2YHIB

Trypanosoma brucei ptr1 in complex with inhibitor wh16
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE, PUTATIVE
publication title Exploiting the 2-Amino-1,3,4-thiadiazole Scaffold To Inhibit Trypanosoma brucei Pteridine Reductase in Support of Early-Stage Drug Discovery.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 93
structure length 249
sequence length 267
chains with identical sequence D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2011-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2yhiB00
4ZRNA 5JC8A 4L9RA 4MVJF 1B3BA 1YDWA 5DP1A 2F1KA 1QV7A 4S1VA 5LC1A 1WDMA 1DLIA 1I3KA 5AXAA 1MXFA 4M1QA 4E5NA 4UEOA 4YRBA 3I9JA 3MJSA 5HS6A 2HMUA 3ZWAA 2ZTLA 4Q3EA 1OZAA 5GY7A 1J6UA 1P1FA 2NTJA 2DBVO 4FJ1A 4P8RA 4Y67A 3GEGA 5EESA 4BO2A 4CUZA 1GZ6A 3VTFA 4TVBA 1BXGB 2R6JA 2ZQZA 2O4UX 1ULUA 5AYVA 4W4TA 4MVJM 1T26A 1T2DA 1WDKA 4LISA 4NJOA 4ZRMA 1GV1A 1R0LA 3M2TA 4IQGA 1I10A 4E2XA 1VI2A 2B0JA 2DTEA 4L74A 4D0SA 5IZCC 3GAZA 2NVUB 3DBLA 3U4IA 2GN8A 2Y99A 3S1LA 2NNLD 3BMQA 4XB2A 2QX7A 2PFGA 2QRKA 2VTDA 3DR3A 3CIFA 3S55A 3WQRA 1PWZA 4B4WA 3VH4A 3P19A 3K31A 1B2LA 2OO5A 2VHXA 3NTQA 5H83A 2IDZA 1DB3A 3AWDA 5JCJD 1UXKA 2JAPA 3PYXA 1B0AA 2FZEA 2Q1TA 3WBBA 4P4GA 1P0FA 4I9NA 8LDHA 4MO2A 1U3VA 1BDBA 1Z75A 2C2YA 5G0TA 4R4JA 4IMPA 2C59A 4FSHA 1DFHA 3ANLA 2VYND 3I9MA 3PXXA 1A7AA 1E1LA 1YRLA 3F5SA 4L76A 3O03A 4YAKA 3AI3A 1P1HA 3HFSA 2VZ8A 5J23A 3BYZA 1PGPA 3DC2A 1NR7A 4O63O 4JQCA 3KLMX 4B7CA 2HMTA 2BKAA 4D0RA 2VRBA 3TZCA 1ONNA 4RVSA 4M8SA 1ADBA 2RIRA 4YR9A 2NU7A 1LDMA 2CVZA 3CPSA 3RUHA 3RU9A 5CAEA 4XJSA 3TL2A 4P4LA 1E3WB 1DFIA 3KLPX 2Y1EA 2X23A 1EEHA 4JGBA 4MDHA 4PIVA 1UXIA 2H9IA 3LZ6A 1J49A 3CSDA 5JNLA 3IKTA 4YRAA 1JN0A 1LRKA 1KERA 1QORA 3LT0A 2GF2A 2TMGA 3HN7A 4J43A 1GFSA 3QWAA 4A0SA 1VLLA 1GDHA 1E3JA 3G3EA 5K6AC 5GMOA 3IUSA 4LK3A 3QVOA 3WICA 1LC3A 2EKQA 1QR6A 2Q99A 5KVQA 5T8KC 3QA9A 3TPCA 4W7HA 1HWYA 3B20A 1E3SA 3HE3A 3OJLA 1FDTA 4TZTA 1G6KA 1NWCA 5FFFA 5JXWA 4Z6KA 1EZ4A 3FHLA 1TLTA 3DMTC 5ITWA 2AEMA 2DT5A 3BTOA 3PJFA 3WB9A 2EXXA 4MIYA 1TB4A 2AEJA 3F4LA 1BVUA 2JFHA 4E2YA 3PFWO 4CMKA 1XU7A 4NG5A 4J2HA 4R1TA 2CFCA 4CV2A 1XR3A 4DC0A 3VDQA 2I76A 1ZEJA 2P5YA 1E3IA 3SC4A 5L7WA 2X9NA 3GNQA 3MCVA 1IL0A 2WEKA 4BIIA 5IFLA 1I3NA 1LNQA 2IXBA 2PZMA 1Z6ZA 3E5RA 2GPTA 4HFMA 3RC7A 4DL9A 3DZIA 4ZQGA 5CDTA 2OORA 2ZJ0A 3E82A 4DIBA 3LU1A 4MVJG 4B3HA 3E6AA 3E9MA 5L95A 1LDYA 4Q3NA 3QY9A 4YQYA 2BD0A 2XXJA 3VKVA 4BO3A 3QLJA 4DXHA 3K73O 4GVXA 1XG5A 3O8QA 5BQFA 1N9GA 4CL3A 1A9ZA 3ZCXA 1SC6A 2X0NA 3EAGA 4A5OA 1PGOA 1PZHA 4D3SA 2G82A 3K92A 3PGXA 5L45A 2GN4A 2QZ9A 3KV3O 3OP4A 1V3VA 4URFA 4W82A 3OEWA 4GX0A 5GZ3A 4QFCA 4RPJA 3W6UA 3ADOA 1V0JA 2JFFA 2A35A 1CEQA 1JAXA 3Q9UA 1ZSNA 3IOYA 2NTVA 2YW9A 2E4AA 3QSGA 2OHXA 2VT3A 2QYSA 4YBZA 4B4UA 3T7CA 4D7AA 1QYXA 4YXFA 1DIRA 4BNHA 2CY0A 3JSAA 2NQ8A 4DYVA 1Z45A 4AL4A 1ONOA 4CM3A 2G17A 1M66A 2X0JA 4ZQEA 1I3LA 4DYDA 2CVOA 2JCYA 3MZ0A 2AQIA 5KKCA 2AE1A 2ZB3A 4J9UE 1EE2A 5I7EA 1XQ1A 3KXDA 1U3WA 3GUYA 4OQZA 3AM3A 3V1UA 4EEZA 4WNIA 4DPMA 3WGGA 5B12A 2RHCA 1YB1A 3PJGA 2WDZA 1LDGA 1RM0A 1YXMA 5THQA 3KEQA 4RPGA 1XGKA 3VOSA 2JAHA 2GNAA 4CM4B 2PV7A 4R01A 5CP8A 2OGUA 1KVRA 3VZSA 1U3UA 4I5DA 5TF4A 1Q0LA 3TNLA 3UCXA 3PWKA 4IDBA 5L4SA 1X0VA 3RKUA 1MX3A 1GUYA 3U4HA 2PKQO 4YJGA 1ADCA 4ZICA 4MVJP 1NQ5A 5ITVA 4J9VA 1LUAA 3U0BA 3LC7O 1DC6A 4RZIA 4MKRA 3ZHBA 4B7UA 1F12A 4II3A 4PG5A 2ZTMA 3DFZA 4N5MA 4XIYA 5JPIA 1Q2XA 3WLFA 2O3TA 1E7RA 4TRMA 4ESOA 4M87A 3F1KA 4WASA 1H0KA 3TZHA 1EUZA 4UUOA 1W4ZA 3FRJA 3UKOA 4DQUA 1I2ZA 4WLNA 4ALIA 2C54A 5T5QA 2W98A 4DPLA 4B3JA 5IG2A 3N58A 2V7PA 1BW9B 1Z73A 4RQTA 4PLGA 1DC3A 3UUWA 3I6IA 4ALJA 3D7LA 2GN9A 2A92A 1XQ6A 2DUUA 1I3MA 2ZB4A 1DJQA 5F1PA 1CYDA 1GPDG 3MOGA 3B1FA 3U9LA 1GTMA 4TQGA 1KC1A 4YT5A 1QG6A 1W0CA 3GA0A 3WMWA 6ADHA 3HB5X 1YL6A 3GDFA 4L4XA 2GERA 3H7AA 1PU2A 3OIFA 3WWYA 4KUGA 4DQXA 4W99A 3G1TA 3PHHA 1CDOA 2VUUA 4A26A 3U49A 2FRDA 1GEGA 1DLJA 4OKIA 3ADPA 4XDYA 1P31A 4GWKA 4C7KA 3NT5A 4BMSA 4EUFA 1SO8A 4XYBA 3WIDA 3ZU5A 2GZ2A 3OBBA 3I23A 1Y1PA 2BFOA 3GVXA 3JQAB 2D0IA 2O3SA 4JJIA 4E6PA 2OP1A 1P1JA 1NFQA 4XRRA 4GLLA 2YUTA 4MP3A 2VZ0A 4MVJD 4XB1A 3BHJA 5JYDA 5IXSA 5BSGA 4PLTA 5TRTA 1UZMA 1SNYA 4DC1A 1E0DA 1DFGA 1LJ8A 1V3TA 2GUGA 4JJFA 3RC9A 3JYNA 2P68A 5C7IO 2X9VA 1HZJA 2P2SA 2YJZA 3KBOA 3L9WA 3F6YA 3AI1A 4F46A 2FOIA 5L3ZA 1H6CA 1F0YA 3QV1A 3JTMA 4KZPA 2EWMA 4QTZA 1B26A 3K9QO 4CQMA 3TWOA 1F14A 3CEAA 4D42A 2BRUA 3DEYX 4M86A 1GY8A 1OBFO 4J91A 5HWSA 2FWMX 4UUPA 3DBLB 4GI2A 3V5NA 4BO7A 1GYRA 1X1TA 1YJQA 2GSDA 4HP8A 3BMQB 1HTBA 3JYQA 4NK5A 2DQ4A 4PLVA 1PQPA 2I3AA 1I01A 3G1UA 1ZO8A 5ILGA 1WNTA 4G5HA 3FR8A 3H5AA 1IB6A 2HK7A 4F45A 4LRTB 5IJZA 5JDIA 3CMCO 4FFNA 2Y1GA 1IE3A 1NPYA 1PJ2A 3RC1A 3W8EA 1RWBA 2YY7A 1Y6JA 3HQ4O 4O6VA 3WFJA 3HDJA 1HYGA 4CQLA 1QV6A 2J5QA 3IQDB 4YAIA 4YYZA 1NHWA 4Z0HO 3O9ZA 4BVAA 4YJHA 4FGWA 1BDMA 2FPGA 4BQRA 1YH3A 5I8WA 4GMFA 4BNYA 2O3RA 1U7HA 2JL1A 3FWNA 3DDNA 5A9SA 3GEDA 3DAGA 2C29D 3FI9A 2YV3A 4HNHA 4XKJA 1YGYA 2CDCA 3K5PA 3ZU2A 3ZNPA 1VSVA 1R4NA 3S2GA 3GDGA 2O7QA 2VUTA 5DBIA 3GHYA 4U7WA 2FR1A 5G0UA 4H3VA 3NJ8A 2BHLA 4CLHA 1SOVA 1U8XX 3KSUA 2VCYA 3JYLA 4IJKA 4IUYA 1DRWA 5AQ1A 3AOGA 4J1NA 5HA5A 1P0CA 4CMBA 4F3YA 2R2GA 3DB2A 3RJ5A 1N2SA 4K6FA 1B16A 4FQ8A 1QSGA 4FFLA 4WKGA 5JMWA 5CDGA 5CEFA 3OQBA 4RJTA 1A27A 1PSDA 5ES3A 3IMFA 5L40A 2WE8A 1UP7A 3K2BA 1AUPA 1H94A 4GBJA 4CV1A 1ONPA 1BG6A 4YB8A 1BXZA 1XA0A 1YQXA 1FDSA 5F3RA 1E7MA 4JROA 4IGFA 4XWYA 1C1XA 3NEPX 2JKVA 2Z5LA 4RPLA 3KHUA 3CUKA 4WLEA 1IPFA 3GFBA 1EFKA 3H3JA 1NWHA 1ZFNA 5THKA 2DPHA 3ROMA 2FY8A 5JAQA 4YAGA 2AQ8A 2QG4A 3F3SA 2LDBA 1BRMA 2I9PA 3ETDA 1EVZA 4AJ1A 4R3WA 5L53A 4R51A 4B7XA 4RGBA 5AOVA 3OJ0A 3IKVA 5A06A 4DLBA 4WLOA 5BSFA 3W4JA 3ZW8A 3CZRA 2P5UA 1M76A 3JQFA 3GZNA 4ND4A 4YJDA 4IIVA 5COAA 2BLLA 3KM0A 5T67A 1F8FA 2EERA 4R9SA 3V2GA 3IAHA 4FCCA 5L51A 2E49A 4P38A 3ZNQA 2I6TA 3WMXA 5I9LA 4RCVA 4EITA 1JWAB 1Y5RA 5TJ9A 3NUGA 3BHMA 1WZEA 3ETGA 1PTJA 3O8QB 1N9GB 4GX2A 3AOEA 5KCZA 4AJ2A 1DRVA 3PI7A 1HYEA 4FFOA 1B8PA 3OA2A 2PNFA 3DTTA 1R66A 1Z74A 4I8XA 3GFGA 1NQTA 1ML3A 5JAMA 1NNUA 4IJUA 3ROKA 3PYMA 2VWQA 5ENDA 3V8BA 1X0XA 4R5MA 4XYLA 3VVCA 1Q1NA 1Q0QA 4N18A 3D4NA 4J1QA 1KBZA 1KY5A 1PL6A 1JLLA 4GSLA 4RQUA 3RD5A 1JDJA 2V6BA 3L6DA 1E7YA 3JQGA 4P4NA 3ZWPA 4ALLA 2PZKA 4RF3A 4PCVA 3HHPA 4ALKA 1YWGO 2JHFA 4JCOA 1S6YA 2J3IA 1HE4A 3PVZA 1EVYA 1E3LA 3ORFA 4O59O 2IZ1A 2VRCD 1LTHR 4FJ0A 3UN1A 4R41A 1M2WA 3QVWA 4ROSA 4GKVA 3ICCA 3BA1A 3PIDA 3Q0EA 3R0IA 3KYDA 4X54A 5COBA 3ANMA 3SEFA 1DC4A 4EI2A 4DLAA 3OFSA 5TLSA 2I99A 2YHIA 1WMAA 1U4OA 3UXYA 3WGTA 4R1UA 5K0ZA 3Q2KA 3D3WA 3WG9A 3VZQA 4UAGA 4OSOA 3CMMA 5BNTA 3V1TC 4I1IA 3CKYA 1K89A 4PG6A 2V65A 1SOWA 4INAA 2UAGA 3LK7A 4A10A 5ER9A 3WTCA 2QRJA 1D8AA 2OZPA 1P1IA 3NTRA 4NHEA 3ZWNA 1P1RA 1RM4A 3I9NA 2VT2A 4YJGB 1KY4A 5T57A 3TOXA 1HT0A 3HNPA 2BELA 3A9WA 1ZXBA 1TEHA 1X13A 1V3UA 2D3TA 1PR3A 3QWIA 3JQ9A 1P1KA 3DBRA 1GD1O 2Q2WA 1Y8RA 2VN8A 4DA9A 1XKQA 2OBNA 1NQAO 3AU9A 3W6ZA 5A9RA 4AG3A 2W2LD 2C5AA 3NDJA 4NJMA 4RDIA 3D3EA 3D5TA 4BNKA 4Q39A 3ASUA 2DU8A 4CR7A 4MIOA 3VC7A 5K6AA 1X1EA 1C0LA 3KVOA 2ZATA 2BGKA 3MJEA 3X2EA 4ID9A 2Y67A 4EBFA 3AU8A 1CQJA 4AJ4A 2CMDA 3PYLA 5JW6A 1UAGA 4FGSA 4Y9DA 2IYPA 2HRBA 4J4HA 4BO5A 3Q9NA 1HSZA 1QRRA 2D5AA 2ZQYA 3LF1A 5CFZA 3OMLA 3GQVA 4TRJA 4XD2A 4CMAA 1LI4A 4IXTA 2AG5A 2FR8A 2X86A 3C7CB 1UXJA 1KEUA 2PWZA 1MFPA 1J0XO 1DEHA 4IQ0A 4D41A 1LX6A 1IYZA 1ENOA 4XZ3A 3EZLA 3AOEC 2J3KA 5T64A 3TOZA 2IXAA 4KDFA 1B8UA 1GPJA 4PG4A 1R4MA 5EINA 1UP6A 1U28A 5DBGA 5G4LA 5DBFA 4M89A 1TA4A 4J1SA 3RIHA 1M6WA 2H6EA 4GVLA 5A3VA 4D43A 4DIOA 1JWBB 5JAZA 4FOSA 3H9UA 3DBHA 3NV9A 2GN6A 1E5QA 4ZQFA 2D1YA 4CUJA 2X22A 2ZTVA 4NBVA 3W4IA 3VH1A 5FEUA 3WS7A 1VPDA 2J5KA 1XELA 4CL8A 1T1SA 4ZGWA 1ZZEA 2Z1MA 1X15A 4WUVA 4CM7A 5KWEA 2G1UA 5KVVA 5FF9A 2WWRA 3F1LA 1GV0A 4HUJA 1DAOA 4D3FA 3GR6A 4R68A 4HFJA 1T2EA 3FPCA 1Q7CA 4AJKA 1Y81A 3FTPA 3KTDA 4M55A 3GZ4A 3TDKA 3O4RA 2PKQP 2Q2QA 2A4KA 2FR0A 1DXYA 3A1NA 3AY7A 1VL8A 1X7HA 3KUXA 4BO1A 4CQMB 4PLZA 4BGEA 4DBZA 1ENYA 3QQPA 4YJFA 3WSVA 1ISJA 1GZ4A 4HWKA 2I5PO 2EGGA 1EQUA 5B4UA 4BB6A 1R16A 4Y6RA 4C4OA 2DC1A 5F5NA 2EF1A 3PK0A 2X0RA 4DLLA 3BIOA 3AM4A 4WEOA 1HLDA 4XDZA 3AFNA 2ZYGA 4CODB 2DM6A 4H7PA 1P77A 1QP8A 3UAGA 1ZEMA 3H6KA 4W9NC 1CWUA 3WBFA 4ILKA 4JXKA 1ADFA 3H4VA 4CQLB 3JQ9C 3RU7A 1NAHA 4R16A 5CEJA 1R6DA 2B4TO 3GY0A 2QIOA 2HMSA 3EK2A 4YJHB 3JD2A 5EN4A 4JNKA 3JQAD 3PHLA 4HFNA 1O95A 3C1TA 4PRLA 1QMGA 3OHSX 2BFMA 4CMEC 5U1PA 1NAIA 5JMPA 3RSHA 4JP3A 3RC2A 3HADA 4AJHA 5A9SB 2QW8A 1YBMA 4NDNE 1HXHA 1E6WA 1Z7BA 3I9OA 2R00C 1TVEA 3ETEA 1R4NB 4NZ9A 1T1RA 4R3NA 3KZVA 4CM1A 4Y98A 3QWBA 4U0KA 4OSPA 1ZK0A 2OOSA 3FF4A 1Y9AA 5BT9A 1LSSA 4IQ8A 2HK9A 2WD7A 4HX5A 1VC2A 2NU9A 2POQX 3D1LA 4PLFA 3DZFA 1LRJA 3I4CA 4CM5A 2UYYA 4MP8A 3TFOA 2J5RA 3PLNA 1J5PA 4IS3A 1PS8A 2UV8A 2X6TA 1PL7A 2XOXA 4DMLA 3N74A 4KUHA 2NVWA 3MJVA 2ZCVA 3C7AA 1KVSA 3UHAA 4EJ0A 4PN3A 5JSFA 4DIFA 2P9EA 3BTVA 1Y5MA 4Q3CA 3V1YA 1W8DA 3LSYA 4BGVA 4E12A 2EKPA 4IMRA 3HUDA 4FFMA 1C1XB 3PPIA 4RVGA 3G79A 4KWHA 1YL7A 4BGUA 1FDUA 3T7EA 4L4RA 2PA3A 1SEPA 1GYPA 1YKFA 2BGMA 4IDFA 2B4QA 3ANNA 2ZTUA 4I9UA 4EW6A 2J3HA 2OL4A 4BNTA 1IOLA 5TIIA 1YE3A 1VM6A 4JX8A 1N7HA 1OC2A 5DN9A 3S8MA 5EQDA 2GO1A 2RBEA 3AY3A 4J4BA 4FFPA 4XQCA 3GZNB 3BMCB 1ISGA 1OFGA 3IP3A 2DVMA 2ET6A 5DULA 3RUCA 2OFPA 4OM8A 1SCUA 3CZMA 4UREA 5H82A 3SLKA 4CMIA 3FSRA 4R1SA 3PHJA 1Y7TA 2BFAA 3PJEA 2XF8A 1KYQA 3ZNOA 3K8ZA 4QX6A 5C7OO 4YRDA 3DL2A 4XGKA 3RUEA 3LT2A 4CLDA 2WSBA 4WK6A 1BMDA 2BH9A 2NVBA 3FD8A 3QVSA 1ZMOA 2VTEA 4GPD1 3WNQA 4QFDA 2FPIA 1TT5A 3OICA 4CMJA 1A4IA 1EVIA 1UUFA 1CQIA 1MA0A 1IHXA 2JD2A 2O50A 2A9FA 4LGVA 2CSUA 1PJBA 4ALNA 1UR5A 3D4OA 5EJ2A 3IC5A 4TZKA 2DBZA 5GZ6A 1PJTA 3E1KA 1UXGA 1QLHA 3GGOA 4E32A 3W4KA 4OMUA 3DTYA 4DGSA 1HDRA 5L9AA 3UVEA 4J49A 1M75A 4PRKA 2WE7A 2EW8A 2GYYA 1LRLA 1ZSYA 3JQGB 4WPGA 1PZFA 5CDSA 2O3QA 4JIGA 1YB4A 2RH4A 3VH2A 3T4XA 4Z3KA 2VHVA 5F1KA 2OBYA 3UFXA 2DTDA 3GEMA 1CIVA 3ON5A 5G4KA 3ASVA 3UF0A 1B3RA 4PLCA 4QO8A 1X14A 4TKLA 4J7CA 2NU8A 4LN1A 4D46A 3KYCA 4TVOA 3KYDB 3OETA 4YEDA 3G17A 4NI5A 3EW7A 3EYWA 2BMAA 3WLEA 2YHIB 4RORA 5I7FA 8ADHA 1FJHA 4Q9NA 5CEEA 1XDWA 3A06A 3D3WB 1I36A 2EV9A 2Y93A 4J3FA 1EK6A 2NTNA 3VKUA 4CM8A 3WR5A 5CHEA 2EP5A 2H1SA 3HDYA 2AG8A 3AFMA 3ZN2A 3AI2A 3JYPA 1E1KA 2P9CA 1LDEA 4CR8A 3NJ4A 5COQA 3U62A 3OA0A 1EBFA 3MJCA 4J90A 1WVGA 3DXFA 3QWFA 3GVCA 3CINA 1HETA 3BTSA 3UCFA 3FNGA 1PZEA 4UUNA 4WJZA 1RYEA 5TT0A 4Q3BA 2FZWA 2Y1OA 5A9TA 4CR6A 3DBRB 1G0NA 3X2FA 5C5IA 1Y8RB 1YL5A 4W6ZA 4RV9A 1PQUA 3T4EA 2B5WA 1U1IA 4XYMA 4BMNA 3HWRA 1VKOA 2NU6A 3OM9A 1PJ4A 3NGLA 3L6OO 4QEDA 4NJMB 3TSCA 4MKXA 1HDXA 2Q49A 4MINA 3MWDB 2J3JA 1PGQA 4TMFA 5KIAA 1S7CA 3HN2A 4RDHA 2G5CA 6LDHA 2ZJ1A 1H5QA 4O1MA 3DAFA 2CDBA 1U3TA 1UZNA 3DOJA 3OIDA 4WOJA 1IPEA 3GGGA 1E7QA 5KNLA 1E77A 1HDZA 1CERA 3IS3A 5T6BA 1HLPA 3FPLA 5HS4A 1X7DA 2H5LA 3RUFA 5TS3A 4BO6A 4UVDA 4MVJH 4O5OA 3GRPA 4DQVA 4QXMA 3SC6A 2CDAA 2P9GA 1Y8QA 1ZCJA 1T4DA 3PHGA 2FSSA 3ZNNA 4XIJA 5GZ1A 4D45A 2Y1CA 3GPDG 4A73A 2W2KA 1R4MB 2X5KO 4IPTA 1NVMB 1QYDA 1A9YA 1JKIA 2B4RO 4L0QA 2IRWA 3KETA 1ZXLA 2Q1UA 1A71A 2E48A 2DPGA 1ZK4A 3DBHB 4J6FA 5TJHA 4BNNA 3PZBA 4AICA 1NQOA 3DOCA 3C1AA 3S2FA 3ULKA 3INTA 3BAZA 1R37A 3NDRA 1L1FA 1JVBA 2ZYAA 3LC2O 5EERA 2Y0DA 4K1LA 2A94A 1EUCA 3WQQA 4DUPA 5AXCA 1VKNA 3B70A 2JCXA 4MIEA 4CJXA 3KSZO 3NX4A 1MB4A 3ONDA 1VE9A 2NVUA 4CMHA 2X1HA 3P2YA 2NM0A 5BSHA 2NUAA 2QYTA 1MXHA 3FN4A 1C0IA 3AUAA 4RL6A 2I65A 4S3MA 3A14A 4KTTE 4OQYA 2DFDA 5CDYA 3GG9A 2V6MA 3OJOA 1O94A 2YFHA 2Y68A 1NR1A 4OXKA 4YJFB 1BHSA 3FCOA 4A2CA 1YOVA 1B7GO 4JJGA 4PVCA 3WXBA 4WCFA 1HL3A 5IDXA 3SVTA 3U09A 2YYYA 3LLSA 4YCAA 1R12A 2OP0A 1PGJA 3BXXA 1MV8A 3GMDA 2WD8A 1IUKA 3M6IA 3PDUA 3ZV4A 4CPDA 4EUHA 1YBVA 4LVUA 3C7DB 3P7MA 3BMNA 3FNFA 1HYHA 5HBRA 3F9IA 3HZZA 5JE8A 3SX2A 3ZWYA 3EY4A 5G0SA 3QVTA 4LSWA 3PQEA 1DSSG 1I2CA 2HAEA 3L77A 1RJWA 3LT1A 4XYGA 3WWZA 1WZIA 2YQ5A 2P4QA 1DRUA 2O2YA 3Q1LA 1EMDA 1N1EA 4NU5A 3OJEA 4BNVA 2X5JO 4EYEA 3RI3A 1DJNA 2CVQA 1VJ1A 4EDFA 4DTIA 1BTOA 4YAEA 1KEWA 2JD0A 2NLOA 2BI7A 5DF1A 1MGOA 2EJWA 2WM3A 4XRGA 1PQWA 2IZZA 4JBIA 1N8KA 3DBVO 2GDZA 5G0WA 5A5FA 3H5RA 2WD7B 4HADA 2QZZA 3RUAA 3K2EA 2AEFA 3QP9A 1K5HA 4EJMA 5BSEA 5MDHA 1R0KA 2GLXA 2ZB8A 3D4PA 3F47A 4AFNA 1BSVA 1DC5A 3EZYA 4I5EA 1HDGO 2NADA 4CQMD 1U7TA 2F00A 5A04A 3ZH2A 3I1JA 1W73A 3R3SA 4OXNA 4QUKA 3TF5A 1ISFA 1XU9A 2AHRA 2CD9A 4BKQA 1O9BA 1LSOA 4BV8A 1NM5A 5MGBA 3ZHZA 2B5VA 4Q3DA 3JQ8A 3DO5A 4AJJA 3AK4A 4O0LA 2BI8A 4R5HA 4UVGA 1VL0A 1YQDA 1B8VA 1CETA 1ZKMA 3EVNA 3D5QA 1UXHA 3WGQA 4E30A 3L4SO 1A4UA 1JW9B 5A5EA 5BNIA 4RVFA 4XCVA 5C37A 4CUKA 2RHRA 3C1OA 3IJRA 2CUKA 1IHYA 2AE2A 4E33A 2ILTA 1LEHA 3WGOA 4Z0TA 4KTVE 1LA2A 3JQ6A 4CM9D 2HQ1A 2VHZA 4UULA 1KVUA 1UAYA 1QYCA 2PGDA 3VTZA 3PGJA 3G0OA 1C0KA 2AQHA 3GVPA 5I8ZA 3NAQA 1J4AA 3KO8A 4TROA 4HY3A 1KEPA 4CMIB 2I66A 5BR7A 5ICSA 2GZ3A 3DHNA 3NT4A 1JA9A 4UEKA 3P2OA 2VHWA 3WFIA 1EBUA 3R1IA 4M54A 4NFSA 1F8GA 4BNIA 3W8FA 3ROQA 5DOVA 2AMFA 1MC5A 3GNTA 3OQ1A 4GH5A 2TMDA 1MP0A 1TT5B 1ZK1A 4BNMA 4ND5A 1E7SA 4E2WA 1PEDA 2PH5A 1HE2A 3KEOA 4XQEA 1Q7BA 2WYVA 2YHUA 4WCFC 1AXEA 2FSVA 3FBTA 1DOHA 1WAMA 3VPSA 4Z3DA 2EGHA 2FP4A 1E1NA 2B37A 3HFGA 4RLSA 4R54A 3GN2A 5ENVA 2P91A 4NBWA 3AUUA 4Y6SA 3KOUA 1Q7GA 2VYVA 1ULSA 1I8TA 1EDZA 1H6DA 1HDYA 3M1AA 4EUEA 1O8CA 4NFYA 1UH5A 5K9ZA 1DO8A 5IZ4A 5A4DA 4PG8A 2GGSA 2E82A 1MLDA 3MWEB 5LCXA 1DIBA 3P5SA 4CV0A 1NXQA 1A7KA 4CLXA 4NMHA 2W90A 1O5IA 4AJPA 4E13A 5AVOA 1E7WA 5G4KB 4CM4A 4TSKA 5DNAA 1ADGA 1MUUA 1H2BA 2UUPA 4XEHA 5CG2A 3D64A 3KYCB 1IY8A 1JTVA 1H6BA 4NR0A 4BKPA 3LVFO 1GQYA 1A72A 1LQTA 4ALMA 5I7VA 4OJNA 1ZW1A 2VOJA 1ZJYA 4XYEA 4YVFA 2YQ4A 4W9NA 5JY6A 3SBOA 1DPGA 1VJTA 1I30A 1H6AA 4OL9A 4OIMA 4CM8B 2X9GA 4GX1A 3JQEA 3ZW9A 4YWJA 1BVRA 5FI5A 3VPHA 1EVJA 3PQFA 4IDAA 4FJ2A 3I9LA 1XWFA 3MTJA 3F5QA 3SXPA 4CMEA 4B4OA 2R00A 2RCYA 4WECA 4ZD6A 2H63A 3R3JA 4BUCA 4XGNA 2PH3A 2PTGA 2JFGA 3AW9A 2EJVA 3ZWWA 2IEBA 1I32A 4L4SA 3GOHA 1AN9A 2Y0EA 2EKLA 4DVJA 5JCJA 4OOFA 1HDCA 4FN4A 3NRCA 1FDVA 1ISIA 2Z95A 1U4SA 2EP7A 4YTEA 2G76A 3GNSA 3GLQA 4BS9A 5CDUA 4GGPA 3JD1A 1U8FO 4BNXA 2C5EA 2VYNA 3TFQA 3HSKA 3ICPA 4PLPA 4QT0A 4YT2A 1OMOA 2B36A 3K30A 4U5QA 4B4VA 2Q45A 2X4GA 3O26A 1V9LA 2J8ZA 4RO0A 3Q6IA 2DTXA 1LLCA 2YV2A 3H65A 1V6AA 1BGVA 4YA6A 3KYBA 1SZJG 2XXBA 3FNEA 5LDGA 4IJWA 4EEXA 1EK5A 1Y8QB 1HE3A 3BMOA 4PVDA 3AY6A 1VSUA 3NTOA 1T2FA 1OOEA 5DCUA 1C1DA 1NX6A 2HLPA 2W2KB 1RKXA 3FR7A 4LMPA 5B4TA 5JY1A 2VWGA 4RVHA 3RUIA 3H9QA 5IF3A 1P9LA 1GQQA 3UGKA 1C0PA 4E5PA 3QVXA 2XPCA 4BO0A 3A28A 5EIOA 2HCTA 3JQ7A 4KDEA 3BZUA 5HM8A 3GG2A 3H9EO 4J0EA 4JBGA 3LQFA 1JVSA 5DOZA 1ISHA 4GAEA 4XR9A 5CPBA 2VWHA 2HUNA 5JO9A 4IINA 2I67A 1TI7A 1UDAA 3OJFA 5A1TA 1KOLA 4J1TA 4RF2A 3SJUA 5L7YA 2C0CA 2C20A 4GL4A 4K6CA 1RPNA 3IIEA 1L7EA 2ZYDA 4RZHA 7MDHA 3NT2A 2ZK7A 3E9QA 2Q3EA 3PHIA 3H5NA 1ZUD1 5TX7A 4DWVA 4FFRA 4FC6A 1ZH8A 2JCVA 3O38A 5ADHA 1I33A 4MPDA 3PP8A 9LDTA 1YOVB 4IGEA 4L8VA 5JS6A 4MVJI 3JQBA 1G0OA 1K2WA 3ITKA 3COSA 4MP6A 4WCFB 4QECA 3TRIA 3EDMA 1GEEA 1ZVMA 4B8ZA 4BNZA 2SCUA 4IJVA 3ABIA 2Q46A 4I5GA 4YDRA 1U2GA 3GDOA 5JDCC 5JBIA 4XX0A 2VQ3A 3PZRA 1K6JA 4UVHA 3KB6A 3LYLA 3BMNB 3WJAA 3U5TA 2IYOA 4FPXA 2HSDA 1JKFA 4IDGA 2WJPA 1ENPA 4N7RA 3VDRA 1HF3A 4WLVA 1O0SA 3HB4X 2B69A 2C7VA 4YT4A 4BMVA 4D79A 5JYEA 4A03A 3OQ6A 1D7OA 4Z9FA 2CF5A 5IN5A 1FMCA 4MJLA 3NKLA 5IXYA 3UH1A 2VUSA 2GRAA 3DZJA 4K28A 2YDYA 4MVJE 4PFJA 3RVDA 5JO0A 4PG7A 4AVYA 3RKRA 3WNVA 3VPFA 4FD3A 3HJAA 4U6SA 1JAYA 1XEAA 4ND1A 1SMKA 5G0VA 3TZQA 1D1TA 5IN4A 3S2EA 2YZ7A 2O48X 2QQ5A 3E03A 4I9HA 4AJOA 4F6LA 5B1YA 4PZCA 2G0TA 2D5CA 4D44A 1T2CA 3GRKA 2E6UX 1WMBA 3AUTA 3ZWBA 2HMWA 1N5DA 4GQAA 2PGJA 4BGIA 2HJRA 4OXYA 1WWKA 1LQUA 2UVDA 1B14A 3GH3A 1ZIDA 1FDWA 3L4BC 3OECA 1FK8A 2VWPA 4J7XA 1ZK2A 2X7HA 5IDQA 5A3JA 4K9DA 1HZZA 2DFVA 1MC4A 4G81A 1W6UA 2EIHA 3JQ8B 3F4BA 4BNGA 4E5YA 3GT0A 2WYUA 4KUEA 4PGFA 3WGHA 1QXSA 1ORRA 4DMMA 4R1NA 2FPPA 4LSMA 4LW8A 4PZEA 3KRTA 3UW3A 4TWRA 3H3FA 4OH1A 1ZJZA 3D0OA 5AXDA 3JD4A 1H9BA 3WYBA 4J0FA 1QYWA 3AJRA 2AXQA 2DAPA 3RAJA 1GYQA 3IDSA 1XCBA 3I9KA 1R15A 1BWSA 1UDBA 4MKZA 3W1VA 1XHLA 5JCXA 1OC4A 4KQWA 1ZMTA 3INRA 4LCEA 9LDBA 2PY6A 4GSKA 1I2BA 2HK8A 4E0BA 3BTUA 1SPXA 2VNSA 3AUSA 4ZJUA 5F5LA 3TQHA 4UEJA 4CM6A 4CV3A 3MEQA 1CJCA 3QWHA 4AJIA 4BHTA 1U9JA 3RBVA 3K96A 3RBZA 1IZ0A 3OEYA 3KSDO 2YDXA 2ZKLA 3DHEA 4FW8A 5DP2A 2CZCA 4N5LA 3RFXA 2GD1O 3N7UA 2UDPA 4ND3A 1U5AA 4OOEA 1UJMA 5KTKA 1YBAA 4OYRA 2O3JA 4YAJA 1PJCA 1GCOA 3PTZA 3NYWA 1NFFA 1X7GA 5FI3A 3R6DA 1CF2O 5FWNA 4BKRA 4U0JA 1V35A 3JQBC 4RF5A 1I24A 3I6QA 3PJDA 4HV4A 4BO8A 4NPCA 3VPGA 1NASA 1PL8A 3V2UA 2IEDA 5ICMA 2Q1SA 4BO9A 3ZHYA 3AM5A 3VH3A 1XLTA 4CLOA 1WDLA 5L4NA 1JQBA 3RFVA 4E31A 2O7SA 4QQRA 4D3DA 3WOHA 1E6EA 1NTOA 4PZDA 4JP2A 2O3UA 4U6QA 4BNUA 3S2IA 2HDHA 1E1MA 1HEUA 1P33A 2O23A 3TN7A 1GU7A 1NP3A 4IY1A 1RYDA 2FMUA 3LF2A 4B79A 3I83A 1I0ZA 3DMYA 1NBOA 4GWGA 4BNJA 3A4VA 4MVJA 2X8LA 4NQZA 1YO6A 3H2SA 1XSEA 1YS4A 4LMRA 4FOOA 4I08A 4IZHA 3RROA 5C3MA 1NVGA 4TRRA 3ZDFA 1AXGA 2PGLA 3VVBA 3DZKA 1GL3A 3GC6A 5TT1A 1P45A 4BKUA 3PFFA 3FTNA 1GZ3A 3BHIA 3QJ5A 1DHTA 4HNGA 3W8DA 3TZKA 3GK3A 3INGA 2EHDA 1E92A 2HJSA 2X58A 1DHRA 3DZBA 3M2PA 5TGDA 2NV6A 1D3AA 4J2OA 2NACA 3C3XA 3PIIA 4E5MA 5KOIA 1UZLA 3FBGA 2IODA 3ST7A 4Q3AA 5TSDA 4L75A 3QRWA 2PK3A 1KS9A 2Y1DA 5TC4A 4B3IA 3WTBA 2C2XA 3TJRA 4IDCA 4ZN6A 2HO5A 4DRYA 1MFZA 2RAFA 4BL5A 2EW2A 3C85A 4KP7A 1IULA 3ZWCA 3RWBA 4WLFA 1Z7EA 1DDOA 1KVTA 1LXCA 2I3GA 2VOEA 4H15A 3K6JA 4WNCA 3ZV3A 3WYEA 2UUOA 4CLEA 3M1LA 3I4FA 2VNAA 1HSOA 1G1AA 2EEZA 1SB8A 2Y1FA 4LRSB 4QSMA 4UUMA 4JK3A 1E3EA 4Z0PA 4CLRA 4JBHA 2BFPA 4NBRA 4ONEA 4PLHA 4XA8A 4IS2A 5IDWA 3I5MA 4KWIA 3ENKA 5AXBA 3ZGYA 3B1JA 3GGPA 2JHGA 4RLHA 1KVQA 4XQ9A 1YB5A 1O6ZA 4Y8VA 3NGXA 1LU9A 3Q11A 4RF4A 5C7LO 4ND2A 1B15A 3L07A 5FYDA 2YV1A 4GMGA 3HG7A 3MJ4A 1JU9A 2BGLA 4FIZA 2P4HX 4IXWA 3VZRA 1ZBQA 1WW8A 4IIUA 2FHSA 1CRWG 3EC7A 3RASA 2CF6A 2W4QA 2C7GA 4BKOA 3IL2A 1GAEO 3RUDA 3STHA 1U5CA 4RPHA 3ENNA 3UICA 1R0SA 3PWSA 3CE6A 4A7PA 4Y6PA 1HKUA 1KETA 3U4CA 1YONA 4IZIA 3WGZA 3BMOB 4E2ZA 4KOAA 3EMKA 3ZV6A 3JQDA 4JLWA 1LSJA 4OGWA 1BXGA 1C1DB 4UVIA 4ZVVA 3H8VA 4YT8A 2DBQA 3PLRA 4IM7A 1SB9A 4WGGA 2PD3A 4JN6B 2X5OA 3PEFA 5TNXA 3PDJA 4NH4A 5KVSA 4EJ6A 3JQ7B 5L7TA 3F46A 1VRWA 3GMSA 3VZPA 5DDIP 3H9JA 1F17A 3QW2A 2PZLA 3SJ7A 7ADHA 4NK4A 1YVEI 4KQXA 1M67A 3ZWOA 2IE0A 4J16A 3DZGA 3GF4A 4DBVO 2V6GA 3PRJA 1GUZA 2GR9A 5KVCA 1ZSVA 2FN7A 4GKBA 3PWZA 4DREA 4CMCA 1KEVA 1NYTA 4P22A 3GHHA 4LCJA 1OAAA 4IDDA 4E4YA 2Q50A 1T4BA 1GQ2A 3L9XA 1P3DA 4XR4A 3U4DA 1PZGA 1PWXA 4G2NA 1E5LA 2PLAA 5KJFA 2PZJA 5EQFA 1NPDA 5EMHA 1LLUA 4HKTA 4EZBA 4IDEA 1TT7A 4NFHA 3RFTA 3GAFA 3ZI0A 2J6IA 3VHRA 1DIAA 3GUCA 1E3WA 1NVTA 2ZCUA 3ZV5A 3LDHA 4J7UA 2DUWA 3UOGA 4CMGA 1EDOA 4ZHSA 4FS3A 4K26A 2NWQA 2WMDA 1H2HA 4CM9A 4ZU3A 1ZK3A 4IBOA 4AJLA 4XGIA 5EPOA 3FWZA 3ZHXA 4FDAA 1WPQA 1Z82A 4NIMA 4E3ZA 3DFUA 2PR2A 4ZQHA 3ZWMA 4HXYA 2Q2VA 1NFRA 3MOIA 4WOKA 5HTOA 1AHIA 4GGOA 2QRLA 4I5FA 4RVDA 3Q2IA 2ZIZA 2PD4A 4PLYA 1K0UA 1D4FA 2BF7A 3WJ7A 3NDIA 4W7IA 3DZHA 1WP4A 3H9GA 1N92A 3ZWVA 3EGOA 4RVUA 3ONFA 3UCEA 1VL6A 4E5KA 4BNWA 2NSDA 3E18A 4MOWA 2O2SA 1WXDA 5KJ6A 1A5ZA 5A02A 3RJ9A 4OAQA 3GPIA 1NPTO 4LVCA 2VZ9A 4FBGA 5JC1A 1DIGA 3DQPA 5I9NA 2VRCA 4E21A 3I3OA 5LDHA 3MJTA 2O4CA 2LDXA 3HDQA 3IUPA 1D1SA 5IDYA 3DHYA 3E8XA 3ZWXA 2Q1WA 3ZU3A 2DKNA 4G65A 2X0IA 1DAPA 1PJSA 1HRDA 1SEVA 1M6HA 1C3VA 1LDBA 1PS9A 3EHEA 2AW5A 4J4TA 1OI7A 3QE3A 2D2IA 2C82A 4FR5A 1ARZA 4WLUA 1V8BA 1EUDA 2D4AA 2WTBA 3OF2A 3QIVA 4HFRA 4A27A 5KJ1A 1QKIA 4AJNA 3B1KA 3BMCA 2PKRA 2GZ1A 2WYWA 4U8GA 1SAYA 4BNLA 1FF9A 4BO4A 2JJYA 4EGFA 1T25A 3IP1A 3JCZA 5U4QA 1LLDA 4TRNA 4ZQBA 3Q3CA 5TQVA 1EFLA 3OIGA 3IJPA 1I5RA 2CNBA 1VJ0A 2NQTA 2Y05A 1H93A 2V6FA 2OXIA 1LC0A 1RM5A 1Q0HA 4WEQA 4B8WA 4FB5A 2ZB7A 2W2LA 4XQGA 4UVEA 1MG0A 2DBRA 1DIHA 3L6EA 1C14A 4OHUA 3CXRA 2Y66A 2B35A 4GLOA 4FC7A 1L7DA 2D59A 1PR9A 3DAPA 3OH8A 1P44A 3JYOA 2RH8A 5L4LA 3GVHA 4GX5A 3V2HA 4Z9YA 4AJEA 5ER6A 3VPXA 3C24A 5ILOA 2B83A 3LC1O 5EL0A 4ITUA 3FNHA 1EE9A 4BOYA 1HE5A 5JDIC 4N5NA 2D8AA 3JQCA 5CPFA 1QYVA 1K6IA 5KJCA 5HRUA 2DLDA 2W8ZA 1O89A 3SLGA 1YJ8A 3EUWA 1PS0A 4Z9XA 4BNFA 4NU6A 1DBVO 5A03A 2HRZA 2HMVA 3WX0A 1T24A 1KIFA 1PJ3A 1AE1A 2EG9A 3L0DA 4YACA 2GCGA 3WGIA 3I52A 5IZCA 1PJLA 5B4VA 4RPKA 1AHHA 5JFOA 3HDHA 3ROPA 3RCBA 4HBGA 4BB5A 4CLOB 3WQSB 5KKAA 4XJTA 1N1GA 4R9RA 2Z1NA 2PD6A 3TL3A 1MG5A 3QHAA 5I7SA 1H9AA 4OO3A 1Y9EA 4DPKA 3LT4A 1T2AA 2OMEA 3WDSA 3WIEA 1BXKA 1YDEA 3C8MA 3ZU4A 3B6ZA 3ZZNA 1PX0A 5U9CA 2C07A 1GADO 1ID1A 3MTGA 1GCUA 2HU2A 3PQDA 3DWFA 5IAAA 1PGNA 4R69A 3E5MA 4II2A 2OUIA 3WGYA 3EVTA 5JDCA 1LBEA 3GN1A 2GASA 1QLJA 3TZ6A 2AQKA 1JKJA 2HKIA 1UDCA 3ONEA 3RBXA 3U3XA 1NHGA 3H2ZA 1P74A 4H16A 2E37A 1PIWA 5G2OA 5KJEA 3WYCA 1KC3A 1LDNA 4WCDA 4TKMA 5B37A 1ENZA 1FXSA 1GUFA 1RM3A 3DONA 4KMSA 3RQSA 3DOOA 1U2DA 4PLWA 5F21A 4YPOA 1BW9A 2YFQA 1F06A 4F6CA 1XYGA 4M49A 4WE3A 3CTMA 3E9NA 1SBYA 4OKNA 4L73A 1GR0A 5CG1A 1N7GA 3GVIA 1K6XA 5F1OA 1HDOA 4YQZA 1TXGA 3JQFC 2XAAA 4BV9A 5T8KA 1AGNA 2QHXA 3VAZA 5DCWA 4ZA2A 2AA3A 2VHYA 3WSWA 3JD3A 5A05A 2Y0CA 3JD0A 3OSUA 2IZ0A 3E48A 5DT9A 1LLQA 4QO7A 2VYVD 4CLRB 1E6UA 3LLVA 2Q4EA 5DZSA 1IZ9A 1LSUA 5H81A 3DMTA 5JLAA 1ZNQO 3JV7A 4BQPA 1UP4A 5I9MA 1XIVA 4N54A 2JD1A 4C7JA 4NBUA 1PJQA 3CH6A 1WLYA 1ISMA 4NBTA 1EQ2A 2Q4BA 3JQAA 5JAIA 3G49A 4NNJA 3ITDA 1K3TA 3L4BA 5BNFA 1YQGA 5DCYA
chains in the Genus database with same CATH superfamily
5LA6F 1YA4A 4EGCB 1JG6A 1QMPA 1G8HA 4MVJF 5I4CA 5JC8A 1EVLA 2EWVA 5DP1A 7AT1A 2J41A 1JPNA 1WDMA 2A1UB 3RFFA 1E79A 2ZVDA 3NHAA 4AMUA 1CUCA 5HS6A 5K45A 1KMHA 1OZAA 3MGGA 4QWMA 1A96A 4GYWA 5ICEA 1QF6A 1QVAA 4DNFA 1N2OA 2DBVO 2I7XA 2NTJA 4FJ1A 4Y67A 1UBTS 2TMYA 3GEGA 1UADA 2BEVB 3VHLB 3P0JA 4CUZA 3VTFA 3T9BA 4TVBA 4UTNA 1N32B 3FHJA 3F78A 4B0OA 5C1PA 1BU8A 2O4UX 1NX9A 1PHPA 3CF2A 5AYVA 4W4TA 1KH1A 2J31A 2VSXA 2P5SA 1T2DA 1Q0UA 4LISA 3STUA 4ZRMA 5JAOA 1JAIA 4CTKA 1SH7A 5BORA 5KNDA 2H4XA 2VDUE 4Y2VA 1C7IA 5IZCC 2ODQA 4D0SA 2RKWA 2DHDA 4KIGA 4NOKA 2W6ZA 3K0KA 1IH8A 4Y9TA 4QDTA 2J9RA 5ED0A 1AIPA 1GLVA 4GICA 4IO0A 3HZHA 2OGTA 2QX7A 3FDIA 2QRKA 4FXPA 3CIFA 3Q7EA 4JJAA 1PWZA 2PG3A 3P2MA 1TTQB 3P19A 3K31A 3FOZA 4ACBA 2ZSHA 3MLAA 2OPHA 3NTQA 1SHLA 4INPA 3AWDA 2ECPA 2FEAA 2R79A 4NE2A 1UXKA 2JAPA 2P35A 4JSYA 4QQ8A 3WB1A 4A2QA 5JH7B 4ASUA 3WBBA 3IDFA 2GFHA 2D5BA 1HNWB 3ZGZA 1W2GA 1NI4B 1ISSA 1N1DA 2W6OA 3DLAA 3F67A 3FCYA 4HRXA 3JS5A 3S2SA 4TYYA 1Z26A 2C59A 5FBLB 4FSHA 3SE7A 3ANLA 5CFNA 1WQ1R 2JHCA 2J32A 3BWBA 3PXXA 5TE9A 5JNVA 3AI3A 4CEJB 5J23A 1GA4A 3PXBA 3DC2A 5GOTA 1NR7A 3FFAA 3IODA 1XAHA 5T4HA 1UIRA 3JWPA 4REQB 1E18A 2D0OB 2BKAA 3HBJA 1VPVA 5F4ZA 1EB9A 2EFGA 3JVUA 1ADBA 2RIRA 4YR9A 2ZYSA 3FGZA 2NZ2A 3RUHA 2CVZA 4A6EA 2ODWA 2ZGVA 3A9UA 4LJSA 4C7BA 1Z5OA 2Y1EA 2FZ4A 3BL8A 4H6PA 1T5DX 4PIVA 3SR3A 3SR0A 1J49A 4LY3A 3OZWA 1YZVA 4BN0A 3H4MA 1G41A 1GDHA 1I80A 4MW2A 4PGGA 4X6YA 3OZEA 1QNLA 5GMOA 5K6AC 1QU3A 1IWPB 1NYQA 5GV7A 3QKSA 2BBOA 4P32A 5FWDA 4LK3A 4WA8A 3VGPA 3HJUA 2VDWA 3RYFA 4ICIA 2VXYA 1Y1TA 2ZZKA 4D3YA 1G9XA 3U6BA 3T5BA 5IT5A 3MHPA 4B32A 4XFKA 1T5HX 4TZTA 1I1NA 1NWCA 3EIEA 3NIFB 1EZ4A 1X77A 2VJCA 2QTFA 3DMTC 1SD5A 4YI5A 5EYPB 4MW5A 4KQHA 4G07A 2AEMA 6GPBA 4MIYA 1NVKA 2GBGA 4H7HA 2VDRB 3SOZA 2FDXA 4ZI5A 3F4LA 1BVUA 1C3LA 5CITA 2B6HA 1QK5A 2JFHA 3K4QA 3BRCA 3DQQA 5JH7F 4C7MA 1XU7A 2VJDA 2Q7OE 3AEKA 4FDMA 2CXOA 4OG2A 4J2HA 2V97A 2CFCA 3CRRA 1BKSB 4MO9A 4R1TA 3SHTA 4CV2A 2I22A 2O5VA 1TEVA 4HDNB 3MTQA 4UHKA 3MCVA 2XXAA 5EZYB 1IL0A 4P5DA 1ZJWA 3ZTTA 3L1KA 1HA3A 4JJEA 2A9KA 3CT6A 5CB4B 5IFLA 3QSYA 1MB2A 3RS2A 1I3NA 7YASA 5DTJA 2DG2A 4RK7A 5AP9A 3RC7A 2GK6A 3FTDA 2JGLA 3UTCA 2VG8A 2ZJ0A 3CFYA 3KFVA 3V8EA 4EW1A 8GPBA 5K3OA 3ZD8A 2DE0X 3E82A 1Y3FE 3MS4A 2W6IA 2XDAA 3N3AC 1TK3A 2BTQA 2CNOA 4DA6A 3IT3A 2LIVA 3E6AA 3T5DA 4PBTA 4Y18A 1EUDB 3I1FA 2SKDA 1OFIA 3B2EA 1J06A 3OX3A 4HQKA 1UF9A 3ZKWB 4LFCB 3U7QB 4GXTA 3UA4A 2BD0A 2XXJA 3VKVA 2PS9A 3QLJA 4FE3A 2R1VB 1QH8B 4GVXA 5GWXA 1RQ2A 3O8QA 4RTMA 3LDAA 3AF2A 2JBWA 4Z5XA 4NYJQ 3DMNA 1M6YA 2M1ZA 4OI1A 4WHMA 4EY7A 4OHBA 2HV8A 1PGOA 3OCXA 4EQ6B 1EM8B 1ZKDA 1N2CE 3BILA 3ORRA 4GMHA 4LKRA 4MV9A 4TV9A 5ESXA 4URFA 4B80A 3A9SA 1OA0A 2C1XA 3HM2A 2EFYA 2AN5A 4RPJA 5EIWA 4BB9A 5ECWA 3AMVA 2BUBA 4O4IA 4A16A 1R2QA 2V3WA 3W6UA 2R8EA 5TGTA 3MCTA 3SQOA 3VUFA 2QTHA 3VVMA 3S2ZA 4QVIA 1U02A 4Z1MD 1JAXA 3Q9UA 3PLAE 3NONA 1ZSNA 4DG9A 4U2EA 2FPRA 2NTVA 1WV1A 2QRGA 4MWBA 2UYCA 4EELA 2OV1A 2QYSA 3S7TA 1RLTA 2B9EA 1KK2A 1TVMA 2JGNA 3C3JA 3Q3JB 4GKJB 5FTWA 1FU4A 3CS3A 3QNUA 5FOVA 4PQRA 4BNHA 2NQ8A 1MB9A 3GRRA 4CM3A 3TNYA 1R8SA 3DYIA 4RY2A 1RKQA 2V5AA 1I3LA 5DGHA 1B43A 2JCYA 3AFGA 4LBZA 4IX9A 3FZQA 4QDUA 3COPA 3IP9A 3GUYA 2LWIA 5L3SA 4LRQA 3V1UA 2QTTA 5EZYF 3RAPR 3H13A 2GTPA 5CB4F 5JROA 3WGGA 4QPDA 1W85A 3PJGA 2Z6UA 1KO4A 3KZCA 1ES9A 1SCIA 4TXLA 1LDGA 1YRYE 2FGKA 4UBOA 5HF5A 1YXMA 5THQA 1XEWY 3LLCA 1KMNA 5NLLA 3TLEA 4PHCA 1NRJB 4HNSA 5HDBB 3RREA 3PC3A 3MBIA 2NUPA 4I19A 4CE6A 3ORHA 3HJRA 1KVRA 2XMPA 2PCJA 4I5DA 1YQUA 1UBMS 2NSHA 3RVBA 1AGXA 1RW4A 1GRRA 4MQEB 5BW4A 1T4MA 1VE7A 3UCXA 1IZYA 1V96A 2FFQA 2G1PA 3S6JA 1CP3A 4ZU1X 1E1CA 1U94A 3HABA 1ADCA 4MVJP 4J29A 4J9VA 3U0BA 3ZCSA 1OX4A 4MV6A 5EKDA 4AXBA 3THXA 4JL6A 4ZMRA 3F3KA 4JT4A 2OD2A 1EYZA 2DX7A 2ZBVA 3ZHBA 5I7AA 1Y6FA 1F12A 5UKDA 1GZSA 1N2EA 1O4WA 3J7TA 4PG5A 4X8HA 3P9KA 3WGVA 5BRJA 4FZ3A 2VUIB 3UMVA 1W8IA 3DFZA 4XIYA 5KYWA 1R8XA 4WSOA 1VGQA 3WLFA 3VJRA 2CHGA 1E7RA 3AHDA 4MJ3A 5D8DA 4TRMA 3U80A 3I61A 5AW4A 3E23A 4M87A 1Z2OX 3BFXA 3FWYA 3LXUX 4ZALA 1NXWA 2PMWB 3N0XA 3FRJA 3ZE9A 1N2JA 2J7KA 2ZRHA 1YULA 2HHJA 1MX5A 3MPOA 2X42A 4JSRA 5SYAA 3WNBA 2OBLA 3HXLA 4YLYA 1NLYA 1B42A 1NIJA 3AJAA 1R74A 1Z7GA 2HPZA 1NF3A 3GFRA 3OKCA 3ZDZB 4O3MA 1X9GA 2R0QC 1NV9A 1TUBB 3ABQB 1IQRA 2V7PA 3F73A 1CUFA 1H42A 1PZNA 2KBEA 3ZEIA 3H97A 4TN5A 5F3WB 4RABA 3M49A 4FLFA 4Q4DA 3I6IA 3U7FB 4QOJA 3NASA 4B9AA 2IYSA 2DUUA 2QI9F 1BEUB 1K4KA 1FLNA 4Y3UA 3EDQA 5F1PA 3RHZA 5JVDA 1KJZA 3S81A 1K4YA 1JR3E 3DC7A 4GQIA 4KE8A 2HPHA 2BVNA 4M9CA 2X0EA 1KC1A 1CB7A 3QNMA 1QG6A 1QNFA 2A5YB 2OTCA 4YT5A 4AKGA 3GA0A 4X0EA 6ADHA 4MRVA 3HB5X 1YL6A 3GDFA 2C7PA 3ENWA 3ID6C 3OIFA 3P4UA 4DLRA 1Y63A 3ER9A 2G40A 1UMDA 2GK7A 3G1TA 3PHHA 2VUUA 4YIKA 3AR4A 3KSAC 2FRDA 1GEGA 2HRQA 1N2CA 3ADPA 5TLSA 3M6UA 4XDYA 1PZXA 2DY0A 4FYMA 3HDGA 3RWMB 1JDZA 3VZBA 5IWAB 4GWKA 4C7KA 4JJ6A 2FPOA 5AJWA 1CRZA 2G63A 4I4TA 2XOEA 3RVOA 1AUVA 4HYEA 4KPUA 4FE7A 3M0EA 4XYBA 3UKJA 4ZFNA 3OBBA 2ZYIA 3I23A 2CFIA 3GVXA 5JALA 3IOCA 1JQEA 2WF7A 2HXSA 1OI3A 1C8KA 1CF9A 2OP1A 1P1JA 1XDUA 5A4MS 2E5WA 2GX6A 3HY4A 5AHXA 5JYDA 5AVWA 2WILA 3ICWA 4UAJA 3UMJA 4C3OB 3WL3A 3LUDA 3LA8A 3AYXB 4NEQA 1UZMA 1SNYA 3QLVA 2QUBA 1QBGA 4DLUA 4FR0A 4KK3A 1LJ8A 1V3TA 1XL0A 2XCUA 1UFRA 2DWUA 2GUGA 2POCA 4INZA 1D2HA 3U44A 3HCOA 3W2TA 1CY7A 3JYNA 2P68A 2VAPA 2X9VA 1HZJA 1O97D 2MSEB 3H11B 3KBOA 4N7BA 2BKUA 1UWLA 2WABA 2XT0A 4C4ZA 3AI1A 2FOIA 5L3ZA 1L7BA 1NQWA 3U7IA 4CDGA 4YPFA 4X41A 1FUYB 1B26A 3UGQA 3EXHA 3K9QO 1F14A 4CYMA 2UUAB 4TQUS 2BRUA 2RB4A 2W8BB 4GC9A 2ZIAA 5HWSA 2FWMX 1GGKA 2RGBA 2DYKA 1EJBA 1AO0A 4F3KA 1YJQA 3RIMA 1AKNA 4DQDA 1LK5A 3BMQB 2R6DA 1HTBA 3VI3B 3EHDA 3QE0A 3O3MB 4PLVA 3FX2A 1V8FA 3G1UA 4IF4A 1DG9A 1ZO8A 1WXXA 4KGDA 2E1RA 5EHIA 1WNTA 4N3BA 3H5AA 1IB6A 2FG7C 5HF6A 4HAVA 1DIOB 5ALGA 2Y1GA 1IE3A 3LKVA 1E2LA 1EIZA 2ZW9A 3MLBA 3F90A 1Y6JA 5INTA 1C2YA 2FLKA 3HDJA 3U9TA 4CQLA 2WWWA 5I51A 3IQDB 1IN7A 2J5QA 2ZUVA 2WLTA 3D6JA 3F6PA 2QQEA 5AI9A 4YYZA 3T5AA 2WICA 5ED4A 1PEAA 4YJHA 3SEZA 2Y76A 4FGWA 2PMCA 4EJSC 4OX9Y 2VPIA 1Y8CA 4BE9A 2XGJA 2YWDA 4OJMX 4GMFA 4BNYA 5C18A 1KYIA 3FYHA 2XKBA 3FWNA 5DGDA 2C88A 1K92A 4MMXB 3GEDA 3DAGA 3CVJA 2NO0A 3LUJA 1KI9A 2QUZA 3K5PA 1JHAA 3M9LA 4GLJA 2ZWAA 3ZNPA 3ZU2A 1EUYA 3MW8A 4QPCA 1ICIA 5JNSA 4LHZA 2O7QA 3ZTWA 2VUTA 1NUUA 3GHYA 3H8SA 1KYTA 3A9TA 3D2LA 3UHFA 2PDAA 4U7WA 2FR1A 5G0UA 2OBMA 4HUTA 1Z07A 4UMFA 3NJ8A 4A5SA 4CLHA 3RC3A 4HVCA 4B7ZA 1I7NA 1PEKE 2VCYA 4X65B 1M34E 2XUOA 4WFQA 4BXOB 5BSTA 2WAAA 4P58A 1JHRA 1IUNA 4DMCA 2B1RA 2E4YA 3EPHA 1B16A 4PX5A 5JMWA 1SXJD 2I55A 5CDGA 5CEFA 1N6RA 1JR3A 3OQBA 4V0KA 5L40A 2WW8A 2QRVB 3IMFA 1XP5A 5ES3A 2WE8A 5KSWB 1KGSA 1QP7A 3OHPA 2BEUA 4M9UA 3LQKA 4K05A 1H94A 1NXSA 4CV1A 1NDUA 1BG6A 1PG2A 3KAPA 3EARA 1KI2A 3DLTA 4MHOA 4X90A 1J99A 1FDSA 1O9GA 2CLSA 2PUTA 5GONF 1SBQA 4PYNA 4TTRA 2JZNA 2UUBB 1VBFA 3CUKA 4IVRA 4ARSA 1IPFA 3E2IA 1EFKA 1SVMA 1V43A 1W49A 3W77A 5DI3B 4ZEMA 3IHKA 5EWMB 1G5PA 4IZ6A 3FKSA 5THKA 3UJ3X 4KH0A 3ROMA 2EL7A 1UMBB 1UZUA 2ZYUX 4YAGA 2QG4A 1M0EA 3F3SA 3IR5A 1FFSA 3C14C 1PFVA 3WNDA 3EOAI 1UJ2A 4UHFA 1VG9B 3GBSA 1RZRD 3DGFC 2V5VA 2G9NA 1X6VA 1XZBA 1WO8A 4EL5A 5D6OA 5AM1A 5K8IA 4ER7A 2ZIXB 3TNDA 3ADDA 1NG1A 1U0JA 4DMHA 4KB5A 5BSFA 3ZW8A 2KW5A 1FDIA 5JZMA 5JJLA 3HKEB 4QJ5A 1K27A 1TKAA 2VPQA 3FA2A 3LD9A 4Q7EA 3SHFA 4YRIA 1FJGB 1XMQB 2B8EA 4WOCA 3ND7A 1IY0A 2V7QD 3RABA 4DLWA 4D92A 2H2GA 4MUXA 1F8FA 4KLCA 1ACMA 2ZYHA 2Q8QA 3C5HA 4R9SA 4L6AA 2F55A 2P8SA 4FCCA 5B58T 5L51A 2YIVX 4K6KA 4UE6A 2IYWA 2E49A 4WW0A 3H4TA 3WMXA 4YJ2A 5A0TA 5EJIA 4EITA 2FLWA 1T9KA 2O2HA 4LV6A 3ETGA 5LZ4A 1YU9A 3NWBA 4C04A 4PNHA 3EISA 2BZ0A 1JECA 2VDPB 1G16A 2A5FA 1OXVA 1EWVA 4EP1A 1HYEA 4FFOA 2HO4A 3BBPA 3K6SA 4LHVA 5JEEA 1R66A 2F9FA 2G7MC 5E6RA 1BKDR 1NQTA 1RTTA 3I9V6 4GIBA 4KQFA 5DGIA 3PL1A 4DCCA 5TV2A 3GLFE 1NNUA 1NF2A 3ROKA 1ZD1A 1X92A 2Y27A 3CJQA 4XYLA 1CSEE 1RKBA 3IMEA 4FYXA 4QOSA 2GYVA 1KBZA 1DGQA 1QGZA 3IAFA 4Y1FA 5CIYA 3DR5A 4P7KA 4HZUA 2H8KA 2P6MA 4FONA 1G20B 5FO0A 1SXHA 4RF3A 1GZDA 3SSMA 4BU0A 3PRKE 4IMJB 2OQVA 5ALDA 3VSAA 1N3YA 4R05A 1S6YA 2J3IA 2ZBFA 4C87A 2C92A 1EVYA 3NBFA 4MUFA 3UN1A 1VE3A 1FYFA 1Z4NA 4L5YA 3ICCA 5F9HA 2Z4TA 3Q0EA 1AB5A 3A1EA 4DDUA 3R0IA 2XUQA 1ZI8A 1MIOA 1J2RA 1NZFA 2VK4A 3KYDA 4O4HF 4YRPA 3K53A 1SFRA 4OHMA 2OWEA 1KQ3A 3QUTA 4OX9B 1BS2A 4LXXA 1DX4A 2SBTA 3BRQA 3DE2X 2ERCA 5AHKA 1U0OC 3WGTA 4HPXB 1M34A 1U9YA 1YVPA 3R8XA 3TNJA 3VZQA 1KO1A 2C4NA 2VJMA 1JHYA 3CMMA 3GAMA 4F97A 4RUKA 1XF9A 4RIFA 1I6KA 1JBEA 1K89A 3CKYA 3ESAA 3OT5A 4PG6A 4XH9B 3RF7A 5JZOA 1HEIA 1SOWA 3NHFA 3ZEAA 5EXTA 2QLMA 2UAGA 3A6JA 3LK7A 3AHHA 3PC4A 4U1RA 2D1SA 2M2IA 4X7PA 3RRJA 4A10A 5JTTA 3AF6A 1JFRA 4K5QA 3USCS 1TYEB 1V4NA 2HF9A 1P1RA 4RYLA 3I9NA 2VT2A 4X92A 1MRSA 2OSVA 2VNJA 3GRVA 3L0OA 2QSZA 1HT0A 4Q4JB 1E2MA 2CBZA 3EGIA 1ZXBA 1TEHA 2GJ8A 3N2IA 4ENQA 3QOWA 2HSGA 2D3TA 4ZTBA 5LXTB 2CT8A 5D84A 2OFOA 4FN5A 4ZRDA 2O07A 1XZMA 1Y8RA 2P77A 4U3JB 4N3GA 4X24A 4DA9A 1P2UA 3IIIA 4PAWA 4AG3A 2YICA 1ZHOA 4AAYA 5EJ4A 4L4ZA 3BUSA 2JLAA 4HDRA 3ASZA 4L15A 3G6KA 1N8SA 4OKSA 2C5AA 3G0DA 3ZWDA 4ZQHA 1PBNA 3NDJA 4PR3A 3D2BA 3D5TA 4PQGA 2YWEA 5AW7A 1Q2UA 3VPCA 3MWDA 3K70C 3VC7A 1Z25A 3B9BA 1C0LA 3KVOA 4JNCA 4XDHA 5K6AA 2BGKA 3HP1A 2GB4A 3MJEA 4H7DA 4ID9A 4JOSA 4LPSA 4M2LA 3X2EA 1MZPA 4EBFA 1TECE 2D6FA 4AJ4A 5FBWB 2ZBDA 1NVXQ 2FFHA 4Y9DA 3IESA 2VHQA 4O1HA 1SK8A 3IQWA 4C0AC 2FEXA 1ZJ5A 3CX4A 3LLMA 3IAXA 3P9NA 1RIFA 1QRRA 1SU8A 2CHFA 2D5AA 2ZQYA 3OPYA 4M60A 3R9KA 2OB2A 1Z0IA 1ZI9A 4XD2A 1T10A 1Y5IA 3N2KB 4UPEA 4EG6A 5DN6D 3I9FA 2HYDA 1TIBA 5K3DA 5JZSA 3WP1B 1N5IA 3N8KA 1TQHA 1U5BA 3PTLA 4HAUA 5CLIA 1L4YA 2QD4A 3C7CB 1UXJA 2DBYA 4LRWA 1PFYA 4NICA 2JGDB 1DEHA 1QH1A 2N75A 5B1HA 4XD7A 3TIVA 3TQFA 3VVLA 4DAEA 1IYZA 4JGIA 1PTJC 1RAIA 2ZBGA 3ECCA 3NFYA 1OX5A 4MYRA 3CX3A 1H05A 3KVRA 4JA0A 4XZ3A 3TH5A 3NHWA 5T64A 2WY2D 4Q18A 2LCIA 3HEAA 2QE6A 1EJ6A 2HREA 2JRLA 4HAYA 4MR9A 1E1DA 2L18A 4AWXA 4NJEA 5A4FS 4PG4A 1S9DA 5BVHA 3IUQA 5DBGA 3TAXA 1DTWB 1PCXA 4J1SA 2C4HA 5C9ZA 1M6WA 1NJ6A 4PAGA 4L0CA 4GI1A 4TM7A 1JWBB 4H4DA 1OYOA 5A3VA 2JFNA 3RGGA 5BMVA 3GLFA 4I8IA 1XB2A 5EIBC 4UM5A 2GN6A 3FVTA 1RQLA 1UBUS 4ZQFA 2MYPA 3KHSA 3I2GA 3U2QA 4NBVA 2BBTA 4RTQA 1PSZA 3DDOA 4KO4S 5FI0B 3B2NA 4LY6A 4MRPA 4O2AB 3WS7A 1WV0A 1VE1A 3O3NB 2IPMA 3B7WA 4CL8A 4NAUA 4Y6OA 1N3LA 5IJ9A 5KOYA 1MORA 4DS3A 2QMOA 4KYTA 5IBQA 1H2FA 1MNQA 3KB8A 2WWRA 5FF9A 5KYUA 4N5HX 4DANA 3VKGA 3DCJA 4G36A 1GV0A 2W6QA 3DVQX 3M3PA 3ZY3A 1Q1ZA 3WLPA 4H31A 3B9RA 2CJXA 5DGCA 5C52B 3C3WA 4FB4A 3JALB 4AN0A 3GR6A 2C83A 2PVCA 2MSKA 3VOTA 6YASA 5EPUA 4DV3B 3PGA1 1CJVC 1GU0A 3Q12A 1AU9A 4EB3A 3UHPA 1VMKA 5IKPA 3I12A 1ZNXA 3O4RA 3EAQA 2HHCA 4US1R 1KZ1A 3BJMA 5FH9A 4DBZA 1MW9X 3DLIA 4CQMB 3UT5B 3IBGA 1W34A 3DE6X 5F76A 5TQ2A 4D4IA 1MAVA 3ZCVA 1R0ZA 4N49A 1TMGE 3O47A 3A9RA 5LQSA 2QRZA 2IGTA 3IHTA 4OY3A 4HS4A 2EGGA 3C3KA 5AVTA 1YK1A 2IU3A 4TLMB 2A57A 4YHHB 4JLAA 2DC1A 4C4OA 3MIZA 3N70A 1EFAA 1ULAA 2QMHA 3LIIA 4WEOA 1XRLA 1YZNA 2AI2A 2AG1A 3NHRA 4IDQA 1X1BA 4CDMA 4DN6A 2JFBA 2PU5A 3AFNA 3SYRA 5CCBA 2R6HA 3O83A 1QP8A 3ESRA 2P8JA 3H6KA 1L5NA 2WF5A 2P11A 3DEJA 1CWUA 4V0QA 4AD8A 4ILKA 1VLJA 1ADFA 4JXKA 2YHBA 3H4VA 4W8GA 3LCRA 3WK4A 3JQ9C 4UTVA 4G25A 1EXVA 1RCFA 3O1JC 2CYAA 1CLUA 3REGA 2B4TO 4EWLA 3GY0A 4WADA 5FUQA 1DKOA 2IEGA 2QIOA 3R24A 1JX6A 3N8DA 5ECDA 3JD2A 2RGXA 2IX3A 1KXZA 5CCXA 2QGNA 4MLCA 1QMGA 3OHSX 4IUDS 3EFBA 3HWWA 3PCRB 4QQNA 5JNWA 2BFMA 2QE7D 4O2AF 1I7PA 2PMKA 5A9SB 2YZGA 4LWPA 3EY9A 3K72B 1Z7BA 3N6VA 3HJNA 1R4NB 1MR3F 1V9CA 1WCIB 3AHEA 3NV7A 3KXIA 4L72A 5AKGA 4R3NA 1UKBA 1VG0B 1KJNA 4KYVA 2PYDA 1CYEA 3FF4A 1WQ4A 1KO5A 1NW5A 5KYYA 1UJNA 3MCUA 2F1IA 1NYLA 3WL5A 4BFSA 5JS7A 2POQX 3D1LA 3WMFA 1OGJA 2JDID 4AZVA 1GPMA 2V5UA 3FY4A 3I4CA 4JEHA 4QUBA 3PLNA 5CK5A 1JYEA 4C21A 4IEFB 3LOUA 1GSHA 1UJCA 1SUPA 1MZVA 1PL7A 4W1PA 3N74A 4KUHA 2FSGA 2NVWA 5EEHA 2FX3A 5EQTA 1OFHA 2VTKA 1JIQA 1FTGA 3L4KA 2PR7A 1AZWA 2I4LA 2WSLA 3I04M 4RMJA 3B13B 5FOUA 4OBXA 4BGVA 5IJAA 4E12A 1V4BA 1LCIA 3HUDA 2R8XA 4FFMA 5ITZA 1K9VF 5AW3A 3KQTA 3G79A 2IL1A 2B25A 4KWHA 4P4UA 4GD3Q 4L4RA 1TO1E 1UBJS 4DLYA 1GYPA 5DO9A 2D62A 4ZYVA 1NKTA 2FN3A 3O91A 4IDFA 4DVGA 2B4QA 1Z6PA 1J00A 2HF2A 1KTIA 1KYZA 1YZLA 4I9UA 4EW6A 2ZTSA 2OL4A 3F8TA 1IOLA 2JH8A 1YE3A 1VM6A 3PB3A 3N53A 3OQPA 4JEIA 3M82A 1OC2A 1IZZA 1WTCA 4RSGA 5EQDA 4M98A 2ZI7A 3AY3A 3LAWA 3ZXUB 4Z4GA 4BTVA 4FFPA 4X5OA 3WGUA 1U0RA 3TAUA 3K7EA 3ZHCA 2XIQA 2VCEA 3DWEX 3KD2A 1ZGCA 3G02A 2HF8A 4J0DA 4IGAA 3KKNA 1ISGA 1Q21A 1QHIA 3AVQA 3RTGA 4OHXA 3WKCA 2EJUA 2ET6A 5AW6A 2BTEA 5TQ0A 3CWZA 3CZMA 3ER6A 5C8ZA 2VSYA 4UREA 2OVFA 3NBQA 3PHJA 3LQRA 1G7SA 3PJEA 5CX1B 1KYQA 1JLSA 2FWIA 2EIXA 4P4SB 2C9OA 3KAJA 1P19A 2H9YA 2OQRA 2VDLB 3A3OA 1P4GA 2ASEA 1DUVG 3TRHA 3PNMA 1T1GA 2NXNA 1UC5B 2EZ4A 3DOHA 4V0LA 1A82A 1OTXA 3AJ8A 3PXDA 3ZK9A 1CUAA 4DCOA 2XKJE 4EY5A 1A7UA 2HQSA 1Y9JA 2JD2A 4F72A 3A2KA 2A9FA 3GUVA 4W5JA 5HFAA 2RDMA 2ONKA 3IOBA 4GMXA 4A0GA 4D26A 4B40A 4ZGBA 4KXQA 5FL3A 1CUJA 3GLGB 4ALNA 4YUWA 4WIAA 5EJ2A 3QPCA 3KJFA 2W4MA 5SY4A 3TGWA 1DBWA 5LOVF 3IC5A 4U2CA 3P9ZA 2Z98A 4RS3A 4U2BA 5GZ6A 5HE8A 2H8GA 1PFUA 3GGOA 4RSRA 4CIYA 2JGKA 4E32A 1TJ5A 3LBAA 5F7OA 1Z3CA 4CT5A 5K0JA 3DTYA 5JTUA 4M0PA 3AEQA 5HCUA 1U0LA 1W2WB 1CS0B 1EXNA 1W76A 2PKXA 5L9AA 3FYDA 2LR0A 2GYYA 3DH0A 1TGYA 1ZSYA 3JQGB 3MOSA 4OFXA 2JEOA 1NMZA 4K8OA 4D6XA 3CTPA 1QUEA 3COWA 3T4XA 1OFUA 1V6SA 4P3OA 1EG7A 3DFKA 1QKJA 2BHNA 3BHNA 3MWEA 1Y37A 3UFXA 4RCYA 1XD9A 2PRYA 5ERGB 2ZDGA 4ZCTA 5H59A 1CIVA 5G4KA 1DT5A 4L7QA 3EZ6A 5HEKA 3UF0A 5JD6A 2OK8A 4UMEA 2ZRIA 1OT3A 3D1VA 3SLRA 1B73A 5DYGA 1WRBA 3VR4D 3F98A 1RHRA 3ZWQA 2YVAA 2ZE8A 4O0MA 2FX5A 3WLEA 2YKGA 2YHIB 4E1AA 4YUVA 4MQ4A 5FFNA 8ADHA 2ZBPA 3OLQA 3NDPA 4L8GA 1D2RA 1O96B 3A06A 4MB0A 1QRTA 1PDWA 4R2MA 2F62A 4J3FA 1E4EB 1NQUA 1G3UA 3O4VA 3ZJTA 1D07A 5LA6A 4CM8A 2E21A 2GJAA 1A9PA 4HMPA 2ECFA 3WSWA 1HX7A 4K2AA 3L6CA 1UWCA 4URZR 2IVZA 1VBMA 4EJSA 1GNVA 2XDQB 3TLBA 2P9CA 1TDJA 2V96A 3U62A 1FP6A 1EBFA 4DLNA 3DE1X 2H06A 3QKTA 2MWMA 5K0NA 4IHJA 4R7GA 1RC1A 3ZDYB 3CKLA 1SBNE 4EF4A 2EYUA 4UUNA 4WJZA 2IUUA 2VO1A 1JFFA 2C9ZA 4R8MA 1QFSA 5A9TA 4RESA 2Z2JA 3ZXYA 3DBRB 1G0NA 1ZA1A 2K87A 2QVCA 5D1NA 1UFVA 1MQAA 3GA5A 5JXJA 5LFAA 4W6ZA 1SUAA 1FTSA 2VDQB 4RY8A 1O5OA 2B5WA 3T4EA 2FCRA 4WERA 4AQYB 2Q3HA 4L9WA 4L50A 1RCTE 2DHQA 3HWRA 2G9RA 4MX8A 3W9UA 1SIOA 1VKOA 3OM9A 3QFSA 4PS1A 3TSCA 1WW2A 5LZ9A 5MHTA 1Z2CA 2IVFA 3LRXA 4B43A 2I8LA 5BXQC 4JC5A 1TLFA 1TF7A 3HN2A 3MTAA 3KP1A 4RFSA 5AK4A 5I3CA 1GWNA 4XDGA 2FE1A 1F8XA 2ZJ1A 2BKLA 3K9WA 3MINA 1NJ5A 1AQLA 3DAFA 3JATA 4GP9A 4KRXA 4MQBA 4PU0A 3R5HA 3ROXA 3ZXIA 3ZCPA 5KDDA 2CDBA 2OKGA 4Y2TA 5JJCA 2EKDA 3DOJA 3OIDA 3CSUA 4FR2A 4HQRA 4JX9A 1IPEA 1RP1A 4WNAB 4DSTA 4F1KA 2ZRNA 1A8SA 1E7QA 1QE3A 4MH0R 5B1IA 2BFFB 1HDZA 3LV8A 4XSGA 5DLDA 5J5VA 5BP7A 1HLPA 1JSLA 3K1JA 1O7JA 5AI5A 4DLPA 2H5LA 5TS3A 4R8VA 2H59A 4UVDA 4MVJH 3U4AA 4O5OA 4EO4A 1EFRD 4UNSA 1JV2B 3GRPA 1Q0TA 4DQVA 1QIFA 1DKRA 1TYAE 5FKJA 2G70A 2P9GA 1F5SA 1MJFA 3VU9A 1Y8QA 2VQEB 1Z0UA 4KRYA 3S68A 2VT6A 2FSSA 3VI4B 5IWCA 4D45A 4EGQA 1TE2A 2NXCA 2XODA 4HB0A 4A73A 1TQ6A 5TPWA 1R4MB 1PQ4A 3P9RA 5CNIA 1D5CA 1WOMA 1NVMB 2O1SA 3FPKA 5FTKA 2PO7A 2DWPA 3KETA 2ZUCA 3GI1A 2FPWA 4HRYA 2VTBA 1JE0A 1J2EA 1ZK4A 1M1NA 5TJHA 5FUBA 4UDXX 2HRCA 2VCHA 4LXHA 1ZOSA 2C58A 4AICA 3S2FA 3ULKA 4S12A 4ZZIA 5JZBA 4N6GA 8MHTA 3TVTA 5ESWA 3V2IA 1XNHA 3EC1A 3P96A 5THXA 2BEVA 3UUFA 4BJ5A 3DJFA 4F6RB 4F9TA 1JVBA 5ALVA 2ZYAA 3C98A 3QMWA 2Y0DA 3L7CA 5FNVB 2A94A 2M9MA 3M81A 5F3DA 2WG0A 3AKZA 5F98A 3L5OA 2ZZNA 4LDRA 1Z9BA 2JCXA 4CJXA 1GAWA 5CGZA 3E53A 4BZWA 1I4TD 1VE9A 1WBJB 4HB3A 5K3FA 4RTLA 5KQGA 4NZYA 2NM0A 5BUZA 2QYTA 3PICA 2EZTA 1V8PA 2FFBA 4OB7A 1PT5A 3CUSA 4C29A 4OL0A 1CY2A 2G9VA 3E84A 4G0PA 5DXFA 2YVUA 1ZR2A 4EA6A 2WSSD 2QOEA 4RL6A 3T1HB 2I6UA 3MWJA 4X6XA 2V74B 5LQDA 2IS6A 2O6LA 2OR3A 1JTEA 3LX6A 3EVZA 3GG9A 4WT7A 1QONA 2DFKB 4BFXA 1EPUA 5JH7A 2YFHA 3B6KA 2DMRA 4EB8A 2CL5A 4QOHA 4ZEOA 1WF6A 3FLMA 1VFPA 4A2CA 1WZUA 1ZL2A 1NI4A 4PVCA 1USUA 3WQHA 2HGSA 3NHZA 5JQGF 4LFAB 4I55B 4RMGA 1W52X 2IZ6A 3U09A 3SVTA 1SHKA 4MMZB 2RIPA 3GJSA 3L8ZA 1SHJA 4YCAA 3VC3A 3W3ZB 5JMTA 4YP7A 2XCSB 1PGJA 3HC7A 3BXXA 3EBOA 3ZV4A 2G67A 1BQ3A 3CLRD 4U7FA 3BRWD 4UBIA 1GU1A 1FUIA 4IVQA 3P7MA 3ZHRA 3FNFA 3T4UA 5JSZB 2FPSA 3VHQA 4L5JA 3EPJA 3N07A 3Q7SA 4NCHA 3AW8A 3KSMA 1L7MA 2B3DA 2GO7A 3PPYA 2PMBA 3KDPA 4FT4A 4H6XA 4U00A 4KQEA 3PQEA 4LSWA 4C0KA 3CO0S 4V0OA 2YIJA 3LLUA 1ZGJA 5K8TA 1M0TA 1RQXA 2JFVA 2OZVA 3TSYA 2GD6A 1X2EA 4I4NA 3V7FA 3L7AA 4IJMA 1Q57A 1DRUA 3Q1LA 1AKVA 1X1QA 1VJ5A 4UMDA 5HRAA 4MV3A 2KBFA 4BNVA 1QHYA 4RSMA 4EYEA 5CH5A 5F52A 2C2HA 2CVQA 1VJ1A 4LNAA 1SA0B 5ALWA 2GCIA 3ZBTA 3Q8KA 2PUHA 3HUUA 1OPXA 2JD0A 2BI7A 2W58A 4IOKA 3VTKA 4E5DA 5FNVF 3IILA 3SS9X 1QP4A 2ZJAA 5J3JA 1YR9A 5IK2A 3LY5A 2WM3A 1OWOA 3PFCA 1QIDA 3KQKA 1N34B 3FVQA 2D7JA 3ND9A 2WUWE 5G0WA 2X6RA 1W47A 2YNMC 4HADA 2NU9B 3K2EA 3LL4A 4WZBE 4IP0A 2H9AA 3QP9A 4IWNA 3SC3A 2RK6A 2QX6A 3G2PA 1R0KA 1YB2A 3L6UA 2LKCA 4OJTA 4QGAA 4AZTA 1ULBA 4AFNA 4FS8A 3A4MA 3EZYA 4U63A 3MRTA 4G56A 5HGXA 5DNCA 3W04A 5A04A 1L5MA 2PM8A 3IKLA 3ZH2A 5LP1A 4F1WA 1Z2PX 3WYNA 3I73A 1U3GA 1FMLA 4LXYA 1VHQA 4YGXB 4MQUA 2CD9A 3FWHA 4BKQA 1KFBB 4EY3A 3OY7A 1O5TA 3SYTA 3IAS1 4FGJA 3QKRA 1QHNA 1U7WA 4Z51A 4B3SB 1M5TA 3JQ8A 1JQKA 3DO5A 4LXTA 4O0LA 3BH7A 2BI8A 3HZRA 3JAWA 3K0EA 1PG5A 4TLLB 1VL0A 1YQDA 3NETA 3TO5A 1XRNA 1CETA 2HI0A 5KCMA 4D9IA 5CYOA 2YC2C 3Q3IA 4PC7A 4L8WB 2RGGA 1UXHA 3WGQA 1S96A 4NY1A 3AR5A 3L4SO 621PA 3BA6A 4RVFA 1G21E 1XJCA 1SIUA 3R6TA 1LTQA 2ZBUA 2RHRA 3CUWA 3L7OA 2VK8A 3IJRA 3PENA 4LOKA 4CUKA 1AT1A 1SZDA 2HMAA 1TLLA 4EMUA 1W5FA 3WGOA 4KTVE 1KZ7B 2OQ2A 1NQXA 5KTYA 2Y71A 3VC1A 1IVNA 4H1UA 4ZJPA 2X8JB 2JIZD 1KVUA 4ESEA 1QYCA 3BVPA 2Y9PB 3VTZA 4GMKA 5AI6A 2Z5VA 2JF0A 5DKFA 2A59A 5I4IA 2AJCA 3R20A 1J4AA 2Q29A 3CLUC 4BX2A 1W4RA 1AV6A 3ESQA 4IKEA 2B8NA 4EGAA 5BR7A 2JI6A 5ICSA 4KRFA 3JWIA 1UM9B 3NT4A 1PR0A 3IBYA 1U1DA 2YIMA 3KJEA 4UEKA 3R77A 3WFIA 4G0OA 3R1IA 4M54A 1WMEA 4G5GA 4WN9B 2D1QA 3RLFA 3UMYA 3W8FA 5DOVA 1LS6A 3MAGA 1KI1A 3OKFA 2Y4OA 3EASA 2UZ1B 1ZK1A 1M8JA 2G28A 4RKWA 4ZP1A 3ZHQA 1PEDA 2C84A 1JGTA 4I4IA 3DO6A 3C70A 1V71A 4XQEA 1T34A 5K3SA 4ARIA 4OHRA 4UUAA 4UZEA 2YHUA 4V2UA 5AI0A 1AXEA 2NZVG 3KB1A 3FBTA 4Y2XA 1XKTA 3HYSA 3VPSA 3ZE0B 3NALA 5AKLA 2H1HA 3BJRA 2P9ZA 3GN2A 5ENVA 4NBWA 2Z9CA 3MGBA 4Y6SA 3VKWA 1EFPB 1ULSA 3CUUA 3D6MA 1I8TA 4ZCSA 1GITA 4QBFA 1T8SA 2GRJA 1OQAA 4HCJA 5IAOA 1O8CA 5C5DA 5J2TB 1ITZA 1NNSA 5KDLA 5A4DA 4PC3A 4X45A 1V8OA 1XN1A 2VF7A 2ZXUA 4MHTA 4XWGA 1G5QA 4CV0A 1NXQA 3ZX5A 4TT3A 4NMHA 2W90A 1IBRA 2XUKA 1Z4PX 3KYJB 4QBIA 4XLZA 4YWHA 5BQ5A 4RULA 3K70D 4C4XA 4XEHA 1NIPA 2NU8B 4MWSA 3D3NA 3D2AA 4AF8A 2AKAB 1IY8A 1P2GA 1H6BA 2X4LA 3MAJA 3ND5A 4MVWA 4NR0A 2A9RA 4ESHA 5JNUA 2ERYA 1A8QA 1OROA 3K9HA 4S35A 1W4AA 4JKYA 5LYYA 2FA9A 5I7VA 1MO4A 5IJWA 5CFRA 1RJGA 3OQOA 2VOJA 1JZQA 2XITA 4WZBA 1DPGA 1RI1A 1VJTA 1JKMA 3OZTA 3R3WA 5IABA 1H6AA 2R4UA 2V0CA 3O0DA 4G0MA 3JASA 1KDPA 4OIMA 4DNXA 2IDKA 2JVIA 2V0NA 3JQEA 1E1QA 2AOUB 2KQUA 3VJMA 4MA5A 1Z35A 3BK1A 3P5BA 3WAJA 3VA7A 4XFDA 4Z4QA 3ZW9A 1T9DA 2I34A 1WZNA 3SD7A 4Y9SA 1PK7A 1J0BA 2BEWB 3VPHA 1BMFA 2CK3D 1PK9A 2F3SA 2Q1XA 2RGAA 3N8NA 1P2VA 4HWGA 3IUYA