4TTPA

Crystal structure of legionella pneumophila dephospho-coa kinase in apo-form
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
201
structure length
201
Chain Sequence
b'MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 72
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttpA00
2CE2X 2ONKA 4ESHA 1Y63A 3B9QA 1NSFA 5GJVC 3THWB 1NRJB 3TVDA 3SJAA 3ZGXA 4PZYA 2WSMA 1TU3A 3TKLA 4C4PA 3ZVMA 2V3CC 1CJUC 2OM2A 2HUPA 2ZRBA 3RC3A 1XU4A 4R2IA 4JLOA 3LX8A 4Q4JB 3CWZA 1II8A 1TF5A 3LQQA 2ZRCA 3W3AA 1L7VC 1S8FA 5DI3B 3GLFB 5FTJA 1N5KA 2W2XA 2YC2C 3B7GA 4RZ2A 3SYLA 3W3ZB 2HYIC 4E03A 2NMVA 1S9HA 2O8BB 1A4RA 2WSSA 4IDOA 1SGWA 5FPKA 5L3SA 1VMAA 3FYHA 3W6PA 4AK9A 2QROA 3AVOA 1VG0B 5GVRA 5HE8A 1E2MA 3QG1A 1CBUA 2VEDA 4E07A 1WXQA 2H5EA 3EIEA 3IPYA 5L3QB 1T4GA 4Q02A 3T06B 1VCOA 4XSGA 3R9IA 1DTSA 3U44B 1FTNA 2WSSD 4XVUA 3SDZA 1C4OA 1HE8B 2OSBA 4BZXA 1BYUA 3FHOA 1OIWA 4NYJR 2D7DA 2P0EA 4B6EA 1T0JB 2OBNA 2PMKA 3VR5A 1UAAA 1JALA 1U81A 2PX3A 2CNWA 2GZAA 3UWKA 2N42A 2R6GA 3KXLA 3RWOA 2GCOA 4RZXA 4M1KA 5FBLB 5DIFA 4BWYA 1Q20A 1G7SA 1U0LA 2JA1A 2IUSA 4JBXA 4QGAA 1PLLA 1CJKC 5KDLA 5DISB 4IDHA 3SFZA 2NGRA 4IXNA 5FOTA 3W8NA 2XITA 1OFHA 2CHQA 1W4RA 4JL8A 5TMPA 1SULA 4G5GA 1WMSA 4A15A 3UK6A 1DG1G 2GK6A 1OIVA 4IVRA 3K09C 2GHIA 4IXMA 1QBKC 2DB3A 3X1DA 1SVLA 1Z22A 1CR4A 3EPHA 1DOAA 2PEYA 4V0ME 4BLOA 3W8RA 1KDOA 4V0MA 3TAHA 1NNEA 4A0FA 1SVMA 1PV4A 1E9FA 3QQ5A 3HPQA 1UADA 2CL7X 3QNUA 3V4RA 1Z47A 1MR3F 2HT6A 2PZEA 2C8VA 1V5WA 2I4IA 2ONJA 3UKDA 4NYMR 4WW0A 1N0UA 1R6BX 1X8JA 2GRJA 4IFBA 5E7JA 3SHWA 5JZVA 3TSZA 4B2IA 1OT3A 1V43A 5JS8A 3PIRA 3QKRA 2EU8A 5JECA 4A2PA 1DO2A 1GRRA 2Z83A 2FGKA 2ZXUA 3K9LA 1TL7C 4MKIA 3I5XA 4D82A 2BJVA 4I1VA 2PX0A 3GFOA 1VCIA 1E2EA 1Z08A 3SYKA 4PC1A 1LNZA 3EWSA 2HV8A 3CW2A 3H4MA 4NONA 2OFOA 3M4YA 4X8LA 4EJSA 2CBZA 5LD2B 5AK0A 3WMFA 4IRUB 3EIHA 1MRNA 3R7WB 2AL7A 5KUTA 2HXSA 3NDBB 3BXZA 3ONWA 2HLDA 2P6UA 2G0NA 1W4BA 1Z63A 3HU1A 4G5OA 5CITA 4D80A 3B1WA 2AXPA 2E87A 2HYDA 2QI9C 2ASEA 3MUFA 5DE3A 4EPXA 1Z2AA 4B34A 2JJ1D 4IOMA 4OQLA 2QBYA 1GIAA 5LBIA 3FKSD 4U5XA 1KZ7B 2QQ0A 2L0XA 2NO7A 1P62B 2VSFA 1E2KA 3A4NA 4U00A 2R2AA 1XTKA 3BFXA 1KAOA 3C16C 3QXCA 3OEHA 2Q6TA 2V6IA 4B2LA 2GJKA 2IS1A 5K8IA 2B7BA 2CXXA 2C95A 3CPEA 2BVNA 5DH9A 2IHBA 2J0VA 4QGHA 3IKJA 3HDTA 5TY0A 2V4ZA 3AH8A 4PAMA 1ZIPA 2Z4SA 1ZYUA 3A8TA 1YZTA 1M74A 2J0UA 5FBRB 3R20A 3WBKA 3T1OA 3AVVA 5AJZA 2J7KA 2XSZA 1UBFA 4DCUA 4GT1A 1KJWA 4V0OA 1SHKA 1W4AA 4NCJA 2QAGC 1NY5A 2HCJB 1U8AA 5J40A 4IKEA 4US2R 3VKGA 2VSOA 1XTRA 1ZBDA 1Q1ZA 4W5JA 3LVQE 1IN7A 1U9IC 2PLFA 3H86A 2QE7A 1TQDA 3NG1A 2REBA 3QIAA 4HDOB 3WNBA 1BMFA 4GOJA 4E5UA 1TF7A 3TR5A 5A0FA 5HCNA 1Z6GA 3QXHA 1CR0A 5B64A 2P5TB 4K46A 2GCOB 3QF7A 4C2TA 4I1OA 2QMEA 3CH5A 4B3DA 1YZQA 2ZIAA 3HP1A 2G9NA 4LHWA 2NO1A 4ZDJA 4A36A 1IJFA 1JAHA 4I4LA 4AKIA 1NN5A 2ZVPX 3VAAA 4PHTA 4C0JA 1FFHA 1U8ZA 2FOLA 3X1XA 3EPLA 3AF4A 4CDGA 1KDRA 1T8UA 3C14C 3EASA 3I1FA 2W0MA 4CT4B 3AM1A 3VR2A 3SOPA 3TIFA 1JR3E 3QF4A 5D3MA 3AVTA 4W5WA 2IS4A 2Q9AA 1UEJA 3CZQA 4ZKEA 3AVYA 3LLMA 1E2PA 2WKRA 1Z29A 5FOSA 3IEVA 1DELA 1MT0A 2VO1A 4DVGA 1J7KA 5J4VA 4LZZA 1D2NA 4RKEA 2FGJA 4KYIB 4BASA 3TUIC 3QI2A 4NE2A 3U5ZB 3A58B 3N2IA 3S1AA 4CZ2A 1JR3D 4DLWA 3KFXA 4IW3B 4JJZA 1F2UA 3VMFA 1XTJA 1ZNYA 2FZ4A 3QENA 2C9OA 2DWPA 4FCTA 1KIMA 5JRZA 4S2EA 1KI6B 4ZIRA 4C7OB 5JBQA 1G1MA 3NBFA 4D4KA 1EFRA 1G4UR 1JJVA 2ZI4A 2ZJYA 4NU0A 2ATXA 3C7KA 1F3OA 1KI7A 3RS2A 2IYQA 5EE1A 2FA9A 4HAWA 4MYHA 1VKJA 3KUDA 5GJWC 4GNKA 5FI0B 1CJMA 5FOUA 4CYMA 1VDZA 1FOEB 3RANA 1PZNA 3R9XA 1EGAA 4DCSA 5TXGA 3PJRA 4HLUA 4W7SA 2GZHA 2FSFA 2EYUA 4FMCF 3DKPA 1GUAA 2ZI9A 2QEQA 4WXRA 2ZE7A 3AVUA 1E2DA 2H16A 2WWYA 4RFSA 5F2EA 2O0KA 3K0CA 4KLZA 5KOYA 4JYBA 2MSCB 2V1XA 4F38A 3B6EA 2HT1A 4L15A 2OUKA 2A5DA 3V00A 1KSFX 3FWYA 6Q21A 2CCJA 1W46A 4U02A 2BC9A 4Q1CA 1R2QA 1G8FA 4MUAA 1GSIA 3FKQA 3PUVA 3C4JA 4QC2A 4MRVA 4D6PA 2X2EA 3CLVA 1PUIA 1E1QA 3DM5A 3NTUA 5ELXA 1US8B 5FBQB 3RHFA 4M9SA 2J0UB 4I99A 4FW9A 4DLZA 4GZMA 1IXSB 2HF8A 5E3HA 1P6XA 1YRBA 1E2QA 2A5YB 4MYCA 4TT3D 4YDHB 1EFTA 2R6DA 4HATA 1CJTC 1P73A 3KTAA 3BC1A 3Q9LA 5CB8A 1Z07A 3MWLA 4MGYR 1G9XA 2NPFA 3W34A 5JFGA 1ZJ6A 1BS1A 2FMXA 5C1BA 2GKSA 2G88A 2F43A 2OFWA 1E94E 2WJHA 4KFSA 3TH5A 4XIGS 3LA6A 1XEWX 1ZINA 3EA0A 3QXJA 1FP7A 3FMPB 4TL6A 1DG3A 1H8EA 4R71A 2CK3D 4D81A 1T5LA 2QPTA 2DFLA 3RS7A 1LS1A 3GPLA 4CF7A 4Q7JB 2QZ4A 3I73A 3GD7A 5J4KA 5CLQA 1YZKA 3QG5A 2CDNA 1H8ED 4M4SA 4GP7A 1VIYA 2IEZA 1E98A 4EUNA 1KKLA 1AS3A 1LTQA 3RDPA 3LBHA 1Z6AA 2ZETA 1XCPA 4M8NE 4HAXA 4IDPA 4RCZA 2ZJZA 3SZRA 2AD5A 1T5IA 3CB4A 5SZHB 1RPZA 4CT5A 2NQ2C 2VF8A 4CEJA 3R8CA 5EZ6B 1RVDA 1GKUB 4DSTA 3SHFA 1NVWQ 3EZ6A 1ZUNB 1AS2A 3BRWD 1XCGB 1X3SA 2GESA 2JEOA 5F9HA 4A82A 2GAAA 1NG9A 5JHGB 4MRNA 2BCJQ 1YQTA 5EP2A 4B43A 2DY1A 1T9HA 4P4UA 1XPOA 4LYHA 4DLUA 4GOXA 2UZ3A 4B73A 5A5GA 2D3WA 1CRQA 3R8FA 3RS3A 4XSHA 4HUQA 2GJ9A 3ZVLA 4Q66C 2G1KA 4GFDA 3A1VA 4ZDKA 1GKIA 1CS4C 1XPRA 2WOOA 3RS5A 2CHGA 3TQCA 1VYUA 5IHPA 2AR7A 1JXOA 2JJ8A 1IN8A 2DWQA 4N0EA 4EPRA 3P4XA 4LPKA 3LRPA 1DE0A 1CR2A 5BN5A 2GTPA 2ZRKA 1P7CA 5L3RA 4BZPA 2QNRA 2ZU0C 2EW1A 4BLTA 1OHHA 2QRNA 3H84A 5CIWA 4ACBA 2AWNA 1GFIA 3T61A 1YZUA 2BOVA 3AKCA 4DLYA 4A0GA 1X1SA 2ORIA 2UKDA 4DB2A 1P9WA 2ZPTX 3RLFA 3RS0A 3KKMA 3ZS9A 2PJZA 1LVGA 4H1UA 4DDVA 2O8DA 2IYSA 3OFNA 4BFZA 1VTKA 4MYUA 3PUXA 3AVWA 1LF5A 3A1TA 4B75A 3BIFA 4UQOA 1KK2A 3CBQA 3BK7A 2NG1A 4B3FX 4TL8A 3J81k 2FF7A 1ZNXA 4TYQA 1TADA 2D06A 4XOIA 3X2SA 2F3TA 1NJGA 2BBTA 4P4SB 4CIDA 2WBLC 1JXMA 4HI0E 4NMMA 1GWNA 2GJAA 4PR0A 5G3YA 1XMSA 4L8GA 2XNSA 2G1JA 4DCNA 2C04A 1K8RA 1NJFA 5FTKA 2OESA 3MFYA 3WY9A 1HUQA 3LW8A 3KTAB 2A30A 3DOFA 4NCIA 3EW9A 2O8CA 1ZIOA 2GXSA 5KNCA 4RZUA 3VR1A 2R44A 5GJBA 4XVQA 3THWA 2JLXA 1EK0A 3WRXC 4Z51A 3CRQA 2F55A 2J59A 1JEDA 1K6MA 1KI9A 4AG5A 3QBVA 3JZAA 4TLDA 1NL3A 3ZYCA 3REFA 3AQ4A 3VX4A 3B2EA 4LYAA 3VQTA 4URXR 3SQWA 4F92B 1TEXA 4Q4JA 1W5SA 2ZAOA 3NKVA 2BJWA 4LWZA 3GLFE 1U0HC 2A78A 2DCUA 2R6FA 1QG4A 3K0AB 1KSJA 3GLFA 3GEIA 2IS6A 1JPJA 1B0UA 3E70C 2ZAMA 1OPXA 3ADKA 1NLZA 1W47A 2GETA 2A9KA 3TJZA 1KK1A 2FG5A 2ZR9A 3H1TA 2X19A 2QUZA 2WKQA 3CH4B 2BMJA 3L8YA 5L3QA 4CEJB 3ZD6A 4C0LA 3AP1A 4RKFA 4M1YA 4E09A 1TQ4A 5C4GB 1ZRHA 2MMGA 3CR8A 4J0QA 3SEAA 1D5CA 221PA 3CM0A 3AEZA 1E2HA 2B92A 3AKYA 1GG2A 5K8LA 2J3EA 2N1BA 1MKYA 3AUYA 4M1WA 4H1VA 1QRAA 3LQRA 2KJQA 3NEYA 2ODEA 1P5ZB 4YMTA 1L4YA 1VPLA 1OE0A 5JJIA 2JAQA 1J8MF 1S1MA 2GF9A 1BH2A 4U7DA 3P32A 4LYJA 4F93B 2DHRA 3CF0A 3G0HA 2V1UA 3BD9A 4YMSA 1Z3IX 5HKKA 4BZQA 5J4LA 2GILA 3OF5A 1P75A 4RFVA 5KNDA 2OG2A 2ZROA 1X86B 4F4JA 1Q0UA 2G6BA 4M21A 1FNNA 2AK3A 5FUWA 2HJGA 3TNFA 1TUIA 2XNDA 1S3SA 2Z6VA 2CVFA 3CF2A 4P0TA 4D2IA 3CRRA 5M04A 1Z0JA 5JWOA 3KB1A 2QSYA 2XX3A 1QHIA 2D2FA 2QP4A 3VFDA 3REGA 1HV8A 1N6IA 1U0JA 2W6ID 2WKPA 5FOWA 3NC1C 5E4FA 3IPXA 2OLJA 2JLSA 4TYWA 4OQNA 3NC0C 1VG9B 3UMFA 3E1SA 4M9ZA 4AD8A 1G64A 4G5QA 2RGNA 5UKDA 1OKKA 3IO3A 4FCWA 3L8ZA 1FMLA 5JHHB 3R9WA 1E0KA 3WNCA 1RW4A 2XZLA 2ZRMA 3TK1A 2NOAA 4Q7LA 3UXMA 1NIPA 2GEVA 4O0MA 1SXJC 4MUBA 4OQMA 1W49A 5CB6A 121PA 1GNRA 3A1WA 3QSYA 2G77B 3BGWA 1R4AA 2KE5A 1OKKD 2CCGA 1ZU5A 2LCFA 3I72A 2WIAA 4ZO4A 1XMVA 3LLUA 1H8HA 4C30A 4M1MA 3R7WA 2C78A 4A6XA 4LJ4A 1I4TD 1KDPA 2D4HA 3ASYA 5DYIA 4ZCIA 2I1VB 2GXUA 1RE0A 5H70A 3RNLA 4HZIA 4KHZA 5L3VA 3GFPA 4US1R 4JKIA 3MD0A 3O8BA 2O8CB 2ZSAA 2OCAA 4KBGA 3LV8A 3MWYW 2J46A 1VHTA 3NDPA 4LJ6A 4LPSA 3THYA 2EFGA 2QGNA 3BB3A 1JECA 4MKHA 3ZZTA 3U3RA 3L0PA 3VTKA 4PO1A 1IM2A 2YWEA 1AKEA 3CIOA 2BKUA 1H65A 3RWMB 4D0GA 5JI2E 2QL6A 3DEFA 4N1AA 4WIAA 5DGXA 4FMDB 1AGRA 4XWAA 1FMJA 4BFTA 3VR3A 3CKLA 2XZOA 4V0KA 2ORVA 4JLDA 4HB4A 4RVCA 4R98A 2C96A 1MABA 1ZC4A 2NZJA 4BFUA 4BECA 3ICQB 3PG5A 4MRPA 4DDTA 5KPJA 3GQBA 4IVQA 2BCGY 2GEDA 2QA5A 1EXMA 5C4MA 3EPJA 1XEWY 2ZRJA 4QHTA 2QGZA 4QNRA 1S96A 1HEIA 4AYWA 5EP4A 1KO1A 1TU4A 4UXIA 4IOLA 1RC8A 3CUEF 4LJ9A 1TQ6A 3ZH9B 4JVLA 3B1VA 3CZPA 3MRSA 2IC5A 1RKBA 4BFVA 1WA5A 4M1OA 2V7QA 1MV5A 1YRAA 1S1CA 3ZQJA 2PJRA 3H2YA 4XWKA 4OHVA 1W44A 4LJYA 1IONA 2BM1A 4FMDF 3EXAA 5LD2C 2VP6A 3DOEA 3IIKA 4LC1A 2JLVA 1N6HA 2EYQA 3NBXX 3L43A 1WQ1R 2PZGA 2V7QD 3I61A 3Q7QA 4D4JA 2FFAA 2F3RA 2H8KA 4DIDA 4OI4A 2BMEA 3AVPA 5EXPA 1XDBA 2C03A 2R6CA 3IQXA 1KO7A 2ZUBA 1IBRA 4R9UC 2BMDA 1DAMA 1YE8A 5SZIA 4B3CA 2LKCA 2IXGA 1W4CA 1GL6A 4OJKA 1Y3AA 1CEEA 4EIWA 2IW3A 2QMHA 3M0EA 4PXAA 4G5SA 4UJ5A 1IN5A 1NVVQ 2YHSA 5ANRB 4OI0A 3B78A 2B7CA 2KWIA 4QXAA 4ZCLA 2WWHA 4JLBA 1SVKA 3D7MA 1PLKA 3ZVNA 2JLWA 1M34E 1YZLA 4HAYA 2IK8A 3OIYA 4HLQB 2C98A 1RJ9B 2CE7A 4IDNA 1HA3A 4M1SA 2JLRA 1W48A 2DFNA 3ND9A 3BOSA 1ZD8A 1AKYA 4M0LA 4KFTA 5KSOA 4B44A 3FHTA 2DFKB 2JIZA 3I92A 1IY0A 2WWXA 3IBGA 5E7IA 5JWRA 4PQYA 2Q9BA 1Q57A 1VIAA 4KV9A 2VHJA 5DO9A 1KI6A 2WAYA 4C7OA 2ZQ5A 2FZLA 4IOKA 3VNVA 3Q72A 1DAIA 4DUGD 5EXXA 3B13B 5FL7D 1IHUA 4TYYA 2CJWA 3B5JA 3P20A 3QXXA 4I81A 2GBLA 2JIZD 3IGFA 1G18A 1ELOA 4XTRA 2JJ1A 4Y0VA 1N0VC 2IUTA 3FVQA 3FKSA 1L8QA 1JQLB 2ZVQX 4LBZA 3TW8B 3MWKA 3VHLB 4D4MA 2R6AA 2YKGA 5AUQA 3BERA 2RHMA 3LBNA 2HDNB 1XJQA 4O2LA 4AIIA 2OFXA 4UNRA 1R5OA 3VHXA 3THYB 4B33A 2SHKA 3MMPA 1E9BA 2JLQA 5B58C 3LFUA 4AI6A 2WWGA 3BH7A 3AB3A 3I62A 2VHCA 2NIPA 2OE2A 4TYNA 4BFXA 1YR8A 1HT2E 4TMKA 4TLAA 4FN5A 1E4VA 5IDVA 521PA 2OXCA 3A6PC 4Z1MD 5HR5A 2WWWA 3PXGA 2FPLA 2VP2A 4GZLA 4D4LA 621PA 4JKYA 3DVLA 2Y8EA 1MABB 2GWHA 4QL3A 5JSZA 4JS0A 2O0JA 2P5SA 3GJ8A 4LC0A 4PSVA 4DDUA 1K5DA 1LV7A 1US8A 5K8UA 4QM6A 2ERXA 4OK5A 3A1UA 2JLUA 4LHXA 2WAXA 4JLAA 4DLVA 1XF9A 3OZXA 1NBME 4LYFA 4C0AC 3SJCA 1D9ZA 4NKRA 1R0XA 1I4DD 2J7PD 4KODA 1QDEA 1XMIA 3E5HA 4EPWA 3PEVA 4LCBA 4Q4HB 2IUUA 1KI2A 3T1VA 1TQ2A 4MKGA 4XJXA 3LAWA 4LJ8A 4MRRA 2VH5R 2RGEA 3W6OA 1R0YA 1W0JD 3LH5A 4ILEA 3OIUA 2WHXA 2Q0HA 4C3ZA 1A1VA 2OCYC 4TTRA 1NBMD 1N6RA 3AP2A 4EJSC 4EQ6B 2ZYUX 3G5UA 3GCGA 1GP2A 1ZD9A 4WVFA 3DZDA 5FL3A 4GL2A 3Q5EA 1XCMA 4CEIA 2XJ4A 3O8DA 4MQBA 2Q3MA 1G21E 2ORWA 3EZFA 5AJXA 1FPMA 2OBLA 2BKEA 2ZS7A 1QVAA 4BLRA 2EVWX 2IXFA 4OHYA 1G3RA 4B48A 3KJHA 4M9QA 4MH0R 4O25A 2EFCB 4LBWA 4UNSA 3CPJB 3ETLA 3KXKA 1Q44A 3P4YA 2ZJ5A 5GADl 4ARZA 3A4MA 1QHGA 4NYIQ 1S0UA 2BBWA 4URZR 3MWJA 2Z4RA 5FUXA 2Z43A 4P31A 2PCLA 3PFIA 3CRMA 4LJ7A 2QM8A 4KJZA 1GL9B 1JR3A 2WJVA 3N70A 5E7MA 3ZJYA 4BFSA 2F1IA 1DS6A 1XTQA 1T8TA 2VP4A 3F8TA 3MAAC 1OXSC 4F91B 2AHOA 3B8HA 3U60B 2RGGA 4BFWA 2ZRGA 3HU3A 4L9WA 3DM9B 4HB0A 5IT5A 1N6PA 4M53A 2XOKD 4DKXA 4MYTA 4F4IA 2IYXA 3HYTA 2QAJA 1AGPA 4F7WA 1KAGA 2YC4C 1E32A 1KSHA 1QHHB 2IBMA 2VHTA 1QHNA 2AKAB 2KI5A 2ZUCA 3NXSA 4G01B 4GRAA 5FPTA 4NPHA 3ZZUA 1RYFA 1QVRA 5KPDA 4TLCA 1DBSA 3GLGE 1N6NA 4JBYA 4FD2A 4DSOA 3B85A 1HQCA 2F9LA 5TV2A 5GVSA 1HTWA 5KSYA 2CL6X 2YWGA 2CJWB 3DDCA 3K9NA 4WZ6A 4ZDWA 2HJVA 3KQNA 1XB2A 4I1UA 4S35A 1AZTA 4PHHA 4A2WA 5B57C 4B3BA 2XEXA 1LY1A 3TSWA 2F1HA 4RY2A 4EKDA 4LBYA 2B21A 3MJHA 4YQFA 4CEHA 2EFDB 4A92A 5JEEA 3QKSA 4XH9B 3I3SR 1E2JA 2HCBA 2RGCA 1EWRA 1TX4B 3T1QA 1EFHA 4LV6A 1E2GA 4WXPA 2Q21A 4A9AA 4JMPA 5JJLA 1GNPA 3IILA 1MO3A 1UBCA 2I1QA 3SE0A 1NKTA 4JIMA 4Q03A 3ZZ0A 1T0HB 2VA8A 4TT3A 5F98A 2W6JA 2ZSDA 3QPWA 5JSZB 2O52A 3F5FA 4OHZA 3DZ8A 3VU9B 1FUKA 4P4SA 4X8MA 3QBTA 3NHBA 3FTQA 4LJAA 1IXZA 2RCNA 4PTLA 2BHRA 5F3WB 2FEMA 1U8YA 2ZRAA 4KXFB 4FXPA 4BE7B 3HWSA 2PBRA 3CNLA 2W6JD 3D3QA 4JLNA 5EZ5A 2ANCA 4Q48A 4KFUA 2CK3A 2NPIA 1XD9A 2ZEJA 2OBMA 4Q47A 4NCKA 3GJ4A 2QRZA 5HPYB 2NO9A 5EP3A 2WZQA 2YV5A 4KI0A 5HE9A 4B74A 2IX3A 4JLMA 1NIJA 2GDJA 1XP8A 3ZQ6A 2HF9A 4WZBE 5KSPA 5FPSA 1OW3B 2FPMA 3GEHA 2B8TA 2OAP1 3IO5A 1LB1B 3OEED 2IWHA 3U7GA 4Z8XA 2VTKA 4NBSA 4CEIB 1M8PA 1CJVC 2QU8A 3IUYA 4HYYA 4UXJA 3LVRE 5FOVA 1ZM2A 1UDWA 3ND8A 4PC2A 5LPNA 5E95A 4URWR 1W36C 2H17A 4MDEA 4HLUC 3K0AA 4JSYA 4DRZA 2F9MA 2OXRA 4PQFA 1UF9A 1W2GA 2QG6A 3P1JA 3SBDA 5DN6D 1W1WA 4PPGA 1CRPA 4DLRA 3ICEA 5TB5A 3TMKA 1Z28A 4ZCMA 1XEXA 4ARZB 2EWWA 3K0CC 1KMQA 2GNOA 3RRZA 4WBSA 3G82C 5BQ5A 3O8RA 1II0A 4TMXA 3ADDA 1G41A 2ZRHA 4TTQA 1C1YA 3WHLA 4DWJA 1QHSA 2VP0A 4OQXA 5JWHA 1ZM7A 2WOJA 1RYHA 2H1LA 2Z0MA 1FZQA 4ESVA 1NF3A 3L0IB 1SVSA 3SNHA 2QTVB 1DARA 1XWIA 4X8HA 2EWVA 1Z6TA 3KQLA 4Q1AA 4PSAA 1ZVQA 4Q1BA 1G4AE 2OT3B 1G291 1N2CE 3BFVA 2WJGA 4NYJQ 4MDFA 1KDTA 2IXEA 2FFQA 5AJWA 4C2UA 1J99A 2ERYA 1XD8A 3NBZC 2JDID 3GLGB 2VSXA 1X8LA 3N5CA 1NVUQ 5FUVA 4FINA 1G16A 4MITA 2OCPA 1HE1C 3AVQA 1RRGA 1F48A 4HSEA 4RD0A 1M6NA 1J90A 3C8UA 4LHVA 3K0EA 2WJIA 1F5NA 2MSDB 1GRNA 3T1TA 2WWIA 2DBYA 3NVAA 3CX7A 3U6KA 4B47A 4URYR 3E2IA 4B76A 1IJEA 4CEHB 3EIQA 1JAIA 2VRWA 3QKSB 1OXUA 5G41A 4AURA 2FV8A 2JLZA 4MA4A 2WTUA 2XTNA 3BJIC 3NWJA 3RRNA 3AGPA 1P2SA 3UATA 2IT1A 4QBIA 1OYWA 1UDXA 4P33A 3ZIAD 1M7BA 4QGGA 1DAFA 2R8RA 5J4YA 1T3HA 5HZHA 2IWRA 2BBSA 1KK0A 5G40A 1G20E 4GP6A 3U4QB 4QBHA 4LOAA 1QHXA 1T3SA 2FU5C 4Q21A 4BRUA 4A4DA 1E1RD 1R5NA 5KSZA 4P3YA 4QJ4A 3GLIE 4WZAE 1SQ5A 2REXB 3EWAA 1CR1A 1N6OA 4EFNA 1CP2A 3RRMA 2ZJOA 4E22A 3TQFA 1OSNA 2PT7A 3WHKA 1QZXA 1ZCAA 2KBFA 4G3XA 2ZYTX 4UNNA 4YMWA 4IEEA 3OIVA 4JSTA 1WB9A 2PMDA 1NN0A 4AYXA 3KQHA 4TSFD 5AUPB 1BOFA 1P61B 3BH0A 1UKEA 5C2JB 1DAGA 3PEWA 3LY5A 4TZ6A 2O8EA 3AVXA 2XGJA 2GF0A 3ZS8A 4JLKA 1OFUX 4ZV4A 1Z6YA 2WMNB 5B30A 3OESA 3LXRA 2AN9A 2VHQA 4G5RA 4AKHA 2ZREA 3AGQA 4ZI2A 1DVRA 821PA 2B6HA 2QTHA 4WOPA 4GI7A 3BWDD 2RMKA 3JVVA 3SI7A 1R0ZA 4XD7D 5J5CA 3K70C 2VF7A 3QVUA 4CW7A 1ESNA 3VKWA 2C2HA 1ZM3A 3DPUA 3FHCB 1MO5A 4Q00A 4QOSA 4DBLC 3PEUA 5EE0A 3JZMA 3QXSA 5J47A 1XMJA 2PH1A 1I2MA 5FH9A 4LJ5A 2OAQ1 1P60A 3D6TB 4Q1EA 1XEXB 3AF0A 3NHAA 2ZI3A 3TVTA 2AD1A 3CX8A 4Q1FA 2WWFA 3KKPA 3WYFA 4GMDA 2J0SA 1SKQA 1XTIA 1S4QA 1XX6A 2RGAA 4RSGA 3U3OA 4A8JA 3GLHE 1KOFA 2WM9B 2ZTSA 3MLEA 1XRJA 1W0KA 1KY2A 4ABYA 4NYIR 3FOZA 4KVAA 3U3JA 4LV8B 4YC7A 1D8TA 4NDZA 1G6OA 2KSQA 5CLLA 1M7HA 5CYOA 3T5DA 4POAA 2YOFA 2IYZA 1RRCA 1A2KC 1AJEA 4OHXA 2ZSFA 1KJYA 3C5HA 4L5BA 4PC6A 3VX3A 1FP6A 2DPXA 2OEPA 1P9NA 5F9FA 1LF0A 4W9MC 1W0KD 4D25A 4C0SA 1XJCA 4C0HA 721PA 1SXJE 1SVWA 2BWJA 2H7VA 4DDWA 4OQFA 1L2TA 2R65A 3OE7A 3CRVA 1KY3A 1UM8A 5G53C 3KUCA 4FWTA 2FX3A 2A5GA 2W6IA 2OZEA 2BEJA 4XTCS 5EE5B 4EFLA 2N46A 1II9A 1N3BA 3NH6A 3CO5A 4QNMA 4YMVA 1Q3TA 4RD6A 3UG7A 4LX0A 1KO4A 1TPZA 1ETUA 3CX6A 3OE7D 3I32A 1SXJD 1FW6A 2QN6A 2GZDA 5DHAA 4DZZA 3BORA 2FJUA 1FQKA 2ATVA 1Z0IA 1G17A 3WBJA 2VYFA 1VG8A 3SU8A 2X2FA 1WCV1 4Q7MB 4UNPA 1ZC3A 2P6RA 3T5GA 1SKYE 4DLTA 1EG7A 3V4FA 1WF3A 1EFUA 2IYUA 2WMOB 3MSXA 5EQTA 4UNQA 5DYGA 1R0WA 1NLYA 1RJ9A 1GOTA 3AF2A 2ECKA 4PO9A 4DJTA 2P3SA 1PVOA 2EQBA 2VPPA 4OKSA 1N25A 1KKMA 4YXWD 5BYJA 1UJ2A 2GJSA 1Z6XA 3TLXA 1CTQA 1RRPA 2YOHA 4V02A 4ACAA 5KDDA 1E96A 2C99A 3B60A 1P4SA 2WJYA 3D31A 2FNAA 1Q1BA 3ZDQA 4AG6A 3GLIB 1BKDR 2EFHB 4Q4AB 3C41J 1OH5A 2RGBA 1L4UA 2X77A 2LKDA 2P6NA 1Z0KA 1E79D 2RH5A 4HZUA 2AK2A 4JBWA 3FFAA 5H8WA 1P2UA 3K9GA 1GITA 1ANKA 4Q7KA 4D0LB 4LGMA 3AUXA 2FH5B 2O8EB 3MG9A 2CCKA 1CXZA 3QJYA 4G0NA 2W00A 4N3NA 3DKVA 4R7ZA 3MGCA 3THXB 4TMTA 4TL9A 5K8TA 3H0KA 2MSEB 3HR7A 1VG1A 1FTSA 1OLOA 1M1YE 4HAUA 4QRHA 5EP1A 1N5LA 2ZR7A 4IDQA 4RCYA 3K0FB 1ZM4A 1KO8A 3SFVA 2B8WA 3CNOA 2F7SA 2W2VA 3EARA 4A1FA 4EAQA 2OO7A 5BN4A 4Q9JA 1G3UA 1Z0AA 4HDQB 1F60A 1F2TA 2TMKA 1NKSA 3EZ2A 1S9DA 2VQSA 3MCAA 4A0RA 4JJKA 4LV5B 1LS6A 1N6KA 4PO8A 3TAUA 3EX7C 2GA8A 4PC7A 3C15C 3K09A 1HY3A 1KJZA 2CLSA 1JBKA 3EZ7A 4C0KA 1YZGA 1C9KA 3GJ0A 2QMUA 5EXTA 3B82A 1XXHE 3PCRB 1NMXA 2RGNC 1XXHA 3P26A 2ZRLA 3KJGA 4PC3A 2W0SA 2J1LA 2JCSA 3SS8A 2ZJ2A 1NG1A 4Q4HA 2IF0A 3ADCA 4A8JB 1XD2A 2DR3A 2CVHA 3T34A 3IHLA 3GLHB 1G8YA 2BV3A 1UPTA 4V03A 2FFHA 2RGDA 5GJCA 2PEZA 1G5TA 1WBBA 1D2EA 1HYQA 4Y0AA 2R9VA 3SJZA 4EQ6A 1JNYA 3EPKA 5H1YA 1SZPA 2JLYA 1XTSA 1NY6A 2V9PA 4FCVA 4JLVA 1ZUHA 4KYUA 4P32A 4TQUS 4CVNA 1ZW6A 3EC1A 4B3XA 4BEBA 1HT1E 3A4LA 1P2TA 3JVUA 1SXJB 1XZQA 4K81B 2YINC 4MKFA 3MJRA 3IIJA 1TF2A 2IL1A 3SR0A 3QUSA 1AQUA 4IVPA 2XJ9A 1AZSC 2OV2A 4C0BA 2WICA 3HJNA 1ZD1A 1IN6A 2QORA 3QE0A 4LSGA 5LDDC 1N5JA 421PA 1IXRC 3CPHA 1IN4A 3TUJC 4EPYA 3VR4A 5LB4A 1AQYA 3O47A 4QHYA 1PJRA 4L4UA 1G8HA 4GBMA 3K1JA 2CNWD 1G7CA 4LUCA 1CLUA 1Z83A 4PHFA 1SKYB 3RABA 1E99A 3RS4A 2QTFA 4QBFA 4DUGA 5FL7A 4DCTA 3I5YA 1I2DA 1Q1QA 1GL7A 2ZJBA 5BXQC 3VKHA 1QHHA 1TTTA 1O3YA 5JI3E 4XWOA 1GKYA 1RZ3A 4TMZA 1XFAA 4QBGB 4PX9A 3L2OB 2V55B 1OH8A 1WBDA 2YVUA 1O87A 1E0JA 1MH1A 1F6BA 2O5VA 2ZRIA 3M1IA 3AKDA 4LBVA 4Q1DA 5CJPA 3QEJA 4II7A 3QPUA 5G3ZA 4A2QA 1YR6A 4UJ3A 1IAQA 1AS0A 3Q8XB 4YONB 4YLGA 2Q3HA 3KZ1E 4HZUB 3L0OA 2QQEA 2C9YA 1KNQA 5AJYA 3U3KA 4LK2A 3ZLJA 1E0SA 2QAGA 2QM7A 1KI3A 5CK5A 4A0HA 1Z0FA 4JT4A 1CKEA 4JT2A 4IFEA 4MRSA 3TR0A 1DAKA 4O3MA 4EFMA 1RFLA 4HEJA 4BFYA 2ZJAA 4BQSA 1U9IA 4NHOA 3U7HB 1E9DA 3U2QA 5AWFC 4Z1MA 5C18A 1GM5A 5FBVB 8OHMA 3UPUA 4PHGA 5CJ2A 4PPFA 3SN6A 5HCIA 2ZR0A 2XB4A 3B1YA 1WE2A 2F6RA 1GAJA 3ADBA 4Q5IA 5FBWB 3OIWA 4HLDA 1KI8A 4BGDA 4BLSA 1P3JA 5BW8A 1F2TB 5IF9A 3QY0A 3UANA 3BB1A 2J7PA 4DXAA 3KJIA 3VU9A 4EPVA 4PAQA 4LHYA 1T91A 1E9CA 2P65A 4DC9A 4NL4H 1EX7A 4JL6A 3L82B 3KX2A 1W0JA 1OB5A 5KDOA 2HLDD 4JL5A 4PZZA 1BYIA 2G83A 2KB0A 4XVRA 3WXMA 4AC9A 4TTPA 4D0NA 5KO2A 1A2BA 1E2LA 1NBMA 1IQPA 1XXHB 2BEKA 3GJ5A 4OBEA 3FE2A 4TMVA 5CDFE 4D26A 3IDQA 4BEJA 3RSOA 1Q3HA 2GXAA 5CDFA 1KMHA 3P27A 1XD2B 1X1RA 3PENA 1ZP6A 2FDCA 1CIPA 1II8B 2RKOA 3ZD7A 1Z8FA 1E2IA 2C5LA 3DHWC 3WP0A 4AKGA 3OEHD 3TBKA 5L3SB 2GBLC 2V54A 1TEVA 1KSGA 4MGKR 3UIEA 2IYLD 4KSCA 1WDTA 5IRCD 4RJLA 1I4LD 5D3QA 4I1SA 3DMDA 1OF1A 1HQYE 1QG2A 1M2OB 4PANA 3GFTA 1U2RA 1XZPA 3DMNA 3PUWA 1U99A 3U3MA 3U7FB 1G19A 4L16A 4DT1A 3WNDA 2W83A 3NEJA 3FDIA 4OK6A 1E6CA 1AIPA 2XSZD 4RD4A 1G5PA 4CRWB 4X8OA 2W58A 3K8YA 3AV0B 3X1WA 1SVIA 3TE6A 1XPUA 1UKVY 3T12A 1ZCBA 4HAZA 2ODNA 3U61B 4RZ3A 5B2ZA 4YMUA 1YZNA 5JLJA 1VYTA 2WJJA 1TUEA 2XOKA 3PV0A 3W6NA 1G8PA 1U98A 2QE7D 4JLJA 1BMFD 5FR1A 4NCNA 1J70A 2AFIE 3PR1A 4KSBA 4ERNA 3EZ9A 2CEAA 3KQKA 2FPKA 1ZNWA 2ZANA 2ZI6A 1CULC 1OJLA 2G3YA 2D2EA 2P67A 4HUTA 4QKQA 3PEYA 2PCJA 4AWXA 2GK7A 1NN3A 2QMOA 1HH4A 1YVDA 1WRBA 2IYTA 4DIEA 5JS7A 1S2MA 1ZAKA 2VHUA 3FGNA 5DI9A 3D8BA 1G3MA 4R2HA 1YHNA 2LWIA 5JJKA 1G5RA 1JB1A 1YU9A 2IEYA 3GLGA 4US0R 2QY9A 3GJ7A 1SHZA 4JVMA 2FFBA 4JYCA 2DFTA 3WP1B 2UZIR 2QPAA 1E69A 2ZI7A 2X8AA 2OILA 4KO8A 2AKYA 3LBIA 3KQUA 3SQXA 2CL0X 4QM7A 3TSOA 3K53A 1AK2A 4GOKA 2V6JA 3QEOA 4FMBB 2YWFA 2ZUDA 3QKRB 4FMCB 1Q22A 1W7AA 4H9GA 4Q9IA 2QAGB 3EA5A 1VHLA 4IJMA 5CIQA 1ZNZA 1G7RA 2R62A 3RRYA 1ZUIA 2FSIA 3CR7A 2ZJ8A 2ZRFA 1A5TA 2A5FA 1W2HA 1E3MA 1BO6A 2ODWA 3RSLA 1JEEA 3WRYC 4IOJA 2WIBA 1T3LA 3NBYC 5FTMA 3W9YA 4NTZA 3U6BA 4EJSB 3WYAA 3LX5A 4Q18A 2PLRA 3KJEA 2KBEA 4M1TA 3U4QA 1X6VA 1EFRD 3OAAA 5FI1B 1IY2A 2FSHA 2ZSEA 4TQ9A 5AR1A 1G3QA 4FI3C 3EC2A 3GJ3A 5DNYB 3BB4A 2ZE8A 4Q9KA 2GJ8A 3PITA 2A2ZA 3AF1A 1FX0A 3F0TA 4RD3A 4C9BA 5JCZA 3UWOA 1KGDA 2QBYB 1N6LA 2BBOA 3IBYA 4BLQA 4EDHA 3NH9A 4Q9HA 4AY2A 4L9SA 1ESMA 1JI0A 1MO4A 3OAAD 2D62A 1G6HA 3SYNA 2NO0A 3PQCA 1OIXA 4MGZR 4B6FA 4JZKA 2GCPA 1W36D 4A6PA 1EX6A 5BWMA 5HZKA 1B23P 2J5XA 1DEKA 3OEEA 1OFIA 3F3YA 4Q19A 1N5IA 1KMHB 3TGPA 2WPDA 1OYYA 4HAVA 3BAFA 1RIFA 1VCNA 1D6JA 4N0DA 4DB4A 4PFSA 5EE9A 3PUYA 5KYKA 4TZ0A 1DPFA 2VBCA 2DYKA 1OB2A 1MOZA 2IYWA 2OLKA 2J87A 2ZM5A 1G7TA 4GMXA 5DN6A 1EWQA 1A7JA 1FQJA 1TAGA 2WPDD 2ODBA 3CWQA 1JR6A 2GAOA 3WMEA 2CMKA 4DSNA 1E1QD 5AUOB 1XJ0A 3IHWA 4TLEA 2H57A 4FWIB 4M2LA 4UXHA 5CM9C 4DT1B 4Q01A 1XNJA 1GNQA 2BDTA 3Q85A 3TUZC 1JPNA 1OXVA 1EESA 2XXAA 3I8SA 1PLJA 1S3GA 1OH6A 3FFBA 2REOA 2VLIA 4KBFA 4OI1A 1N0WA 1IOZA 1KZGB 1DAHA 1E0AA 2ZE5A 4PPNA 1W5TA 3RC8A 3KB2A 3FMIA 2QT0A 2EFEB 3Q5DA 1UEIA 1MO6A 2BIFA 3GJXC 1KI1A 2RB4A 2JDIA 2QT1A 5DHFA 1ZM9A 2YNMA 2E9SA 1DAEA 1E9AA 4QHSA 3RAPR 2O8FA 3Q3JB 1BIFA 1NVVR 2ZS9A 3HPRA 4OK3A 3O8CA 3T15A 1XEFA 3BFKA 5BYKA 4BPBA 1A82A 3K0SA 1AA9A 2GXQA 3QF4B 1VECA 5D3MB 2CLCX 4LI0A 3SC3A 2PZFA 3HR8A 4URUR 2NO6A 2J9RA 3AP3A 3DO6A 1TMKA 2GVZC 1R8SA 2XTZA 1YR9A 3AF3A 3FMFA 4QFMA 5EXSA 5TARA 1FNMA 1D9XA 2CLDX 1OH7A 5DLQC 1FL9A 2YYZA 4K8OA 3RYTC 4Q9LA 4Z8YA 3S1AB 5CYPA 1E4YA 2YWHA 3HYRA 4ZI3A 3C5CA 3ZIAA 3GEEA 2D7CA 1F2UB 2PL3A 1KI4A 1R10A 4KCGA 4Z54A 2VP5A 3QKUA 1E9EA 3OHMA 1UKYA 4ZIRB 2X1VA 5TDHA 2IA5A 2ZS8A 3GJ6A 4IEIA 2V8OA 4KAXA 1YJ5A 1E1RA 2QPOA 4RD1A 2ZRNA 1Z5ZA 4PAOA 1GTVA 4EPTA 5C46F 2IS2A 3WYGA 1GILA 5LB2A 1Q12A 1COWA 3ZVRA 5KHOC 2RGXA 3IIMA 3IQWA 2ZE6A 4JVNA 2IHYA 4NYMQ 2C77A 2BM0A 2J41A 3CF6R 2I3BA 2H18A 1M7GA 4NCHA 2ZYWX 4V0NA 2A3RA 4TN1A 4ASUA 2J0QA 1NP6A 1P2VA 2ZSBA 3B1ZA 1W36B 4TSFA 5DSZA 4QGFA 1COWD 3GLIA 3X1ZA 3QVVA 4DEYA 4Q4AA 1FX0B 3KKNA 1KK3A 1QF9A 4PQRA 2MMCA 1XBTA 3DL0A 3EAQA 3K70D 1KO5A 3KKOA 4RFSB 3THOA 1OHHD 3CRW1 4ASUD 2J45A 3BBPA 2GCNA 2H92A 2C9CA 2OCBA 1EFCA 1UBGA 3EG5A 4OYHA 4ZPXA 4URVR 4KVGA 1VYVA 3SJBA 4JLPA 4XD7A 3LXXA 3THXA 2HEIA 4GSYA 1R8QA 4GPTA 3SBEA 4Q4LA 1CU1A 1ZMXA 2G0TA 2QSZA 1YR7A 3OFND 2WVJA 5JEDA 2GEUA 4DEXA 2IYYA 3GP8A 1Q21A 3UG6A 3HU2A 1U90A 4DCVA 2FN4A 1AN0A 1PUJA 1R7RA 1NN1A 2Q9CA 3K0FA 2ZITA 3QPVA 2JJ2A 5EE3A 4IHQA 4C0QC 1Z0DA 3LW7A 2XAUA 2O0HA 4BUJA 1VCMA 2W2TA 3A37A 5FPHA 1UKZA 4LDJA 1E9RA 4QJ3A 4QG7A 2F43B 5JRJA 4NZYA 4M22A 2GVDC 3LNCA 5A4JA 1JQJC 1E2FA 1E9SA 2AXNA 4KFRA 4LHZA 4B32A 2NZ8A 2XXAB 2JJ2D 3T35A 2PT5A 2NTYC 3VR6A 4JVSB 1GVNB 1ZU4A 2RAPA 2XZPA 3QOFA 2AFHE 2FWRA 1SVOA 2IYVA 4TL7A 5TVKA 1JJ7A 2D74A 1OXTA 2WV9A 1OFTA 4P4TA 4PSKA 2CHVA 4DLXA 5EUQB 3U7EB 3GLHA 4TQAA 5DI3A 1TNDA 1RRFA 4KLNA 4LY6A 1DADA 4B71A 4DHEA 2O8BA 1P72A 3KDSE 3NIBA 2O8FB 5SZJA 4F4CA 3VNUA 1P9RA 3UMRA 2VIIA 5FUYA 1MRSA 4B2PA 4TMWA 3Q7PA 1KHTA 1Q1EA 3KL4A 4GDFA 1ONBA 2IF2A 4ON9A 3I4LA 5KNBA 4OL0A 3LWNA 3U44A 1SXJA 4NH0A 1E2NA 4BRWA 4FIDA 1R5BA 5KTYA 2JGNA 3RVBA 2A5JA 1AM4D 1J2JA 2K5UA 1GZSA 5JCPA 2ZYVX 5FTNA 1YKSA 5FR2A 4DLSA 5EUMA 2YJTD 3V9PA 3L0SA 2QP9X 2VP9A 1WP9A 2QENA 1UFQA 4PZLA 2ZI5A 4HUQB 1GRQA 2BMFA 3KXIA 3CNNA 4WAUA 2YZ2A 3K9HA 2F1RA 2IYRA 4YXWA 1NSTA 1T6NA 4HDCA 4G1UC 2XB2A 1X8KA 3A1SA 4LRWA 4TLBA 3CONA 1K5GA 5KU1A 2P2LA 3X1YA 2OHFA 1HURA 2UVQA 3BH6A 4TWZA 4RD2A 5AJVB 2FSGA 4KU4A 4OHWA 2AX4A 1Z06A 5P21A 5SZKB 5HTKA 4B35A 1CF4A 5HKKD 3BE4A 1NMYA 4B3GA 3TW4A 5FTLA 5JMTA 3K70B 1E79A 2VL7A 3I8XA 5L8VA 3N2EA 5CK4A 3B1XA 5EJEA 4A8JC 1IY1A 1FUUA 1DO0A 2ZRDA 4OI2A 5FFMA 5FPYA 2DWOA 2XNDD 5CM8B 4WA7A 2ZRPA 3B9PA 1LW7A 4MGIR 1G3IA 4AKEA 1LFDB 4ZKDA 2HXYA 3W5IA 3GMTA 3PUZA 4ITRC 5H68A 2QP3A 4HB2A 3TRFA 3W5JA 4KITB 1KYIA 1D2MA 3KFVA 2Z5FA 3LD9A 2O8DB 4QJ5A 3W90A 1Z2CA 1NLFA 5IK2A 3FPAA 3FB4A 2RHDA 4O2RA 1OXXK 2A7QA 3LDAA 4YDSA 1GDDA 1NVXQ 2E1RA 4TYPA 2ZU6A 4CGZA 3M6AA 1KNXA 2AWOA 3QKTA 4NP6A 1U94A 5J4HA 3A36A 3ECCA 1OV4A 4HB3A 4ZDIA 2JASA 4AYTA 3BS4A 2Q3FA 1UBEA 5FOXA 2XTMA 3ASZA 4M9XA 4UKDA 4BLPA 5AUNB 1J8YF 3LO5A 3KKQA 5IK2D 2FEOA 1QHYA 1KTVA 4HLCA 3WMGA 4PPQA 2ANBA 1NMZA 2F1JA 2JATA 3PVSA 4OJQA 2YOGA 1ODFA 1G8GA 5BN3A 4W5HA 4DSUA 2FE4A 3IEUA 1NI3A 3AKEA 3FMOB 3UMSA 4V0LA 1H8HD
chains in the Genus database with same CATH superfamily
6REQB 1P5FA 3RTCA 3WFZA 3UV3A 4BQRA 2C2BA 2XUZA 3ZGXA 3KOMA 1X39A 2FETA 1QV6A 3MQFA 1TU3A 3DL7A 2X86A 4NV3A 2OM2A 3HCCA 4MUNA 1RWKA 3JWPA 4JLOA 4O63O 3NNSA 4AMVA 3RYCB 3VZCA 5HIMA 3LQQA 1DQRA 2QS9A 5CT6A 4J6EA 1UBNA 4MQ5A 2VK2A 3NMUF 3A2LA 4H3VA 2TYSB 4IZOA 1YH3A 4LNUA 2W2XA 2GN6A 5FTJA 4FE4A 2FPPB 1R0LA 3VNQA 5JRDS 5K2OA 2WSSA 1SGWA 2JA2A 1NQUA 4KN8A 3NT2A 5FPKA 3EPRA 3IE0A 3FYHA 3O8LA 4YRAA 2C4TA 3P2KA 3UW3A 1CBUA 2VEDA 4UPEA 4UUNA 3TMYA 1WXQA 4E07A 3AT1A 2BR3A 1T4GA 1B2LA 1QCCA 1RACA 1VCOA 3GRRA 1YRWA 5CX1B 1PW5A 3WDKA 3DUFB 5KKCA 5IH7A 1Z56C 1QIDA 5DBOA 2WSSD 5DGHA 3WAJA 2OSBA 2E4XA 4DM4A 3ICPA 5HILA 1TO1E 1XL0A 3ZHOA 4NYJR 2VSNA 5K3BA 1E6EA 1WJGA 2X6RA 1C1HA 3URKA 4MP6A 4RJTA 1UAAA 1V11A 4AQ7A 1U81A 1BE8A 3K0BA 2DKOA 2E6KA 1CJSA 1MXHA 2D5BA 1ZA2A 2J9FB 2R6GA 1SUPA 3H17A 2GCOA 2JGMA 3EZYA 3DE0X 3WA7A 1YIOA 2H51A 1GT6A 4WK6A 4CM4A 2ZJ4A 4UU7A 5COQA 3OUUA 3P0RA 1Y9EA 4JBXA 4U39A 1BTOA 1CJKC 1RBQA 5DISB 4M0DA 2NGRA 3W8NA 4ABTA 2RB5A 3BTSA 4YRTA 2CHQA 1W4RA 3CSDA 1KVSA 3FOWA 2DHQA 1PR5A 1U2DC 2ZW9A 4AULA 4G5GA 2Q29A 3ZXSA 1WMSA 4A15A 1L4BA 2ODQA 2YIMA 4EBBA 3UK6A 1Z8HA 2G09A 4INZA 5FWXA 2HHLA 3ZV3A 3DYIA 3G3EA 5A9TA 3X1DA 1ADYA 1SVLA 1T1IA 1Z22A 3V4ZA 1ZMOA 1CR4A 4YY3B 5JZBA 3JZDA 2YMQA 1FW8A 1WCWA 4L2IB 4W9RA 1YJBA 4JI3B 1UK6A 3NDIA 2W42A 4HAIA 3FJOA 1SVMA 2GH1A 4TKVA 4ZZIA 1NRXA 1PV4A 3HPQA 3PC8A 4NPCA 1UPUA 4JLSA 2PZEA 2C8VA 5MDHA 5ALEA 5CG1A 4NYMR 3ETGA 1U2EA 3L6UA 4BO4A 1R6BX 3IQGX 3LUFA 4JB0A 2CWWA 2X4IA 3I23A 4ZVTA 2NT3A 2P1RA 4B2IA 2CHFA 4TLMB 2B1JA 3FPKA 4S1WA 1RJWA 3GVXA 2IHUA 4ZVPA 4JP5A 4LF9B 5J2TA 1HDIA 3DLHA 2X0NA 1GRRA 1JDTA 2FGKA 1QYXA 3FIJA 5KMGA 2ZXUA 5HKOA 3TL2A 1TL7C 3VBEA 5THXA 3R5JA 1R5JA 4D82A 2WJ4A 4G24A 5I3ZA 4EHKA 1ZO8A 3GFOA 1VCIA 2DXIA 1G1AA 1E2EA 4RX1A 2VG8A 3VR5H 3OX3A 1ZVMA 3EWIA 4R2XA 4X8LA 1T1EA 2TSYB 2QSUA 1PEDA 2QY6A 3BTUA 3H99A 3K94A 4OQ4A 5FJIA 1GNLA 3EOZA 5AK0A 3RODA 2AEEA 3EIHA 1MRNA 3JW8A 5B3JA 2ZB4A 1VFNA 3BXXA 3RG8A 1I01A 2QUBA 2BYTA 2K87A 3BXZA 3NDBB 3NAMA 2HLDA 1VP9A 4O4HF 1NNSA 4UBLA 1W4BA 3O0TA 2VH1A 4G5OA 4XUDA 3SZUA 4F2DA 1Z63A 2P4UA 2CNNA 1HE3A 3B1WA 3F4BA 2HYDA 4WDQA 2ASEA 5DNAA 3MUFA 5DE3A 1Z2AA 4B34A 1K88A 3FVRA 2IP1A 3KAQA 5EESA 3RIXA 3IS3A 3CRZA 2FPGA 1E8NA 3FKSD 1M73E 1OBCA 2JFXA 2WFMA 1Q15A 3JQGB 4H2DA 5ETJA 2WHRA 3C3AA 2CGEA 2IVFA 1E7SA 3Q3VA 1THTA 1RPTA 3OEHA 5HKAA 2GJKA 1V9SA 2IS1A 1U28C 4HC4A 1ZVJA 2PS3A 4RKYA 2WWTA 3CPEA 1Y4UA 4AROA 4XCQA 1XMQB 1R4MA 3BF8A 4J6FA 3HDTA 1L4NA 1CY6A 5TY0A 2V97A 2X0JA 3AH8A 2MT9A 2XD4A 1JSLA 3K2EA 3X2FA 4ENQA 4DR2B 5KCZA 2VDKB 3ID6C 3NBAA 1UJBA 1C4XA 2C8LA 1N8TA 2YW9A 1KJWA 4V0OA 3NTVA 3ETJA 4D3DA 5KWSA 1WVMA 2VZ0A 1NY5A 4YRMA 2ZG6A 5A4FS 4Z0PA 3V4PB 1ZCZA 3UOWA 3VKGA 4LZOA 1SK8A 1NI4A 1GDTA 3A26A 1XTBA 1Q1ZA 2H3EA 3LVQE 1IN7A 1PFGA 1UODA 1RWQA 1HRDA 2BP7A 2ZTMA 1E3EA 4CQNA 5K2MA 4FZ5A 4O29A 4YR7A 4EKIA 3GNTA 5H80A 1XZHA 4J0CA 1DEHA 4EO7A 5JYCA 2PQMA 1ZK2A 2HJ9A 2V4UA 3KYCA 4X62B 1QFJA 2GCOB 3WK7A 3GEGA 1X7ZA 3AI2A 1YGYA 4DA9A 4QYIA 4CM4B 1O9HA 2NNLD 2ZIAA 2YJ3A 3RJ9A 1Y3FE 5IU6A 4U0KA 4H7HA 4LHWA 1EBFA 5BSEA 1DKNA 4GIBA 4FYHA 1EUDA 5J5AA 1UKAA 1IJFA 1IZYA 3OE1A 4CG1A 1EVLA 3U9LA 3OETA 4AKIA 4MNTA 2Q5FA 3CF4G 4X7RA 1T0UA 4MZXA 5CB4B 1IN1A 3VAAA 2VUTA 2FZWA 4PHTA 1KEKA 1FFHA 1P7ZA 2Q3BA 3FN4A 5FWXB 1T4BA 2H4FA 2OTCA 3X1XA 1B14A 1U3FA 3AF4A 4X1YA 4BQQA 5BNIA 4CDGA 3C14C 5LNK1 2O7QA 1N9KA 4NS1A 4R0NA 3ZY4A 4BQFA 2CZCA 3AM1A 1J42A 3G2IA 3SOPA 3TIFA 4BNTA 2C61A 2Y1WA 4CUKA 2P91A 3R5KA 4JU8A 4RHUA 3ETCA 4TKVB 4BNUA 3ER8A 3AVTA 5GONF 1L7EA 1F8GA 1Y3CE 1IU9A 2I34A 1E2PA 2ZWOA 2WKRA 3CEMA 4IQ8A 4W5JA 4AO6A 4BP1A 5FOSA 5KWVA 3WI7A 1AV6A 2VO1A 4DVGA 3C8DA 2MR6A 2FGJA 3TQIA 4GI3A 4ZN6A 3PC6A 4JODA 3OPYB 2P41A 4FBMA 3P9ZA 1Z5WA 3N2IA 1T8WA 4BB6A 2X4DA 1IQ0A 3KFXA 4NMLA 5I7HA 5J2TB 4ZYLA 2DPHA 2H4WA 3TTSA 3T6KA 2DCMA 2DWPA 4IIHA 4FCTA 3WLAA 3CHYA 4IQ0A 4F8EA 2R7AA 5F35A 3TXXA 2PY6A 5BUZA 3U3XA 3R44A 4G9BA 4BMPB 4OBWA 2XVZA 4ZIRA 5JBQA 5FWNA 1E1LA 2A7XA 2VDQB 2QQ5A 3AL3A 1ZH0A 5JSFA 4LCJA 1O6BA 1LRLA 3DKKA 3SZGA 4F96A 3BE5A 5F73A 4BVJA 3DMGA 5EMMA 1XCBA 2ZI4A 2ZJYA 4NU0A 2PT9A 3OC0A 1F3OA 3JYQA 4HH3C 2VCYA 1EVKA 2IYQA 3FPEA 2V65A 2I9PA 3FGZA 5EE1A 2FA9A 4CMBA 4JEUA 1MDFA 1YF3A 1OYVA 4XIJA 1CJMA 5FOUA 5A3SA 4DQKA 1MENA 1I5EA 4Z4HA 1PZNA 1IB6A 5AQ1A 1HDYA 4IF4A 1WP4A 5LOVA 2HBRA 4DCSA 2VDUE 1WLYA 3A25A 3P2YA 4IO1A 5CT5A 1VZ3A 4CT5A 4D8YA 2IEDA 2EYUA 2ZKLA 2ZIZA 4OFXA 2H4HA 4C7JA 3KTDA 2QD4A 2QEQA 3SFTA 1GZDA 1VQ1A 1VMIA 2H16A 3Q7EA 4LZWA 3P0FA 4C14A 1B6RA 4LDRA 3RF7A 3LPLA 2PTGA 4AP5A 3TOVA 4ZJUA 1UDRA 1A9XA 2FW0A 1I10A 3V00A 2P75A 3FWYA 3IQHX 4B80A 6Q21A 1BEEA 5B58T 3UCEA 4HWSA 2PH3A 2NSHA 1J49A 1R4MB 4RC9A 1QPGA 2P2CA 4ARAA 2X76A 4JJFA 3PUVA 3F4KA 3IJEB 4MRVA 2X2EA 3CLVA 1PUIA 1LPOA 1ZOIA 1ORDA 3NTUA 7REQB 4ESOA 5ELXA 3RHFA 1UR5A 3V8EA 1LQUA 4XRGA 3BWMA 2Y1EA 4C6SA 1DWPA 2YV2A 2H5LA 2E82A 3UV6A 1F3LA 3G88A 3L3BA 5E3HA 2AZTA 1P6XA 1X38A 1YRBA 1E2QA 2H1WA 2R6JA 2C54A 3EDRA 2YJGA 4N47A 3TLKA 1Z5VA 4FLFA 4B9EA 1QP0A 2DTDA 1L7QA 1NFFA 3GA7A 3T7CA 1DIGA 1NI4B 2ZYDA 1Z07A 3ZOZA 4IO0A 1G9XA 3W34A 1DBWA 1ZJ6A 2V96A 4ER6A 3JQBA 2IHZA 1Q7CA 4CLOA 3FWKA 5TE9A 4DAEA 3AFGA 5ER6A 5AYVA 1E94E 3G5LA 5ISMA 2OOKA 4K26A 3EDMA 1AD2A 2F90A 3F6BX 3OOYA 3UB4A 5J59A 1DJNA 4R4JA 5JY6A 2DWCA 1GDHA 3KYCB 1NHWA 1FP7A 2C7GA 1ZXXA 2C4HA 2OBXA 1H8EA 1X7ZB 1H2BA 2CK3D 3DEHA 3FMPB 4QYIB 4EO9A 4JHLA 3FYCA 5I45A 3IKTA 4QUGA 1QYDA 3B36A 1RWPA 3EEOA 3GY0A 3ZHQA 1WU8A 3RS7A 1QX4A 3RVDA 1Y89A 3R4VA 2I22A 2V7VA 3GD7A 3I73A 4PRKA 3MC1A 1XV5A 3RPEA 5CLQA 5J4KA 3ZLJA 3QG5A 4LSWA 1K0UA 3RF6A 2ENUA 1H8ED 2P7IA 4GP7A 1VIYA 2IEZA 1E98A 1VGQA 3EF1A 1SUAA 3KAPA 4X1YB 4C4ZA 1AS3A 1MV8A 4R8SA 3QQPA 2D8MA 1N2JA 1XCPA 4PXYA 4OU4A 3TBHA 1Y6RA 5LJIA 3R8CA 5KU7A 1H4TA 5CXSA 1NVWQ 5ER9A 4D56A 3EZ6A 1XKLA 3IB3A 4WY8A 4AO8A 4BMYA 4K9DA 1SQ0A 1Z62A 3BRWD 1XCGB 2LCQA 4DREA 3LP6A 2EJWA 4LOLA 2GAAA 3LC7O 3OX4A 3W78A 4L5CA 1R64A 5G2OA 1R1DA 2JARA 5MFPA 1TUGA 1YQTA 3RNOA 2XYPA 4BB5A 2BI7A 3D0KA 3LF2A 2DY1A 4F2GA 2XNJA 5E1OA 3PSAA 4DLUA 4O4JA 4B73A 1GARA 1WEHA 3RIHA 4BMVA 3OTWA 1YXMA 2YN2A 3OLYA 3OO1A 4AWAA 2BSAA 1OVMA 3CT6A 3R8FA 1DCTA 1F7UA 3HYNA 3F1LA 3UQZA 4ND7A 1XPRA 2PLAA 3QTBA 2JLAA 3TQCA 2PWYA 2AR7A 5I3CA 1NR5A 2JJ8A 1ADCA 1Y3DE 4AWBA 2PAFA 1YBAA 3AIMA 3GWGA 5K09A 2YJZA 1B43A 1YCDA 3H2KA 2IHVA 2AJTA 1XT6A 4O2AA 3LRPA 5DWVA 4RTPA 1ESDA 1ADBA 1EINA 3BJRA 5JAOA 1CR2A 2E7ZA 2PGDA 1T4MA 2GTPA 4UTVA 4LTDA 5BV1A 4CUZA 4HEA1 5AH0A 5FQOA 5EMKA 1RXIA 4ZICA 4ACBA 1MX9A 3FPLA 3ROMA 2AWNA 3HB5X 1VBFA 1GFIA 2QXTA 3EB9A 3QEKA 4K3VA 4C88A 1JS1X 4DLLA 5BSGA 4I50B 5LOVB 3TF5A 1QKJA 1XQXA 2Y2UA 3AJDA 3A4TA 3PFBA 4OVKA 3TTTA 1X1SA 1PX0A 3GRKA 3GLSA 2ZPTX 3RS0A 2J08A 2EBUA 1ZWLA 3ANYB 1JBEA 4HXYA 2O07A 3EGCA 1F1JA 1QSGA 3VC2A 1AUVA 2GZ1A 3WGHA 3ZHUA 4DDVA 1PT8A 3WLSA 4RXMA 4MEJA 4ZOQI 1CCWA 1KZ1A 3EHEA 2GN9A 4Q9AA 4M38A 1N77A 3FSGA 3JQ9C 1PDVA 4R6XA 1JHZA 1CG6A 4JXZA 5EVCA 1EFVA 5LVAA 1IVYA 2NG1A 4ME6A 3ZCQA 4BMDA 4F1WA 4C4YA 3J81k 2OGSA 4RMJA 4YALA 4FB4A 2QLBA 2WTNA 1LI7A 5GWXA 1TADA 2D06A 3B7PA 3BXOA 4RACA 3S1SA 5JTTA 5E1MA 3RW9A 1WHSA 4RMIA 4CLDA 1GWNA 1T1GA 2GJAA 1M67A 1BA2A 4L8GA 3QE9Y 1EFAA 4Q34A 3ZKAA 1BQ4A 4G5HA 4DR7B 2ZB2A 3QWHA 1K8RA 1WD7A 3OOSA 3AHIA 3F71A 3TLAA 4BMCA 1HZZC 2BMWA 3JYPA 3V3TA 2BZ1A 1EXNA 3AU9A 4WCVA 4PONA 1T2DA 2GXSA 1JDUA 1D09A 4RZUA 5KNCA 1TYBE 2WIDA 3KLMX 4OU5A 4TYMA 5JDCA 4EA8A 2E4VA 3HXOA 3THWA 3D3NA 4ZC8A 4KQJA 5DTEA 1GCAA 4BGEA 4L3OA 3UJCA 2J59A 5KWIA 1A98A 1ZITA 3EXHB 3QBVA 1M5UA 4TLDA 2PANA 3GA0A 3AY6A 4I6GA 4BDTA 1A7UA 2Z8YA 4J29A 4WX2B 5C32A 4H6XA 1MNQA 1XAIA 2QNIA 2VZ9A 3QSGA 4MWZA 3RVRA 4QO8A 5CURA 3VQTA 1EZ1A 3T5AA 1AC5A 3L0BA 3NKVA 4LWZA 5LBTA 4CMEC 1NBEA 4M98A 2R6FA 2WA1A 4KQ2A 1KQOA 3GLFA 3GEIA 4YK7A 5FFFA 3E70C 3ZJVA 4IDGA 4FNAA 1FFGA 3MS4A 5GIPE 1P44A 2Z2KA 2GETA 3B12A 1KK1A 2FG5A 1L1RA 2ZR9A 1SQSA 3G59A 3G2LA 4Z7NB 3CH4B 5EPOA 5BR8B 2JIQA 2G5PA 3F47A 5A4AA 1MAAA 3L8YA 3VSDA 3ZD6A 4C0LA 3E05A 4BC0A 4M1YA 3FZNA 4CKBA 3GCWA 3L8HA 3CR8A 3OT5A 1H5NA 1K0FA 4CLHA 221PA 2HJSA 3I2IA 4IPTA 4PZDA 1GG2A 1PNOA 2N1BA 1MKYA 1RXSA 1VPEA 2X5XA 1KAMA 2VHEA 4M1WA 2O06A 2ZB7A 3GNQA 5LYJF 4O4JB 1OE0A 1ABFA 4OO3A 5JDCC 5JJIA 2JAQA 2YZGA 4PE5B 1UAGA 3NP9A 5B3AA 2HU2A 4LYJA 4M8SA 2DHRA 1X9IA 2C2XA 4WERA 3PD0A 4WK4B 3G0HA 3F7NA 4IY1A 1UXGA 2GBIA 4AMUA 5LZ2A 3FNBA 4OXRA 5C1OA 3PNVA 3HHEA 1ZMTA 2GN1A 4MQLA 3RS8A 3T4PA 1T3TA 4PNZA 4RM2A 4PZUA 5BW6B 4BKRA 3ZBQA 1ZH4A 3D5TA 4WKCA 4N01A 1R6DA 1FNNA 2F1KA 5FUWA 2HJGA 3TNFA 1FP2A 4BAGA 3AR9A 2XNDA 1S3SA 1X77A 2CVFA 2FWJA 3MRTA 3CRRA 3K9BA 2WR8A 2QL5A 5BRJA 5JWOA 2XX3A 4KRGA 2VDPB 5EQFA 4CM9A 1QHIA 1TJNA 1TVKA 4R51A 4EG4A 1GXSB 3REGA 3DZHA 4RPIA 3PDIB 4X85A 4B5LA 2IY7A 3SEFA 1U0JA 2W6ID 2PA3A 1PWYE 3BTOA 3KR2A 4HLNA 3RIEA 4D9EA 3PXBA 2WT4A 5EXDA 5SY6A 3MLBA 3BCHA 2D3TA 3H5IA 3PHIA 4EYKA 5IBCA 1GQOA 4HZGA 1U3VA 4OQNA 2JHAA 4IUYA 2WU3A 3NC0C 1T35A 5CCBA 1M0TA 1UK7A 4RK0A 5AXCA 2HY7A 3UMFA 4JXJA 3UTCA 3ZWOA 4MARA 2B8EA 1DIBA 4Y2RA 5A03A 1LTHR 4LXQA 4R31A 4G5QA 3O4FA 5C31A 5UKDA 1KZHA 5ALKA 1G59A 2PUAA 3IO3A 4TTSA 2B83A 5TMBA 2PKQO 4WGGA 1RW4A 1DDIA 2ZRMA 4PVDA 3RHZA 1B0AA 3TK1A 1OTYA 2NTJA 4CKXA 1RP1A 2D2VA 2V3WA 5B1IA 3HY4A 1VMEA 2GEVA 2YTZA 1OU4A 2C2ZA 3TZ6A 1SXIA 121PA 3EDOA 3ETDA 3HA7A 3A1WA 3DHEA 3C6ZA 3CJRA 3MJDA 3VYRB 3BGWA 1NQTA 5FT9A 2ZJ7A 3NYIA 3W1VA 1OAOC 1WHSB 1JIIA 2VUIB 3QPCA 3DXXA 2OCDA 1QIMA 3LLUA 4ZO4A 4BX2A 2QZPA 1PGQA 4NSNA 4P1ZA 1KVQA 1DV2A 2A9QA 2Y77A 3IP3A 2H54A 2QRPA 2Q41A 2P3LA 3HUDA 4J03A 2HJHA 3RC1A 3UC5A 4ZCIA 2GXUA 3P2IA 5H70A 3RNLA 1U2TA 4FE7A 3MJTA 4DWVA 4PVCA 4ZCSA 1NQXA 4US1R 4JKIA 4QE3A 5I4IA 1BG6A 2BEVB 2VAXA 3O8BA 1UXHA 1QZTA 3ORFA 3LQFA 4C29A 4BUCA 4Y2QA 5JZMA 2PKQP 2PS0A 2J46A 4K3UA 5ICCA 3VBCA 4LJ6A 4X24A 1WZCA 3UMCA 2QGNA 1JECA 3N2LA 5HHTA 3IUBA 5D84A 3U3RA 3LBAA 3VZSA 3PHJA 5B1EA 1AKEA 1H65A 1F5SA 3E15A 1SHLA 2ZDGA 4N1AA 1RJFA 4JGGA 2B4YA 3LQ2A 3HVUA 1EWTA 1VSBA 4FMDB 4RZIA 5ALZA 3VYSB 4EEXA 4XWAA 2GPNA 3CXRA 1CUVA 2P9QA 4HB4A 4R98A 2OAEA 4A0SA 3K6JA 4E7OA 4L0CA 1MABA 1JDJA 4QXOA 4D9JA 3E9DA 4B5KA 4DLPA 1J23A 5CD1A 4AJ1A 1JJIA 4J49A 2ZRJA 1RLUA 4QHTA 1B6SA 3LK6A 4GEGA 4LDQA 4RZHA 4KXYA 3M4XA 2IVZA 2VZEA 2ZBGA 3GGGA 3M6XA 2J33A 2VR1A 1Z7WA 2M32A 3IMCA 3MRSA 5L4LA 2PIDA 2IC5A 3GDOA 5F23A 2Y1FA 1KOLA 4CKBB 1RKBA 3N0TA 4ZT4A 4BFVA 1D03A 3PNYA 1FQOA 2V7QA 1YRAA 5L9AA 1LBIA 3I3OA 3EGEA 4G2TA 2HQSA 2I4NA 4MQMA 4XWKA 1EZZA 1BCSB 1E6KA 3NORA 5GMOA 1QH8B 3DZFA 3CEPB 1RYBA 1UL1X 2BM1A 1J21A 1BWRA 4I36A 3EXAA 1QQTA 1LJLA 4P2BA 5E9WA 3DOEA 2OD7A 3IIKA 5BSMA 1W88A 2AQ8A 1MOQA 4RS3A 2Q5IA 4TGLA 5ENZA 4NIMA 3O92A 1N6HA 1JEOA 3MRVA 3QOWA 5DN9A 4PS1A 2V7QD 3AJRA 1USVA 4QTZA 2Q62A 2ZTLA 2OWDA 5CVTA 1ZICA 2XMPA 2F8MA 2FFAA 3HCBA 3QHPA 4F71A 4GI5A 4N7BA 2HPZA 3SKVA 1SFRA 3MGGA 5D8DA 4DIDA 1UXKA 3R5SA 2BMEA 5EXPA 4YYZA 2RBKA 3IQXA 2R6CA 1YWGO 3CUVA 1KO7A 3ELWA 2TMYA 3PICA 1AK9A 1KJ8A 2HNAA 2IIPA 2P9YA 4UZEA 2ZUBA 3JQQA 4EA9A 5KYGA 1QH0A 4TXMA 3VPDA 1H1LA 2NZUG 3K35A 5FWYB 1MW8X 3EG9B 4WCFB 2XA1A 1VFPA 3OH8A 4G26A 5SZIA 2IXGA 4DLAA 1QAMA 4R9VA 1CEEA 1I3KA 1FNDA 2F64A 1ORIA 1QYWA 2HR1A 3WIVA 4R9RA 4G5SA 2FE1A 3BMCB 3UJNA 4MVJD 1VL2A 1EXWA 1GR1A 3B78A 1Z6PA 3FR7A 4EL0A 4CKZA 5KYXB 1U63A 1DZIA 3LZCA 3BQNB 4GVLA 5IULC 1QLHA 5E3JA 2P7HA 3IOYA 3O2QB 2WWHA 2OP0A 1SVKA 3B9BA 1PLKA 2BKLA 5DNWA 5FUMA 2FY8A 4YP7A 2B4RO 4F86A 2A0XA 2C98A 1FQWA 1RJ9B 3MRXA 4M1SA 3WO1A 3IOEA 2AOVA 2YX1A 3FVTA 4PCVA 4CR6A 2R4UA 3BOSA 4AICA 1AKYA 3D9QX 4M0LA 3GMDA 1ZGJA 3E7WA 1UJMA 3EGXA 3I92A 3RIYA 4G84A 2IYOA 4YVFA 4CWAA 1E6WA 2EC5A 2PO7A 1FXWF 3LUGA 1XQ9A 3GRCA 5HGJA 4DRXA 2ZQ5A 2J8ZA 4IOKA 1ACLA 4XFKA 3VNVA 2WLTA 1ZN7A 1P6UA 2XWSA 4UW9A 1JAYA 1N2ZA 4Q05A 3D2CA 3D8RA 2R86A 5FL7D 2VAWA 4DUGD 4HDMB 2FMHA 3IKMB 1TYEB 3KAKA 3H5TA 5CLJA 1KVRA 2DTEA 2GD1O 3GN1A 4KRXA 5HZGA 3IGFA 1ELOA 1YVRA 2JJ1A 3DLCA 4R5HA 2I6UA 1N0VC 2ID9A 3Q6IA 3WGJA 2IOFK 2XBUA 1JQLB 4ZHQB 4NAHA 3INGA 2JH3A 4UHFA 4WOKA 2I29A 1QWOA 4RQAA 1LSOA 5IABA 3JAMA 2RKBA 3BERA 4OXIA 4A5OA 5LXTA 2FEAA 2HDNB 3BGSA 4UBIA 4O2LA 1ULAA 1BROA 1D4AA 1DL5A 1I3NA 4B3MB 2OM6A 3WLKX 5BUQA 4HDNA 1H4VB 3C6BA 5EIWA 3VHXA 1TD1A 4GE3A 4YRGA 1AB5A 2A9JA 1TW3A 2NZWA 1WXEA 3H05A 1YMQA 5B58C 2C5GA 2O2HA 3I37X 4BV9A 3BH7A 4RPKA 1ESCA 3C48A 4GDMA 5GZ1A 2IZ1A 4DARA 3D7KA 1CUYA 3LPMA 1CB0A 4RV5A 5DRTA 4XUGB 1B8VA 3UT6A 1Z5OA 1YE5A 2BT4A 2ZSIA 521PA 3A6PC 5CNIA 1TQHA 1NT2A 2C9ZA 2VP2A 4GZLA 3VJLA 4WUVA 4BWVA 1NDUA 2OO5A 1MABB 1B16A 3E81A 2OR3A 2Q4TA 2VT7A 2IOFA 2ZIFA 4JS0A 4UAUA 4LC0A 1NXVA 3SZOA 1K5DA 4NI5A 3O83A 1WMFA 4LHXA 2GMWA 1K6XA 3PQ5A 2WAXA 4JLAA 2EZ8A 3K0HA 4LYFA 3UYKA 2W2PA 1GQSA 4DKJA 4LXIA 3W2IA 1D9ZA 2IEIA 1I4DD 3QUBA 2B36A 3I12A 3LOUA 3E5HA 3IQDB 4EY3A 4EPWA 5LIPA 3PQDA 1KMCA 4G5YA 4L75A 3UEOA 5B6JA 5L6MB 1XVUA 4MKGA 2Q28A 1TLLA 2VH5R 3EH2A 2ODAA 3W6OA 1G42A 1R0YA 1IAVA 1FJHA 4FUQA 3S29A 1AT1A 5BURA 3OIUA 1QIJA 4FEAA 4TTRA 5IH3A 3ZE9A 1N6RA 3HWX1 1PWHA 3L8DA 2BKXA 2JVIA 2ZYUX 3G5UA 4MV6A 1H1DA 1W88B 1U0RA 3PRHA 4GUAA 3TDMA 2VTBB 3N0RA 5FL3A 2UVPA 3E3NA 2XJ4A 4IDBA 2FUNB 2FXVA 3OPYI 1D7OA 1UP6A 3I4FA 2I5PO 4YDRA 2ZS7A 1QVAA 3RI3A 4BLRA 2XECA 1JYEA 4HN4B 3KJHA 3IELA 4MH0R 5LZ5A 4UM9D 2A0FA 1TIKA 1KAEA 1QV9A 3AUAA 5DGIA 3RV4A 1GZ3A 3L7IA 1A1SA 3CPJB 2H1SA 4AZTA 1I1HA 4ZYZA 2PUFA 3QLTA 1PGNA 1AKWA 4J3FA 4O4IF 1H1LB 1KYVA 3SBXA 1FSGA 1P0FA 2HK7A 4URZR 2BBWA 5H59A 4GHWA 3MWJA 3UCFA 2JB9A 3DEJA 4P31A 3ONDA 2PWBA 3CRMA 1G0OA 1BXGA 2QM8A 2R00C 5L7WA 1QMGA 1GL9B 3MQ2A 3OG9A 4AN1A 2Q8PA 4BIIA 1T15A 1R27A 5AK3A 4BCDA 3H4IA 3HU3A 5T8KA 1NJSA 1P1CA 4G0OA 4DLYA 3CG4A 3GFFA 1N6PA 4J2OA 4X54A 4ZVQA 3T15A 3L04A 3WISA 2XOKD 3GB9A 4CMHA 3KYDB 2EZ9A 2IYXA 1EFPA 2QAJA 3QELA 2JI4A 1UP4A 2JAWA 2R8XA 3VGPA 2YC4C 3NXSA 4G01B 3U81A 1QHNA 1TEHA 2CB9A 3EGXB 1OYOA 3ZZUA 4TLCA 4JBYA 1V6CA 1XWFA 3BX1A 4BBAA 4LWQA 1NDHA 4DRXB 3FWZA 3PA6A 5CT8A 4X95A 3DAHA 1YL6A 2UXCB 4G1CA 1HQCA 4NCXA 3VO8A 2BFBB 1HTWA 2ZT8A 3H97A 5IZCA 1FU4A 5KSYA 2QVBA 2YWGA 3PHHA 3DA8A 4WFQA 4RMGA 4ZDWA 3U19A 1HZJA 1O8BA 2TMGA 4IS2A 4S35A 3G6WA 3HL4A 3R3ZA 1HDZA 2CMDA 5AI6A 2HTFA 4PHHA 3F5QA 1GG9A 1ARZA 4KQWA 1OREA 2TMDA 5DM2A 3T1HB 1YDHA 4OIMA 3DAOA 3TSWA 4RVGA 2C07A 1NU6A 4K7JA 1UAYA 1YU6A 1FYEA 1NI5A 2F1HA 3D6UA 4Q3DA 3O9VA 4TPKA 2DF8A 1Q91A 5EJ2A 5JXGA 4O0LA 4RJIA 5IAJA 3UMGA 3IP7A 2EFDB 4A92A 3EVAA 4MCIA 1CC1S 1N9GA 5D3KA 3AOEA 2HMAA 3GJZA 3I3SR 1E2JA 3E7XA 4YJGA 1C7JA 2RGCA 3QTLA 5EHGA 1EWRA 2FP3A 4RHXA 1L5HA 3TZEA 1E58A 1EHIA 1GN8A 1EFHA 3WBBA 4I5GA 3DMFA 3ITNA 2HHHB 1MTOA 3VV2A 2Q21A 4KXLA 4UNIA 1VA5A 5EZYF 4JMPA 5FIUA 3OPXA 3ZDXB 1TTQB 2I1QA 1XRPA 4J0DA 2CBGA 4Q03A 1E60A 4P6VF 5G0UA 3QKWA 4PU0A 3RVQA 3K3PA 4AB1A 1I1QB 4DR6B 4PYRA 1OLUA 2O52A 2BGJA 4UUOA 3I64A 3IT1A 4NOMA 3H1BA 1FUKA 5CPFA 1DBIA 2MYUA 4A8PA 2VDLB 3PF9A 4OQPA 4P4SA 4Z7JA 5K0BA 1EI9A 1JB9A 1QIEA 3QBTA 4LE1A 3V97A 4BNDA 4CLRA 2CLLB 3FTQA 4BGIA 2FWAA 2RCNA 1NUTA 3C24A 2UYOA 3A14A 2FEMA 3I8OA 4RQTA 3WYNA 4RTRA 1ZJZA 4ITVA 2NAFA 4S0ZA 5IN5A 4F85A 3TNLA 2E1PA 2AF3C 4KFUA 4RWEA 1UIRA 3G2QA 4YA6A 5GOZA 1DGQA 2O3UA 5KEIA 2ZEJA 4KR7A 1F6WA 3F78A 1PAUA 2NO9A 1WOYA 5IDYA 4R1TA 2H1IA 3L6BA 1ZH2A 5EP3A 3B5EA 3G7SA 1W9MA 4H60A 4KI0A 3ROEA 4LW8A 4JLMA 2CUTA 1RC0A 1NIJA 5H0IA 4WZBE 3TZCA 1G8KA 2FUKA 1DC3A 2E0IA 1OW3B 2OAP1 1LB1B 3OEED 4UFPA 2IW1A 5BSTA 4CDNA 4X7BA 5CAEA 1M8PA 5GZ3A 3AL2A 3IUYA 4GQIA 2WSIA 3LVRE 3FWPA 1G21B 1ZM2A 3FCAA 1UDWA 3G2MA 2PBZA 4PC2A 1MB9A 4H3KB 4FUTA 3MB8A 1W36C 1N34B 3DOHA 2H17A 2SICE 3MBOA 4IG4A 4KE7A 2F9MA 3SBDA 1UF9A 3ZUGA 5DTIA 3QK7A 4HDKA 5G0TA 1CRPA 5KTSA 4NPAA 2IH2A 3ICEA 4MR8B 4UOEA 3TMKA 4C1NA 1R3DA 2FPXA 1EVEA 3KVVA 1KMQA 2GNOA 3BF7A 3RRZA 1KU0A 3FUUA 3H4TA 4WBSA 2JW5A 3O8RA 4TMXA 4B81A 3PPIA 1QNFA 2A1UB 2CLEB 3KALA 3MAJA 2NYAA 4R6WA 1BXGB 5IT4A 1ENZA 4JDPA 4N9WA 3JWGA 4NX2A 4UCQA 5ITWA 1O6ZA 3OSUA 4CV3A 5B6PA 3E5RA 2Z0MA 4XLLA 2WY2D 5SYMA 4IIGA 3U49A 1D6MA 1CZOA 1V6SA 2P6MA 2FK8A 2QWXA 5DZSA 2YN0A 1Q1GA 3HYCA 4KQXA 3VYUB 2EWVA 4PSAA 1YOVA 4ODIA 2I03A 3JASA 2RARA 4X97A 3HC7A 2QMQA 4HBGA 2P2NA 2VJKA 4LDAA 2WJGA 3ZWCA 3UGKA 3HJFA 1QGUB 1KEZA 1N2CA 2YWCA 3GZJA 4Q7QA 4C2UA 4OM8A 4DNQA 1KBZA 2X22A 3R2JA 5TGTA 4E1AA 4HTFA 1P19A 4ALJA 1K89A 1KARA 2VSXA 1PO7A 2ZT5A 4FFSA 3HDVA 1YCGA 3N5CA 4HH0A 3ODPA 2I2XB 3D1LA 3HBJA 4FINA 1PJLA 4K1XA 3T3NA 3ETHA 3A1NA 1NQVA 2W2LA 2KYRA 3AVQA 3HLKA 4RD0A 2PTHA 4L4RA 1YFKA 2RONA 4RM3A 1K7YA 3N86A 3UJHA 1Q17A 2BHSA 2PGXA 4QDZA 3MGKA 3T1TA 2WWIA 5FUBA 4J0GA 2E2WA 2QW0X 3EW7A 4B47A 4K9SA 3D64A 4TVBA 2J3IA 4GBJA 5E1DA 1E6UA 2YICA 4B76A 3KK0A 3EIQA 2W2LD 3INRA 1TKAA 1A04A 1BS9A 1JAIA 3QW4B 3JQ8A 3T8YA 5A3JA 3ADPA 4MPJA 3MW8A 5BQOA 2FV8A 3PEEA 4PIVA 1Y1RA 4MA4A 2R8ZA 2WTUA 1KZ9A 3CLUD 2BW0A 1XG5A 5F21A 3RRNA 1L5HB 3TLMA 3V2UA 2QD1A 4QBIA 1JIVA 1OYWA 2L17A 4AUMA 4ETMA 5AW1A 4DA4A 3MBKA 4DV5B 2R8RA 1QWSA 2NZVG 3WQRA 2P2YA 3BCUA 5HF6A 3W5UA 2X58A 3BRSA 3FR8A 1GVHA 3M33A 5TS2A 3GI1A 4JT9A 3Q15C 2QV7A 2Q9UA 1QHXA 4KN9S 5B1DA 3SLGA 1G20A 3WSWA 4BRUA 2BPOA 3NHMA 3G9UA 3GLIE 2WWRA 3NANA 4WZAE 1FVFA 1KQNA 5TS3A 1SQ5A 2REXB 3LT1A 1IOVA 1CR1A 1P77A 2VZ8A 2WF8A 3LHSA 2V7GA 2X6QA 2ZJOA 1S7GA 4DN6A 5BNFA 4QPNA 2VJOA 1QZXA 4BMXA 1ZCAA 2KBFA 1AUXA 1RKXA 4G3XA 2ZYTX 4IMPA 4DR1B 1AXRA 2CVOA 3U3ZA 3K9QO 3SYTA 2FQXA 4AYXA 3NOQA 2C2KA 5AUPB 1ZI6A 2QT9A 4XYLA 3SWWA 4A27A 1DAGA 2HGZA 3JTEA 3I4CA 1ISMA 3AVXA 3AHGA 2GGSA 3SQOA 1WUKS 1SELA 1OFUX 4ZV4A 3WGNA 3E03A 4RTSA 2W6NA 1RWXA 2YJ6A 3OJLA 5FV4A 1YFJA 2AZXA 1NQOA 3MAGA 2HSGA 2VK8A 1JQEA 3ROKA 5CHYA 1L5MA 1DVRA 1LZKA 3DDNA 2FX2A 5HK9A 4JU9A 4MJ3A 1NUQA 4QD3A 2OGWA 1U0EA 1UZNA 4LY0A 3I53A 1WZ2A 1YS9A 2C9BA 3AR5A 3DHYA 3X2EA 1FTQA 1P5HA 4XD7D 1X19A 3EZGA 3LKDA 1KDYA 3X1MA 5A9RA 3U7RA 1WCYA 3M81A 2P62A 3O95A 4NCAA 2C2HA 2H63A 1SG9A 1ZM3A 3MYYA 3W1EA 3ESCA 2XQVA