4TTPA

Crystal structure of legionella pneumophila dephospho-coa kinase in apo-form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
201
structure length
201
Chain Sequence
MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 72
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttpA00
1NNEA 1COWA 1FX0A 5J4VA 4W9MC 2ZJ8A 3SHFA 4G1UC 3TLXA 4I1SA 1R5OA 2HT6A 3FHCB 1DS6A 3I5XA 3CRRA 3C16C 1XD9A 5KUTA 4CRWB 2KJQA 4BGDA 3KXIA 2P67A 2WJGA 3KTAA 4PPNA 3C5HA 1E2DA 2XB4A 1E94E 4L5BA 5J40A 2V4ZA 5L8VA 1GRRA 2VHTA 4IXMA 3KFVA 4OQNA 2QAJA 4RZUA 3IGFA 4XWAA 2OLKA 2XITA 3I32A 2IHYA 1I2DA 4URWR 3THYA 4M9ZA 4DCSA 1JPJA 2FFQA 1KO5A 1N6OA 3ASZA 2KE5A 3C41J 3VR5A 1EWQA 1A1VA 4LHWA 1DAFA 2RAPA 4GZLA 1E0SA 2ATVA 3UMFA 3BK7A 3BS4A 4GZMA 3THXB 4C0QC 4MRRA 2BKEA 1R10A 5LDDC 1VCMA 3T06B 3T1TA 5DI9A 5CB6A 3AGQA 2WWFA 2W00A 1AJEA 1FQKA 2RCNA 3RWOA 1XCMA 1P2TA 3GFTA 1RPZA 1RRGA 2D7CA 2I1VB 3QUSA 3P4XA 4MUBA 2J0QA 4LHZA 1Z2AA 4HDCA 2Z6VA 2NO6A 1U0HC 4LC1A 3IIJA 2Q9BA 2XXAB 1UFQA 2Q0HA 5EXXA 3WBJA 2R6DA 4C7OB 2HJVA 1K5DA 4MUAA 4ITRC 2GEUA 4JJZA 4PSKA 3RS0A 4Q1FA 1TX4B 1W47A 3DKVA 4AKGA 4I1OA 4KU4A 2W2TA 4TSFD 5JLJA 1CULC 2RGNC 2N42A 2UVQA 1GITA 4DCUA 1E79D 4D80A 5B64A 1FMJA 3LA6A 3TQCA 4JLKA 1E0JA 2FOLA 3E5HA 3EARA 1F2TA 3P26A 4Q9JA 1O3YA 3ZLJA 4KLZA 1IM2A 4TMVA 1XU4A 1W4CA 3H84A 1S3GA 4DT1A 1K8RA 1EFUA 1MR3F 1Z0KA 1RE0A 3K09A 4QG7A 4QNMA 1D2NA 1SVWA 4V0LA 4C4PA 3WMFA 1NKTA 2Z83A 5FFMA 3RLFA 5D3MA 1X8LA 4OL0A 4Q01A 1W2HA 1JAHA 2ONKA 4TTPA 2NMVA 2WOJA 1Z0JA 2J9RA 5EP2A 2PCLA 3WNCA 3PUYA 1YHNA 3ZVRA 3CF0A 1S1CA 1RIFA 1N6HA 4WZAE 1NN3A 5CB8A 4AY2A 2YYZA 1Z6AA 3X1WA 2AHOA 4PO9A 4MDEA 2H18A 1NVWQ 4ASUD 1R5BA 1NG9A 1G3RA 2B8WA 3TSWA 1XTIA 1SKQA 2Q9CA 4DLRA 3GP8A 4LZZA 4M4SA 3AVTA 2IW3A 4RCYA 2WBLC 3IPXA 1NJFA 2JLRA 4DUGD 5TDHA 5FPTA 3NC1C 1OT3A 1ZNZA 2ZVQX 4F38A 4OK6A 3ZQJA 3SEAA 1TF2A 2CVFA 1IONA 1NG1A 4IEIA 3U6KA 3CLVA 4XVRA 2FF7A 2CLDX 2IWRA 1G16A 4TT3A 4V02A 1VMAA 2FEOA 4EAQA 3GPLA 4KXFB 2HUPA 4RCZA 1E99A 3N5CA 3FWYA 1E2PA 2REOA 4IRUB 1P9RA 4NE2A 1PZNA 1M74A 1G8PA 2F3RA 3IPYA 2ZM5A 2O8DB 2XNSA 5G53C 1VG1A 4BFVA 2IXGA 3M1IA 4IDOA 5EZ6B 3FKQA 3RS7A 4BZQA 3LV8A 1P7CA 1Z0DA 1J2JA 3B9QA 2R65A 3L8ZA 1X8KA 3OHMA 2ZSAA 4DKXA 4KYUA 3WRYC 4EPTA 4TYWA 1W36C 1JR3E 2IYYA 4AG6A 4B32A 4DCTA 4NCKA 3NC0C 2AR7A 2WWIA 4C7OA 2DBYA 4HDQB 4DRZA 4EUNA 3B8HA 3JZAA 4GOXA 2HEIA 4HSEA 1QHGA 5FUXA 3KJIA 1LF0A 3W9YA 1NF3A 2SHKA 2ZSFA 1D8TA 1KK1A 3ZYCA 1GKYA 5L3SB 4US1R 1ESMA 4C0KA 1AS2A 1E4VA 2ZVPX 3OIUA 5BXQC 3EXAA 2BBWA 5JWOA 1BMFD 1ZAKA 1UBFA 2NTYC 2PBRA 1R0ZA 3FMFA 4B34A 2CXXA 2N1BA 2IF0A 5KSZA 4FCWA 2IWHA 4KITB 1YR9A 4KBGA 2OCAA 3CPEA 4YMTA 1FNNA 1E2MA 2BDTA 2C99A 4X8OA 2C78A 3T12A 2VSXA 2WSSD 1EESA 1HE8B 4Y0AA 4UNRA 1E69A 5KDDA 1XPUA 2PZFA 2YJTD 4MRVA 3AUYA 4W7SA 4LJ8A 4S35A 4C0LA 2QPOA 1NJGA 3I4LA 4B75A 4BLPA 3I62A 4M9SA 5EP1A 3U3OA 1HE1C 4RD0A 1JR3A 1KO4A 221PA 4X8HA 4C3ZA 1KAGA 1KI6A 4M1SA 4PR0A 4TL7A 2A2ZA 4RZ3A 2OO7A 5DE3A 4DDUA 2VTKA 2CBZA 1T6NA 4JLMA 4M1TA 5D3QA 1GP2A 1R6BX 5FUWA 3AVPA 2JCSA 2CCGA 3PUVA 4G3XA 3KKQA 4R9UC 3K0AB 5JCZA 4XWOA 4KAXA 3IDQA 2GZAA 5E3HA 4JVLA 1G19A 4EFMA 3SYKA 4ERNA 2XJ4A 2WJHA 2VLIA 3K0EA 3THOA 4HLDA 5FTJA 4LHVA 3EZ7A 3MWKA 4M2LA 2J0SA 1L7VC 2BCGY 2ODWA 2OEPA 2CE7A 3A1TA 5JBQA 5FL7D 3TAUA 3DZDA 3EWSA 3RC8A 4B73A 2AKYA 4OBEA 1GILA 3U4QB 4JLNA 2UZIR 3TIFA 3VR1A 5CJPA 5KSYA 2GAAA 2Q9AA 5G40A 5GVSA 1EFRD 4GT1A 2VHCA 4B2PA 3OAAA 3FGNA 5FI1B 4P32A 3LD9A 3NHAA 3SS8A 1IN8A 1ZRHA 4QGAA 5FTKA 3WHKA 4NYJR 3AVWA 4BRWA 4K8OA 1JR3D 1KSJA 1UF9A 3AKCA 2O8DA 1EFCA 3RRMA 4B71A 2V55B 4ZCMA 3HR8A 2Z5FA 5HZKA 4YMVA 3RS2A 3PUWA 1VTKA 3DOFA 2C5LA 1I2MA 3T1QA 4ARZB 1EFHA 5K8TA 3NG1A 1M7GA 4M1MA 3CF6R 2VBCA 3BXZA 3KUDA 3PUXA 2ZS8A 3FHOA 1ZUIA 3Q5EA 4QXAA 2IK8A 2WJYA 1XTRA 1ZD9A 3UKDA 2NG1A 3LDAA 3N2IA 1Z0FA 4Q7MB 5C1BA 4IKEA 3E70C 4V03A 4ABYA 2ORIA 3A6PC 1V43A 1E9BA 2BM1A 2ZUCA 4XVUA 5K8IA 4RFVA 2DWOA 1IY1A 1KYIA 1XFAA 4HYYA 5DYGA 1IJEA 1MRSA 1S3SA 4FMBB 3ZJYA 1N6NA 3Q9LA 4BLSA 4RVCA 1CKEA 4MKFA 4NU0A 1OYYA 2WKQA 3AGPA 1YZLA 1ZIPA 1ZUHA 3KZ1E 1WDTA 5JSZB 5LB4A 4GI7A 1OKKD 4D0LB 4F7WA 2PMDA 1JB1A 4JSTA 1XEWY 2REXB 4W5JA 4L9SA 3QPWA 2Q3HA 2YWEA 4BFTA 5DN6D 4OQXA 2REBA 4MA4A 3GFOA 4JSYA 5FBWB 3IUYA 1YR6A 4HZIA 1JXOA 1F2UA 2DCUA 5CK5A 1DE0A 3GJ7A 4A0GA 4Q4LA 3B1XA 1H8ED 2A9KA 3DPUA 2NIPA 4ACBA 3U7GA 2H17A 421PA 2WKRA 2BV3A 3EZ2A 2EYQA 4ZCIA 1WP9A 2CEAA 3QBTA 2TMKA 1KDOA 1AK2A 1KY2A 1U0LA 1D2MA 1NVVQ 1IN5A 3FB4A 4A9AA 5CM8B 5JJKA 4Q21A 3B85A 3K70D 1S9DA 3ZD7A 1SVMA 4HATA 2W58A 3BFKA 3AM1A 3U4QA 4KHZA 4PXAA 1E9EA 4QM7A 3AP2A 5AUNB 4AKEA 1NVVR 2QMUA 4X8MA 4RKFA 2V6IA 2KB0A 1U98A 4LJAA 4GBMA 4A6PA 2ZJAA 4A2WA 2EFDB 2FFBA 1XD8A 1T9HA 2W6ID 2IL1A 2HXSA 4MRSA 4QNRA 3AF0A 3Q85A 3UXMA 1W36B 2HLDA 1JR6A 4JVSB 4RZXA 4F93B 3BOSA 4BPBA 1ZCBA 3LW8A 3UATA 4GRAA 5HE8A 2DWPA 2FFAA 4JLJA 1W5TA 2B21A 2G0NA 4QGFA 2XJ9A 3THWB 4YLGA 3U3MA 1QZXA 2RGNA 2HJGA 2B8TA 3FVQA 5DO9A 5F9FA 1MH1A 4XSHA 3ETLA 1FTSA 2HCJB 4DLZA 3GJ5A 3W3ZB 1P73A 5EXTA 3V00A 3OEHA 2JLQA 3BH7A 1D6JA 2LKCA 1GSIA 2FZLA 1NBMD 4DLSA 2W0MA 3QY0A 1GL9B 1JEDA 3QXJA 4HUQA 4PO1A 4YDSA 1W46A 1I4TD 2FWRA 2IF2A 3H86A 2NO0A 4C9BA 2OFWA 3U7HB 3TK1A 4JBWA 4NZYA 1AZTA 3RAPR 1TNDA 4JVNA 4KVAA 1E2QA 4FWIB 4CZ2A 5CYPA 3ADCA 3WYGA 1IJFA 1CR2A 2GKSA 3BWDD 1E2JA 2A5JA 4PSAA 2GJKA 1GKIA 4B6FA 3DM5A 2JJ2D 2BM0A 2GDJA 1W0KD 2KSQA 2R6CA 2AKAB 5JSZA 2PCJA 3RYTC 4HLUC 1QF9A 1TEVA 2P6NA 4JT2A 2AWOA 4PPQA 1KAOA 3ADDA 4UXJA 5EE3A 4N1AA 1SHZA 3E1SA 5EE5B 3U61B 1Q3HA 2E87A 5HPYB 2HCBA 4ZV4A 2GNOA 4K81B 4B44A 5E4FA 3O8BA 4MKHA 4QJ4A 3QXHA 4JLPA 4OHYA 5FOTA 2WMNB 4BUJA 3K1JA 1ELOA 3KJEA 4N0DA 2WIBA 3FMPB 1U99A 2DB3A 3VR6A 2V6JA 3VNVA 2J46A 2RGBA 1KO1A 4QJ3A 3QKSB 4I81A 1QVAA 1NLFA 3L0SA 3EWAA 4Q48A 4Z1MD 4FW9A 2BKUA 1P75A 1XCPA 3NKVA 2ZROA 1ZM3A 5L3QB 1XXHB 2P5SA 5CIQA 5E7MA 3FMIA 1OPXA 1C4OA 3P1JA 1KDPA 1RVDA 4PAOA 4EFNA 2NZ8A 1OHHA 1XD2B 1NMYA 1OJLA 3UG6A 1EFTA 2IHBA 4LYFA 4EFLA 1R0YA 1Q1QA 3EPLA 4Q9LA 4B3FX 5EE9A 2WHXA 3WP0A 1GDDA 1V5WA 3K9HA 4HUTA 3AVYA 3CR7A 4P4SB 4ESHA 1K5GA 1ZM4A 2ORWA 1XRJA 4G5OA 4M9QA 4IVPA 1GUAA 1YZKA 2O0JA 2ZJ5A 3THWA 4LJ7A 2AFIE 1H8HD 2YWHA 2Z43A 1YJ5A 3TR0A 4QOSA 4DXAA 4JKYA 2FSHA 2P3SA 4GMDA 3EIQA 3UG7A 2XTMA 3X1ZA 3MJRA 1J8YF 1ZM7A 4D25A 3REGA 1EXMA 1FX0B 2VHUA 2D62A 5KYKA 4TMXA 1T8UA 1LFDB 2C77A 2D2FA 2HDNB 5FTNA 3O8CA 1RJ9A 3OFNA 1JQLB 2QE7A 5IT5A 5JECA 4MH0R 3D7MA 4JBXA 4QBHA 5EE0A 4MDFA 2P0EA 4JL6A 3FE2A 4JLAA 3QPUA 3WY9A 1GRNA 2Q21A 5JWRA 1E2EA 3ZZ0A 1MKYA 1G3QA 4YXWA 4XJXA 1DTSA 2QUZA 3LRPA 2LKDA 5UKDA 1PV4A 2JLUA 3R7WB 1VIYA 1RKBA 3KXKA 5JCPA 4WXRA 3THYB 5JEDA 1JJ7A 1XXHE 2F1JA 1CU1A 4LV5B 5JI2E 5HCIA 3TAHA 5CJ2A 1FZQA 2VA8A 5DI3A 3Q7PA 3DVLA 1YZUA 1JJVA 1K6MA 5J5CA 1DADA 1HV8A 2W0SA 2V3CC 4QBIA 1ZD8A 2GJSA 2YINC 4C2TA 1Z06A 2ZI7A 1AZSC 3VHLB 5EJEA 2ZR9A 1GVNB 1IN4A 1KSFX 2RGDA 3QBVA 5FOUA 3BD9A 3DO6A 1SXJC 5E7JA 4RD2A 3A4NA 3I73A 2FDCA 4N0EA 3BH0A 3VQTA 5JHGB 3M0EA 5FR1A 1CBUA 3T15A 3HU2A 1WB9A 2I4IA 4QRHA 3QKSA 2A78A 2A3RA 4P4UA 1DARA 5KDOA 3HWSA 5L3QA 1XB2A 1XXHA 3BH6A 2FV8A 3ZH9B 4CIDA 4KLNA 2GHIA 2YOGA 1NIPA 3OEED 1XD2A 3IO3A 4QHYA 2J45A 5CLQA 4DB4A 3PEVA 4D82A 1D2EA 1E2FA 4CVNA 3LW7A 3OIVA 4B33A 1LTQA 1Z22A 4DLYA 2J1LA 3NBXX 2WZQA 4P4SA 2QMEA 4Q03A 3EIHA 3ND8A 4Z54A 5AK0A 1FUUA 1Z63A 2AK2A 3UWOA 4NYMQ 2QBYB 1G4UR 2ZRIA 4AYTA 2ZAOA 2BC9A 4MGZR 1WBBA 3CH5A 2QTHA 1S0UA 3ZDQA 1EGAA 5EUMA 1GTVA 1N6IA 1UKVY 2ZRJA 4FMDB 4Q7KA 1OFIA 5LB2A 3VNUA 4HB0A 1NRJB 5C46F 4DVGA 1XMIA 2VL7A 3T1OA 3VR2A 4B47A 1P2UA 1XMSA 3WYAA 4M22A 2MSDB 1KSHA 2XTZA 3NVAA 3MRSA 3GJXC 5AUQA 4BLRA 1XWIA 1FL9A 3D8BA 4O0MA 5FBVB 1VCIA 4ZCLA 1FPMA 3D3QA 2FSIA 3CRW1 5B30A 2E9SA 3FKSD 2VSOA 3R7WA 2FGKA 4PHFA 1TU4A 4DLVA 5ELXA 3GLHB 3ZIAD 3QEJA 4B74A 1KIMA 2V54A 4KSBA 2B92A 3H4MA 3MGCA 1QG4A 4JMPA 2JIZD 1AKYA 4DSOA 1SHKA 4PFSA 1P72A 4KFTA 3U3JA 2G83A 2Z4RA 2JJ1D 4MRNA 1R8SA 5TVKA 1ZINA 2RB4A 2Q3MA 4OK5A 1MO3A 1PLJA 4JS0A 1DAGA 4US2R 2ASEA 2QA5A 1R7RA 4LWZA 2X77A 4B3CA 3O8RA 1XMVA 2QT1A 3FFBA 3K0SA 1FMLA 4D4MA 1COWD 5E7IA 3KJGA 2CJWB 4KV9A 2J5XA 5CITA 2CMKA 4M9XA 2DFNA 2PH1A 2V7QA 1YR7A 3H0KA 3AV0B 4PAQA 3V4RA 5C4MA 4KI0A 2FPKA 2WICA 2JLWA 3TRFA 2QGZA 5KSOA 3W6OA 1NSTA 2GXUA 4DSTA 1G3IA 1Z0IA 1XX6A 5EQTA 1WE2A 3VFDA 5DHFA 3KB2A 4NH0A 4TQUS 5BYKA 1Z6XA 2FPMA 5GVRA 1G41A 5HCNA 1VHLA 1OIWA 3QSYA 1AIPA 4K46A 2QRNA 4BLQA 3LWNA 3RSLA 4Q1AA 1YU9A 5E95A 1A4RA 5AJVB 1VHTA 4F4JA 4TYPA 2H57A 3ND9A 1Q44A 2OCBA 1QHHB 1XPOA 2BEJA 4MITA 5JZVA 1ZYUA 1VG9B 2G77B 2ZJBA 3GEIA 2MMCA 1ZP6A 3MSXA 4TTQA 2QBYA 2HT1A 4WZBE 3GLHE 3CPJB 4JJKA 1TU3A 4FI3C 4LV8B 4LBVA 2WTUA 2R2AA 3KKOA 2CLCX 3HDTA 1BH2A 3JVVA 5EE1A 5JS8A 2OT3B 4N3NA 3NH9A 4HAXA 5L3RA 3NWJA 1KO8A 1KI6B 3REFA 4Q9KA 1JALA 2A5FA 1OH8A 2JLVA 1QHNA 2XGJA 2GWHA 2WWXA 3U3RA 4A0FA 4GDFA 3WNDA 1Z8FA 2PEYA 3SU8A 2IX3A 2ODBA 1XDBA 2QGNA 1CJVC 2EFEB 3WXMA 1KI4A 1T3SA 2KBFA 5G3YA 3SJCA 2WAYA 5TB5A 1FP7A 3SYLA 3C8UA 1M2OB 4HLUA 4C0HA 1XZPA 3P27A 3MJHA 3SN6A 4ZI2A 1D5CA 3B1WA 1PLLA 2FU5C 1NIJA 521PA 3W6PA 3PR1A 3RC3A 4XH9B 1XJQA 5LPNA 3HU1A 2CCKA 2FMXA 4OKSA 4Q02A 1NMXA 1G18A 4Q00A 5JJLA 1CR1A 1NKSA 4HLQB 1E3MA 3EPJA 2AX4A 3D6TB 3GLHA 4C30A 3RDPA 2CNWA 3CRMA 3RS5A 3AVOA 3AKDA 5FI0B 4I1VA 2QM7A 2Q6TA 3QE0A 4L8GA 3RSOA 1KI1A 1UBCA 3ASYA 4LYJA 2OAP1 2VP2A 4PHHA 1TAGA 4RFSB 2ERYA 3B5JA 3DM9B 4NCHA 3CONA 2P2LA 3M6AA 3IEVA 2C8VA 1AGRA 4FMCB 3GLGE 721PA 2MSCB 3RANA 3CIOA 2QMHA 3HYRA 4D0GA 5FBLB 2CJWA 3Q72A 1NL3A 4UNNA 1E0AA 3GD7A 2NQ2C 1ESNA 4ESVA 3A1VA 4DDTA 1ZC4A 1GL6A 4P31A 4R2HA 4LPKA 4EJSA 5LD2C 1T0HB 5SZKB 1GNRA 4GP6A 1KJZA 2JA1A 2JLYA 4A82A 1TUIA 3QG1A 2QP3A 1SVLA 4BFSA 2AD5A 5AJZA 4TLBA 1MABB 4Q4HA 1UDXA 2FPLA 4HAVA 2GILA 2NOAA 3BFXA 3OF5A 3VKWA 2XSZA 4PQFA 3T61A 3HJNA 4JBYA 4BEJA 1OIXA 2ZUBA 2ZJZA 1IY2A 4TT3D 2OBMA 2N46A 1HEIA 1BIFA 1GZSA 3NEYA 1S96A 3GLGA 1M1YE 5KDLA 1QHHA 3I8XA 4IDPA 4BQSA 2YC4C 2EW1A 4KFUA 2EWVA 2WWYA 4M0LA 3EAQA 1HT1E 3EA5A 3SR0A 4B43A 2WIAA 3B13B 4Q18A 3KFXA 3VKGA 1KY3A 1SXJE 3I1FA 1WMSA 4F4IA 4B3GA 2KI5A 1SULA 1AKEA 1WCV1 1IN6A 2VF7A 2IYVA 1DBSA 3GLFA 4Q19A 3I72A 4EQ6A 3B7GA 4PSVA 2AK3A 1F2UB 3GFPA 1E9DA 3TVTA 3LX8A 1KO7A 1SVIA 3PV0A 4NBSA 2YNMA 2AXNA 1P5ZB 1XEFA 3NEJA 1UDWA 3DMNA 4YC7A 1CRPA 4IVRA 4XTRA 1ZU4A 1ZU5A 2IYQA 2WJVA 3GJ6A 1CEEA 5H70A 1KK0A 5BN3A 2Z0MA 1UAAA 4QL3A 4TLDA 3QKRA 2G3YA 1F6BA 1GIAA 2RGAA 4AYWA 5DSZA 1JXMA 1M7HA 1N5JA 1FUKA 2WMOB 4LC0A 5K8UA 1Q1EA 4OQLA 1UM8A 1SXJA 3EW9A 3CB4A 1VDZA 2F43B 4LJ4A 2Q3FA 4XD7A 4RFSA 1D9XA 3TUZC 2B6HA 2JDIA 2OUKA 3MCAA 4GFDA 5JFGA 4A2QA 4GOJA 2OM2A 1OE0A 4DEXA 2IYWA 2ZSEA 3EASA 5JJIA 1II8B 1OFHA 3RS3A 1M6NA 5KPJA 2O8FB 1SKYB 1U94A 1AQYA 1ZCAA 4IDNA 5JMTA 2GRJA 1PUIA 4U00A 1KK3A 1T8TA 1E9FA 3GCGA 3QXSA 3WMGA 4L16A 1N6LA 1E1RA 4TL9A 1DEKA 5KOYA 5IHPA 4P3YA 1NVXQ 1UBEA 1EX7A 3ADKA 3UPUA 1Z6GA 1W4AA 2JJ8A 4R7ZA 4MKIA 1YZQA 4V0NA 4HUQB 1PLKA 1ZVQA 1G1MA 1GL7A 1GAJA 1N25A 4LPSA 3DZ8A 1MABA 4PZLA 3QF7A 2NPFA 1LNZA 3NDPA 1Z28A 4JLDA 4PPGA 3QVUA 2OBLA 4XVQA 5B58C 3UANA 5FUVA 3I92A 2WM9B 4TN1A 3B6EA 2WV9A 3ZGXA 5TXGA 4QGHA 5SZIA 5TY0A 3OAAD 2C9CA 3VU9B 2R6FA 1XJCA 1A82A 4PAMA 4QBFA 5KSPA 1B0UA 3SFVA 4NYIQ 3IHLA 5FPSA 3U60B 2DFLA 3CX6A 2OBNA 2ZYTX 4CEIB 1Q12A 2H1LA 4MQBA 3IQWA 4TQ9A 2X2FA 4MYCA 4JLBA 3EZFA 2PX3A 2ZI9A 2VIIA 4IOKA 1H65A 4CT5A 5CLLA 2PT5A 2H92A 5A5GA 3DHWC 1Q3TA 1LW7A 4HAZA 1IXSB 1SVKA 3FYHA 4MKGA 5AUOB 1O87A 2WVJA 4FINA 4HI0E 2OG2A 1HH4A 1T3HA 5F3WB 3KL4A 2OSBA 5HKKA 4E03A 4B48A 2XNDA 4ACAA 2OILA 3QKTA 4V0ME 2CK3A 2OFXA 1E9RA 1P6XA 1SKYE 4IOLA 4A8JC 5J4HA 2WWGA 3CNNA 3L82B 4WVFA 4PC6A 4WXPA 1KI2A 4LJ9A 1XP8A 2QTVB 2ERXA 4NMMA 4F91B 1E4YA 2QPTA 4TZ0A 3NBYC 2C2HA 1F5NA 1XTQA 3P4YA 3SJBA 2VP6A 1DG3A 2QM8A 4P4TA 5BYJA 3SC3A 1B23P 5GJBA 4ZIRA 4G0NA 3W3AA 2QQEA 2VYFA 3V9PA 2LWIA 2ZR0A 4AC9A 1W7AA 4C0SA 4OI4A 3ZQ6A 1L8QA 4TLEA 3KKNA 2WJIA 1HUQA 3M4YA 2F6RA 5FR2A 3VX4A 2F43A 1E2IA 4AYXA 3AEZA 3D31A 2O8EB 1NLZA 2XX3A 3SBEA 4AURA 5LD2B 2XZLA 2ZIAA 3OZXA 1CXZA 1OF1A 4CT4B 4A36A 4J0QA 2XOKA 1U0JA 4V0MA 3TSOA 1E1QA 1II8A 1HY3A 4PC2A 2O8FA 2Y8EA 1Q20A 1TMKA 4GOKA 3QI2A 5F2EA 2RHMA 3AUXA 3CW2A 3NTUA 3PENA 3AVQA 1PJRA 5FOVA 1YZNA 4U5XA 3CUEF 2QAGC 4UXIA 1GM5A 4I1UA 1CJMA 3CWQA 4DIEA 4F92B 2D2EA 4L4UA 2X8AA 5CDFE 4LDJA 3B1YA 3K53A 5EP4A 1IXRC 1OXTA 2WPDA 3FTQA 4FD2A 2O5VA 3BERA 4DHEA 2CL7X 1N0WA 1RJ9B 2ZRLA 4TQAA 2GCPA 2RGCA 1P4SA 1HT2E 2GA8A 3AP3A 5KPDA 1OLOA 5AWFC 1WXQA 2IC5A 4JLOA 2OCYC 1OXVA 4C0JA 3FMOB 4EPXA 1W5SA 1KOFA 3PFIA 1DAIA 2QTFA 1G5TA 3VU9A 4C0AC 4HZUB 3QF4A 3U6BA 5AUPB 3DL0A 3B2EA 2GK7A 1DO2A 1AS0A 2W2VA 4UNQA 3PCRB 4LI0A 1RYHA 2HLDD 4CEIA 1XEXA 2E1RA 4WOPA 1E2NA 4H1UA 4QC2A 1LF5A 1DAMA 2BHRA 4OYHA 1S1MA 1E32A 4DLUA 1BO6A 4IHQA 5DI3B 1BOFA 3U3KA 2EFHB 1OV4A 1S8FA 4ZDKA 5JRZA 4AG5A 4JYBA 1N2CE 2W83A 5K8LA 3B60A 1LY1A 2VPPA 3HYTA 3I61A 5CDFA 2NO9A 2VSFA 2JASA 2OXRA 2BJVA 2GESA 3OEHD 1OH7A 1MOZA 5EXPA 1E2GA 4A6XA 4IOJA 1CR0A 4B35A 2ZXUA 4LOAA 3HR7A 2QPAA 3QXCA 4TL8A 1PVOA 3AKEA 3K0FB 4PZZA 1Z83A 3GLIB 1W44A 3QKUA 2PJRA 3P32A 4CW7A 2ZE7A 3JZMA 4OI0A 2YWGA 2C98A 1T91A 5EXSA 2J7PA 5IK2A 4C0BA 3TW8B 2ANCA 1Z07A 2ZE6A 1EK0A 2VHQA 3KKPA 1W0JA 4L9WA 2PEZA 3ZS9A 3UWKA 4EPYA 4WAUA 2IXEA 2DPXA 3EPKA 2PZEA 3WRXC 4Q7LA 2CVHA 1L4YA 5A0FA 4LHYA 3SDZA 1TQ6A 1YZGA 1G5PA 1YRBA 2GJAA 2ONJA 4EJSC 5AJWA 2PZGA 1JBKA 3NH6A 3SJAA 2J7KA 1KK2A 5CYOA 4G5RA 4JYCA 2XTNA 2O8EA 4A2PA 5BWMA 2B7BA 4BFZA 5CK4A 1KJWA 1TQ2A 4JLVA 1W48A 2BIFA 2PX0A 1ZMXA 4P0TA 4WZ6A 4YMUA 1VYTA 4NTZA 2O8BB 1WF3A 4LYAA 1N5IA 4NPHA 2QP9X 5FPKA 2GEDA 3PXGA 4UNSA 4DLWA 2NZJA 2MSEB 2ZRPA 3GJ3A 1KMHA 2ZSBA 3R8CA 4A4DA 5KHOC 1DPFA 2HYIC 1L2TA 2YWFA 1OB2A 1G3UA 2PLRA 4KYIB 4UJ3A 2NPIA 2CDNA 1SVSA 3LX5A 4BZPA 1FQJA 1DAEA 3G82C 5C4GB 1G8HA 2ZRAA 3BC1A 2F9LA 1YQTA 3AF3A 3NXSA 4CYMA 1P3JA 5B57C 3GLIE 2F55A 1OHHD 3L2OB 4Q47A 1A2KC 2A5YB 3MLEA 4DCVA 2V1UA 3ONWA 2G88A 3LAWA 4HZUA 4BFUA 3KQUA 3I3SR 4GPTA 3TH5A 1G7SA 3KQKA 4HLCA 1W36D 4B6EA 4TZ6A 3TNFA 3LO5A 621PA 2ZRBA 3ZD6A 4NHOA 5C2JB 1X1SA 3Q3JB 5G3ZA 5TMPA 2C96A 1G64A 3LLUA 2W6JA 1JEEA 3BFVA 3R20A 3ICQB 1VCNA 3PQCA 4XSGA 2QNRA 1ZNYA 2R6AA 3A1SA 4HAYA 4JVMA 2GCNA 1OB5A 4G5GA 4DSNA 2MMGA 1ZM9A 1Q22A 1A2BA 1G9XA 2QSYA 3RS4A 2FSGA 3KB1A 3K0FA 1QHYA 1A5TA 2AD1A 1AGPA 3OFND 2QE7D 3GLIA 3DMDA 2EWWA 2IT1A 5FPHA 1G6OA 4B2LA 4ZO4A 2BVNA 1ANKA 2ZU0C 4UNPA 1LS1A 3A4MA 1YKSA 1GNQA 1OXSC 5KNBA 4YXWD 4QJ5A 1TQDA 1YR8A 2DWQA 1FOEB 2JAQA 2JATA 2Z4SA 2GJ8A 3A4LA 2I1QA 5HE9A 5B2ZA 2IBMA 3MFYA 5IRCD 3LH5A 3B1ZA 4POAA 2OV2A 1OFTA 2C04A 2G1KA 2VEDA 1ONBA 3B82A 5JEEA 1I4DD 2QAGB 4YDHB 2IEZA 1KI7A 2AL7A 2HYDA 2OCPA 1UEIA 3EPHA 1FFHA 2AXPA 2QU8A 1E0KA 3LY5A 4M53A 3EC1A 4DDVA 2O8BA 3EZ6A 2ZYVX 3PEYA 4Q9IA 3OIWA 2GXSA 3CO5A 2JLZA 4D26A 1KJYA 4HB4A 3KKMA 4NYMR 2FFHA 4DDWA 2DR3A 4FCVA 4NCIA 5H1YA 1TQ4A 1QG2A 2J87A 3CZPA 2FE4A 2EFGA 2CHGA 2GXQA 2FSFA 5IDVA 3LLMA 2QENA 3ZS8A 1VECA 2BBOA 3MAAC 4O2RA 4E09A 3BB3A 3W8RA 821PA 3W8NA 4OQMA 1CP2A 2K5UA 4ILEA 3FOZA 1J8MF 3TE6A 4DCNA 1LB1B 1NN5A 1VIAA 4NP6A 2BMEA 3K70C 2GCOA 3MG9A 4Q4AB 1US8B 1RFLA 3RVBA 1G20E 1XPRA 121PA 5FTLA 1E9CA 1II9A 3AVUA 1YVDA 2ZRCA 1IHUA 2V9PA 3RHFA 5BW8A 4D2IA 4WBSA 1FP6A 1OXXK 4TLCA 3GJ4A 1SQ5A 4MYTA 3AQ4A 5GJCA 1XCGB 3AF4A 2RKOA 1J90A 3F3YA 4I4LA 1GNPA 5F9HA 5FOSA 4AI6A 4TTRA 2FG5A 3GJ0A 3CWZA 4QGGA 2IUSA 4A8JA 2IS4A 2ZYWX 2V8OA 3AB3A 3IQXA 5P21A 4Z8XA 3LFUA 1DOAA 1ZC3A 2RH5A 1MT0A 4TSFA 2J0VA 4TYQA 3A1WA 4JKIA 3O8DA 1CJTC 3QG5A 1E79A 2WJJA 1U2RA 2A5GA 4QKQA 4OHXA 3L43A 3X1XA 4HDOB 2GF9A 3A8TA 5SZHB 3HP1A 2D7DA 4QBGB 3EIEA 3Q5DA 2R6GA 4KVGA 2DYKA 2ORVA 2AWNA 4HAUA 2IUUA 1S9HA 3CKLA 3CRQA 1ZUNB 5LBIA 4EJSB 2NO7A 2NO1A 1W4BA 3B78A 2D06A 1J7KA 3BIFA 1RRCA 3MWLA 1R0XA 3P20A 2H8KA 4AKHA 3MD0A 3ZVMA 1W4RA 3TUJC 2QMOA 3T34A 3T5DA 4Z51A 4Q4HB 4ZDIA 1MO4A 4KO8A 1WQ1R 1CR4A 1W1WA 1L4UA 1XF9A 2RGEA 1QHIA 4KSCA 3VR4A 2ZI6A 1KMQA 1NN1A 1KGDA 2XEXA 3F5FA 1Z29A 2ZRMA 3GJ8A 4PHGA 2WSMA 4PZYA 4LJ5A 2QAGA 3Q8XB 1CS4C 2EQBA 2FA9A 4DLTA 3GLGB 3R9IA 4QHTA 2IYXA 1VG8A 4ASUA 2ZR7A 4UQOA 5HZHA 4DLXA 2ZI5A 2F7SA 4U7DA 1AM4D 2XB2A 3OESA 2GZHA 2VP9A 1XMJA 3CNLA 3N70A 4URZR 3RABA 4BZXA 5A4JA 3PIRA 1D9ZA 1U81A 4Q4JA 3NBZC 1OH5A 4B3DA 2HV8A 1AA9A 4WW0A 3UIEA 1Z3IX 1FNMA 1G21E 1R8QA 3OE7A 3IBGA 3LBIA 4DUGA 4YQFA 2V7QD 4M8NE 2B7CA 3GLFB 3LVQE 4EQ6B 2HXYA 5JRJA 2ZSDA 3K9GA 4KJZA 4WIAA 2RGXA 1U8ZA 4PO8A 4CEJB 1Y3AA 3X1DA 5AJYA 1R4AA 3VHXA 5AJXA 1OFUX 1E2KA 2BWJA 2FH5B 2C9OA 4EIWA 4US0R 2W2XA 2C03A 5J4KA 4Q4AA 3PUZA 4G5QA 1US8A 4TYYA 2FEMA 2BMFA 2GK6A 3LVRE 1N5LA 2BMDA 4BASA 3SNHA 2ZS7A 3QEOA 2CL6X 4JT4A 2IS6A 3QKRB 4JZKA 3I5YA 4GSYA 4Y0VA 2FZ4A 2ECKA 4OQFA 3EX7C 1UADA 2QROA 4TMZA 4W5WA 1AS3A 1Z0AA 2ZJYA 1R0WA 1YE8A 2ZITA 3ZVLA 4L15A 1ETUA 3CNOA 4BWYA 4M1YA 4TMWA 1DO0A 2VH5R 4AWXA 1SXJB 5FPYA 1KZGB 3NDBB 1MO5A 4OI1A 2D4HA 2YHSA 3GMTA 2ODNA 1TEXA 4KFRA 4TYNA 4GL2A 1F3OA 1Z6TA 2EVWX 2J0UB 2VHJA 3Q7QA 4JIMA 4LK2A 3OE7D 1U90A 2GXAA 4E22A 4ON9A 1I4LD 3NHBA 4V0KA 5BN4A 1QBKC 2G1JA 1WA5A 5DIFA 1KI8A 2ZE8A 4Q7JB 1BMFA 4IVQA 3R9WA 1G17A 2CHQA 1OSNA 2IUTA 2JGNA 3SQWA 1G291 2J3EA 1VYUA 4O2LA 2BMJA 3E2IA 1GWNA 3IKJA 3AF1A 2GBLC 2C95A 4OK3A 2WSSA 1KSGA 3DEFA 3THXA 1VKJA 3GLFE 1E9SA 2ATXA 3PJRA 1JQJC 1E2LA 4F4CA 2QN6A 3QVVA 4URYR 1RRPA 3C15C 2RMKA 5FBRB 4DIDA 1M8PA 2ZUDA 2JLXA 2F1RA 1OW3B 4ZDJA 2CNWD 4NCJA 1KNXA 1XTKA 1C9KA 4PHTA 3ZZUA 5AR1A 2YOHA 2XXAA 3N2EA 5KO2A 5DISB 4UKDA 2ZI4A 2UZ3A 3IBYA 2BOVA 3FDIA 2G9NA 4II7A 4HB2A 2GEVA 4PPFA 4RKEA 1LVGA 4A92A 5C18A 1FTNA 1VYVA 5CIWA 2ZRGA 4NKRA 2R9VA 3MWJA 3TSZA 1DAKA 2RGGA 5DH9A 3R8FA 1CJKC 3AF2A 3UMRA 5M04A 4MGKR 1TUEA 1LS6A 3K70B 2ZAMA 5FL7A 2F9MA 1HTWA 2P65A 3S1AB 3K0CA 1U9IC 2J59A 1P60A 3AP1A 2PJZA 1G6HA 3ICEA 4Q5IA 4EDHA 4EKDA 1NP6A 4LBWA 4M1OA 2BBSA 4CEJA 1KHTA 1EFRA 4PANA 1IXZA 4AK9A 1GKUB 3L0IB 3LBHA 4LBZA 3DDCA 4MYHA 1CTQA 2YC2C 2FX3A 3SOPA 4E07A 3IEUA 5IF9A 4LRWA 3PEUA 3KUCA 3W90A 2QT0A 2XSZD 1SGWA 2PL3A 3L8YA 4ZIRB 4E5UA 3SJZA 4R71A 1ZW6A 4GMXA 4RJLA 3F0TA 3KXLA 2CCJA 1G5RA 5DYIA 5G41A 3KQLA 3SQXA 3OIYA 2X2EA 1TTTA 5JHHB 1RC8A 1G3MA 4BLOA 2O0HA 5FTMA 4BE7B 4PX9A 1BYUA 1KDRA 1Q0UA 2IYLD 3PEWA 4D81A 2ZE5A 4KCGA 4GNKA 1KKMA 2J0UA 3BGWA 2GETA 3NIBA 2O8CB 4O3MA 1QVRA 3EA0A 2EU8A 3BORA 2P6RA 1NVUQ 4NDZA 2ZU6A 4IFBA 5HTKA 4BRUA 4NYJQ 1ZD1A 4RD3A 3TBKA 4IFEA 1C1YA 1R2QA 4EPWA 3CM0A 2HF8A 3B9PA 1OKKA 3MUFA 1YRAA 4LCBA 5DNYB 4LBYA 1T5LA 1NSFA 4DC9A 4B3BA 1WBDA 3F8TA 2IYZA 4Q1DA 3UK6A 2OXCA 1Y63A 5DN6A 4PC3A 1TADA 4YONB 4UJ5A 4OHWA 4URVR 1IAQA 2WOOA 5L3VA 4FMDF 3VR3A 3UMSA 3SYNA 1BKDR 4AKIA 2CLSA 1SXJD 1UKZA 1CLUA 3QPVA 4G5SA 2ZTSA 3O47A 3QF4B 3SZRA 1N5KA 4BFYA 1X86B 2YZ2A 4XD7D 4XIGS 1H8EA 2JDID 1XTSA 1XEXB 3L0OA 3CZQA 2OESA 2GAOA 1OH6A 4NCNA 1TF7A 1RYFA 1Q21A 1NMZA 3BBPA 4OHVA 1Z6YA 4O25A 4PC1A 3TR5A 5L3SA 4NYIR 3U5ZB 1JNYA 3G0HA 2QP4A 1CJUC 3A36A 4ZKEA 1P61B 3QENA 4NL4H 5GJWC 4BECA 1NBME 3S1AA 5SZJA 2WKPA 3X1YA 1MO6A 1E1RD 4FXPA 1HQYE 4KBFA 2AN9A 4C2UA 2OAQ1 2DFTA 3W5JA 2H5EA 4RD6A 3U44B 3CR8A 1HQCA 3IILA 2ZETA 2IYUA 3R9XA 2QSZA 3T1VA 5JS7A 1G8GA 2W6IA 2BJWA 4B3XA 2ZJOA 3MMPA 1P2SA 1RRFA 2ZEJA 3VAAA 2IXFA 3BAFA 4OJQA 3CX7A 1P9WA 4CEHB 2VQSA 2GJ9A 3PG5A 4A0HA 4D4LA 1EX6A 1HURA 2ZANA 4XTCS 3RRYA 3ZZTA 3TGPA 2AFHE 1MRNA 1QHXA 5JI3E 4DZZA 3ZVNA 3K0AA 1VPLA 2J41A 2G0TA 5BN5A 3VMFA 4H9GA 2D3WA 1TL7C 3GEEA 1TPZA 4JL5A 4MGYR 3WBKA 2RHDA 1NBMA 1BS1A 2OHFA 3DKPA 3BB1A 1VCOA 4D0NA 1EWRA 3C7KA 3U7FB 2O8CA 1UKYA 1KZ7B 4IXNA 3T35A 5TV2A 1P2VA 1M7BA 4MYUA 3RNLA 4TWZA 3EZ9A 5HKKD 4W5HA 1Q1ZA 5JWHA 2XNDD 1HYQA 1SVOA 1X8JA 1X6VA 2CK3D 3A58B 1FW6A 1KMHB 2FJUA 2JJ2A 3LXRA 1E6CA 1W0KA 3C4JA 3QOFA 1E98A 1SZPA 1N0UA 3QNUA 4LUCA 3LBNA 2DY1A 4R98A 1G7TA 4LX0A 5F98A 2PT7A 2ZJ2A 4IEEA 4FWTA 4M1KA 3W5IA 2C9YA 3BB4A 1II0A 4LY6A 4BEBA 3BJIC 2JLSA 1IBRA 4AD8A 8OHMA 1S4QA 2R8RA 4LJYA 4PQRA 2FNAA 4EPVA 5J47A 4A15A 3VKHA 3SHWA 2CE2X 4CF7A 1P9NA 2WWHA 4ARZA 5TARA 4PC7A 3WHLA 3IIKA 2XZOA 3K09C 3MWYW 1GRQA 1GFIA 4CGZA 4NONA 2D74A 4DWJA 3NBFA 2FGJA 5FL3A 1DELA 1U8AA 2JEOA 4BFXA 1X3SA 2X1VA 1RW4A 4TMKA 5H68A 3EG5A 1LV7A 1N6PA 4QFMA 4DSUA 5GJVC 1KI9A 1XNJA 2XOKD 3CBQA 3PITA 1E1QD 4Q9HA 3RRZA 1UJ2A 1R5NA 2WWWA 3IHWA 3U2QA 1T0JB 4Z1MA 2VF8A 4IOMA 1CIPA 4LJ6A 2L0XA 3BRWD 4P33A 1XJ0A 1J99A 1XTJA 2PMKA 1OXUA 1UBGA 4RD1A 1N3BA 1KKLA 1JI0A 2YVUA 3X2SA 3CH4B 5J4YA 2LCFA 5DGXA 3SBDA 3U44A 2FN4A 1NY5A 2F1HA 1T3LA 2G6BA 1NLYA 2BBTA 2WPDD 1W49A 2UKDA 2CL0X 1YZTA 1E9AA 1ZNWA 2ZRFA 3TMKA 3AVVA 1ZM2A 5BQ5A 2NGRA 4KFSA 3HU3A 3KQHA 1M34E 4FMCF 5FBQB 2IA5A 4CEHA 2IYRA 2O52A 1EG7A 1MV5A 1ODFA 4CDGA 3U7EB 3L0PA 4FCTA 1H8HA 3TQFA 2WAXA 4HAWA 5H8WA 3QIAA 1JPNA 4V0OA 3G5UA 4Q1BA 2QEQA 4URXR 2GVZC 1KNQA 4M21A 2CHVA 3HPRA 4LSGA 3PVSA 4HEJA 4LGMA 3QXXA 4Q1EA 5FUYA 1NI3A 5J4LA 2ZRDA 1ZIOA 3ECCA 3WYFA 2KWIA 2IYSA 3SE0A 3TVDA 2X19A 2GBLA 3CF2A 3LNCA 3SI7A 2P5TB 1J70A 1QRAA 2O0KA 5KU1A 1DAHA 2ANBA 4WA7A 1T5IA 1ZNXA 1F60A 4ZDWA 4DBLC 2ZRKA 2QZ4A 1Z2CA 2PLFA 1CRQA 1A7JA 3SFZA 4RD4A 3LQQA 4IJMA 4PTLA 4URUR 4MRPA 4UXHA 3FHTA 4IDQA 4B76A 5DHAA 5EZ5A 1P62B 5HR5A 1OIVA 2A30A 2IYTA 1IOZA 4U02A 2YKGA 2J7PD 1ZBDA 2GVDC 5IK2D 4QM6A 1AN0A 3A37A 1G4AE 3C5CA 4D6PA 2H7VA 4KODA 2ZREA 2OLJA 1W0JD 4TLAA 2VRWA 3TKLA 3IIMA 1U8YA 3KX2A 1IN7A 1DG1G 1GOTA 4X8LA 4YMWA 1XBTA 4OI2A 1KDTA 2OFOA 2GCOB 3WP1B 2ZS9A 3K0CC 3KJHA 5KNDA 3RWMB 1XZQA 1QHSA 2R62A 1T4GA 4D4JA 4TL6A 4EPRA 2XAUA 2QI9C 1U9IA 3AKYA 1S2MA 5EUQB 2ZRHA 1UEJA 2EYUA 4FN5A 1KTVA 3DOEA 2VO1A 3C14C 3ADBA 1IY0A 2OE2A 2EFCB 2V1XA 3I8SA 3TUIC 2ZYUX 1BYIA 2GTPA 1Q1BA 4Z8YA 5FOWA 4LYHA 4A8JB 5CM9C 3KTAB 4GP7A 3K9NA 2GZDA 3VX3A 3CRVA 3FPAA 2OZEA 3GQBA 2YV5A 4G01B 3VTKA 1Z08A 3H1TA 1E96A 1RZ3A 5FH9A 3OEEA 1TF5A 5EP3A 4B2IA 5KTYA 1DVRA 4XWKA 5KNCA 5DLQC 2IS1A 2QRZA 4BLTA 1UKEA 4RSGA 1Z5ZA 4DB2A 2QQ0A 2A7QA 3BE4A 3W34A 4ZKDA 1WRBA 3T5GA 1VG0B 3LXXA 3QJYA 4BFWA 2H16A 1QDEA 1X1RA 2DFKB 3V4FA 2I3BA 5FOXA 3W6NA 3J81k 2VP5A 2YOFA 3K9LA 4HB3A 2BCJQ 4A0RA 1NN0A 1N0VC 5ANRB 2ZPTX 4Q1CA 3WMEA 4MGIR 4PQYA 2P6UA 2ODEA 1AQUA 2HF9A 1JAIA 4IDHA 1IQPA 1NY6A 2QY9A 2R44A 4ZI3A 3KQNA 3CPHA 1F48A 3FFAA 1G8YA 2ZI3A 4A1FA 3TJZA 2ZRNA 3H2YA 4DJTA 2QL6A 4R2IA 4AIIA 4M1WA 3TW4A 2W6JD 3RRNA 4XOIA 2DHRA 3IO5A 3B1VA 2KBEA 2IS2A 1XEWX 1HA3A 4RY2A 2GF0A 4DEYA 1N6RA 4Q4JB 1JECA 4IW3B 1G7CA 6Q21A 2QORA 3EC2A 1W2GA 1F2TB 1GG2A 3LQRA 2IEYA 2VP4A 2F1IA 3FKSA 3CX8A 4D4KA 1OYWA 1KI3A 1N6KA 2QG6A 3A1UA 4OJKA 1E2HA 2ZQ5A 3JVUA 4DT1B 3ZIAA 1ZJ6A 2BEKA 5GADl 4I99A 4LHXA 1Q57A 3HPQA 4H1VA 2JIZA 4LV6A 4TMTA 4YMSA 3AH8A 4ZPXA 3AVXA 3K8YA 4JL8A 1PUJA 5D3MB 2VP0A 1G7RA 1UPTA 4RZ2A 2JJ1A 2F3TA 2A5DA 4Q66C 2XZPA 4OHZA 3GEHA 1Z47A 4QHSA 1G8FA 3QQ5A 4FIDA 4S2EA 3KDSE 1CF4A 3WNBA
chains in the Genus database with same CATH superfamily
3RBVA 1YIOA 1DI0A 3B3GA 1COWA 1FX0A 1IDOA 1SBQA 4WLOA 3GGJA 5A5FA 2ETVA 5J4VA 4W9MC 1OTXA 3TLXA 1ZGZA 3SDSA 1ZN9A 2X3FA 2J4CA 3BRQA 4NQRA 1OASA 4RMHA 1SWVA 1E2UA 2P91A 4W5QA 1DS6A 1DRJA 4OIFA 3I5XA 1K0FA 3BSSA 4MW4A 2PGOA 3DV0B 3H5WA 3CMMA 4GI1A 1PV2A 3A9UA 1V1MB 4RKQA 1QH1A 4L57A 1WUKS 5G4KA 4BV2A 1GSHA 1CY7A 2KJQA 4P92A 3KXIA 3QM1A 2IW1A 3VH4A 2P67A 1YOVA 5U9CA 2RK6A 2V0CA 1EUCB 2PZKA 1FQWA 2WUDA 1VSVA 3PL5A 4UHHA 4U6QA 5C1PA 3KTFA 2XB4A 1I7QB 1E94E 3O21A 2V4ZA 3PQ2A 3NHSA 1N7JA 1Z18A 3KFVA 4OQNA 4XDYA 3VC2A 5JASA 2R4UA 3NORA 4RZUA 1ODSA 2OLKA 3C1OA 3I32A 2QN9A 5K3BA 1T43A 4E4YA 1I2DA 3AY3A 4RKYA 3SD7A 3RK0A 1JPJA 2FFQA 5DM0A 4B6GA 2JVKA 2WFLB 1QRSA 2CY0A 3CNQS 4LHWA 1DAFA 1E0SA 2ATVA 2YFQA 4O0LA 3ETJA 1B1CA 1MJNA 4G97A 4JJIA 1LSSA 3EC7A 4JP1A 1QANA 4OXKA 1OZFA 2NU6A 2ZTVA 3GVIA 4RIFA 3VBCA 3KHKA 4ARUA 1WSDA 5KWIA 1U1CA 3L7YA 2GTHA 1OWNA 1LLQA 2WWFA 3CFYA 1DFHA 1EKXA 3IE1A 4N3CA 2EF1A 4FEAA 1P6UA 2E82A 1K8QA 1BE0A 3QUSA 3DWEX 1Z2DA 1ZGAA 4LHZA 4RMIA 5BYAA 2YR0A 1Z2AA 4RTKA 4NBLA 5CPFA 3ZW8A 4HDCA 1JHOA 4FFBA 5U1PA 1JJAA 3EDCA 1KMIY 2Q9BA 1UFQA 1F8UA 2Z9DA 3WBJA 3C7AA 4YRPA 1AF7A 4H7IA 1DHRA 1QP8A 2AYZA 3M2PA 4NG5A 5KBYA 4PSKA 3PRKE 4ITRC 2YMLA 4JJZA 4LVNA 3RS0A 4Q1FA 4J1SA 1KQ3A 1TX4B 2QRLA 1PZFA 1CQJB 3OZBA 2VWQA 4OKNA 4F3NA 5FUQA 1QGZA 2JGDB 2YCLA 1CULC 4KC0A 4RY9A 4HGRA 1KE1A 3HFGA 3CVUA 4MSUA 1E79D 2WFAA 4Z1OA 1T0UA 2Z2YA 3MJEA 1QNLA 1T4DA 2BHSA 3A1NA 2CB9A 4N5DA 5H4GA 3A4TA 3LUPA 4IMIB 1F2TA 3N39C 4LVCA 4HPWA 2XGOA 1KU0A 4WEOA 4CKCB 1A9YA 1BE1A 4TMVA 1XU4A 1NMEA 3FAKA 5D1NA 3WBFA 4EDFA 1LC0A 4EG7A 3NO4A 3WAKA 1QV6A 3PC6A 1K8RA 3D3EA 4QNMA 3DE0X 1RE0A 2WZBA 3PQ7A 4R7GA 2QRGA 4LMBA 1OZ0A 1IMOA 1ZWLA 4GIBA 4IG9A 4V0LA 2YV2A 5E6UB 3BQNB 3WWCA 4JX9A 5FFMA 2J4DA 2XUPA 3I1YA 4IIHA 3FDZA 1X8LA 2D1FA 4HFNA 4JB3A 3BK1A 4OXQA 3SM9A 2RJOA 1Y3HA 2ONKA 2NMVA 2Q1UA 1Z0JA 3PFGA 3QYJA 2J9RA 1G6Q1 1Q84A 2I76A 2J5QA 2OD2A 3P19A 5DHTA 5EP2A 4F9EA 2WQ7A 2YV3A 4A3SA 3ZW7A 3E6AA 1U2QA 3K1AA 3JALB 4MVJG 3ZVRA 3CF0A 1LQ2A 5DDIP 5KQLA 1G2QA 2VDUE 2GYVA 2W43A 1NN3A 4MWCA 3TFQA 1BN6A 3X1WA 1J0BA 4MDEA 1KU6A 2H18A 2Y0EA 3LYAA 5K3OA 4CQNA 4ASUD 1Y4UA 2QVCA 3EVTA 1PTKA 3FUWA 2XNHA 4ALMA 1EJBA 1G3RA 3BICA 1TZKA 3QWFA 2OMEA 2Q9CA 3CLTD 3T9FA 4C7MA 4LZZA 4DLRA 4ZHQF 3OZCA 3H19A 1OC2A 1FDUA 1PR6A 3QOWA 4TKUA 1POWA 1X70A 4K3UA 4ED9A 4B3RB 5F51A 4RXUA 3IPXA 1NJFA 1PZXA 2JLRA 3UK0A 5JY6A 4DUGD 2C4TA 3PDJA 5HS6A 3H2JA 3OFKA 5CD9A 1C7JA 3FOEC 1OT3A 3VAZA 1GT6A 3ZZMA 3DAPA 1D0SA 3ROFA 3AI7A 1X7ZA 3ZWVA 1IONA 1A98A 1X15A 2NLOA 4XVRA 4A26A 1TTQB 4B5LA 1KYQA 4YDQA 1G16A 1JXQA 1TT5B 2EZ9A 3EY4A 3HK2A 2PSFA 4G0UA 2XQVA 2BP7B 3LHSA 2IH5A 3KD2A 4JIGA 3N5CA 5A62A 3SXUA 4MDHA 4C22A 5BMVF 4MX8A 1P9RA 4MLZA 4ZGBA 5ALZA 2ZM5A 1B2RA 5G53C 1VG1A 2JFOA 4BFVA 4OMFG 4IDOA 4ZAYA 1YC2A 2RKBA 3FKQA 2PDAA 3TLKA 3H2SA 4EA6A 3RT9A 1Z0DA 4GPIB 1GZ3A 2R65A 4O5OA 3GRUA 1IDN1 1VBMA 3OHMA 4MAAA 1SCNE 3C45A 4MP6A 4AJEA 1ZR4A 2QR3A 2ZSAA 3NHJA 3OTIA 3SSOA 4GE3A 1BA2A 5DOVA 1SD5A 3STYA 1C4WA 3HJCA 2Q5CA 4AG6A 4B32A 4DCTA 1U1DA 4NCKA 4Q7QA 5BNIA 4DRZA 1ZRSA 3B8HA 3JZAA 4IH9A 3BZWA 4BVAA 4GLOA 1QHGA 1SXIA 4CMEA 4FHGA 3A06A 3LX6A 5HOQA 1LF0A 3C39A 1JG6A 2CNNA 4P4GA 3KWJA 3WRWA 5L3SB 2VF5X 5DEIA 2PLAA 5E2AA 2P69A 3VR4H 1ESMA 1Y3CE 3ASVA 5BXQC 2XKKA 1S7GA 4HYEA 2BBWA 1IZZA 3TQOA 1XQ9A 4BTLA 4FFVA 1R0ZA 5H59A 1XCBA 2CXXA 4FC7A 5KSZA 4U39A 1GUYA 4PBSA 1WXXA 4LOIA 3MT8A 2BDUA 2NVOA 1OTHA 1D2RA 4XGRA 4KITB 1USVA 1SNYA 2ABWA 4QSHA 1E2MA 5FI5A 1EESA 2C78A 3T12A 3KE9A 1XE3A 1V5IA 3TLJA 1UMCA 4Y0AA 4UNRA 1E69A 5KDDA 1SWWA 3ETGA 4IRMA 2QRMA 2DC1A 4Y2HA 5ETJA 2PZFA 4MRVA 3ZV6A 3R9XB 1XTBA 1TZMA 4LJ8A 4S35A 3GEBA 4C0LA 4QPCA 2OD9A 5FT9A 4FR2A 1QYIA 2EFYA 5EP1A 3U3OA 1M0EA 3JZIA 2AKEA 5EZSA 1ECFA 3CNBA 4Z7JA 1H5NA 221PA 2OM6A 2Y0CA 4X8HA 4C3ZA 2PR2A 3KZMA 2WG0A 1HLPA 4DDUA 1D4ZA 1L8XA 1V3UA 4RZ3A 5IYZB 2HMTA 2VTKA 2YCBA 3D6VA 4Z0PA 4MB6A 1MIOA 5F2OA 1T10A 5FUWA 1E3TA 4HEA1 3KKQA 5LZ7A 3DAGA 2AVDA 4I5IA 5HZMA 1YK1A 2PHZA 3AOEA 4KAXA 1A9PA 1VIDA 2H4FA 3EK2A 3VR5A 4YUZA 5I7UA 5IKEA 5JADA 2M9MA 2XJ4A 1M2OA 2QTCA 1V3TA 2VLIA 4QYMA 1W59A 3LUFA 4IYJA 1V8ZA 3RAGA 1R0CA 3Q0IA 4NU5A 5AKZA 3WLTA 3I6ZA 2J0SA 2R1VA 3G17A 3P2JA 4FFOA 2IFTA 1X1BA 4QQKA 4EX6A 4JP3A 2CYAA 5FL7D 4ECEA 2H48A 3OHSX 2WNSA 4RF3A 4B73A 3USZA 4L5JA 4BMYA 4CBVA 2I0FA 1EE1A 2UZIR 3TIFA 4GEKA 3VVBA 2I3DA 1UINA 2GAAA 5EWLA 4B4WA 4FKZA 5JQWA 3PLRA 5FNVF 4RACA 2B2XA 4RJJA 3RCBA 3HV2A 1R6TA 3Q87B 3FGNA 2CEKA 1ULUA 3NHAA 1KOGA 4D6XA 1IN8A 5FTKA 4MHTA 1EJ2A 1W88B 2X14A 3NTRA 3AVWA 4F06A 3WK4A 5BV2P 4V1CB 1E58A 1EFVB 4JJ7A 3AKCA 2X9QA 3NFRA 2O8DA 1PR3A 5KZMB 3UA3A 5CEFA 4HPJB 1L5LA 2XY4A 3ROPA 3TKAA 3CVVA 1KEZA 4K2AA 4X1KB 4NDNE 4OAQA 4WLVA 3H5OA 3DOFA 3QEBZ 2C5LA 3G2LA 3TR6A 1KAMA 3QUBA 4MW6A 1FY2A 2BELA 3T1QA 4BN4A 4EJ6A 2RK3A 3KLPX 5K8TA 1C3VA 1QIFA 3CF6R 3OUZA 3I83A 2AOTB 3BXZA 3DE7X 5D85A 2JCBA 3K0KA 5FWXA 1LSJA 1Q16A 4HXGA 5BURA 1XTRA 3WNQA 3E23A 5GY7A 3U7QB 3AFMA 3UKDA 4HV4A 5CFPA 4HAIA 3X43A 4QODA 5KI6A 1YJQA 1UOQA 4B79A 1NNSA 1Y6ZA 4I9HA 3FWPA 2O3SA 2MHCA 2Z9BA 3V1UA 1SCAA 4PQEA 1E7RA 1D0IA 1CE8A 2ET6A 1JDNA 3E70C 3SQDA 3ZV4A 4ABYA 2ZUCA 2QVLA 2WNIA 4RPCA 1R4MA 5BSFA 1XFAA 4HYYA 4QDZA 3R3SA 1IJEA 1S3SA 3RFXA 5KQRA 1N2OA 3Q9LA 4BLSA 3IV7A 4EG0A 3HCNA 2IPLA 1O4WA 3SYRA 1FYDA 3I0ZA 5JIBA 1ZUHA 3LVFO 5CA1F 4GI7A 4F7WA 3GC6A 2NSLA 2PMDA 3OOWA 3OZFA 1LDYA 3DR3A 4RA9A 4JSTA 2C84A 1XEWY 2P62A 2JGJA 1WDLA 4K0RA 2CT8A 1Z4NA 2WSYB 2BGWA 2HCTA 4OQXA 3LK6A 4MA4A 1NW8A 2HMYB 3A0UA 3OF2A 4C21A 2G06A 4CG1A 4B3HA 4I08A 1XL0A 3C0KA 8ADHA 1YR6A 1T6XA 2WHPA 4HDAA 2HW8A 1NJ5A 4S1VA 1F2DA 4G1CA 1E4EA 2NUAB 5FRDA 1F2UA 1TMYA 1R5JA 2WSIA 1BMTA 4F4FA 3KWFA 2DY0A 1GQQA 4ZVRA 4UAJA 3U7GA 2FQYA 2ON6A 2BV3A 3HY6A 2BFOA 4L4XA 2IP2A 1HYBA 2CEAA 1YVUA 1KOJA 2HC9A 1KDOA 1KY2A 2A1UA 1DJMA 5HJ5A 1D2MA 4J07A 3TEJA 4CKBB 2AJCA 4NS1A 1G4HA 3AETA 4A9AA 1CZLA 3GP3A 5JJKA 2CUZA 2R96A 3D7SA 2K2QB 5AT1A 2X1LA 1LSUA 3LPMA 2W93A 2G9QA 4C6TA 3ZD7A 1Y5RA 3G1UA 3HKBB 5AUNB 1AKQA 4KEAA 4CM9D 2DTEA 1TI7A 2QMUA 5DKFA 1KOLA 3RBXA 2QVXX 1PWYE 3PJEA 1I13A 1VLLA 4B6SA 1NBAA 4UTOA 4DMHA 2V4UA 3WAGA 2FFBA 3IAHA 3AQIA 4QRIA 2VSNA 4MRSA 4QNRA 3AF0A 4JN6B 4Z5XA 2DBVO 2PK3A 4G0XA 1JR6A 4EG5A 4REQB 5HX7A 4KTTE 3BGSA 1Q7GA 2DU8A 4JVSB 4Q7EA 3ZWMA 4F93B 4MHSA 2JFPA 2BGLA 1ZCBA 3AJEA 2I55A 3GGCA 3LW8A 4V39A 4BNNA 2XADA 4OHOA 2IOFK 1T5BA 5I9SA 5HE8A 1LLUA 5ESWA 1XCJA 4JA0A 4G0YA 2XJ9A 4H6PA 1DFGA 1K6JA 1A9SA 4YLGA 5JO9A 3U39A 2I8LA 2B8TA 3GMDA 2BGRA 5LMUB 2QZJA 3IAXA 4N3AA 2CNDA 1FTSA 2FPWA 1ZI9A 3GJ5A 2EP5A 5EXTA 4YRBA 2HNAA 2HU2A 3Q6MA 4WXEA 4ER3A 1RMQA 2PFKA 2HZ7A 3NMUF 5KHAA 2CLOB 3H05A 3QY0A 1DO8A 1MDFA 1JEDA 1TD1A 1GHTA 3HY4A 3PC8A 3V7YA 3VPCA 1EH5A 2UV8A 3WS7A 4MGHA 3R77A 4CHGA 5KJ1A 2XA9A 3GUCA 4JBWA 4NZYA 2DKNA 4X6LA 3VO8A 4BVFA 2DULA 1AZTA 3TLGB 3ILSA 1SXPA 1E2QA 3PKZA 3MB5A 4FWIB 5CYPA 2C9MA 5CB0A 3ADCA 1IHYA 2OUIA 4YRFA 1CR2A 2GKSA 3HCFA 2GYWA 3ME5A 4PAWA 3WYGA 1YJ8A 2GJKA 5B4VA 1F17A 1ENYA 3O8NA 4MVYA 2Y4NA 2WWTA 3L5KA 2YASA 4G0PA 4WK6A 3MPUA 2NZ2A 4UEKA 2KSQA 4DRXB 4J75A 2AKAB 3V6MA 1RYBA 1VLVA 5KX5A 1QSGA 2PCJA 2PMBA 4WX2B 1R0SA 2XUOA 2EHDA 2Q7DA 3PC3A 2XZDA 5DTJA 3SEQA 4BIMA 1GGKA 2FWMX 1I7LA 2AWOA 4R31A 1KAOA 2R6JA 4F3RA 3ADDA 3LZDA 4YREA 1SU7A 2BL4A 2Q7XA 3HN2A 2KS6A 1QGYA 4Y9SA 2R4TA 5ARBA 4WFIA 5EE3A 5AVWA 3HE3A 1Q3HA 1Q74A 1TRKA 1MT3A 3RQSA 4DLKA 5HPYB 2P9JA 5IAOA 2PWBA 4B44A 2IQIA 4K81B 1ULSA 4WLFA 3KZKA 2BFMA 3HABA 5F5XA 4QJ4A 5JZBA 2RKWA 3R5KA 5FOTA 5TT1A 2E3JA 4N65A 1NQUA 5A9SA 5KTKA 2RGUA 1J2YA 3R44A 3W78A 4EZEA 5K0ZA 4N0DA 5HP4A 4RYDA 2QSUA 2FPOA 3FMPB 4WT7A 3SEFA 2DB3A 5JYCA 3PWTA 3CVJA 5JPDA 3WDSA 3G1TA 3AJRA 2J46A 2R8EA 1KO1A 2RGBA 4QJ3A 4S05A 4BNKA 2ZJ7A 1NUQA 4N0MA 2IQ5A 4Z1MD 5IH7A 1O94C 1B8VA 2EJVA 1YMVA 3IURA 4LSMA 4GG1A 2ZROA 1WSWA 4LMAA 2DQSA 2OK8A 2PD6A 2QTNA 3FMIA 4CQMD 1OPXA 4PAOA 1FFXB 4S0ZA 5A71A 3TCNA 4K9LA 2HR1A 1W76A 1WB6A 4DMKA 3DTVB 4F1KA 3RSQA 3DE3X 4GZ3A 1GCOA 1X80A 4KQ9A 1O0BA 1R0YA 1Q1QA 2EJCA 4B3FX 3TQTA 1GA1A 3F6BX 3VGPA 1EVIA 3WRYA 1V5WA 3HRHA 2ACKA 2C88A 3U4IA 9ATCA 2R5FA 4Z9BA 3AVYA 1HQDA 2FWAA 2GLTA 4BB9A 3ORYA 1VA5A 2ORWA 3E4CA 3BWBA 1XRJA 3WKBA 3L1JA 4G5OA 4CQLA 5I4CA 1JHPA 4M9QA 1CIJA 3GRCA 2ZJ5A 3EDYA 2PUFA 1SIOA 1YJ5A 2J3QA 4IMRA 3R74A 3UXYA 4JKYA 1Y8QA 4N49A 4CR7A 3X1ZA 2L19A 1X7YB 3MJRA 2LTAA 3P0EA 4MJLA 4ZT3A 1P1JA 5AKKA 3P94A 1F9EA 4JC4A 3C6BA 1FX0B 4GD3Q 4COOA 4W9NC 3VR6D 4MA5A 5B7QA 1YMQA 5FTNA 4L72A 3ORQA 3Q0TA 3HCWA 4LISA 4ZEVA 3O8CA 3OFNA 2G9ZA 1JQ3A 4B3DA 1IMJA 1P4HA 2A0YA 3B1KA 5E4JA 1QH1B 2WU0A 1RAHA 3W2EA 2R86A 4JLAA 5C1DA 1L5ZA 5AK4A 3RC9A 4YCSA 4RVSA 5KYYB 3IAM1 2GLUA 1YOVB 3ROGA 3TZHA 1NXPA 3ZZ0A 4BBJA 1MKYA 4LF7B 1G3QA 2YS7A 2QRVA 3BJZA 1M8JA 1UFKA 2IEAA 4KQWA 4XM2A 1MZPA 5ALXA 5FYQA 2LKDA 5IXJA 1OGIA 4G36A 2ZIFA 4DEVA 5KQGA 2W5UA 3GVPA 1Z2PX 2ZPUA 3MJSA 3C4QA 1CUSA 5EIOA 5CGZA 2UUAB 1MLDA 1CU1A 3H65A 3OLXA 3W6UA 4DM4A 1EFLA 4UFPA 3AO0B 4QGSA 2VA8A 5E2IA 4RYLA 3FTCA 2HNBA 1UOEA 1NVKA 1ISFA 2RHGB 4L4YA 3EQZA 1B76A 3O7MA 4EK9A 1GAQA 2G25A 4ND3A 4UD2A 1HV8A 4ZT2A 3P2EA 2UZ0A 1KR2A 2LD4A 3ZHUA 4E5DA 4JHLA 1T6YA 2WIFA 1AZSC 3KPYA 3VHLB 3K5WA 3M1AA 4AWXA 4PIMA 4YRKA 1S2DA 4NBWA 3QU5A 1GVNB 4FU0A 1KSFX 5FOUA 1QRTA 1SXJC 2MSNA 4GECA 4RD2A 5E7JA 4CKWA 2FSUA 1QYVA 2FDCA 4N0EA 5KVVA 1T1SA 2J9YB 3VQTA 2D2XA 4QIHA 5G0TA 4YJGB 2BKLA 2C2GA 3M0EA 5IM5A 3U49A 1R50A 2H07A 1CBUA 2J6IA 3HN7A 3T15A 3HU2A 1DWPA 4IYRA 4ZO7A 1UPAA 1FS5A 3IVGA 1J9ZA 2XDWA 4QRHA 4TXNA 2V9ZA 1LVHA 4AJHA 3QKSA 4MINA 1L3IA 4WN9A 5BPFA 3TNDA 2VDMB 1RD4A 3WV4A 1ZMOA 5L3QA 3R5JA 4G0ZA 3ZH9B 4CIDA 4HDKA 4P53A 2NO4A 2GHIA 4YROA 3ZE9A 1ZSNA 2ZXEA 3IO3A 3MTQA 4QHYA 4W1PA 3WJ7A 1KERA 2PO5A 1D2EA 1YI1A 1QO0D 1E2FA 1ADYA 3PJDA 5GM2A 1RC0A 3O9MA 1GA6A 4C4OA 3DF9A 4DLYA 3O2SB 3A3NA 1I32A 2J1LA 1SZDA 3EIHA 2CLHB 1ONSA 3F96A 2ZGVA 2G1UA 5BMVA 3UWDA 5J58A 1ZIDA 4AU1A 1XV5A 4FNGA 4EFKA 4ZYVA 4AYTA 1T1EA 2EIXA 3HUEA 4QBTA 2ZAOA 1PSZA 4JFRA 2YFHA 4TTAA 4O1HA 6GPBA 2ZUFA 3ZLVA 3TLMA 3C2QA 4LI0A 1S0UA 3L6OO 5SYMA 5EUMA 3OI7A 1EM8B 1N6IA 1UKVY 1ZS9A 4YX9A 3MWFA 3J80A 1NDHA 5TMDA 1JEYB 3HRKA 1NFQA 2BRUC 3JD1A 3T54A 2AJDA 5C46F 4RIEA 1NX9A 3RJTA 2VL7A 1Y5LA 4N5HX 3E9ZA 1JW9B 3A6GA 2QDXA 2PD4A 1XMSA 3CZAA 3NKLA 3RROA 1F0YA 1T0PA 4M22A 4Z49A 1JIIA 1V2HE 4M8IA 5IKXA 1FS4A 3EE6A 2F9FA 5BSVA 1O8CA 3NOVA 4YRSA 3JWGA 1FL9A 3D8BA 3EGXA 4WPGA 2G5CA 4P36A 3HBFA 4TKUB 1VCIA 1B26A 3T6KA 1W2WB 4F5ZA 3D3QA 1PR2A 2XH8A 1JKIA 4RDCA 5KNDH 2CMDA 3BIJA 3CRW1 2HIGA 4OEHA 5I7SA 2O14A 2GPNA 1W19A 5B30A 2H63A 2UZ1B 3V7NA 1UXJA 3RF6A 3T4EA 3O8QB 4R05A 4FFLA 4KX5A 1V9CA 4PHFA 4KNWA 4WZBB 3GLHB 1X7ZB 8AT1A 2P5UA 1JLLA 4KSBA 3NEPX 2RI1A 3D0KA 4FLMA 3L8HA 4W6QA 1EGMB 2LW7A 1AKYA 1X1DA 4LF9B 4H17A 4DSOA 1SHKA 3KKZA 2VYVD 4W8OA 3PHGA 1C4XA 5B4TA 1UQTA 3SXUB 4JJ6A 4MRNA 2HWXA 2PKYX 1R8SA 4HQOA 5ALWA 2ZUVA 1ZINA 5AVQA 1IEVA 4OK5A 3F90A 1FZTA 3SOZA 1DAGA 4US2R 1R7RA 5ALSA 3OURA 3U4MA 2D5CA 1YU6A 3WBBA 3ZCSA 2QT1A 4DSAA 3PDUA 1B0ZA 2IITA 4X44A 3UJPA 2RC5A 2OA0A 1GPMA 2BUBA 2JANA 3TRIA 4GKAA 4B6RA 5CITA 2ZSJA 1WAMA 4LZOA 2F1OA 2QRHA 1PF7E 1USIA 2X0JA 4M9XA 2PH1A 1CFZA 2C20A 1AA6A 2NXJA 2WLTA 2HSDA 4GL4A 1RAEA 1FRZA 3F2IA 3TRFA 1L3BA 5KOHA 2AC2A 2GN9A 3KM0A 1RPNA 2OCIA 1E1YA 4NU6A 5EQTA 4FT4A 1Q0HA 2X5KO 1H4VB 3BXHA 2FPUA 1NR5A 1ATZA 3CX4A 1AURA 4NH0A 1APBA 4TQUS 1Z6XA 2GUWA 5DXAA 4HT3B 2ECOA 4GNRA 3FSJX 2FDXA 1AIPA 4K46A 3O9VA 2WD9A 5CJJA 3LWNA 4EYOA 3D2CA 3VR5D 1NHWA 4R8SA 4L0MA 3RSLA 1PT7A 1YU9A 1A4RA 3BVPA 3HS3A 3CZCA 4WKCA 1BKYA 4GXNA 2H57A 3DHEA 1I51A 3ND9A 5HKOA 1G59A 1GGMA 4H7PA 1H85A 2G77B 2X6QA 1ZOOA 5IULC 4TTQA 1P0FA 1A69A 1JH8A 4QULA 3GLHE 3CPJB 4WZBE 5K3EA 1E6UA 1F0KA 3S1LA 3HXOA 5DNEA 3OJCA 2R2AA 1S8OA 3NTLA 2DHDA 3O4HA 1BH2A 1Z7BA 3IALA 1P6QA 5JS8A 3NH9A 1CYDA 4OUDA 3OCJA 1KO8A 2AT1A 5HGJA 1P9OA 3BSFA 3DLTA 1T9ZA 4D41A 2GUGA 4B6QA 4BNXA 3H6KA 3EDMA 1QHNA 5AJHA 1Y3FE 1F38A 2V6GA 2CFRA 2FPPA 3K8QA 3JSXA 3SU8A 1NASA 4OY3A 3CCBA 1CWUA 3WXMA 4IMJB 1KI4A 2JBWA 3QX8A 4JYZA 2D6FA 1O95C 1RM3A 5TT0A 1FP7A 1M2OB 2V5UA 3QSGA 3EQ2A 2OG1A 3ZI7A 3JQBC 5LBUA 1CS0B 3LPCA 4JI3B 2DTXA 4BO0A 5EPOA 4A6DA 3E3NA 5K2MA 3ZDYB 1D5CA 1SC6A 2C3YA 3N0TA 2FU5C 1JQDA 3OO1A 3PR1A 2E4YA 1IUKA 1DBWA 4XH9B 1XJQA 5EI5A 4XD2A 4LMPA 2AA3A 3HGTA 2FMXA 4OKSA 2OGUA 4Q02A 1G18A 4Q00A 4CQJA 4M86A 5LZ4A 2I66A 4HLQB 2AX4A 2V8BA 3CSSA 3D6TB 2V6BA 4JCOA 5EWLB 2CNWA 5AXCA 4HEHA 5E6RA 4ZYLA 3RSOA 3QE0A 2H2HA 2GD0A 4G8BA 3IESA 4IL5A 5CA1A 3HM2A 2GO7A 4X3PA 4LYJA 5HFJA 3JWEA 1AY0A 4D9EA 2C29D 4G0WA 2VP2A 4PHHA 1TAGA 4C29A 3DS8A 4OL9A 3VPAA 1FJHA 2GPTA 4IS2A 3NT5A 5LU8A 1H69A 4G0VA 3AM3A 2C97A 2CGEA 1I80A 4FMCB 5F7ZA 4D79A 721PA 2Z6AA 2PGAA 5BW6B 4D0GA 4FKMA 3C8MA 3RM3A 2C42A 4QX6A 3Q72A 1CUXA 2QSJA 2VF2A 3C5EA 4QDJA 4YRDA 3GD7A 1FFAA 2Q0SA 4KQIA 3RNOA 1ZR2A 5JD5A 2DJIA 1HGXA 1K63A 2NVWA 1P91A 3OMWA 4LPKA 3RUCA 4EJSA 3TECE 3STTA 1T0HB 3D9QX 3DMPA 2QZPA 4KOAA 3TAXA 5SZKB 1GNRA 4BAZA 2GZSA 1BXZA 5FWXB 1G9SA 3QG1A 3VOAA 4TRNA 5AOCA 1NMQA 1VLZA 1X14A 1M2JA 4JBHA 4N7BA 4XSVA 1Q0QA 3NNDA 5E8JA 3RRFA 4TLBA 3FJYA 1MABB 2AQKA 3ACDA 4BO7A 4DAOA 5AXDA 5BT9A 3PD0A 1IXYA 1LX6A 2O23A 3KHUA 3TIIA 3EXFA 1YGPA 3GUZA 5MDHA 4R8RA 1XLVA 4QOFA 4BEJA 3T5AA 1R4MB 4YPFA 4EHKA 1IH8A 1IY2A 4XI9A 1EEHA 2BSQA 1PQ4A 1HEIA 3BJRA 2FPGA 2G40A 1TJ3A 4OXRA 4X5OA 2XVXA 3TD9A 4YV0A 1QHHA 4EB8A 1MX3A 2YC4C 1I3LA 4OPMA 4KFUA 1ONOA 1CQIA 2EWVA 3TQRA 1GADO 5IAKA 5AQEA 3EA5A 3LY9A 5ITSA 3BWXA 3VDRA 4FSHA 3EWIA 4Q18A 3KFXA 4DA0A 3KYDB 3EUAA 5DYNA 5HNKA 3VKGA 3TZKA 1WMSA 4F4IA 2O2JA 1LGYA 3HWRA 5JTTA 2VF7A 1SO8A 2CXTA 2AQ8A 2A86A 1U5BB 1P0CA 2JI7A 1QMGA 3HZZA 4LHSA 4Z7QB 5JS1A 3GRAA 3I72A 3EF0A 2I2AA 2RHWA 3B7GA 1XAHA 3BCHA 3DEJA 2AK3A 1C41A 1F2UB 1CLEA 1OQAA 3KUKA 4OBXA 4PBRA 3WGVA 1E9DA 4YCNA 3AV3A 1PFVA 3LX8A 1BS2A 3TPCA 3D6NB 1PL7A 2AXNA 4C7KA 3TSCA 5IXYA 1ZPDA 4YC7A 3UA4A 2BSXA 1OXMA 3V1TC 4UBJA 3PJGA 4XTRA 3I58A 4WCFC 2C4WA 3CF4A 1CEEA 3IBTA 4YGXB 4XJVA 4FX2A 2D5AA 2HN9A 3PXDA 2GT1A 4S1WA 3UMCA 4QL3A 2ZTHA 3GRKA 2WUVA 1E77A 3TSAA 4EFDA 4MS4B 3S70A 4RQAA 1HZZC 2ZJ6A 4N0QA 5DSZA 1N5JA 1T9GS 1U3VA 4BNYA 2WMOB 4LWQA 1XU7A 3VYUB 1UM8A 2FRDC 4M9CA 5AVYA 2FMHA 3VPDA 2G7MC 3TUZC 3DE5X 2B6HA 5I7OA 3HI6A 3ZY3A 3MCAA 1NVGA 4GFDA 2XF8A 2YZNA 2I67A 2RI6A 4EGSA 1YZVA 2OHGA 2O3UA 3WJ2A 4DEXA 5DMXA 2ZSEA 5ARCA 4WFQA 2D5BA 3NTQA 2K2WA 3AIKA 4WY5A 1U94A 1AQYA 1SBIA 1ZCAA 2EEZA 3D3JA 3GVCA 5F1KA 3TQIA 1USWA 5JMTA 4YYEA 1L6RA 2R87A 3EH1A 3KAQA 4IXWA 3PXEA 4B7CA 1E9FA 3WMGA 3JY6A 3RWBA 4LVUA 1Z13A 5DIZA 3ZUGA 2WV7A 1Z7YA 4TL9A 4WESB 5IARA 3WDLA 2PUWA 1RAGA 1NVXQ 3KR2A 3UPUA 2FUKA 3ADKA 1VE9A 1W4AA 1Z6GA 4J03A 1T1IA 4R7ZA 3T9AA 2EP7A 3IB3A 3MCZA 2DUUA 2HSJA 3A6EA 3N76A 1PLKA 1G1MA 2XWBF 5KTMA 4PZLA 4UZEA 4D4LA 5K3SA 2Y0DA 2B1QA 3NDPA 5AFSA 2ATIA 3D0OA 4J1TC 4PPGA 2O9JA 1Z5WA 1M54A 4I9NA 3I92A 2WM9B 3B6EA 1XLUA 3GPIA 5DASA 5TXGA 4B0PA 3NXKA 4UDXX 3I2IA 5IAEA 3O93A 5JYEA 4UREA 3OAAD 4IIDA 1J0XO 2R6FA 2WJ4A 4M38A 1IBLB 1B0UA 4RMGA 5DWVA 4OXNA 2G6TA 4IEFB 4PCVA 1MAVA 2ZYTX 2ZUUA 4CEIB 4FP9A 1N3YA 3FBTA 3GAAA 1D7OA 4P86A 5D2CA 3L7JA 4F2PA 4EY8A 5BVGB 1ATIA 2BHTA 1TJYA 2CC2A 3OICA 2WDPA 4U7WA 2APJA 3I8OA 1RI1A 5FDFA 3OQPA 1DQZA 5LP6A 1D03A 1JQKA 2QDKA 4CM3A 1YR2A 2PT5A 5A5GA 2NTVA 2ZJFA 2VDOB 3FYUA 3KZOA 4HAZA 1QF7A 4I5DA 3ZK7A 4LF5B 2CWDA 4MKGA 4CPDA 2FN3A 1O87A 3S7TA 4YP6A 1M2KA 2FCRA 4FINA 4OGLA 3LPDA 2O7QA 4ITVA 4PRKA 4X60A 5E3JA 4FOPA 3T1NA 1HH4A 1QS0B 5F3WB 3KELA 5AQ1A 1NM5C 2OSBA 2J9FA 2XNDA 1EJ0A 3K3PA 2DT5A 1KH1A 3MUEA 4I6JA 1X9IA 1BJTA 2OFXA 4KXNA 1NXQA 4AVYA 1E9RA 2KQUA 4IOLA 5J4HA 1HK7A 2WWGA 3CNNA 4HYTA 5ELLA 3GJQA 1KI2A 1U1EA 1WEKA 2CJYA 3IOCA 4LJ9A 1N7HA 1EJ6A 4HOYA 2QTVB 2G4CA 1JSRA 1MAHA 4D9HA 3PD7A 1BAPA 4TZ0A 1XI2A 4J0JA 3G0IA 1KP2A 5AP9A 1RWKA 5F7JA 1DKOA 5EHIA 3MXTA 2HDHA 4EVSA 2BI4A 2CLKB 1B23P 5GJBA 1GNSA 2D5IA 3FR7A 5K6TA 3DSRA 4PM4A 1R15A 4FC6A 5I8ZA 1ISMA 3NYWA 4S2UA 3EQ8A 1U0BB 2GWRA 2V58A 3IP3A 1DZIA 4C0SA 4TLEA 1N2JA 1R66A 4P84A 1WVGA 3WSTA 1NF8A 4F6RA 5JZ9A 3HXTA 4D5EA 4E6PA 4W4TA 3DA8A 1G60A 5FR2A 4KNYA 2BTEA 1N2CB 1JUDA 1NNI1 2F43A 1QV9A 4DWWA 4WINA 1PT8A 4HMQA 4QDOA 4MQ5A 3JXEA 4MVJI 2VHZA 1JFFB 1PUXA 3SBEA 4BMCA 3IP6A 2IP1A 2CD9A 3MNFA 3ZDRA 4C08A 3P2YA 2ZIAA 1T5DX 3L0ZA 1O96A 4H15A 1OF1A 1PG2A 2DETA 1RAFA 3S99A 1K27A 3TSOA 4FS3A 1GYRA 2JZNA 3SC6A 1DUVG 2Y8EA 3QI2A 4ND6A 3AFHA 2VBFA 3AUXA 1KAEA 1Y8QB 3ISVA 3PENA 3EGEA 2AS0A 3IVAA 3BRWA 4KUEA 3I9FA 5AVUA 5FOVA 3G0OA 1YZNA 1NOIA 4QQ8A 4TMYA 4U5XA 4CCWA 2P6PA 2OP1A 4I1UA 3CWQA 1YQQA 3JWIA 2QI9F 2DR2A 2IXDA 3B5IA 3SQMA 5F7OA 1YNSA 3K53A 5C31A 1IXRC 1OXTA 4FD2A 5LYJA 1UBUS 2O5VA 4Z7OB 4UU7A 1QTRA 4FEEA 4GC5A 1ZOLA 2GCPA 2TYSB 1EK2A 2OO3A 2ZB7A 2NU8A 3Q9NA 1P4SA 1HT2E 2QMZA 3T3OA 4I55F 4K9DA 3LC2O 1WXQA 2OHVA 4E08A 5EQFA 3OY7A 1OXVA 3KUUA 4EPXA 5LQJA 3GA7A 1N34B 4B40A 4QWMA 2KM1A 1YDMA 5CR9A 4HZUB 2BZ1A 2J3LA 4HXYA 3U6BA 5AUPB 2CNBA 4EAAA 2GK7A 3H13A 2EZ4A 3E7XA 1T26A 4LOLA 2OYRA 2OC4A 3ISTA 3I5UA 1IJBA 1D2HA 1GZ5A 1K92A 1PQUA 1Z0ZA 2JBAB 5FO1A 4P5DA 1E2NA 2NZUG 3ENZA 3QA3E 4H1UA 4RBNA 1DAMA 4AX4A 4OYHA 1S1MA 4DLUA 1BO6A 5JRZA 1XL1A 3VTAA 1DEXA 3PDWA 1J8QA 3GRVA 1U7OA 4PSUA 1CY0A 1AK1A 1KVQA 1N2CE 1P2DA 4JYBA 1L7DA 5K8LA 2YWBA 5L6LB 2VPPA 2LXNA 4TWAA 4GKKB 1WP4A 1J23A 2JIDA 4EF4A 2JASA 4D02A 2PQ6A 1SOMA 4POOA 2Y2UA 2ZRQA 1MOZA 3FCOA 5ELMA 4YHBA 4HH3C 4LRQA 2AF3C 4F2GA 4A6XA 8ATCA 1RHRA 4GMKA 5HDQA 5THKA 3V3TA 2IP4A 5KTSA 3E9MA 3L7IA 1Z83A 5J2UA 2H1OA 2VTVA 2FEXA 1V16A 2HIMA 2Q41A 1U6JA 3P32A 4CW7A 5IN4A 4K6CA 4OI0A 3RYCB 4Y6LA 2B8NA 5JQGA 2MOKA 2G4VA 3D64A 2ANCA 3GOQA 3GJRA 5J63A 1JB9A 3Q11A 4ZHQB 3LUAA 1IM8A 1W0JA 3HHEA 4EPYA 3UWKA 4WN9B 5EIWA 5KNLA 5KYXA 2AXQA 4QFBA 3EPKA 1ORHA 3JQ8B 3O4VA 4RTJA 4HDKB 3QJ5A 1WQ4A 1TQ6A 1F2VA 3G7UA 1XHEA 5EHQA 3KLOA 1NF2A<