2YHIB

Trypanosoma brucei ptr1 in complex with inhibitor wh16
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE, PUTATIVE
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 93
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yhiB00
5B1YA 2H63A 2E4AA 4HY3A 1DC3A 1XEAA 3I6IA 4G81A 3PIIA 4YVFA 1NYTA 4P38A 3O38A 5DT9A 1GYQA 1ZMTA 4BNGA 2FHSA 4FDAA 4IINA 2HMUA 1P0CA 3GF4A 2DLDA 3T7EA 1PQUA 1YL5A 1LDEA 2P9EA 4OQYA 5GZ3A 4FS3A 4K6CA 2O3TA 3JQ7B 4Q3CA 2GCGA 2IEBA 3DBLA 4BO0A 4CMAA 3CTMA 4BNFA 3RROA 2VYND 1PS9A 4N5LA 2OOSA 2VT3A 4CMKA 1A9ZA 2GO1A 2BFAA 4JP3A 4FN4A 2AQIA 4NI5A 1MUUA 5JAZA 3M2PA 3H65A 3DFUA 4I5GA 1NPYA 1XQ1A 1E1LA 3PZBA 1KVRA 2P5UA 1GV0A 2X5OA 3HN7A 3UFXA 5L95A 3DC2A 4RF2A 3WYBA 1XKQA 1ZKMA 3LQFA 3QWFA 2VCYA 5EN4A 2CVQA 4BIIA 3JQ8B 3OA0A 4HNGA 3ZU3A 1MGOA 3PWSA 3WR5A 2I76A 4C7JA 4CPDA 3GAZA 4GPD1 1IZ0A 3KLPX 2FR8A 3VKVA 2RHRA 2QX7A 1ZW1A 2P9GA 1KEPA 4PZDA 3ZU4A 2DUWA 2X0IA 4QT0A 4M86A 4NBVA 2WYUA 4PVCA 3FSRA 1O94A 1QV6A 4CR6A 1CEQA 1N8KA 1VL0A 3ABIA 2NLOA 2NU6A 3PQFA 3A06A 3HB4X 1UXKA 4GMGA 3LK7A 3WMWA 4XIYA 1WZIA 2DKNA 2C0CA 3SX2A 3DDNA 2DFDA 3N74A 4AL4A 1ZJZA 3WG9A 3EDMA 4OXKA 1R16A 4WE3A 4IJKA 4OAQA 1IB6A 1LDGA 2Y1OA 3FNEA 1A7AA 1GQYA 3JQEA 5IN4A 5CDTA 4GX0A 2ZK7A 4QO8A 4R54A 3RU9A 5KKCA 3WDSA 1NWHA 5DOZA 3O8QB 3RUHA 3PZRA 3FF4A 4H15A 1NM5A 4CMIA 1JKJA 2PY6A 2WD7B 3D3WA 3E82A 4YJDA 3HDYA 4BNUA 4FFMA 1L7EA 2H6EA 3ICPA 2IZ1A 1RYEA 4YBZA 4E33A 4BVAA 1M76A 2VWQA 2EHDA 3HQ4O 1Y8RA 2Z1MA 3DAFA 3FD8A 1C1XA 3K6JA 1XQ6A 3PLNA 4GSLA 5HS6A 5GZ6A 2X5KO 4M87A 2X4GA 1LXCA 1U7TA 4CV3A 5KJCA 2EG9A 4GMFA 4DTIA 1ZK0A 1P1JA 1R4NB 1YL6A 3K5PA 4E2ZA 3HADA 4RVGA 2D4AA 2X0RA 2BH9A 1PL6A 3JQAA 2PR2A 2J3KA 3L4BA 5LC1A 2OP0A 1I30A 2FOIA 4MP6A 1PGQA 4AJHA 3TFOA 4XQ9A 3VHRA 2DBZA 2BMAA 4N7RA 3GAFA 3VZQA 5A05A 2B4TO 4I9HA 2CY0A 5IG2A 1B3RA 1M75A 3GOHA 2F00A 1UUFA 3FNFA 4RF5A 1PGPA 2VN8A 4QEDA 1ZSYA 4W6ZA 3OA2A 2C2YA 1EK5A 3E5RA 4M1QA 4QTZA 4XA8A 4R69A 4ZU3A 4Q3DA 1J4AA 1HRDA 2Q1WA 4HXYA 3AM5A 2VZ8A 1NPDA 4H16A 4E5NA 4II3A 1YDWA 3NDRA 4NU6A 4CQLA 2EGGA 5JCXA 1PJBA 4I9NA 3TQHA 3B1JA 3FNGA 5KKAA 4TKMA 3WICA 2O3JA 3V1YA 3B6ZA 5TC4A 4CLHA 4MVJA 3OQBA 1I3KA 2HRBA 2XPCA 4J91A 5L3ZA 3R3JA 3DBLB 2FPGA 4Z9YA 4BV8A 3HDHA 1KVTA 1WDKA 2PA3A 3PTZA 2C54A 3PP8A 1B2LA 5THKA 1UXGA 1X0VA 2NU9A 2IZ0A 3RBZA 3GA0A 4GX5A 5DCUA 1DEHA 3FTPA 3W8DA 1I10A 2CF5A 3VZPA 3L6OO 2YUTA 3L77A 2QZ9A 4QO7A 4L4RA 3JQDA 3DZHA 5JDIA 2B69A 3GHYA 3OEYA 3WYEA 4BNYA 3NTRA 1CJCA 1GY8A 4OJNA 2W2KB 1KERA 3DZFA 5IZCC 3ZWMA 3IDSA 4BMNA 2G17A 5CEEA 1MXHA 3DOOA 4XYEA 4EZBA 4XQEA 4XZ3A 1MB4A 1O8CA 2P68A 2Z5LA 1RPNA 3ZU5A 2GASA 2ZYGA 3D7LA 3ITKA 3H5NA 4JBHA 3Q0EA 4KP7A 4UUMA 4RF3A 2X86A 5I9NA 1TT5A 3L9XA 4EJMA 4EUFA 3WGHA 5JLAA 4FPXA 2O48X 3ONDA 4CMBA 2OGUA 1B3BA 3QWBA 3NJ4A 4R41A 5JS6A 4YAJA 3MOIA 1F8FA 1X7HA 3CE6A 3BA1A 5BT9A 1E3EA 2YHUA 3IKVA 4OH1A 3AK4A 3E9MA 4B4VA 4Q39A 3ASUA 4E3ZA 4I08A 3A1NA 5BSFA 4ALLA 1SO8A 1MP0A 1ZCJA 2YQ4A 4C4OA 3TZHA 3W4IA 4JQCA 3ZDFA 3GUYA 4TVOA 1A7KA 3DHEA 2FPPA 4WLNA 3C85A 4ITUA 3ETEA 3GFBA 4BB6A 3PFFA 4G5HA 1NR7A 1PGJA 1I24A 3ICCA 5KVCA 1BWSA 2O3QA 2A9FA 3UHAA 1VKOA 3AU9A 4CUKA 4NJMA 4A2CA 3CZMA 3DHNA 1Z6ZA 3DZGA 3QVWA 4B4UA 2EW2A 3D3WB 4I8XA 4TRNA 4CLEA 3WFIA 4UAGA 2X8LA 1KY4A 1W6UA 1W8DA 3O03A 4GL4A 3OBBA 1GYPA 4K9DA 1O9BA 1Z82A 5DN9A 4C7KA 1R37A 3BMCA 1C1XB 3OJEA 2HUNA 4E2XA 3AUAA 4OXYA 4RV9A 4U6QA 1H6CA 1QYCA 1DRUA 4FC7A 4CR8A 4ZJUA 3ROMA 3JQCA 5KJEA 5C7OO 5BR7A 3GGGA 1YB1A 1TA4A 1DIGA 1LDYA 4BNKA 4RPJA 4IDDA 3ZV4A 4PG7A 3AY3A 1NHWA 3JQAB 1ONPA 1VJ1A 3AI3A 4PZCA 4ND2A 2J3HA 4IXWA 3R0IA 1PZEA 3OIFA 5IXSA 5A06A 3PHLA 4XQCA 5H81A 3GPDG 2AEMA 3PVZA 2HKIA 3JQGA 1AN9A 1O0SA 3CPSA 3NGXA 1Y6JA 3I9KA 3TOZA 1FDTA 2WTBA 3P2YA 5ADHA 5JC1A 4E5MA 3WWYA 2VNAA 5LDHA 4OSPA 5L51A 1XCBA 3LF1A 4OO3A 4J16A 2FN7A 3VPFA 1EE9A 3I1JA 4OIMA 2O3SA 1VKNA 3WLFA 3RKUA 4HUJA 5JXWA 1H94A 2BRUA 2NNLD 4WGGA 1W0CA 2IZZA 1DFHA 1GU7A 3HE3A 4D43A 1NR1A 2H5LA 3LDHA 3H9JA 4YAEA 2ZYDA 1YDEA 5HRUA 4YAIA 3RUFA 2YFQA 3GLQA 3LT0A 4BUCA 8ADHA 1ADGA 1X14A 2HRZA 1X1EA 4K28A 4BQRA 1DIBA 2E37A 1RKXA 2CF6A 4DIOA 3FBGA 5JBIA 4ZA2A 5DULA 1JLLA 3D64A 3KV3O 4LGVA 3ZWCA 3RC7A 5L45A 4WKGA 1SOVA 4BOYA 1SC6A 3B20A 4QFCA 1BXGA 3IP1A 4RPKA 3UICA 3NEPX 2PK3A 1IE3A 4BGUA 3MJCA 2J3JA 4EEZA 1HSZA 2Y1EA 1HE5A 3T4XA 4J1QA 4E12A 2VZ0A 1JW9B 2HLPA 3GC6A 1YO6A 4ILKA 1X1TA 5FWNA 4JBGA 2Y1FA 3QV1A 1U8FO 1JKIA 5LDGA 3DBVO 1Q2XA 2Y1CA 3JD1A 3PWZA 4CV0A 1OBFO 3GN1A 1H9AA 1T2DA 3ULKA 1B8PA 3GHHA 5MGBA 2BI7A 2PKRA 4KDEA 3UCXA 4E32A 4CM9A 5JW6A 2C07A 2XF8A 4R51A 1WAMA 1EEHA 1LU9A 2YFHA 4GQAA 4OSOA 4D3DA 4DLAA 1U7HA 4LVUA 2NADA 3ANMA 4O63O 3E6AA 4J6FA 1V0JA 4DREA 1YONA 3MJVA 4NU5A 4UVDA 2YV3A 1N5DA 2Q99A 2QQ5A 3DBRA 4R1SA 3IUSA 4KOAA 4TMFA 2JAPA 2O2SA 4PZEA 4TROA 4MIEA 5EQDA 1UZNA 4FGWA 4M89A 1N2SA 3INTA 3QSGA 2VYVA 3PXXA 3D4OA 3F5QA 4YA6A 5FI3A 3K96A 3ZI0A 2AQKA 2VHYA 3M1AA 3UOGA 4Z0HO 1WDLA 4FFOA 1PR3A 4CM8A 1ISHA 4B79A 4JK3A 4UVHA 1EK6A 1PQWA 1EDOA 8LDHA 2B35A 4PLWA 4ZICA 4KQWA 5GMOA 2X5JO 3JCZA 5F1PA 2QW8A 4IQ8A 5EESA 5JDIC 1DIRA 2GNAA 4NZ9A 4WLOA 1HDCA 1XIVA 3CXRA 5L9AA 3F5SA 4UUNA 2AMFA 1SPXA 2NACA 3Q6IA 1F06A 3F1LA 3PHHA 3KYDB 3E48A 1AXEA 4LCEA 1T4DA 1E77A 1R0SA 4FBGA 1P44A 4ALMA 5I7EA 4LSMA 3BMNB 3DZIA 4LK3A 3BMCB 1DRVA 3RUCA 5JDCA 3JQ6A 1MXFA 1VPDA 1B8VA 4E6PA 2GF2A 2Q4EA 3FR8A 4J7XA 3NT2A 4GI2A 3VVCA 1YOVB 1GUFA 1ID1A 4DIFA 1R0KA 1TI7A 2QG4A 5F3RA 1JKFA 3IJRA 4R16A 2C82A 4Y98A 2IEDA 5I7SA 4J49A 5L4LA 1UH5A 1ZUD1 3R1IA 3JQ7A 1ULUA 4BO3A 4I5FA 3JQGB 4HX5A 5G0UA 5JCJD 5ICSA 4E2YA 2R6JA 3RI3A 4PG6A 3WGOA 2B37A 3ROQA 2Q4BA 3LC1O 1LRKA 2Y67A 4MIOA 2EIHA 5G0SA 3WGYA 1ZBQA 2V6FA 3AUSA 4DVJA 1NAIA 4W9NC 4CUZA 1K6XA 1BRMA 2FPIA 1NASA 1I8TA 3H4VA 4D44A 5I9MA 5HTOA 1BHSA 1YS4A 3C7CB 2VRCA 2EKLA 3JQ8A 4MVJF 4EITA 4EJ6A 4R5MA 1LLDA 1W73A 2PGLA 3EK2A 3ZW8A 3GDOA 3COSA 1JAYA 1R66A 4WLEA 4HBGA 1C1DB 3DXFA 3KEOA 3ZHZA 2OL4A 5CPFA 1BG6A 1EE2A 1KYQA 5DBIA 3TZQA 2C7VA 2HCTA 5B4VA 3ZCXA 4CODB 1BXGB 1GV1A 5MDHA 3RSHA 1U8XX 4YT8A 3NGLA 1RM3A 4NPCA 3ZHYA 5JMPA 3EVTA 3L0DA 4NFHA 4XDZA 1PJQA 1RM4A 3KOUA 1KS9A 5G0VA 1U2GA 2NTJA 2JCVA 1T26A 3KHUA 4B3HA 3WGGA 5C3MA 1YB5A 2DQ4A 2HMTA 4ND5A 4XJTA 3LSYA 1I2CA 3TZ6A 1LNQA 3UW3A 2Y0DA 3IOYA 1KOLA 5IF3A 3GDGA 1CYDA 4U0JA 5BQFA 4UVEA 2EP7A 3UN1A 2NV6A 1WPQA 2E49A 4CLXA 3CIFA 4CJXA 4Y9DA 4JIGA 4A03A 4HFNA 4L4XA 3NRCA 4GWKA 2VOJA 3GVHA 1T25A 3LLVA 5HBRA 6ADHA 1R0LA 3DEYX 1GCUA 5AVOA 3L6DA 3PK0A 4AJ2A 2QRJA 3IUPA 3ZWPA 4IZIA 2RH8A 1V6AA 2EV9A 1HYGA 3EUWA 1S6YA 1VE9A 3UH1A 1T4BA 1YXMA 3JD3A 1D4FA 2AEJA 4ND3A 3U0BA 3IC5A 1EFLA 3RBVA 3TZCA 1DSSG 3P7MA 3DBRB 3U4IA 1YKFA 2O7SA 2V6MA 2NUAA 5F1KA 1QYDA 1LBEA 4J2HA 1HE2A 1O89A 4B3IA 2ZIZA 3AY6A 3PPIA 1HLPA 4BHTA 4CM8B 3ZN2A 1K89A 1ONOA 4BL5A 3PFWO 3LT2A 1C0LA 4DLBA 1HLDA 1U3WA 1DC6A 1IPEA 1K5HA 2UVDA 3DHYA 2X58A 2VYNA 4WK6A 3GZNB 4BNXA 3GGOA 2NVBA 3LT1A 1WZEA 4HNHA 3F4LA 4WLVA 3BTVA 1KY5A 4BKOA 5CAEA 1E3LA 4EW6A 5FF9A 2IXAA 2DFVA 3C7DB 2I3GA 3AM4A 1SMKA 1CDOA 1F17A 3BMOB 3JSAA 4RVDA 1DBVO 3RJ9A 3VKUA 3ZWWA 3WBBA 4A27A 4E0BA 5KVSA 1XU9A 4LRTB 1EZ4A 4JNKA 1Y9EA 5KCZA 4OHUA 5BNFA 3FHLA 1ZXBA 3DAPA 1ZMOA 1R12A 2XXBA 2YY7A 3Q2IA 4FJ2A 4R1UA 5LCXA 1OZAA 3JYNA 5BSEA 4FFLA 1UDAA 1EMDA 2C20A 1BGVA 4PGFA 1WP4A 2IXBA 4XYGA 1G1AA 3SLKA 2D5CA 1E7RA 3VTFA 2Q49A 5H82A 4W4TA 2W4QA 4P4GA 2J8ZA 3UGKA 3JYLA 4YAKA 4EDFA 5FFFA 1DJNA 1J6UA 2WWRA 4KTTE 5CPBA 3O4RA 3ZWBA 1U4OA 4WEQA 1EQUA 5A5EA 3NX4A 3LT4A 1WWKA 1V3TA 1BTOA 4EYEA 1E0DA 3MOGA 4J4BA 3ZNPA 5JAIA 4EI2A 3V1TC 4BO8A 4R1TA 4W7IA 2W2KA 1NX6A 3DFZA 1M67A 1MX3A 4E13A 1MFPA 3ZWXA 5KJ1A 1OC2A 4YJHA 4MDHA 2OO5A 4XB2A 1FXSA 1PL8A 1XR3A 2AE1A 5JDCC 3WLEA 4N5NA 3QIVA 3U4CA 4L0QA 4D7AA 4PLCA 4EUEA 1ENYA 1K6JA 2IYPA 4BKUA 3CINA 3ANLA 2OMEA 1SZJG 2JHFA 5JYEA 1Q7GA 3TJRA 1N9GA 1IY8A 1C0KA 1Y5RA 3FWNA 3ONEA 4UVGA 5ENVA 4IQGA 4WUVA 1MG5A 4URFA 5CDGA 4HP8A 3JYPA 1U3UA 1E6WA 3NV9A 4XGIA 1NHGA 4A5OA 4BO9A 3FN4A 5TF4A 1QYVA 5CFZA 1U3TA 4XB1A 4EGFA 4CMGA 4YTEA 1Y7TA 3S2GA 1B16A 2Y05A 4RPGA 3C8MA 4WJZA 2PD4A 4Y6RA 5DNAA 1DDOA 5H83A 5A3VA 1ZH8A 3WB9A 1XELA 1ZSNA 2NTVA 4GGPA 1XA0A 2HSDA 2EF1A 2WM3A 3D3EA 2YHIA 2AW5A 2VHXA 3FBTA 3V2HA 2VHWA 2ZB3A 3TNLA 2VTDA 1PJ3A 2VUTA 1LA2A 3TPCA 2W98A 4CV1A 2AQ8A 3AI2A 2B4RO 3KVOA 3AM3A 1UP7A 1Y8QA 3D0OA 4F45A 1LSOA 3GR6A 3B1FA 2I3AA 1R4MB 2NU7A 2X9VA 1MLDA 4YQYA 1P74A 2Q2VA 3H6KA 1QLJA 6LDHA 3S8MA 4WECA 3VDQA 3Q9NA 1D3AA 3VPXA 4CLRB 5HWSA 2VNSA 1E5QA 3NYWA 1F12A 2H1SA 2HO5A 3GNTA 1VLLA 1G6KA 3K73O 4L9RA 4MVJI 3JV7A 1Z73A 3PHJA 4GAEA 1OAAA 4DPKA 3VOSA 1U4SA 5G0TA 1A27A 1C3VA 3EZLA 1VSVA 4KQXA 3VC7A 4AJKA 4PRLA 5I9LA 4CM5A 3ETGA 4KZPA 4ZRNA 4RVUA 4RF4A 1PJ2A 5AXCA 5G4LA 3C1OA 3KB6A 1A72A 1QYWA 4R4JA 1KEUA 4D79A 5TIIA 2BGKA 2DTEA 1DAPA 5EQFA 2GPTA 2IRWA 2YDXA 4HADA 1OFGA 4AVYA 4D3SA 2DTXA 4NBTA 4NBWA 4WNIA 3QP9A 1H6BA 4RZHA 3PQDA 2YZ7A 5F21A 1MG0A 3GRKA 1PGNA 1YJ8A 2RHCA 2VT2A 5ER9A 5BNTA 4Q3EA 5A03A 2VHZA 3JYQA 3OJFA 1LLUA 3DR3A 1NBOA 1NFRA 1PJ4A 3MJEA 3E8XA 4NR0A 4IS2A 1Z7EA 4IPTA 2OZPA 2HJSA 4PVDA 5L7YA 4F46A 1SAYA 4GSKA 3U09A 4DIBA 2NTNA 3JD0A 4PG8A 4MP3A 5CHEA 4I5DA 2OXIA 1IULA 2ZQZA 3MJ4A 3V8BA 3WMXA 1LSSA 4BKPA 4A73A 3QY9A 4QXMA 2DM6A 1C0IA 4IS3A 1QR6A 2PWZA 2I6TA 1BDBA 4S3MA 4CM6A 1ULSA 1FDWA 1UZMA 1MFZA 5K6AA 1P0FA 3E5MA 4W7HA 1FJHA 2HK7A 2B0JA 1WLYA 3HHPA 4HV4A 1AHHA 1QYXA 5B37A 1ENZA 4GKVA 4L8VA 5U1PA 1WMBA 1ZEMA 2I9PA 3ROKA 4BO1A 5B4UA 1Z45A 4PLYA 4WCDA 3PJFA 3RBXA 4RVHA 3OQ1A 5KWEA 3BAZA 2PH5A 4PIVA 1IHYA 3ZW9A 3WOHA 3W4JA 1LDBA 3S55A 2D0IA 3BHMA 4YJHB 2HDHA 2FRDA 2Q3EA 4BMSA 3PI7A 2Q1UA 2PV7A 4OOEA 2E48A 2DPGA 4F6CA 2JAHA 3K31A 3RUDA 3BYZA 3AFMA 1N9GB 3MTJA 1AHIA 1ZZEA 1R15A 1WNTA 2D2IA 1ISJA 1SB8A 4DUPA 1NVMB 1NP3A 4RDIA 4Y6PA 1HSOA 1V3VA 5JPIA 2RCYA 1TXGA 3JYOA 1KVQA 4AJPA 2HK8A 3ZNQA 1H93A 2ZYAA 1SNYA 3OP4A 4JN6B 1PJTA 4D46A 3DOJA 4ALIA 1GYRA 3I9JA 5JFOA 3NDIA 2AG8A 1GD1O 4IDEA 4BGIA 2C5EA 2G1UA 5AOVA 1GADO 1X0XA 4HFJA 2AQHA 2UUOA 4J3FA 4R3WA 4O1MA 3G79A 4U0KA 2YHIB 1EVIA 2G0TA 2WDZA 4OMUA 4PLVA 4AJEA 1XDWA 3AW9A 2UUPA 1PGOA 1CRWG 3QWAA 2VHVA 3TDKA 4TRJA 2PZMA 3IKTA 1P33A 4D0RA 3N58A 3A28A 3TOXA 3H9UA 1Y8QB 1DJQA 4W9NA 3KLMX 3KYDA 4BNJA 5TLSA 1NQTA 3HB5X 4IJVA 4UEKA 4CUJA 1BVUA 1LLCA 3EW7A 3NTOA 5G2OA 2LDXA 1DAOA 3BMNA 3BMQA 2E82A 5F5NA 4WNCA 3MJTA 3AOEC 1IUKA 1UXIA 3ZGYA 3F1KA 2OORA 4F6LA 1P9LA 3DMTC 4EJ0A 1YOVA 4B7XA 3VZRA 1ZJYA 1P77A 1Q7BA 2GERA 1P1IA 3N7UA 4TRRA 2GN9A 3C1AA 3HUDA 1N7GA 3ADOA 1VL8A 4BO7A 1X7GA 1ONNA 4NJOA 5BSHA 2I66A 1RJWA 1K6IA 2BELA 4OGWA 4O59O 3JD4A 4BNVA 3WJAA 1IZ9A 1PS8A 2A4KA 3EAGA 2HMWA 3GVXA 2HMVA 3C3XA 4AJ4A 2JFGA 1HZJA 3ROPA 3VDRA 1E6UA 1GCOA 4AJOA 4ZVVA 5IDXA 3RWBA 1QP8A 5DCWA 4ZQEA 3RCBA 3GDFA 1EVYA 2FP4A 2J5QA 2WMDA 2Q50A 2NSDA 3PDJA 5TGDA 3OHSX 1PWXA 1PTJA 4IJWA 5COQA 5JO9A 1BW9A 3IQDB 4XR4A 1ADFA 2DT5A 3BHJA 1GFSA 4BO6A 3X2FA 4OXNA 3D1LA 3NUGA 3GVCA 3GGPA 3HWRA 1OMOA 2X7HA 3RFTA 3W4KA 3GNSA 2J5KA 3A4VA 4FR5A 2H9IA 4MPDA 2HJRA 4NK4A 2DVMA 3GNQA 3RFXA 5AYVA 3LLSA 4J9VA 4J0FA 5T57A 4TZTA 2UAGA 3NAQA 1C1DA 4B4WA 4CQMD 1MA0A 5T64A 2DAPA 2GDZA 4Z0PA 2EKPA 4D3FA 3D5TA 4YCAA 2JD1A 4PLZA 3ZZNA 4UUPA 5I7VA 4FCCA 3D5QA 4J1TA 3U4HA 5GY7A 5KVVA 2GD1O 4D41A 4YRAA 1EUZA 4LCJA 2WE8A 5EJ2A 1ZNQO 1I3NA 5C5IA 2BFPA 4XRRA 3Q1LA 5IAAA 3F47A 1BMDA 1B15A 5TT1A 4YT4A 1EVJA 4NH4A 1LTHR 2BFMA 4Z3KA 2JHGA 4DL9A 4LVCA 1J5PA 1E3WA 3QVTA 1P1FA 5JAMA 4JJFA 1U5AA 4KTVE 5EL0A 4OOFA 4R3NA 4CM4B 5TS3A 2CZCA 1GZ6A 2OHXA 4DMLA 4DWVA 2HU2A 2X0JA 3S2EA 3S1LA 3C24A 1PIWA 2AG5A 2X6TA 4U6SA 9LDTA 2A35A 1B7GO 4IDGA 3KXDA 3DTTA 1CETA 4IMPA 3FWZA 3WYCA 1Y81A 4YWJA 4D0SA 1OC4A 2B5VA 4IM7A 4XKJA 5IDYA 2P91A 3L6EA 3VZSA 3WGQA 3A14A 2X23A 3EMKA 4AJNA 2AEFA 5K6AC 3D4PA 1GEGA 4DC1A 5AXAA 3U9LA 2CMDA 3X2EA 4IMRA 1AE1A 2JCXA 2PFGA 2NU8A 5A5FA 3STHA 5IJZA 1F14A 4NMHA 3AUTA 2SCUA 1SEPA 3H9QA 1PJLA 2YJZA 5JCJA 4FB5A 4IGEA 4K6FA 3GZNA 2X22A 2Y66A 5DZSA 1OOEA 3BIOA 3RC1A 3SC6A 4LMRA 5U9CA 1QORA 4XR9A 2BI8A 2W2LD 4MKXA 1Y9AA 2FWMX 4YJGB 3OJOA 4YQZA 4I1IA 3RQSA 1OI7A 2Q2QA 2PD6A 3WTCA 1M66A 4J2OA 1RM5A 3BMOA 3TRIA 3I9OA 3PJDA 4QECA 3KYCA 1EUCA 4R9SA 4NFSA 3VPGA 1AUPA 2PZKA 3DMYA 3BMQB 3WGZA 3AUUA 5T6BA 1I0ZA 2BGMA 3ZWYA 5A04A 3CKYA 3GMSA 1DLJA 1PEDA 4ZGWA 5IDWA 3WQRA 1N1EA 2WE7A 3WFJA 1GAEO 1QV7A 4TVBA 3IL2A 3KO8A 4GBJA 3CUKA 4MJLA 2GN4A 4MIYA 4A0SA 1E7QA 3JQBA 2EERA 4TZKA 4CQMB 3DZJA 3OF2A 3VH2A 2I99A 2J3IA 3QW2A 4GX2A 4PN3A 1FK8A 3G3EA 3SJUA 3SXPA 5AQ1A 4UVIA 1BXZA 1H2BA 4J1NA 1H9BA 3BZUA 3DO5A 4ZD6A 4QUKA 4DA9A 2CDCA 1D8AA 2NWQA 1PU2A 3CZRA 3DONA 4L76A 2W90A 4E5PA 4RZIA 1D1SA 1HDGO 1ISIA 3SLGA 2R00A 4BKRA 1UP6A 1K3TA 1F0YA 3IS3A 3PGXA 2OFPA 5CG2A 5TJHA 3KEQA 1DXYA 2I5PO 3FR7A 4FGSA 2DBRA 3EYWA 3VH3A 2VTEA 3GZ4A 3B70A 2C29D 3WQQA 2IYOA 1QKIA 1UZLA 1AGNA 1XYGA 4M49A 4PFJA 2V6GA 2EJVA 3C1TA 1BW9B 4YXFA 2ZTUA 1V8BA 4JXKA 3P5SA 1GQQA 4XRGA 2I67A 2AHRA 4EUHA 1HXHA 4J0EA 4YYZA 4FFRA 5KJ6A 4L74A 4TSKA 2CDBA 3SJ7A 3KTDA 4ZQFA 2A92A 4NK5A 2WYVA 1HTBA 4AICA 1KIFA 3FPLA 1JN0A 1P3DA 3VH1A 2UYYA 2EP5A 3GFGA 1HDYA 3GVIA 3AOGA 4A26A 1GPDG 1MV8A 2QZZA 2V7PA 3TWOA 3PJGA 4TRMA 2GUGA 5A9SB 1Y5MA 3U5TA 4F3YA 5FYDA 4R01A 1I33A 1XU7A 3H9GA 3ZNNA 1GQ2A 4HWKA 4D42A 2CVZA 3PDUA 1DO8A 3RC9A 4HKTA 3IMFA 4O5OA 4A10A 2DTDA 3S2FA 2X1HA 1LEHA 3OJLA 4Y67A 1EBFA 2CDAA 4MVJH 3RAJA 3ENNA 4CL8A 1PJSA 4CLDA 1E1NA 4DPLA 3CMCO 2ZTLA 2RAFA 2HK9A 1E3WB 5TX7A 3TSCA 4AJIA 4FFNA 1Q0LA 2HAEA 3PIDA 3G0OA 3ZV3A 5A9RA 1T2AA 3BHIA 2PD3A 5J23A 1FF9A 1HKUA 1FDUA 3D4NA 1E6EA 4PLPA 4XDYA 1DFGA 3ITDA 1R4MA 4CL3A 4BNTA 2VZ9A 2WD8A 1ENOA 1O6ZA 4JX8A 1UXJA 4QFDA 1U1IA 3K8ZA 3ONFA 3QE3A 4CLRA 4BO5A 4IDBA 1X15A 4XYBA 2EGHA 4YPOA 3GG9A 4XGNA 1J0XO 1I3LA 5IDQA 3KBOA 1BSVA 1FDVA 2GGSA 1DHTA 1GPJA 2B5WA 2ZB8A 1T1SA 3DL2A 1ZIDA 3FNHA 3H2SA 4II2A 5TT0A 5C7LO 2WSBA 2CD9A 4DC0A 4EEXA 1LSUA 1UXHA 4IDAA 4RPHA 2CVOA 3RASA 1M2WA 3WBFA 2TMGA 4HFMA 1QLHA 2GN6A 4GVLA 4CMJA 1H5QA 4NNJA 2BF7A 2G76A 4XWYA 3ZWAA 4AG3A 4BO4A 1JWAB 3BTSA 4MKRA 2ZATA 3WGIA 4RORA 5C37A 3HG7A 2NQ8A 2GZ3A 2WJPA 5HS4A 5EERA 4NDNE 2RH4A 4MVJE 3KYCB 2ZJ1A 2O4UX 3INRA 2FSSA 2ILTA 4JJGA 2WYWA 4BNZA 1LDMA 1DOHA 1N7HA 2XOXA 4OL9A 3GK3A 3WNQA 2PNFA 4J4TA 1E7WA 3VPHA 2PLAA 4ESOA 3QWIA 1E1KA 3SEFA 3OH8A 4K26A 4P8RA 2O23A 5ENDA 1A71A 2D5AA 4WOJA 2DBQA 1HDXA 3RJ5A 1E7YA 3ZWNA 2FMUA 2Z95A 2FR0A 1P1KA 4AJLA 4N18A 3G1TA 5IFLA 1RYDA 4DLLA 3ANNA 4XEHA 2P2SA 4O0LA 2HQ1A 4WCFA 2X0NA 3H3JA 2PGDA 4IDFA 2QHXA 4PG5A 3DBHB 5EMHA 5G4KB 5JE8A 2JD0A 2JKVA 1QXSA 3O9ZA 3UCFA 2G82A 4LW8A 4J1SA 2P9CA 4M55A 4CMEA 4YAGA 4MVJM 2EKQA 5FEUA 1NPTO 1JU9A 3I9MA 1WW8A 2ZB4A 4M8SA 4DQUA 2JD2A 1GZ3A 2GRAA 1UR5A 3OQ6A 3V2UA 4RGBA 2A94A 3EY4A 2EXXA 3AU8A 4DQVA 1WMAA 3HDQA 3H3FA 1H2HA 1WXDA 1ZXLA 5F5LA 3I83A 4NIMA 3A9WA 3WX0A 3VTZA 3WSVA 1XGKA 3ST7A 4FC6A 1VI2A 4Y6SA 1CWUA 1KVUA 4UREA 1E3SA 2TMDA 5KNLA 4HFRA 3ZU2A 3AOEA 1YH3A 4G2NA 1NQAO 1PSDA 3JQBC 4RVFA 2X9NA 3WGTA 2P4QA 3F3SA 4ZQBA 2VUSA 4DGSA 1IL0A 5B4TA 3WNVA 1T2EA 3DMTA 1YGYA 4N54A 3ORFA 1YBMA 1ZEJA 3EGOA 3KSDO 1CIVA 1DLIA 5T8KA 4BO2A 2PGJA 3R6DA 2O3RA 4H7PA 5A1TA 1W4ZA 1XLTA 4ZRMA 1I36A 1E1MA 2R00C 1M6WA 4YT2A 4YACA 4N5MA 1JTVA 1B8UA 1O95A 1U5CA 2YW9A 1ZO8A 4NQZA 1V35A 2Q2WA 4YJFA 3GEMA 1HL3A 3RUAA 1A4IA 4E31A 3MTGA 4PLHA 1A4UA 2UV8A 5U4QA 2GSDA 4ALKA 1TVEA 3LF2A 2R2GA 4DYDA 1YQGA 4E5KA 1JQBA 2Y93A 2BFOA 5EINA 4IY1A 3LC7O 4DMMA 3M6IA 3I4FA 2LDBA 4RLSA 2Q1SA 4Z9FA 1B26A 1UDBA 3G1UA 4E21A 2WEKA 1MC5A 4WPGA 1ZK3A 5F1OA 4OKIA 4GLLA 3M2TA 1ZK4A 4NBUA 5DBGA 1PL7A 2CUKA 4INAA 1HEUA 4QQRA 1NFQA 3JQ9C 2E6UX 2PKQP 1V9LA 1U2DA 1K2WA 1ISFA 1CQIA 1JWBB 2X9GA 4PLFA 3NDJA 1KC3A 5I8ZA 3PYMA 4XIJA 3UKOA 3ZV5A 2I65A 4RQTA 3PJEA 5THQA 4AJJA 3NTQA 3KZVA 1VC2A 2Q1TA 3K92A 1Z75A 1DC5A 4KWIA 2XXJA 5BSGA 1EUDA 4FIZA 2VOEA 3OETA 1DHRA 3QJ5A 4Y8VA 2YYYA 5KIAA 3KM0A 3TF5A 4LISA 3DZBA 4JLWA 2Y68A 4DXHA 4UUOA 3UVEA 1LUAA 1YVEI 3EHEA 1KEWA 3WIDA 5T67A 3C7AA 3H7AA 4FFPA 2DBVO 1I32A 3PHGA 4L4SA 3F46A 1JAXA 3LC2O 5IN5A 7ADHA 4JGBA 1YJQA 1QRRA 4P22A 4J4HA 1HWYA 4OYRA 5IXYA 2PKQO 1YBAA 1VL6A 3I3OA 3QA9A 4CLOB 1HETA 3TL2A 1DPGA 3U4DA 3I52A 5L4SA 1TEHA 5JAQA 1N92A 4ROSA 1CQJA 3AI1A 4ZQHA 4W82A 5CG1A 4J7UA 1XHLA 3DQPA 1KVSA 3NT4A 4WCFB 2Q45A 4MP8A 3B1KA 3RU7A 2C2XA 5CP8A 3SBOA 3OMLA 1L1FA 3F6YA 2Y1GA 3FI9A 2PH3A 3ZWVA 3AFNA 4AJ1A 1E3JA 4JP2A 5JC8A 1NFFA 3JTMA 3GMDA 1QG6A 3CSDA 3QQPA 3DOCA 3ZHBA 5JSFA 4IJUA 5ILOA 4S1VA 5DDIP 4KDFA 4CM7A 4CM1A 4OKNA 1YBVA 4PLGA 3F9IA 4W99A 3ZV6A 4MKZA 3OEWA 3OSUA 1CF2O 4L73A 4LSWA 1YL7A 3QWHA 3JQAD 5CEJA 1JVSA 1GTMA 2JL1A 4Q3AA 2DUUA 4ALNA 2BD0A 4CM4A 3S2IA 4XYLA 3OECA 3WWZA 4Z6KA 1KETA 1DIHA 2GN8A 2GR9A 2EJWA 2P4HX 3GEGA 1Z7BA 4AFNA 3VVBA 1WDMA 3H5AA 3AY7A 3ZHXA 3O26A 2YQ5A 1T2CA 1LLQA 5COBA 4RLHA 5ICMA 1NQ5A 3DTYA 4DBZA 1SEVA 3QHAA 4PRKA 4WCFC 2GYYA 3RFVA 3TZKA 4IIUA 2PZLA 4BV9A 1Q7CA 4XQGA 4MVJG 2NQTA 2ZTMA 4CMEC 3W8FA 4FOOA 1PQPA 1QMGA 1I2ZA 3V1UA 1SOWA 3DB2A 4YJFB 4P4LA 1UAYA 2FY8A 5A02A 4MVJD 3ON5A 3KRTA 1SCUA 3I6QA 3QVOA 3PLRA 4BKQA 3OICA 1ENPA 3Q9UA 4ND4A 2DU8A 2V65A 2C7GA 3QLJA 4YT5A 4IQ0A 4Z9XA 3UCEA 5C7IO 1YWGO 3IAHA 3GT0A 4B8ZA 3Q2KA 4YJGA 4GX1A 3PGJA 4LRSB 2OUIA 4FD3A 1LDNA 4FSHA 4IZHA 4JCOA 4QX6A 3JQFA 3AWDA 5FI5A 2YDYA 1LX6A 1UDCA 4MVJP 5K0ZA 7MDHA 3AJRA 1FMCA 2O4CA 3G17A 4FJ0A 2VWPA 3DWFA 3E9NA 1HZZA 4BNHA 3HSKA 1ISGA 4XGKA 5DCYA 3BTUA 2HMSA 1KC1A 3H2ZA 3CMMA 4R5HA 4CMIB 2POQX 2EWMA 3RVDA 1NWCA 3M1LA 4X54A 5T8KC 4CQMA 1YE3A 2V6BA 5A4DA 3KSUA 4BS9A 1Y8RB 1P31A 5COAA 1GUZA 4WOKA 5ES3A 2BHLA 3EC7A 1M6HA 1T24A 3E1KA 2QIOA 1FDSA 1MC4A 3RKRA 1F8GA 1L7DA 4U7WA 3EVNA 4ONEA 1IOLA 3R3SA 2PTGA 3GN2A 1PX0A 4LN1A 2UDPA 3I23A 1G0NA 1S7CA 2P5YA 4K1LA 4OM8A 4WLFA 4B3JA 2YV1A 5DP1A 1PZHA 3DAGA 2JFFA 4JBIA 3JD2A 4PCVA 5L7WA 1DB3A 3W1VA 5TSDA 4CR7A 5JNLA 1JVBA 2QRLA 2D8AA 1HDZA 4FOSA 1P1HA 1HT0A 3ETDA 3PYXA 3V2GA 4P4NA 4IGFA 3PYLA 3MCVA 4FJ1A 2AE2A 3IP3A 4BNLA 3LVFO 3RC2A 5A9SA 4I5EA 3H8VA 2ZKLA 4CQLB 4YRBA 1XWFA 4IUYA 4B8WA 1GDHA 3T7CA 1HYHA 2C59A 2EEZA 1TLTA 5TQVA 4H3VA 3ENKA 3KSZO 3MWDB 4Q3BA 5JO0A 1U28A 2OP1A 3MZ0A 3ADPA 2B83A 5KVQA 1YQXA 3WTBA 4ZN6A 3RD5A 2W2LA 1IYZA 4B7UA 1LJ8A 1N1GA 5L7TA 1NQOA 3MJSA 4E5YA 3L4BC 1U3VA 1P45A 1ZSVA 3E9QA 3L4SO 2W8ZA 3ASVA 1ZK2A 1PZFA 1UJMA 3F4BA 1ML3A 5L4NA 2ZJ0A 5HA5A 1X13A 2VRBA 3ZNOA 3H9EO 3OIGA 4PG4A 3CEAA 1Q0QA 1DRWA 1WVGA 1X7DA 2VUUA 3GQVA 2Z1NA 3TL3A 2IODA 4ID9A 2ZB7A 5AXBA 5B12A 1ADCA 3W8EA 3E03A 4PLTA 2RIRA 3I9NA 4DRYA 1PR9A 2BKAA 3GH3A 2QYSA 4UEOA 1TT5B 5IZ4A 1EVZA 5AXDA 2BGLA 2AA3A 2O3UA 3HJAA 3IJPA 3VPSA 4B7CA 1ADBA 4BB5A 1D1TA 3NKLA 1E3IA 2ZQYA 4GWGA 2GLXA 4BQPA 1PWZA 1PZGA 3GEDA 4XYMA 3WS7A 4J90A 2AXQA 5DBFA 1I5RA 4UULA 4J9UE 1VJTA 3U62A 5CDUA 5L40A 2GZ1A 2B4QA 3V5NA 1LC3A 4RQUA 1SBYA 5A9TA 2GZ2A 3I5MA 4RPLA 3SC4A 9LDBA 2JJYA 1QSGA 1C14A 5ILGA 2Y0EA 4RJTA 3VAZA 3HNPA 3MEQA 4JJIA 1YB4A 4WASA 1EFKA 3K2EA 5A3JA 3BXXA 3FCOA 1JA9A 4BNMA 4D45A 5CEFA 1TB4A 1U9JA 4KUHA 1A5ZA 4IXTA 4NJMB 4WEOA 1RWBA 4A7PA 4DQXA 4CM9D 3SVTA 4TKLA 1NTOA 3UUWA 1IHXA 4ND1A 1DFIA 2NVUA 2ZTVA 1ORRA 5TNXA 3PRJA 5T5QA 2IDZA 2D59A 2C5AA 5G4KA 4LMPA 4DPMA 3WSWA 3DBHA 3CH6A 1IPFA 3HFGA 1EDZA 5JYDA 5ER6A 4KMSA 1I2BA 4O6VA 2CFCA 4Z0TA 1R6DA 1Z74A 1YRLA 2VYVD 3E18A 3LU1A 1ZK1A 3BTOA 3L07A 4L75A 4XD2A 1HDRA 4BNWA 5L53A 5TJ9A 3QVXA 2FSVA 3RUEA 5GZ1A 2XAAA 3KUXA 2QRKA 3JQFC 5K9ZA 2B36A 4ZQGA 4UEJA 2ET6A 3W6ZA 3FPCA 1JDJA 2CNBA 1NAHA 1Q0HA 3LZ6A 4IBOA 1NVGA 4NFYA 2FZWA 3K30A 5DP2A 1UAGA 4GH5A 4MINA 2D3TA 3FTNA 1Q1NA 3OFSA 4I9UA 4BNNA 1NXQA 5DF1A 1H6DA 1LQUA 2O7QA 1HE3A 3HDJA 2O2YA 4JROA 2Y99A 1E7SA 4RCVA 1I3MA 3GUCA 4NBRA 4BGEA 2Y1DA 1KEVA 4KUEA 3JQ9A 4E2WA 5KOIA 3T4EA 1VJ0A 3RIHA 1HE4A 3QVSA 3P19A 3PQEA 5JY1A 4J7CA 1BDMA 4DYVA 2PZJA 4GVXA 5CDYA 3H5RA 1BVRA 5G0WA 5I8WA 1RM0A 2DPHA 5CDSA 2Y0CA 3LYLA 5EPOA 4CM3A 3Q11A 3WIEA 3NJ8A 2YV2A 3W6UA 1NVTA 1TT7A 1B14A 4U5QA 1XSEA 4XJSA 1XG5A 2FZEA 4BGVA 3Q3CA 5EIOA 5I7FA 1SB9A 2DC1A 1PS0A 4E30A 1AXGA 1GZ4A 4Q3NA 3K9QO 5JMWA 2FR1A 2Q46A 1LI4A 1EBUA 1E92A 4G65A 4GLOA 1C0PA 3HFSA 3PEFA 5DOVA 1J49A 3U49A 4FW8A 3EZYA 3PHIA 2VQ3A 3L9WA 1E5LA 3P2OA 3WJ7A 1VM6A 2D1YA 1P1RA 3OJ0A 3WQSB 4ZHSA 2JFHA 2F1KA 3KYBA 5HM8A 5BNIA 5KJFA 3IIEA 4TWRA 1HYEA 1DC4A 2ZCVA 3DZKA 4RL6A 4U8GA 1Y1PA 4YRDA 1T2FA 1ZFNA 4RVSA 3K2BA 3UF0A 3MWEB 3GPIA 1KBZA 1D7OA 4Q9NA 4MOWA 3FRJA 4DBVO 1I01A 1BXKA 4CMHA 3QRWA 3ZWOA 1VSUA 4CV2A 2NM0A 3O8QA 4M54A 1VRWA 2VRCD 2JCYA 2J6IA 1NNUA 2EW8A 2QYTA 1E7MA 1LSJA 2IE0A 4R1NA 4TQGA 2NVWA 4RO0A 2OBNA 1PJCA 2WD7A 4B4OA 4YR9A 4RDHA 5ITVA 3UXYA 4IDCA 1HF3A 3GG2A 4YDRA 3HN2A 4IIVA 4BMVA 4NHEA 3TN7A 4OQZA 4KWHA 3ZH2A 2G5CA 1LQTA 4QSMA 3NT5A 2O50A 1GEEA 3OIDA 1ARZA 3INGA 3GVPA 5JY6A 2CSUA 4FQ8A 4CMCA 2OBYA 4XCVA 1B0AA 1A9YA 2ZCUA 3UAGA 1R4NA 1HDOA 4MO2A 3U3XA 3VH4A 1LRJA 1GR0A 3KETA 2VWGA 3TFQA 3HZZA 1YQDA 1GUYA 3GRPA 1LC0A 4NG5A 4YB8A 5KTKA 3WXBA 2VWHA 2J5RA 4E4YA 1CERA 4KUGA 2BLLA 1K0UA 3G49A 4BNIA 4CLOA 1O5IA 4GGOA 1EQ2A 3RUIA 3OM9A 4J43A 4R9RA 3I9LA 3PWKA 4WLUA 1G0OA 4XX0A 1DIAA 3I4CA 4EBFA 2NVUB 4ALJA 5IZCA 3GY0A 1LRLA 1ISMA 2RBEA 1H6AA 4GKBA 5TRTA 5ITWA 1H0KA 1T1RA 4Z3DA 1V3UA 1ZVMA 4R68A 1UP4A 4YEDA 1GL3A
chains in the Genus database with same CATH superfamily
1BFUA 2H63A 5JNRA 2E4AA 4HY3A 4M36A 1DC3A 3VU1A 3VSEA 2JBAA 3PIIA 1GL6A 2AG1A 5H1YA 5BW4A 3MN1A 4GEGA 1GIAA 4FDAA 4IINA 1L5HA 5CVJA 1IHDA 3TQQA 4RAQA 2HMUA 3VO8A 1EVEA 3OEHD 4LOIA 1TKBA 3P71T 3PRYA 1YL5A 4GZMA 1I94B 2ZIGA 4OQYA 5GZ3A 2PXCA 5DNYB 2VDJA 3HBFA 4FS3A 3SIPA 4K6CA 4YAUA 2VJCA 1MEOA 2IEBA 1E2MA 4FMBB 1C1YA 5EMKA 4CMAA 2BBTA 1DTEA 1QO0D 3U4GA 2ZJFA 3KOMA 2VYND 4BNFA 4LTNA 5D3ZA 1EQAA 2V7QA 3MAJA 2HADA 4YMTA 4WESA 3PPVA 2AQIA 4JGIA 3EE6A 5K51A 3TGWA 1Z25A 4Q7EA 3FPFA 3K4HA 1AKMA 3OU6A 2FWJA 4B40A 3JPYA 1V1RB 3DFUA 1M8KA 2XOEA 2XF2A 3TEJA 4EECA 5C18A 3N5KA 4JQOA 3PU6A 5H4HA 5BXYA 2CZQA 2HA3A 1IY9A 4WN9A 2N46A 3SOZA 1R6VA 1GQFA 1X6VA 3F73A 2BSQA 4R7GA 1Z4NA 1GV0A 2X5OA 5L95A 1IOZA 3WYBA 2EFDB 3EODA 1XKQA 2JK1A 2MSWA 2Q6KA 3AT1A 2EZTA 3LQFA 3TPZA 1CE8B 5SYNA 4LDQA 3PTLA 4AY6A 1F6DA 4B74A 1PD1A 3OA0A 1MGOA 3SEAA 3AETA 2I76A 4G8CA 4CPDA 4Y9RA 2VA8A 3A6LA 3IXMA 2E6KA 1PN3A 5K3BA 5JAHA 1ZW1A 1AV7A 4WZBA 1D1QA 1KEPA 1JHVA 1JT9A 2OZVA 3NYIA 4FONA 3E4DA 4P35A 4PGMA 4Q37A 3ZU4A 1NLUA 2O2HA 2ZWVA 3GUHA 4GPZA 4MUJA 4NCKA 5IC6A 3TXXA 4CG2A 2QZ4A 5I7WA 5CNIA 4W8OA 2DUMA 3WL6A 5H9WA 4CTKA 4BDSA 3D6FA 1HDIA 3D59A 2WJ4A 3ABIA 4L2IB 4TWAA 1NUQA 3QJGA 1NBEA 2QTMA 1OGIA 3FFWA 4LNHA 3A06A 2Z3ZA 4OAOA 1UXKA 2PR7A 3LK7A 1PJ8A 3IDFA 3N6XA 4R2XA 5IEBA 3WMWA 2LCQA 1IK6A 1JYEA 2C9YA 4XIYA 1PR6A 1WZIA 1YFKA 2C92A 3WB2A 1L5QA 3SX2A 1L7NA 2DFDA 4FCWA 4M76B 1ZJZA 3NBYC 1FXUA 3HLKA 2QN3A 2VXYA 2YQZA 3GJRA 2RGBA 1VSTA 3HABA 5DHSA 2J0SA 2W22A 5KREA 5FB3A 2GM9A 1SCDA 2JKYA 2QT1A 2ZK7A 3T9DA 3RYHA 5B1EA 4L95C 3WDSA 2PBLA 1KPHA 1OU4A 3O8QB 3PZRA 2QVYX 5HFJA 3FF4A 4V2IA 4GE3A 5LXTA 4UM9B 3K16A 5SV2A 2AS0A 3O93A 4WY5A 3O8NA 2WD7B 4MAAA 4Q18A 3HDYA 2FRXA 2C04A 2ZSFA 5IX8A 2E5FA 1RYEA 1MZVA 1OASA 5BW5A 2HXSA 3TGLA 1EFHA 3TIVA 4R05A 1R0RE 2VWQA 1E9BA 3HQ4O 3E9YA 5L3QA 2YS7A 2GMWA 2Z1MA 4IJMA 1M2VA 2VDKB 5AUPB 2QTNA 1PQ4A 5U4XA 3SC3A 5IBQA 4MPRA 3T5CA 3JR7A 2IPAB 5IJXA 1RAFA 5GZ6A 4C7BA 2X5KO 1N6LA 2QD5A 1LXCA 3MG9A 5H3HA 1YVRA 3DFIA 3OZCA 4A8HA 4BFTA 5BNZA 1S2NA 1D04A 1P1JA 5AR1A 4ZVQA 2XRZA 5EE0A 5AVXA 4N49A 4B3BA 4JEMA 1YZKA 3V7NA 3HADA 4RJJA 1L4NA 1PL6A 1VCHA 1O6BA 4TL8A 4OLBA 1I30A 2FOIA 3L01A 4MP6A 1OXVA 4Q7MB 5T7BA 1PFUA 5DEOA 4LJKA 3QEJA 4QOGA 821PA 3MM4A 3GLVA 4XQ9A 3VHRA 2CLEB 2GN2A 3O91A 4YCNA 1FNCA 4NX2A 5FT9A 3E8SA 1SA0A 2PL9A 2A0FA 1A7UA 1P39A 3AB8A 3VZQA 3ASYA 5EWLB 2Q8QA 4YFVA 2CY0A 1GSIA 4H7FA 1EJ0A 1X1CA 1HL7A 2FMHA 2LE0A 2XUHA 4OX9B 5K3EA 4BQOA 1R4ZA 3D7RA 5LBIA 3DZ8A 4GBMA 3C3KA 2PUAA 1EK5A 5A4MS 3PXCX 5IYZF 4M1QA 4DJDC 2HGZA 1LB1B 2CUNA 2VPZA 2FSIA 4HXYA 3W8RA 3HXOA 3IESA 4GOKA 4WHMA 1NPDA 5CFPA 2GQ0A 4NU6A 5DM4A 3N05A 3FG9A 1U0SY 4I9NA 3TQHA 3FNGA 1ZQ9A 3L7OA 4CL0A 2IX9A 3B1ZA 1PE0A 4JLBA 4WIAA 3TBFA 4EB0A 2NYVA 3HV2A 1YVUA 5JD4A 3TNFA 2RGAA 1Q11A 1ZNZA 3RRBA 4OQLA 4J91A 4P32A 3OLXA 4X24A 1RHQA 3BFPA 5DVZA 5HILA 4KREA 2O8EB 1BE6A 1W0JD 2VQSA 2FHPA 2JFPA 2VDPB 1QIJA 1VKZA 3ISTA 2O57A 3HDHA 1WDKA 4ZI5A 5ED4A 2JLXA 1TA9A 1CLEA 5HKBA 2CV0A 5THKA 5AW3A 1UXGA 5F98A 3STYA 3L5KA 2FFRA 1H2RS 3AESA 4HN4B 4OQQA 3IGFA 3W78A 3W8DA 4CKYA 3II6X 4G1BA 3AF3A 3J7AC 1QQTA 1RAGA 3CONA 1GITA 1TTHA 3L77A 3DV0B 4QO7A 4WK4B 2H8KA 1XZAA 1U81A 2YWDA 3BSYA 3DZHA 4C03A 2QN1A 3BQ9A 3GHYA 3OEYA 1F51E 4RA6B 4OJNA 3WYEA 4BNYA 1V8DA 1WXFA 4BXOB 3RC8A 1KXZA 3KXIA 3MT9A 1ORIA 4ZT5A 1KERA 3DZFA 3S28A 1ZOPA 1UJ2A 4BX2A 4YRPA 5AM1A 2BE7A 4S05A 5CEEA 3U7IA 4KPYA 1XDBA 1MB4A 1TFRA 3CZ4A 1O8CA 1DCFA 3KKQA 2Z5LA 5D7NA 4QRDA 3D7LA 4C76A 5HKKA 4CZ2A 3HSSA 1ZR2A 4JBHA 4MS3A 4UUMA 1VL1A 4UUQA 1HY3A 1S3SA 2FZKA 3I53A 3K05A 4UE2A 4F9GA 4EO9A 4G5XA 3S4YA 4EUFA 2QNBA 4FPXA 4I1UA 1GGHA 4JELA 1W4LA 1XD2B 3ONDA 4OJYA 4CMBA 4KYUA 2XNDA 5EMNA 3WLJA 3NJ4A 4N0EA 2HIMA 3SNHA 5G3ZA 5B7QA 3DLHA 2ZSKA 3CE6A 1QOZA 4HJRA 4MW5A 2EJUA 1NYRA 4KDCA 2NU6B 2PUCA 4PM4A 4UM5A 5IWAB 2IDMA 2ZRDA 1ECCA 4LA4A 4BWVA 3B7GA 3E9MA 3EXHC 4B4VA 1M6NA 4B3FX 3A1FA 4L22A 2WIKA 4I08A 1IN8A 2XCIA 4MKHA 2P69A 4WKBA 4E2FA 1WXEA 1E1QA 5C4GB 1FU8A 4QTYA 4ZVTA 1FL9A 3R44A 2H3EA 1R5BA 4G5HA 1YKGA 4OYYA 2UZ3A 4X3PA 4UU7A 4QGGA 3V4ZA 1T3HA 3UHAA 3D6NB 4TUYB 1PI3A 4EA8A 4CUKA 2EARA 4YALA 4A2CA 2P1ZA 3DZGA 2G6TA 4YLGA 1UINA 4I8XA 1CRZA 4ZANA 4ZVUA 3W2EA 1MB9A 4B4UA 3BD9A 4FEAA 4UAGA 4TV9B 4M21A 1W8DA 3AKEA 2QLBA 4OHXA 3ADBA 1EFDN 4K9DA 1Z82A 1JLMA 1SPBS 5DN9A 1F1JA 2VDRB 3PGLA 3WAGA 2NSJA 4EHDA 4HDRB 3QEBZ 3K0BA 3TRJA 1C1XB 2NO7A 1TX4B 2IOFK 2BT4A 3GFTA 4OXYA 4RV9A 5CLLA 1UBOS 4U6QA 1H6CA 4DLNA 3M6WA 4JXZA 4A8JB 2C5HA 2P9QA 3SPXA 2LNDA 4ZYVA 3ROMA 3FPGA 2B78A 2AVDA 1P0MA 5BR7A 4ISCA 4QGBA 1TA4A 1SUSA 2R7MA 3S68A 3S81A 1LDYA 1EAMA 4BNKA 4RPJA 4KJXA 2AV6A 4ZEVA 2PRSA 2BAGA 3JQAB 2XXAA 1VJ1A 2QVXX 5KYXA 4PZCA 1PZEA 4HTFA 1L9XA 2BFWA 4KAFA 3ZHVA 1BX0A 3G0BA 5A06A 4HEA6 5J5CA 3U3OA 2I4TA 2ODPA 4XQCA 1TIBA 3GPDG 3HCFA 2AEMA 5I7AA 1O77A 3T1QA 5BN1A 4LF7B 1AN9A 4YP7A 4DB4A 1A96A 4MWBA 4H1TA 1X92A 1ZMRA 2BUCA 3RLIA 4EUNA 5CBKA 4KAJA 3CKMA 3PGKA 3NZEA 3NVDA 2ADFA 4OSPA 3NC0C 5FV7A 5L51A 4OO3A 3WO1A 3GQBB 4TQAA 1ISPA 4X94A 1XYVA 4OFBA 3HS3A 4ZJYA 2MOKA 4LZJA 1ESCA 2O3SA 1VKNA 3VJLA 3IAEA 1WM1A 5CNJA 5DI3A 1QIEA 1DAHA 3IR7A 5DFAA 4W8HA 4DBLE 1G8MA 4HQ6A 2I7XA 2IUSA 2M1XA 3HE3A 4P7BA 4EJSA 1AS2A 1N5MA 1C4KA 1NR1A 2NXWA 3FZNA 3H9JA 3N0RA 2QBYB 1N6NA 2ZYDA 5DMXA 3C16C 2VK2A 1YDEA 5PNTA 4BMPB 1OY1A 2MMGA 2YFQA 3ROGA 1NXXA 4BUCA 3ISVA 2OQRA 4PBTA 1N3YA 2FKAA 2Z9CA 2PX2A 5C1PA 1X14A 1S4MA 2HRZA 4B5KA 3ZBPA 4BQRA 4DLPA 1JG6A 2E37A 4G0VA 4D98A 2FPGB 2QWXA 1XK7A 3DWIA 5DULA 2J41A 2XMBA 1JLLA 3AONB 3KU4A 4ZA2A 4KWCA 3ZWCA 3A9SA 1Y7IA 5K3OA 4BOYA 3B20A 3AVWA 4QFCA 1AGRA 2VIIA 1BXGA 3WA7A 3ESXA 2ZUSA 4A5SA 5IABA 3B1VA 4RULA 3ZLUA 2XZLA 2V4ZA 1KI9A 2B1QA 3TLMA 2J3JA 3BZBA 3EVCA 1DTWB 2Y1EA 3INYA 4KZKA 4V0LA 3RUPA 3SXUA 1IQ0A 5E6RB 2MINB 2YICA 1B74A 3GC6A 1SQSA 4AMVA 5FWNA 4HRVA 1R0ZA 1KORA 1V95A 4LJAA 4O2BF 4PEVA 4V2UA 2BEVA 1N5LA 1JKIA 2IEGA 2YVUA 1KJIA 3HP4A 5LDGA 4CTMA 2JFQA 3PWZA 1UWCA 2RAPA 1OBFO 3BH6A 1YBHA 3ZBQA 2CXPA 3NHBA 4YX9A 1T2DA 1IVYA 2ZUFA 2A67A 3UCXA 3BB3A 2QOEA 3OOWA 3M9WA 2QZJA 1XTJA 3WL8A 2C07A 2HXGA 1OZGA 3UAWA 1XVAA 1G2QA 3ECAA 4D3DA 1U7HA 1UFOA 2QQEA 2XJ4A 5KAMA 4LVUA 4IUBS 1BMFD 4ZPJA 1ZJ6A 2D06A 2NADA 3DHWC 4KX3A 4EPRA 5JCZA 1OAKA 4AS1A 1YI0A 3E6AA 2Y1KA 2QPAA 4P80A 1MB3A 1QHXA 3KWJA 1SCJA 2HRQA 3OE5A 4FQ7A 1MB2A 1QJ4A 5SY6A 3FTEA 3KT0A 1MABA 1U7ZA 3C4QA 3FYTA 2X2EA 2ES4A 4KOAA 5ALXA 1AS0A 5IEJA 2AN4A 3UMJA 3D3KA 3DVSX 4FGKA 3LIPA 1CZUA 4FGWA 3ZKAA 1BVHA 4YA6A 1CUBA 1U8CB 4LRWA 3PIRA 2K7ZA 2AQKA 1QH1B 2EZ8A 1R6AA 4PFKA 5FTKA 3OQIB 3QELB 4Y6GB 2AI2A 4N65A 4CM8A 3EMVA 3U40A 3EOAI 2ALJA 4TL6A 8LDHA 3UGJA 4PYKA 2WUFA 3CR7A 5TEVA 1B6GA 2GEKA 3HUFA 4HUQB 1A5SB 3LPMA 4UBNA 2FPPB 5F1PA 4IQ8A 3W2IA 2QLNA 4C4YA 5BMOA 2II6A 2Z98A 4HG2A 5F7ZA 3BF8A 2GNAA 1IDN1 1O5OA 5C31A 1HDCA 1XIVA 4C89A 1VECA 3IHTA 5LYJB 4NXMB 1SPXA 1F06A 4KXWA 2HLHA 3VNAA 4AF7A 4AULA 3WJ2A 2G72A 2Q0SA 3KX2A 3NM4A 3FUWA 4FZ3A 1T4DA 4BCBA 5HBGA 1AF7A 1DWQA 5JJIA 2RHTA 4FYVA 4X6YA 5FJJA 4CGZA 3PA6A 2WPDD 1P3JA 3C45A 3GT7A 3T4UA 1F8YA 5LIRA 2A9OA 4FE4A 4DV7B 1QUFA 4GM0A 1MXFA 4BQEA 1ZGHA 3WLLA 5JADA 5DU2A 4Y9UA 3MSCA 2GF9A 4M22A 2ZUTA 1HE8B 1CUGA 3LUCA 4LOAA 1ECBA 1U6JA 2AKEA 4NU8X 2GRJA 1Q44A 1KO4A 2X4LA 3IR5A 1FXWF 3EMDA 3QXHA 4ZU6X 4R16A 2C82A 4Y98A 1LPSA 4WXYB 1DAFA 1P4HA 5I7SA 4J49A 2GBFA 2FZGA 2C0QA 1CJKC 5IBRA 2FPRA 2HQBA 2OCXA 2I2WA 1TJ4A 4MRMA 3BL6A 4B4KA 4BO3A 6CHYA 3QBDA 1L5MA 4HX5A 4MI1A 4F4HA 2F67A 4TGLA 2R6JA 5DNDA 4OK6A 4Y18A 4HAOA 1Q83A 2Z9DA 2F1IA 1NUPA 3LC1O 3NFYA 1QC5B 2Y67A 2YOFA 4QOSA 3KT8A 4NDAA 1ORVA 2NZYA 1V1RA 3V4SA 5CITA 5KSWB 2FCAA 1GU1A 3K9NA 1GAJA 3W6PA 3QIAA 4DVJA 5I48A 1NAIA 2XUJA 4UPEA 2QYHA 4G3XA 3ENWA 1X86B 2QY9A 1WUIS 5L6LB 4KQEA 2X6RA 1XO1A 2C9BA 3H4VA 3SHOA 1R0XA 2FQQA 2QTLA 3VYRB 4O4JF 1E61A 3KC2A 2J3LA 4PGGA 2V7BA 2YMPA 3IR6A 5I9MA 3R7AA 3U7JA 2ID4A 1CE8A 4ZIRB 1YS4A 1ODLA 2EKLA 3OT4A 4E7PA 3DE6X 3WISA 1AK9A 1DQSA 1UOPA 4Z51A 1Z4PX 1JRLA 1QIIA 2FSGA 2J07A 3ZW8A 3B53X 1LK5A 1R10A 1DKRA 2VNJA 3COSA 4RHCA 2YHBA 1KAGA 3KEOA 3LNCA 2OL4A 3UMGA 1EE2A 1KYQA 2JLSA 4INPA 3KOYA 3L8DA 2D2FA 2CN1A 3FOCA 4HPWA 5TVGA 3TZQA 1QAMA 4ENUA 1G2OA 1NJFA 1GGEA 5KYYA 3G1WA 1J1UA 1U8XX 3BWMA 4MCAA 3NGLA 2AF4C 2P0YA 3FB4A 3IRUA 1U8ZA 1WXWA 2IW1A 3BIFA 3BCRA 3PD1A 3WL5A 1F8UA 4PXSA 4ZQCB 1KWGA 1E6KA 1CUUA 4AZ0A 2JH9A 1FP1D 1YB5A 1TRHA 5KTNA 1AQNA 1OI3A 2W6OA 3TO5A 3TZ6A 1PFVA 3IOYA 1WHSB 1EHYA 3GDGA 1TGVA 1A9XB 2N1MA 2WU0A 3K8QA 4TTAA 4TKZA 4C0KA 4Y9DA 5EMMA 1ZWLA 1J22A 4NCIA 1G19A 4ZTZB 4LXXA 5HBRA 3TEMA 1SC3A 1GCUA 5AVOA 3L6DA 4AJ2A 1QX3A 1UBRS 3IUPA 1CW2B 4KQCA 4LXTA 4P86A 3ZWPA 4C05A 3BXFA 3SU8A 4EJSC 2NSYA 3ER8A 2D1FA 2C3YA 5BWBA 5AI6A 1S6YA 3O1IC 5D3KA 4BLPA 3RAEC 1T4BA 1ISSA 5IT4A 3IP7A 2J3DA 2VDLB 4ARZB 1O58A 2CUZA 4G9EA 1FX0A 1DUSA 3KT6A 2OD9A 2VEDA 3U4IA 1M7GA 1YKFA 4LYJA 3M81A 4HR7A 3P9SA 4LPKA 3NIGB 1L4FA 1S9DA 5ADWA 1QYDA 3KFXA 3RARA 3CN7A 3MCUA 4CN9A 1HE2A 3SOPA 1ACJA 3AKZA 1RMQA 4IO0A 2ZOSA 3FDIA 2QMQA 3RGWS 3EG9B 4GEKA 3ZN2A 4G2TA 2GZSA 2C42A 3R6WA 1BA2A 2HEGA 3HJGA 2I2BA 3PFWO 3T41A 2NU8B 3LT2A 1IWPB 1C0LA 4DLBA 1AMUA 3PQ2A 1U3WA 3F3KA 3W34A 5B64A 3VSDA 2ORVA 5FA5A 4H1VA 3OSZA 1VKHA 3G5UA 3KZKA 4EK9A 1T6NA 3E7DA 3E7XA 3OEEA 4JHLA 4EFNA 4IYJA 1P9NA 3LBIA 4OXIA 5FF9A 2UXBB 1W0KD 5H9VA 3LXUX 1ANKA 1I3CA 1X3SA 2XA1A 2AC2A 3BXPA 3OCXA 3O84A 4YK7A 4MWEA 5FOTA 5FP0A 4CE6A 3A36A 1SMKA 1F17A 1Y1RA 4RVDA 3JSAA 2IXFA 1DBVO 3CFYA 1EUCB 3RJ9A 4O3MA 3WBBA 1UBEA 3DT9A 3EEBA 2I3ZA 3VDXA 5KVSA 5KTRA 1J2YA 1XU9A 3IP5A 3LQ4A 5BR4A 5EE3A 1GKYA 2GZDA 4TV8A 4NULA 5DNEA 1RVV1 3RVQA 5KCZA 2GKOA 4UZFA 3FHLA 4FMCB 2ECFA 4CBVA 1R12A 1WSDA 2YY7A 4RY0A 3KR2A 4FJ2A 2C4WA 1NY5A 1A98A 1PVVA 3R7BA 1SKMA 4FNAA 1OZAA 5KYUA 1N2EA 2JIZD 4NEQA 4UFOA 3HVHA 1PJRA 3EVEA 2Q9AA 1RXCA 4Y2TA 2ISSD 5HUQA 2QTZA 4U7HA 4PGFA 3GV0A 3M5PA 4HZUB 1P7CA 2BZSA 3MVEA 4XYGA 4NSNA 3ZD8A 3RYCA 1JR6A 4G67A 3T9CA 2Q49A 2QJTA 1SQGA 2W4QA 1G9TA 1ETUA 3LXMA 3O47A 1CY2A 1GGMA 2GDJA 4YAKA 3MPUA 4DSOA 4MITA 3ZWBA 3DT8A 1MC8A 2HNAA 2P1DA 4IHJA 1DJMA 3A6KA 2NZWA 2J0QA 2YXLA 3QEAZ 2D5IA 4AT1A 2UYGA 2A5JA 2Q62A 4B09A 2Y4OA 4AKEA 4WSOA 3L1UA 3MWLA 4GQIA 1A1VA 1Z47A 2ZSHA 5DGXA 1CUXA 4LJ5A 5KCMA 3CQ9A 3A3YA 4KXXA 5KAPA 2P90A 3V1TC 4R1TA 5FWDA 5KDLA 2RGYA 3DFZA 1KMCA 1EPUA 2VR1A 4JUFA 3ZWXA 4DMGA 4TKUB 2CT8A 3JAWA 4YJHA 3THXB 2RKWA 3DSRA 4GR5A 1RYZA 2J6CA 3NEJA 2ZW9A 3EB9A 2PWYA 4XIFA 2IL1A 3U4CA 4MW7A 4PLCA 2J6BA 1X38A 3ODPA 1K6JA 1S4QA 4BE4A 4D7AA 4DDKA 5CRIA 3V2IA 1GQSA 4HLCA 1SZJG 4ZVOA 4RAOA 3KSAC 4ZHQB 4W5QA 1TADA 1IY8A 1THZA 3DTVB 3HJBA 1Y5RA 3W7AA 4QTTB 5LJLA 2VRNA 2IYEA 1SKYB 3DFKA 3HR4A 3GJ6A 4LAFA 4URFA 5DSTA 2FMFA 5FCDA 3JYPA 1U3UA 4F72A 4XGIA 4BO9A 5K20A 1ZD9A 5CFZA 1OYOA 2H11A 3S29A 5C8YA 4GXQA 4EGFA 5AW9A 3LY7A 1J2EA 1W25A 2BP7B 1COWA 3W5IA 1XPRA 1B16A 2Y05A 13PKA 3U4QB 3DNFA 1ORWA 1VE3A 1E8DA 3C8MA 2C7RA 3OE7D 3SYKA 4HGZA 5DNAA 1TYBE 3C8HA 4RANA 1JDVA 3HCEA 4IEFB 4KVAA 3WB9A 4LBYA 4JI7B 1YQQA 3ZCUA 1XA0A 1E20A 3SSNA 3FCCA 1QGOA 3GUUA 1YZTA 3D3EA 3Q88A 3NBKA 3LO8A 1XQ9A 2GARA 3FBTA 3PVSA 1NXPA 3KAQA 4KJZA 4OBXA 3P0FA 3TNLA 1YNOA 5ALHA 2R79A 3W7VA 1E66A 3HR8A 1BX3A 1ZJJA 1W4BA 3ZI7A 4K88A 4H6VA 4WNAA 3AHGA 3PPXA 5AM3A 4CV1A 2QKYA 2JI7A 1TAHA 2ZYSA 4QXRA 1U9ZA 3AM3A 1UP7A 1RC1A 1Y8QA 4RJ2A 4B45A 1CCWA 1LSOA 5I4CA 5FNVF 2I4OA 5B1HA 4RHEA 4EVSA 4TV9A 2Q2VA 1QLJA 2ODQA 2CHQA 1K8ZB 2G5PA 2HB6A 1VP9A 4WECA 3VOAA 5GVSA 3Q9NA 2OZKA 1XI2A 2E1PA 3VPXA 2BH2A 3DXXA 3I2FA 5IPFA 4HDRA 1M2EA 5EG5A 3GNTA 5B7NA 1G6KA 4MVJI 1EIZA 3JV7A 3PHJA 2IU3A 4G1MB 1OAAA 3HVKA 4GAEA 4QVGA 4A8JA 1WO8A 4HNRA 4IX9A 4HTAA 2RHGB 2VQFB 4AMYA 1JBEA 1KH1A 1VSVA 3OOHA 4I9FA 4IW3B 1C9MA 4PRLA 2Q3DA 4BTVA 4KKXB 4YP6A 2JJ1D 4KZPA 5JMTA 1CNMA 4Q47A 3N76A 3WIOA 4RVUA 4D4IA 1PJ2A 2FW0A 3PQ5A 5BSMA 1QYWA 3R76A 2XSZA 1KEUA 1TQ8A 1X77A 5H70A 1P62B 4QU8A 4D79A 3BH7A 2DTEA 1ATIA 5CAEB 3FPSA 5EQFA 3GW8A 4GOOD 4JP1A 2FEWB 2CZGA 2X4IA 4M6WB 3FAZA 5LP1A 2WNSA 2DTXA 2DSTA 1I6WA 1KDPA 1M7BA 3AUXA 4NBTA 4TYWA 1B43A 3KJIA 3AF0A 3NGMA 4RZHA 2G4VA 2B92A 2YYSA 4X64B 4ARCA 4WXRA 2E4YA 4G5FA 1E5VA 3GQBA 4I4CA 4KR0A 3YASA 2D54A 1JI3A 2Y71A 3BGDA 5ER9A 1USIA 2A9RA 1WW2A 4DA4A 4N4AA 4Q01A 1YZGA 1Z2CA 3MRXA 4DJTA 2PQ2A 4E09A 4MLCA 1XXLA 4JZKA 4EMTA 2C4HA 3W5SA 1PJ4A 5EE5B 3PC8A 3RRMA 1FSFA 4NR0A 1K88A 2R8EA 1DKPA 1K5GA 4PVDA 3T38A 1ZLXA 5J63A 1A76A 2G88A 3GLIE 1ZD2P 2QBYA 3U09A 2QGZA 3THRA 3RBAA 3JD0A 4INZA 4JQSA 4BEWA 4PO3X 4AY5A 2BM9A 5GJVC 1QU2A 2ZT8A 2IOQA 5BW6B 1FYDA 2XAUA 3EZNA 2QTTA 3HKDB 5BUSA 3KQTA 2AN9A 4A73A 2CJYA 3QY9A 1T4GA 2GZHA 4IS3A 2X9LA 1KJZA 4QWWA 3RSLA 1EA5A 2V1XA 2OQVA 4RK6A 4CKBB 4OA5A 1KSFX 3JWPA 3WLAA 1P0FA 3DOFA 4IG4A 5IUJC 3E5MA 4XIIA 4W7HA 1FJHA 2I0FA 2ZSDA 1MEEA 2HK7A 3EC1A 4HS9A 5EYPB 2ZZNA 1MV5A 2B0JA 1VPEA 2I4MA 4HV4A 1T9GR 3KFLA 3DE0X 3OFVA 1AHHA 5TQJA 3TW4A 2QTWB 3VBCA 3M82A 1ENZA 1M1ZA 2XGGA 4GKVA 4QHYA 4BDTA 2PH7A 3K35A 3ROKA 4BO1A 2MINA 1AO0A 2A5GA 4FR2A 4PLYA 4WCDA 3PJFA 3UMVA 3RBXA 1KZ9A 4AC9A 3OQ1A 1E2BA 2AEEA 4IUCS 2X5XA 1SHJA 4O3FA 1SIUA 1TKCA 2YASA 3AWIA 4XOIA 5K8TA 4DG9A 3HYCA 1SUBA 5MN4A 3N0TA 3W4JA 1XLUA 4C0BA 2XVXA 3NNNA 3S55A 2B3DA 3P0JA 2FRDA 1JIIA 2BFBB 2JFBA 3KLOA 3BE5A 2Q1UA 1RXSA 2PV7A 2JGDB 4NEHB 4OOEA 3HJCA 5DGHA 5HK9A 3P26A 3K31A 4XSVA 1N2IA 1Y5NA 2R4TA 3AFMA 1N9GB 2QRNA 1Y37A 1VJRA 1F9AA 2YZKA 3MTJA 1J8YF 3LUJA 3RTBA 1ISJA 2QRMA 1SB8A 4DUPA 1FTYA 2CVHA 1NVMB 2PG3A 1NP3A 1YUNA 3T12A 4Y6PA 4CKCA 1Z6QA 4O4LB 4IFEA 2RCYA 2WW8A 3G0GA 3JYOA 5EJ6A 4NV3A 3ZNQA 1F20A 1H93A 1RAEA 2ZYAA 3OP4A 4ITVA 1SCIA 5C4MA 2ZUVA 5AVTA 2XZOA 4HSGA 3VC2A 5JROA 3I9JA 4FLEA 3GLFB 4C2TA 1K4YA 3T7KA 2ODAA 2AG8A 2RI6A 4IH9A 2EBHX 3EXG2 4IDEA 4QUDA 3RLFA 1UJCA 2INGX 4F91B 3DJYA 5EIHA 1YCFA 3HDTA 3OQIA 4HFJA 1A88A 2EC5A 4OJTA 3K1TA 3NR2A 3QFCA 4O1MA 2FWBA 1C8VB 4JL8A 3FHOA 4JT2A 1EVIA 1QRAA 1JDNA 2WDZA 3IDAA 3K1AB 4HUQA 1U7UA 4P92A 4RDCA 1ZPDA 3GDHA 2AI1A 1IWOA 1VZ3A 3KELA 4WH0A 4AJEA 4WBNF 1K8QA 3AW9A 4RGYA 4X20A 5F64A 3IIKA 1PGOA 1CRWG 4K6GA 5CT5A 3HRHA 1KQGA 5LYJA 4Y9SA 3A28A 4IFTA 3TOXA 1LQ2A 1V6CA 3NWOA 5BN3B 1NY6A 1EB9A 1NUUA 1UJBA 1P8JA 1VYTA 3FLBA 1NQTA 4JJEA 3ZD9A 4IJVA 3NNSA 4HEHA 2OECA 1RJGA 4JLUA 3DOUA 4RK5A 2WTUA 4MMXB 1TAUA 2IEZA 2NSHA 4WNCA 1XKTA 1ZKDA 2JHAA 1SM4A 1PV4A 1OE0A 2BCGY 4X85A 4QRIA 1KZ6A 4LXQA 4U8HA 5ECDA 1N6PA 1RYHA 2OWEA 1JIQA 5JAUA 3OUZA 3L1HA 4FOPA 1G18A 4LYYA 4R2WA 5KTTA 2I62A 3OZ7A 4JH0A 1ZJYA 2VTKA 1P77A 2GPJA 3A6HA 3EUAA 1YZVA 3FNBA 2FN8A 5P21A 4DQ0A 4GOJA 1GZVA 1JBQA 4ZV9A 2RHHA 1ODFA 2VATA 1OI2A 2R6R1 4TTPA 3TAHA 4DLTA 1N7GA 3VKWA 3L84A 4ID3A 3FHTA 2HBQA 2WHEA 5LOVF 4L8LA 4PV7A 2VP3A 3S44A 1DO2A 5B6IA 3UENA 2OHOA 4PFQA 5ECWA 3RJTA 2C96A 1E6LA 1QVZA 1K6IA 2AMYA 4QYMA 2B2XA 2HHLA 2I2DA 4ESEA 5ESXA 1QTRA 5EJEA 2A4KA 3X2SA 4EG8A 4HLQB 3GVXA 2HMVA 5H5JA 4KFSA 2OV2A 4UNPA 1MRZA 2V7VA 3A4LA 1GCOA 3CE9A 3ROPA 1R74A 2M6KA 3RS0A 3TJZA 1H1TA 1QC5A 5LKAA 3V1KA 1DO0A 3EQ2A 3RCBA 4MS1A 2IYRA 4CEJA 4I3GA 3WGJA 5IU6A 1D2NA 1CZRA 2O8NA 1A95A 3SWWA 4C07A 3PDCA 4CNQA 2Q50A 4GPEA 2V7TA 3RHTA 4BFSA 2HSGA 4MRRA 2AFIB 2DUJA 3IILA 1RFGE 1J33A 2B8NA 5J3JA 4X65B 3VO9A 2RCNA 3L7YA 2AJCA 4BO6A 3DE4X 4UNSA 3X2FA 5HYVA 3NUGA 1Q0PA 3IQWA 4PQRA 3ZHQA 3O8DA 4ZCLA 4V03A 5WRFA 3RFTA 2PXAA 2GOYA 1JR4A 1WVIA 3IT2A 3MIIA 2XRFA 4NK4A 4BMZA 1C7EA 2DVMA 3LDGA 1WX1A 4JZYA 3RFXA 1RBQA 3KZMA 1MQAA 3LLSA 4B6OA 5GJBA 3JYHA 4IGKA 4J75A 4Y2VA 2W6NA 5T57A 4GL2A 4GLFA 5EJMA 4I50F 1PSZA 3ONWA 3PE4A 5ERGB 2DPYA 2D0OB 1A9SA 2ZAYA 4BWGA 1C3XA 1XRPA 5JARA 4RZQA 2WSSD 1UJNA 4YCAA 1N77A 3DPUA 4D5EA 5CVEA 3ZZNA 1DEXA 1OA0A 1OWNA 2Q2NA 4PO8A 1TM3E 4YAFA 4HEJA 2QUKA 3B36A 4FCCA 2EG5A 4J1TA 2Q0HA 4U2CA 4YJKA 3W9BA 5JZBA 3M83A 4FHGA 4L4UA 3TRFA 3VVMA 1NJ1A 2G83A 1WKBA 2GD0A 2J4CA 2OV4A 5DLYA 4TXNA 2O1XA 3HGQA 1I3NA 4Q16A 4AS2A 1ZBDA 1NYLA 3Q1LA 3SZUA 2X8BA 2ATCA 4MA4A 4W5OA 3C43A 5AM0A 3RREA 2FLVA 2JVJA 3AH8A 4NH4A 1NVKA 1A9XA 1LVUA 2YRXA 3LQQA 2ODBA 3E81A 4LVCA 1J5PA 2AOXA 2CB0A 2FOLA 4Q24A 1RI2A 5JAMA 1RHJA 1MJGA 1KPGA 4OOFA 4R3NA 3KZOA 2DWPA 1I0IA 1GZ6A 2Q8NA 2QSJA 3PC8C 3STUA 4DMLA 4PN7A 3H97A 3U44A 4JVOA 2HU2A 3NAGA 1OF1A 4R2HA 1GOTA 3CF2A 1EUQA 2AG5A 4ARIA 2IHVA 1FQOA 2MYNA 2JLUA 4TVKA 4V0KA 3O0TA 1R88A 1A69A 3L79A 4IKPA 4WWHA 4G0OA 3R8CA 1U11A 2A35A 2VDNB 3BK2A 3KLNA 1B7GO 1CY6A 3L6UA 4GYJA 4RXTA 1FYEA 1P8AA 1L7OA 3SLRA 5M5BA 4ZEXA 4DCUA 1W4RA 1NVFA 1CETA 1JR3E 3BL5A 4IMPA 3VVLA 1ESMA 3PFBA 3FWZA 1Q17A 4CIYA 2AZXA 4D0SA 1DGQA 4XM0A 2YJGA 3L6EA 3VZSA 4Z54A 3A14A 4C4AA 1BCSB 2AEFA 1OH7A 3EG9A 5FV4A 1CUIA 1GEGA 3GBPA 4KIFA 4M98A 5AXAA 3HYLA 1U2QA 4ARVA 1AE1A 5L3RA 2WWGA 2JCXA 2PFGA 2D2VA 1UZUA 4RGQA 2NU8A 4F5WA 1NVUQ 4RD1A 5E6SB 2R84A 4NMHA 1U0RA 1HKHA 3STHA 4CFSA 5B3AA 4ECEA 1DOZA 5IJZA 1B6SA 1Q95A 1PJLA 3EFEA 3M4NA 1GLGA 4IGEA 5K7SA 4LZZA 3BIOA 3TTTA 3W3ZB 4LMRA 4PPYA 1KMHA 2P9ZA 4XR9A 2OHIA 2W2LD 2IXTA 1AN0A 2A1UA 3ZK7A 4ZZ3A 2PD6A 2FRDC 1RQ7A 1HFJA 4L5IA 1T3SA 1RM5A 2QD2A 3I9OA 1EUCA 2B8TA 2Q7OE 1AUPA 1FUUA 2VTBB 5KBYA 1DEAA 5K3FA 5FD8A 4ZP1A 3AUUA 3U3JA 3LHSA 3GMSA 1OZFA 2XB9A 4JLOA 1ZXXA 3B9BA 3LLCA 3WQRA 1W1WA 5CB6A 2XUQA 2QAGA 4IAOA 4X3CA 3FCUB 3EPHA 1JHXA 3TCKA 3WFJA 1GAEO 3WLQA 1QV7A 4TVBA 1M2NA 3PL5A 5F51A 2P41A 2IC5A 1K06A 4D99A 2VSOA 3CUKA 4ARBA 2GN4A 5CDHA 4RIFA 2Q7DA 3HNOA 4ZC8A 3IX7A 4MIYA 1E7QA 4A0SA 3FNQA 2G0NA 3FMPB 3DZJA 1KSJA 5I47A 1NA5A 2JI8A 3DGFC 4G07A 1IXZA 1O54A 2RK3A 5AVQA 3FRHA 5JHHB 1E96A 1OTYA 1YK1A 3C3YA 3PGVA 4FGUA 2J9YB 2GD2A 5ERYA 4RTRA 4ZD6A 2BR4A 2CDCA 1VIYA 1D8AA 3FWPA 3ISJA 3NVMB 2W90A 2I4IA 3DA8A 3A0UA 4RZIA 3AVVA 2GBGA 1HDGO 2H92A 2H18A 2I29A 2EFJA 5EIBC 3T1HB 1WS6A 4OHWA 3IAXA 3VR5H 3G2PA 5BMVF 1A4RA 4MQ5A 1STOA 3KEQA 4QDXA 3FR7A 3ZEAA 1Q1ZA 2DBRA 2ZI4A 1JUDA 2ERCA 4E5PA 4YIKA 5HXAA 2IIVA 3L7JA 1VJ5A 5D5PA 3U17A 2H17A 5JSKA 2EDAA 2RH5A 4M49A 3CEMA 3CC8A 4P0TA 1S5PA 2CXQA 3O2NA 1BW9B 3R3HA 5DTIA 4KR9A 4A8PA 2JLRA 4J0DA 1QHSA 4J0EA 1VHJA 4TKUA 3VAAA 4G5SA 3C4VA 3T0GA 3B5JA 1XNGA 1AX9A 3D54D 1U2TA 2R6AA 3BJMA 4YECA 3ZQ4A 4BZPA 4EBBA 5LQMA 5FNZA 3C6YA 3FPLA 1WU8A 3OPNA 2ADOA 4ZHQA 3GFGA 3DTVA 3AOGA 1NF2A 4MQMA 2AG0A 3GP5A 4A26A 3WGKA 5AVYA 1OFVA 3E9RA 1MV8A 1EM8B 2QZZA 2WA2A 4R2KA 5DTQA 2VQEB 4PS0A 4TRMA 2GUGA 1VHWA 4AKHA 1FP6A 3TLZA 1JH9A 3BWEA 4F3YA 1R1DA 1YR7A 5ALEA 5E9JA 3THWA 5JTUA 2BP7A 4R01A 3TNYA 1XU7A 2BJWA 2WKSA 4ENQA 2NUTB 2PX3A 4E5DA 3U4QA 4K6OA 3P0HA 5AFSA 5K4AA 2PUBA 4KH1A 2CVZA 1JYFA 3IT0A 1MJFA 3PDUA 1K92A 3RC9A 4JVNA 4AMZA 3S2FA 1GT91 4MLZA 1OU0A 1SK8A 4LC9A 3N0VA 4KVFA 3PBKA 4XWTA 4OHZA 4CL8A 1AUQA 3BIJA 3VU0A 1PJSA 4UASA 4KBYA 3R5SA 4PC6A 2ZTLA 4DPLA 1MJNA 2D5LA 2IY8A 4ZOQI 5TX7A 4AJIA 1ODSA 1R7RA 4FFNA 2HNKA 4EB6B 1YQTA 4LZAA 2F62A 4RETA 2ZRGA 2JBWA 3PIDA 1KAMA 1U3CA 2E89A 4YDSA 1T10A 1PDWA 3JW8A 5A9RA 2K2WA 4BX8A 4HRXA 5J23A 1FF9A 1A97A 1FTSA 3D4NA 1E6EA 2XMRA 3FPEA 3MUOA 1NYQA 1RLUA 4KO8A 3FZGA 1DFGA 3BEDA 4LHWA 1X70A 2BGTA 2QQ0A 2QXTA 3WK4A 1QRTA 3OOSA 1E1CB 3HMKA 4ADSG 1VJCA 2QN6A 1OLSB 2WD8A 2QM7A 4FR0A 5GQSA 2F3PA 1IBKB 1O6ZA 3UB4A 3EXIA 3UWDA 1U1IA 3K8ZA 3KYIB 2FQWA 3QE3A 1XNQB 4BO5A 4IDBA 1RZRD 4BFYA 2JHPA 4BLVA 4EPYA 3GG9A 1JFLA 4MNTA 5IDQA 4ZREA 1BSVA 1FDVA 2H7XA 5FQOA 1DHTA 5CB4F 2B5WA 3DL2A 3WJ1A 4D9HA 1ZIDA 3QSYA 4II2A 5KNCA 5K0EA 1XXHA 5JVDB 4EEXA