3L77A

X-ray structure alcohol dehydrogenase from archaeon thermococcus sibiricus complexed with 5-hydroxy-nadp
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
235
structure length
234
Chain Sequence
EMKVAVITGASRGIGEAIARALARDGYALALGARSVDRLEKIAHELMQEQGVEVFYHHLDVSKAESVEEFSKVLERFGDVDVVVANAGLGYFKRLEELSEEEFHEMIEVNLLGVWRTLKAFLDSLKRTGGLALVTTSDVSARLIPYGGGYVSTKWAARALVRTFQIENPDVRFFELRPGAVDTYFGGSKPGKPKEKGYLKPDEIAEAVRCLLKLPKDVRVEELMLRSVYQRPEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short-chain alcohol dehydrogenase
publication title X-ray structure alcohol dehydrogenase from archaeon Thermococcus sibiricus complexed with 5-hydroxy-NADP
rcsb
source organism Thermococcus sibiricus
total genus 93
structure length 234
sequence length 235
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3l77A00
4GX1A 4W9NA 3SEFA 3KSDO 4UUNA 1EVYA 4W7IA 5FWNA 3GVIA 3HDYA 3TZCA 4J1TA 4ND3A 4OH1A 3F3SA 3NRCA 4U5QA 2WE8A 4GI2A 3JYQA 3TJRA 5KVCA 1ISGA 2YHIA 2PD3A 3OIGA 4J43A 1E1KA 4TZTA 3D5TA 3INRA 3ZWBA 5MGBA 4GL4A 2AEMA 2CNBA 1DJNA 2J5QA 1I2ZA 1O9BA 2DKNA 3DBRA 3S2FA 3WWZA 3E8XA 4YEDA 1NNUA 3K96A 3E6AA 3ZI0A 3PJDA 4E31A 3AUTA 1BSVA 5ENDA 1EUCA 4RLSA 1ZJZA 3Q11A 3UAGA 1PR9A 3DHEA 2BFPA 2NU9A 2X1HA 1W0CA 2C82A 3EY4A 4PG5A 4ZU3A 4IIUA 5IXSA 1PJCA 2Y1DA 3EW7A 4DREA 4YJHB 3PVZA 4O6VA 4PGFA 4OMUA 4WLUA 2ZJ1A 1CIVA 1PJ4A 3H65A 1VRWA 4XR9A 3KLPX 5CPFA 1Q0QA 1RWBA 3D7LA 1KERA 2O50A 4BO2A 1YVEI 2X58A 5C7IO 3ADPA 3H5NA 2CVOA 5L4SA 2J5RA 4NFSA 1E6WA 4J6FA 3QWAA 1VE9A 4WECA 3GEDA 5IZ4A 5JC1A 3O38A 1EE2A 3GGGA 1EVJA 3U9LA 4BGIA 4YT8A 1B8UA 3HE3A 2CF6A 3E82A 5JMPA 3WDSA 1ID1A 5IZCA 2Y93A 4CMBA 4TRRA 4INAA 2DUUA 1M67A 2VWQA 4LCJA 4GKBA 3H3JA 1PGNA 1EZ4A 3E5RA 4BNNA 3VH2A 2IDZA 3E48A 3U4DA 4OGWA 3ETEA 3GK3A 2HJRA 4D3DA 1I3KA 3UCEA 3IP3A 1NXQA 5DBFA 3JYPA 1WAMA 2WD8A 4YAIA 3CE6A 1IHXA 1HE5A 3ULKA 3NUGA 1E7WA 1L7EA 4BNLA 4NBUA 4XYGA 1J5PA 1L7DA 2DBZA 4GKVA 1LQTA 1GZ4A 1ZK3A 2WEKA 1T1SA 1YXMA 3MJVA 1TI7A 3V8BA 2YFQA 4OXYA 4R5MA 4UVHA 4JX8A 4BKRA 1WDKA 3KYCA 3WMXA 4DA9A 3I9KA 3OBBA 3QVWA 4B4UA 4CJXA 3ZWNA 4IJKA 3KSZO 2Q1UA 3BMCA 4Z0TA 3WTCA 4OOFA 4YRBA 1ZKMA 1EVIA 2A94A 4PG7A 1ZFNA 4NH4A 4XQ9A 1O5IA 2ZCVA 4R1TA 3TL2A 3PYXA 1JKFA 5T6BA 3RWBA 3DOCA 2C0CA 4J2OA 4OO3A 1HDGO 2Q4EA 3O26A 4P4GA 5A9TA 2Z1MA 1LA2A 2GN9A 5EPOA 2TMDA 4A2CA 3AK4A 3AU8A 4NFYA 4WCFA 5G4KA 3W8FA 1PQPA 3WGZA 3IP1A 2FY8A 5I9NA 4D79A 1LX6A 4MKXA 4IDBA 4NDNE 4AL4A 4CM1A 1U7HA 5IXYA 1YE3A 4CM4B 4BVAA 1PJBA 4E2ZA 1CYDA 2PLAA 4MVJI 4FD3A 3OIDA 2FMUA 1EDZA 2VWHA 1QYCA 3QRWA 3PFWO 5G0SA 3VAZA 4E12A 4IDDA 2NSDA 3BTSA 4PRLA 4CMIA 1FJHA 3VH4A 4IQGA 2FR1A 3OFSA 2CMDA 2RHRA 3CSDA 5K6AC 2CVQA 4GX0A 2OBYA 4OL9A 3RUCA 1BXKA 3QVOA 1M6WA 1MFZA 2D2IA 1P0CA 3ROQA 5L40A 4BIIA 3B20A 4IJUA 3JD0A 1E0DA 3PIIA 2W98A 1YB5A 3RKUA 4Z9YA 2WD7B 5T64A 3LU1A 2IZ0A 5ITWA 4OKNA 1ZXBA 4FCCA 3HZZA 3TNLA 1QV6A 2DUWA 2VOEA 1PZEA 2YDYA 2FR8A 3NT5A 4B7CA 5B1YA 5L9AA 4EEZA 4IDAA 1GUYA 1I3MA 3GDFA 4LCEA 1RPNA 2NM0A 1JAYA 2X7HA 5LDGA 4B8WA 2ZQYA 4YWJA 4XGNA 1EVZA 4UUMA 5BSHA 4YYZA 4Z6KA 4WNIA 3UICA 3LK7A 4FOOA 2EV9A 4E4YA 3WR5A 1M6HA 2J3JA 4FFLA 2FN7A 2QW8A 4MVJE 2CFCA 4HX5A 1HDRA 3VH1A 2C7GA 2FR0A 1EQUA 4QUKA 4L9RA 3TPCA 1H2BA 2SCUA 3H9EO 2B5VA 5A4DA 4OOEA 5BSGA 6ADHA 1ZUD1 4BO4A 1KVTA 2ZYAA 4U0KA 4Q9NA 3ABIA 3KEOA 1GV1A 4M87A 2VYVA 2OOSA 1LSUA 1MLDA 4Z3KA 5MDHA 4YXFA 4D41A 3JQAB 4D44A 5I9LA 1PEDA 1P1IA 2IE0A 3TWOA 3DMYA 4RVGA 1NWCA 3H9UA 2GF2A 3Q0EA 1PGPA 4MJLA 4RVSA 1BWSA 5TT0A 3WFJA 2NU8A 4QO8A 3I6IA 2VRCD 1YGYA 3AOGA 4EJ0A 1CEQA 3B1KA 4YA6A 1V8BA 1H94A 3BTUA 4Q3AA 1BW9A 4UEJA 4EDFA 1UAYA 1NHGA 4BNKA 5A5FA 1C0LA 1R4NA 4IY1A 2JCXA 1HZZA 1YRLA 3ZN2A 1NFRA 1AHIA 4RVDA 5F21A 4WLEA 5EERA 3DZJA 3FF4A 5FYDA 1P44A 5KJEA 3HB5X 4UEOA 1I8TA 1HWYA 1QYDA 2DPHA 3DHNA 4MINA 3RKRA 4A10A 4A0SA 1GR0A 2C07A 2QIOA 1HSZA 3BA1A 3KV3O 4EBFA 4BNUA 4DVJA 2EERA 4ALKA 5AXAA 1QRRA 4R1UA 1JN0A 4RDIA 1I36A 2VUUA 4IDGA 4IIVA 2Y1EA 3IIEA 3MCVA 2H9IA 2O3UA 4XZ3A 1K3TA 4ZICA 3GAZA 4QEDA 3WGQA 1IULA 4BO0A 3OJLA 2D59A 3I23A 1D3AA 5JSFA 3FTNA 4CLOA 2OP0A 4J0FA 1XKQA 4CLRB 1ISFA 1M2WA 4PZDA 1YQXA 3PQFA 2PY6A 1JWAB 4XGIA 4E13A 2AA3A 1GYPA 1NR1A 5KVQA 3OSUA 4I5DA 1DAOA 1UZNA 5TIIA 1U5AA 4IQ8A 3ZV5A 5HTOA 3RC9A 3TOZA 2VCYA 2HU2A 5DBGA 1PJTA 1UR5A 3C7DB 3LT2A 4Q3BA 1KC1A 1NQAO 4U7WA 1GY8A 1O0SA 2DBQA 4W99A 4B7XA 1SOWA 3JSAA 4MO2A 3OEYA 4II2A 2VHZA 4JJFA 3UFXA 3DR3A 1NR7A 3PHIA 2EP5A 5DOZA 1KEVA 2R6JA 3RBXA 2YV1A 2I67A 1G1AA 3I5MA 1F8GA 3E18A 4AJOA 5ICSA 1NPDA 4U6QA 5JFOA 4ZHSA 1PGJA 1ZMOA 3DZKA 4PG4A 5JAMA 1LLCA 2NWQA 3WLFA 4E33A 1JVBA 4MVJP 1Z75A 3AUUA 4RPGA 3V2UA 3JD1A 3EAGA 4KUEA 5CDSA 3CINA 2O2YA 4I9UA 3GG2A 5A3VA 4FIZA 5GZ1A 3SBOA 1CRWG 4XQCA 3EVTA 5JS6A 4BKQA 2V6FA 4R3WA 3M1AA 3D4OA 1P74A 5EESA 4ONEA 1EK6A 2NVUA 3SLKA 4S1VA 5CFZA 1LU9A 1LDMA 2D1YA 4H15A 4CQMB 5IN4A 2XXJA 1Q1NA 3QWFA 2PH3A 5U9CA 3ZHBA 3P2OA 3CIFA 2D5CA 3NDIA 3FNFA 4B4OA 3TZHA 2VT2A 5KVSA 4IDEA 1H6CA 3VHRA 4BB5A 3CUKA 1ENZA 3DC2A 1H6AA 1N7GA 1W73A 2B4TO 1HZJA 1R4MA 4FJ1A 4F6LA 1C1DA 4WCDA 1YB1A 3WFIA 4C7JA 1ULSA 2OHXA 3R1IA 4DLBA 3ZU3A 4PFJA 1QG6A 3H2SA 3ROKA 2VUTA 3NEPX 3FBGA 3HB4X 2HAEA 2J6IA 3WIDA 2JD1A 3OA2A 1KEPA 2PKRA 4GMGA 1Y8QA 3A4VA 3FR7A 2BKAA 1DSSG 3DAFA 3PJEA 4BMVA 5KVVA 2WMDA 4AJKA 3AWDA 3U4IA 1GYQA 1ZEJA 2C2YA 5JMWA 2D5AA 3K31A 3LT1A 1KS9A 4OIMA 3JQFA 3I9JA 1N7HA 2AEJA 3SX2A 4AJPA 5JDIC 1R16A 2UUPA 4PLHA 4XDZA 2ZYDA 4BUCA 3KYCB 3OECA 4L4XA 4CM9A 3JYOA 2FHSA 2XPCA 4JN6B 4J2HA 5CHEA 4XKJA 2QYSA 4CR6A 2FZEA 3CEAA 5DDIP 5IN5A 4UVEA 1QYXA 1NM5A 3F5QA 2UYYA 2JFFA 2GUGA 2Y0DA 3STHA 2PGDA 3NT4A 1ISHA 3T4EA 3CZMA 1R15A 1FXSA 5B4VA 3LLVA 2X9NA 1XR3A 4PCVA 2RAFA 3R6DA 4DQUA 3U62A 4UUOA 4XYMA 1P0FA 3LC2O 1C14A 5G4KB 2VZ8A 3BHMA 3IL2A 3C7AA 5K6AA 4TMFA 2DBRA 4ND4A 4P38A 4K6CA 1QP8A 4A27A 4R01A 4NBWA 3G3EA 3PEFA 4AJ2A 4J0EA 3OQ1A 2HRBA 4Y6SA 1UZLA 5L95A 1O6ZA 4CM5A 5F1PA 2HK8A 4YAEA 3TFOA 3ZNNA 1A9ZA 4QX6A 3TQHA 1X1TA 3ZV4A 4BGUA 3DWFA 2PGLA 3MJ4A 2Q99A 2G17A 3GGPA 2PKQP 1XU7A 2OO5A 4J7UA 2IZZA 3A9WA 1YONA 1U5CA 1B26A 3QLJA 4LGVA 4HNHA 4GX2A 2Q46A 4OSOA 5KJ1A 3PQEA 1G0NA 4ZQHA 5HWSA 1YOVA 3WYBA 1Y7TA 4GVXA 3LT4A 1I10A 4UULA 1GU7A 2I9PA 4IUYA 2ILTA 5A3JA 2BGMA 1DRUA 3ZU2A 4CMEC 3ZGYA 5TQVA 2W8ZA 4ESOA 2PGJA 2G82A 2GSDA 3BMQB 4PLPA 2VZ9A 4FSHA 4MP6A 1UXGA 1QLHA 4CMJA 6LDHA 5BNTA 5L3ZA 4K26A 3KBOA 1ADBA 1B8VA 2E48A 3Q9UA 1ENYA 4K6FA 4P22A 1Y5MA 1V6AA 4A03A 3RIHA 3IDSA 3E9MA 4BO5A 4UREA 2R00C 2ZB8A 1RYEA 4MIOA 3K73O 4NU6A 2Q3EA 2YV2A 3NKLA 2WYVA 5BR7A 2C2XA 1T24A 4DLLA 1S7CA 1PWZA 3ZWYA 4PZCA 3BXXA 3KZVA 2A92A 4FPXA 3AUSA 1PTJA 3JQ7A 1NBOA 2NTNA 1U2DA 1ZK4A 5COQA 3RJ5A 4ZJUA 1XSEA 2NVBA 4R9SA 4DIBA 1Y5RA 3GLQA 4UVGA 4JJIA 3VKVA 4IJVA 3PFFA 1U3TA 2ZIZA 4AICA 5KOIA 3VKUA 3GNQA 2G5CA 1O8CA 4JP3A 3LT0A 4M86A 1NFFA 3QJ5A 1R37A 1YL7A 1RYDA 2O3QA 3NAQA 3H9JA 3PPIA 4KTTE 4WKGA 5I7EA 2VHXA 4R5HA 4LVCA 3KEQA 4JXKA 3ICCA 3SJ7A 3U4HA 3MOIA 4DLAA 4DWVA 1IHYA 3W4JA 3QIVA 4G5HA 2BRUA 3DB2A 1Q0LA 3I6QA 3Q9NA 1HE4A 3WG9A 5HA5A 4BO7A 4ZGWA 4DBVO 1GPDG 5HM8A 4LVUA 3HFSA 4NNJA 4FOSA 4E2YA 2JCYA 2GRAA 5I9MA 1E5QA 1FDWA 5CAEA 3ZWXA 4NK4A 3O8QA 3GN2A 3T7EA 5EJ2A 3DMTA 3R3JA 1GEGA 4YQZA 4HXYA 1U2GA 4YAKA 1Y9EA 3VPXA 4CMKA 2O4UX 3GPIA 4GMFA 4TWRA 3WX0A 4BKPA 4PLCA 4CM3A 4GAEA 1V35A 1QYWA 5K9ZA 5HBRA 3WJ7A 1NAHA 1ZK2A 2ZB3A 1GAEO 4XRRA 5IG2A 3VDRA 2JAHA 2W2KB 1M76A 3ON5A 4NMHA 3T7CA 3S2EA 2B4RO 3ETGA 2PH5A 4KUHA 3I9OA 4PVCA 1QSGA 3BTVA 4X54A 2Y1OA 4XQGA 1IPFA 3I3OA 3VPGA 1HE3A 4K9DA 2Q1SA 1WMBA 2BMAA 3GQVA 1I5RA 3L07A 2E82A 4J7XA 1A5ZA 1B0AA 3GMDA 2VYVD 2PZLA 3DBHB 4LSMA 2QX7A 3U0BA 4M1QA 2PZKA 2VYNA 1EBFA 1Y6JA 4R51A 5JCJA 4BNZA 4F46A 1DOHA 1B8PA 5KJCA 3M6IA 3D0OA 1P45A 2HDHA 1PS9A 1UJMA 4R16A 4UEKA 3ASUA 2Y05A 1EBUA 3JQBA 5HS6A 1UZMA 4FDAA 3OEWA 3QHAA 2X5OA 1ZXLA 2HJSA 2TMGA 1FF9A 2FRDA 2CDBA 3A06A 1IY8A 4OYRA 5I7SA 4CMGA 4R41A 1H93A 4ALLA 2GZ1A 2CD9A 3JQ8A 3CZRA 5DCWA 1Q7BA 2E4AA 4B79A 1I3LA 4GVLA 3WS7A 2IEBA 4M49A 1LXCA 1XELA 1D8AA 1C3VA 3ZU5A 3MZ0A 4YBZA 3GNTA 4HV4A 1T4DA 4AJEA 4IPTA 1E6EA 1ZCJA 4RGBA 1ZVMA 4ZQEA 2E49A 5KKCA 3JCZA 2FZWA 1PX0A 1D1TA 1B2LA 4WLVA 3JQCA 4EI2A 5L4NA 1BDMA 4D0RA 4RF5A 3Q1LA 3L0DA 1N9GA 5A9SB 3V1TC 1X7GA 3RSHA 1KY5A 4YJFA 1WWKA 1U28A 3KVOA 3EUWA 1CQJA 2GN8A 2WE7A 4OSPA 5KKAA 1DC6A 4J9VA 2HMSA 5IDXA 4E3ZA 4MVJM 4CM8A 4AJ4A 4BL5A 3GRKA 4J1QA 2GDZA 3TZKA 3DZBA 3JD4A 2H63A 1MC5A 4XWYA 5EN4A 4A7PA 1R0LA 1VC2A 3KLMX 4YJGB 3RCBA 4IS3A 1LDGA 1ZIDA 3IMFA 1HETA 3INGA 4XB2A 2HRZA 3DTTA 1R4MB 2CSUA 1SC6A 2EP7A 1C1DB 3D64A 2P68A 1JW9B 1N92A 4CPDA 3BMOB 4GGOA 3ZU4A 1MA0A 3D5QA 5L51A 3MTGA 4FQ8A 3TL3A 8ADHA 2B0JA 2E6UX 3DZHA 4E2XA 2IODA 4LN1A 3AM5A 2Y66A 2I3GA 3ZWCA 4YVFA 4CV2A 1V3VA 4RQTA 3OH8A 3OETA 1IPEA 1V3UA 4G65A 3AM4A 3KXDA 4KMSA 2BFOA 5CDUA 1S6YA 3IKVA 5DULA 2BI7A 5A5EA 1CWUA 2D4AA 2Q2QA 4XRGA 4KWIA 4DMMA 2E37A 4J4TA 3FPLA 4IMPA 4TRNA 3DONA 3K92A 3WWYA 2J3KA 2EKPA 4BMNA 1LJ8A 1O95A 2X5KO 3JQ6A 1XQ6A 5JNLA 1YJQA 1UAGA 2PV7A 3JTMA 4L4SA 4OHUA 4RZIA 3RC1A 4D46A 2IYOA 1C1XB 1DB3A 4MKZA 1FDSA 3JQ9A 2ET6A 4E5MA 4GWGA 2W90A 1QORA 4AFNA 2ZTMA 3AM3A 3JD3A 3FNGA 4UVDA 5TRTA 2AQ8A 3JQGB 4IINA 3K5PA 5JAQA 4E5YA 4ALJA 1TT5B 4W6ZA 3FHLA 4B4WA 4J16A 1IZ9A 5LCXA 5I8ZA 1BRMA 3K8ZA 4A26A 5FI5A 3B1JA 1RM4A 2X22A 1B3BA 1N1GA 3MJSA 2FPGA 3FCOA 2EG9A 2Q49A 1TVEA 1X0VA 1YL6A 4L75A 2OUIA 2GN4A 3GFGA 5BSEA 1BG6A 1NQ5A 3C7CB 3UHAA 2HSDA 4GGPA 3EGOA 1P77A 2HO5A 3VOSA 1LEHA 2PD6A 4TVBA 1XU9A 1KEUA 2WM3A 3V1UA 1B7GO 3L6OO 3FI9A 1WDLA 4GLLA 1H0KA 4KQXA 5JC8A 4NJMB 4FFMA 4E0BA 3KYDA 5CG1A 1PQUA 1P33A 3RAJA 4FW8A 3WTBA 1LQUA 5A02A 1OFGA 2B69A 1LTHR 3AUAA 4RZHA 3DAPA 5CDTA 1E7MA 1FK8A 1LC0A 3PDJA 4H16A 4AVYA 4CLEA 4BV9A 1QV7A 1EFKA 2R00A 2V6GA 4II3A 1YOVB 3ZV3A 3SVTA 2JD0A 3ANMA 1HF3A 4D45A 3ONEA 1KVRA 5DZSA 2Z5LA 1JDJA 1Q0HA 2AQKA 2FOIA 2GLXA 3GVHA 3WSVA 4CM6A 4EZBA 3MOGA 5AOVA 4BV8A 3E5MA 1Y8RB 3M2TA 1PWXA 1GPJA 1R6DA 4R1NA 4CM9D 4HKTA 1T1RA 3G17A 4FGSA 3W4KA 4ND1A 3ZV6A 1LDYA 3CMCO 1BDBA 4MIYA 4OAQA 3ZWOA 4QFCA 2Y0CA 4FS3A 3FSRA 1F14A 1AGNA 1VI2A 4PRKA 1EUZA 5GZ6A 3GZNA 2QRLA 4MVJF 4EYEA 2C59A 3OQ6A 5A9RA 5L4LA 3NGLA 4CV3A 1U3WA 4H3VA 4J4BA 2CF5A 3A28A 4A73A 4BNGA 2X0JA 3F4BA 5KCZA 1MG0A 1P1HA 1UXIA 2NACA 4DPMA 1MUUA 3ZNPA 4EJMA 1UUFA 3AY6A 5U1PA 1RM0A 1B14A 3AU9A 4GWKA 3JQ7B 4MIEA 4BMSA 3P19A 3U5TA 5JO9A 4TSKA 2EGHA 2NVWA 4TRMA 1NYTA 2C5EA 5EQDA 1ZSVA 3IAHA 3OJEA 4YDRA 3X2FA 5JY1A 5CPBA 4JBHA 3LF1A 3RC2A 4E32A 4BNWA 3PXXA 1R0SA 3TZ6A 1KOLA 1ORRA 3TFQA 4DTIA 2NNLD 2O3JA 2CY0A 1HLPA 1PGOA 3NTQA 4O59O 3WGTA 1SBYA 3PWZA 1D4FA 1JVSA 4YQYA 4QTZA 3ETDA 1F12A 5AXBA 4BNHA 3H8VA 5T8KC 3O03A 4EJ6A 5ER9A 1VL8A 2IXAA 3GUCA 4YAJA 1DLIA 1IZ0A 2FSVA 4BO9A 3AI2A 3BMNA 4L8VA 3GF4A 4TKMA 4DGSA 1KVUA 3VZPA 1VLLA 4FFRA 3PHGA 4BNIA 2BD0A 1NASA 3JYLA 2HK7A 2J8ZA 3QA9A 4IZIA 2WJPA 4RVUA 1X7DA 2JD2A 1A7AA 4J1NA 4G2NA 5DBIA 3IUSA 4JP2A 3OF2A 1BHSA 4QQRA 1CF2O 1DFHA 1GZ6A 1SZJG 2VHWA 2ZQZA 3Q6IA 3MJCA 2EHDA 3ZWMA 2PR2A 2I3AA 4N18A 1XCBA 4QFDA 1WDMA 3RJ9A 3T4XA 2CVZA 3GA0A 1NVMB 5TS3A 3U49A 1ADGA 2OL4A 4XJSA 1T25A 2W4QA 1AXEA 1R0KA 5DP1A 4TVOA 3EVNA 3UCFA 1IYZA 1D7OA 2F00A 2C5AA 3ZHXA 1HEUA 1CQIA 4PIVA 4PN3A 5CG2A 4K1LA 3KM0A 1VJTA 3B6ZA 3K2EA 1N2SA 1GUZA 4ZQFA 5G0WA 3RD5A 1N5DA 2ZTVA 3DHYA 4O63O 1HE2A 4EUEA 4I9HA 3RI3A 5JW6A 4IQ0A 5TJHA 4WE3A 3ITKA 1K89A 1MGOA 2OZPA 1HDCA 4DIOA 3WICA 4IBOA 3FR8A 1ISJA 1ISIA 3INTA 1DAPA 3QWIA 2WYWA 1N8KA 3I1JA 4YACA 2DBVO 4BNFA 1OBFO 5G0UA 1LRLA 4AG3A 5JXWA 4PLTA 2EF1A 3B70A 3FD8A 5DCUA 3ZCXA 4Q39A 4DYVA 2YHIB 1WLYA 3S1LA 1E7RA 3MJTA 3OIFA 5CEFA 1YBMA 2B83A 3JQ8B 3BAZA 3DBRB 1ONOA 1U3UA 2A35A 4O0LA 2DFVA 3AY7A 3NX4A 4I8XA 4XB1A 1Z73A 3RFXA 4BB6A 3NTRA 4XYLA 3GVXA 3PTZA 2JFHA 3ZZNA 1X14A 1MXFA 3RU9A 3WIEA 1NPYA 3GFBA 4B4VA 3HN7A 4XA8A 3GHHA 1ISMA 2X0NA 4AJNA 4JBGA 5JDCC 1N9GB 3PLNA 2UV8A 1ZO8A 3WGOA 3MEQA 4WPGA 4L73A 4M55A 3L6DA 1W8DA 3GEMA 2NTVA 3UKOA 2POQX 3VVCA 1YKFA 3PWKA 1U3VA 4FJ0A 2I6TA 3FPCA 4YJHA 3WQRA 3N74A 1FDUA 5F5LA 4CLXA 1HDXA 1DC4A 3L6EA 3UF0A 3LVFO 3TZQA 1DDOA 1QKIA 5L45A 4DPKA 3AI3A 3FWNA 4E5KA 1SEPA 2P4QA 4NQZA 2VYND 5THQA 5JCJD 3P2YA 4L4RA 3JQDA 3PP8A 1HDOA 3QV1A 4CUJA 4DMLA 3RUHA 3S2IA 3HSKA 1MXHA 1E3IA 4Y9DA 1KVQA 2B36A 2P9EA 1H2HA 3COSA 3I52A 4MVJA 4R1SA 4QT0A 5HS4A 1DPGA 1XG5A 3HUDA 4YRDA 3VZQA 4C7KA 2GO1A 2WTBA 4FBGA 3RBZA 2HQ1A 4GSLA 3RFVA 1P1KA 3QQPA 4EGFA 2D0IA 1C0KA 3HFGA 1Q2XA 1LSJA 4I9NA 3KUXA 3SXPA 5BT9A 3U09A 4CQLA 3UN1A 1HKUA 4DPLA 4GX5A 1A9YA 4RPJA 5IF3A 2VOJA 2EWMA 3BMCB 1MP0A 4H7PA 3DEYX 1P1FA 5CEJA 1KYQA 2X0IA 4E21A 2OORA 4NIMA 2HLPA 3PYMA 2V6BA 4N5LA 4GBJA 1WP4A 2Y0EA 3DDNA 2YZ7A 3GDGA 3RUAA 4OM8A 3I9NA 1E3WA 1P9LA 1NVTA 3IJRA 1MX3A 4CMHA 1H9AA 2VRBA 2DQ4A 4QXMA 4TQGA 3KB6A 3G79A 4NU5A 3D3EA 1CJCA 1G6KA 4WCFB 4EUHA 1EQ2A 4N54A 5THKA 2Q1TA 5GZ3A 3QSGA 4Y6PA 3PYLA 3GY0A 4IDCA 3W6ZA 2YQ4A 4OXNA 1PR3A 1OMOA 2QHXA 4NK5A 3RUIA 1AHHA 3GC6A 1BVRA 4DUPA 3BHIA 4Q3NA 1GQQA 3BYZA 3D4PA 4WK6A 4BO6A 3NT2A 3VPHA 1P3DA 3PDUA 1XEAA 4FFPA 3LC7O 2BI8A 1ZK1A 4QSMA 4CMIB 1L1FA 4OQZA 1KBZA 2ZATA 3NYWA 4PG6A 3KYDB 1YBAA 2PTGA 1NTOA 3VTFA 1UP6A 3U3XA 3ICPA 3U4CA 2ZKLA 3OJOA 4O5OA 3KTDA 5KTKA 1ZZEA 2Q2VA 3K2BA 2PWZA 3R3SA 3LQFA 5A05A 5G2OA 4J90A 3VTZA 4BKOA 4F45A 1DIAA 1DFIA 1LLUA 2H1SA 5JE8A 3CH6A 1Y1PA 1E7SA 3GH3A 2RH8A 1PS0A 4TKLA 1Z7BA 2OP1A 4YRAA 3MJEA 4QECA 2X6TA 1WVGA 1AE1A 1DRVA 4XCVA 4KP7A 3ZWWA 2P4HX 1YS4A 1V0JA 3IJPA 1O94A 1VKNA 1QLJA 1NP3A 2BH9A 4F6CA 4DC1A 3PRJA 3WMWA 2HKIA 4ND5A 4ZRMA 2VTEA 4DXHA 3W1VA 4NBRA 2GNAA 3AI1A 2I99A 3RFTA 2WD7A 2PNFA 3OJFA 3TDKA 9LDTA 1GCOA 3OM9A 2Q50A 5A06A 5T57A 1W6UA 1LSOA 2B4QA 3TF5A 4Q3DA 2B35A 4AJ1A 3I83A 3VZSA 4IZHA 2Y99A 3PHJA 4BNTA 3H4VA 2P5YA 3MTJA 4LMPA 5KWEA 4WNCA 2O3TA 1GV0A 1A7KA 4OXKA 5H81A 1OC4A 5AXCA 5J23A 1NVGA 4YT4A 4NJOA 1NQTA 1GTMA 2P9GA 3KRTA 5DF1A 1XHLA 4RF2A 2EGGA 1PZFA 5JY6A 4KTVE 2O48X 1U1IA 2BFAA 1QR6A 1DBVO 2DTEA 3WSWA 3CXRA 4MPDA 4WJZA 3C3XA 3DBVO 1E6UA 4U8GA 1EEHA 3QY9A 1RKXA 2PK3A 2G76A 4EITA 4LW8A 4D42A 3A14A 1BW9B 1P1RA 4BS9A 3JQAA 1R4NB 4M54A 5CP8A 1YL5A 1E1LA 2XOXA 3WQSB 3BMNB 3HG7A 5TX7A 1DEHA 1J6UA 1LC3A 2D3TA 4N5NA 4XX0A 1C0PA 2BFMA 4BO3A 1OOEA 3CPSA 1EDOA 1MB4A 5T5QA 1KVSA 4B3IA 1I33A 4XD2A 2Z95A 4OQYA 3I9MA 4XIJA 2VT3A 3ONFA 3ST7A 4I5GA 4B3JA 9LDBA 4EUFA 1YO6A 3EK2A 5IJZA 4RCVA 1TT7A 3AW9A 5FI3A 3WJAA 4Z0HO 4KWHA 3AOEC 2VQ3A 1XLTA 2ZYGA 4NHEA 3TOXA 5L7WA 4NG5A 4ZN6A 7MDHA 5EIOA 4WLFA 4XYEA 4ZA2A 1LLQA 4CLOB 1ZH8A 4W7HA 4M8SA 1Z45A 3BZUA 5G0VA 4XJTA 1ULUA 2XXBA 4CMAA 2GCGA 1XIVA 4LSWA 1KY4A 3FWZA 1FMCA 1O89A 3QWHA 5ENVA 2B37A 2DT5A 3RROA 4KZPA 3NJ8A 2NU7A 4W82A 1H6DA 2AXQA 3FRJA 4Z0PA 5C7OO 4MP8A 2CZCA 3EMKA 1E3SA 2DPGA 1LDBA 2G0TA 1JWBB 4U6SA 2ZB4A 4YTEA 5BNFA 1DIBA 4CLRA 1VL6A 2VHVA 1T2FA 3L9XA 2DTXA 1F8FA 5GMOA 5GY7A 3UCXA 1H5QA 3VVBA 1B3RA 1NPTO 4DC0A 2EEZA 3NJ4A 3L9WA 3ZHZA 4MDHA 3QWBA 5DCYA 4MKRA 5JBIA 4YPOA 5JDCA 3F5SA 4MVJG 4RJTA 2J3IA 3ASVA 1HYEA 2PZJA 5JPIA 4D3SA 4PLYA 4PG8A 1DHTA 2AE2A 2HUNA 2P91A 3JV7A 1Y81A 5L53A 5HRUA 1QMGA 4N5MA 2NUAA 1HDYA 3ADOA 4XEHA 3JD2A 4CLDA 3RUFA 3LDHA 2NLOA 4TRJA 3JYNA 1ONPA 1DIGA 3ENNA 3S8MA 4CLHA 2VNSA 1DO8A 3ZH2A 2DTDA 2C7VA 4YCAA 2H5LA 4ZQBA 1ZJYA 1J4AA 4RF3A 1V3TA 2EIHA 4C4OA 4BNMA 1WZIA 1K0UA 1SCUA 3F6YA 2NVUB 2QZZA 1XGKA 3H3FA 3GVCA 3W8EA 1UP4A 1YBVA 2O4CA 2YUTA 3F47A 3IS3A 1ZEMA 4JNKA 5TC4A 3S55A 2GR9A 4ITUA 1ONNA 3WGGA 1EUDA 3L4SO 3D4NA 4GPD1 3W4IA 1JQBA 1SOVA 2ZB7A 5A1TA 1PJ3A 2XAAA 4JJGA 4KUGA 2JKVA 4O1MA 5CEEA 4J49A 4J4HA 3Q3CA 3AY3A 1HL3A 1JTVA 1PL6A 1U7TA 1HYGA 4I08A 3HDHA 2A9FA 4R68A 4RORA 4CQMA 4CUKA 2IRWA 4RQUA 3RU7A 2CDCA 5JDIA 2QRKA 3GUYA 1ZBQA 3G49A 4R9RA 2GYYA 3IOYA 4JLWA 4YJDA 3H5RA 2RIRA 1CDOA 1NQOA 4JBIA 3VPFA 4W4TA 3BTOA 1Y8QB 5ER6A 2VNAA 1B16A 2JHFA 1E3JA 4IS2A 1UDAA 3BHJA 4PLZA 2WDZA 2I5PO 2O3RA 3CKYA 3H5AA 1T2DA 4ZQGA 1P31A 4PLGA 4CR8A 3PGXA 1PIWA 2PKQO 3DFUA 3OHSX 2Y67A 4I5EA 3TSCA 2BELA 3L4BC 4CQLB 1ARZA 4R4JA 2VWGA 5AXDA 2X0RA 3P5SA 1LDNA 1OAAA 8LDHA 4PLWA 1PL8A 1JKJA 1GCUA 2GN6A 3PJFA 1BVUA 2I66A 3NV9A 3O4RA 4ILKA 1P1JA 1OI7A 5LC1A 2UAGA 1Z6ZA 2EXXA 4AJJA 1KETA 1I01A 4HFRA 4ZRNA 1E3WB 4KQWA 5TLSA 4ND2A 3WLEA 4CMCA 4RVHA 4NPCA 1TA4A 1GQ2A 4P4LA 4BQRA 4CM7A 5ILOA 1EE9A 4D3FA 3KHUA 5I8WA 3DZGA 3QVTA 4KDEA 1YB4A 1LI4A 4ID9A 4U0JA 2Y1FA 1D1SA 4DBZA 4UVIA 2EW2A 4NZ9A 2X4GA 1IL0A 2IYPA 3LYLA 3WQQA 5JAIA 4XDYA 5ITVA 3WOHA 3GEGA 5DP2A 3V5NA 3JQFC 2VTDA 1ENOA 3HN2A 3FNEA 4LK3A 1SNYA 5KJ6A 4CMEA 4EW6A 5KIAA 3SC6A 4CL3A 1W4ZA 3NDRA 4Q3EA 4MP3A 3I4CA 5IFLA 2ZTLA 2W2LA 1I30A 3O9ZA 1HDZA 1U8FO 4MVJD 3RVDA 2JL1A 1K6IA 2AQIA 1VPDA 2OGUA 3B1FA 3HNPA 4R54A 1XA0A 3DZIA 4DIFA 1LRJA 3OP4A 1U8XX 2XF8A 3C8MA 1ZNQO 1WXDA 3AFNA 3ONDA 3PHHA 4J3FA 1YQGA 3EZLA 3NDJA 2FSSA 5EQFA 3D3WA 1YDWA 1F0YA 1YJ8A 2DC1A 2BLLA 2GD1O 2NTJA 4BQPA 4HP8A 4AJHA 1VJ1A 2ZK7A 4JK3A 5H82A 1WPQA 1ML3A 4HUJA 5IDWA 3VC7A 1SEVA 4B8ZA 1CERA 5U4QA 1WNTA 4UUPA 2P5UA 4RL6A 4XR4A 5DN9A 3VDQA 2BF7A 4DL9A 5BQFA 1SB9A 1DJQA 4OKIA 1BXZA 3VPSA 3UOGA 3LLSA 2Y1CA 1NAIA 4RV9A 2YDXA 3MWDB 5TF4A 5JO0A 3F9IA 3BMQA 4PZEA 4IGFA 3DBLA 2QQ5A 4URFA 1UH5A 4WEQA 4Y8VA 3WB9A 4KDFA 3RASA 3GPDG 2GERA 4B7UA 1Z7EA 4HNGA 3EZYA 4NI5A 2OMEA 2RBEA 1B15A 2V65A 3GGOA 3PWSA 3HDQA 2DFDA 1AXGA 4LMRA 4Z9FA 1FDTA 3LSYA 2YW9A 3LF2A 3PGJA 3G0OA 2WSBA 3PK0A 5EINA 3Q2IA 4TZKA 1DXYA 4CV1A 1DRWA 4GH5A 2VZ0A 2NADA 1FDVA 4LISA 3ZW8A 1DFGA 2R2GA 4FFOA 4A5OA 3LZ6A 2CUKA 1MV8A 1GDHA 3F4LA 4JROA 3SJUA 7ADHA 1WZEA 3BIOA 3NGXA 5T67A 3W8DA 3DXFA 2JJYA 1DHRA 5F5NA 2C20A 1EMDA 1NHWA 3AOEA 1E1MA 3CTMA 2IZ1A 2HMUA 1VL0A 1A72A 2FWMX 2GPTA 4AJLA 2EKLA 3K30A 5FFFA 1VSVA 1DIRA 5JYEA 3GOHA 3O8QB 1I2BA 1WMAA 2BHLA 4NR0A 1MC4A 3I4FA 2PFGA 1X1EA 4IGEA 1I24A 5TNXA 2QRJA 1DC5A 1LSSA 2O7SA 2RCYA 4YT2A 4I5FA 3D1LA 3PLRA 3HWRA 3DO5A 1PQWA 4L74A 4FB5A 3ANLA 3ZNQA 4BHTA 2YQ5A 4RO0A 3K9QO 4Y67A 3OQBA 3V1YA 1PZHA 1LBEA 2AQHA 1GYRA 4BO8A 4CL8A 4Y98A 5AYVA 4EEXA 2GGSA 4N7RA 1KIFA 2X9VA 3FNHA 3DL2A 5COBA 1GADO 1HRDA 1ZSYA 1PU2A 1HT0A 2QYTA 1NWHA 3DOJA 1XDWA 2I65A 1F06A 1LRKA 1A71A 5TGDA 2JFGA 4P4NA 1BXGA 5ILGA 1SO8A 3NTOA 5EMHA 3RQSA 1J0XO 1SAYA 3DQPA 5KNLA 5CDYA 1BGVA 3AFMA 3KOUA 4G81A 3G1TA 3ITDA 2W2KA 3GT0A 2AG5A 2AE1A 3C24A 4WLOA 1GEEA 2VN8A 1R12A 5A03A 2WYUA 3P7MA 4WOKA 5B4UA 5DT9A 3DMTC 1ENPA 3E1KA 4P8RA 3WGHA 3L77A 3PQDA 2GZ2A 3F46A 3ZWVA 1E7QA 2FPIA 5I7VA 1NFQA 3DBHA 1ADCA 1T2EA 4FC7A 1OZAA 1KC3A 5ICMA 2BGKA 3JQAD 3KSUA 1YDEA 5TSDA 3OICA 4IJWA 3WYCA 4ALIA 5L7YA 1ZMTA 1Z74A 5F1OA 4ZVVA 1OC2A 2IXBA 3UGKA 3DFZA 4IXWA 2O3SA 4E5PA 2HMWA 5C37A 3HADA 2O2SA 2NV6A 1K5HA 1R66A 1K6XA 3QP9A 5F3RA 1PSDA 3ANNA 4PLFA 4YJFB 4UAGA 4W9NC 4BNJA 4E30A 1K2WA 4RDHA 5L7TA 3QW2A 4Y6RA 5TT1A 4YT5A 1ADFA 5FEUA 2Q4BA 3OMLA 4CM8B 4WUVA 4JQCA 1U4OA 2QZ9A 3JQBC 5C5IA 5IDQA 3RUDA 1JAXA 1I2CA 4IXTA 5JLAA 2C54A 1T26A 3GR6A 3E9NA 2UUOA 5AQ1A 1T4BA 3PJGA 5A9SA 4LRTB 3Q2KA 4J91A 5COAA 1T2CA 3JQEA 3R0IA 5B4TA 2JCVA 2C29D 4JGBA 2OXIA 3G1UA 4WGGA 1DIHA 2DVMA 4FC6A 1GQYA 4BNYA 2VWPA 2X86A 2YYYA 3C1OA 3L4BA 3QE3A 2UDPA 4GSKA 1VSUA 3C1AA 1LUAA 1VM6A 3QVSA 2EW8A 3MWEB 4LRSB 3H6KA 4J9UE 4CODB 4E5NA 2AG8A 4YJGA 3WNVA 1M66A 5BNIA 1A4IA 4IM7A 3FBTA 1LLDA 2JAPA 4Q3CA 2AMFA 3QVXA 1IOLA 3WGIA 3ENKA 1PS8A 5AVOA 1DC3A 3X2EA 1X7HA 1X0XA 2HMTA 3BMOA 1YWGO 4FR5A 3V2GA 3SC4A 3W6UA 4RPHA 1GFSA 1F17A 1X13A 1XQ1A 2OFPA 4HFMA 1MFPA 5CDGA 4XQEA 2O23A 4BO1A 1EFLA 4CV0A 2ZJ0A 1PJ2A 3IQDB 3FN4A 3IKTA 2GASA 4JIGA 5G4LA 3HQ4O 4E2WA 4ALMA 2AW5A 3DTYA 5EL0A 1NX6A 4BGEA 5IZCC 1AN9A 2H6EA 3UVEA 1EK5A 3PZRA 5A04A 3WNQA 5BSFA 5IDYA 4RLHA 3UXYA 2DM6A 3GHYA 1PJLA 4WLNA 2Q45A 4BNVA 1UDBA 2D8AA 1UDCA 1PZGA 2V6MA 3AJRA 3A1NA 2Q1WA 3C1TA 4XIYA 3ZHYA 4CR7A 2QG4A 3GG9A 3GAFA 3LC1O 1KEWA 4BOYA 4XGKA 3KETA 1Y9AA 4HFNA 2FP4A 1H9BA 1LDEA 1ZW1A 3CMMA 2ZCUA 1C1XA 4RPLA 3ZWPA 2J3HA 1V9LA 3GRPA 3WXBA 3RBVA 2YFHA 2P2SA 3VH3A 1I32A 4YR9A 2UVDA 3C85A 4KOAA 1LNQA 1VKOA 5H83A 1HXHA 3JQGA 3OA0A 3SLGA 4CQMD 3M1LA 1GZ3A 1TT5A 3DZFA 3HJAA 4HADA 3ZWAA 1N1EA 1TXGA 2GZ3A 2V7PA 2A4KA 1E7YA 1J49A 1X15A 1YQDA 1UXKA 4PLVA 1PL7A 3TRIA 1XWFA 1JA9A 3WBBA 2VHYA 1JU9A 4BNXA 1SB8A 3GN1A 5TJ9A 3ZDFA 5I7FA 4CM4A 4TROA 2FPPA 3JQ9C 4FN4A 4YB8A 1Q7GA 5JCXA 1QYVA 4ROSA 2DU8A 2ZTUA 2J5KA 2RH4A 3H7AA 2CDAA 1SMKA 4E6PA 1CETA 4R3NA 1HLDA 4HBGA 1PGQA 3WBFA 2EJVA 4NJMA 1A4UA 2YV3A 3F1LA 1HYHA 4D43A 1E1NA 2DLDA 3M2PA 3IC5A 2PZMA 4L76A 4WCFC 3VZRA 5F1KA 3D3WB 4L0QA 2VRCA 3EC7A 4WOJA 4FFNA 3GMSA 3OJ0A 1UXHA 1YH3A 4GLOA 4NBTA 4S3MA 4NBVA 2EJWA 2RHCA 5DNAA 5K0ZA 3PHLA 2Y68A 3PZBA 5C7LO 3GZNB 3GZ4A 3EYWA 4IDFA 2B5WA 1GL3A 2I76A 1DLJA 1E92A 3GDOA 1C0IA 1Y8RA 2HMVA 3KO8A 1K6JA 4J1SA 4Z3DA 3DBLB 4DRYA 2F1KA 4PVDA 1UP7A 5ES3A 3V2HA 4ZD6A 3E03A 4K28A 3WGYA 1GUFA 5T8KA 1BTOA 1HTBA 1I0ZA 1Q7CA 4HWKA 1ZK0A 2X8LA 3ZNOA 4MOWA 1RJWA 4WEOA 4XYBA 3TN7A 1Z82A 1A27A 3GVPA 5DOVA 5FF9A 4D7AA 1WW8A 3PI7A 2X9GA 2AEFA 3ROMA 4B3HA 3UH1A 2IEDA 2W2LD 4IMRA 4FJ2A 2Z1NA 3F1KA 3RC7A 3EDMA 3HDJA 5KJFA 5IAAA 3K6JA 1AUPA 1ZSNA 3KYBA 2X5JO 4DQVA 2PA3A 3ORFA 1UXJA 2LDBA 3S2GA 4CUZA 1GD1O 2LDXA 2Q2WA 4YAGA 4Z9XA 3H9QA 2P9CA 1T2AA 3IUPA 4R69A 3UUWA 2OBNA 1QXSA 1M75A 2NU6A 3DAGA 1RM3A 1SPXA 4BKUA 1H6BA 2BGLA 3ZW9A 4ALNA 3H2ZA 5JYDA 1JKIA 1IE3A 2YY7A 4RPKA 4NFHA 3WYEA 2VUSA 2DAPA 1U4SA 1VJ0A 2WWRA 4AJIA 2AHRA 5B37A 1IB6A 1PJQA 1I3NA 4JCOA 4QO7A 4BGVA 1U9JA 1G0OA 4M89A 1TLTA 4F3YA 4RVFA 2G1UA 2YHUA 3PIDA 4WASA 2X23A 3RUEA 5ADHA 1TB4A 3DOOA 1RM5A 3FTPA 1BXGB 2O7QA 5B12A 3ROPA 4DQXA 4DYDA 5C3MA 1BMDA 1E3LA 2HK9A 3N7UA 4GQAA 4HFJA 1E5LA 1TEHA 4HY3A 2JHGA 3EHEA 3HHPA 3GNSA 1JLLA 2NQ8A 1PJSA 5G0TA 3H9GA 2HCTA 1E77A 1HSOA 4D0SA 1XYGA 3UW3A 5JAZA 4FGWA 2Y1GA 1IUKA 2YJZA 3I9LA 1MG5A 2EKQA 4I1IA 5LDHA 4RF4A 1E3EA 3E9QA 4MVJH 2NQTA 4J7CA 3N58A 2PD4A 4OJNA
chains in the Genus database with same CATH superfamily
4GX1A 2V5AA 4W9NA 2V7GA 1USWA 2ZITA 1DTWA 1XEXA 2JBAA 4QWWA 4UUNA 3TUJC 1EVYA 2A5DA 2NG1A 1QZZA 3HYTA 4W7IA 4MR7B 4ND3A 1ZL0A 4EFKA 3G8YA 5TPWA 1CQPA 1YDHA 1GG2A 2I71A 2A59A 3NRCA 4PS0A 4U5QA 2IWHA 2BMWA 4DCUA 2RHGB 2UVQA 4Z8XA 4QGFA 1WUHS 1GA6A 3IVRA 4F5EA 4A0FA 5B2FA 5BW4A 3D5TA 3INRA 5MGBA 4GL4A 4G5OA 2CNBA 3PL1A 1UBGA 1I2ZA 4BEBA 3CUEF 1KQNA 3EWSA 5E1BA 5FHRA 3E8XA 1AV7A 2F4NA 1GGFA 2ICAA 3K96A 3QBTA 4C7OA 2YMQA 4OJMX 3AUTA 2P0EA 3O8OA 5D6OA 4AZWA 4RLSA 1ZJZA 1EFTA 4NAVA 1GKKA 4HDKA 3DHEA 1WPXA 4I1YA 4F0JA 4PQEA 4JDUA 2FMHA 1LPAB 5FUWA 3UWMA 1O4WA 1RBMA 1YA6A 2D0PB 5GTDA 3KFLA 3GO4A 2AOVA 1QUFA 5CA0A 3MPUA 4YIHA 5FDFA 3SVZA 1CUBA 4DV3B 3D7LA 4LYDA 5CFPA 1FVFA 4PNHA 1KERA 2BMDA 5I8PA 3FAZA 3N70A 1YVEI 1UF9A 3B13B 3R0VA 2QJFA 1JDUA 1ZXXA 1L7MA 3CF6R 1R9MA 5K3DA 1E6WA 1HQKA 2WUDA 4F4DA 1N5OX 3B7GA 1DMSA 3NR2A 3R3YA 3QKRA 3H4TA 3I6BA 5IZ4A 5JC1A 3BRCA 1YFKA 2QLBA 5ALZA 1U5BB 4M1TA 3GGGA 1FMLA 3TI7A 4ASUA 3TX2A 1ELOA 1KI8A 1B8UA 4OFWA 4DG5A 3N6VA 3G89A 4LXYA 5JMPA 3D43A 5IZCA 1MX9A 2I4RA 2Y93A 4CMBA 2O8BA 2QQFA 1DARA 1PNRA 3LQKA 3C8HA 2CFTA 3A11A 1YQTA 4KPUA 4PV7A 2XCTB 1G8GA 4Z8YA 1C3EA 1PGNA 1XD2A 3E5RA 5C7YA 1JDPA 3HB9A 3OFND 1WS6A 1EFDN 4ARZA 3LECA 5KSOA 2A0XA 1TO2E 3IP3A 4QAJA 4YRQA 3RHFA 4D9BA 4OLAA 4U2KA 2P5TB 4R1LA 4V1CB 4FHCA 1G9SA 1A9QA 4OA5A 3BICA 3ULKA 3NUGA 1CR1A 2C92A 1XK7A 2GSWA 1L7EA 3IE0A 4BNLA 3TGPA 2AWNA 3QBEA 3KOXA 4XVRA 4XYGA 1DAKA 4XPIB 2FDRA 5AVVA 5JRDS 2QTVA 2ZSHA 1AXRA 1LQTA 4EQ6A 4HDOB 2CKDA 1ZK3A 3I1FA 3I6ZA 1T1SA 3R3XA 1QQTA 1S3SA 3U3DA 1YXMA 3ID6C 1KE1A 1YZFA 2BTEA 2WJ3A 3A6HA 3PRKE 2D4HA 5LDDC 5MHTA 2I7CA 4HYQA 4R5MA 2WMNB 2L2QA 4MUBA 4JX8A 1QIDA 4J8PA 4YS6A 4ZVQA 3WMXA 1WVMA 3OMXA 3I9KA 3WZ2A 3OBBA 4DA9A 2D06A 3COZA 1IDN1 4RMGA 4Z0TA 2Q1UA 1E9CA 4NH4A 1BWQA 1O5IA 2ECQA 4R1TA 3PYXA 2R85A 1JKFA 4ML3A 1EHYA 4FMDF 4U7FA 3V00A 5AJXA 1QTIA 3NHZA 4KXNA 4EG8A 4ZOLB 4TM8A 1U8ZA 2W6ID 1P0QA 1W52X 1P7YA 3QEKA 2IUUA 1IQRA 3B6EA 4NAUA 3KQSA 1A4XA 1MJNA 4HZUA 2Z09A 4P4GA 5A9TA 3RR2A 2O0HA 4DLUA 1ZIPA 4PC7A 2GN9A 8ABPA 4ZO9A 2TMYA 3B38A 2ZP1A 3ONVA 4RA6A 1NVEA 1OKKA 3BWMA 3OOHA 3W1WA 5F3DA 3WMFA 1AKTA 2X41A 2XE8A 3G59A 1H66A 4WCFA 5EJMA 1Z5WA 4UQPA 5BOVA 4UU7A 3F5MA 2WKQA 1SBTA 2OG2A 2OYCA 4ZODA 5KYYA 2O8VA 1IDOA 4MKXA 4QXPA 2VR1A 2ZIGA 3T35A 4CM1A 2OORC 1QG2A 1U7HA 3BF7A 1YE3A 5IXYA 3A2KA 1PJBA 1TO6A 3QG1A 4K3UA 3TD6A 5HE9A 3DVSX 4RF4A 3DZDA 4W5HA 2PLAA 5B1DA 5K3CA 2H54A 1ZA2A 1RXCA 2HX1A 3A70A 2FMUA 2VWHA 4FKZA 4IJ6A 4OLJA 5DNEA 3WKAA 1L9KA 1ZAKA 3WP1B 4O29A 3VAZA 4IDDA 2NSDA 4YP1A 3VOBA 1GO2A 2CV1A 2QN8A 4L2IB 4U7TB 3JWIA 3R2JA 1FRFS 3U4AA 1TC2A 4MWBA 1M6NA 2FR1A 3OFSA 2CMDA 4QICA 2RHRA 3O73A 5C1IA 1CCWA 4GX0A 5IABA 4OL9A 1BXKA 1M6WA 1ZISA 2D2IA 2XLBA 4QELA 2LGJA 5C8DA 3GEEA 2QAGC 3JQPA 3PIIA 5BSKA 2WRZA 4GXNA 2RGEA 3MBOA 1YB5A 3PRHA 4R81A 3X0DA 2LR0A 3IVXA 1VZ2A 4JKOA 4UMEA 4GXQA 5T64A 5A1JA 1XPRA 3LU1A 3JS5A 2QR5A 4UU8A 1QHNA 4YJKA 2IZ0A 5ITWA 5BMOA 3NZEA 3UWOA 2QMQA 1ZGBA 5L9AA 1TECE 4G8BA 1GRNA 1LCIA 1V16A 4B8WA 1RPNA 2QX8A 5LDGA 5DK6A 2ZQYA 1OAKA 4XGNA 2NZUG 1EVZA 1NBAA 3NHUA 4WNIA 4MJ3A 1XUOA 2DWPA 5FTJA 1QIJA 3FSEA 1E9AA 3LK7A 4N6NA 3FJ1A 3ZDDA 3F5FA 4RZQA 3ZDCA 5C52B 3BWDD 3GFTA 2CFCA 5B3KA 4WI1A 2W4MA 3MGCA 1KHHA 3DKKA 3H42B 1A9XB 3OHPA 3VH1A 1JFFB 2C7GA 3T5AA 5J2UF 5KYUA 2IXGA 4RXUA 3TPCA 5ALFA 3PHBE 5E1MA 3W1EA 4H1UA 4RSHA 3DP7A 4B48A 1SUFA 3I5XA 2OFXA 5ALTA 1RYZA 1RBQA 2YWEA 4LVOA 3F2VA 1Z5GA 3C3CA 3R6LA 5KPJA 4C03A 1OAOA 1TE2A 3UPUA 2VYVA 1AM4D 2XRMA 3M81A 3O9MA 5T7BA 1IATA 4O4LB 3QUCA 2Q2OA 4IF6A 2FH5B 1N2BA 2W2OA 5CW2A 2IW3A 4D44A 5DVZA 2IE0A 1C4OA 3TWOA 4N7JA 2NU6B 3BIWA 1H2EA 1KYVA 2GPNA 3S2SA 4RVSA 5TT0A 1ORIA 2A1UA 2HF7A 4GEKA 1CR4A 3EYAA 2O57A 4F9TA 2F3PA 1UJCA 5KNBH 3QSYA 4RQBA 3Q7RA 1SWVA 4D4HA 2FQYA 1V8BA 2PG3A 2WTAA 5KOHA 1O57A 2P78A 3VDXA 5CFRA 4X7PA 5H3HA 3H99A 5IAKA 1C0LA 4QDKA 5F52A 3S2YA 4GE0A 1HZZA 1NLMA 2QE7A 3URKA 1WOYA 2EZTA 3UJCA 2DOKA 2ASVA 1YT5A 2TS1A 4DJJA 3QE2A 5EJAA 3AV3A 5REQA 1SQGA 3OX3A 4M6WA 1I8TA 1QYDA 2V7VA 3PDWA 1K6EA 3H2GA 4ZEOA 2HSJA 4W8GA 1HFKA 4A10A 3E7PA 1XTVA 2C07A 4H27A 1VRCA 1Q21A 1Q57A 4BNUA 5FBWB 4RTPA 1QRRA 1ZCBA 2ZRMA 4J0IA 2G04A 2HZBA 3AEQA 3L6CA 2FZLA 4B6SA 2CT8A 4RKWA 4A0QA 3H7AA 4LHEA 5U4XA 1GLGA 4HRXA 4W9RA 2QLTA 5K8LA 1XEFA 2V3WA 4IIJB 5C31A 5MF6A 5SZHB 2H9IA 4PZUA 5DLQC 4MV5A 3TAXA 4QEDA 1IULA 5EZSA 1H3NA 5JSFA 3I23A 3IBSA 3K9FC 1KH2A 3OWHA 4UMDA 4BMZA 2OP0A 3AZOA 4J0FA 1QWSA 4H9GA 4V0SA 4CLRB 1WW3A 1ISFA 2J9RA 1QH0A 3IRUA 5P21A 3RC3A 5ARDA 3RVQA 2OFOA 2PY6A 4RK5A 3K8YA 2OZLA 3ZCQA 3HEBA 3F3YA 1QRSA 5KVQA 4EVQA 2HXYA 3AI7A 3X3HA 3EVDA 4YCJA 1E0SA 3NO4A 4IVNA 2FX3A 1CV2A 5EHXA 1VJGA 3DEFA 5EHQA 2J4CA 2HCRA 4LDZA 1GVHA 4BEJA 2UVPA 4P35A 3AY0A 4BVLA 1EDBA 1EXNA 3TOZA 1IK4A 3R7WA 2J0QA 3H8JA 2AMJA 1F2TA 3KKZA 4Q3BA 3LT2A 1SKUA 3W5BA 3PCRB 5FA8A 1ZRNA 4OQXA 4U7WA 1GY8A 1O0SA 4W99A 5FPQA 1WY5A 1JU4A 1M34E 3PUJA 4D4GA 1SBZA 1VMAA 1WZUA 1RD4A 4II2A 4BWYA 3NATA 4XWKA 3HCEA 2MYNA 3PXGA 4FILA 3KFXA 1TKAA 2GM3A 2DSNA 3BXZA 1XQWA 2CLCX 3RBXA 1V9CA 2FWBA 221PA 2PAAA 3RUCA 1F8GA 2G07A 3PFGA 2QRVA 4Y3UA 2AI1A 4TYPA 1ZHHA 5ICSA 2O2JA 3UK1A 2CL0X 4TSRA 2XZOA 2ZRNA 3H9CA 5CX4A 2IS4A 4Q19A 1E4VA 1PGJA 1KF0A 3D6AA 4PG4A 1E1QA 1LLCA 2G7ZA 5C4MA 5JZVA 1HNZB 3OZEA 4DWOA 4RPGA 4AURA 2WJ6A 2X8JB 1TQ6A 4I9UA 3LXXA 3CR3C 2QUBA 4OTZA 4P93A 4FIZA 3TXAA 3ZD9A 3UAYA 2JGLA 1ZUWA 2CV0A 2AHOA 4JI3B 3SBOA 4FKMA 1CRWG 3A4MA 5LVAA 2LNDA 3LCCA 1R0YA 2VYFA 3CH4B 3CONA 5BN3B 3CRQA 4UM9B 3C3PA 2BFCA 4R3WA 2PBZA 5DNUA 4YH1A 2J46A 2WV9A 1XZ8A 4X63A 3H83A 4JY7A 2YBEA 2D1YA 4H15A 5U9CA 3CG4A 2XXJA 1Q1NA 3NBQA 3QWFA 2D54A 5A4AA 2YHSA 4LNUA 4B32A 1T9BA 2Q9BA 3N87A 3NDIA 3FNFA 4YECA 3OZFA 2NT4A 3JQRA 4CFYA 3FMGA 5HIJA 1B4DA 4IRUB 4PYOA 5F51A 2J4FA 2JGRA 1JJFA 1YVUA 1V41E 1T35A 2WM8A 3OLQA 3VR2D 6YASA 1ANKA 1KMHA 1LVUA 4J94A 1HZJA 2P6UA 4F6LA 5A62A 2ZULA 4N39A 2FFQA 2II6A 3H5IA 4H4CA 4UBKA 4ILEA 4WCDA 2P4SA 4C7JA 1WSDA 3R0ZA 4QFMA 1NVXQ 1FTQA 1K1EA 1ULSA 2OHXA 1SUWA 3FPKA 2P7HA 3LCUA 1RADA 3LHFA 4US0R 5UKDA 3QTTA 5JH7B 5LZ9A 2ZJAA 2F4VB 2VUTA 2EW1A 2W8BA 3OQOA 3EGXA 2P6OA 2HAEA 4KK4A 2PUFA 5ARBA 4DMFA 2CE2X 4QBTA 1KEPA 2PKRA 1KO8A 2DCUA 5EHNA 5BWLA 4A2WA 3FWKA 4PC3A 3A4VA 1A9PA 1EAYA 3E4CA 1BCRA 1DSSG 3PJEA 1ZKDA 1M1YA 5KVVA 4JI1B 1IN1A 4NV1A 5FORA 5JMWA 4ABYA 3PD7A 4OY3A 1E94E 3K31A 3L5OA 4MEAA 4TV9F 5F7OA 3VR4A 4JT2A 6LDHA 2EARA 4ARSA 2YWXA 4AJPA 2UUPA 4DCJA 5FYQA 4HOYA 5PNTA 1FQOA 2XB9A 1JEQB 2QD1A 1T36A 5TQ0A 2OFFA 4BUCA 5E3HA 4CM9A 3A31A 5EE0A 4JI8B 4L72A 5JATA 1U0NA 4LOAA 4XKJA 4CR6A 3HDVA 4B73A 4PFQA 3W0LB 3ZGLA 3T94A 1QIHA 3H11B 1QFXA 4QGGA 3F5QA 3HYSA 4KLZA 4UNNA 5LMUB 1K86A 9ATCA 5KTPA 2VATA 2GUGA 2Y0DA 3M6XA 4YXWA 2PGDA 1NVVQ 3LPDA 4L7VA 4PNPA 2QPOA 5CFQA 1W9HA 3T4EA 5KYWB 2RSLA 5FRDA 2HT6A 1GQRA 1KMQA 2JATA 4FMCF 4PBSA 1JEJA 3UV3A 4PCVA 2X9NA 1I2MA 1FLDA 4DQUA 1D6SA 4IVRA 3U3KA 4EG4A 4XYMA 4F71A 4JS0A 1Z33A 2AX3A 3LC2O 5G4KB 3SHOA 3BHMA 1NRXA 3IL2A 1WCIB 2REQA 2DBRA 2HTFA 4LE1A 3VNUA 3TNYA 1TQDA 4AUMA 3EARA 4JH0A 1QP8A 4K6CA 3W8RA 5B36A 3PCTA 3A6FA 3LUKA 1F5SA 1XOIA 3OQ1A 3R9KA 3FVWA 4Y6SA 4N47A 1YI0A 4ZVSA 3VR5D 2CLMB 3PVCA 2JNWA 2OBBA 3ZPXA 4EYQA 3DTNA 2XA1A 4MWTA 2B1GA 3CJTA 3I0NA 3ZNNA 3EJWA 4ZOBA 1OLUB 2PBFA 4JSYA 3RABA 2PIAA 3CZ4A 1UCFA 2V45A 3MJ4A 4OU5A 2WU4A 3K9HA 2RJ3A 2PKQP 1XU7A 4JSRA 3GDWA 4B87A 3MWGA 1M8KA 2ZAYA 1SIUA 2INGX 3IPCA 4ND7A 4J7UA 2XF2A 1PHPA 2J41A 1E0KA 4S35A 4LGVA 5CB4A 4HNHA 1T91A 2IV3A 2RHDA 3A0RB 3P2KA 2XKBA 1X1CA 4WFJA 3LT4A 2CFSA 4YAWA 1U65A 2B99A 3RVNA 4ZFNA 2I9PA 2QX6A 5GP1A 4WESA 2ILTA 4NX2A 1GKIA 1D2HA 4JB2A 4NJEB 2EFYA 3ZU2A 3FPEA 2P30A 3ZGYA 5TQVA 4ESOA 1J2RA 4LTMA 2PGJA 4ANFA 2R79A 3WDMA 4MP6A 1W88A 1O95D 1QLHA 1UBTS 1GXSA 3CWZA 3LRXA 3OKCA 3P9XA 2PKYX 3ZQ4A 2F3SA 2H57A 4D5GA 1K3UB 5BNTA 2VRWA 3PGMA 1T2NA 4ZREA 4NS4A 2E48A 4P22A 4AO7A 1C2YA 5FV7A 2UXCB 5I5GA 3RIHA 1SHKA 1S3FA 1J2TA 4IOMA 4LXIA 1QQ5A 1T8WA 1YS9A 2ZUCA 4EM6A 1A69A 3S3TA 2UU9B 4I81A 5JMTA 1U9ZA 4A8JC 3K73O 5KTRA 3HHEA 2BV3A 4DBLC 4JLJA 3IUYA 5IM5A 3GLGE 1TJNA 2IPOA 3BXXA 1EVLA 1PG2A 1A8SA 1H2AS 2A92A 2IXTA 1ZIOA 5LZ4A 1DADA 2AN1A 4HLUA 1XDZA 1NBOA 2CXXA 2SCUB 1ZK4A 2I4OA 3E15A 3H1EA 4XFKA 3RYFA 1AMUA 3F7OA 4J03A 4OQDA 2NVBA 2P9BA 4HDAA 3MHPA 3GLQA 1NXTA 4L9SA 4BLTA 3HS3A 4HVCA 1PZNA 3RF6A 4B2IA 3OSZA 1FUKA 4AICA 4JDPA 5ALHA 4MAFA 4QOFA 5IAOA 1T0BA 3CGGA 4JP3A 5HK9A 3KB8A 3SIRA 4MW2A 3V7WA 4KPEC 1NFFA 5CYPA 1R37A 1YSCA 2AS0A 2O3QA 3PPIA 4KTTE 4WKGA 2ES4A 3DFMA 3GPCA 4L02A 5FWYB 3FTCA 4CKZA 2R7MA 2VHXA 4F1JA 4G37A 3WB1A 1R6UA 4LF6B 4TTJA 4QTTB 4HJXA 3RTEA 1SZDA 3KEQA 3E9RA 3U4HA 3MOIA 2NU8B 5GVSA 2XMZA 1IHYA 4X1KA 1EEXB 1LH0A 2BRUA 4HLCA 4CI9A 4DSTA 1BS9A 1Q0LA 2AN5A 1HLGA 4IYJA 3OLVA 1HE4A 3Q9NA 2HCJB 2Q5IA 3WO1A 3GCWA 4YRRA 1Z5OA 4DBVO 3EVCA 4EKIA 3EQ8A 4RSGA 4R9UC 2H2FA 1VI6A 1YS6A 4E2YA 3GBSA 1QO0D 4KIFA 4MV7A 5EE9A 2R6DA 4NZNA 2PJRA 1PF7E 3DC7A 2AD5A 5FOUA 5JQGF 3HP7A 2QRNA 5F33A 3NTVA 1U7WA 3HH8A 5EJ2A 3T7EA 4BZXA 2RJOA 3BUSA 5LL6P 4F6RB 1H3FA 5IYZA 1KFCB 2DPMA 4HXYA 4LKOA 3I01A 3EOZA 2FK7A 5BN4B 4KQJA 3HBMA 2ZE6A 4PS1A 2WSMA 4MWDA 5K0NA 2WUVA 2X5NA 3AR3A 5A7GA 1GPAA 4A6XA 1LK7A 4CM3A 1EGMB 5CCXA 5K51A 3FFXA 1PVVA 3UHOA 2Z9DA 2EOAA 5HBRA 1NAHA 1QWOA 2ZR7A 3WLOA 2ZB3A 2FSVC 5EEGA 4XRRA 2P67A 2KJQA 5IG2A 4IIFA 1VOTA 2FEOA 2OGZA 5D01A 4RKFA 1LNSA 4DWJA 3GYBA 3MTDA 1Z9BA 1MRSA 4Q7KA 3T7CA 3A25A 3EB9A 1G64A 3ETGA 1BH6A 5A7HA 2WHRA 5FUBA 4ZZ0A 3SDBA 4KUHA 3I9OA 4PVCA 1QSGA 3BTVA 2F6RA 4X54A 4CM9D 3MAGA 3R5FA 4JC8A 1FJXA 2IPMA 2KLBA 1YR8A 3TLBA 3I3OA 2XMCA 2IYUA 2Q1SA 3KVRA 5IKPA 2BMAA 3TSYA 4J7XA 4YMSA 1HYQA 2VZLA 3WGKA 4JBXA 1T0PA 1P9NA 3DBHB 2F1IA 3A1CA 1HT2E 2P35A 1QB7A 4IHAA 4JJ6A 4LSMA 3H5TA 4RENA 5CX1A 1L6RA 2QSJA 4B43A 4D3YA 3VR6A 4L5AA 4UUAA 5JCJA 3U2QA 4F46A 1N77A 1B8PA 3P4XA 4KDCA 2JJQA 4D9IA 3FHCB 3GLHE 3D0OA 4DQKA 4F8EA 2QD5A 2XOKA 5BV8A 1ZMBA 3HY6A 4I2NA 4WXPA 2HIHA 1EBUA 1ZUNB 1HEYA 2HD4A 2NIPA 1CW2B 2ZJOA 4FFVA 1TZKA 2WW8A 5AHWA 4BJ6A 1UDRA 3ZE1B 4DV0B 4HSGA 4C5AA 2HQOA 3O82A 5IJWA 1FF9A 3A06A 2C95A 2CDBA 2WAOA 5GWXA 5TMBA 1RW4A 4OYRA 3W3AH 2VP0A 5AJVB 4ALLA 1JA1A 2YV4A 4FR2A 4E7PA 3JQ8A 5DCWA 1FZTA 2ODEA 4JENA 3HKBA 1IHOA 4BC0A 1F8YA 4QDOA 4UMVA 3T5BA 3QOFA 3UQYS 3ASZA 1X1AA 1ST2A 1XELA 3K0AA 2XCSB 4R0VA 3P9PA 3KB1A 2M6SA 3DMFA 3LHIA 3WA7A 1T4DA 4PYJA 1BQEA 1QQ7A 1UWKA 3FMIA 3KUDA 4HDQB 1TMOA 2AR9A 3WL3A 4C06A 2E49A 4CW7A 4YHBA 621PA 2GD2A 1DCMA 2J67A 2OT3B 5FEMA 3A8TA 3BFPA 3T9CA 3LDFA 1KSGA 1BDMA 3U7EB 4B4KA 2BGTA 3WYDA 3VKGA 3V34A 1GSIA 6PFKA 5A9SB 2WZBA 1KJ9A 4A15A 4NCAA 4E07A 2C3PA 1KYIA 1VKZA 3IR7A 3O4HA 4OBXA 3EUWA 1CQJA 1JHVA 1GGKA 3NORA 2WE7A 5FP0A 3ZXYA 3KQLA 3JX9A 1CY6A 2FFJA 1EE1A 1PFKA 2A5JA 1PNOA 1UOEA 1X7WA 3UJ7A 4ZANA 2H5IA 2SKDA 1UKCA 1NMSA 3RV3A 5I51A 2RGXA 4F72A 3V8VA 1WPRA 5EJIA 1I0IA 1U7PA 3EZXA 1S2NA 2FDCA 2AJ8A 2RK3A 5EN4A 2YWHA 1K08A 3C87A 2VJOA 3RCBA 1IY2A 3KLMX 1Z3IX 5KOJA 2FW8A 2VP9A 5KU1A 3DL0A 4Q9LA 1XCJA 1AUVA 1NKTA 3MSCA 4LRWA 2EKZA 3L6UA 1FXUA 1RWNA 2HRZA 2EQ5A 3DTTA 4YCNA 1C1DB 1JB1A 1GGHA 2P68A 4KVAA 4NMXB 4QASA 1RPZA 2XMPA 3CW8X 2EVWX 3KWLA 3BMOB 4OX9Y 4UHCA 4OATA 3O8NA 9GPBA 4Y2TA 4ZEWA 8ADHA 1GTJ1 3TG8A 2IIVA 4HPXB 1SJ9A 1IM5A 1NW6A 1MRZA 3AM5A 3HKCB 1ZP6A 2NO4A 2Y66A 1FFDA 4LN1A 2HJ9A 4R8RA 1L7NA 4GZ5A 4YVFA 2ZIWB 2QN6A 4KR0A 1JIIA 1V3UA 3E22B 3EUAA 4G65A 4A6EA 5FPKA 2W6ZA 2ZJZA 4BVKA 1Z0IA 5DULA 5IFKA 4KXXA 4TYWA 2R0QC 1JPJA 1SA0A 2ZAOA 1I4OA 5ALGA 5K05A 4OGFA 2IEGA 2D1TA 3NANA 5BR1A 2HNKA 4JMPA 1NUUA 4GRIA 4L9WA 4XRGA 3UMYA 2Q4DA 2J7PA 1KU0A 1MT0A 3NKFA 4I1VA 5DMXA 1JHUA 2R9VA 1V7PC 4PRYA 4IKPA 4QUJA 2HBRA 1EUQA 2MSCB 3K92A 2MOKA 2J3KA 2P3QA 4CF6A 3K6SB 2EKPA 1HX7A 1I1QB 1XZJA 5JNLA 3JVDA 3KZCA 3PEYA 2Y1KA 3C6XA 4RZIA 4OHUA 1AQNA 4L8FA 4TMXA 4ENVA 2XXAB 5A6SA 1WXEA 2FWIA 1PT6A 1CK4A 1TTHA 1DB3A 2XTAA 4MKZA 1J8DA 1FDSA 2WLTA 3JQ9A 2W2PA 1CFJA 4L0CA 3C3DA 1FJGB 3CLSC 5CT6A 2W90A 5IT5A 1ZZGA 3DBIA 3V7YA 2ZTMA 1L7XA 3AM3A 1NG1A 4AFNA 3IJ5A 5HFAA 4WW0A 4UVDA 3WJ1A 4DAOA 2IPLA 3ZKAA 2R6FA 3D6UA 4HX9A 5JAQA 1JT2A 1PP4A 1AOXA 1TT5B 3JVIA 5LA6B 3Q3VA 1IZ9A 5IBPA 5I8ZA 5GOTA 5EWJA 5FI5A 3PT9A 2G09A 1OLXA 1U7UA 2YWDA 2KBFA 1M0SA 3ERCA 1I4EB 1ZH0A 5KAPA 1HFWA 1YL6A 4L75A 2OUIA 1TIKA 4ZTZB 3GFGA 4X6YA 1CD5A 3C7CB 3MMSA 4H6PA 4HB2A 2ZUVA 4GGPA 2RG1A 5D3KA 4A3SA 4TTSA 3IJEB 3T99A 3K53A 5KC9A 1LEHA 1DXQA 2PD6A 1CEYA 1SU4A 2H85A 3ZHTA 2FHPA 3STWA 4DLYA 1POWA 1U4NA 1F38A 1XROA 3P1JA 4UKDA 4XCQA 4AMUA 4D9KA 2PFSA 1AO3A 3FI9A 4FYJA 4JGGA 3T4PA 3UMJA 1D2CA 5ED0A 2OO7A 2XUPA 4LHWA 1HE1C 3W90A 3DE1X 4HLQB 1P33A 1H69A 1K9SA 2AG1A 3OTOB 1KAGA 2WABA 2C7BA 4ZYLA 2NYRA 1H5NA 5FCDA 4FCVA 1ZD5A 2IA5A 4IZ6A 3R5XA 1ESZA 4YFVA 2V0GA 4DB2A 4UE6A 1ECLA 4IMIB 4PF1A 1FK8A 1BA2A 5EJ4A 4CLEA 1CJVC 1SD1A 2YXNA 1FDRA 1RRVA 1P4SA 1EFKA 2R00A 2V6GA 5EG5A 3TQIA 4POAA 3ZZ1A 1N2IA 3FXAA 1U0EA 3EIEA 4M83A 4UDYX 3VZCA 3ANMA 1HF3A 5E9JA 1J8QA 2Z5LA 3D8BA 3RT1A 2PX4A 2PYIA 1MEJA 2ZYTX 5ALLA 1OU4A 3G13A 1CR0A 1NN3A 1YK0A 4BV8A 1PWXA 3FRIA 1SD2A 4KAXA 4NXNB 4HKTA 1TU4A 3G17A 4JI6B 2I7VA 2Q62A 2BGGA 3CMCO 2CHQA 3EPPA 1RHMA 2WUEA 3EVBA 4GOKA 3T9FA 2W0MA 3QM1A 3B1ZA 4RKRA 1VI2A 2ZJ2A 5FB3A 4PRKA 3U9SA 4AECA 2F2TA 5DEIA 4P82A 1GPLA 4K9NA 3OT5A 4U9UA 5ALIA 4RTQA 4R2JA 1ZIXA 3CIOA 4HQOA 1E4OA 3Q5EA 4H3VA 4RY8A 3NP7A 1H8ED 1FTNA 1TVKB 2H2AA 4KXMA 4L78A 5AKLA 1P1HA 5CB0A 5LMCA 1MR3F 2OD9A 1JFSA 4DPMA 1MUUA 2J9FA 2ERYA 2QT0A 5U1PA 2GXUA 2V1UA 4OP3A 1B14A 2GXQA 1IC6A 5TEVA 1FRZA 1DKPA 4KYIB 1P7PA 1E6LA 2J5BA 5E7IA 1D2MA 1IXKA 4GR9A 1M0WA 5CM9C 4OGKA 1DDGA 1ZSVA 4GPEA 4JWKA 3WK9A 4RHCA 1RDFA 4QOSA 2JH3A 5AK3A 1ZJ4A 4XVHA 1KWKA 4Q7MB 4YRIA 1TM2A 2Q3BA 3RS5A 3IOMA 1G3MA 1WG8A 2FV8A 3MCWA 2OILA 3D8HA 2IYLD 4FFDA 5EMMA 2RAVA 5GM1A 2QJTA 1RLMA 4AY4A 4YP0A 2O2ZA 3QELA 1DUSA 1N1DA 1Z15A 1SBYA 3O95A 1QHHB 3PWZA 5TF0A 3UK2A 3V2IA 2ZUEA 1F12A 2TRSB 4JB0A 1DT5A 4LMAA 4U4AA 3H8VA 3QKSA 5J59A 1P7ZA 5LQJA 2IGTA 2P1RA 5ER9A 2QY9A 1KK0A 1EVEA 3D6VA 4CN9A 1JEYB 1IUOA 2VUIB 2ZZKA 2BZ1A 3P20A 1DLIA 1UC9A 1IAQA 1OD6A 3BMNA 5DI3A 3GF4A 4EY5A 1R8JA 6AT1A 3DLAA 4DS3A 5ELMA 4QRIA 1TZMA 4B3FX 4BNIA 2BD0A 2HK7A 2BFFB 1GZSA 3ZLTA 4QJ4A 1UMKA 1X7DA 2JD2A 2P2CA 1WMDA 3VTKA 4BAUA 4G26A 1W49A 2JAOA 3ABQB 1VIVA 5IC6A 4B84A 3FDJA 1CF2O 2WIKA 1W4RA 3H6HA 1SZJG 3L0YA 2ZQZA 4EMUA 2CWDA 1XCBA 3WNCA 4C7VA 1WDMA 3RJ9A 1R7RA 4DY6A 2CVZA 2VEOA 3GA0A 3IYLW 2MYTA 4Q4JA 5TS3A 1G21E 2VO1A 4XJSA 1B41A 4BFSA 1T25A 1R0KA 5KTKA 1U2ZA 2Q6LA 3X1ZA 3BJEA 1WA5A 3LY8A 1RKVA 1HDIA 5G1NA 1Q20A 4TL9A 3DOEA 4WSOA 1HEUA 3IULA 3PIRA 1CQIA 4PN3A 1RXYA 2PMFA 5CG2A 4EJ2A 5KNCD 3LLCA 3PT5A 4V38A 3B6ZA 1MJGA 3K2EA 4GD3Q 1GUZA 4ZQFA 4FYKA 1RHRA 3M0EA 2PPLA 3EE6A 4O63O 4ZC8A 4CNBA 2RH9B 3ZDQA 4CU5A 1X9HA 4EUEA 2VP2A 4J0KA 5JW6A 1KMCA 3PXUA 1X1DA 3AM1A 2B4KA 3NH6A 4HH1A 2WWTA 5FTKA 3PEWA 2OZPA 3IT3A 4Q00A 3WC4A 4DIOA 5JSKA 2XDAA 4IBOA 4JAVC 3EDYA 1DTWB 1XEXB 3ND5A 3VU9A 5KTNA 5FL3A 2WYWA 1V43A 3I1JA 3OVMA 3ZDXB 5K8CA 4YQEA 1UKBA 2L17A 2WWWA 5TPWB 1H5UA 1XXLA 5JXWA 2ZRPA 3L7DA 4LRXA 3B70A 3N3BC 4HN4B 2B92A 1E7RA 4LQCA 4UUBA 2XBUA 4UU1A 1YBMA 1G59A 4ID3A 1FNSA 1YZLA 1U8YA 2JI6A 1NIPA 2PSFA 4WZAA 1U8CB 3HXTA 4LZZA 3RYHB 3HWX1 5EZQA 5JAOA 1F9AA 1YB7A 2DFVA 3EODA 5JASA 3NX4A 1JYFA 1REQB 3IFSA 4I8XA 2Z0MA 5IAGA 1SHTX 1R88A 2CXSA 2JGJA 3NW9A 1TCCA 4LYFA 4I5IA 3O47A 1E2UA 3RFXA 4BB6A 4ZV9A 3K70D 3HACA 3HFJA 2ONCA 5BPHA 3SC3A 1ZLXA 4FZJA 5CW1A 5HGJA 4HDKB 3MB5A 3RU9A 3LX5A 1NPYA 2AXEA 2ZU0C 3P9KA 4N5HX 1CUSA 2WPNA 1QU3A 3OFKA 1F20A 1R10A 2OQIA 3GHHA 3IPAA 4KO3S 2OCPA 2NO7A 1LWOA 3G9UA 4L4ZA 4NAHA 5I9TA 2VP6A 5JVDA 1W46A 4IILA 5EIWA 5AT1A 5JDCC 4OK5A 1N9GB 3PLNA 1NI4B 4JQOA 4JZYA 2QN2A 1J2JA 2WSSD 2YVKA 5CA0B 4M55A 4WNAB 3L6DA 5AOCA 4M9UA 1VIMA 4W5QA 4QZVA 2IXDA 1GNLA 3FGNA 3GEMA 4IFEA 3CUUA 4J0DA 4TLEA 1IQUA 1YAJA 2KYRA 1J25A 4GECA 2IFTA 2BVNA 2QP4A 1G3RA 1YIOA 3PWKA 1EB9A 2XH8A 3QKRB 1U3VA 5KWSA 3FPCA 4QDTA 3FCCA 3QEOA 2C4TA 2ZSUA 4YJHA 2V3VA 3F6SA 1G1MA 4QM7A 3CRVA 5MFPA 4H0CA 5BT8A 3LVFO 3VJKA 3OQMA 3B85A 3A3KA 5AUNB 1VFPA 5H3CA 4IHKA 4JJ8A 4P5DA 4ZMRA 5K3AA 3FKSD 2A88A 1HQDA 4OIFA 4KPUB 2VTKA 4NQZA 4F04A 7MHTA 4BZQA 2XNJA 1XD2B 3O92A 1I7LA 1RJGA 4LDQA 2A86A 4ARZB 4Q1FA 1W5EA 3MB8A 4HMOA 4C0WA 3ETNA 4MQEA 4QPJC 4DA0A 3S2IA 4W5TA 3HSKA 1MXHA 3QKWA 4I8IA 1TU0A 2JGFA 4R1QA 3VO8A 4C2BA 1TCUA 2QS9A 2QBYA 1G41A 2BBSA 2ZSFA 3I52A 4LDNA 4MVJA 4QT0A 1U8TA 1YB2A 1XG5A 2VH5R 4YRSA 3AF4A 4YRDA 3EBOA 3SP1A 1GUBA 1WBJB 4FBGA 3RBZA 5HCUA 4JLKA 2X6QA 3QQPA 2A7QA 9MHTA 1C0KA 4W1SA 3DM5A 1Q2XA 1YTUA 1DG9A 1LSJA 1RAIA 2AC7A 2OHFA 3ZOKA 2C2ZA 1DWUA 1DKRA 2DB3A 1P3Y1 4IAOA 5DB4A 2IKSA 2FXVA 4OD0A 3UN1A 3VMMA 2AVNA 3QYJA 3IQEA 1XJ5A 4F2HA 1UEXC 2EWMA 3PSAA 4ZT5A 4B0OA 5ALQA 2HJHA 2R5WA 4OHPA 4JJ7A 1IU9A 1IMJA 1RMTA 3O9VA 1E2BA 1H85A 1A5SB 2D8MA 2O1SA 2Q5HA 3WHIA 2OGWA 2Z04A 3E27A 3PNVA 4Y0AA 3F6CA 3PXAA 3WGUA 1H0RA 4PYLA 4GBJA 1WP4A 1UKYA 3DDNA 3IMKA 2AJDA 1TJ5A 2ZJ8A 3I9NA 1E3WA 3SEAA 3TMYA 2P9TA 3KQTA 5AVTA 1YA8A 4HZUB 4PQGA 1H9AA 5AKHA 1A8PA 3BE4A 3QPBA 3HO8A 1W36C 1E9EA 1C9MA 1YR7A 3B7WA 3GGJA 3M33A 3OM1A 4TQGA 4AF7A 4F3NA 1H9CA 4NU5A 3C4VA 1B73A 2H52A 2I33A 2Q5EA 2R62A 3IE1A 4WCFB 1X80A 1Y1QA 2G77B 4MRMB 1RBZA 1KPGA 2Q1TA 3I2IA 3T1QA 3QSGA 1G5FA 4Y6PA 5KYYB 5F77A 2DFNA 4MKFA 5LP6A 4RNDB 5IM4F 1DQSA 5BW8A 3CKLA 1PR3A 3V4RA 1G3UA 1OMOA 2I8AA 3K5IA 4NK5A 3UMFA 1GM5A 1AHHA 1VGRA 3GC6A 3O8BA 4X92A 1NXWA 4ZVPA 3SMQA 4ER3A 2OY0A 4Q3NA 3CR7A 3RAGA 1WUJS 3NT2A 4G1BA 1W87A 3PDUA 4LGMA 3LLMA 4FFPA 1JFRA 3QHPA 1GAXA 1AKWA 3LC7O 1I6LA 1JDTA 2BI8A 3P4YA 4QSMA 4PANA 4LYJA 1YR9A 2DWCA 1QIMA 4HDRB 2QTCA 1XD9A 4JYPA 2ACKA 3TAHA 3ABSB 5IDXA 3WGJA 3VTFA 5SZKB 5TARA 1G19A 2J30A 2SNIE 3K9CA 3U3XA 1W44A 2XQKA 3ICPA 4UCXA 3U4CA 4C9BA 1AU9A 3OJOA 2C88A 4NHOA 3KTDA 1NMYA 4CFZA 2V8OA 4KQ2A 2WJZB 2DF8A 3K2BA 3DLCA 1S3IA 3LQFA 1RRKA 5G2OA 3T7KA 3G8BA 3ND7A 3C48A 4DMRA 1YFJA 3JWPA 2ZYHA 4PNEA 2GCEA 1DIAA 2J9YB 4Z4QA 4C29A 5IHXA 4M99A 4IXNA 1PS0A 1Z7BA 3CZ9A 3MJEA 1W48A 3CR8A 2YVQA 4PZLA 5GONA 5DFAA 1DRVA 1ECBA 4D8VA 3PUVA 4KP7A 2QMZA 3X1MA 2YIMA 4KMMA 3S27A 4GC9A 1DJLA 3ZQKA 1YS4A 4KNYA 4NQRA 3IAM6 1V16B 1TAGA 4I36A 4J0JA 1G2PA 1QLJA 2AOTA 1G5TA 5SV2A 2HKIA 5F7ZA 2IV2X 1T8TA 4ZRMA 3GZJA 3GPLA 4MUEA 4M0DA 2QL7A 1FDIA 2GNAA 3AI1A 1MAHA 1TKCA 3JZMA 1Z0DA 3UAWA 3U7HB 2XWPA 2ZYIA 3TDKA 1GCOA 2VJNA 1I6WA 1IK6A 3IIMA 4C0HA 2MDTA 5A06A 2AZMA 3FCSB 1K0FA 3HI6A 3QYFA 4ZPXA 2A7XA 1X7YA 2B4QA 4R8LA 4EPVA 3A6ZA 2B35A 3L8YA 3ORRA 4WBXC 2PSDA 5KYUB 2Y99A 1NVFA 3KDAA 4RC9A 3EZFA 2FEPA 4LRUA 4MCIA 4QXAA 2P5YA 1H8HA 1YCGA 1INLA 1ZCFA 5ALUA 3TOVA 3TOCA 4B6FA 5KWEA 4HD8A 4WNCA 5E4YA 2NZYA 1X39A 2XB4A 3FWHA 3V97A 2M1XA 1T0HB 1JJAA 4OXKA 1DV2A 5H81A 1FYXA 1M2GA 1OC4A 4XH9B 1NVGA 2NAPA 5PGMA 5J23A 1GAQA 1L4NA 1NQTA 2G83A 4JUBA 5DF1A 2PX3A 3TMAA 2IS2A 4FB4A 4KFUA 3I64A 2OCKA 3GUZA 2O48X 1VLMA 5F76A 2BFAA 1DBVO 5KTSA 2F48A 3TZEA 4D25A 1TL7C 3K9NA 4OHXA 1IM8A 1KMNA 3W6NA 3ZJ5A 4ED9A 2QJOA 2A1UB 3EEBA 5IEJA 2H0RA 1YBFA 3R41A 3QY9A 2ZJBA 4ZI7A 5HMLA 2QSUA 5BW5A 5HM6A 1L4UA 3ZQ6A 1JSXA 1TM1E 3IQGX 5KOHB 1KTVA 4LYAA 2R48A 5AKKA 2MJLA 1N6OA 4BX0A 1P1RA 2ZAIA 5IJXA 4QUHA 3DNPA 1HEIA 3CF4G 1J6UA 2I2AA 5REQB 2PE5A 4RZSA 2ZBVA 1ZGAA 3RS8A 1IG3A 3UTCA 5KQMA 3ESAA 4FSDA 1E5TA 3ROEA 2HU8A 4TMYA 4B6GA 3RT9A 2HF2A 4C20A 3ER6A