3L77A

X-ray structure alcohol dehydrogenase from archaeon thermococcus sibiricus complexed with 5-hydroxy-nadp
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
235
structure length
234
Chain Sequence
b'EMKVAVITGASRGIGEAIARALARDGYALALGARSVDRLEKIAHELMQEQGVEVFYHHLDVSKAESVEEFSKVLERFGDVDVVVANAGLGYFKRLEELSEEEFHEMIEVNLLGVWRTLKAFLDSLKRTGGLALVTTSDVSARLIPYGGGYVSTKWAARALVRTFQIENPDVRFFELRPGAVDTYFGGSKPGKPKEKGYLKPDEIAEAVRCLLKLPKDVRVEELMLRSVYQRPEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain alcohol dehydrogenase
publication title X-ray structure alcohol dehydrogenase from archaeon Thermococcus sibiricus complexed with 5-hydroxy-NADP
rcsb
source organism Thermococcus sibiricus
molecule tags Oxidoreductase
total genus 93
structure length 234
sequence length 235
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3l77A00
4JN6B 3DO5A 5HBRA 3WQRA 3C1TA 5IJZA 2C82A 3X2EA 4YEDA 3PEFA 3O38A 4CM5A 2JCVA 4E2YA 3AI2A 1UXGA 1N9GB 1P44A 2Q99A 3DOOA 2QZ9A 4I8XA 2ZQYA 5CAEA 4QT0A 1LLDA 4AFNA 2JFFA 3Q9UA 4FFMA 2X5JO 3FNFA 3FF4A 1K0UA 4Q3CA 2C59A 1K6JA 4ZQEA 3DBHB 3WS7A 1VSVA 2I3GA 2JAHA 1HKUA 5HWSA 3DHYA 1HYEA 5CDTA 3UCEA 4K1LA 4MVJD 4MIEA 2O7QA 4AJIA 1T2EA 1J49A 4PLWA 4LVCA 1PWZA 1KC3A 2HUNA 3AM5A 4BO4A 3UCXA 1V8BA 5KJFA 1AXEA 3KOUA 1IHYA 1YBAA 5I9NA 3NTQA 1UAYA 5F5LA 3DWFA 2B83A 2WYWA 2IDZA 4N7RA 4GMFA 3GZNA 4WE3A 4PLFA 3CH6A 3T7EA 3ZNQA 1IB6A 1SOWA 3IAHA 1DRVA 2E37A 1OI7A 1YE3A 3SX2A 2D0IA 3D64A 3ZHZA 3BMNB 3HSKA 3ZHXA 5K6AC 3AUTA 3KSZO 3WOHA 3RBXA 1ML3A 1MG0A 1WMAA 5AVOA 1NFFA 1XCBA 3PQEA 3PYLA 1TVEA 1XWFA 3KSUA 2Y66A 4K28A 4W9NA 3NTOA 1IL0A 4OKIA 4B4UA 4LK3A 3UF0A 2NVUB 4BKPA 4B4OA 1PQPA 4F6CA 2J3IA 3Q2IA 4G5HA 4WJZA 4WKGA 1SO8A 3UKOA 3NEPX 2RH4A 2Q45A 1RM0A 4EEXA 5DCUA 1KY4A 5HS6A 4P4LA 5CPBA 1PIWA 3SJUA 1UZMA 3BHIA 3WMXA 4E6PA 3EAGA 1UP4A 3VDRA 5JAZA 2VZ0A 4IDEA 4CLXA 1LSOA 2Y1FA 2FPGA 3ZHBA 3CZRA 4YAEA 3I9JA 1BXGA 3ROPA 5A04A 3JYOA 1UDCA 4YR9A 2GRAA 2HK7A 2GN9A 2VNSA 2PZJA 1L1FA 2VOJA 1OC4A 4CMEC 1RYDA 3PHGA 1NPYA 3WNQA 1KEUA 1GDHA 4L8VA 3S2GA 4M8SA 1H6AA 2DUUA 4R3WA 3FNHA 4MIOA 1EUDA 2RIRA 1GR0A 3TWOA 4J4BA 2FY8A 4ALNA 4BNJA 3VAZA 1ENOA 2OUIA 2O48X 1HT0A 5DCYA 2NU6A 3MJSA 5DBFA 1JQBA 3INTA 1M2WA 1UZLA 2ZATA 4RDIA 4J3FA 2DBVO 3RI3A 2FRDA 1Y8QB 1NM5A 1ULSA 2HK9A 4OIMA 4OMUA 3ST7A 2Q3EA 1SPXA 5BNFA 5JYEA 5G0WA 4U8GA 5CP8A 5GMOA 4XKJA 3DEYX 3VH1A 3TZ6A 4IBOA 1ZUD1 2P9CA 4FW8A 4JXKA 4YAJA 4YT4A 1YRLA 1LDGA 2P2SA 4DPLA 1XA0A 1RM4A 3OQBA 2OP0A 1T2FA 4A2CA 3PP8A 4OXYA 3W4KA 1YDWA 3HWRA 4IJVA 3DAPA 1TXGA 3O8QB 3BTUA 3OM9A 3PTZA 3BA1A 2H1SA 1TI7A 1DDOA 1SMKA 2AEJA 4D0SA 2BGMA 3P19A 2VTEA 3ZH2A 5F3RA 2G5CA 1LQTA 4RQUA 5EN4A 4OYRA 3U4DA 4E5MA 1YB4A 1OFGA 1MGOA 2J5RA 3LT1A 4RPHA 1ZZEA 2OXIA 3TQHA 4ZQGA 5BSHA 2V6FA 1L7DA 3AU9A 3Q6IA 4B3JA 4BO9A 1G0NA 3W6ZA 3AI1A 4RDHA 2YV3A 2OGUA 1MB4A 3S55A 4I9NA 4H3VA 4CM8A 1OOEA 1K89A 2VNAA 1NHGA 4A27A 4EBFA 5JE8A 3M1LA 4CR6A 3ZDFA 1JVSA 3VZQA 2DKNA 4NBTA 3TFOA 3MWDB 1Z45A 4HFRA 3IMFA 4E4YA 4RLHA 1VPDA 3I6QA 4ID9A 3VOSA 2DM6A 4XYBA 4EI2A 2IEDA 3S1LA 4CLRA 1QV6A 4NFYA 3I83A 1MA0A 4U5QA 4C7JA 2QW8A 4R68A 4RL6A 3WB9A 2ZTUA 4O1MA 3GEGA 5MDHA 5JC8A 2C2XA 2DLDA 2NACA 2D5AA 3ZHYA 4B3IA 1H0KA 3HNPA 1GQQA 1V9LA 4QO7A 3UVEA 4XRRA 1VSUA 4J4HA 4XZ3A 1HF3A 4XYLA 1ZFNA 3NT4A 4UVHA 3F9IA 3VZPA 4YAGA 3QE3A 2O2SA 2ZB3A 2VHWA 1Y7TA 3HN2A 3NYWA 4CLOB 4ND2A 2WEKA 5FYDA 3PLRA 3RASA 4ALKA 5TX7A 4CPDA 3K92A 4KOAA 2FPIA 5JBIA 2BGLA 5A1TA 4NBRA 3T4XA 1WLYA 4DPKA 2CDBA 4XQEA 2P5YA 4C4OA 4YXFA 3IP3A 4ITUA 4D7AA 2GSDA 1I33A 5KTKA 1WDMA 5KNLA 3PIDA 4AJKA 1KERA 2JL1A 4HBGA 4O5OA 1KOLA 1HDRA 2BGKA 3RC1A 4BL5A 1EK5A 4O63O 2Z1NA 4GMGA 3WNVA 1B8PA 1XU7A 1PTJA 1ZJZA 3RKRA 4YYZA 3GDOA 4DUPA 1P1RA 1IPEA 3OECA 2NU9A 2Y1CA 4PZDA 1MC5A 3GNSA 2RAFA 1NTOA 2Q49A 1VL8A 3GPIA 5JDCA 4UUPA 1PJBA 3AUSA 5TF4A 3KLMX 4RVUA 1R4NA 3U4IA 3JD1A 3KTDA 1RJWA 4TQGA 4B7CA 2W98A 3GGPA 2P4HX 4UUOA 2LDBA 4HNGA 3GVPA 3NT5A 4JQCA 1C1XB 1P0FA 3JQDA 3QP9A 4UREA 5JAIA 1NNUA 3PHHA 4IJKA 2Q2QA 1LBEA 3B1JA 3W8EA 3P2OA 2RHRA 1PX0A 3VH4A 1S6YA 1FDWA 4A26A 3L4SO 1YBVA 3WGQA 2CMDA 5B4VA 2FR8A 2DPGA 1VM6A 1DAOA 2FSSA 2X0IA 4BVAA 3EHEA 1Q7GA 4J1TA 4ONEA 4XCVA 3UOGA 3TOZA 4HWKA 2P68A 5ENDA 2I3AA 1TEHA 2PTGA 1E7WA 1HZJA 4XQ9A 2GNAA 1B3RA 1ZW1A 4BNWA 5B4TA 1PS0A 2ZJ1A 1CYDA 3ZWMA 2YV1A 3STHA 4YJFA 1B16A 4KWIA 4YRDA 3TZCA 3FD8A 4II3A 3I5MA 4TKMA 1VJTA 2J3HA 5EESA 1ZSYA 4S1VA 5CHEA 1GAEO 4DMMA 3BMQA 4O59O 3JSAA 3WFJA 1Z6ZA 3M2PA 1EDZA 2PZLA 5COAA 3JQ9A 2CZCA 4XGKA 4J6FA 2EKQA 1AHIA 2HMVA 2O3SA 3GRKA 2AQHA 1PR9A 2Q46A 3GT0A 3PDUA 4RZIA 5COBA 5I9MA 1LJ8A 2BFOA 2OP1A 3U62A 2HMUA 3L6DA 4Y8VA 1QSGA 3VH3A 3V1TC 3B1KA 5L7WA 5DCWA 1P74A 1HSZA 3FHLA 5CDSA 4ZVVA 3S2FA 3LC7O 3RFXA 1QRRA 3ROMA 3E9QA 2OMEA 1KC1A 2Y1OA 4DIOA 5BNTA 2AEFA 2Y99A 3SC6A 2DT5A 3DFUA 1QMGA 3K2BA 1QR6A 2FN7A 3F47A 4GWKA 1VJ1A 2I9PA 5T64A 5BR7A 3DXFA 2X22A 4XYEA 3DONA 2UUPA 2C07A 2JFHA 3I9MA 3EZYA 2JJYA 5ER6A 3EK2A 4IIUA 1NBOA 4UVEA 3WYBA 3WG9A 1G6KA 4M87A 3FWNA 1HLPA 4ROSA 1NQTA 1DJNA 1YB1A 2IODA 3DMTA 2GZ1A 3DBLB 2VYVA 5JO9A 1SNYA 5TJHA 2VRBA 3OJEA 3AWDA 4PZEA 3TZQA 3PJDA 3AI3A 3H9EO 2DC1A 3OA0A 1ZEJA 5MGBA 3V5NA 3KYCA 3BAZA 3UAGA 3KM0A 4KQXA 3JD2A 2PKRA 4WLUA 5H82A 1I5RA 1NX6A 2WMDA 5JDIA 1NHWA 3RU9A 1F17A 1JTVA 4HNHA 1LTHR 3GUCA 2DU8A 1CQIA 3OBBA 2POQX 4IDFA 4LCEA 1H6BA 4JIGA 3U4CA 5DT9A 3WQSB 2Y05A 1E3EA 5THKA 4FIZA 3BMCB 3FTPA 3LC2O 3PJEA 4ND3A 5ITWA 1E3JA 1HDGO 1KS9A 1PJ3A 1O94A 3GFGA 1PJQA 4L4SA 3R3JA 1BW9B 2YQ4A 3GVXA 1H6DA 3TZKA 4DL9A 4IUYA 5DNAA 3F4BA 4R51A 4BNVA 1AE1A 5T5QA 2RHCA 3JQAD 1EQ2A 3W4IA 4F46A 2EERA 3JQFC 3G0OA 1FK8A 4Y6RA 2YDXA 4YJDA 2PK3A 4YQZA 4IDGA 7MDHA 4DLLA 4CM7A 3L9XA 1GZ4A 1KVSA 2GZ2A 4RF5A 4TKLA 4BV8A 4L76A 1A27A 4MVJE 2C2YA 2QX7A 4OAQA 1GADO 3GEDA 5J23A 4L73A 3ZWYA 1MG5A 1U5AA 3PWKA 5JY1A 3WWZA 4L74A 3C7AA 2PA3A 2C5EA 3H5RA 1K6XA 1PJSA 4YTEA 2G82A 3BTOA 1KETA 3ZV6A 3TF5A 4B7XA 1ZJYA 3F1LA 2X5KO 4BQPA 3CINA 2PH5A 5TGDA 3NDIA 1ENZA 1J0XO 1GPJA 1X14A 3RJ9A 3MOIA 3WTBA 4E0BA 2H5LA 3PZRA 4EUFA 1ZK2A 3CXRA 4TVOA 4OM8A 5IDYA 3E82A 4BO6A 1NQOA 3OQ6A 4RCVA 4YDRA 4FB5A 1PWXA 3C1AA 3HFGA 3AOEC 1P33A 2NNLD 3JD3A 3TDKA 2WJPA 2WD7A 4E5KA 1NXQA 1GPDG 1PS9A 1MLDA 3GMSA 1RM5A 5TQVA 3H9UA 4NU6A 2Y0EA 1YXMA 1X0XA 4GI2A 3BTVA 5G4KA 2ILTA 2W8ZA 4FFOA 4FN4A 4TVBA 4XGNA 5A3VA 3RUIA 3U5TA 2UVDA 4GL4A 1YQXA 1XHLA 3H7AA 5C3MA 5TC4A 1YBMA 4PZCA 5CEEA 4BNHA 1QYCA 2AG8A 3WBFA 4E30A 4I08A 2YJZA 4AJ2A 4YRAA 3IDSA 2FMUA 2DQ4A 1LXCA 2D5CA 4GKBA 1EFLA 1IY8A 1DRUA 1BGVA 4LMRA 3C3XA 3ON5A 1U3UA 1NQAO 1N9GA 1DIHA 5HA5A 2J6IA 3AUAA 5AXAA 1X7DA 3B6ZA 2BI7A 4R41A 2ZYDA 3ICCA 3GOHA 3RKUA 3C85A 4EUHA 3Q2KA 4IZHA 3GF4A 4IM7A 4MVJP 5AQ1A 2W4QA 3Q11A 1M75A 1YJ8A 4WOJA 4AVYA 2EKLA 3KUXA 2ZTLA 4EITA 3FR7A 1ZK0A 1ZO8A 1ZK1A 2DBZA 4CQLA 1I0ZA 4FC7A 4Q3EA 6LDHA 4N5NA 2ZTVA 4IINA 1TLTA 3JQ6A 4R5HA 1EVYA 1ZH8A 4YT2A 3GMDA 4CUKA 5A03A 2G17A 2CF5A 2HAEA 3PJFA 3FSRA 1H2BA 1NFQA 3PHIA 4BGVA 3NTRA 4XEHA 3I9LA 2AQKA 1SEVA 2NU7A 3BTSA 3KEQA 1HE4A 4JP2A 4NBVA 3DTYA 5KVCA 3O03A 4IPTA 1I3KA 3LLVA 4YB8A 2Y68A 3JQEA 2VYVD 6ADHA 3KLPX 4B4WA 1QP8A 4LMPA 1OMOA 4OGWA 4AJOA 1X7GA 3PRJA 3RFTA 2JD0A 4R3NA 5ER9A 4PLGA 2PD6A 4XQGA 3AY7A 4XA8A 4OSOA 5A3JA 4OSPA 4E12A 4D45A 3RVDA 1I2CA 4NNJA 5DOVA 5ILOA 3H5NA 5FI5A 3AUUA 2D1YA 3GRPA 3K2EA 4UVDA 4J4TA 5EL0A 4AICA 3DHEA 2W2LA 3E6AA 4IJWA 4MINA 3WGYA 1T24A 4E13A 2DVMA 2NTNA 4BGUA 3OETA 3ORFA 3JQ8B 4FJ1A 1PJLA 4XD2A 1ISMA 3VVBA 3RC9A 1DHTA 1TA4A 4R4JA 1YWGO 2X8LA 5TS3A 4CLEA 3AY6A 3K96A 1AHHA 4Q3NA 2QG4A 1A9YA 5IDXA 2I67A 4J2OA 5U9CA 3D5QA 3F3SA 2D2IA 1R15A 4I5DA 3UHAA 4L4XA 1Y5RA 2Q2VA 3JD4A 4E5YA 4MVJM 5L51A 2RCYA 2BRUA 5A05A 1B8VA 3WGTA 2JCYA 2PGDA 5DP1A 5IZ4A 4LCJA 4BO5A 1C1DB 4NFHA 1H6CA 3K73O 3QWHA 1BDBA 2I6TA 2X7HA 3DZKA 4R69A 4PN3A 3HB5X 2Z5LA 4IQGA 3B70A 1M76A 2EV9A 3U3XA 1I3MA 3Q1LA 2BH9A 4KDEA 1Y8QA 3LT0A 4PG6A 2GDZA 4FSHA 4WNCA 4CL3A 2EF1A 1ONOA 4FBGA 3P5SA 1N7HA 3E9MA 3EGOA 4AJ1A 1E1LA 4NBUA 3OIDA 1V35A 4DYVA 3EVNA 4CM6A 5I7SA 2X0RA 3GG9A 3DZJA 3EVTA 2WD8A 3B1FA 1Z7BA 1I3LA 1IULA 5TIIA 3PDJA 1DXYA 2E6UX 5ES3A 3OFSA 5A5EA 5KJCA 3L0DA 2JHFA 2EKPA 3OP4A 1R0SA 4OJNA 3LQFA 1ENYA 2DAPA 3KEOA 3KYDA 2XF8A 3RWBA 4A73A 3R0IA 1PL6A 2HJRA 3ICPA 4D0RA 5A9SA 1LLQA 3COSA 3L6OO 2WDZA 1XSEA 5T57A 4WCFB 4CV3A 4XYGA 2DUWA 3RUFA 4ILKA 1PJ2A 2AA3A 3LU1A 1LC3A 3P7MA 2VWHA 4YJHB 1L7EA 4ZQBA 3H5AA 1YL6A 4DYDA 3D3EA 2BI8A 2YV2A 1NVTA 2UV8A 3ROKA 5G2OA 2XPCA 3HJAA 3WICA 4HFJA 5LDGA 1ZK3A 4J2HA 1BVRA 1SZJG 4WUVA 2OBNA 4MP6A 4RF4A 4FFPA 4MKRA 4BGIA 3PYXA 2Q1TA 4ALJA 2PH3A 4UEJA 4TSKA 5T67A 2Y1DA 4M49A 4RF2A 1DC3A 1LSUA 1XELA 4QUKA 4IDAA 3HDQA 5AXCA 2H63A 3K8ZA 3UH1A 4OKNA 3MTGA 3FPCA 1ZIDA 3SLKA 4A03A 2EG9A 4PCVA 2VT3A 4BNZA 8ADHA 1DEHA 1LNQA 1B3BA 2J3JA 2VYNA 3ANNA 4RJTA 2E48A 2UAGA 4KZPA 4CMJA 4X54A 4H15A 2HMTA 1P1IA 4PLTA 1F8GA 3E18A 1AN9A 5DBIA 2EW8A 4CLOA 3CKYA 2OZPA 3E5MA 2ZJ0A 5JC1A 5JMWA 1MXFA 2X86A 2PZMA 4F6LA 1PQWA 1M66A 1A7AA 3VPFA 2V65A 1NR7A 3NT2A 4BV9A 1NWCA 4PLYA 2OFPA 4Q3BA 2B4QA 4R16A 1ZNQO 1XLTA 2UDPA 1EVJA 1QKIA 4HKTA 4CM4B 3QRWA 1PZGA 4RPGA 1KEVA 3KXDA 1GYRA 1PGJA 4E2ZA 2QIOA 3S2EA 3GA0A 1D1TA 2X5OA 5JS6A 3LC1O 4E5NA 3IIEA 4ZHSA 2EGGA 1I24A 3OJOA 5H81A 3TJRA 5KKAA 2WYVA 1SC6A 4XDZA 1U3WA 3U49A 4QEDA 4YAKA 3IQDB 1S7CA 1RWBA 1JAXA 4D3DA 3JYNA 4DC0A 1DC4A 3C7CB 2QZZA 1OAAA 1C3VA 3I6IA 2PFGA 3RU7A 5KCZA 1E7MA 1GQ2A 1P1FA 1PZFA 3H4VA 1NAIA 4P38A 2W2LD 2FZWA 3AY3A 3CTMA 1GD1O 1NVGA 3OA2A 3G49A 3D4NA 4RF3A 5CDUA 1CERA 1U3VA 2ZB8A 5I7VA 1C14A 3KB6A 4JX8A 4WNIA 1PQUA 2EIHA 1EUZA 4WPGA 1NFRA 4ALLA 1UXHA 1GV1A 1PGQA 3EW7A 4CL8A 1Z7EA 4FQ8A 2NV6A 2OORA 3DL2A 5AXDA 4JJIA 3ZU2A 3QWFA 1JW9B 2YY7A 3ZU4A 3WWYA 4GWGA 1LLCA 1EFKA 1GTMA 2IXAA 4YT8A 4ZICA 5IFLA 1MFZA 4BNIA 5GZ1A 5JAMA 5A5FA 4PG8A 1EBFA 1NYTA 1D3AA 1GYPA 2FHSA 3ANLA 8LDHA 5KKCA 4K6CA 1N7GA 5JCJA 3MCVA 1O95A 3NX4A 4A0SA 4Z0TA 5AYVA 3LZ6A 3RBZA 1FJHA 4WECA 1LI4A 3LLSA 1W8DA 3F6YA 4II2A 4FOSA 5LC1A 4AJEA 1CQJA 3IC5A 5K9ZA 1UXJA 3CMMA 3R3SA 1R0KA 4BUCA 2AQIA 3JQ7B 2A35A 3DFZA 3JQGA 4BKRA 2DBQA 4JBIA 3RBVA 2R00A 3A28A 3AM4A 4BS9A 4GGOA 4K26A 3WIEA 4B8ZA 3CE6A 3X2FA 4GX0A 4HY3A 1KIFA 4KTVE 1U7TA 3VPSA 2Y67A 1ADFA 4MDHA 5I8WA 3I52A 4BNLA 1MP0A 1W73A 1JKIA 4LN1A 2IEBA 1ZVMA 1XU9A 3C8MA 1U9JA 1CJCA 1XEAA 2EEZA 2YQ5A 2AE2A 2PNFA 4P4GA 1ADCA 3A14A 4BNMA 1HEUA 1Q1NA 1QLHA 2XOXA 2WE7A 3DBVO 3WQQA 2EXXA 4PFJA 1X15A 5U1PA 3Q0EA 4CQMA 1AXGA 3ETGA 3SVTA 3DBLA 3EY4A 2G0TA 2VZ9A 2OOSA 3N7UA 4UEKA 3ETDA 2IXBA 2IYOA 1PGOA 4DXHA 3GH3A 4I5EA 1BDMA 2EJVA 5C7IO 4HUJA 3PFFA 3INRA 4GLOA 3RUEA 1A4UA 1PJ4A 1QV7A 1JN0A 3GG2A 2WTBA 4F45A 1NP3A 1YDEA 2GF2A 1I36A 2WYUA 1WWKA 4GPD1 4Z0PA 3W8FA 2VYND 3ZWVA 4QECA 1XIVA 3ZWXA 4DLBA 1N92A 1ADBA 3GEMA 4J16A 1EK6A 1EZ4A 3KV3O 3BMCA 1ADGA 5IDWA 4MVJF 1YOVA 3OMLA 3GN2A 1VKOA 4ALMA 4DGSA 1K3TA 3W8DA 2WM3A 1GL3A 4NMHA 2JFGA 5TRTA 1B2LA 4CMGA 1FDTA 1HSOA 2HQ1A 3NDJA 4OH1A 3RUDA 4QX6A 3IJPA 4W82A 1KVQA 1XDWA 1NASA 3H9JA 3TL3A 2JAPA 4MO2A 1I2BA 3DZIA 5TSDA 3GPDG 1Z75A 3VVCA 4NDNE 2EHDA 3ZGYA 3GAFA 4BO0A 3NJ4A 3D3WA 4ND1A 4NHEA 2AG5A 4I5FA 4XR4A 1JDJA 2QRKA 1BMDA 3WX0A 3DDNA 5BSGA 4KUEA 4OL9A 1IPFA 1T1SA 3OHSX 3PZBA 1SAYA 1CRWG 1Z73A 3ZWPA 1DBVO 1YQDA 4XB1A 3D7LA 3L07A 1JWBB 2NQ8A 2EWMA 3JQFA 2R00C 5I8ZA 4J49A 2QRLA 1T2DA 4CUZA 1LRKA 2O3RA 4O0LA 4RLSA 3H9QA 4RZHA 1VJ0A 1HDOA 2Q2WA 4IDDA 1T26A 3I9NA 3OJLA 4W99A 2HRZA 1NQ5A 3UCFA 4E5PA 2O3JA 1E3WA 1PJTA 2PV7A 1P0CA 1PZHA 4Z0HO 5I7EA 1WAMA 5GZ6A 3AFMA 2DPHA 3PWSA 4GH5A 5JCXA 1NAHA 1YS4A 4R9RA 1GCUA 2PR2A 3NUGA 4RVSA 5C7LO 2NSDA 1IYZA 1Y5MA 2W90A 3WMWA 3NGXA 5L7TA 1UDBA 3I4FA 3WLFA 1T25A 3QLJA 4WEQA 3F5QA 1H9BA 4FCCA 1TT5A 3O9ZA 3Q3CA 3WYEA 1IZ0A 2BD0A 2UYYA 1MV8A 2FR0A 3BMOA 4HX5A 3I9KA 4HFMA 4FGWA 2X6TA 4I1IA 1WP4A 1KVRA 3LSYA 3AOEA 4R1TA 3V2GA 1MX3A 5JNLA 5KVVA 1OC2A 5HRUA 4RQTA 1O6ZA 3I1JA 5JCJD 4BHTA 3ABIA 2C5AA 2FOIA 3ONDA 3O26A 4MOWA 2VWGA 3PXXA 4KQWA 1E92A 4AJJA 5C7OO 3JQAB 1PSDA 4OQYA 4Y6SA 3OJFA 3G79A 3O4RA 5DBGA 3FNGA 3OIFA 1RYEA 1J4AA 1E1MA 3IKVA 5F21A 3V1YA 3WR5A 5BT9A 4YRBA 2C0CA 5L53A 1Q2XA 2D59A 4FPXA 2ZYGA 3H2ZA 3WGHA 2DTEA 4KP7A 4XX0A 5IXSA 4FR5A 5DF1A 5ICSA 2Q50A 1Q7CA 3LYLA 3RAJA 3HN7A 1CF2O 2GASA 2GN4A 3I9OA 2VWQA 3LT4A 4QTZA 3PLNA 2EJWA 3WFIA 3VDQA 1FDSA 1J5PA 1N1EA 1LSJA 4DPMA 4RVGA 5IN5A 1R4NB 3KVOA 4FD3A 1ISFA 2NVWA 4MVJH 2J5QA 4IGFA 4IXWA 1Q7BA 1HDXA 5JY6A 3CPSA 2RH8A 3QWIA 4H7PA 4ZRNA 3EDMA 1U8FO 4MIYA 2O50A 1RM3A 4KTTE 4Y98A 1M6HA 1C0LA 4C7KA 3HB4X 4ZRMA 4CQMD 5L40A 5G0UA 1JKFA 1U1IA 1ZMTA 5G0TA 3MJVA 1BXZA 2QYTA 1F06A 3LF1A 2GCGA 4NI5A 4ZD6A 5IDQA 2O3QA 5L95A 2B36A 2X1HA 1U2DA 5EPOA 1K5HA 5EQFA 3GGOA 1YVEI 4D44A 1P1HA 1YL5A 3Q9NA 4NH4A 2Q4EA 5L7YA 2Z1MA 3W6UA 3IP1A 2NADA 3FBGA 1UH5A 4OO3A 2CDAA 1PZEA 4J1NA 4NJMB 5L9AA 3VC7A 1ISJA 3JQBC 3L4BC 4YJFB 1WMBA 1P1JA 3WGGA 1B8UA 2Q1SA 4JJFA 4WK6A 2VN8A 3DZFA 1UP7A 1YJQA 3BMQB 5EJ2A 1HYHA 4EZBA 3ENNA 4BNUA 4LRSB 1T4DA 5JAQA 1GU7A 2BFPA 4OHUA 1H94A 1XG5A 3CEAA 4CMHA 1R16A 1ULUA 3ZWCA 4N5MA 1O0SA 3TNLA 4BGEA 1BRMA 1NVMB 3QSGA 3VZSA 4PVCA 4Q3AA 2VUUA 3DAFA 3U4HA 1WDLA 5JW6A 1D8AA 3SC4A 4CMIA 4A5OA 2V6MA 3GC6A 3E5RA 1I30A 4Z3KA 1E7YA 4FJ2A 2VHXA 4AG3A 4Y6PA 4M55A 3PGXA 2X0JA 3QV1A 2CUKA 3ZU5A 2AW5A 5DULA 4MVJA 1XQ1A 3TRIA 2YHIB 3H2SA 3NV9A 4NPCA 2DFDA 5ENVA 3KYBA 1A7KA 3VKUA 1VI2A 3GHYA 3U09A 2O2YA 1ZCJA 4PG7A 1EUCA 2LDXA 3LVFO 3A1NA 2VRCA 1HE3A 2D3TA 3JCZA 4L0QA 3V2HA 1LQUA 2CDCA 4H16A 1E3LA 3KSDO 1LDMA 3PK0A 4CM9A 4LVUA 3HQ4O 4TRMA 1C0PA 1Y81A 4JJGA 3DZBA 2NVBA 3QA9A 4GAEA 4XYMA 3EYWA 4Y9DA 3NKLA 4G65A 1GUYA 2BMAA 3UUWA 1A72A 1DFHA 4URFA 1A5ZA 4CV1A 3DBHA 1B0AA 4PRKA 4DBVO 4J7CA 3M6IA 4BNKA 1FF9A 3JQCA 4E32A 5G4LA 1HWYA 1X1EA 2E82A 2Y1EA 4GQAA 5EINA 3HADA 1OZAA 2BKAA 3UICA 4HFNA 3KYCB 3FI9A 1XKQA 2DTDA 3GNTA 1E1KA 1LLUA 1T4BA 3A9WA 3HHPA 1BVUA 2GUGA 4OXKA 2P4QA 1DIAA 3ROQA 3I3OA 2G1UA 4WLVA 2QQ5A 1FDVA 3BHMA 2YFQA 1U5CA 2QHXA 4YJHA 3VPXA 4DQXA 4CJXA 1BHSA 1WPQA 3BMNA 1DSSG 2IZ1A 1HZZA 4XDYA 3VZRA 3WDSA 2BLLA 3N58A 1E6WA 3R6DA 1B26A 3ZW9A 2HO5A 1YQGA 1Y8RB 2NVUA 3WXBA 4CV0A 1P31A 3ADPA 5DOZA 4BMNA 4GX5A 4CMAA 1MXHA 1F0YA 1BXKA 3A06A 4D79A 1HRDA 2BHLA 2JD2A 5KIAA 1QYVA 3BZUA 4N5LA 1ENPA 3WBBA 2NQTA 3L6EA 1JWAB 1E7SA 4M89A 4EJMA 3GAZA 3HZZA 3AW9A 3GR6A 4E21A 3BIOA 4D43A 3PYMA 4GSLA 2X58A 3H3FA 3W1VA 1EE9A 5ITVA 1ZMOA 2PGJA 5EERA 5FF9A 3V1UA 1X13A 4YWJA 3WSWA 4TRNA 1GZ6A 1GUZA 2C20A 1ONPA 2O4UX 4Q9NA 3RC2A 3D4PA 1WZIA 1U7HA 2UUOA 3D0OA 1LDEA 3DMYA 4CM4A 1UR5A 4PLCA 4RVFA 3T7CA 1SCUA 3PFWO 3LF2A 1QYDA 3C1OA 2R6JA 3WJ7A 1FMCA 2PD4A 4J43A 4BB6A 7ADHA 3D1LA 3K9QO 1SEPA 3LDHA 3IKTA 1ISHA 3AJRA 3FRJA 2WD7B 4JLWA 1HDYA 2P9EA 4NR0A 5A4DA 1N5DA 2EP5A 4FGSA 3F4LA 4RVHA 1UXIA 5G4KB 4DRYA 5T8KC 1CETA 1X1TA 4Z3DA 2CFCA 4U6QA 3QQPA 4UAGA 4E2WA 2CNBA 5IXYA 1GEEA 1R6DA 3QJ5A 4R1SA 3H8VA 1KBZA 3DZGA 5IZCC 2HCTA 3IL2A 5I9LA 1PR3A 4WCFC 2BFMA 3O8QA 2NWQA 1W6UA 4R9SA 4DVJA 1FDUA 4J9VA 1XGKA 1CEQA 4PLPA 1FXSA 2JHGA 1JLLA 2TMGA 2PKQO 4BMSA 1PU2A 3FPLA 3CIFA 1R4MB 3DZHA 2EW2A 1GEGA 1P9LA 1T2AA 4YAIA 1U28A 1E1NA 2O4CA 2D4AA 4XQCA 4PG4A 4EJ6A 2AQ8A 2J8ZA 2P5UA 5BNIA 3KZVA 4GVXA 3F5SA 4UUNA 3SJ7A 1E7QA 1X0VA 3M1AA 5I7FA 4BO8A 2IZZA 2O3TA 4RPJA 1O8CA 3LT2A 3G1UA 1YKFA 4CQLB 2AEMA 4DC1A 1PL7A 4J0EA 2GZ3A 4EW6A 4E2XA 4Q39A 1KY5A 4EDFA 5BQFA 2IYPA 4IMRA 4IXTA 4DA9A 3PIIA 3TSCA 1VLLA 5AOVA 5JMPA 4RPLA 3ASVA 1VL6A 2VRCD 3ZI0A 1PJCA 3VTFA 4FDAA 3PQFA 2RBEA 3DC2A 4CM9D 3HG7A 2I5PO 3KHUA 3OH8A 3JQ7A 5KVQA 4UUMA 3TFQA 2F00A 1P77A 5CG2A 4ZN6A 4XWYA 1EVZA 2GPTA 2H9IA 3B20A 3ZNNA 4M54A 4YBZA 1LRJA 1W0CA 2FZEA 3OQ1A 1DC6A 3OJ0A 2CY0A 3DAGA 3CSDA 1G0OA 1GCOA 4BQRA 4DREA 2Z95A 4BO1A 3IJRA 4J91A 1O89A 1U2GA 2X4GA 2ZB7A 5F5NA 1LA2A 1RKXA 1ZXBA 4ZGWA 1QXSA 1QYXA 3DTTA 4FFNA 4YJGB 3GVHA 2PZKA 3KETA 1H2HA 3SLGA 3NRCA 4MVJG 4UULA 3QWBA 4TRRA 4YCAA 3DBRB 1JAYA 4JBHA 5ILGA 1EVIA 1P45A 2PY6A 3R1IA 4YQYA 5CEFA 4NBWA 5TT0A 4D3FA 3PHJA 2B5VA 3FWZA 5B1YA 1VKNA 3N74A 4BNFA 4E3ZA 3IOYA 3ITKA 3K6JA 1GYQA 1IE3A 1LEHA 4AJNA 1A4IA 5L3ZA 4RO0A 5CDYA 1J6UA 4J7UA 4PLZA 4M1QA 2AE1A 2SCUA 3I4CA 5KJ1A 1B14A 1N2SA 1E5QA 4MPDA 2ZTMA 4HXYA 2ZCVA 1DOHA 2VZ8A 1U8XX 4BB5A 4CODB 5B37A 2W2KB 5IAAA 1C1XA 4AJPA 2CVQA 4LRTB 1RPNA 1D7OA 1Y6JA 3JYPA 2NU8A 2C29D 1H93A 3GZ4A 1V3VA 2YUTA 4XIYA 2A94A 2TMDA 4LSWA 4MKZA 1LDYA 4P22A 3VKVA 1SB8A 4EJ0A 3E48A 2XAAA 4PVDA 4Y67A 1GY8A 3FBTA 4NQZA 5F1KA 4WLFA 4IQ0A 3IUPA 5JYDA 3NAQA 4AJ4A 3MJEA 1JVBA 2VT2A 1LX6A 5JFOA 5LDHA 2NTVA 4BIIA 3WIDA 3GNQA 3HDYA 2JD1A 2B4RO 1N8KA 2P9GA 2YZ7A 3VPGA 4J1QA 2IRWA 4NK4A 4L4RA 2CVZA 1DHRA 3KYDB 4PG5A 1U4SA 1B15A 2GERA 3K30A 5A9SB 3ZCXA 5JSFA 3ONFA 4QXMA 3U0BA 1WW8A 3VHRA 4QFCA 4QFDA 3ZU3A 4RV9A 4W9NC 3ETEA 3GVCA 1MFPA 4CMBA 3P2YA 5BSEA 3GZNB 4BMVA 4A10A 1T2CA 3C7DB 4MP8A 2YDYA 1C0IA 3OICA 2HMSA 2EP7A 3ZNOA 1DIBA 4INAA 3GLQA 1LRLA 4U0KA 1M6WA 4B7UA 4R1UA 4HP8A 1V3UA 1HTBA 1E6EA 1YL7A 1Y9AA 3GVIA 5A9TA 1EMDA 2F1KA 4M86A 4ESOA 3AU8A 5GY7A 1E7RA 3E1KA 2DBRA 3AK4A 1H5QA 3TZHA 1K6IA 2YHUA 4JCOA 2GO1A 3JV7A 4ZQHA 2V6GA 4BNGA 2X0NA 2R2GA 1PL8A 3MOGA 4QSMA 4CM1A 4HV4A 4WOKA 5HS4A 2VWPA 1V6AA 1ARZA 2VTDA 4CUJA 4WLEA 1UAGA 2YW9A 3QVWA 1HDCA 3S8MA 3ZWAA 1UDAA 1GV0A 1I2ZA 4ND4A 2E4AA 3E9NA 1EDOA 1QYWA 3ZW8A 1BXGB 5IN4A 3RUCA 3WTCA 1D1SA 3CZMA 3HE3A 4EGFA 4R5MA 1DLJA 1PGPA 3JTMA 5H83A 2ZB4A 2I99A 4U6SA 4TZTA 1M67A 4ZU3A 2HMWA 4S3MA 1EBUA 2NTJA 5KJ6A 3GY0A 3RFVA 1DJQA 4UVGA 4BNXA 4PGFA 3JQAA 5COQA 4DTIA 4Q3DA 2B35A 4ND5A 5FEUA 4GVLA 4OXNA 4RPKA 4CM3A 3JYLA 3HDJA 3G17A 3JD0A 2O7SA 5T6BA 1DB3A 4HADA 3GGGA 3TOXA 2GN8A 3HFSA 1XYGA 5TT1A 4DQVA 3PI7A 2I66A 2V6BA 1GQYA 3ANMA 4IGEA 4WCDA 1EQUA 4KWHA 2IE0A 3HDHA 1WZEA 4JROA 2DTXA 1AUPA 4XJTA 1JKJA 3QVTA 2PKQP 1TT7A 2Y0CA 4GX1A 4D3SA 1A9ZA 1UJMA 2X9VA 1BW9A 1GZ3A 4G81A 5EQDA 3KBOA 2J5KA 4CLHA 3WGOA 5BSFA 4N18A 3WSVA 1LDNA 1HE2A 4QO8A 1DAPA 1ZSNA 1NPTO 1R12A 1ZBQA 2B0JA 2CF6A 2FP4A 4F3YA 3GDFA 4I9UA 5CFZA 9LDTA 1I10A 3HUDA 4DWVA 2ZKLA 2VUSA 5FFFA 1HL3A 4IS2A 1E5LA 1PS8A 4IS3A 3ZV4A 5K0ZA 2VHVA 4GKVA 1O5IA 4G2NA 5U4QA 3ZWNA 1ZKMA 3LK7A 3V2UA 1NR1A 3W4JA 1N1GA 4BNYA 1LSSA 3ZV3A 1VC2A 4WEOA 4P8RA 2NLOA 1E3IA 2OHXA 3ENKA 4L75A 2O23A 4R54A 4CM8B 3UN1A 4TRJA 4NJMA 2G76A 3GN1A 4MVJI 3E8XA 3RD5A 3RQSA 4J1SA 2IZ0A 4KDFA 4YACA 4E33A 3MWEB 4OOEA 3FN4A 1PEDA 3NJ8A 5THQA 4GLLA 5IF3A 2AXQA 2C7VA 3WGIA 1DFIA 3WYCA 2NM0A 3AM3A 3UFXA 1ORRA 3DHNA 3AOGA 4DBZA 3PPIA 4CLDA 4D42A 1R0LA 2P91A 4CLRB 2VCYA 4YPOA 1P1KA 3ZV5A 2CSUA 5KJEA 5JLAA 5G0SA 1TB4A 3PGJA 3JQBA 3L4BA 1HE5A 2FPPA 1KVTA 1I32A 5FI3A 4DQUA 1LC0A 2PWZA 4EUEA 4ZQFA 4XRGA 4Z6KA 1E3SA 4I9HA 2HU2A 3D5TA 5A06A 2GR9A 5TNXA 1T1RA 3JQGB 1Q0QA 3GFBA 4CMKA 2GN6A 2HK8A 4UEOA 1EEHA 2X9GA 1ID1A 3SBOA 4P4NA 1BTOA 1U3TA 4BNNA 3CUKA 4PIVA 3FTNA 2GLXA 2YHIA 1Q0LA 5KWEA 2VQ3A 4XB2A 4IDBA 1DFGA 3ADOA 4Z9FA 1BG6A 1HDZA 4W7IA 3EC7A 1F12A 3DOJA 2A4KA 1YGYA 4ZA2A 3ZZNA 4A7PA 4GGPA 3SEFA 1X7HA 3FR8A 5AXBA 3BYZA 3NDRA 1G1AA 5JDCC 3RROA 3RUHA 3V8BA 1V0JA 4TZKA 3GHHA 5HM8A 5KOIA 4WGGA 4B3HA 4LSMA 3ULKA 2GGSA 2HDHA 4CQMB 1XR3A 3L77A 2C54A 3EZLA 3WLEA 5A02A 2C7GA 5JO0A 1DIGA 2AHRA 4R1NA 4BO7A 1UP6A 4OOFA 4D46A 5IG2A 1DLIA 2I65A 4LISA 3TN7A 3L9WA 1E77A 4IMPA 2A9FA 1WXDA 5F1OA 2WWRA 1IZ9A 4LW8A 2AMFA 1F14A 3M2TA 5LCXA 3DB2A 3ASUA 3G3EA 2CD9A 4J7XA 5DN9A 4NU5A 2ZQZA 3DR3A 3NGLA 3OIGA 1LUAA 3MJTA 3MJCA 4B79A 4RORA 1W4ZA 3PVZA 1OBFO 2Q1UA 1XQ6A 1YOVB 1QLJA 1P3DA 3T4EA 4N54A 1VE9A 3DOCA 1SOVA 1E6UA 3MTJA 4FFRA 4RGBA 4W7HA 1DPGA 4NG5A 1YH3A 2VUTA 3D4OA 4BKUA 5L45A 4XJSA 4CV2A 3DQPA 3TL2A 1Y8RA 4WLNA 3JQ9C 5ICMA 4Z9XA 3D3WB 1UXKA 4ALIA 5B4UA 3GK3A 5ADHA 1H9AA 4NJOA 3VH2A 4K9DA 2FWMX 4O6VA 4NZ9A 3JQ8A 1YO6A 2OL4A 4XIJA 3RCBA 1BSVA 1WDKA 4K6FA 2HLPA 1UZNA 1YB5A 4EYEA 5CEJA 2GYYA 1I01A 5L4SA 3GDGA 2A92A 1Y9EA 1ISIA 1O9BA 1LU9A 1R66A 1YONA 5HTOA 1Z74A 4IZIA 5FWNA 4YA6A 1SBYA 2J3KA 3H65A 1KYQA 4XGIA 5F1PA 1E3WB 2B5WA 1KVUA 3JYQA 3INGA 3FCOA 4KUGA 4BO2A 1GUFA 2YFHA 4PRLA 3A4VA 3I23A 4BOYA 5CG1A 3MEQA 2BELA 1C1DA 2B69A 2HKIA 3KRTA 4YVFA 4BKQA 3BXXA 3ZNPA 3ITDA 4AJLA 2JCXA 4QQRA 1HXHA 3DMTC 1CDOA 1ZEMA 5TJ9A 5GZ3A 4PLVA 3WGZA 5TLSA 3QHAA 4CR8A 1TT5B 2D8AA 1ISGA 1UUFA 1ZSVA 1C0KA 3RIHA 3BMOB 4NK5A 3BHJA 2ZK7A 1WNTA 2VHZA 4IY1A 4GSKA 4D41A 5DP2A 3PJGA 4GX2A 1E0DA 3F1KA 5JDIC 1VRWA 5DDIP 3AFNA 3C24A 3F46A 2OBYA 4TWRA 2NUAA 4J90A 1PGNA 2BFAA 4L9RA 4XR9A 4OQZA 9LDBA 5T8KA 1D4FA 4JP3A 3ZN2A 1R37A 1R4MA 3OSUA 1DRWA 3RJ5A 3IUSA 3GUYA 1DO8A 1DC5A 5IZCA 2GD1O 2Y93A 5JXWA 4UVIA 4WCFA 1LDBA 3VTZA 3ZWOA 2B37A 4JK3A 1BWSA 4PLHA 2B4TO 1IHXA 5JPIA 3TPCA 3EUWA 5A9RA 3ZWBA 1B7GO 2O3UA 4BO3A 3VPHA 2QRJA 4J9UE 5DZSA 4DIFA 3ONEA 1AGNA 1SB9A 4TROA 2FSVA 4EEZA 1ZXLA 3RUAA 1QG6A 1KEPA 3EMKA 4B8WA 5KVSA 4BKOA 4FFLA 4E31A 4KMSA 4LGVA 3RC7A 3OEWA 3GQVA 2ET6A 3OF2A 5CDGA 2XXBA 2X23A 4JGBA 3PHLA 4RVDA 4BNTA 4FOOA 4W4TA 2X9NA 3H9GA 3SXPA 3ZWWA 1DIRA 3QVSA 4I5GA 2H6EA 2WSBA 4GBJA 3S2IA 3K31A 4J0FA 5L4NA 2JKVA 3K5PA 1MC4A 5G0VA 3H6KA 3MJ4A 2PD3A 4IIVA 2E49A 4Z9YA 5EIOA 3UW3A 1F8FA 4CR7A 1K2WA 3UXYA 1U4OA 3E03A 2Q1WA 2ZCUA 2ZIZA 4ZJUA 5C37A 1IUKA 3QW2A 3RSHA 4CMCA 1VL0A 3PQDA 4FS3A 4TMFA 1NWHA 2XXJA 4IQ8A 3QY9A 4MP3A 2HSDA 3KO8A 4FC6A 3U9LA 5K6AA 2YYYA 5L4LA 2FR1A 1HYGA 4IDCA 1GFSA 1Y1PA 2HRBA 4YJGA 5B12A 2QYSA 3UGKA 5CPFA 3H3JA 4MJLA 3DBRA 2BF7A 4AL4A 1WVGA 2HJSA 1JU9A 3MZ0A 4YT5A 4DIBA 4JBGA 3PWZA 3WJAA 3CMCO 3QWAA 1HETA 2Y1GA 1QORA 4IJUA 1CWUA 4FJ0A 1MUUA 4U0JA 3G1TA 2OO5A 4KUHA 3OEYA 4AJHA 4CMIB 1I3NA 2ZYAA 4WLOA 4R01A 4DMLA 1A71A 2PLAA 1KEWA 2DFVA 4B4VA 2CVOA 1JA9A 3QVOA 2Y0DA 4WASA 5EMHA 1HLDA 1ONNA 2I76A 1CIVA 3QVXA 1I8TA 1Q0HA 3QIVA 1EE2A 4DLAA 4U7WA 4MKXA 1V3TA 2WE8A 4NFSA 1Z82A 4CMEA 5C5IA 1ZK4A 1NPDA 4W6ZA 2V7PA 2VOEA 4NIMA 4JNKA 2W2KA 2PGLA 2VHYA 2Q4BA 3FNEA 1IOLA 3IS3A 2EGHA
chains in the Genus database with same CATH superfamily
3D4IA 1VECA 3QXXA 1KI6B 4JN6B 5HBRA 1KY3A 1SBZA 4PE5B 3CX3A 4KN8A 3DAYA 3EIQA 2C82A 4ARVA 1BD4A 4GOJA 1M72A 2JCVA 4WT7A 4MUYA 5D5QA 1PFKA 3GFQA 3OY7A 1N9GB 3ILYA 4G1EB 5K3CA 5JECA 3ZLJA 3DOOA 4AX4A 1NSTA 3OOSA 4IMIB 1T0HB 1T8UA 2QRUA 2BJWA 1ULTA 3MRSA 4FFMA 3NC1C 1XA4A 3FNFA 4UOZA 2CEKA 4OJTA 3CLKA 3PRKE 1NVXQ 1O6FA 1NJSA 3K35A 3OWHA 3EVBA 3I8XA 4ZO9A 2JAHA 3MIZA 4XSVA 4MR7A 4MHSA 3M4JA 1YVRA 2G9UA 1ACJA 4JLOA 5E95A 2MYUA 1BX1A 1HGXA 3QSYA 4AJIA 4YR7A 1OGJA 1GTVA 1HO3A 2PQ0A 1EBBA 3BICA 3E05A 3EQ7A 3KE8A 1PWZA 2HUNA 1WKVA 4LPSA 4M9UA 4LVCA 2GN0A 2ECFA 1ZN2A 2BFEA 3UCXA 2IYRA 1QE5A 1S8NA 4D9IA 4MAMA 4UE3S 2OWDA 1IHYA 3LBIA 3R6WA 1YBAA 2AN5A 5I9NA 3GDHA 2YN0A 4E22A 1NUHA 1ZUHA 3DBOB 2WYWA 3TNJA 5AKGA 4GMFA 2OAQ1 3GZNA 1VJCA 1MAHA 3C4QA 1Y7HA 2C5GA 3G8YA 3KZCA 4LA4A 5CR9A 3UWSA 3ZNQA 1DRVA 2KBEA 4H7JA 3EZNA 3P2KA 3OZVA 4I36A 4OQ4A 4QUDA 5AM2A 2D0IA 4QRIA 4C6TB 1SPBS 3HSKA 3ZHXA 3AUTA 3CV3A 3KSZO 3WOHA 3N8KA 1OX6A 3LQ1A 1AUQA 1K08A 1WMAA 5EGSA 5AVOA 4QPZA 1Q0UA 5GONB 2CCKA 3SKVA 1XCBA 3WWDA 4Y2TA 3U60B 3F49S 1KSFX 2Y66A 1RFGE 4WESA 2H2IA 4TSRA 3VYRB 2TYSB 4OV6B 4AZ3A 2VYFA 3PS9A 2ZRPA 5H1YA 1ML4A 1PQPA 1RWWA 3U7HB 2GTHA 2YXDA 4G5HA 4WJZA 1NDHA 1OYYA 3UKOA 4B31A 5E7IA 2RH4A 3IKLA 4ZMBA 3GW8A 5G1PA 3FOBA 1RM0A 4B9AA 5H4GA 4I1SA 3FKJA 4QAQA 2QN9A 3DT9A 1JR2A 3OMWA 4FBLA 3GLFE 1RD4A 3HXPA 1OA0A 4D3ZA 5BY2A 1PIWA 3SJUA 2BPOA 1RKVA 1RXIA 1UZMA 3K3PA 4I8DA 4QATA 4RQBA 4E6PA 4U7GA 2ZP1A 4WY2A 1UP4A 4LS3A 2JJ8A 1V37A 1EXVA 4UNNA 3D02A 5EYPB 4ZTUB 2XTZA 4F5WA 4IDEA 2D7DA 3ZHBA 2FPGA 1YJ5A 3U3KA 2JG3A 4U9IS 4HDNB 2KS6A 3JYOA 4MITA 1WXGA 2GRAA 2J09A 2HK7A 4ZOLB 5EZYB 4JQOA 1CW2B 2VZLA 5LP6B 4NFLA 3ORRA 1QUFA 1GPMA 4H7HA 4CMEC 3PHGA 1J0CA 1AQJA 4MVCA 1EM6A 2QMZA 4OGGA 3IT3A 1CJMA 2QVCA 4M8SA 2YVQA 4N3GA 1M5RA 4R3WA 3FGNA 2Q5QA 2F17A 4HQNA 1V25A 4MIOA 2RIRA 1GR0A 2C7RA 1MDFA 3NRBA 5LNK1 1AH2A 1HYQA 2FY8A 4ALNA 1ZNXA 3MBKA 3CVXA 5C46F 2W2PA 1X8JA 3LP5A 1SKQA 1KDRA 1R5BA 2NU6A 3MJSA 4R81A 2VUIB 3INTA 4MWCA 4QREA 4CEHB 3TSZA 4GBED 2IHKA 2OKGA 1MENA 4DDKA 4HVCA 2K2WA 1TTPB 3ZQ4A 4ETMA 3KL2A 1OV4A 4B1FA 2OV1A 2FMKA 2ZJOA 1KFCB 1NVEA 2IVZA 2I4IA 3EQ2A 1B8OA 2I87A 4N49A 4DVGA 1AC5A 4F8YA 2KQUA 3AVVA 4XKJA 3VH1A 3NFRA 4IBOA 1ZUD1 1AF7A 2P9CA 2YTZA 3BWVA 4GP6A 4KQJA 4TSFD 4YAJA 1LDGA 5BQOA 5DM60 3U7GA 4D8TA 4Z4GA 3MAGA 3VGJA 3WLIA 4QEZA 4QA9A 1C2YA 3CUVA 1D4ZA 2I2AA 4OXYA 1YDWA 2AIRA 1TIBA 4FQ7A 2QX4A 3DVRX 5BYBA 3O8QB 2R1VB 2H1SA 1TI7A 4NSNA 5EQTA 4YMSA 1JLLB 2G36A 3DDHA 3ZH2A 3G0BA 3LUGA 2F55A 1XJWA 5KTYA 3J81A 3Q87B 2MCFA 1GLVA 5KYGA 3ZBPA 3VJLA 3QLUA 3WYNA 3ZH9B 1ZQ1A 1YB4A 1OFGA 3G6KA 3GBVA 4RPHA 1J8DA 4V0ME 1YB6A 2QAIA 2CXRA 4Y1RA 3AU9A 1XQVA 3Q6IA 2AHOA 3LX5A 1G0NA 1O8BA 3JQRA 4MS1B 4O4HA 4B3JA 1OX4A 3AFHA 2ZRGA 4B3CA 5KMGB 1JG7A 4HT3B 2PLNA 4H3VA 1DEAA 3FOAA 1QGAA 1JYEA 1OOEA 2PZEA 1K89A 3NXKA 4MQUA 4GNKA 3FFWA 4HH4A 1FVOA 5JE8A 2X5NA 1KO5A 2CUNA 2W0MA 3MUNA 3W34A 3QMMA 4NBTA 3TFOA 1I7NA 2PT5A 4XGQA 2P77A 1U0BB 2I4NA 4CNBA 1Z45A 3NG1A 3IMFA 4HFRA 3V4PB 3SQWA 5BUSA 5JNUA 1JQAA 5ESDA 4RLHA 5J4YA 4ID9A 1QAQA 4G26A 4O2BF 1KDOA 2E1RA 4TMXA 2IEDA 4AY6A 3IUYA 4MB2A 3I83A 4C7JA 2QW8A 4NCNA 2QX8A 4MR8A 2HU8A 3ZK7A 3HBJA 1VA5A 1Y48E 3SOZA 3UXHA 3IQIX 2DY0A 5MDHA 4LUCA 4U1RA 3QYJA 2WWIA 4HAXA 4B84A 4UXHA 4I99A 1ZESA 1EP9A 1RAAA 2IGTA 3AP3A 3P32A 4QO7A 2GNOA 4XZ3A 1H8HA 2HBRA 1G6HA 4IKPA 4IF4A 5TDHA 4WK4B 3H2BA 3W1EA 4A2PA 2GWHA 1BU8A 1Z6PA 1O57A 1YS9A 2W71A 3ADKA 2JGNA 1LNZA 1WF3A 3AERB 3VZPA 1GRVA 4JBXA 3SFZA 1E1YA 3ZOZA 5EUCA 1I6WA 4MQ4A 4E15A 3F9CA 4DSZA 3H19A 1Y7TA 3HN2A 4UDOA 3GJ4A 3MTIA 4A3SA 2R79A 4DADA 2IOFA 3RASA 4P0QB 2NXNA 4K86A 1EFAA 2O8BA 2P5YA 2YZKA 4C03A 4M0EA 3I6YA 3TO5A 2B94A 5K8CA 4B6OA 3E7PA 1SVWA 2A9RA 1WDMA 2CLSA 2KHZA 3PRHA 1M7GA 3O4HA 3RF7A 3CLSC 4AJKA 1KERA 1QQ6A 2JL1A 3QU5A 4O5OA 5L3QB 5LPNA 1FVXA 4BL5A 4TQUS 4MZXA 5HHTA 4IIBA 3H8SA 2VDPB 3RHSA 4YRNA 1XU7A 4U00A 1PTJA 4RKEA 4YYZA 4AIIA 3ND9A 4DUPA 3OTHA 2IBMA 4HYYA 1Z5NA 4QJ5A 1YMQA 2JKYA 3FYSA 1GA6A 3AB7A 1V5GA 2C8LA 4PZDA 2FW1A 4AY3A 3QXSA 5CUQA 2IOFK 1DKMA 2RAFA 3H1TA 3L7NA 3THOA 2DYKA 3LJKA 1N75A 1WR8A 1K5GA 3I58A 2X2OA 3L7MA 3ZJVA 3AEXA 3T52A 2WJ6A 5HIJA 2H06A 4LXTA 1R4NA 2OKCA 4NU8X 3RTBA 3CRRA 3KTDA 1DOZA 1RJWA 5E38A 1AKQA 2VSOA 2P4HX 1JHDA 4LE2A 4XPIB 4JVMA 1II8A 1QGUB 3FDZA 3NT5A 1QLWA 3X1JA 5LB2A 4YUWA 3LUBA 1C7JA 2Q2QA 2XE4A 4JP1A 3SDBA 2ZU0C 4POOA 2QK4A 3W8EA 5EIBD 4G07A 3P2OA 4ZEWA 1S6YA 2ECOA 4JLBA 1YBVA 1E98A 2PYIA 2V7WA 2FR8A 1JEQB 2HHJA 2MT9A 1YBFA 2ZRLA 4C2BA 3EDOA 4BU0A 4CTJA 5FPSA 1Q7GA 2GAOA 3MXTA 4ONEA 3OZGA 1KK2A 3TOZA 3HDGA 4HWKA 4Q7EA 5AHOA 5JSUA 1YFLA 3ME5A 3SG0A 4Z1MA 1E7WA 1GTG1 2ZXEA 4REOA 1VP3A 4OQDA 3LCMA 4MUXA 5FFMA 3ZKAA 1WZ2A 4AN1A 5BN3A 1TM7E 1DUIA 5AI8A 1JIUA 1MA3A 1R74A 2P2YA 3ZTTA 1E8MA 3RS9A 2YV1A 3STHA 3SXUA 1B16A 3JAKB 3ZD9A 4KQGA 5H3CA 3BB3A 3FGOA 3PE3A 4IG9A 4JJ8A 4TKMA 4B3BA 2J3HA 4KO1S 2W70A 5IMSA 4O59O 3H11B 1I7PA 3ND7A 1K2VN 3I72A 4FUQA 1NVDA 1EDZA 2XQIA 2M6LA 3Q7RA 3QKRA 2YWCA 1UT5A 3GJ5A 3I01A 4RD6A 2EKQA 1AHIA 2HMVA 3GRKA 3GT0A 2AQHA 4LHSA 4JUIA 4IRXA 1ZAYA 5BN4B 3VDXA 3B1KA 2BTOA 4ZU6X 1P74A 1XKXA 1ZIOA 2P90A 2XUDA 3L6UA 5CDSA 1GFWA 3E2IA 3K9WA 4ZVVA 2PX2A 2VRNA 2ZYUX 1FNMA 4RJ2A 3RC3A 3RYCB 3RFXA 3ZE7A 2CV2A 1OBHA 1X38A 2W2NA 3A3KA 4HAOA 3M6VA 3P9RA 5HE8A 4P7GA 4DLXA 1SG0A 2WJZB 3PDIB 2JANA 2RE8A 2HHHB 2OMEA 1XPJA 3LUFA 1C3EA 1Q1QA 2QSUA 4D4KA 1L7VC 2AEFA 4V38A 3SC6A 2DT5A 3U7IA 1QMGA 3TQOA 3GGDA 3K2BA 5C1BA 1QR6A 1P5ZB 3LGAA 1KJYA 4GWKA 2I9PA 4TV8F 5GONF 5T64A 1HNNA 3GJXC 4XYEA 3EULA 2Q3MA 3EZ9A 4YRGA 1YDFA 4JODA 1JJAA 1V47A 5KDDA 2CHGA 3WHLA 2PRSA 3I9MA 5GM1A 1GGJA 2ZDHA 3L79A 5IK2A 2V1XA 2VYCA 3MSXA 3GLIB 3DM9B 4WA8A 1FFHA 1UBCA 1HOXA 2GAFA 3QOWA 1AGPA 1G1MA 1TRHA 1H4TA 3KZXA 4WQMA 4UZSA 5B6IA 4PSAA 4RWEA 1I4DD 5K09A 1EFPA 1UOEA 3WYBA 2AFHB 1FA9A 1RYZA 3NM4A 2NYVA 1XF9A 1YS7A 1QO0A 5TPWA 2VKQA 1J2EA 3OOYA 3QU2A 5CGZA 5J63A 2ZRDA 1KDVA 5JZOA 3PUWA 2GJ9A 3DMTA 1QZXA 1KO7A 1YZNA 3OI7A 4FDLA 1SNYA 2L69A 5FUQA 5DTMA 4HLUA 3DWEX 1CJUC 1UANA 4RPCA 5AT1A 3EGVA 4YLGA 4ZOLF 4GOXA 1RHRA 5EZYF 3WFJA 1K6MA 5LP6F 2WK1A 3BN3A 4MROA 4ZALA 3WFZA 5MGBA 2MINB 3V7UA 4RFSB 3V5NA 1RBMA 1ZAKA 3IP9A 3FCAA 3LI2A 4KQXA 3JD2A 1PFYA 5DIZA 5H82A 4EVRA 4G09A 3JW8A 4DQDA 2OILA 4HNHA 1LTHR 3GUCA 1CQIA 3A32A 2IS2A 2NN3C 3AONB 2POQX 3PX3A 5KTSA 1H8HD 5EJ9A 4J1TC 4IDFA 2OHIA 4BRZA 5FPTA 1KOFA 2SNIE 4OQXA 1NW4A 3RVMA 2F2TA 1DZIA 1U3DA 2GUWA 2BGRA 4N3CA 3NBQA 3RHTA 3BMCB 3LC2O 1H2WA 3B8HA 3IQZA 1CUVA 3R6TA 5JATA 2WVGA 4KQ1A 4MUFA 4O2BA 1HQKA 4QOEA 1GILA 5DYYA 1U63A 1RYBA 1XNQB 2ZJ7A 1NXVA 4YMHA 2WF9A 2AS0A 3IGFA 1M2KA 3Q12A 3QUCA 3MAJA 3R3JA 1E2MA 3OZTA 5EA2A 4BRWA 3TZKA 2I4MA 3HRIA 1FFBA 4JGGA 3IDZA 1LW6E 3DM5A 4B8YA 1P2DA 4BWFB 4F2DA 3FETA 3G5AA 1QG0A 1ZG3A 2EERA 3KOOA 3IOEA 2R84A 2W6CX 4KVAA 2OV3A 3R7FA 3STUA 2DR2A 2G5PA 4NBLA 4YQZA 2FDCA 3D54D 2QNRA 5LNK6 5SZIA 4S1OA 5IT4A 4CM7A 5SYAA 1N5IA 1LVGA 4LNUA 4TKLA 3I01M 3F96A 4L76A 5ALYA 4AU1A 2C2YA 5JCZA 1C8LA 3ZCUA 3HVRA 2P2ZA 2D6FA 3ZGLA 4O08A 2PMEA 4ZQCB 2ODQA 3WADA 3ZUPA 1XV5A 1MG5A 1U5AA 4ARZB 4FHZA 5JY1A 1B42A 3WWZA 1RZUA 4LQLA 3IUJA 5E4TA 4BGDA 1FYEA 2F59A 1MQ8B 4D25A 3R8CA 5F98A 1PJSA 3MAAC 1UKZA 3I6ZA 1TZBA 1KETA 1NJ2A 5CBPB 1SC3A 1TZJA 2F1RA 3HRHA 1ZJYA 1RP1A 3NHRA 3NWJA 4BQPA 3CINA 3P9SA 4MQ5A 4FYWA 3NDIA 1WUYA 3WA6A 1AZLA 1X14A 3QTTA 1T5HX 3VR3D 4YRIA 3FOFC 3E22B 4H27A 1OY1A 5L6MB 2H5LA 3R4CA 4BEVA 2R0QC 1ZK2A 1LS1A 4ETNA 3K9FC 4YRRA 5M34A 1L4YA 2FWBA 3E82A 3EXAA 3MMXA 4BO6A 1G3MA 3GLHB 4RCVA 1XAJA 3C1AA 4YMGA 2II6A 3KLOA 3HFGA 3PFNA 5DGHA 2H1IA 1T3HA 3Q7TA 3JD3A 3UTDA 4EA9A 1IU9A 1QGED 4K6GA 4KODA 1NVWQ 5BW8A 3B60A 3GMSA 5TQVA 4R05A 1P5FA 4NU6A 4GI2A 5T3YA 4TVBA 4GYJA 4FFOA 4UHHA 2HNKA 2WM2A 3H7IA 5TGTA 1S2GA 1Z39A 4HWOA 5C3MA 5TC4A 1YBMA 2APJA 3I9FA 4S0ZA 5SZKB 4BNHA 4RENA 3KQSA 4MKHA 2Q5LA 1P5JA 2MU1A 3LW7A 1OAOA 4X20B 1VA4A 4B76A 2GXAA 3NONA 4GT1A 5HIMA 2G63A 1CRLA 3F6SA 2BGWA 1H0SA 3BWCA 1OD6A 1YHYA 2PUWA 4GKBA 1IY8A 1B73A 1Y3DE 1DRUA 4JITA 4YUVA 1U3UA 5LZ2A 1L5HB 1N9GA 1X7ZB 5HA5A 3KIPA 3TLYA 2Y8EA 4RAQA 2YRWA 1TFRA 5I47A 3TINA 3KQMA 4DT1A 3TG8A 2YJGA 2ZYDA 3CKKA 3ICCA 4BX0A 4HQLA 3RKUA 3QEMA 4RYDA 3WQBA 3Q2KA 4BE4A 2I80A 4QG3A 1N8NA 2RGNA 2WUDA 4XJXA 4EWLA 3FCYA 1YJ8A 4RE6A 3T9BA 4PAGA 2EKLA 3NYIA 3GLVA 4BZXA 2V7EA 4YJKA 5CJPA 4BLSA 1W4LA 1ZO8A 3V4ZA 1H4QA 3L02A 3IPXA 4FC7A 3KJNA 4Q21A 4GMDA 5F9FA 4N5NA 2ZTVA 2FXIA 1ILWA 2O0KA 3C48A 3N75A 4GU5A 1FSGA 1XAGA 3QOXA 4R5HA 1EVYA 1ZH8A 4S2EA 3V2IA 3GMDA 4YT2A 3QPUA 4CUKA 5A03A 1UFKA 5I6DA 4KFUA 1KMMA 1AS3A 4LAFA 3FSRA 1SXIA 3L49A 5SICE 1SHTX 2YWHA 3COPA 3PGKA 4XEHA 4C05A 2AQKA 4JP2A 4AY5A 2Y1XA 2H4WA 1R9GA 3DTYA 1L5YA 2W6MA 5KVCA 1AA6A 3ZI4A 1ZR2A 3EA5A 1C4XA 4NTZA 3IT2A 2B7LA 4U2EA 4GR5A 1ORWA 1FRZA 3WE7A 3OQOA 3BC1A 1Y1KE 3MS7A 3QKSA 4OQEA 5C8XA 1JYFA 1UBTS 4TTAA 3W0LB 4F1KA 5GONA 3KLPX 4TV8A 2XQGA 1E9EA 4ZYVA 4TZ0A 3BREA 4LRXA 1OMOA 4MW9A 4Q82A 4UCWA 4GI5A 5CLLA 5DIFA 3KPUA 3PRJA 3WYAA 3HVIA 4R3NA 4WD3A 5ER9A 5HILA 1E61A 3U3MA 4XQGA 4HVAA 4OSOA 2R68A 3A6HA 3MMZA 3NYRA 3NBXX 2XOKD 5A3JA 4BRSA 1I14A 4E12A 4L0DA 4D92A 4DDWA 5T6MA 5KQMA 3H5NA 2C0QA 1LBHA 3AUUA 4LTMA 4UVDA 2QQEA 3NEJA 4J4TA 3F3MA 1Y5IA 4WOCA 4URZR 3DHEA 4IJWA 2FN3A 2GEBA 1IOZA 1N5JA 1J21A 1SUBA 4R9NA 2BDTA 4REMA 4XFDA 2XW6A 4XD2A 3VVBA 5FJJA 2FWIA 1J09A 3H6HA 1YWGO 4HDNA 4NG4A 4OSEA 3ZQKA 4ZOLA 2GBFA 3AY6A 3K96A 5EZYA 5LP6A 2ZWVA 3EIUA 4LHEA 1AHHA 4RDCA 4MQ6A 2RD2A 4AKGA 3RM3A 4A6XA 3ILXA 4RXTA 1AT1A 1NMZA 4LZOA 1N6KA 1EWKA 4M99A 2O0MA 4TGLA 3F3SA 4MWSA 2D2IA 4ZANA 1GPBA 3VR1A 3UHAA 2Q7DA 4P08A 3P5BA 5D3MA 2HWWA 3IXLA 3L46A 2JDID 2PUJA 3AY0A 2IP2A 2J6HA 5CT4A 2BRUA 3DQQA 5D85A 3A27A 3DFFA 2PGDA 3G88A 3Q3HA 4RM2A 4BO5A 4NU0A 1X1SA 4NFHA 3M5DA 3HYRA 4Q19A 2HCFA 4GECA 4MDFA 1TTQB 2C99A 3DZKA 4IHKA 4QPJC 4PN3A 4P1ZA 1SWVA 1TVKB 1UMCA 4JLMA 5DM1A 1K4KA 1SXJB 1B76A 1I3MA 3Q1LA 3DMRA 3FXAA 4KDEA 4OHMA 4US1R 3S2YA 4KKVA 7GPBA 2GDZA 4YCJA 3H3XA 5DEIA 3OCYA 1VFPA 2EF1A 4DJTA 5J47A 1DAKA 2AI1A 2MSWA 2P6NA 3FMOB 4FBGA 2Z2XA 3E9MA 4URHA 3RABA 1N5RA 3JRNA 4AJ1A 3NANA 1E1LA 1T8YA 1X2BA 1N2OA 2QN8A 2MIIA 1V35A 2QT0A 2WUWE 1UM9B 2X0RA 4EF5A 1TCCA 3B1FA 4H7KA 1M74A 2JLAA 3RT9A 1FLAA 1S0UA 1A7UA 5TIIA 2R1VA 1DXYA 4QUEA 5UKDA 1W88A 4JMPA 4N8EA 3WISA 2O6HA 2FWJA 5K8LA 2JHFA 2EKPA 2INGX 3Q5DA 3OP4A 3LXXA 2QR5A 4QICA 3DEKA 1Y1SA 2PEZA 4DIDA 2XF8A 4YO8A 4D0RA 4AP5A 2V8OA 1UIMA 3D43A 4DR1B 1HZZC 5JTUA 3ZE9A 3GJQA 1UT8A 2V4UA 3COSA 1XZFA 2PSFA 2W6JD 1J7JA 3L6OO 3W3AA 1XSEA 2ZUDA 4MRMA 3OD1A 2PO5A 2NUTB 4I1OA 4CV3A 1GDTA 4MS1A 4XYGA 1N32B 1EIWA 2D7CA 2PL1A 3LMKA 1GNSA 4LHXA 4JBLA 3GGCA 4TTTS 1SURA 1LC3A 3IERA 4WI1A 2XDQB 1KORA 3MCTA 1YJCA 5KEIA 1N4AA 4RXMA 4ZV4A 4YMIA 1X3LA 1MOZA 2OLKA 2UV8A 4N8DA 3VKWA 1W2WB 2R6HA 3AINA 2XPCA 1AK2A 3HJAA 3EH2A 3HA2A 3B12A 1QANA 2B2NA 4DLZA 3H2GA 1UBMS 3OSZA 1ZC4A 4QBKA 4RF4A 4UOEA 1RC8A 1E2DA 2G8LA 4MKRA 2V7QA 4GPAA 3NORA 1TEVA 2JJMA 2EFGA 4KNWA 4G5GA 2GCIA 4DM3A 3OX4A 2KM1A 4FDUA 5AW0A 4M9RA 1DC3A 1OXSC 4WVLA 1XELA 4H77A 1YACA 3ENQA 4AP6A 3K8ZA 5LB4A 2BONA 2R6GA 5J5CA 3UH1A 3QVKA 1ZIDA 1DUSA 3TM4A 4C0BA 2VT3A 4LHZA 3A70A 4BNZA 3Q8XB 8ADHA 1B3BA 3T9FA 3KE9A 3ANNA 3GGJA 4GE3A 4RJTA 3IODA 2E48A 2EATA 1R8YA 2PS9A 3OTGA 1RAEA 4AZSA 4KZPA 3D7MA 5D1NA 4CMJA 4MVYA 1XXHE 5HZHA 2GYVA 1Z4KA 4EKIA 3EVEA 5J5VA 4PYQA 2OZPA 1RAHA 1U90A 4NOJA 1XMSA 2PZMA 2VDVE 2ZUVA 2EFJA 1Z62A 2P4UA 3QF4B 2C5LA 2NO5A 1C4WA 2Q5CA 4OA5A 1MX1A 4XIGS 1GUDA 4C4RA 4DXDA 2VH2A 3QYFA 5IC5A 1NR7A 4TWJA 1CF4A 1VCOA 5H5JA 1ID8A 3U48A 5KVAA 1TF7A 1XLTA 1QKIA 1W4AA 2FZ4A 4HKTA 2J59A 4M0LA 4R8SA 1B0PA 5L3QA 4G4SO 5IVHA 5B1IA 5AJUA 3AIMA 4E2ZA 2I62A 4OBWA 3SMQA 3OP1A 5F78A 1JQ3A 1IBCA 4MRNA 5JS6A 1YFJA 4G0YA 4B6SA 3QEAZ 1IXYA 4HX9A 5H81A 4N40A 2N47A 2HT6A 3NP9A 3B52X 1SC6A 2MSNA 3H9BA 4KR2A 4XDZA 1NXOA 1FTYA 3CLVA 1M54A 1PNQA 2PMCA 2WMOB 3SQLA 1RWBA 1JAXA 4F8JA 3JYNA 1P8JA 1DC4A 2QTNA 2QZZA 2QTZA 1BE8A 1Q17A 1QHSA 2E85A 2RIPA 3RU7A 1G2QA 5EE0A 5LXTB 3T12A 1RPAA 4L9AA 2H4YA 3ZW7A 1NAIA 5IJ0B 4KRGA 4A82A 3ZVMA 2WICA 3TD9A 3GT3A 1R6AA 4XPIA 1QHGA 4ASUA 4RF3A 1QGUA 4HEA6 1U3VA 2RBGA 4U5XA 5C5DA 1P72A 1G7TA 2I2FA 2PFSA 3KB6A 4ZDWA 4BTLA 5A62A 2J67A 2OD9A 2EIHA 3QBDA 1V6SA 2QKYA 1Y5NA 4HAVA 1KZ9A 3T38A 5FPQA 3K70C 3KD2A 4BP9A 4ALLA 1PGQA 5C34B 1KFJB 1N2XA 2P1DA 1F0KA 1J99A 1LQ2A 1JEQA 1Z7EA 1KPGA 4EENA 2VJYA 4RSRA 2FEWB 2OORA 3ACCA 3TPFA 1P0PA 5J43A 1OYVA 1VI6A 4L28A 3KQKA 4MWOA 3DZDA 3E5NA 4UTOA 1GTMA 3QFHA 1N34B 4U4AA 3IJEB 1X9HA 3H9CA 2BZSA 3UVEA 3OVMA 3AKCA 1MCZA 5GZ1A 4OK3A 5C51B 4EF4A 1BOOA 2G07A 2IA5A 5ALZA 2HRCA 1JHZA 4YAFA 4F3TA 1NUAA 1D3AA 1GYPA 1RAFA 2YOHA 8LDHA 5KKCA 1N7GA 3MLBA 3RTAA 4IVNA 4A0SA 1G8MA 1H1TA 2QZSA 2JLVA 5AVWA 1KYYA 4AIRA 3E3OA 3LLSA 2QTRA 1T9CA 2Z9CA 4ZYWA 5FPYA 1PFQA 3QENA 2PR7A 4ZXPA 1UXJA 1OVMA 5F1YA 5BO5A 4U2DA 4EB8A 3AL0C 4BQNA 4DG9A 5I45A 1E9CA 4MDEA 2ECQA 4ZOEA 1JLSA 2A35A 4B0OA 3PQCA 2VDWA 4HYQA 1U2GC 1Q3HA 2GPBA 5DYIA 3ZZUA 5FT9A 3K71B 5DBHX 2HZBA 3V33A 1L5MA 4LI3X 1J2RA 1H2ZA 3PXEA 3RBVA 2R00A 5C1IA 4G37A 1SHLA 1KK1A 2C88A 3G9TA 4PWYA 4KC0A 3CPJB 3PD7A 3F6PA 3WIEA 4JJZA 1PG2A 3GEIA 2EAUA 3OPYB 3X2FA 5JNRA 1M34A 4M8IA 4N7MA 2C84A 3VPSA 1ADFA 3S3TA 3KWMA 1I7SB 1NTRA 1O58A 3NATA 1U9ZA 1MVLA 3VOBA 2XZOA 1JFSA 3JALB 1YAJA 1ND5A 3ZS9A 2TECE 1U9JA 5E6SA 1TK9A 4FHCA 3VO8A 1KJZA 1KDPA 1YZUA 2PNFA 3V7WA 1K9VF 3ASYA 2IXTA 1QHHA 3DMNA 3MWGA 2XUIA 1E5TA 2CDNA 3L3BA 3D59A 3K05A 4CQMA 3EY4A 2G0TA 2GARA 1XWIA 2GZDA 2BZ0A 1Y37A 3KCQA 3N7UA 4YCCA 4GRIA 2MSKA 1QVVA 1E5XA 1E6MA 2IYOA 1PGOA 3GH3A 4I5EA 3TRFA 4XVCA 4GM0A 1PNVA 5KYUA 5C7IO 2D1SA 2PKWA 3PFFA 5BOSB 2ADOA 2XB9A 3P8ZA 3WA7A 2VQ6A 4GLOA 4DCJA 3W8RA 4WW0A 3NGMA 1IQUA 1QV7A 1T8PA 3GG2A 2WTBA 3I5AA 1L8XA 2QLNA 2R6ZA 3WAKA 3HVUA 4F45A 5AFSA 5AKIA 1I36A 3BWYA 1Q1ZA 2FLWA 1XK6A 4A9AA 4AO6A 2P7IA 4OP1A 1V6CA 1YIDA 1JXQA 2IOYA 4DLBA 3ZWXA 4ES6A 4XWOA 4KBGA 2B9EA 2VBGA 3O6VA 3BVPA 4G1MB 1FDRA 2GTIA 2P6UA 4J16A 4CN9A 5I7OA 4UAJA 2IL1A 2CD7A 1SCIA 3DFIA 3BMCA 2FPMA 3KV3O 3L1IA 3NIDB 4MVJF 4NBKA 5EWMB 1XVAA 3OMLA 4JWTA 1U2RA 2OYSA 5P21A 2QX9A 5LLDA 1EVKA 1QH9A 3ILVA 4HGNA 2WM3A 5ECYA 4PBSA 1HSOA 3NHMA 4BFUA 2CYBA 3RUDA 2H7YA 3EVFA 4QX6A 1JDSA 1M6EX 3JATA 5JCOC 2QP3A 3PPYA 1NASA 3NCTA 4Q34A 4MRPA 4AROA 2JAPA 3KJEA 1I2BA 2QD3A 2EKZA 2G9ZA 2HPHA 2HCJB 3GPDG 3O4GA 4JUFA 4NRDA 4LGYA 1N77A 4NDNE 3WNZA 4H4DA 4CKZA 3D6NB 4KH1A 2DUMA 2VK8A 2AG5A 4NHEA 4DDVA 3O9MA 3DDNA 3BF8A 1O3YA 1EHYA 1QRDA 3BERA 1I4OA 1L5OA 1NYQA 1IJFA 1POWA 2QTCA 3E81A 4WZBA 5H02A 1CRWG 1Z73A 2VF8A 4Q0MA 5C4MA 3D7LA 4MRSA 3L8MA 2NQ8A 4BZQA 3CZ5A 1DG1G 4OHVA 1UAAA 1ATIA 4DN6A 3IBYA 4ARZA 3A6FA 5H9VA 1T2DA 4AN4A 1LRKA 3VYSB 4ATNA 1QGZA 2QXYA 4O0LA 1EWTA 1DWOA 1HDOA 1FP1D 4N1AA 1T26A 3DYVA 5CBPA 1S9HA 3M9LA 2ZWPA 3HJCA 4FHDA 3TW0A 3DMPA 1M8KA 9MHTA 1EESA 1NQ5A 4HNSA 1JR4A 5KOJB 4MYSA 2V4ZA 2IBTA 1G2OA 3AKEA 3SHOA 2AVNA 4ASUD 2IZ7A 1Z5WA 2W37A 1H1LB 1Q22A 1L5VA 1N9KA 1PZHA 2KWIA 4LYYA 4N6GA 1SBHA 2GPYA 4KK3A 4ZREA 4B32A 4EJ2A 2JGEA 2Z1DA 4X6YA 4X8MA 4UFNA 4Z0HO 3U37A 1YVUA 5KYXB 3ML1A 1OT3A 4MKGA 4Q4AA 5JCXA 4R9RA 4IFBA 3K9LA 3GLHA 5DHRA 1LVHA 4JJ7A 3W05A 3OTIA 4YUXA 4ZZIA 5FUMA 5C7LO 2FHPA 3IE0A 2NSDA 2PZAA 3WMWA 4ZI2A 3H5IA 1JZSA 3NGXA 5L7TA 2A5GA 2WDPA 4CF7A 1YU9A 2W22A 4IYJA 4IVPA 4EBBA 4GXRA 5A7GA 3W90A 3WYEA 4RFVA 2BD0A 2PUTA 2E4ZA 1FQWA 2HDNB 2UYYA 3TOVA 2FR0A 3BMOA 1ESDA 3CTPA 1WHSA 3V55A 4B35A 5CFPA 4D9HA 1MQAA 3L8YA 4FGWA 4GM1A 1P3JA 1FRNA 2IHZA 2P9JA 2FMIA 3ADCA 1N36B 5JRDS 2ZRKA 4L6CA 2XMDA 3H5TA 2BN4A 3HCRA 4C30A 2R6CA 4KN5A 5JNLA 3DVSX 3MGCA 4X20A 5ED0A 3LQQA 3OG9A 5I8PA 1X1CA 3ABIA 2C5AA 2GF0A 4MUEA 2H3EA 4GQBA 4PX3A 5AKKA 2JVJA 5ENZA 3THXB 1SVIA 3PXXA 4AJJA 1XTSA 4JI2B 2WM9B 1CP3A 2IV7A 1TF2A 4Y6SA 3KQUA 3OJFA 4RU1A 5BMOA 2GJ8A 3G79A 3O4RA 1JVNA 2BMVA 5DLQC 2CNNA 1XVIA 2PCJA 3I2KA 1TUBB 3ESXA 5B2EA 1UFQA 5E2AA 1XZAA 3CVYA 1WOYA 1IZ8A 4WZAB 1WD7A 1WCYA 4FIDA 2ZUTA 4BBZA 1QIIA 2WJVA 3CLUD 3RTCA 4FR5A 4L5AA 4MPPA 5DF1A 3VNSA 3BE4A 4Q9LA 4N01A 2EP8A 4CCAA 4F21A 1M33A 3SIRA 2QE6A 1U04A 3HP4A 4LTDA 5FAKA 3RAJA 1SOAA 5AI4A 5HCIA 4UCFA 3HO1A 3JWHA 3LUAA 3IOMA 3PENA 1Y3IA 2OCPA 3THYB 3DTVB 2P78A 4DDTA 4P7BA 4LJKA 3FYUA 1MRSA 2OV2A 1M2OB 4INPA 4YRZA 5IN5A 4N8SA 1KA9H 3WLQA 3BPSA 2PL5A 3KVOA 4JU9A 3JR3A 5JZBA 4JH0A 1JDBC 4FXOA 4B7AA 3FM9A 2VRWA 4MVJH 1AD2A 2FZLA 1D0SA 1MOQA 2HA3A 2PG3A 1DKPA 1NJGA 3CPSA 3HCFA 3HV2A 2E87A 1TCUA 1U8FO 4C0XA 4MIYA 1Y4ZA 2C4TA 3DMDA 1DBSA 1M6HA 4Y98A 1N0UA 4CQMD 1ULHA 1D0VA 3GP5A 2UXDB 4AQDA 5KWVA 2LIPA 5D5HA 5BVGB 5ED4A 1TLLA 4JC8A 3CCCA 3M5CA 1FZTA 2GQ0A 5L95A 4NS1A 4MX8A 1RC1A 1VCNA 2GCPA 4UE2A 2IV3A 1FJ2A 3ZY2A 1YVEI 5AH0A 1YL5A 3E8MA 4NH4A 5L7YA 2ATIA 1IHPA 2RGUA 3W6UA 1AS0A 1CJKC 1I1QB 3IP1A 3QBEA 4DLYA 5AI6A 3AETA 4YRSA 1QOPB 2CDAA 4J1NA 4Z9AA 4X95A 1AKMA 1WO8A 3I4LA 4R0NA 1ISJA 2EZTA 5C81A 3OCUA 4HWPA 4YJFB 2CVFA 4DA8A 2G3YA 2G1JA 3TRJA 2IXDA 4N0PA 2ZS7A 3PU6A 2YZ2A 5HJ5A 2WWXA 3PDCA 1UP7A 2WSSA 2C98A 1U1EA 2V7XA 5EJ2A 5DK4A 3W2FA 3RSFA 2WSYB 4UXJA 3OT1A 4AZTA 4UNPA 1T4DA 4RY2A 1R0ZA 4O4JB 2XITA 3QG5A 2BFPA 4EB0A 1H94A 4PAQA 4Z5XA 3O75A 1T9KA 2PPLA 4JT9A 4UATA 2REQB 1I4LD 1R16A 4BV3A 2EFEB 4FZRA 3TNLA 2QTVA 3FSJX 1V8ZA 2PFKA 2JIZA 4Q3AA 4LYAA 5B6JA 4QNNA 4U9UA 4HDSA 4RLQA 2VDUE 3AJEA 3BGDA 3SZRA 4MTLA 3QUTA 4A5OA 4DABA 4DIKA 3L4JA 4KITB 4WXYB 3WKDA 4LZLA 4B3MB 4B5KA 3SGLA 1I30A 2AJLI 5AHXA 1E7YA 3T5CA 5EMJA 1Y42X 3TTTA 3BF7A 3F7OA 1GJRA 1XCJA 1OI4A 4M55A 4BLOA 1H69A 1T3SA 1TZ2A 3ZU5A 4CI9A 4YX9A 1MABB 4MVJA 5FAXA 1YQUA 3TRIA 2YHIB 3KAJA 1YQQA 2P9YA 2A0WA 3PKJA 3H4IA 5DWQA 1L4HA 4DR3B 1SXJA 2ZJAA 3GV0A 3THWA 4OHBA 1OV6A 3A1NA 4YRQA 3ZCPA 5CCXA 1C9KA 3T8YA 2D3TA 3JCZA 5JCPA 1WQ4A 2A1IA 4QDUA 1CUBA 3AMVA 4H16A 4QXAA 1LDMA 3Q98A 4EEKA 3HQ4O 3O94A 2ZS8A 3IV9A 4KJXA 3SSNA 3QVLA 2PH1A 3SDZA 1XCOA 1LW7A 3JAWA 2IPNA 2WW8A 4Y9DA 3NKLA 3B3FA 4MCAA 1P60A 4OI2A 1DFHA 2ID8A 1QZ3A 3OU2A 2XVYA 4WNAA 4YDSA 3AEKB 3UUWA 2JI7A 4IIJB 4PRKA 4RD0A 5EI5A 3M6IA 4NH0A 3OZFA 4XLTA 3OE7A 4LPKA 4YLEA 2ZRNA 5SY6A 3TTWA 4CL0A 1WG8A 4IUBS 5JD6A 2XMPA 4CDRA 2DY1A 3A1UA 1HWYA 1X1EA 2VS1A 5HUHA 4M1TA 3HADA 1OZAA 3UJPA 2C5SA 4PPNA 3EGIA 3WNBA 1M1ZA 4HFNA 1XKQA 1K3UB 1E1KA 2ISSD 1S2DA 3OCZA 5F2EA 3SE0A 1ONBA 4OXKA 4JI8B 2P4QA 3HXMA 1DIAA 3ROQA 3FH0A 2G77B 3I3OA 4WLVA 4ZZ1A 2QQ5A 3KQTA 1RBQA 1VJ5A 4XXHA 5AK4A 2IYZA 1WKBA 2E4WA 2QHXA 4M3NA 2BUAA 1G5TA 2C2HA 3VPXA 3ODPA 3LO5A 1BHSA 1U8ZA 3BWBA 1E60A 1THTA 3JYHA 3F78A 4ZO7A 4PX2A 4AKIA 1LVUA 2PUHA 2REOA 2J3LA 1JDVA 1U6KA 2H52A 4A92A 4EO7A 1T0IA 1L4LA 3H2JA 3I2FA 1LPPA 2PT7A 5K0LA 3N58A 4M60A 2QV7A 1E6WA 3HNOA 3PICA 4PYOA 1UOOA 4Y9UA 3ROXA 4EPWA 4RVCA 1KI7A 1Z5VA 2DCMA 3DF7A 2V6IA 1YQGA 2IC5A 1I6KA 1Y8RB 2WLSA 4OQLA 5ALPA 4KG7A 3HWX1 3WWCA 3OUTA 5KKNB 2E5WA 2GRJA 2GK6A 3NU1A 3QJGA 4GX5A 4CMAA 1JHPA 2O1WA 4PYNA 3T0GA 1OWNA 4D79A 2GHRA 4RSGA 1HNZB 4MXDA 1QYVA 2WFLB 2XCUA 1UPFA 4IVRA 2I3BA 3B7WA 4WADA 3WBBA 1T29A 3WRYC 3ZLUA 4MAAA 1E7SA 4M89A 2QRVB 4X0EA 1FFSA 3ZC3A 3V7YA 3ZZMA 1OFUA 1RIIA 1XZPA 4AZWA 2W5UA 3AQIA 1GM5A 4RGQA 1VYTA 1T5LA 1R9JA 2XIQA 3BIOA 1Q6ZA 1U7PA 4ZJYA 2X58A 3QGMA 3H3FA 2PGJA 1GZSA 5EERA 3FVWA 4L16A 2VA8A 1NVBA 2W2XA 3ZGNA 1YUNA 3EVDA 4YWJA 3CGWA 4D6YA 2H2HA 1CVIA 1DV2A 1N2GA 1MU0A 4G67A 1WA5A 2QRPA 4DNPA 3RC2A 3ZDYB