3L77A

X-ray structure alcohol dehydrogenase from archaeon thermococcus sibiricus complexed with 5-hydroxy-nadp
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
235
structure length
234
Chain Sequence
EMKVAVITGASRGIGEAIARALARDGYALALGARSVDRLEKIAHELMQEQGVEVFYHHLDVSKAESVEEFSKVLERFGDVDVVVANAGLGYFKRLEELSEEEFHEMIEVNLLGVWRTLKAFLDSLKRTGGLALVTTSDVSARLIPYGGGYVSTKWAARALVRTFQIENPDVRFFELRPGAVDTYFGGSKPGKPKEKGYLKPDEIAEAVRCLLKLPKDVRVEELMLRSVYQRPEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain alcohol dehydrogenase
publication title X-ray structure alcohol dehydrogenase from archaeon Thermococcus sibiricus complexed with 5-hydroxy-NADP
rcsb
source organism Thermococcus sibiricus
molecule tags Oxidoreductase
total genus 93
structure length 234
sequence length 235
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3l77A00
1LDNA 2FR0A 1I36A 1DC5A 2O23A 2QW8A 3CINA 4M8SA 4YWJA 2GZ3A 4DLAA 1NP3A 4XX0A 4Z6KA 4MVJM 2NADA 3L4SO 5L4LA 1JWBB 3JQBC 3ZHBA 8LDHA 2PKQP 4WCDA 2GUGA 3IUSA 4OKIA 2CD9A 3K9QO 3GPDG 5C5IA 3DAPA 1B16A 3GUYA 4RDHA 5DP1A 3HWRA 1DOHA 2RIRA 4YA6A 1ADBA 5TT1A 1EVIA 4II2A 4RPHA 3FWZA 1D1SA 1EFLA 2PWZA 1AXGA 1UZNA 2C82A 1BW9B 2DBQA 2O7QA 2X1HA 3RBXA 2VZ8A 5A3VA 4KMSA 5IAAA 1FJHA 4U7WA 2EERA 2HCTA 3AUSA 3Q2IA 1PL6A 2PR2A 4GMFA 4HWKA 4JNKA 3U4HA 3GZNA 4R3NA 1Y81A 3HDHA 2BFMA 3Q0EA 4IJKA 4LRSB 1X0XA 3SX2A 2BGKA 1MG5A 5TS3A 5EL0A 3INRA 3LT1A 2ZYAA 3AM5A 4EGFA 3FWNA 1B3BA 4CR6A 1QG6A 2X86A 3OJLA 1GQ2A 4RORA 5ADHA 3PIIA 5JYDA 4PLHA 1P45A 1E3LA 2VWHA 1HYGA 1PR9A 3INGA 3B6ZA 3R3SA 5DN9A 3WMXA 4BNTA 4XRGA 1O8CA 4F3YA 1FXSA 1UXHA 3TZQA 3RQSA 2PZKA 5A04A 1P33A 2NU9A 4AL4A 1GZ6A 3I9NA 2DM6A 2WD8A 1ZSYA 1U5AA 2EV9A 1YQXA 5IDQA 5JMWA 3U4DA 5F5LA 3CZMA 1G0OA 2PD4A 1W8DA 5TSDA 2GASA 4PVCA 1O0SA 1U8XX 2ZJ0A 1OBFO 2DTEA 3T4EA 1JKFA 4IDAA 5DULA 4CM6A 5HS4A 3H7AA 5CPFA 2G82A 2NVWA 1DDOA 3DL2A 3NT2A 4FFMA 3STHA 3T4XA 5EERA 3PRJA 2EJWA 2HQ1A 4M89A 4K28A 2FSSA 1S6YA 3EVTA 1NFFA 1UZLA 1YB1A 1KETA 4J49A 2EGGA 2AQKA 5F3RA 5GZ3A 1CEQA 1IYZA 4ID9A 5TJHA 3W4IA 1YDWA 4DIFA 4MVJD 2HUNA 3DBRB 3RUIA 3FNGA 4YAIA 4GWKA 5EESA 3RFTA 5I9NA 2H5LA 2CUKA 4CUZA 2OGUA 3DFZA 1NPDA 4DA9A 5JPIA 2WE7A 1KYQA 4NZ9A 1PJBA 4CV0A 3ZWOA 1ML3A 2OOSA 1N8KA 1NVMB 3F4LA 2I67A 1NR7A 1NASA 3TQHA 3WNVA 2E48A 1CETA 3KEOA 3DMTA 3PFWO 4ND5A 3FCOA 4G81A 5JAQA 1N7GA 3P5SA 2O7SA 1GEEA 3ASUA 1TEHA 5EJ2A 4URFA 4CQLA 1GEGA 4W82A 3IUPA 4CM7A 1JVBA 1HT0A 3WBBA 1X14A 2NM0A 1KEVA 4UUNA 3ADPA 2W90A 2Y1FA 1ISJA 5I8ZA 3HHPA 3ZWNA 4IDGA 4NFYA 3HADA 2GO1A 1R4MB 1R0SA 1D8AA 2X0RA 3KO8A 1PSDA 4KUHA 4CUKA 1WLYA 3CXRA 2EKQA 3JQEA 3GUCA 4B7XA 3PYMA 2V6BA 4YJDA 1GADO 3GGGA 2AEMA 4YJGB 3D4NA 4ALMA 1TT7A 1W0CA 3C7DB 4R9RA 4D0RA 1NVTA 4ROSA 1WXDA 3GRPA 3IDSA 5EMHA 1LDEA 4GKBA 3PHHA 4TQGA 3ANNA 4E32A 2DKNA 1QYCA 4I5DA 4MVJA 2VQ3A 4DC1A 5TQVA 2GYYA 3BAZA 3K8ZA 2JAHA 4HBGA 3EZLA 2EWMA 3ETGA 3EZYA 4LSMA 2HMUA 2BGMA 3LYLA 1GYRA 5G2OA 3UAGA 4B3IA 1JW9B 1UP4A 1U3UA 3GAFA 2AMFA 3LK7A 4UULA 4I5FA 2ZK7A 4NJMA 3QW2A 4KOAA 1D3AA 5ES3A 2IZ1A 1H6DA 1YONA 3PDUA 2GSDA 5AQ1A 3DBHB 2V7PA 1BMDA 1T1SA 1PJCA 1GUYA 4HY3A 4P8RA 1LQUA 5B37A 3VKVA 4CQMB 2HMWA 4I9UA 3PJDA 3T7EA 2UUOA 4AJ4A 1QYWA 4NDNE 3NDIA 1Q7BA 1IHXA 4BNJA 3JYOA 4CM9A 1A5ZA 3RBZA 4E5NA 3AY6A 4L9RA 4OOFA 2PNFA 3B1KA 2IZZA 4GWGA 1QV6A 1FDVA 4XJTA 3ZDFA 3OQ6A 4R3WA 2EJVA 1FF9A 4CODB 3RUAA 2C7VA 4TRNA 2DC1A 1BVRA 2X5KO 4DMLA 1ZIDA 5L51A 1N1GA 2I76A 2X58A 2IRWA 1RM0A 3KHUA 4KDFA 5F1OA 3WGOA 3FBTA 1HF3A 1DEHA 3E9QA 1VM6A 4ALLA 4ZVVA 4D41A 1IE3A 3GPIA 4WLOA 5KVQA 3ONEA 1XKQA 4OGWA 1N9GA 3KYCA 3LC1O 3SJUA 3DOCA 4PG5A 3PPIA 4MVJE 3LC2O 4PZCA 4KQWA 2AQHA 4JQCA 1HSZA 1YL6A 3E03A 1B0AA 2X0NA 4B8WA 4YBZA 1ENOA 4E5MA 3ZHXA 3UW3A 4LVCA 4H15A 1VRWA 1BGVA 1UXKA 3GNTA 2OBYA 5TLSA 5TRTA 3IP1A 4XYMA 1KS9A 2C5AA 3G17A 3WIDA 3VZQA 3VDRA 2H6EA 4CM5A 5T5QA 1GQYA 1UH5A 1N9GB 4A0SA 2GCGA 2P68A 1EDOA 1OMOA 4WUVA 1GD1O 5BT9A 2VHYA 1Y8RA 3ZWVA 1DJNA 2FOIA 5DF1A 4RLSA 4R41A 4BO8A 3WFIA 3RIHA 4OHUA 2PA3A 2NU8A 1NHGA 2R6JA 2WEKA 3A06A 3GEDA 3GLQA 3NJ8A 3V2UA 3DMYA 3VHRA 2Q1SA 4UEKA 4ZA2A 4CL8A 2WMDA 1Q0QA 4HXYA 2V65A 5H83A 4WLEA 1CDOA 4ZQGA 3V1YA 2HDHA 2EF1A 3L4BC 4GLOA 3AY3A 4NFHA 3M6IA 3DWFA 5TT0A 4P22A 5JLAA 1E7WA 2HKIA 4CM4B 4DMMA 1TT5A 3VC7A 2BGLA 1RM5A 1BWSA 3WYCA 3DAGA 1C0PA 1RWBA 3LSYA 1Z7BA 1J0XO 4KWHA 4YTEA 2Y68A 4NU6A 2OORA 3OEWA 4ND2A 4QFCA 4A03A 4RF4A 2EEZA 3JQ7B 2X0JA 4AJKA 5IZCA 4MDHA 1O5IA 2VCYA 4WECA 3ZWWA 4IUYA 3AOEA 4IDCA 3QVTA 4HUJA 2ZB4A 2DBRA 2Y1EA 1I5RA 2J5KA 4K6FA 3D7LA 5KKCA 1LBEA 1HLPA 3L6OO 3RJ9A 1DC3A 4J7CA 1PJLA 1XDWA 1U4OA 3E5MA 2CDAA 1AXEA 2B4TO 4LCEA 4B4UA 4ZQFA 1U9JA 4IIVA 4DQVA 1A9ZA 4GVXA 4FW8A 2JD1A 1NVGA 1E77A 1S7CA 3CMMA 3A28A 5T67A 1UDAA 1ZBQA 2Q50A 3DTTA 4PLGA 2P5YA 3F1KA 4MKXA 1Q0HA 4F6CA 2YUTA 2P4QA 4J7UA 4HFNA 1J6UA 2OXIA 4JROA 4N5MA 4EUFA 1HZZA 4B4WA 3PGXA 2GPTA 4BGUA 2VTDA 3UF0A 4LGVA 4PIVA 5CFZA 4O6VA 3ZU3A 5LDGA 3EK2A 1HTBA 4BO7A 2VRCA 3JQFA 2FRDA 3CTMA 2ZB7A 2AW5A 3O8QA 3UUWA 1K5HA 5A5EA 4XRRA 4B7CA 4YT2A 5ITVA 4R5MA 1I0ZA 3PWKA 1M75A 4OMUA 2OP1A 1IZ9A 1BTOA 2HMVA 4BNMA 3HE3A 2X9NA 4A7PA 1XCBA 3DFUA 5BSEA 2AQIA 2A94A 4KQXA 4YQZA 1DAPA 1DSSG 2ZTLA 2VUUA 1ZXLA 2WJPA 3WGIA 1SCUA 3ANLA 1GZ3A 3MTGA 3TNLA 4RF5A 3VH1A 3TPCA 2YHIB 4EI2A 4RVFA 4CLRA 4J43A 4IMPA 1XEAA 3U0BA 3MTJA 4AFNA 3L4BA 5TF4A 4YRDA 1IOLA 1PGJA 3GVIA 1HEUA 1NFRA 4XQ9A 4J1QA 4FCCA 3PLNA 4D7AA 1P9LA 3DAFA 5G0VA 2O50A 3SLKA 4DPKA 3GDOA 1LA2A 4CR7A 4WLVA 1E7RA 4CM8B 4E2ZA 4J0EA 2GZ1A 1DRUA 3TF5A 3QWFA 1BVUA 5CEJA 4GBJA 2OP0A 2AG8A 3FNEA 3WS7A 4YR9A 2YQ5A 1LRJA 2AEJA 4I1IA 1R12A 2TMGA 3BTOA 4PLWA 1MFZA 2POQX 3WQRA 5IDXA 1NWHA 4HX5A 1ULSA 1P74A 1LSOA 4FFLA 2IODA 2PV7A 2PZJA 4Q9NA 2LDBA 1LU9A 4KTVE 2XOXA 4ONEA 4WNCA 4EYEA 4KZPA 5KJ1A 2O4CA 5BNIA 2B83A 3EC7A 2B4RO 2NU6A 3JQGB 4Z0PA 1WZEA 1P1FA 5CDTA 3TZKA 5DP2A 4ZGWA 3OJOA 1JVSA 4UVGA 3AI3A 4KWIA 4EEZA 1XWFA 4H7PA 4H16A 3ICPA 1ZKMA 2I6TA 3E48A 4GAEA 4L4RA 2CVZA 4QX6A 2FY8A 1I24A 3OJFA 4UEJA 3BZUA 4OSOA 1PZHA 5IDYA 3F6YA 1ISHA 4FB5A 5G0WA 1BXZA 3WGQA 3DDNA 2JL1A 4FC6A 3S2IA 2EP7A 4L76A 3ZWYA 4I9NA 3DZFA 3P2OA 4N5NA 3JD1A 1I2BA 2A92A 2IYOA 2Q2VA 3QRWA 3QWHA 4O63O 3ROPA 2XPCA 4BGVA 2ZIZA 3GGOA 4DLBA 3F1LA 4WOJA 1GYQA 1UP7A 1DIAA 3QVSA 5BSGA 2D5AA 1B3RA 2JCVA 2OL4A 2JFHA 2IE0A 1DLIA 2GF2A 2O3RA 2D5CA 2D8AA 3BHMA 5C7IO 1U7TA 3A9WA 3TFOA 1P1KA 4N54A 4FSHA 3ZU2A 3FI9A 2JJYA 1GQQA 1QYDA 4IPTA 3GN2A 2C07A 2O2SA 4L75A 4R1TA 4TWRA 4J1TA 4XIYA 2P9CA 1GPJA 4JJIA 5HS6A 3PI7A 3KRTA 4UVIA 5G0TA 3GT0A 1WNTA 3C1OA 3LF1A 3KSZO 3AFMA 1W4ZA 1Y8QB 4FN4A 1K6IA 3E82A 2IXAA 4JK3A 1YQDA 3G1UA 1A7KA 2Y1CA 2UYYA 1ZW1A 1NAHA 3EDMA 4MOWA 4BO5A 4YAEA 4QFDA 1UP6A 1KERA 3DONA 4YJHB 1X1TA 3F4BA 1YBMA 3D3WA 1PJ2A 3ZHZA 2AG5A 2VZ0A 5L4NA 1C0LA 1MG0A 3BMOB 5IJZA 4INAA 4YJFB 3ITKA 5G4KA 1DBVO 3PK0A 3AWDA 4I5GA 4MKRA 3U49A 1T4BA 1YH3A 1X7HA 1GDHA 1K0UA 4R16A 2ET6A 3VDQA 4F6LA 1DB3A 3AU8A 8ADHA 4YPOA 4PN3A 5DOVA 1SB9A 1EFKA 3H8VA 1FDUA 1JAYA 1N7HA 5DDIP 1H2HA 4IDEA 1I3NA 2VTEA 1R0LA 4YT8A 4UUOA 2C20A 3AK4A 4RQTA 3HJAA 4Z9FA 3MJSA 4TRMA 4X54A 5I7VA 2JCYA 1JLLA 5COAA 5BSFA 2QQ5A 1D1TA 4E3ZA 1I3MA 1F8GA 2B36A 1PIWA 1ISGA 4PZEA 4BIIA 5IXYA 4K9DA 5A5FA 4QXMA 1YXMA 1PJTA 2B37A 4FOSA 3BHJA 3GA0A 2NTNA 2PGJA 1O89A 2ZTVA 3GC6A 3NTRA 2X9GA 2H63A 4IJUA 1MC4A 4OYRA 4RVDA 5LDHA 2DU8A 2CSUA 4CMIB 3WB9A 1NFQA 2ZTUA 4BKOA 2G17A 5A4DA 2D59A 1BRMA 4BV8A 1DIGA 4ZICA 3JQ6A 1LDMA 2Q3EA 1A27A 3PQEA 4P38A 3QWAA 4J4HA 1ZO8A 3H9JA 4FD3A 4PVDA 1XQ1A 3SXPA 4E2YA 1U1IA 5DCWA 1VJ0A 4E12A 5FI3A 4R68A 1KVRA 1XLTA 4NBTA 1JKJA 3RROA 5ITWA 1V3VA 5MGBA 1R0KA 3NKLA 5T57A 4Q3NA 3L07A 1WDMA 5COQA 3L9XA 3H3FA 2BELA 4B8ZA 2DAPA 1HE2A 2PTGA 3NDJA 3ZWCA 5JAZA 2LDXA 3GG9A 5EN4A 2Y1DA 4WE3A 3SJ7A 1K2WA 2HMTA 3GY0A 3DBVO 4YYZA 4LVUA 1SOVA 5F21A 2P91A 3E18A 2X4GA 3FNHA 4J9VA 3ICCA 4CMHA 3GAZA 1N5DA 2HJRA 1BW9A 5BNFA 3DXFA 1T24A 1WDKA 2WDZA 2Q2WA 4RDIA 1RM3A 2NVBA 3PDJA 1IY8A 1ONNA 3RFXA 3LLSA 3HB4X 3IJPA 2ZATA 4RVUA 3V8BA 1XG5A 1F12A 2OFPA 2FR8A 3PVZA 4PLTA 4IQGA 4M86A 3VZPA 2C54A 5BR7A 2DVMA 3RC7A 3BMNA 4W7IA 4ZQEA 1RM4A 5FI5A 3RWBA 2CF5A 3D4PA 4LISA 4OXKA 1T26A 1DC6A 2JD2A 3Q9NA 3QSGA 1QXSA 2VYVA 3BHIA 4GPD1 4NR0A 1NM5A 1ZK0A 3TSCA 4RVSA 1YB4A 5C7LO 3MOIA 3W8EA 3H2ZA 1O6ZA 3LZ6A 3S8MA 4D3FA 4XEHA 5EPOA 4II3A 2AEFA 2PD6A 3HNPA 3PJEA 2DFVA 2R2GA 3WTCA 1LLUA 3QHAA 5A06A 3LT0A 4FPXA 1ADCA 2Y1OA 3PQDA 3VAZA 1T2EA 3TZCA 4R1SA 1SC6A 3BMNB 1H0KA 1LRLA 1V0JA 3VTFA 1O95A 4D0SA 3ZU4A 4GX2A 4ALJA 1EEHA 4BO0A 3C85A 3B1JA 1XSEA 4IQ8A 1E0DA 1MX3A 3OICA 4GSKA 3V2HA 1P3DA 1H5QA 5CEFA 2DPHA 2YV2A 3BXXA 3FF4A 3RI3A 3ZU5A 4OH1A 2AHRA 3SBOA 4NBRA 5B1YA 3KEQA 1A9YA 3UVEA 3AUUA 2TMDA 1MUUA 2F00A 3DBRA 4BQPA 1ZMTA 2CMDA 3GFGA 3ZNOA 1IL0A 1PL7A 2ZQZA 4YVFA 5JBIA 3JD3A 3O03A 2BMAA 1E3WB 3ABIA 3WGTA 5JYEA 3U4IA 3OH8A 1EUCA 4CLDA 1RYEA 3PXXA 1T2FA 2ZQYA 1E92A 1DAOA 3Q1LA 1T2AA 1IUKA 4LRTB 1P1JA 2QHXA 4AJNA 1NR1A 4HKTA 3G79A 2C2YA 1SNYA 1X0VA 3OJEA 1YQGA 2D2IA 5JDIC 1VL6A 1A71A 2Q1WA 3WFJA 3OIGA 2QG4A 4JLWA 2EIHA 3JQBA 4GLLA 5ENDA 4N7RA 4CQMD 4RPJA 4JJFA 4XGIA 1ENPA 3VH2A 3AUAA 1YJQA 1NAIA 3DTYA 3KYBA 4IS3A 1R4MA 1PGNA 3ZW9A 4XYGA 4MVJH 1HDZA 1LSUA 4IM7A 3K2EA 4XA8A 3RU9A 1SEVA 3ZNQA 1LC0A 1XU7A 3NEPX 1OC2A 5KCZA 3WWZA 4YXFA 1AGNA 2HO5A 1R6DA 2G5CA 1MB4A 2YFHA 2VUTA 4GX0A 3VPHA 2C2XA 4YRAA 3WDSA 2ZYDA 2D0IA 3WBFA 2O3SA 3KLMX 1NPTO 2HSDA 4YJGA 5ICSA 5KOIA 4HNGA 1DO8A 2V6MA 3QQPA 4YRBA 1V6AA 1PR3A 1JDJA 1VLLA 2YJZA 3ETDA 2YW9A 4ALKA 2G0TA 1LDYA 4IXTA 4WNIA 1RPNA 4IS2A 5IFLA 1YBVA 4CM9D 2BI8A 4I08A 3JQCA 4TVOA 1UDBA 2WYWA 5JNLA 2QZZA 4ESOA 2JD0A 1FDTA 4R1UA 2C7GA 4Z3KA 3PHJA 3P7MA 1XYGA 1ZK1A 2X22A 3OMLA 2HMSA 2RH4A 2FR1A 3LQFA 3KB6A 3QWBA 3D64A 4A2CA 4ZQHA 2VWQA 4CLOB 1E7YA 1HZJA 1U3TA 4DVJA 5KVSA 1JU9A 3ZWMA 3I9MA 5ILOA 2Y0CA 1E5LA 3KETA 1VPDA 3DBHA 2D3TA 3O4RA 3WGGA 1I32A 4D3DA 5JAMA 2I5PO 3LT2A 4N5LA 1YBAA 2WYVA 4CQMA 4G5HA 3Q9UA 2FSVA 3DB2A 3ZWBA 1QR6A 5A9SA 1NPYA 3MWEB 4TKLA 4IZIA 3H5RA 4FFNA 1LTHR 1ZK3A 5GY7A 1CERA 4FFOA 3JQ9C 5JXWA 4E4YA 4RZIA 2XXBA 4IGEA 1SB8A 5CAEA 4W9NC 1E3IA 3TOXA 4XYLA 2VRBA 3DR3A 4LN1A 1D7OA 2VT2A 4O0LA 1V35A 2PGDA 4EBFA 1TA4A 1N2SA 4JIGA 1YOVB 3ZWAA 1Y9EA 4MINA 3M1LA 3MOGA 4BO1A 4MP6A 5IN4A 5A9SB 3FPLA 1RKXA 2IDZA 3PYLA 3FD8A 4JXKA 4DPMA 3GR6A 3CKYA 4M54A 3Q11A 5K6AC 3NTOA 5L9AA 1BDBA 1GAEO 1CWUA 3AI2A 2O3JA 1XQ6A 2PZLA 1EMDA 3QJ5A 1YB5A 4FFRA 3HZZA 4OOEA 2P4HX 2UDPA 4H3VA 1UXIA 1PJ4A 1PQUA 2CFCA 3RD5A 1DIRA 4BGIA 3I52A 4NBUA 1LJ8A 1TI7A 2Y93A 1U5CA 2W4QA 5I7EA 3M1AA 3GVHA 2WSBA 2DTDA 1VSVA 1KEUA 3Q6IA 1MXFA 3LF2A 4PRKA 3U09A 5F1PA 4WCFC 2VHZA 4BO3A 4BO2A 3BMQB 5AYVA 3OA0A 2R00C 1YRLA 4TKMA 1R66A 1J5PA 4C4OA 1G1AA 3ITDA 1E6EA 1J4AA 3RASA 3DZGA 1ZJZA 3G1TA 1ENYA 3DC2A 3PHIA 4PCVA 4HFMA 4PLZA 4XQGA 1U2DA 3W1VA 2BRUA 1H2BA 1PZFA 3H9UA 4ILKA 1P44A 1T1RA 3H2SA 5L40A 5CDYA 2DLDA 4JBHA 2DUUA 3IJRA 1PGOA 1KVTA 1VL0A 2J3KA 2X5JO 4O1MA 1WMBA 4Y8VA 2JAPA 4RVHA 1HE3A 4CM4A 3OM9A 4E5YA 3JYLA 4XR9A 2SCUA 1IB6A 2QRJA 3BTUA 4CMAA 3WIEA 3BMCB 2NU7A 2OO5A 4XDYA 1U8FO 2PD3A 3JYNA 3PHGA 4P4GA 3TDKA 1MXHA 1ZNQO 3CUKA 3JQ9A 4Y6PA 1QYXA 5CDSA 2JHGA 2OBNA 2XF8A 4Q3AA 2WWRA 4YAGA 5CDGA 4CMBA 5IDWA 1NWCA 1ZCJA 4LMRA 4BO4A 4DC0A 3C1TA 1E7QA 3JQ7A 3K6JA 1XA0A 1QP8A 2ZTMA 3NGLA 1MLDA 2VRCD 3NTQA 1PWZA 3NT4A 4PGFA 3C7AA 1Z7EA 3BA1A 4Z0HO 2GLXA 5I7SA 4IJWA 4TZTA 5L45A 1M66A 1DFIA 4C7KA 1XELA 4Y98A 5L7TA 4ND3A 3QWIA 4LSWA 4BNYA 3EYWA 3DZIA 5DOZA 7ADHA 4NFSA 4JP3A 2PY6A 4WEQA 1XGKA 4AJOA 1NQTA 1GU7A 1I2ZA 1QMGA 3M2PA 3S55A 3TZ6A 2Q1UA 4J6FA 1K3TA 1BXGA 3RUDA 1NQAO 3UFXA 4JCOA 1LQTA 2C29D 3GRKA 5B4TA 4W7HA 4OAQA 4OO3A 2Q2QA 1VC2A 4E5PA 3I4CA 3B1FA 2CY0A 1QYVA 4G2NA 1EVYA 5COBA 1ZK4A 3K5PA 4JX8A 4Q3DA 4BMSA 1H9AA 4HV4A 4RVGA 4CLEA 1MP0A 5HM8A 4ZN6A 4Y6RA 5B12A 1Y5MA 4BNKA 1R15A 3V5NA 4CMCA 1E3EA 1BXGB 1DRVA 4AJEA 4FR5A 5T8KC 4R69A 3FR7A 4Q3BA 2QZ9A 3RVDA 4ZD6A 4P4NA 4MO2A 4CM3A 1OFGA 3DZHA 2FHSA 4EUEA 2YHIA 1EE2A 3EY4A 3HDJA 4FFPA 1QRRA 1A72A 1E1MA 2J6IA 1A4IA 3F5QA 1PS9A 4WCFB 2JCXA 3ZWXA 1TB4A 4BNNA 4FBGA 4XIJA 1YS4A 2G1UA 1EK5A 2ZCUA 3KXDA 3VVCA 4BHTA 4MKZA 1GCUA 5TIIA 3H3JA 4ND1A 4TRJA 3ZV6A 2EP5A 1BXKA 2PKRA 5KIAA 3GH3A 1I30A 3LT4A 4E30A 2J3HA 1HDRA 1LSSA 2WE8A 1GCOA 1Q7CA 4QSMA 4CM8A 1QLJA 4E2XA 2X5OA 2E6UX 1I10A 3P19A 4BUCA 4DYVA 2VWPA 3PJGA 2FZWA 3MZ0A 3EW7A 5EQFA 3TJRA 5IF3A 3LVFO 1PZEA 5ER6A 1YJ8A 3FRJA 3K96A 3NV9A 5T6BA 1U2GA 1X13A 3H65A 3IP3A 3JQAB 4EEXA 4ALNA 1L7DA 5IN5A 2W2KB 3GDFA 1TLTA 3HN2A 4IQ0A 4YCAA 4GL4A 5U4QA 5A05A 5T64A 4NK5A 2Y0EA 4LW8A 1DFGA 3JSAA 1XIVA 1ZEMA 2QRLA 1I33A 3JQGA 2A4KA 3R0IA 1I3LA 3GOHA 4U5QA 4L4XA 3TZHA 5JE8A 5C37A 1WAMA 2B5VA 5L95A 1PTJA 2WYUA 4TROA 4MIEA 5FYDA 1H6BA 1WPQA 2QYSA 4IZHA 4RZHA 4XYBA 3AM4A 4DXHA 4MVJI 4DRYA 3WWYA 3UH1A 4Z0TA 4F45A 2X6TA 4QO8A 2RCYA 5L7WA 1U3WA 2Z1NA 3ORFA 4J0FA 5U9CA 2FP4A 1HDCA 3ZV3A 3GFBA 5KJFA 5G0UA 3DBLB 4TMFA 1PWXA 1LRKA 4U6SA 2J5RA 2YY7A 3C1AA 4R1NA 1P1RA 2FMUA 4W6ZA 4AJ1A 4RCVA 3DHYA 3CEAA 2GN4A 2Y1GA 3I1JA 1VSUA 1MC5A 3F3SA 1E1KA 1U4SA 3I6IA 4PLYA 4DWVA 3ZN2A 4PG4A 2Z1MA 2NACA 3I9KA 2CDCA 1F06A 2D4AA 3W8FA 5B4VA 5FFFA 3C24A 4NPCA 5HBRA 3RCBA 6LDHA 1C3VA 5I9LA 1C1XB 3I3OA 2O3TA 4DQXA 1EBUA 3NDRA 2W2LA 2RH8A 4Y67A 4BKUA 4OXYA 4FJ0A 1RJWA 5J23A 3ANMA 3WG9A 4CJXA 2EG9A 4XR4A 3ZV4A 1AUPA 2RHCA 1KBZA 9LDTA 1ZMOA 1G6KA 2H1SA 4IGFA 5F1KA 1T4DA 3PEFA 4KP7A 3L6DA 5JFOA 2HAEA 3FN4A 4J91A 1Y8QA 3GDGA 3S2EA 4L4SA 2UAGA 2GN8A 5CHEA 4PLPA 4AJJA 4A73A 4QECA 4ZU3A 3AI1A 4YJHA 3ZZNA 4GGPA 4NMHA 4CV2A 1TVEA 1U7HA 1VKNA 2IEDA 3KSUA 4MIYA 3HQ4O 3KBOA 4U6QA 1GPDG 1E1LA 1UAYA 2Y05A 3BMOA 4CMJA 3IKTA 1P0CA 1GL3A 1P0FA 4YJFA 1ZH8A 5TX7A 4I8XA 1FMCA 1EVJA 2WD7A 4DPLA 3WJAA 1R4NB 5TGDA 1EUZA 3KOUA 4J1NA 3EUWA 5JC1A 1EK6A 4CMEC 5IG2A 3OQ1A 4MP8A 1M2WA 5LC1A 3VPXA 2PLAA 3JD2A 2I66A 3W8DA 1KVQA 5B4UA 5AVOA 2QRKA 1QSGA 1Q2XA 2B4QA 3VPGA 4D43A 3H4VA 3A4VA 1PJSA 5FWNA 4CMGA 4WLNA 1DIBA 4QTZA 5AXDA 1ZSVA 5ENVA 4GH5A 3CE6A 2WD7B 5AXAA 1F0YA 1M67A 4AJ2A 3ROKA 4GI2A 1O9BA 1YL7A 3GVXA 1QLHA 5JW6A 2VHWA 4A5OA 4W4TA 2BHLA 3ST7A 3ADOA 2FPGA 4IMRA 1PL8A 2WM3A 4JBIA 4NHEA 4CLHA 2NVUB 4CMIA 1ORRA 3IQDB 2E4AA 3I9OA 3C3XA 1YL5A 5AOVA 5CG1A 3M2TA 3DQPA 3W6UA 4E2WA 2RBEA 3KV3O 2FPIA 4NNJA 4BGEA 3W4KA 5BNTA 3I23A 3BIOA 1KY4A 5KJ6A 1V3TA 3IMFA 4IJVA 1KC3A 2BH9A 1H6CA 3AY7A 4XKJA 5KKAA 2Q46A 4ND4A 3KTDA 3ZNPA 1LI4A 3RAJA 1H94A 2V6FA 4BNZA 2DT5A 4WLFA 3WXBA 2QYTA 3G3EA 1JTVA 1E7MA 4L0QA 3WLEA 4B3JA 5DCYA 3EAGA 4UVHA 3HUDA 3MJVA 2VYVD 2HRBA 4KUGA 3UN1A 1V9LA 1DRWA 4GGOA 3SC4A 3WLFA 4IBOA 1HL3A 4NIMA 4EITA 1SBYA 4PLCA 4XWYA 2H9IA 5EINA 3ZH2A 4WGGA 3X2EA 3VPFA 3ON5A 3E8XA 5GZ6A 3T7CA 2AXQA 1LXCA 4RPKA 3FHLA 4AG3A 1PEDA 1YGYA 3A1NA 3QA9A 3IS3A 3QY9A 3KYDB 5L53A 5KWEA 3NUGA 2IZ0A 4O59O 1LSJA 1B7GO 1LLQA 2GNAA 2O48X 2VHVA 4LMPA 1JWAB 3IC5A 3U9LA 1I2CA 2NNLD 1B8UA 4BKQA 2Q4BA 4R9SA 3NRCA 4HP8A 2B0JA 4BVAA 3L6EA 3VZRA 1KC1A 1L7EA 3FTNA 4TVBA 3V2GA 3DHNA 4YACA 4EDFA 5KTKA 1F17A 1CRWG 2D1YA 4NG5A 4IDDA 2OMEA 1DC4A 1LDBA 1GTMA 3DEYX 2P9EA 3F47A 2IXBA 3TWOA 2J5QA 4TSKA 3NYWA 3UCEA 3RUFA 1HYEA 3MWDB 2BFPA 1C0KA 1DJQA 2W98A 3PJFA 4MPDA 1B14A 1SZJG 3NJ4A 2GN6A 3OIDA 1UUFA 4BNFA 1OAAA 2PH5A 4Q3EA 3U3XA 1UJMA 3I83A 3F46A 3MJTA 4BNGA 4IDFA 4OXNA 1GY8A 3WGHA 3WICA 2VT3A 1Y9AA 1LNQA 4D46A 5JCJA 5THKA 3UHAA 2YHUA 2UV8A 2B69A 4IIUA 5GZ1A 2Q45A 3JQ8B 1KOLA 3JYPA 3KUXA 3GK3A 4MVJG 2I99A 1VE9A 1HDOA 4XZ3A 3P2YA 1PS0A 3V1TC 3WYEA 4C7JA 4B79A 1JN0A 4YEDA 4D45A 3DMTC 3RKUA 1E3WA 3WGZA 1Z45A 1JAXA 2BFAA 3L77A 3GQVA 3H9EO 3OEYA 5DZSA 4K6CA 1TXGA 3H9GA 3NT5A 1ZFNA 1BDMA 3MJ4A 1PQWA 4MVJF 4J2OA 1H93A 2GGSA 4J3FA 2OZPA 4EUHA 4J1SA 3DOOA 5GMOA 1YO6A 3TFQA 1ONPA 2Q1TA 3UCXA 1UDCA 1HE5A 3OFSA 2C5EA 3GMDA 3BYZA 2EW2A 1C0IA 1PU2A 3PYXA 5CEEA 4TZKA 1GZ4A 4XB2A 1DLJA 4E6PA 1Y5RA 2EW8A 5CP8A 3ZCXA 4E0BA 3HB5X 1PQPA 2HJSA 2PZMA 1OOEA 2EKLA 3EHEA 1LLCA 3GZNB 3E5RA 4JJGA 1P31A 3PIDA 3ROMA 3QVWA 4O5OA 3RJ5A 1CF2O 3HFSA 1PGPA 1CYDA 3GG2A 1DPGA 4BNLA 5G0SA 1YKFA 2XXJA 1C14A 3QLJA 1PJQA 3QP9A 4OL9A 1EZ4A 3IL2A 2A35A 4YAJA 5DCUA 3IKVA 1P1IA 2O3UA 1F14A 1NQOA 1XR3A 4FGWA 4E5KA 1AE1A 2J8ZA 2Q4EA 1ZSNA 4GQAA 1KIFA 2Y66A 5HTOA 3PWSA 4R51A 5A3JA 3R1IA 4B4VA 1JA9A 2GRAA 4NJOA 4I9HA 3GN1A 2RAFA 5JAIA 1O94A 3V1UA 4HFRA 4YDRA 5I9MA 3PHLA 2FZEA 4HNHA 3VH4A 1F8FA 5A9RA 5C3MA 4JGBA 3RC1A 4E13A 3G49A 1Y7TA 2DBVO 5DBFA 1A7AA 1ZZEA 5JDCC 1EBFA 4CLOA 4MIOA 3NGXA 4UAGA 2GERA 4Z3DA 4E21A 1SO8A 2Y99A 1JKIA 4QQRA 3QIVA 2WTBA 2X7HA 4CUJA 3GNSA 3I9LA 1M76A 3QVXA 3X2FA 4AJHA 3S2FA 3TN7A 1WP4A 2XAAA 3LC7O 4DQUA 2DFDA 1ULUA 3U5TA 1UR5A 4HFJA 4WASA 3G0OA 5A9TA 2ZKLA 2ZCVA 3C7CB 3PGJA 3HG7A 4NBVA 3ZWPA 4BO9A 1LDGA 1T25A 5KJCA 4OKNA 1YOVA 2I3GA 1Z74A 1X7GA 4OQYA 1OI7A 4Y6SA 2O2YA 1CJCA 3OHSX 1U3VA 4NI5A 3E1KA 3GHYA 2RHRA 3AU9A 4CQLB 3A14A 5A03A 2JKVA 1BHSA 3PP8A 5KNLA 2V6GA 1NBOA 4D3SA 4XGKA 1T2CA 3AW9A 4A10A 2NQ8A 1WZIA 2OUIA 3AOGA 3PZBA 4B3HA 2NQTA 3I9JA 3DOJA 3WYBA 5JDIA 2DPGA 3KZVA 4FDAA 5JCXA 2BKAA 1QORA 1HRDA 5JC8A 3OBBA 3N58A 3VKUA 1Y1PA 4RL6A 1LLDA 3C8MA 3OSUA 1R16A 3VH3A 4DREA 3BMQA 2Z5LA 1ADGA 3JTMA 1NHWA 2VYND 1B8VA 2JHFA 3DZBA 4LCJA 4R4JA 4L73A 5U1PA 1D4FA 3DZKA 2VOEA 4RJTA 3E9MA 4CR8A 1ARZA 2IYPA 1PGQA 5AXBA 2X8LA 1GYPA 3K92A 1K6JA 1HDYA 1EDZA 4Y9DA 3ETEA 4E33A 1IPFA 4JBGA 3HFGA 2VNSA 4PG8A 1H6AA 5BQFA 2FWMX 3OF2A 4RPLA 4WKGA 1HYHA 2BD0A 5JDCA 4ZRNA 3LU1A 4WEOA 3Q2KA 1Q7GA 1AN9A 4UEOA 1IPEA 4BNHA 3WSVA 1X1EA 3VVBA 2EKPA 3O26A 4GX5A 5DBGA 2YV1A 4CL3A 4NJMB 4S1VA 1T2DA 2GD1O 3F5SA 1EQ2A 1GUFA 3TOZA 2NLOA 1UXJA 5IZCC 2X23A 3BMCA 3AOEC 3HDYA 4XQCA 3WQSB 4R5HA 1Z82A 4J7XA 5BSHA 1ENZA 3ZGYA 1ISMA 4S3MA 1OC4A 3DO5A 1A4UA 2I9PA 4UREA 5K0ZA 4DBZA 5JMPA 4YAKA 4DGSA 3GGPA 2Q49A 4BMNA 4GKVA 1FDWA 4U0JA 3L9WA 3IAHA 3MCVA 3RUEA 1WWKA 4FJ1A 4NU5A 5H81A 1HSOA 2CF6A 2QX7A 3KVOA 2PFGA 2YDYA 1E6WA 4IXWA 4CV1A 5JS6A 4ZJUA 2W8ZA 1VKOA 2VYNA 2GDZA 2YV3A 3SLGA 4BL5A 4DUPA 1GV1A 4RF2A 3RC9A 2FN7A 4CMKA 3JQFC 3D0OA 5JY6A 4EJ6A 5CDUA 3SVTA 5FF9A 3H5NA 4W9NA 2VHXA 4U0KA 4BMVA 4UVDA 3VOSA 4OSPA 1X15A 3AFNA 3GF4A 3KYCB 4KDEA 3ONDA 3FBGA 5HWSA 1ADFA 2HLPA 3D5TA 2VUSA 4PFJA 4YT5A 3CIFA 1HETA 4FOOA 2BFOA 5JY1A 3JQAD 3KLPX 2X0IA 3K2BA 2NV6A 2HK8A 4QO7A 4M55A 3RU7A 4DIOA 5K6AA 4YB8A 3WNQA 3RC2A 1LX6A 3MJCA 1E5QA 4XD2A 1WMAA 3B70A 3OP4A 4UVEA 3EVNA 5JSFA 1Q0LA 3BTVA 1BSVA 3CZRA 1N1EA 4BV9A 3OA2A 4GVLA 4DTIA 3PLRA 1UXGA 3LLVA 1SAYA 4EJ0A 2PGLA 1Y8RB 3HDQA 2I65A 4RV9A 3VPSA 2B5WA 2E49A 4ZHSA 3GMSA 4WCFA 1PX0A 2IEBA 1GV0A 5A02A 1HXHA 2EHDA 2R00A 2Y0DA 4OQZA 3FSRA 5ICMA 3MEQA 3OETA 3WR5A 4J4BA 2NTJA 1K6XA 3K30A 1NNUA 3U62A 2AE2A 1N92A 3IIEA 2JFFA 1FDSA 1E7SA 3JQDA 4WOKA 1HKUA 4B7UA 1MV8A 1NTOA 3FPCA 3R3JA 3UOGA 4BO6A 3I5MA 1C1DA 3AM3A 1TT5B 5IXSA 4DL9A 2JFGA 1EE9A 1V8BA 1WW8A 3FR8A 3OJ0A 1WVGA 3WOHA 3ZHYA 4ZQBA 2HK7A 3LDHA 1E6UA 2G76A 1I8TA 3EMKA 1B2LA 1YVEI 3KSDO 1P77A 2E37A 1G0NA 3JQAA 4PLFA 4IY1A 3I6QA 2W2KA 3WGYA 3GHHA 3K73O 1VJ1A 3H6KA 1B8PA 3WTBA 3O9ZA 1ONOA 1E1NA 4I5EA 3RFVA 1C1DB 2CNBA 1YWGO 3D5QA 1DIHA 3JD0A 2AA3A 1SMKA 1BG6A 4RLHA 3ULKA 2VZ9A 4J9UE 4L74A 3F9IA 3ZNNA 1Q1NA 2O3QA 2GZ2A 5JO9A 4Q39A 1CIVA 4OJNA 1KY5A 4Z9YA 3O38A 4RQUA 2C59A 4FJ2A 3UICA 4EJMA 3I4FA 1KEPA 3GZ4A 4BKPA 1OZAA 3U4CA 2W2LD 3MJEA 4E31A 4M49A 3DBLA 1HDGO 3OECA 2DBZA 4OIMA 4EW6A 4ALIA 7MDHA 5C7OO 2ZB8A 2F1KA 3K31A 4Q3CA 5DT9A 5THQA 3O8QB 5MDHA 2GN9A 2O4UX 3HN7A 4J90A 4IDBA 1AHIA 1DHTA 1M6WA 1PZGA 1YE3A 1LC3A 5K9ZA 3TL2A 2CVQA 3ENNA 5TNXA 2PH3A 1U28A 5KJEA 3TL3A 2YZ7A 1ZJYA 5HRUA 4NQZA 4WPGA 3OQBA 4BQRA 2P2SA 3EGOA 1ZXBA 3QVOA 4FQ8A 1EVZA 4PG7A 3PFFA 4F46A 2PK3A 1GR0A 5EQDA 1ISFA 4BS9A 4M87A 1NYTA 3E6AA 2C0CA 4BNVA 4BOYA 2YDXA 4XJSA 1C1XA 4XDZA 4CLRB 4K1LA 4BNWA 2CDBA 2B35A 5T8KA 2BI7A 4QT0A 1IULA 4MP3A 3AJRA 2P5UA 4PRLA 3WSWA 5CG2A 3ENKA 5AXCA 2EGHA 1I01A 3GNQA 3SEFA 3S1LA 1VJTA 4LK3A 3RKRA 1J49A 4D42A 1GFSA 1UZMA 3CPSA 3KM0A 2NSDA 3RUHA 5KVCA 2PKQO 4CLXA 1JQBA 1QKIA 4DYDA 1KVSA 2A9FA 4GMGA 4RF3A 1FK8A 1AHHA 4GSLA 2X9VA 4XGNA 1CQIA 5H82A 5L3ZA 2ZYGA 2I3AA 3WQQA 6ADHA 3NX4A 1ZUD1 1M6HA 4YT4A 2VOJA 3ZV5A 3DHEA 2BLLA 3CMCO 3L0DA 4FIZA 4RGBA 3GVCA 5DNAA 3QV1A 4BKRA 2DQ4A 4WLUA 3WMWA 3IOYA 5G4LA 4K26A 1DFHA 3D3EA 3D4OA 4MVJP 3DZJA 4PLVA 3RSHA 2FPPA 5JO0A 3PTZA 4FS3A 1R4NA 5LCXA 2YQ4A 4MJLA 1I3KA 4M1QA 4AVYA 2UUPA 2YFQA 1NX6A 2AE1A 2Y67A 4ZRMA 4CPDA 5ER9A 1KVUA 4AJLA 1Z75A 1PS8A 4UUMA 1ZVMA 4AJIA 2HU2A 3ASVA 5F5NA 4P4LA 5L4SA 4BNUA 1ID1A 3H9QA 5FEUA 4R01A 5IZ4A 4W99A 1W73A 2VNAA 2QIOA 1NQ5A 4IINA 1MA0A 2AQ8A 3RBVA 1WDLA 3R6DA 3JCZA 3WX0A 1MGOA 1RYDA 4NH4A 1DXYA 3Q3CA 5TJ9A 4ITUA 1UAGA 1DHRA 2NVUA 2HRZA 1IZ0A 3JYQA 3W4JA 4XB1A 4U8GA 1EQUA 2Z95A 1HE4A 3N74A 3PZRA 3VZSA 5DBIA 4CM1A 3WJ7A 4NBWA 1HWYA 4CV3A 4DBVO 3RUCA 9LDBA 4PG6A 1HDXA 1SPXA 3FTPA 4PZDA 1LUAA 4QUKA 1GUZA 1VL8A 2J3JA 2Q99A 4BB6A 2DTXA 1QV7A 1XHLA 4GX1A 4RPGA 1MFPA 1SEPA 1V3UA 1IHYA 1R37A 3INTA 2VWGA 1NXQA 5TC4A 3TRIA 1KEWA 3UCFA 3JD4A 3B20A 3ZW8A 3PWZA 5L7YA 4WK6A 3OIFA 4EZBA 1P1HA 3QE3A 4J4TA 3CSDA 4QEDA 4UUPA 1L1FA 4D79A 3CH6A 3FNFA 3N7UA 2ZB3A 1XU9A 4XQEA 4BNIA 3PQFA 4DIBA 1PJ3A 2EXXA 4XCVA 4OM8A 2VN8A 1ISIA 3D3WB 3JV7A 1B26A 1Z73A 1X7DA 2GR9A 3BTSA 3D1LA 3KYDA 1SOWA 4XYEA 3ZI0A 1W6UA 5ILGA 4Z9XA 2CVOA 5G4KB 5I8WA 4G65A 3H5AA 2NTVA 5JCJD 2J3IA 1Z6ZA 2UVDA 1Y6JA 5I7FA 4J2HA 3ROQA 4A26A 4B4OA 2NUAA 2P9GA 2E82A 2HK9A 4J16A 4NK4A 5A1TA 1E3SA 3UXYA 5HA5A 3AUTA 3E9NA 1E3JA 4AICA 4D44A 3GEMA 3NAQA 4L8VA 1HLDA 4HADA 4FC7A 1EUDA 3HSKA 3S2GA 4KTTE 1VI2A 4JN6B 4DLLA 4CMEA 2ILTA 4TRRA 3SC6A 1K89A 5CPBA 3GVPA 4YQYA 2CZCA 3UKOA 4RO0A 1CQJA 3COSA 1ZK2A 4N18A 3VTZA 4KUEA 1ZEJA 2YYYA 4FGSA 1B15A 3UGKA 4AJPA 2ZJ1A 1H9BA 1LEHA 2NWQA 4JP2A 4WJZA 3JQ8A 5EIOA 3GEGA 2DUWA 5KVVA 4BNXA 3W6ZA 4R54A 2BF7A 4BB5A 4A27A 1YDEA 3ONFA 2OHXA
chains in the Genus database with same CATH superfamily
5BN5B 2GEBA 4ZYUA 2PKCA 3WYGA 2JA2A 1G8SA 3BKWA 3EISA 3VR5A 5HJ7A 2EX4A 2I8LA 3D6MA 5HKAA 1DC5A 2QW8A 4O4LF 2MMCA 4XX0A 3L4JA 1E94E 2CK3D 5HPYB 3LBHA 3ZHBA 2PVPA 2GUGA 3LUFA 4OKIA 3SNHA 1AB6A 5BQ5A 1Q0SA 1Z3CA 3K9QO 2TMKA 1FSSA 3NTXA 3REGA 2WSSA 3WB1A 1OBHA 3JALA 4ESEA 3ZEAA 3E81A 2PX8A 3GUYA 4RTJA 1DOHA 4ATNA 5BWOA 1FU4A 3OY2A 3O3MB 4YA6A 3UV7A 3OIWA 2R7AA 4CTMA 4BB9A 2EL9A 3CR3C 1EVIA 4II2A 4RPHA 1Y1TA 1CJTC 3K9BA 4X8LA 1UZNA 1XLUA 5F2OA 1BW9B 3RGWS 3W5JA 4C7MA 1O3YA 1E3TA 1F2VA 1R74A 4Y2UA 4KMSA 1FNMA 5LPNA 1AV7A 1FJHA 4KQIA 4U7WA 3LG2A 3WISA 1FA9A 5ED0A 3CX3A 2YCBA 3Q2IA 4J8PA 2DH5A 3RVQA 4BQQA 4O0MA 4HWKA 3T9DA 3U4HA 1QZTA 4DCPA 2MT9A 2KBEA 1GGFA 1DEKA 1NXPA 2PQ6A 5FR2A 3ER8A 3FTDA 4KYUA 3NETA 4MWZA 2ZRBA 2CCKA 4MUHA 4XWKA 1LNZA 5EL0A 2ZYAA 3AM5A 4LXGA 4LZZA 4M7PA 2VXCA 3QPCA 3WLLA 5HX7A 2CV0A 1Z2OX 3BXOA 2A5FA 1UOQA 2BT4A 3OJLA 3PIIA 1PR9A 2BFNA 3HKEB 4KYIB 1YA4A 5DN9A 1SVLA 4MTCA 1O8CA 1JQ3A 2AV6A 4IGKA 1FXSA 3IDOA 3RQSA 2XMBA 4PEVA 5A04A 1D2RA 4Q1VA 4YRGA 4NZZA 5ELLA 2WD8A 1GFWA 3U7HB 4XEUA 1U5AA 2BEUA 2QL6A 1CF9A 2WKQA 3HR8A 1MVNA 5IDQA 3B1VA 3AH8A 1OWPA 5E1MA 2PD4A 4IV5A 4O4HA 5HW0A 1GZDA 2GASA 4INZA 3L7JA 3LP6A 1U2QA 2HA2A 3LUBA 4EJSA 3N6XA 1KO8A 2JA1A 1A2BA 2DTEA 2QNIA 1PQ4A 3RSGA 5DULA 3HO8A 1TDJA 4EECA 2FGKA 4F4HA 1NRIA 3VDXA 4NCBA 5CPFA 2NVWA 4EB6B 3ZGZA 1UPXA 1VYVA 4M83A 5EERA 1KE1A 3T4XA 4YJ3F 3TFWA 3W2IA 3O84A 3PQ6A 5C5IA 1FTGA 2HCRA 5C1DA 4PW0A 2QP4A 4K28A 2WZQA 1P6UA 4IZOA 3DXXA 4FGLA 5H9VA 4BX2A 1UZLA 4OX9Y 1X19A 4MEBA 4YI5A 3A6PC 5DYWA 2AG6A 1KETA 2E4ZA 1XZPA 4UW9A 3EF0A 4BFZA 2XMZA 5AKEA 3W5BA 5KDDA 1WKBA 1NBHA 3AUXA 1FXWF 4HEA1 1ZIPA 1FLAA 1XCMA 4KHPB 2FP3A 3ZCVA 1H2EA 1U02A 2GA8A 4DM7A 3IELA 4KO2S 5B7NA 3D02A 5ALPA 1GGKA 1WA5A 1XMOB 2MIIA 4MVJD 3DBRB 4N0QA 1CX9B 2ZUTA 3W9SA 2FN8A 1SXPA 4KQ1A 4I3GA 5DTIA 5I9NA 4H1HA 2B0CA 4FMCF 2H5LA 5AIBA 2B6NA 1PL0A 4CUZA 2A6PA 1NPDA 4DA9A 4FQ7A 3OY7A 2WE7A 4HJXA 4KN6A 4QGBA 2FFBA 4U7FA 3H0CA 4X91A 4BP8A 2ZUDA 4OLHA 1ML3A 2OOSA 4TMKA 4EG0A 3EOBI 1P17A 1TIPA 4X8HA 4D0GA 3UJNA 2JH9A 1U7DA 2HBYA 3SDZA 1T35A 2AF3C 2E48A 5ERGB 1CETA 5EWLA 3IR5A 1W87A 3KEOA 2JKZA 3DMTA 4IYJA 4ND5A 5M34A 3AHIA 1XTIA 4G2TA 1N7GA 3P5SA 1X74A 1T34A 1GEEA 2B1GA 3ASUA 3OKAA 5EJ2A 5LYYA 1P4JA 2HIGA 3CCCA 3HA7A 1XTRA 4CM7A 4EGJA 4B3MB 1X14A 4PYNA 1KEVA 2OYSA 2R4TA 2W90A 3DLAA 1SUAA 4XFKA 4TTTS 2OK7A 4ZYZA 1RYMA 1BX0A 1Z28A 4MAMA 4IDGA 4H6WA 1VL1A 3ZWNA 4NFYA 2R60A 4LJRA 1VHDA 1RCUA 2FSGA 2GO1A 3CUVA 3OU6A 1PSDA 2R3SA 5DYYA 2LD4A 3WLNA 4CUKA 1IIRA 1VLVA 3O4IA 4QTYA 1QP0A 1ZJ5A 3LWBA 1V7CA 1D6SA 2FZCA 1ZL0A 2V6BA 4MS4A 3QVMA 3AXSA 3NEAA 1DBSA 3GGGA 4FNGA 4KHZA 3UJHA 1RXCA 3D4NA 5CBPA 1ZHFA 1SY7A 3QA3E 4R9RA 4D99A 5EMHA 4UMFA 3GRPA 3H0KA 2JGIA 4GKBA 1M8PA 1Z4QA 1YACA 5AQEA 1MW8X 2A2ZA 2RHGB 4DC1A 1EWTA 1XEWY 1U4NA 1N9KA 2P79A 3TGWA 4EY3A 5D87A 1TC2A 2QSYA 1ANKA 3F6PA 2GVNA 4ZALA 1CS0B 1USGA 1UDXA 1M5RA 2OO5C 1U0OC 2ZIXA 1JW9B 1MZVA 3FSEA 3M9WA 1ZH2A 1U3UA 2YHBA 2ZSBA 3ND5A 3OBIA 1XCOA 5DLEA 3KJFA 1QU2A 1TKBA 3C3BA 4IRMA 4P4SB 3A6JA 3AEKA 4KOAA 2ZUEA 1TUEA 4WT7A 2XDWA 4O3FA 5ES3A 2ZIEA 1FNBA 3SHVA 1MEJA 3MMNA 4X1YB 5JOQA 3W79A 3WIUA 3DBHB 5HXAA 1T1SA 4DUZB 2XKBA 2SICE 3MRSA 3KKKA 1LQUA 3ICWA 4CQMB 2B8JA 3T7EA 1MPTA 3PGKA 1WQ3A 2DE0X 3DMDA 3I0ZA 4DLZA 4REOA 3AEUB 3R7AA 3JYOA 3B6KA 1R00A 2W6ID 2WRZA 3KYJB 3PE4A 1A5ZA 2Y9PB 3KFXA 1GNRA 4IWXA 1GU0A 3AY6A 4OOFA 2X9QA 1BQ4A 1CU1A 1UINA 2OLKA 3KJIA 5EJ7A 4GWGA 3KSMA 2WLTA 4MJXA 2WJ3A 1BFKA 5LQUA 1CR6A 3B1ZA 3FG9A 3BE4A 3OQ6A 1G3QA 5KTYA 4UHBA 2XB6A 1AK9A 1H2AS 5C4GB 5KX5B 4FI3C 3SYLA 5FLXA 4HVLA 5HUQA 1M0EA 1QRTA 1ZRSA 4YNBA 3OT4A 1BVRA 2CZGA 3CH7A 3EG9A 3Q12A 4XDHA 3VI3B 1ODCA 2QJTA 4PONA 2BHSA 4O8ZA 5K7SA 4KYTA 4KDFA 3WGOA 2QMHA 4YRQA 1J00A 2FK7A 1PT6A 1VM6A 4IOJA 2AI1A 4NATA 3D6AA 2COKA 4D41A 1IE3A 2MOKA 3LFHA 3I9V1 3GPIA 4QYSA 5KVQA 3RF7A 5B58C 5CITA 2ESRA 4P3KA 3ZTYA 3IB6A 3M4YA 4KK3A 3KYCA 1HA3A 4C87A 1VSTA 4EHHA 2XW6A 1XTTA 2QN6A 1VKHA 3AUFA 4UU8A 4AP5A 3W9YA 3I5UA 3ML1A 4PZCA 2H1CA 3OURA 5MFZA 1RHQA 1B0AA 2X0NA 3GCZA 3N0VA 3OQPA 4ARZA 2Y71A 3AERA 4Q4JA 4P35A 1FSGA 4PU0A 4UTVA 4KPYA 3G6KA 2G0NA 2JGLA 2REOA 2H54A 2N42A 1XZBA 1A9XA 2O8VA 3BRQA 1K5PA 2VPYA 1VB3A 2Y2UA 3DGEC 3E84A 3IP1A 4R1QA 4QXOA 2C5AA 3EAQA 1G6OA 4RIFA 4HPJB 4F1WA 1QLWA 3ITEA 3IPYA 4PHHA 5JFGA 4OGGA 1G9XA 1UH5A 1N9GB 4L95C 5D5PA 4C6TB 3ZBTA 5I6DA 2J3QA 2ARKA 1PG0A 5ELXA 1Y8RA 3ZIAD 1BE1A 2NP7A 3ANYB 3O9VA 1KO1A 5JMOA 4R2MA 1Y6GA 3SZMA 3VX4A 3A06A 3GLQA 2I22A 3DMYA 3ODGA 2O8CB 1PR5A 2DWPA 1RQ2A 2PXAA 1ESDA 2IIBA 2GPBA 2ZEJA 1QHIA 4HXYA 4PY2A 3GLHA 5BWNA 2ON6A 1T3HA 2QU7A 4X1KB 5H83A 1CDOA 4LJ9A 4ZOBA 1HFWA 1VE3A 3KZXA 4G1FA 3V1YA 2HDHA 4GLOA 2EW1A 3AY3A 1P72A 1YAJA 3DWFA 4G1VA 3UJDA 3FGZA 1KQNA 5JLAA 5LJLA 5EKXA 1V1MA 4K7JA 4MLDA 3GUZA 4CM4B 3VOAA 4LHWA 4XDGA 4V0OA 4DG9A 2PO5A 2GAFA 4L0MA 5EE5B 1T0PA 5A3QA 1X7ZB 5IW8A 3OZRA 4OU4A 1XDBA 1X7XA 2QV0A 2X41A 4NU6A 4CFYA 5IJWA 4F93B 1ODLA 3DW3X 4M8KA 1JQEA 3EW9A 4QTTB 3ZKAA 1JHQA 3U1BA 1ODIA 4M0DA 4UHJA 4BFCA 5BUCA 1L5HB 2J31A 3VNQA 1OB2A 3T34A 1L7AA 3JQ7B 4BATA 1RBYA 1PTJC 4HEA6 2IX3A 3UJ9A 2G07A 4HUJA 2K6GA 4Z9BA 4P0QB 1JU4A 2DBRA 4ZGGA 2DXIA 3OOWA 2F17A 2BCEA 4GW3A 4HH0A 5KKCA 2LRHA 1LBEA 4KXYA 3MT7A 3AVXA 3ET5A 2AF4C 3BVPA 1V96A 3KB1A 4ZAVA 3T3GA 1PJLA 2XRYA 1LBTA 5JNUA 3ZLJA 1XVVA 4PPQA 5FT9A 2WAYA 2QR5A 4JXXA 4GE0A 1XWWA 4ZO8A 1W5BA 4B4UA 4ZQFA 1U9JA 3W5AA 1A9ZA 2YXBA 4HDRA 1E77A 1S7CA 1RD4A 4WESA 5SICE 5T67A 2NPFA 3WHLA 1Z5NA 1MO4A 1UDAA 1UPTA 1ZBQA 2Q50A 1CP2A 1GNLA 2P5YA 3DTTA 2OHFA 3F1KA 3M6FA 4MKXA 2SKEA 4DUGA 1SC4A 1SWWA 1U2PA 2IHZA 2X9LA 4HAIA 4PFQA 3WWEA 1J6UA 1SQGA 1TCCA 3DWEX 4DRXB 4QRHA 2TSYB 4N5MA 4II7A 5SV2A 4EUFA 3RG2A 1KAQA 4PFKA 1V5IA 2GPTA 2WINI 3L0YA 2DHRA 2NO1A 3EXAA 1P60A 2Z9CA 3PC3A 4PNPA 5LDGA 3ZU3A 1RR6A 4BO7A 1UK9A 2ID9A 2V54A 4B7CA 3F2VA 1VLMA 1SU4A 3PWKA 1M75A 3H75A 1IZ9A 3QFCA 1D2EA 1XMJA 2JG3A 3HE3A 2X9NA 3HJTA 4EAAA 1QGZA 4K6GA 2XVYA 3GYBA 4GXRA 4KQXA 4B3RB 2PGIA 1DSSG 4MVXA 1KU0A 2ZTLA 1ZXLA 1J42A 2WJPA 1SCUA 1NBAA 3MBOA 2VRWA 5CIWA 4NBSA 1YKSA 2G9NA 3TNLA 3UPUA 5E7QA 3TPCA 2VP6A 3K15A 4RVFA 4CLRA 4J43A 1X8LA 2DHEA 1S3GA 2ADOA 3V8NA 4IMPA 3UKJA 1T8RA 2O8EA 1XEAA 2WF7A 4WDRA 4ZIRA 1E98A 3QKUA 4AFNA 1ZD2P 3UK7A 4RJJA 3SFTA 1VB5A 3FYSA 1QQ6A 1LVUA 2I3BA 1PGJA 5CA1B 4YCSA 4W8HA 2OV3A 2EZ4A 3B1YA 3GVIA 2PUWA 4FHGA 4K88A 3OE5A 4WBXC 5T41A 4FT2A 4J1QA 5H3HA 1Z0DA 4I19A 4A0HA 1FBNA 4BB6A 1YTLA 1XL0A 3PLNA 4BMDA 1P9LA 3M5WA 4RHXA 4DB4A 3UH0A 4TQUS 3PPYA 5AW1A 1T36B 1BDIA 1YVUA 5GONF 4CR7A 1Z5UA 2O05A 1E7RA 4G86A 5ALKA 4Z86A 4J0EA 3ABZA 4E94A 2HL6A 5LVAA 3QWFA 3OLCX 1MHPA 4GBJA 1T8UA 1A8SA 2AG8A 3WHKA 3NC1C 3WS7A 1DWOA 2VAXA 3AHEA 2YQ5A 4AZTA 1LRJA 5DX1A 4MLCA 3B7PA 2JJ2A 5KOJA 4JUDX 3EEQA 2JFYA 2AKEA 1Y9ZA 3A1FA 1MFZA 2D1QA 3WQRA 1DOAA 1TMKA 2HB6A 2Z30A 3B48A 3PR3A 2PV7A 3IPRA 3OHPA 1XWIA 1OR8A 1RAFA 2YWXA 5B64A 1LU9A 3EHDA 1V45E 3MF4A 1UT5A 2XOXA 4WNCA 1D0SA 3THRA 4BRSA 2PUCA 3UK1A 3E27A 3D4IA 2FXVA 5BNIA 3EC7A 3NASA 4M9UA 4E5UA 2CW5A 2DPYA 5CDTA 3TZKA 5LR6A 3A7DA 1FP1D 5EJ6A 2QLJA 1RXUA 1T3LA 1RS0A 1JVSA 3P45A 4UFPA 1I7DA 2J0QA 4FOTA 1II8B 1XCJA 3KD2A 4TUYB 4P08A 4H7PA 1YHZA 2J3LA 5HF9A 1XKTA 3IOBA 2DP4E 3ICPA 4WKPA 1D8TA 1NSFA 5EIAA 3SKXA 4U2GA 3E48A 4C4ZA 3N0XA 4N0DA 4O3MA 4JT9A 4KQEA 3N76A 1I24A 3OJFA 4GE3A 1JR3E 2ZE5A 2Y8EA 4JVSB 4KODA 3HYLA 4QGHA 1RPZA 2UUAB 3HKCB 2D5IA 1BXZA 3TBKA 3WGQA 4EPTA 3I9V6 1YQEA 2AXEA 4L76A 1FX0A 2R7NA 4I7EA 2W11A 2R65A 4HN9A 4TV8F 1TUBB 2Q4RA 4BZZA 3K8OE 3S4YA 1AHPA 4OMCA 1MABB 4CTJA 5L6LB 3N2GA 2O54A 3FRIA 1BE0A 4HDNB 3PX7A 4MW0A 2CL6X 1G5PA 2IU0A 3F1LA 4DLBA 2Y1LA 4ZVSA 2BLNA 2XNSA 4YJKA 3KZMA 4ER5A 2JFHA 1OI3A 5LLSA 3ASYA 1BKSB 3BGOS 1UMBB 2D06A 5GPBA 1FFWA 1BMFA 1MBZA 1YR2A 4HLUC 2O3RA 1EI9A 2D8AA 3DQQA 5C7IO 4GOJA 1P9RA 2WFZA 3A9WA 3AKDA 3OKCA 4HUQB 4MS3A 1AQLA 4XFDA 5LXTA 3ZVMA 2WVAA 3HLKA 5KTMA 4FHFA 3HRHA 4K6HA 3CCBA 3KFLA 2X5XA 4DIKA 1XZFA 3O3NB 4C7OB 1C8BA 3L1UA 2O2SA 3R75A 4AIRA 2WJIA 1N0IA 1NW4A 1IM5A 4XIYA 2P9CA 1QTRA 1YZYA 2XUIA 2VNKA 4M46A 1N3IA 3FDZA 2RJ3A 3LKVA 5HS6A 5HSGA 3TFOA 1T4MA 1UCFA 2IKQA 1FUKA 2HHJA 3SC2A 4ZEOA 4BJ5A 4XWGA 4WRRA 2PFKA 1SKAA 3C70A 3PFHA 4UVIA 1QGUA 3GT0A 3FPBA 4ZZ1A 3WGLA 2XNDA 1W4ZA 3AFMA 4JK3A 2IXAA 4E08A 1N5OX 1YQDA 2ZKIA 1A7KA 1KZYC 2XXAA 2UYYA 3TLEA 4PGGA 2H51A 4KL8S 4IX1A 2HRQA 4PGMA 1T5OA 5K3DA 3H8JA 1KERA 2R4UA 2ZRJA 3WY9A 5TB5A 3F4BA 2RHWA 2YN4A 1SPBS 5KHAA 1Z4JA 3GZTB 2B82A 5B2EA 1PJ2A 4KQCA 2QGFA 2AG5A 1AMUA 2VSOA 5L4NA 5IRCD 3VNAA 3V8QA 1OWMA 2PL3A 3M6WA 1Z12A 2HFJA 3IBYA 4IW3B 4AXBA 4INAA 5FB3A 2IIQA 2KW5A 3OJCA 5G4KA 3AWDA 3MW8A 4IJ5A 1T4BA 4LZLA 1JJFA 1JEQB 1YH3A 1XMPA 4KFRA 3UAXA 1E1YA 3E4DA 1N5LA 4RLQA 5JSKA 3VDQA 1KH2A 4M0FA 2WPDA 8ADHA 4PN3A 4Q4LA 4WTOA 3RT7A 4S1OA 1ETUA 1I5EA 1Z5OA 4TLCA 1IATA 4E46A 1N7HA 2J9FB 3HH8A 4BQSA 1H2HA 1I3NA 4YT8A 2QL7A 4C20A 5AVUA 5HP4A 3UYKA 3N6RA 2B21A 1FS4A 3IDZA 3BZBA 4JBWA 4X54A 2UZ1A 3CVYA 3ITNA 4G8CA 3PX3A 4Z8YA 3PTAA 1U0BB 1KHHA 1ZKDA 2QT9A 2B36A 1NMZA 2ZZKA 3GLTA 1ISGA 1JXOA 2OKCA 4ZOAA 4ZV7A 1KY2A 2GA9A 2GEUA 4DQ0A 3ABRB 2X0DA 5AVRA 5KO2A 4QXMA 2GJ9A 3H6GA 3P9XA 1EB8A 1YXMA 3FVTA 4ZCTA 2RHDA 2B37A 2D74A 3ER9A 3ZWKA 1Z0IA 2FRVA 1YZTA 2C4NA 2Y1WA 3E23A 5EY5B 3SDBA 2PMWB 4P9NA 3T1NA 3M81A 2QU8A 1DZ3A 2GN1A 4ZCPA 4YQFA 5DGIA 3K2QA 3EXHA 4WUTA 1MN6A 2FPGB 4Q02A 4RVDA 1Y98A 1H05A 3A9SA 2Q5JA 3MRTA 2CSUA 4IV0A 3ZYCA 5JRDS 3WB9A 5ALSA 1CY4A 1V7PC 4BKOA 1IIBA 2RIPA 2D59A 2OHJA 5GQSA 1CFJA 2RBGA 1LDMA 1FFCA 4FFBB 2JLAA 4J0HA 4DABA 4YR7A 3IEVA 3E35A 2ONCA 4PVDA 3NFRA 2EFDB 1A7JA 1GZHB 2XE8A 1RFGE 3SXPA 5BN5A 4FYIA 3ACCA 5FI3A 1PFUA 4EFDA 3G9TA 4YRNA 3NIFB 2WIBA 4B09A 4DA4A 4I3HA 1R0KA 1Y6ZA 1FDRA 4IFEA 4EGQA 4YCMA 1M2NA 3OPXA 3L07A 3OESA 2SBTA 4RTSA 4GR9A 4MPRA 4Q7QA 3T7RA 5FWYA 3U7QB 1IBMB 5ALQA 5K8IA 3DEIA 1VPWA 4NOMA 3C6MA 4D5GA 5HR5A 4A2WA 5AK4A 3U7EB 4H6VA 4DJTA 1JLHA 1IXYA 3OUUA 3N0WA 4ACBA 1GGJA 2VIIA 4QGGA 4WE3A 3T1TA 5H8WA 2BP7A 3SJ7A 4JSYA 1FU7A 1K2WA 2HMTA 3DBVO 4N0PA 2IOFK 4YGYA 3SFZA 1KXJA 2ZREA 2HXGA 4J76A 1GGNA 4OVKA 5DGTA 2P91A 3W3AH 3E18A 5TQ0B 4BMZA 1XOIA 4QJ5A 2Y6VA 4J9VA 3GAZA 3IT0A 1MQAA 1P1CA 1BW9A 1W36D 1JAHA 1J2JA 2HK6A 2AD1A 2DF8A 3U3MA 1NI3A 1QC5B 2Q2WA 4JJ8A 5ELMA 5K8UA 4CTKA 2BWJA 2V7WA 5DO9A 4CEJB 1RM3A 5DHTA 1L5SA 3EC1A 1P29A 3GJTA 4C4RA 1IY8A 1QG4A 2H0RA 3HCCA 4H60A 3HB4X 1KWGA 5JVDA 2XWBF 2GHQA 2FW8A 3V8BA 3R7BA 4HNUA 5KB3A 3V2IA 3WMRA 2GD6A 4MW1A 1Y6FA 3IIIA 2HD4A 2XBLA 3I4LA 2NGRA 5AVYA 1MNQA 4IQGA 4M7OA 4ZI2A 1OX4B 1JLMA 4W7IA 2FW7A 4ZQEA 1RM4A 5FI5A 3HKEA 4JOQA 3IPXA 3WADA 1MVLA 1D1PA 3Q9NA 1DC6A 4BN4A 2OCKA 3QSGA 3LUCA 4JCCA 3PE3A 1ZJWA 1SQ6A 3F8SA 2X0EA 1G9TA 3W8EA 1ZUIA 5C7LO 1K86A 1O6ZA 3LZ6A 3WGNA 3K2IA 1X1DA 1IZYA 1XDUA 1G8GA 3IXLA 5EPOA 3TAUA 4LJ5A 1NDQA 3HNPA 2UZ4A 3WTCA 5KAMA 5A06A 3LT0A 4Y1RA 3HSSA 3ONWA 4FILA 4OJMX 5GGXA 4H1WA 1UPCA 5LMZA 1MHTA 2XSZA 4FPXA 3VR6A 4PHCA 5E4YA 2ZYVX 3BMNB 5F9MA 1H0KA 1I4WA 4EB6A 4MR7B 1UADA 4BYMA 1GL9B 3FSGA 3K0FB 4GX2A 4H7DA 1T9DA 4OQLA 3G2IA 2FLVA 4BO0A 4HNVA 1BGWA 1KL7A 1KYIA 3K6KA 3I73A 1E0DA 3BFJA 3NBMA 2MCFA 5JYBA 2VTVA 1ZA1A 3UMYA 2NN3C 1JNYA 5CEFA 3I1YA 2C3YA 2ZAYA 2QZSA 3ZU5A 3I09A 4JLJA 4OH1A 1OWNA 4PQRA 4NBRA 2XIJA 3KEQA 3RIYA 5B1YA 3AUUA 3BHNA 3E0XA 3AZQA 4ER6A 3IFSA 2F00A 3DBRA 3URKA 3ZNOA 4RVCA 1G64A 3DEFA 4BB0A 3O03A 5C8ZA 4EF6A 2FFHA 2H92A 4JC5A 5CXXA 1RTKA 3U4IA 3WWOA 4CKZA 1XEXA 1M2OB 3LLCA 3PXXA 2BSXA 2ZQYA 4JELA 1T2AA 1IUKA 3OFNA 3L0BA 4JA2A 1EDBA 3GROA 1NR1A 3OJWA 2KSQA 2QENA 2XGOA 1GGEA 1KJJA 3BN3A 3QFRA 5K45A 4EQ6B 5B1IA 4HB2A 5EZYF 2XH8A 4FYHA 5D1NA 3OJEA 1F5SA 2D2IA 1GPMA 2VJBA 2Z43A 4Z4IA 2Q1WA 5EMNA 2X8JB 1JPJA 1XD2B 4WNAB 5EOVA 1JQLB 4DJFC 1A5SB 1QAQA 3BF8A 3PUJA 3T1YB 4L15A 5EIWA 3CN9A 1ENPA 4BVGA 4L16A 5GJVC 2WOOA 1L4EA 2PU5A 5IEJA 1T13A 2AK3A 3EDYA 4MVJH 5FTMA 5IKOA 4Q7LA 4QHSA 1SEVA 3D81A 1XU7A 3LQRA 3P52A 4XW2A 1OBOA 3ZNQA 4E14A 4LS3A 3BS4A 1N78A 4NS4A 2VPWA 2Z04A 2CKMA 4MR9B 2VUTA 2OFFA 1NT4A 2C2XA 4YRAA 4G85A 1IXSB 3A9RA 3IUNA 1FRNA 1FSPA 3D54D 1DBQA 4H4EA 3WBFA 1VBNA 2O3SA 2IUEA 3KLMX 4R8VA 3STXA 2HCJB 3A6ZA 2V6MA 1SUCA 1G7CA 2FOLA 2J4DA 1V6AA 4YRBA 1EUQA 1RWMA 4H35A 3ETDA 1GFZA 3OC0A 3I37X 2ZRMA 4ME6A 4IXTA 4ZRDA 3RDPA 1RWKA 1RPNA 5G41A 1E2QA 4IS2A 4G26A 1SQFA 4TVOA 3JQCA 4QDZA 1UDBA 1A1SA 3CB4A 3OPVA 4H6PA 4ZVOA 5HG0A 2MSEB 2OWDA 1FDTA 2WIKA 2QD5A 5AH0A 3UGTA 2G8NA 3P7MA 2DUMA 5DM4A 3PXGA 3WRVA 5DHRA 1ZK1A 3VO8A 5CVEA 3KB6A 3O75A 3QWBA 3DYVA 4ANFA 4YHBA 1Q74A 2L18A 4P4SA 2VWQA 4OJTA 4GPAA 1MRZA 1U3TA 4DVJA 3FPJA 1Z06A 5J2UA 1JU9A 2N3ZA 4RM2A 2V9PA 2VL7A 4X1YA 2AG1A 4DG8A 3DBHA 2HSWA 3O4RA 5ALHA 1I32A 3AJ9A 1NW8A 2WMNB 4IF4A 1ZD3A 3LT2A 4FE7A 4UUBA 4CQMA 5FEMA 3C2QA 2F64A 5F23A 4YI3A 2VJMB 2X1LA 3JWEA 5EHQA 2IHKA 1NQUA 4MRSA 3G7SA 3AEUA 1CP3A 1VECA 2CLHB 2YRXA 3LKBA 1PE0A 1GPUA 2P9ZA 2XMDA 3O0TA 4PXSA 3RJMA 2RH5A 1BH6A 4BX9A 1FQKA 1K68A 4Y6GB 1LTHR 1WZUA 1IK6A 1TOAA 1T8WA 2H3EA 3GJ7A 4FU0A 1SBCA 4MGKR 3VU8A 3WK8A 4YIKA 2J30A 2CUNA 1YS2X 1GXSA 5K0LA 1E3IA 2RCNA 3RVPA 2QI9F 2VRBA 1SIBE 3PFIA 2XUZA 1D7OA 5LYJA 1SVSA 4C5AA 5KX5A 1V35A 4GYJA 1N0VC 3VSAA 1AVTA 3GP3A 4NJEB 4JIGA 4LF4B 2CYAA 2E18A 4KX5A 3S7ZA 1L8AA 4JLAA 1XO1A 4MINA 4RHTA 3P2KA 2ZE8A 1THGA 2JB9A 4MP6A 4WBNB 3SMVA 2IDZA 4Y2SA 4C88A 2ISCA 2WMOB 3BAFA 3EGVA 3GAMA 4M54A 1C4WA 3N6VA 3T3IA 3EBLA 1TU4A 2Z56A 3AI2A 2H9AA 2O3JA 1A04A 3S81A 3IVCA 1K7CA 1JPVA 2P4HX 4F5ZA 1Z6QA 3OTIA 5B58T 3ES9A 2YJ3A 2W7TA 3DLCA 3C7TA 4U02A 3E9DA 4ZPXA 4AQDA 4BGIA 4R3UC 1J20A 5JS8A 1HBJA 2C9BA 2QGZA 3Q5GA 2BMDA 1WW2A 1U5CA 3K0HA 4RQBA 2OMKA 2QD4A 2V7TA 4DM3A 1OHHD 4F11A 5FA8A 2DTDA 3IIJA 4XOIA 2XMSA 4A23A 2XVMA 3D8HA 4PZ9A 1JXQA 5J4YA 5FWXB 4C2TA 5F1PA 5KTOA 4EFNA 2JNWA 3BMQB 3M4XA 1YVDA 4PWZA 1M9NA 2W2MA 4NAUA 5ALGA 2AD5A 2YS7A 3AILA 5BWMA 2GI4A 4TKMA 3KETA 2IYFA 1R66A 1J5PA 5BOVA 4C6TA 5FKJA 4C78A 4NOJA 1FFYA 4C4OA 4AC9A 4P53A 2VCHA 2DQKA 4HPWA 1X8KA 4B3GA 4Q1BA 1E9FA 2Q3FA 1EDDA 3PHIA 4PCVA 1W85B 4PLZA 3W2HA 2O8CA 1LNSA 1U7WA 1U2DA 4LXYA 3W1VA 3ZJVA 5HK9A 4X1KA 1P44A 4D8YA 3BH0A 5CDYA 1B8OA 2DLDA 3M5CA 5CXQA 5IFKA 3LOUA 5KVAA 1AD2A 3CXUA 3DKVA 1KVTA 3VO9A 3UMMA 3GFFA 4UASA 1SC1A 4Y8VA 4CM4A 2N46A 2ZITA 3EASA 4MA4A 4G0ZA 4OGFA 2VEOA 2SCUA 1V4NA 4HBZA 4LNHA 2WHYA 4LXUA 2QRJA 2EDCA 1X7ZA 3G5TA 4ECAA 2G9ZA 4AP9A 4N03A 1LK5A 2B9VA 1MC8A 2OCGA 5K3SA 3WIEA 4EI7A 3PEWA 3PHGA 4DDKA 4KXWA 2KM1A 4X00A 5EKTA 3HJBA 2K2WA 1C8VB 1SXGA 2ZLBA 4R9VA 3RG8A 3DOEA 1Z26A 5F9HA 1Z15A 2JHGA 1D0VA 4D9NA 1C3JA 2XF8A 2WWRA 5J5CA 4EMSA 1NWCA 4LMRA 3TIGA 4MWSA 3RFCA 3JQ7A 1JHRA 1OTYA 1FMLA 2AHOA 3M1YA 3NGLA 3S1SA 1A8UA 1LB1B 3RHTA 2IYSA 3W7VA 3ZUGA 3NT4A 2HA0A 3C7AA 2RKBA 3SAJA 1O54A 1W0KD 4S04A 4C7KA 1ZM9A 3QEAZ 4L8GA 4BLWA 4ZI3A 4KPFC 5L7TA 4BNYA 4CL0A 4L5JA 2VF4X 4RZQA 5DOZA 4TMZA 2PKXA 4UNIA 1RMTA 2VH5R 1ZJJA 4WEQA 4AJOA 5IX8A 1JEJA 1YZ3A 3AG5A 3QYAA 4PSKA 1ABEA 2JDID 2P1ZA 4CKEB 1BXGA 1J9EA 1M8FA 1NQAO 2P3OA 2RI0A 3L6CA 5A4MS 3QKSA 3UAOA 3GRKA 2WU3A 3EE6A 2CUTA 4JZKA 3F5FA 4L02A 3O73A 1O7JA 4QICA 4HXFB 4OO3A 4DGQA 1VC2A 1TNDA 4DRXA 4E5PA 3I4CA 2CY0A 1LW6E 1Y6RA 3C8ZA 4JEUA 4R0VA 4GXNA 3R09A 4KJZA 1XE3A 2D8MA 5CD9A 3T4UA 1PK9A 4BMSA 4RVGA 2VQDA 5ALLA 1H2FA 4BDSA 5HM8A 3QBTA 4ZN6A 3DYBA 5B12A 4DY4A 1Y5MA 3BXHA 1SURA 3O8BA 4C7VA 2ZUVA 3N2EA 2WF9A 1DRVA 5ICCA 4M22A 1WO8A 2R2AA 4FR5A 5T8KC 1A0OA 5EWJB 3N75A 3ZE0B 2XNCA 4EG5A 4JYMA 2J45A 4U9HS 2BMFA 3B2EA 3NM4A 2Z1DA 3BE8A 2W2PA 4TWJA 3WA6A 5JZSA 2QOEA 1N7IA 3P2MA 3AHGA 2ZWVA 4EUEA 1TM2A 4FWIB 1A77A 5FOTA 3EY4A 3BK7A 1C50A 1BRTA 1QRRA 1SVNA 1PVVA 3WLKX 2YHAA 3T7DA 4J6EA 1O0BA 2XNHA 4WCFB 1R8SA 2C2OA 1A95A 5JCOC 1UIRA 5BV1A 2X7XA 1FSZA 1TB4A 3KXKA 4GZ5A 3H3XA 3SJCA 3FUXA 4FBGA 1WG8A 2YVQA 3FTFA 2DY0A 2G1UA 5F7XA 2HNKA 4JASB 2YXLA 2ZCUA 1RJ9B 5DYTA 3KXDA 3VR1A 2VATA 3CGGA 2I2FA 3QPUA 3LJKA 2QJRA 1SKMA 3EOAI 4U4AA 4GNKA 4JLPA 3WV4A 3ILXA 3H13A 4E30A 1TF7A 2R6HA 2ATIA 2BC9A 3TPZA 1T36A 1TC1A 1LSSA 4DLSA 3A70A 1GKKA 2XUJA 3BSFA 1Q7CA 1KYXA 3KG2A 4HN2A 1MQSA 1Z37A 4HGNA 4LJSA 1R0YA 1ML4A 1W9HA 3HVUA 1PJ8A 1FQOA 5EXPA 1SRQA 1XDZA 3VNVA 2ZYIA 5KWJA 1A8IA 3MTAA 4YP0A 3SYTA 3AR4A 2PX6A 1ACMA 3EQ9A 3HB1A 1L5FA 5ER6A 2H17A 3K96A 1XNHA 3PSHA 1DQNA 4AZWA 5EIXA 3C3PA 3L40A 1QJCA 1BO6A 1IRIA 1I6LA 1L7DA 4B35A 1GQSA 2Q0SA 2GM3A 1TLTA 3CLSD 3G89A 3ICOA 3FIUA 4UXJA 3IMKA 1XMSA 2XEDA 3BEOA 2Y0EA 3GFVA 3PL1A 1ZNYA 1PBNA 4RTMA 1T0BA 5DNCA 1C30B 4A2QA 3USCS 1Y37A 2FPLA 1Z6YA 1I3LA 1M5UA 2JIQA 3BWBA 3R0IA 4UFOA 4L4XA 4L8YA 1OH7A 1KDTA 5L95A 3JRNA 1VIYA 1WAMA 4AKHA 4HG2A 3B9RA 4NPHA 2WTAA 5GJCA 2XECA 4B33A 1II8A 4TUYA 3CBGA 2EL7A 3O2NA 4TL8A 1OXMA 4TROA 2O0MA 4MIEA 3PUVA 4DR5B 2QYSA 2EP8A 4IZHA 2A9QA 2BDUA 2O1SA 4QRDA 2VNJA 4RZHA 4UU0A 5C9ZA 3WWYA 2W83A 3UH1A 2OQRA 4Z0TA 1PJZA 1MOZA 3NAZA 5DASA 4XUEA 2RCYA 3OZVA 4MZXA 1H5NA 2JI4A 3LSTA 4J0FA 4Y2GA 5U9CA 3HKCA 3ET4A 3ZV3A 3V6MA 5G0UA 1TA9A 2BF4A 3T35A 4YPVA 1LRKA 4HQLA 4U6SA 4OHYA 1EFPB 3PBKA 2YY7A 2B1RA 1MABA 2QTHA 3GUUA 4UM8B 4W6ZA 1Y6QA 2XI4A 4OA5A 4HDNA 2AZTA 3ZV7A 4F2WA 5IK2D 1Z2DA 3I1JA 1YNOA 1E1KA 3NDPA 4PLYA 3TK1A 3OLWA 4DWVA 1A5TA 2CBGA 4PG4A 2W2VA 4UJ3A 1D2GA 3UTDA 3I9KA 5DT2A 1Z22A 2PRSA 1RI1A 1OLUA 1UMBA 3FGOA 3IQXA 4LE0A 2CDCA 4AD8A 2D4AA 4A8TA 2YVLA 4MJ7A 1U1FA 3CF4A 4HUQA 4RA9B 1Y82A 5HBRA 5DEOA 1EXDA 4RXTA 2P9FA 4LF7B 4MJ3A 2BFFB 1EDEA 2PGXA 1RHRA 3K9CA 2IHUA 1XRJA 1TYAE 2OAQ1 3OIVA 4NMLA 4XM2A 3WDMA 4C7OA 3V8EA 4BKUA 2GM9A 5KWVA 2DJ5A 4KQ9A 2C4TA 1PR2A 2R0QC 1R3UA 2FQQA 3ANMA 3DTVB 3F96A 4FDLA 4JT8A 4N47A 3WG9A 2PT6A 4CJXA 3ZV4A 1X42A 2NAPA 1VPTA 1AUPA 2RHCA 3CVUA 3ZI4A 3ZCSA 2Q6LA 1ZMOA 3UANA 1FP4B 4IGFA 4JY7A 3PEFA 2ZRGA 5F1KA 4KP7A 2JI8A 3QMWA 1U98A 2FN4A 4D25A 1A4RA 1RWOA 2OV2A 3DCIA 1XYYA 4J91A 5EUCA 1AZSC 4BLVA 4D3YA 2GN8A 4PLPA 2FUNB 4AJJA 3LPDA 4K6OA 4Q82A 2X4LA 3R23A 4U1RA 3PKJA 1N6NA 2BFBB 1T1JA 2F3QA 3NH6A 4GPEA 4QECA 4TXHA 4ZU3A 3RVOA 4CG0A 5AJWA 3U4AA 2Q5FA 4GGPA 4NMHA 1MOPA 4UQPA 4D82A 1FW8A 1VKNA 5TGZA 3CF0A 1BHQ1 3W5IA 4U6QA 2VBGA 2O1XA 4CMJA 3AR9A 1UJ5A 4HQOA 2W6CX 1YZFA 3IKTA 1GL3A 1ZH8A 2R751 1J06A 1ONSA 3LQYA 5U4XA 4YV2A 2V96A 3K1AB 3KALA 4KLAA 4PZUA 3AJAA 3MCTA 2LVBA 4AMUA 1NOIA 2H65A 4EO4A 5TGDA 2G04A 2V97A 3GMTA 3EUWA 3RPEA 1STOA 1UQTA 4U7JA 2I2WA 3FMIA 5IG2A 3OQ1A 4KLNA 2J9FA 4MP8A 3P4XA 1AQNA 3VPXA 3UJ3X 4NP6A 2PLAA 3JD2A 4J0JA 2Y9MB 1E8NA 3W8DA 1U5BB 5AVOA 1Y7HA 4DNFA 3PRYA 3M4ZA 1IQUA 2B4QA 2EKDA 1FSFA 1M3SA 1IN6A 1PJSA 4WOCA 1GG5A 4WLNA 4CMGA 2FUG1 5HDBB 4QZVA 1ZSVA 3ROFA 2J33A 3NP7A 2WD7B 5EP1A 1F0YA 3KJQA 3ROKA 2A0FA 1Z47A 2H00A 4RY9A 4YMGA 3L2OB 1TKAA 3N53A 2FDXA 1USUA 1CUWA 3NHSA 4LYGA 4W4TA 2FPGA 2PANA 1TVKB 1CULC 3FKSA 5CNJA 2H1FA 3FZEA 3VU0A 4URVR 3QE2A 5E9JA 3FPGA 5B1EA 4ZTZB 2F1OA 3MILA 4AJ9A 1FJ2A 2HM7A 4G5FA 4EIWA 1QO0A 3ECAA 4AO7A 4KRGA 5BOSB 2FN3A 4DV7B 2RBEA 3KV3O 1BMTA 3GJSA 5BNTA 1U90A 3VSEA 4BGEA 5ALNA 5AW4A 1T5BA 2O8BA 1KU6A 1KY4A 4W8GA 5BW5A 5KJ6A 2CKDA 3BQMB 4UCQA 4FUQA 4IILA 2UVPA 1NLYA 3C87A 4L5IA 4AUKA 4M0KA 3OO0A 1CTQA 1AK2A 2L2QA 2AW3A 4EYOA 3U3JA 1L5OA 2HREA 4XKJA 5KKAA 1U3FA 2PO7A 4Y2PA 1XZIA 3KTDA 3L49A 3OEHA 4BNZA 2DT5A 4TSFA 2QYTA 4EHKA 1JTVA 1E7MA 5C8YB 4EJ2A 4C0XA 3CB2A 4WK2B 5AUOB 1QIKA 2QMOA 2MINB 2PLWA 3A26A 3EPKA 2XCOA 4GNRA 3HUDA 3CN7A 3KNZA 2VYVD 4ROTA 4BBZA 2MSDB 3QNMA 1JX6A 1K06A 5TQ0A 4LDZA 4PO8A