5EIAA 3VDMA 4PYOA 1R10A 3TZ6A 5HXAA 1IU9A 1NN3A 2XUGA 5FJJA 4UFNA 2Q5LA 5EL0A 5KC9A 1SUSA 4KH1A 2W37A 1UJMA 4HWTA 1V2GA 4GW3A 2R5WA 2ZRFA 3BXZA 3IAFA 1T8SA 4RLQA 4DMFA 4AY3A 2E5LB 4NIMA 3KFVA 5EERA 1MR3F 4W5OA 1XRJA 1V96A 5BMVA 2ROQA 3GNTA 4RORA 2MSCB 3I9MA 3WK8A 2A0WA 2DUJA 2Y1KA 2JI7A 3DLIA 3KJEA 1O1YA 1WO8A 2E9SA 3GEBA 3OM8A 4JEMA 3ROFA 4IIHA 1GR1A 1FW8A 1KEPA 1O03A 1XDDA 2JLSA 3SSNA 4E2FA 4RCVA 5CXQA 1NYLA 4UTOA 4IJ6A 4MIKA 3CUEF 4U7JA 3KG2A 3TM4A 2ZJ3A 2QORA 3MNFA 1P45A 2JCSA 4PAGA 4K8OA 3WG9A 3L1IA 5GAJA 9LDBA 2ZZNA 4RVNA 2NZWA 1QDUA 2Q50A 2ZCUA 4XDHA 3TNJA 4X5OA 4MV6A 2EW8A 2XMZA 3NC4A 4MO9A 2PO5A 2RGGA 5AKJA 2C2XA 3DXXA 4EL5A 3GLKA 3PNMA 4OM7A 3TBKA 4ER3A 3VAYA 5JW6A 1C4KA 1NUPA 2ZITA 3ORYA 4EO4A 2Y1OA 1UJ6A 4XE5A 4V1CB 1BMFD 2R8BA 2P9CA 4BMXA 3TKLA 2NZ8A 3K70B 4XTCS 4Y18A 1HNWB 4BLVA 2F9LA 2HLNA 2IYFA 4I50A 3M6FA 5HZHA 5A0VA 5JRZA 1P7WA 2YIDA 5DF1A 3RAEC 3C7DB 4CXMA 1SBZA 4JLDA 1DEOA 3UA4A 4BEBA 4D6XA 3QFCA 1F3LA 1PF7E 2JAWA 3BS4A 3LLVA 1VLVA 3ORRA 2AKEA 3VR1A 5H4HA 3O82A 1TUBA 4GXTA 4UNSA 5FA5A 3TTWA 1X8XA 4JYCA 4RY8A 3TNFA 2BUBA 3OUTA 2XA2A 2ZT6A 4PQEA 3RK0A 4IQFA 4A91A 4AZ0B 4NULA 4NYJR 4F71A 1O4VA 1H1LA 5E1MA 3PWSA 4IJ5A 2QUJA 1A5SB 3PD7A 1SIBE 2MSLA 3Q6MA 5IKMA 1V5FA 2OENG 2ZJ2A 4FFMA 2IHNA 2XNSA 2JFBA 4EL0A 3X43A 5JAQA 3L7KA 3ORFA 4FUTA 3W3AA 2BFBA 2P0EA 4AYXA 4DDTA 1QHHB 1QR2A 2C57A 3JX9A 4HH4A 4KMRA 1Z4QA 4WWHA 2IPMA 2H11A 4BVFA 4E09A 3RFUA 1JKFA 2VI5A 2LNDA 1FFXB 5JH7B 4A26A 1OAKA 2ZOSA 3ML1A 4ND3A 4W1RA 2E1PA 3Q98A 5J23A 3QUSA 1S2LA 4R8LA 4A2CA 1WNTA 3ZD6A 1NI3A 1CYEA 2ONKA 2GYVA 3KAPA 4FW9A 4IG4A 4BLSA 4U3JB 3U40A 4HRYA 4D92A 1XLTC 1NRJB 2X4GA 3IYLW 1DHTA 3STTA 4D4IA 3PC4A 4WADA 4XJSA 5M7EA 5AHWA 4A8TA 1XQVA 3UWOA 3GY0A 4QFDA 3N8GA 5MGBA 3LYHA 4TYWA 1T4BA 2YJ6A 2IIPA 3DAYA 5H9VA 5BP7A 1AA6A 1SXJE 1OU0A 1ZD2P 2Z5VA 1WXQA 4ZTBA 2X1LA 4KDEA 1BSVA 4Q1VA 4DQLA 1QH1A 3R3YA 5MFZA 3L9WA 2AZXA 2IY7A 3CEHA 4YRIA 1SKAA 3TX2A 1OA1A 2O3UA 3DBVO 5B3KA 4RW0A 5GVRA 4DG8A 1CJUC 2JFHA 5CH5A 1KRWA 3KLMX 3B70A 1UT8A 3MW8A 2O23A 2FZWA 1YDHA 2JK1A 4ZQGA 3TQRA 2QQGA 2ZRGA 1YRBA 3ICCA 5IP5A 5H70A 3GJTA 4G4JA 4BE9A 4DLSA 4R71A 3VSDA 2ZBUA 5HR5A 2OORA 4K2HA 4YRKA 2CV0A 3H3JA 4JC8A 1P7CA 2O50A 4L8VA 4RMHA 3H86A 1U3TA 1WV0A 2VCHA 4AULA 5I7HA 3ZVNA 4D8XA 3EGOA 3KPUA 4B4OA 3SIXA 4L4YA 1DIAA 2VJDA 4PHHA 4RSGA 3LQ1A 3DMGA 1NXOA 3FTEA 2JCVA 4GI5A 3I76A 3WK4A 2ZTUA 1E3LA 1LK0A 1YJAA 5C81A 4BVKA 2F9FA 2PANA 3SXUA 1AGXA 1P1JA 1T8YA 3KE9A 4JYZA 4KSCA 3HKCB 3IR7A 4L3WA 2ZP1A 1QIMA 3LLCA 5F5NA 2FAXA 2FSPA 3SLRA 1WZUA 2KBFA 1P17A 3G0CA 2GK4A 4LHYA 4MPTA 3K5HA 1CQIB 3O8LA 4RS4A 1RP7A 1CDOA 2C7OA 2ZB7A 3VBEA 1GQ2A 1U0OC 3P19A 1GVHA 2BGJA 4PS0A 3PLNA 4D96A 3BMXA 5AQ1A 3H1GA 1JE0A 2D2IA 1NAIA 3A05A 1F4LA 3GA7A 4KWCA 3F0TA 4KQWA 4OBEA 3A7EA 1OIWA 1QHEA 3R2JA 4RK4A 3TZCA 1ZO8A 3B3GA 4FSXA 3AJDA 2EFYA 4G26A 3I73A 3QXJA 4MMXB 2A6PA 3LKBA 4KI7A 3WJ7A 4D9HA 2YVUA 1XVIA 3DZDA 1JLMA 4L3VA 2VDOB 1WULS 1XTBA 5DE3A 2R1TB 3UJ8A 3SJBA 3UPDA 1M2EA 3Q11A 1MB3A 1V16A 1V8FA 2FQYA 2H1CA 4I4LA 2H0AA 3RH0A 3QKRA 4M1ZA 3WXBA 4BHTA 1N6IA 2JFZA 4WCFB 1WJGA 5GY7A 2EATA 3DLPX 3L6OO 2X4IA 3U19A 1G63A 1X3LA 3O92A 3QBDA 2HC9A 4MSUA 1G8SA 2OZVA 4ZCIA 1TI7A 3LQ4A 2FDRA 3X1ZA 4GBED 4D74A 3AL2A 2WLSA 1LXCA 1MXFA 1X1AA 2I6FA 3H11A 5KNDD 5H83A 2X7HA 3EZ2A 3UB4A 5CXXA 3EZNA 4HH0A 4RDCA 3KELA 2G5CA 3L18A 1NVWQ 3D64A 4UOZA 1Y9AA 3O8OB 3Q40A 4BO4A 1UPAA 1JSCA 3I9V1 1SCJA 2GN1A 2XDQA 5C4GB 3AIMA 2QSUA 3DZCA 5H68A 5PGMA 4AD8A 5LNK1 2VBGA 2QNBA 4N6NA 3L0PA 2F3TA 1NW3A 2XZOA 2FEWB 1SUEA 1KTVA 2QN3A 2WYUA 3O4FA 4AN0A 4Q1FA 3CB4A 1UINA 5E4YA 2VR1A 3IP7A 4W8GA 3UAVA 3ICQB 4YR7A 2CMGA 3IAAA 4L6AA 3GFGA 3LDUA 5CX1A 4PONA 1IVSA 4BMSA 2QX7A 1UMCB 2BGIA 1FJGB 1MGOA 2D7CA 1OI4A 2AOUB 1DG3A 5FBWB 4EH1A 2B0JA 2W90A 3PC8C 1O96B 3FUCA 2MYPA 4G8DA 4N9QA 5EP2A 1OT5A 1EGHA 3K6SB 3VR6D 3AU9A 3CIFA 1UZNA 1ODTC 1UMDA 5ICFA 3AKZA 1H4QA 1T13A 1ZU5A 2AFHB 2ZETA 2WIDA 4KWHA 3SR4A 3W5JA 1FVOA 1TT7A 5TT0A 5BSTA 1EAMA 2QROA 3QU5A 4DKJA 3ZCPA 3BWEA 5K4HA 4QOSA 2P1ZA 3WSTA 3PCXA 4M89A 4OXXA 3I6ZA 2CLMB 4RA9A 1ONSA 5LZ8A 4BUCA 3FVTA 4C88A 4C4XA 5IJ9B 1MTZA 2ZIXA 3NIGB 3H1EA 2VH5R 5KOJB 4GC5A 4LXHA 5FXMA 3HBLA 1XP8A 2Q3BA 4EW2A 3DBOB 2YNMA 4DHEA 2UZ1B 2CL6X 2G9UA 2I7DA 4YRMA 4KR6A 3V7UA 1M8JA 4KXNA 1WU8A 3ZNQA 2VDPB 4LPKA 2Z8XA 4MP6A 1L5NA 4CTJA 4EEZA 3FHLA 4EHFA 3UJNA 3GLFB 3WDSA 2Y68A 4PHTA 1MH9A 4TLEA 4URHA 1LWOA 1D5CA 1Y9ZA 4U00A 1E9SA 3ASVA 3CX8A 1H93A 4BNYA 2E4XA 4L51A 2C0PA 3UHOA 1I7QB 3EXIB 5KDDA 1U2ZA 4KOEC 1WF6A 3MGGA 3ERCA 3FPKA 4P5EA 1I2DA 1F1JA 5KINB 3JARA 1RLJA 1Z0DA 3KQSA 1DRJA 3D0RA 4WERA 4N9WA 3NHKA 1ULUA 5EMHA 1YZFA 5CHEA 5CCXA 4A8PA 1USUA 1Y6RA 2IU0A 3GIDA 4UEKA 1DUSA 3PQDA 3WQBA 4CG2A 3TNYA 1I2AA 2CDNA 2OVBA 5FA6A 3N1UA 2QRZA 1J9ZA 1L5FA 1FYEA 1XJCA 1ZNQO 4G1MB 1LBHA 4PLVA 1ZWKA 4Z0PA 3SYRA 5FAXA 2AYZA 1XA0A 4LVCA 1ISRA 1G6HA 2GM5A 2OHVA 1KY2A 3A4TA 4XD7D 4AZ0A 3GZ4A 5EMLA 1Y4SA 3A4VA 4GKAA 2CDCA 1MT3A 3M70A 3GDHA 4I4TF 3WQRA 1HT0A 1QPBA 3OSZA 5F52A 4GPAA 1GZDA 1PV1A 1IH8A 2RMKA 3LPAA 4UNRA 1VCHA 1ZOIA 4WGGA 3NGMA 2E4ZA 1Q3KA 1BS2A 2J31A