3AY7A

Crystal structure of bacillus megaterium glucose dehydrogenase 4 g259a mutant
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
260
structure length
260
Chain Sequence
HMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase 4
total genus 100
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay7A00
3FTPA 5U4QA 2V6MA 5B4UA 4YQZA 3OMLA 1RM5A 1XWFA 1CWUA 2HMSA 2E82A 5COAA 3IAHA 3MJEA 3OM9A 5ITWA 2X58A 3FHLA 2AA3A 1EVIA 4OL9A 4GWGA 4B4WA 4B3JA 3KB6A 4CL8A 4PN3A 3GUYA 4CV0A 3OECA 1IYZA 4R3NA 1HKUA 4EUFA 1R6DA 2X9VA 4XYMA 2Q4EA 1T1RA 2VQ3A 5IFLA 4WLOA 4BV8A 3TFQA 1ZBQA 1GQYA 4J6FA 3E9NA 4NMHA 1X7DA 2WYVA 2IE0A 3PK0A 3WXBA 3TZKA 2IEDA 3F1KA 1E77A 1J0XO 2X0JA 1PQWA 5ENVA 2J3JA 4M55A 3AWDA 5DBFA 1M76A 3ETGA 4Q3DA 1AE1A 2NVUA 4LVUA 3GPDG 4J1QA 4E2ZA 4IDGA 3VH2A 2OHXA 4TMFA 3DTYA 3VH1A 2C54A 3JD4A 2VHZA 1Z82A 4RV9A 2ZB3A 2DAPA 1H94A 4OXYA 1DBVO 4DYVA 5KVVA 2BGKA 2O4CA 5CG1A 1E3WA 4LCJA 3RBVA 3JYPA 7MDHA 2GZ3A 1O0SA 4I08A 5HS6A 1M6HA 2EW2A 1A71A 1T2AA 2WWRA 2O3SA 4KDFA 1GYPA 4C7JA 4CM8B 1VSVA 3GQVA 3QWHA 3RFTA 4DPMA 4CM6A 3VZSA 5G2OA 3RJ9A 4J2HA 1W4ZA 3CE6A 4I9HA 1OOEA 3PQDA 1K2WA 2X6TA 3LDHA 3GNQA 4YAKA 3CKYA 4R54A 1FMCA 4RQUA 5AVOA 4HNHA 3RI3A 3PFWO 1YL5A 1B16A 4IXTA 3U0BA 3H3FA 1DAOA 1GR0A 3V2UA 1YONA 1Q0QA 3GEGA 3H9UA 5JDIC 1P44A 3KTDA 2AG5A 3TZ6A 3PWZA 4IMPA 5GZ1A 3Q0EA 2OO5A 4BO7A 3AUUA 4KP7A 1EVYA 4PG7A 3O9ZA 3VKVA 3EUWA 2CDBA 1WAMA 2Y68A 3CSDA 3SEFA 1XIVA 3CTMA 4UUMA 1G6KA 3E82A 1UXIA 4YJDA 1JQBA 3SJUA 4ITUA 3ZNPA 2GZ2A 5L7YA 4FFPA 2DUUA 1XDWA 3NDJA 3WSWA 3GRKA 2JL1A 4HX5A 4BVAA 2OORA 4NFYA 5IXYA 1E3IA 3GDFA 3UXYA 1YKFA 4CM9D 4CR7A 2EV9A 4YT8A 5BQFA 3GDGA 2RIRA 2Z1MA 1T24A 4XA8A 1WW8A 3CINA 2AEMA 3NGLA 3PJFA 2NU9A 2P5YA 3E48A 4FW8A 4L74A 4OO3A 4E4YA 3WMXA 4RVSA 2O7QA 3V2GA 3U4CA 3L77A 3DHEA 4I5DA 3D64A 5FI3A 4QTZA 3MTGA 1GUFA 1YH3A 1XQ6A 3PEFA 1NWCA 3H5RA 1ZSNA 5JSFA 1LDNA 4RPKA 3GEMA 4HADA 3NKLA 1EZ4A 4WECA 2PR2A 4E5YA 3LC1O 3W8EA 1PTJA 1ORRA 2Q99A 4GX1A 3NT4A 3K6JA 3DBRA 2W2KA 4Z9YA 1AGNA 2C0CA 2D5CA 2Q49A 3DZIA 2HMVA 1BXGB 4MOWA 1PQPA 4YTEA 4A7PA 3QW2A 4E31A 1WWKA 4E2XA 3RUCA 3H2SA 3K5PA 2ZB8A 5ILGA 3WGIA 3SLKA 4OQYA 1NHGA 1YB5A 3QWFA 4W82A 3BHIA 2ZB4A 4ZQFA 3B1FA 5AQ1A 4DWVA 1VL0A 1EK5A 5G4LA 4EBFA 4WKGA 3ZU3A 2HUNA 3NJ8A 1LRJA 4BO8A 4FDAA 5L45A 1FDWA 4NJMB 4DQVA 4XEHA 1F17A 1BVRA 4J7UA 3QVXA 4P38A 3WGZA 4PLZA 4R01A 4O59O 5F1PA 5GMOA 1ADBA 3IUSA 5IZCC 2H9IA 4E5KA 3LK7A 4ALKA 2GERA 3ZWXA 1D3AA 3QWBA 4BNYA 1KVQA 4XWYA 3E5MA 4QXMA 4NG5A 2OP0A 4PLFA 5IXSA 4NBWA 1V3UA 3TJRA 4BNWA 4GMFA 3UCXA 5HS4A 1I2ZA 1OMOA 1R15A 1WMAA 4R1UA 3DMYA 3ZDFA 1O89A 1CIVA 5JNLA 3GVPA 3PHJA 2DC1A 4QQRA 4A2CA 1Q0HA 4R5HA 1WP4A 2JFHA 3RFXA 5COQA 5GZ6A 3ZU5A 4A10A 3ASVA 3L9WA 1DIAA 4XD2A 4XX0A 4OKNA 2HK9A 4OH1A 3WX0A 1TA4A 2X8LA 4O63O 4DMMA 2AQKA 3HWRA 3WGGA 1Y5MA 4CMHA 3QVTA 1C1XB 4GVLA 4NH4A 3RBXA 4NIMA 5AXBA 5JDCA 1GU7A 1LU9A 1XKQA 4DQUA 2R2GA 5JPIA 4J9VA 4E2YA 5GY7A 1EBUA 2YV3A 2LDBA 1EE9A 4LMPA 5G4KA 3H9EO 3VDQA 3TZHA 1P0CA 4FOOA 3DZJA 4TWRA 3WFIA 1BW9B 2HJSA 3TOZA 4YA6A 3OJFA 1P31A 3GC6A 2J5QA 5T5QA 5CDUA 1X1EA 1ISIA 3ZWVA 4Q3NA 2QYTA 4O5OA 4WJZA 3A9WA 2NACA 4AJJA 3A4VA 3WR5A 1U9JA 4IJWA 1VM6A 2VTEA 5A5FA 4QFDA 3I6QA 3FBTA 2WM3A 4N7RA 5TJHA 4BGEA 1K3TA 2YHUA 3I4CA 2YW9A 3D4NA 1SPXA 2O2YA 3M1LA 1GZ6A 1MFPA 2TMGA 4YAEA 2BHLA 4B79A 1ZK0A 4P22A 1LDBA 3G49A 1ZO8A 5JAQA 3WNVA 3ETEA 5U1PA 5DCWA 1EQUA 2JD2A 3PLNA 2Q1WA 2CUKA 5T64A 1NQOA 3RUAA 4R41A 5JLAA 2BKAA 4WCDA 1C0KA 3AK4A 3M6IA 1V3TA 2BGMA 4LK3A 2BMAA 2AQIA 3MJSA 1ZMTA 5JC1A 2GN8A 5DN9A 4NQZA 2FY8A 2DPGA 2TMDA 4ILKA 4XQ9A 3L4BC 1I3NA 3S55A 4CM9A 2X1HA 1V3VA 3GHHA 5CDGA 3GFBA 1CETA 4F45A 2X0IA 2EIHA 4OJNA 4PLCA 2Q4BA 1DRUA 1VI2A 1VSUA 2DUWA 2GPTA 3PDJA 4B7UA 4S1VA 3DOJA 1U1IA 4EGFA 3R6DA 5KJEA 1SMKA 2WE8A 5EQDA 1A72A 2NM0A 2XXBA 4CR8A 1I2CA 1ENPA 1PJSA 2YFQA 4R69A 1IY8A 3WGOA 2A4KA 1SB9A 1KY5A 2EKQA 1B8UA 1MUUA 4FOSA 4ND4A 4KUEA 4IUYA 4A0SA 4C4OA 4F6LA 4NJMA 1R0KA 2HMTA 1HXHA 4O0LA 4RLHA 1QYXA 1HT0A 3E9MA 4YRBA 1YJ8A 5F3RA 4Q3AA 2LDXA 1E1NA 3GUCA 9LDTA 3VHRA 5JCJD 5G0VA 4K6FA 3X2FA 3F4LA 4A5OA 3RAJA 1S6YA 3UCEA 3JD0A 2FWMX 4PLTA 5TIIA 4BKPA 2GZ1A 3JYQA 1B0AA 1LEHA 5CG2A 2OMEA 4KUHA 1XYGA 2OBYA 3QSGA 4XRGA 3UCFA 4L4RA 3ONEA 3L9XA 2GN4A 4B7CA 4HFRA 2B36A 5DP1A 2VHXA 3GN1A 2WD8A 5ICSA 2VYND 1ZK2A 1HYHA 3ZGYA 1EEHA 4Z9XA 4ALIA 1PJ2A 2NWQA 2GRAA 2FMUA 2W2LD 3S2FA 3GMDA 2G1UA 1UXJA 2Y1CA 4TRRA 2GLXA 1YO6A 1JLLA 3OF2A 4ZQEA 1LI4A 3ITKA 4ND1A 2EGHA 2DU8A 4DLAA 3KSDO 3FR8A 1PJQA 5JCJA 3QLJA 2ZKLA 5AXAA 2O50A 4A73A 1YQGA 1NTOA 2NSDA 4RZHA 4B4OA 4BO1A 4CLOA 1U28A 1YOVB 1LLDA 1LC0A 1Y9AA 2IZZA 5F1OA 4Z6KA 2C5EA 3ZWWA 3ENNA 1E3EA 1AN9A 1CEQA 3ZNQA 3AOEC 1UP7A 3OICA 5T8KA 2GASA 1JKFA 4FC7A 4BHTA 3WIDA 1NQAO 1YVEI 2Y1EA 2GCGA 2Z1NA 4MVJA 1K6XA 4GBJA 2GF2A 1ENZA 4YB8A 2G82A 4MP6A 3SC6A 1DC3A 5CPBA 4MVJE 1CYDA 3GVIA 1O94A 3V8BA 1Q7BA 2HK7A 1PL6A 4XR9A 4WOKA 1ZIDA 5JO0A 4R3WA 4XYGA 5IN5A 4ZU3A 3GZ4A 3K31A 3PXXA 3G1UA 3UAGA 1BXZA 2P2SA 1IUKA 2PGDA 2BFOA 4Y9DA 1PS0A 2C2XA 1IPEA 3NT2A 3ORFA 3RJ5A 3ZU4A 1PZHA 4LCEA 5F5LA 1OC2A 3G17A 1MX3A 3JQAD 4UEJA 2JFGA 2VUSA 4WNIA 5CDTA 4AICA 4NK5A 3KYBA 5BNTA 1YWGO 5IDWA 5JC8A 3G3EA 4PG8A 4XYLA 2VHWA 2YV2A 2PZKA 3PGJA 4L76A 2DPHA 4GGOA 1YE3A 2EJVA 2GGSA 4RDHA 4PRLA 3FNFA 2HO5A 4PLVA 3BAZA 4LN1A 4NZ9A 2B4RO 2GYYA 3PI7A 3NRCA 5I7FA 4YPOA 3JYOA 3EK2A 4YAIA 1DSSG 3PIDA 1BRMA 3DOCA 3ROPA 1NHWA 3JQAA 5BNFA 1E7YA 1Y6JA 3IUPA 1EDZA 1X0VA 2YQ5A 3H9JA 5C37A 2PH5A 4W7IA 4DIFA 3O4RA 3GGPA 3FBGA 2O4UX 4Z3DA 3OSUA 1KEUA 4D43A 3AOEA 2PD4A 1P33A 1E1MA 3M2PA 3UHAA 3IOYA 3OQBA 4PIVA 1XEAA 3I5MA 1A9ZA 3DZHA 2FP4A 3U4DA 4ND3A 3DONA 1MP0A 3AM4A 2VTDA 1C14A 4UVIA 3PQFA 3WLEA 1NQTA 2EF1A 1ISJA 1BGVA 3GMSA 3H4VA 4JBGA 4E6PA 3LZ6A 5FEUA 1Z6ZA 3GAZA 4CLRB 4J2OA 1ZSYA 4XQGA 3GGGA 2GUGA 1MXFA 1RKXA 1H6BA 4IS2A 4BNVA 1P1HA 2X5JO 4CR6A 1KVUA 3FWZA 2I9PA 1FK8A 1MA0A 3ROMA 4GH5A 1ZZEA 3I9MA 3BMCB 4FGSA 4RPHA 3VZRA 4YT2A 3DXFA 4U6QA 2BF7A 5A9SB 3MCVA 2BFMA 2CMDA 1RWBA 3JQAB 1S7CA 3L0DA 2OP1A 1LA2A 4RL6A 1SC6A 3RIHA 1ZH8A 1U5AA 1LQUA 3DBHA 4AJLA 3PHGA 4MINA 3HE3A 3ADOA 2PZJA 4AVYA 4BKRA 1LNQA 4OOFA 1GTMA 2Q3EA 2IXBA 4RPJA 5EMHA 4II3A 3AU8A 1ENOA 1OI7A 3OJLA 1KEPA 3VTFA 3RU9A 3BA1A 2QIOA 1RYEA 1DFHA 1VL8A 4I5EA 5THKA 5KVSA 4CQMD 3WG9A 2VRBA 2DT5A 1DHRA 5G0SA 2UAGA 3PPIA 1OBFO 4DBZA 2D59A 4RF2A 1I0ZA 3AUSA 3NYWA 3H5AA 4BMVA 2AMFA 2IZ1A 3KYDB 4XQEA 3WICA 2QRKA 3RD5A 2ET6A 4WEQA 4AG3A 1HDZA 1PR9A 4O6VA 3ST7A 3JQGB 3UF0A 4D3DA 2FR0A 1GUZA 1V8BA 3GOHA 3DWFA 3VZQA 3LSYA 4HBGA 2R00C 4XR4A 1U3VA 4DC1A 3JQ8A 1A5ZA 4H3VA 4JK3A 4B3IA 4DL9A 3WBBA 3AOGA 4CM7A 2A35A 1H6AA 2HMWA 3FF4A 2AEJA 3DFUA 4YYZA 4ZVVA 1W73A 1E5LA 1FF9A 3LC7O 1A9YA 1H2BA 3OA2A 3NDIA 2D0IA 5AXCA 4JNKA 3H9QA 5A3JA 5TSDA 2O3QA 2W2KB 2NVUB 1XGKA 4CM4B 5KJ6A 3DZBA 2C20A 1GPJA 2ZTUA 1MC4A 3W8DA 5FYDA 4NDNE 4M1QA 2JAPA 2OZPA 4DXHA 3MTJA 3PTZA 1FDSA 4GX2A 4UUOA 5ER9A 4RORA 2GO1A 1P0FA 1F0YA 5DULA 2B0JA 4CMKA 4JX8A 3NTRA 1YL6A 2CDAA 1K6JA 3GA0A 3GT0A 3ULKA 1GPDG 4CM1A 2AXQA 2JCVA 2FSSA 2IDZA 2PKRA 3A06A 2HRBA 2VN8A 4I5GA 4R51A 1GL3A 1SEPA 3E9QA 3PIIA 1HEUA 3R0IA 2H6EA 1VE9A 2EP5A 2HKIA 4XB2A 1YQXA 5HA5A 1IPFA 1NNUA 3DAPA 3PQEA 1O9BA 2CSUA 1UUFA 3VVCA 2IEBA 4ID9A 3IC5A 1NYTA 1MB4A 3JQ7A 2CFCA 4HKTA 4R5MA 1T2EA 4H16A 4IIVA 1LSSA 4N5NA 1P1IA 2DBQA 5HM8A 3GZNA 1BWSA 2X7HA 1JKIA 2PH3A 1QSGA 5ITVA 5K6AA 2QYSA 3OIGA 1JU9A 1VLLA 1DIBA 4YJFA 2AE1A 3VZPA 2UDPA 2C07A 2EW8A 4C7KA 2AG8A 3PWKA 4OSOA 1DJQA 4NBUA 3QA9A 2QZ9A 3OIFA 2X23A 4RGBA 2NVWA 4DA9A 2HAEA 3MOGA 3W6UA 2PA3A 1XCBA 2C7VA 2FR1A 5BR7A 4P4LA 1LQTA 1Y7TA 1YBVA 2B83A 4PFJA 1EUDA 3BMQA 2XAAA 1Q0LA 4MVJP 4Z0TA 2RBEA 2FPPA 3RVDA 3W1VA 4AJEA 4AL4A 4YXFA 3QVWA 4GKBA 1Y9EA 3ABIA 2YDYA 3JQFC 4OYRA 4J0FA 1MFZA 5T6BA 4L4SA 3JSAA 2FPGA 3CMCO 3DBLB 1HDOA 2IZ0A 1NR1A 4U5QA 3W4JA 3K2EA 3SLGA 1A27A 1DXYA 2G76A 4IXWA 3AI2A 1QKIA 1AXEA 4BO6A 1NWHA 4Z0HO 4YT5A 3JQ9C 3O38A 2ZJ1A 5KVQA 3WFJA 3NT5A 2D5AA 5CPFA 4IQ0A 5JW6A 3EZYA 1DB3A 2VYNA 3U4HA 1LRLA 2PGJA 4G65A 1MXHA 1WMBA 1SNYA 2BH9A 2JHFA 5A5EA 1IHXA 3NEPX 1UXGA 4BNKA 2QRLA 4R9SA 8LDHA 5ES3A 2J3KA 2Q2VA 3AM5A 3ZWYA 1YBAA 1B8PA 2FOIA 2EEZA 4E5PA 3ZV3A 4D3SA 3DOOA 1U4OA 3DTTA 1DIRA 1HRDA 2JKVA 4PVDA 1CQIA 3S2IA 1F8GA 2PLAA 2PY6A 5LCXA 4NHEA 5ADHA 2J5RA 2EXXA 2RCYA 4M49A 1ZSVA 5A02A 5LC1A 4BV9A 4JLWA 3Q2KA 5I9NA 3CPSA 4J43A 5JXWA 1KC1A 3E1KA 3KBOA 1LLQA 1KERA 1O5IA 1YS4A 1I10A 3NTOA 4WK6A 2ZYDA 3W4KA 3UKOA 1DPGA 3BMOB 3ON5A 1EFKA 5B37A 2DVMA 3UFXA 1LLCA 4K1LA 2A94A 3UOGA 4PLYA 2A9FA 1M75A 5JAMA 3KYCA 1ZJZA 1PGJA 1GEEA 2FPIA 1PS8A 4TZKA 4IDBA 1E7MA 1K5HA 4RPLA 4A26A 9LDBA 5KIAA 2NUAA 1H93A 3HB5X 1P1KA 1ZK1A 3BIOA 5ICMA 4W9NC 4GL4A 4DPKA 3KHUA 1WZIA 2O3JA 3DAFA 4OHUA 3TL2A 2PZLA 1TT5B 3GG2A 1TXGA 2X9GA 1O8CA 3C7CB 3OH8A 4RDIA 1VJ1A 4FJ1A 2QG4A 4RF5A 3F1LA 3RKRA 3ZWCA 1GYQA 5TS3A 1I30A 1LRKA 4PLHA 1CDOA 3JD1A 1ULUA 3GH3A 1HE2A 3N74A 1U4SA 1Y8RB 2CVQA 3JQCA 3VPGA 8ADHA 4QFCA 3I9JA 5JDIA 1NPDA 4FFNA 1NQ5A 4GLLA 3MZ0A 3PYLA 2Y1DA 5CP8A 3OETA 3GVCA 2B4TO 1GQ2A 1JDJA 1JW9B 3DMTA 4UVHA 4UVGA 4PG6A 4RPGA 4UUPA 2J3HA 4J4TA 2BFPA 1JVBA 2F1KA 4ZQHA 3VPSA 3C3XA 3BXXA 1CQJA 3BMNA 4DREA 4JBHA 4XIYA 4DBVO 3K8ZA 2X86A 4MP3A 2P4QA 3RASA 1E3JA 1G0NA 4XYEA 3ZNOA 1N2SA 2P9GA 1UR5A 4IDFA 4IQ8A 1RYDA 1JWBB 2B5VA 1G0OA 2PFGA 5BT9A 1DRVA 5CDSA 2YFHA 4YT4A 1LBEA 1E92A 4IDEA 4YJHA 1Q2XA 1ZVMA 2BFAA 4ZQGA 1Q7GA 3DZFA 4FB5A 3VKUA 4LISA 3DBRB 4AJHA 2FZEA 1Y1PA 4WLVA 2NQ8A 3F3SA 1FDTA 3FCOA 3R3SA 2AE2A 2E48A 3O26A 2JHGA 4TRMA 4N18A 3DZGA 2FRDA 1R4MA 3DO5A 5BSGA 2PGLA 2QQ5A 5BSHA 1UH5A 1GD1O 1PJ4A 3VPFA 1TEHA 1UZNA 4TSKA 1ZK4A 1HF3A 2C82A 3LT2A 4BO9A 3BYZA 1N1GA 4L4XA 1U8XX 1BG6A 1EUCA 1A4IA 4MDHA 4DC0A 1D8AA 5DDIP 2Y1FA 2DM6A 2PWZA 5DZSA 1ZEMA 3RUIA 4NBVA 1QYDA 3NDRA 3PRJA 2YUTA 1MV8A 4J0EA 3GDOA 4U6SA 5KWEA 4Q3EA 2B5WA 1ISMA 5A4DA 1HZZA 4R68A 4GSLA 4PLPA 5AXDA 4K9DA 2OBNA 4YVFA 2O3TA 5FWNA 5A06A 3MOIA 4NFSA 1Y8RA 2OGUA 2E6UX 3D3EA 3E03A 4WCFB 4I9NA 3DQPA 1TI7A 1DEHA 1PX0A 4BNFA 5JS6A 4PCVA 3OJEA 4MKZA 4BB6A 2VCYA 4E30A 4NFHA 4PG5A 5G0UA 3B70A 5JO9A 2J8ZA 2GN6A 1SZJG 5IJZA 2W98A 3K92A 1ZW1A 3CXRA 1F06A 3KM0A 1E0DA 4X54A 1BDMA 1Z7BA 1VC2A 1N1EA 2CD9A 1AHHA 3VC7A 2GD1O 1R0LA 3C1TA 1SB8A 4FGWA 3QV1A 5I8WA 1K6IA 1EMDA 4OM8A 1D7OA 4BNUA 3KYCB 4BO2A 2ZIZA 3L4SO 3ONFA 1RM3A 5EESA 4B8WA 4MKXA 3JQEA 3RUFA 3Q9NA 3GRPA 2OUIA 3I1JA 1P45A 4BNLA 1FDUA 1PEDA 1PGPA 1ZNQO 1SO8A 3A14A 2P5UA 2VZ8A 1NAHA 3FNGA 4TKLA 4NBTA 1KC3A 3WTCA 2B35A 2XOXA 3AY7A 3I3OA 4E21A 5KCZA 3UVEA 3TRIA 5A03A 4UEOA 4B4UA 3FSRA 1Y8QB 3N58A 4PVCA 4YJGB 4JIGA 1QR6A 3ZZNA 4CPDA 2G0TA 1V35A 2O3UA 3O03A 3ANMA 3F6YA 1TB4A 3EC7A 2YDXA 1NM5A 4FC6A 3ZWAA 2ZTMA 1R16A 5TC4A 3W4IA 3K30A 3DBHB 4RO0A 1YJQA 5L40A 3E6AA 1E6WA 4EZBA 4XJTA 1CF2O 3V5NA 5KTKA 2EGGA 3L6DA 3DL2A 5JMPA 2E37A 4JJGA 1GCUA 1ONNA 1E7RA 1V9LA 2Y1GA 2Y0CA 4URFA 5JFOA 4J7CA 2XF8A 3EVTA 5EJ2A 1PGNA 4WOJA 3KV3O 4CLDA 3JYLA 1GZ3A 4J1SA 2C59A 4J90A 1HLDA 5EERA 1B3RA 1UP4A 4BMNA 2GN9A 2VWQA 4LGVA 3GHYA 1U3WA 1QLHA 1T4BA 4CV1A 1H6CA 1M2WA 3WYCA 3WQSB 3FNEA 4IY1A 3PWSA 4IZHA 4CQLA 1MC5A 3I52A 1DLJA 3TNLA 4NU5A 4XCVA 4W99A 3D7LA 4E13A 2UUPA 4CLXA 3BTOA 2ILTA 1UDBA 1O6ZA 4LRSB 1BVUA 4IJVA 4RVUA 3OQ6A 3UICA 3BHMA 4A03A 1T26A 3JD3A 3ZV4A 5GZ3A 1UDAA 1KVRA 3T4EA 1B2LA 5COBA 2IYOA 1B7GO 3VOSA 4INAA 3U62A 2F00A 3CUKA 1DFGA 2UUOA 4S3MA 4NBRA 5TF4A 5TLSA 3LLSA 3ZH2A 2NU8A 3FRJA 2PKQP 3IMFA 4WUVA 4MJLA 1IL0A 4G2NA 3JQBA 3KEQA 1NAIA 4DMLA 1N9GB 3CZMA 3HNPA 5KJ1A 3RWBA 2X5OA 4BL5A 2VYVD 1WZEA 2CZCA 4EEXA 5T67A 3GEDA 3IJPA 3ZU2A 3BHJA 2ZATA 4XGKA 1ZK3A 4CMEC 3OEWA 5CDYA 1T2FA 1LDGA 3DZKA 4GPD1 3MWEB 3ZV6A 1IZ9A 1Y81A 1QYWA 1N7HA 4IGEA 2OL4A 1Q1NA 2WE7A 4PZCA 3GAFA 4IDDA 3IJRA 4IINA 1PJTA 1I8TA 2DFVA 4Q39A 4LVCA 1B8VA 4ROSA 4GWKA 1ONPA 1YRLA 7ADHA 1E1LA 1C1XA 4TVOA 4IS3A 3ZHXA 4MVJH 5G4KB 1A7AA 3DFZA 3O8QB 4Q9NA 1ISHA 1UDCA 1NVTA 3OA0A 2DTEA 3LT1A 4KDEA 3PGXA 3HZZA 5F1KA 4CMIA 4HNGA 4BMSA 1PR3A 3V2HA 3I83A 2FSVA 2NNLD 2Y93A 2BRUA 1RPNA 2ZTVA 2HK8A 4QECA 5DP2A 3LF1A 1ADFA 3F4BA 4GSKA 1D4FA 4J9UE 4B4VA 1KEVA 4Y6RA 4PLGA 4TKMA 4BKOA 4F46A 5L7WA 3C7DB 3ENKA 3LF2A 5BSEA 4UREA 4HUJA 4MKRA 4BS9A 2AQHA 3C1AA 2WD7A 3L6OO 4R16A 4WLNA 4R1SA 1P3DA 1R0SA 3SX2A 2D4AA 1JTVA 4BO4A 4CMEA 3DBVO 3L6EA 5IN4A 3C8MA 3CIFA 1PIWA 3Q2IA 3UGKA 3AM3A 1R4NB 1T2CA 3KXDA 2NADA 3T4XA 5DBGA 4PG4A 4GLOA 4IQGA 3JQBC 3KSZO 2PD6A 1WDMA 2QX7A 2DTXA 2RH8A 3OEYA 1L7EA 1U5CA 1NP3A 1Z7EA 2C2YA 2Q1SA 2B69A 3AFMA 2AW5A 1VPDA 1ONOA 4B8ZA 1YXMA 1GV1A 4E0BA 1A4UA 1ZEJA 4RVDA 5IDXA 3F47A 3AW9A 4YJFB 4MIEA 3WIEA 2Y0EA 1I33A 3ZWBA 1PZGA 2YQ4A 3E18A 5I8ZA 4RVGA 1R66A 3VPHA 2FR8A 1E7QA 1GUYA 4IGFA 1KVSA 5HBRA 3COSA 5L4LA 1PS9A 2Y1OA 2W4QA 4YQYA 1GADO 1BDBA 2VUUA 3TDKA 2WJPA 4FFMA 4BUCA 3L07A 1K0UA 1E7SA 5KOIA 2Z5LA 2Q1TA 4XDZA 1MG0A 2JD0A 3SXPA 5C7IO 5B12A 1XELA 4KQWA 4D44A 2VWGA 3S8MA 1LX6A 2RHRA 1XU7A 4Y6PA 1TT7A 4J16A 4UAGA 1WXDA 4AJ2A 2YHIB 5I7VA 3IP1A 3NX4A 3JYNA 4IJUA 3VH4A 4CQMA 1FJHA 3JTMA 2VOJA 3EHEA 1C0IA 3GK3A 2GNAA 4PZDA 2EJWA 3RQSA 1VKNA 2FHSA 2YV1A 3O8QA 4HP8A 3LU1A 1ZUD1 3Q1LA 2HSDA 3MJ4A 1DC5A 2G5CA 4BNNA 2I67A 4CM4A 5HRUA 4MPDA 3QHAA 5TT1A 2ZB7A 1ID1A 3UN1A 4M89A 2HU2A 2I99A 2WDZA 3EY4A 4E2WA 4BNIA 3LC2O 1DHTA 4MP8A 4I9UA 5L51A 3S2GA 4E3ZA 5TX7A 3I4FA 3LT4A 4NK4A 1JVSA 3PFFA 1E6UA 4MO2A 1PJBA 2J6IA 4AJPA 1BHSA 1ZJYA 3IDSA 3JQGA 3RSHA 3FTNA 3PDUA 3PP8A 3WNQA 3WMWA 4XIJA 1KVTA 4G81A 1X7GA 3D1LA 1IE3A 1I24A 3GVHA 3HFSA 3HUDA 5KNLA 3EW7A 2AHRA 4D3FA 4DYDA 1N5DA 3I9LA 5IDQA 5FI5A 3TSCA 1FDVA 1GFSA 4KQXA 2X0NA 1HDXA 5HWSA 3WGQA 3B1KA 1IB6A 1WNTA 1DC6A 2HDHA 4CMAA 2I76A 3FNHA 4CUJA 4W9NA 5DOZA 4EUHA 4WCFC 1ENYA 3TFOA 4BNXA 4CMCA 1KIFA 5JY1A 2DLDA 1EE2A 1QYVA 1E7WA 1LSJA 4OGWA 1EUZA 5L4NA 4O1MA 2HLPA 3ANNA 1LLUA 1DO8A 3H8VA 4DRYA 5L95A 2EG9A 1E3WB 2DQ4A 3D3WB 3MWDB 1HLPA 3WJAA 4CQMB 1U7HA 1H9AA 4EDFA 3ICPA 4AJOA 3H5NA 3IQDB 5JYDA 1P74A 4D7AA 5K9ZA 2ZJ0A 3AI3A 3EGOA 2QRJA 3JD2A 4U8GA 4YBZA 2X5KO 3BMNB 3OP4A 2Q2QA 1I5RA 5I9MA 2E4AA 1I3KA 5TJ9A 3U49A 3GN2A 4KTVE 1JAXA 2I65A 5KJCA 4FJ2A 5CAEA 3PHHA 5JCXA 2CNBA 4FJ0A 3RC1A 3OHSX 3WWYA 4IIUA 3TF5A 1X7HA 1XLTA 5FF9A 1I32A 4HY3A 2HMUA 1J49A 4L75A 4Z9FA 4DUPA 4KMSA 1EQ2A 5KJFA 1NPTO 1YB1A 1KYQA 1QXSA 2SCUA 4BGVA 2FN7A 1GV0A 1A7KA 2PV7A 2VHVA 3EZLA 4N54A 2I3AA 5TRTA 3OQ1A 2DBRA 3V1TC 4N5LA 2PKQO 1DIGA 2UYYA 1V0JA 3ZHBA 3KETA 1DRWA 2Q50A 3OIDA 2ZYAA 3NGXA 4RCVA 2NTJA 3FD8A 4YDRA 1SEVA 3ZNNA 5T8KC 1KETA 1JKJA 1CRWG 2VRCA 4BNZA 5DCUA 3MEQA 4DVJA 4CODB 4BGIA 1P1RA 4R1TA 1BSVA 1TVEA 2HJRA 3CMMA 1M66A 4IMRA 1L1FA 4BNJA 4CUKA 4KTTE 3LT0A 4YR9A 5G0WA 3C1OA 3IIEA 4GKVA 2POQX 3GZNB 2JJYA 1W8DA 3KOUA 1PSDA 3JQ6A 3QY9A 1X13A 1PZFA 4U0KA 1PL8A 3P5SA 3HDJA 1VJTA 2DBZA 4I5FA 3Q6IA 5CEEA 3RUDA 3KYDA 1U3UA 2ZQZA 3ROKA 4E32A 2J5KA 3GNSA 4QSMA 3BMOA 3JQFA 4K26A 2VRCD 4PRKA 4YEDA 3P19A 5JBIA 3G79A 3KO8A 4QO8A 4BNTA 1GYRA 3AUAA 3PHLA 3ZW9A 3KZVA 5CEFA 3DMTC 4WPGA 4EJ6A 2R6JA 1KBZA 5A9RA 1JA9A 3PJDA 2V6GA 3NTQA 3VDRA 4XGIA 4CMIB 1XU9A 4M54A 3G1TA 1DDOA 3UH1A 4CV3A 1VKOA 4HWKA 1I3LA 5F21A 5A04A 2I5PO 1K89A 2VNSA 1XHLA 1WDKA 2VYVA 1YDWA 3RFVA 1BTOA 2CVZA 4UVEA 4BKQA 1VJ0A 2JAHA 4W7HA 1NBOA 2Q46A 3S2EA 1UZMA 4TQGA 2AQ8A 2RAFA 3W8FA 1SAYA 2H1SA 1Z73A 2NU6A 2CDCA 3SVTA 5CFZA 1NVMB 1Y8QA 5L4SA 3AFNA 4JN6B 4ZHSA 1ARZA 1NXQA 4H15A 4EI2A 3KVOA 4CV2A 3T7CA 1YOVA 3V1YA 4DIBA 3TZQA 1ADCA 4BIIA 1M67A 5DF1A 4JP2A 1B15A 2E49A 1ULSA 1W0CA 4TROA 3QRWA 4JBIA 3QWIA 4EITA 3C85A 1ZXBA 3F46A 4OOEA 3QVOA 2NQTA 3DHYA 3FPCA 1AUPA 2YZ7A 3P2YA 3W6ZA 4KOAA 5J23A 1DJNA 4YAJA 1KOLA 2HQ1A 3WQRA 3TOXA 2NVBA 5DNAA 2C5AA 1D1SA 5EQFA 1EVZA 1NR7A 4E5MA 1T25A 1DIHA 5JY6A 3CEAA 3QJ5A 2DBVO 5HTOA 3PJEA 3SBOA 2W2LA 2A92A 4QEDA 4BNHA 5I7EA 2RHCA 1Z75A 3PZRA 4RJTA 2PK3A 4ZRNA 1F14A 4IDCA 2Y99A 3E5RA 4NNJA 4YRAA 4MVJI 3WS7A 4R4JA 1UJMA 4E33A 4AJ4A 3WSVA 2BI8A 1IZ0A 4BNGA 2R00A 1GAEO 3ZHYA 1YQDA 2NU7A 1XSEA 3AI1A 1MLDA 2YY7A 1F8FA 4KZPA 4FN4A 2WYWA 1J6UA 2P91A 3ITDA 3A28A 1ZXLA 4BO3A 2Q45A 3PHIA 1CERA 3HQ4O 1WLYA 1HYGA 3D0OA 3EVNA 4FSHA 4CLOB 3RROA 4D46A 1LDMA 4ND5A 4RVHA 4JJFA 3JQDA 3HHPA 4J7XA 1YB4A 3F9IA 1H6DA 4WASA 5H81A 2VNAA 3OJ0A 1HE4A 2ZTLA 3GG9A 2VT3A 1DFIA 1U2GA 4Y67A 5AOVA 4HFJA 1N92A 3AY3A 1GEGA 1KEWA 3Q11A 5JE8A 3I9NA 1U7TA 3H9GA 4J3FA 3P7MA 5LDGA 4N5MA 1ZCJA 4TRJA 1C0LA 1QORA 1DC4A 1LC3A 3HB4X 3HDQA 3IP3A 2Z95A 5EIOA 4D42A 2W90A 1C3VA 3ZI0A 1QV7A 2JCYA 2YYYA 4J91A 3HG7A 1GY8A 4Y98A 3ZWMA 4HFNA 4ZD6A 5THQA 3AUTA 4BNMA 1Z74A 4FQ8A 4IM7A 4PGFA 4U0JA 4ZGWA 5C5IA 3QWAA 1UP6A 4FS3A 1UXKA 3FI9A 2UVDA 3KEOA 1YGYA 3RUEA 1QG6A 2D8AA 4RF4A 4YJGA 3GF4A 5B4VA 3VH3A 2WTBA 2JFFA 1QV6A 3ROQA 3TQHA 1YBMA 4UEKA 1C0PA 3RBZA 1F12A 2EKPA 3D5TA 2PD3A 5MGBA 3DB2A 4MIYA 3KUXA 4FPXA 2B4QA 2VUTA 1D1TA 4PLWA 1HDCA 5DBIA 1X1TA 3LVFO 4CLHA 5AYVA 2P68A 1YDEA 3DBLA 2C7GA 4DQXA 1Q7CA 3K96A 4BB5A 4DIOA 4J1TA 2Q1UA 5IZCA 2GDZA 3GVXA 1XR3A 2DKNA 3V1UA 1PGQA 4XRRA 3MJCA 1DLIA 3Q3CA 3RC7A 3NUGA 4ALLA 1YL7A 1V6AA 3LYLA 1LDYA 2EKLA 4J1NA 4DGSA 1E3SA 3VVBA 2VOEA 5JAZA 5C7OO 1Z45A 2IYPA 4CM8A 3ZWPA 1R12A 1XQ1A 1NASA 4ESOA 4CJXA 3WB9A 3VPXA 1I3MA 4Q3CA 1R4NA 3WLFA 1WPQA 1GDHA 5I9LA 1P9LA 3PYXA 3F5SA 4BGUA 4MVJM 4GAEA 5IF3A 2G17A 3IS3A 2BLLA 1HDYA 2B37A 4WCFA 1RM4A 1MG5A 2CY0A 3ZW8A 4QO7A 3ZWNA 3GR6A 4M86A 1EVJA 4ZN6A 4A27A 1UAYA 4XYBA 3U4IA 1EBFA 2D1YA 3ASUA 2ZQYA 1PL7A 5MDHA 5TQVA 4CM3A 2RH4A 4KUGA 4CL3A 3U5TA 5ILOA 2O7SA 4W6ZA 3H7AA 5JMWA 3WWZA 6ADHA 3BZUA 3ETDA 2PNFA 2NLOA 3U09A 3PYMA 3WYEA 1SBYA 2BD0A 4YRDA 4QUKA 4KWIA 2C29D 3H6KA 3D3WA 4EUEA 3BMQB 5U9CA 4GX0A 3PJGA 3NV9A 4CMBA 5L9AA 2P4HX 1C1DB 3M1AA 4J49A 2Y0DA 1BW9A 5ER6A 4Z0PA 5EL0A 1C1DA 2GR9A 1DOHA 3JV7A 1EK6A 4BOYA 4I8XA 3I9KA 4LSWA 2EWMA 4ZQBA 4U7WA 4ZA2A 5IAAA 4WEOA 3PLRA 3P2OA 4GMGA 1RM0A 5A1TA 1OZAA 3INRA 1T4DA 4ONEA 4P8RA 3BMCA 3RC9A 1PJ3A 1M6WA 3KLPX 4GGPA 2NTVA 2WD7B 4Q3BA 1ML3A 4LSMA 1P1JA 3RC2A 1HE5A 3G0OA 1WVGA 3TN7A 4NI5A 4LW8A 1U8FO 1N8KA 3X2EA 3DAGA 3C7AA 1OAAA 2EP7A 2BI7A 5IG2A 1HDGO 4AJKA 4IDAA 1T2DA 4MVJD 3QP9A 4NR0A 4H7PA 5JAIA 4FD3A 3A1NA 2O48X 3ANLA 2QZZA 4IZIA 1E1KA 4QX6A 3ZCXA 4II2A 4UULA 1PWZA 4P4NA 2VT2A 3BTVA 1UAGA 3I23A 4ZRMA 3HN7A 1XG5A 4UVDA 3ZWOA 3WOHA 4ALJA 1SCUA 4XKJA 3QVSA 1XA0A 3WGTA 2P9CA 3D5QA 4GQAA 1HDRA 4UUNA 3CH6A 4HXYA 3MJTA 4L73A 4CUZA 3VTZA 5F5NA 1HETA 3RUHA 3NAQA 1H5QA 1W6UA 1L7DA 3DDNA 4OSPA 5C7LO 4OXKA 5B1YA 3FR7A 2QW8A 1NPYA 2DTDA 1MGOA 3KSUA 3FPLA 2VZ0A 4PZEA 4DLBA 4F6CA 2OXIA 1WDLA 2WSBA 4ALNA 4OQZA 1ISFA 1UZLA 5K0ZA 4XB1A 1B26A 3ZV5A 1ADGA 4E5NA 3UUWA 4OXNA 1NX6A 5A9TA 4XJSA 4FIZA 3I9OA 4JGBA 2VWHA 4DPLA 2NV6A 2ZCVA 3QQPA 3WYBA 1I01A 2IRWA 3HDHA 3OJOA 1X15A 3ADPA 1LSUA 5H83A 3GFGA 4TRNA 4LMRA 1PGOA 4L9RA 5G0TA 4JROA 4EJMA 3WBFA 4AJIA 1E6EA 2X9NA 3PVZA 4IJKA 4Z3KA 1NVGA 5KKAA 1JN0A 1UXHA 2I3GA 4BO5A 3T7EA 4BKUA 4B7XA 3BTUA 1U3TA 3WDSA 1ZKMA 2CF6A 1R4MB 3ZN2A 2HCTA 1HYEA 3N7UA 2VZ9A 4AFNA 3EDMA 5IZ4A 1AHIA 5T57A 2XPCA 3GY0A 3H3JA 4FCCA 3TWOA 4YJHB 1H0KA 1ZMOA 4WGGA 1R37A 6LDHA 1LJ8A 1IULA 4FFOA 5TGDA 1GZ4A 2O3RA 2J3IA 3TPCA 3M2TA 2BELA 2ZCUA 1QP8A 5DCYA 2IODA 1PZEA 2ZYGA 4WLFA 4DTIA 5C3MA 1PJCA 2CF5A 4JQCA 1SOWA 3D4PA 1JAYA 3OFSA 1HSZA 2H5LA 4OMUA 4XQCA 5A3VA 4MIOA 5EN4A 4OIMA 3TL3A 5L53A 1J5PA 4HFMA 4IPTA 1VRWA 3BTSA 1PJLA 2X4GA 4FBGA 4FFLA 4G5HA 4ZJUA 1Y5RA 4M8SA 3QE3A 1X14A 1KY4A 2W8ZA 4WLEA 4RVFA 1OFGA 3HN2A 4OAQA 2NTNA 2OOSA 1LUAA 3VAZA 2V6FA 2JCXA 3JQ9A 2WYUA 1LTHR 3OBBA 2D2IA 4W4TA 4B3HA 2OFPA 2Y66A 1HWYA 3NJ4A 3RKUA 3INGA 3STHA 3INTA 3LLVA 4JJIA 2O2SA 2GSDA 4MVJG 1RJWA 1TLTA 1BXKA 4YCAA 4CMGA 3KRTA 3R3JA 4JP3A 3HDYA 1FXSA 4NJOA 4ALMA 3MJVA 3WGHA 5KKCA 3HFGA 2I6TA 3RCBA 4JCOA 1EFLA 1HL3A 4KWHA 1T1SA 2FZWA 5A05A 5JDCC 1QLJA 1NFFA 1VL6A 4J4HA 2UV8A 3GLQA 3E8XA 1G1AA 2D3TA 3CZRA 3I6IA 5IDYA 2WMDA 4IBOA 4ND2A 4K28A 1X0XA 2CVOA 2JD1A 3Q9UA 2AEFA 4JXKA 4D45A 1H2HA 4CM5A 1KS9A 1P1FA 4K6CA 1PWXA 2V6BA 2ZK7A 2X22A 4GVXA 1IHYA 3FN4A 2HRZA 4L0QA 3DHNA 3ZHZA 1AXGA 1BXGA 1DAPA 2WEKA 3HADA 3IKVA 3B1JA 5K6AC 3H65A 3EYWA 3RU7A 5CEJA 3IKTA 3EAGA 4XGNA 3JQ7B 1QMGA 2PZMA 2Y67A 1JWAB 1B14A 5DOVA 4OKIA 5H82A 1LDEA 4XDYA 4CMJA 5EINA 4F3YA 3PZBA 4FFRA 5L3ZA 1QRRA 2BGLA 3WQQA 2XXJA 2PTGA 1N9GA 2EHDA 3K9QO 3WGYA 2YJZA 4QT0A 2O23A 5EPOA 2Y05A 4M87A 4NU6A 3D4OA 4FR5A 4CLEA 5TT0A 4RLSA 3F5QA 3C24A 4YWJA 5BNIA 1U2DA 3AY6A 4EJ0A 3U3XA 4D79A 4LRTB 5ENDA 3U9LA 3IL2A 3LQFA 2YHIA 3L4BA 3HJAA 1E5QA 4WNCA 4EEZA 5KVCA 3FWNA 3EMKA 2QHXA 3KLMX 4I1IA 3GPIA 3AJRA 3B20A 4D0RA 2EERA 1HE3A 4D41A 3SC4A 5B4TA 4AJNA 3K73O 4Y8VA 4NPCA 3JQ8B 1LXCA 5TNXA 2I66A 3QIVA 3WTBA 1HZJA 4L8VA 4CLRA 2DFDA 1PU2A 3DR3A 1ISGA 4BO0A 3WJ7A 5FFFA 4E12A 4GI2A 1J4AA 4P4GA 1H9BA 4EW6A 1HSOA 2VHYA 4YACA 4GX5A 4WLUA 3UW3A 4RZIA 4BQPA 5BSFA 4R1NA 4BQRA 1E3LA 1GCOA 1PQUA 2P9EA 3DEYX 4R9RA 2V7PA 4ZICA 1IOLA 1TT5A 4XZ3A 5L7TA 3JCZA 2X0RA 2H63A 4DLLA 1CJCA 1NFRA 1P77A 1HTBA 1OC4A 3S1LA 3SJ7A 3K2BA 3R1IA 1NFQA 3TZCA 1O95A 4MVJF 4TVBA 5I7SA 1LSOA 5JYEA 5LDHA 4HV4A 4YAGA 3DC2A 3H2ZA 4TZTA 5DT9A 5A9SA 3GNTA 1QYCA 4J4BA 5CHEA 1ZFNA 2V65A 4AJ1A 3GGOA 1N7GA 3HSKA 4RQTA 1EDOA 3ONDA 4EYEA 4RF3A 4CQLB 4D0SA 1BMDA 3AU9A 4WE3A 1B3BA 1SOVA 2Q2WA 4Y6SA 1GQQA 1I36A 2IXAA 3ICCA 1I2BA 3B6ZA 2VWPA
chains in the Genus database with same CATH superfamily
2Q5IA 3FTPA 3L43A 5U4QA 1OXBB 1UKEA 2YQZA 1RM5A 5FTWA 1CWUA 4P7JA 4LZOA 2IS6A 3KDAA 3IAHA 4AP9A 4WAUA 3FZYA 4OQXA 4XFDA 4DR2B 1RAFA 3O31A 4JLBA 4FNMA 3CQ9A 4TVKA 4G4SO 2AA3A 4GEKA 1EVIA 4X41A 2V97A 4OL9A 5ALIA 2DUNA 4B4WA 4PSUA 4B3JA 3KB6A 2BEWA 4G8DA 3R7NA 4L5YA 5FT9A 1KDYA 1J06A 5JPDA 3EFBA 2AWOA 2GLTA 1HKUA 4JI3B 4EB6B 5HE8A 4EUFA 2VDNB 4BVKA 4NWIA 5ABPA 3W3ZB 1W5EA 3TKAA 4NMXB 4WLOA 4F4HA 2NV0A 2QMHA 3GLRA 4FHGA 3TFQA 1ZBQA 1GQYA 1K1EA 3L1UA 3ML1A 1WL8A 4YS6A 3ZG6A 2IE0A 3T7TA 4HLQB 4B2PA 3ZHRA 4NMMA 3WP1B 2IYYA 3F1KA 1E77A 2B5OA 3O1HB 5ENVA 1MZVA 5ELMA 3VSDA 1KZ6A 5DBFA 1TLFA 1AE1A 1JALA 1YE5A 4FE7A 1EUYA 1OBVA 2WUVA 2C5FA 4QASA 1U3FA 2AG0A 3B5EA 3FE2A 2JW5A 3DTYA 3G5UA 4ISBA 4PPGA 1Z8HA 4U7HA 1TUEA 2Q5JA 3S3TA 3R7WB 1H94A 3KXLA 1DBVO 1OKKD 2O4CA 3PGLA 3QVVA 1E3WA 3QUSA 4FWIB 4LCJA 3RBVA 4N3BA 2G6BA 2CL6X 1QH1B 4NLLA 3THXA 3QELB 4I50A 2B1IA 5FA6A 3BCUA 2IYQA 3JY6A 3QUCA 2WWRA 1PNOA 1T2AA 4TTSA 5FHQA 5HS6A 1DINA 5KQSA 1X8KA 5LVAA 2FUCA 4G5QA 1VSVA 1XZCA 2ZYWX 4CM8B 4P3YA 1Q44A 1VHQA 1Q84A 3RFCA 4J2HA 1XDDA 3CE6A 3TEMA 5D3KA 3V1MA 4C14A 4UHJA 4CETA 1TKCA 1VYUA 2B61A 3L2OB 5FR2A 1K2WA 3WMRA 3LP5A 4YAKA 5C3UA 2VKQA 2J4FA 4DANA 1U63A 4UHBA 4MPJA 1FMCA 2XGOA 2QVZX 2QRZA 3K09C 5CH3A 3U4QB 1EAMA 1NYLA 5TQ0B 1A9QA 3THWA 4LFCB 4HNHA 2HXSA 3RI3A 3ZVMA 4KO2S 3U0BA 3VRHA 3HABA 2EIXA 1DAOA 1GR0A 4EYKA 4PC3A 5M5BA 1PHPA 1YONA 1REQA 3ZR4B 3GEGA 2R62A 2VP6A 1IXSB 1UM8A 1YHZA 1P44A 1KFJB 2NX2A 2VK1A 2ZT5A 4FSXA 4PSVA 3O8LA 1T2NA 4YDQA 1OX6A 1SUEA 3PWZA 4NU0A 3EZ9A 3Q0EA 2OO5A 2JIQA 3AUUA 4JT4A 2JGNA 4Y2UA 1EVYA 3GFOA 3UWPA 3GLIB 4JKOA 2EW1A 4Q37A 5ALYA 1NVEA 3W04A 1RLJA 1T29A 4RTNA 1M0WA 2EC5A 2Y68A 1QS0B 5IC5A 1DAIA 4TMKA 4MUBA 7YASA 1KFBB 4L16A 1XIVA 2ATVA 4ZXFA 2H4WA 1UJBA 4AKGA 1BJKA 3T5BA 1MBZA 3I39X 3NIDB 1TGVA 3N7TA 5ALNA 2Q0SA 1JQBA 1WXIA 3ZNPA 5F9HA 5L7YA 1VIVA 2DZDA 4TL9A 3WSWA 1IXYA 3HUTA 1LPOA 2JL1A 4WY2A 2C84A 1P19A 2FZKA 2XUKA 4IDQA 4BVAA 2P6RA 2H2WA 1Q11A 5DHPA 1CJTC 1K4MA 1E3IA 1U8YA 3BK2A 3KNZA 3NASA 4Y9UA 2E4UA 4CM9D 1Y82A 5HDQA 4UTVA 2H4FA 1N5RA 2X6RA 3C3BA 3EIOA 4PYIA 4EHHA 4OQ4A 3TTWA 4D5EA 2AEMA 3NGLA 3MM4A 2P5YA 3RSLA 2FDCA 1DKOA 4PIMA 2I2CA 2VFAA 1LWOA 1VG9B 3MVEA 2OXFA 1WVMA 3QU4A 5EKDA 3UH0A 2UYHA 5IYZF 3ZJYA 5FI3A 4UNSA 3N75A 4W5JA 4ZC8A 1YH3A 5MF6A 4XFKA 1ZSNA 4I4CA 5ICGA 5JSFA 1A2KC 1LDNA 1R6AA 2JHCA 1KZ4A 3OCZA 4KE9A 3ZIAA 4OYLA 1X86B 3ADBA 3Q41A 2P7HA 2F2TA 1SQ5A 5I9BA 4BXOB 2FWNA 3VUFA 1JFVA 4OQMA 4GX1A 1GGEA 1JXQA 3ESZA 4BEWA 4YHHB 1PFKA 3R7AA 2J0SA 3K6JA 4IIFA 1XVLA 2W2KA 1AGNA 1E20A 4RA9B 4UKDA 4V0OA 4YASA 4Z9YA 2ASVA 1BXGB 1R0XA 2H11A 4LJ8A 3AY0A 1U7PA 2VHCA 3CNLA 1PQPA 1QH8A 2JLAA 3KPVA 1FDRA 1WWKA 3R7FA 3K5PA 1XD2B 2CLIB 4MI6A 3SLKA 4L28A 2ZJ2A 2K4MA 1CDZA 4M88A 1S2GA 2IUEA 2VI5A 2ZB4A 4N1AA 2N1BA 3CPHA 1VL0A 3ZIAD 5G4LA 1UC4B 3K0BA 3QUTA 4QNRA 1HO3A 2RC5A 3JALB 1MHPA 5E4JA 3AQIA 3W9YA 3EH1A 4WH0A 1VIYA 3CV3A 5L45A 3B3AA 2A8YA 4N8EA 1D1QA 4ADSG 1XTVA 1R0WA 1F17A 1RC1A 4J8PA 3WGZA 2ZGVA 2Y9PB 3WMGA 1PKEA 2IXTA 2Q0XA 5F1PA 3EXEA 4O59O 2IUUA 5GMOA 3QXSA 1X1DA 4CN8A 2YV5A 5IZCC 5AVZA 1ECLA 5AO9A 4A0RA 4ALKA 2GERA 2GXAA 2PMBA 1JDSA 3QWBA 5DX1A 4DLZA 2AK3A 1Z4JA 4BNYA 2BHNA 1B6TA 2I1QA 3LW7A 5C80A 1ZH4A 1ZGCA 4JBWA 4QXMA 4JV5B 3QE0A 1V3UA 4BNWA 4GMFA 1Z12A 2O2JA 4FZRA 5SY4A 3UCXA 3UMBA 1R15A 5HS4A 2G8LA 1WMAA 3PITA 3QNUA 2HO4A 4RHYA 1TCVA 3DMYA 4FYYA 3KWFA 3LY9A 3ZDFA 3IAFA 2GJKA 3MGCA 1XQXA 3M6WA 5T4BA 1DJLA 2XNJA 2BKXA 3B13B 1P7VA 4NYMR 2YZGA 1IU9A 5JCOC 5JNLA 3DV9A 1YRHA 2JFHA 2LCQA 5TPZD 1KEEA 1E6KA 2GKSA 2WF7A 3UTDA 3PGA1 3LUJA 3ZKWA 1P18A 3F6RA 1CDEA 4XD2A 2RHDA 1OPRA 3WWPA 2WM2A 3TJMA 2HK9A 3HVHA 3LX6A 4OH1A 3WX0A 4E14A 2I8CA 2XUGA 5K2MA 1SC1A 3ILXA 1PE0A 2O8CA 3HWRA 2NYVA 1Y5MA 4CMHA 2EWWA 1M1YA 2I6FA 1F20A 1W25A 2LIVA 4JLJA 4NIMA 1GU7A 1LU9A 4KSBA 4CKZA 2V1XA 5HJEA 3U3JA 1GQSA 2IFTA 2YV3A 3T5PA 4M8LA 3AL2A 1EE9A 4LMPA 5G4KA 1KZHA 4HATA 2AOTA 4PPQA 4FOOA 3EYAA 3VDNB 5J43A 3I6ZA 5EOVA 2REXB 4TWRA 1BW9B 4AP6A 3U9SA 4P4SA 4J0CA 4C87A 2VSOA 1J09A 1X1EA 2AUMA 4GI3A 4LF4B 2R86A 4G01B 1YR2A 1ZBDA 2XMSA 4TSFA 3R0JA 1FTQA 3RLIA 3V7UA 4BFUA 5EIEA 1JZSA 5F98A 2NACA 3WR5A 1UBCA 1CY8A 2COKA 3R7BA 1RWXA 4U6NA 1WU8A 5FI1B 4ZV9A 3JZAA 1TO6A 3FBTA 3TLZA 1VDMA 4PX3A 4BP3A 2BFCB 4CG3A 4Y6LA 4MTCA 2FEOA 3DD5A 5EVJA 5J2UA 1K3TA 3IUJA 3KL2A 3L02A 1SJ9A 2XCRB 4B40A 1TA9A 3T9FA 3H1BA 5C31A 2RH9B 3WWDA 3WRXA 1OLUA 4QU0A 1EB8A 3AJ8A 4EYQA 5A4AA 1X87A 3AZPA 2TMGA 1G41A 1OCEA 2WINI 4YAEA 2UZ4A 2VPZA 4F3KA 4ML3A 3ZDDA 4L8LA 1R6VA 3WNVA 4XPZA 4JC4A 1W5BA 4PNPA 4QARA 1QUFA 2XE4A 3ADKA 1D9XA 4JZYA 1E0AA 3GX1A 2A1TS 5DCWA 3MUEA 4HVCA 2GPSA 1PFYA 2Q1WA 3FI0A 1NQOA 1IRIA 1DX9A 1N1DA 4R41A 3ESQA 4TMXA 2ZIVB 1Z2OX 2WTUA 1K6EA 4BPBA 3O90A 3M6IA 3ABSB 1KAQA 4MGEA 5EZ5A 3RS4A 2NZ8A 5HFNA 3AVYA 1UMDA 1ULZA 1Y6GA 3HACA 4L9SA 4IJ5A 3E2IA 1PVDA 4X9XA 5DN9A 4NE2A 4AYXA 1XQYA 5KC8A 4JQSA 1GJRA 4HUQB 3FF1A 3U37A 3DL0A 2XCTB 2Y1LA 2AN1A 2CUNA 3GFBA 4UHCA 3FIUA 2IHUA 2JCSA 2WWFA 2X0IA 4OJNA 1ND6A 4NZPA 4OXIA 4E70A 5F2NA 4E5DA 1I7QB 1HDIA 3PR2B 1DRUA 7REQA 1Q0SA 1VI2A 5EJEA 3UBTA 1NNEA 1VSUA 3NNDA 3PDJA 1OROA 2P11A 3ONVA 5FFNA 1E63A 5CH8A 1K86A 4Q05A 2J7PA 1NJ2A 1Z7YA 3IESA 3IQGX 3O0TA 4WZBB 1N9KA 2QW1A 1G42A 1N0HA 3LQ1A 2CHVA 4UJ3A 5K09A 4ZQCB 1SMKA 1O9HA 3QPWA 2VH5R 1GTVA 4PTYA 1Z25A 5J1TB 1A72A 2OC9A 3IE2A 2XXBA 5BVGB 3X43A 2R0QC 1T9HA 1ENPA 2BUCA 4HYEA 2HW8A 2NAFA 1IN1A 2A4KA 3UNXA 4WBNF 1L4LA 4ESVA 1B8UA 4ND4A 4Y6OA 5B7QA 1I9CA 5K3BA 1W1UA 1R0KA 1HXHA 4OYYA 4QWWA 3TIGA 4JI8B 4RLHA 3DOEA 4DIMA 2XMPA 4Q9IA 3DXZA 2LDXA 4BLUA 2WYOA 4PHFA 5CA0A 1G8SA 3VHRA 2IHTA 2DHQA 5DHQA 3CX8A 4K6FA 2YJ4A 2FPKA 1F38A 1WHSA 3VHXB 4BDSA 4Q3KA 8GPBA 3F4LA 1TTTA 5LBUA 5EJ6A 3DLAA 3FMVA 4YQFA 1S6YA 1Q1AA 2ZIWB 3FUXA 1T5SA 1ZYUA 3JD0A 4IOMA 4AZ0A 3ZEAA 2CHEA 4UW9A 5TIIA 2A2ZA 3MXOA 5E95A 3JYQA 3P9IA 1B0AA 4HN4B 3SIPA 3VJRA 1OLSA 2FG7C 2OBYA 3TE6A 3OZVA 4MGHA 5KTSA 1JZQA 2CKMA 4N3GA 4RTRA 3UCFA 4HS9A 4URVR 3I2KA 5JECA 1M5RA 1RXWA 5IYZB 3CBGA 2EKZA 1EUQA 4B7CA 3HBLA 4HFRA 2X41A 2WD8A 3MB8A 2G72A 1ZK2A 2VYND 5HQ3B 1AGRA 2Z08A 4UEQA 3VDXA 5LKRA 2R6ZA 4PGMA 5ALSA 4ALIA 4PS1A 1GTJ1 3EODA 3SSOA 1G3MA 5ALQA 4F5WA 1F7UA 5K0BA 3GRRA 2FMUA 4NL4H 2W2LD 3S2FA 1EFHA 3ZI4A 4CGZA 2YVLA 1YDHA 4WIAA 2CVHA 1SBNE 1JPNA 2F7SA 4X1IA 2W6JD 5EI5A 1T9DA 2OR3A 3PFNA 3OF2A 4EATA 4MB2A 3G9UA 3VR5D 5JZMA 3AIIA 4D99A 4CIBA 4LDJA 4ND1A 2EGHA 2IY7A 2QEQA 3KSDO 3NIBA 3O6VA 1PFUA 1G7RA 4UQOA 5HFAA 1FX1A 1Q1QA 2JAOA 2Z2YA 3HO6A 1BS2A 4RA6B 2WA1A 4NRDA 4U7TB 3WP0A 2C03A 1BE8A 1GGVA 5BNZA 2O50A 2WJIA 4AWXA 5JNRA 4CU2A 4EGSA 1PNVA 1IC6A 2NSDA 2FWRA 2RH5A 4ZEWA 4W5HA 3TW6A 1QM5A 3OIYA 1E3EA 2BUBA 2HRQA 1AN9A 3ZNQA 2VPWA 3EQZA 3GP3A 2JH9A 4GDMA 1F3OA 1HORA 4BHTA 2XX3A 1NQAO 3WIDA 2AK2A 2CXXA 3D8BA 4KO4S 2V8BA 2GF2A 2C8JA 5L53A 5IUJC 2G82A 1XTRA 1W36C 1EXMA 4LHVA 1JVNA 1DC3A 3SC6A 2ODWA 3SSNA 3GVIA 3GGDA 5JZBA 1Q7BA 2CEKA 1X77A 2V7GA 1U0JA 1KYWA 3EDCA 1RLMA 1PL6A 2PR7A 3WGJA 3DDCA 1KTVA 1IJBA 3ZCTA 2F8SA 1BEZA 2HJVA 2HZBA 1YZYA 2OO5C 3ENVA 4EB6A 3UAGA 3ZE7A 3G1UA 3MT7A 4DLSA 3SQWA 4WHMA 1IUKA 1T3HA 3IUQA 2PGDA 1O77A 2XUQA 3IHWA 4Y9DA 3LBFA 4MGIR 3NT2A 3ORFA 2ABWA 1A9SA 2OQ2A 1FTYA 4OLFA 5CMLA 2PUFA 5F5LA 2CNWA 1JBEA 3JQAD 4UEJA 4LSZA 2JFGA 2V8OA 4WNIA 3R9IA 3W3AA 4H3HB 3QGMA 2VXCA 3U3OA 3URKA 4KOEC 5BNTA 3IL2A 5IJWA 4NOJA 5JC8A 3RF6A 4PG8A 3D8RA 3LZCA 3MCTA 1ODIA 4L76A 2X8BA 3PGJA 2DPHA 1AQLA 2EJVA 3IOCA 2GGSA 3OMXA 3QMWA 3TBHA 3VVMA 1BQ3A 4ABYA 4PRLA 4QQ8A 3FNIA 4G0MA 3FZQA 4DUZB 3CUEF 4P4SB 1HOTA 4PLVA 4NZ9A 2B4RO 1NVBA 1KFCB 1FQKA 5H5JA 2NYRA 1TCCA 3DWGA 1DSSG 2GCEA 2H92A 7MDHA 1BRMA 1XA3A 3MERA 5IAEA 3NHFA 5DGDA 2ZJFA 4CEJA 1NHWA 1XHEA 3JQAA 1E7YA 1EDZA 1X0VA 1Q20A 1XTBA 2HEGA 4FYKA 2P69A 3V8PA 5GJVC 4QXOA 1GL9B 3FBGA 5B7PA 5IS2A 4Z3DA 4RABA 2HCJB 1JBQA 5LBIA 5JCPA 4W9MC 3BEOA 3FFTA 2BM1A 1JG1A 3HCRA 3NHKA 4GI5A 3M2PA 3WY9A 3UHAA 2LNDA 3L5OA 3OQBA 3AR4A 1XRLA 2PE5A 4LMBA 3X1ZA 1XJCA 2BCJQ 1A9ZA 3FZNA 2QAGA 3OM0A 3P2EA 5E7JA 2FP4A 1OAOC 2VK8A 3RJTA 3U4DA 1SUSA 1U81A 2FPMA 1JFFA 2RGDA 4ID3A 2QV0A 3A9RA 1MH9A 5DNEA 4DQDA 3WYDA 1IBSA 5C32A 1ZU5A 3PQFA 4U2FA 2R84A 1TZCA 4KN6A 2BP7A 3CLRC 3WLOA 5SY6A 4EH1A 3GMSA 3VVLA 4P4UA 4WZBA 2GA9A 5KYGA 1TJ4A 2Q3CA 3GAZA 3RK0A 3R6WA 1U8EA 1S8NA 4NJEB 1R8QA 4B6OA 4M37A 3GGGA 4C06A 4EPVA 2WSIA 1L5NA 4EJSC 4QM6A 3IELA 2GUGA 2YHBA 1XAHA 2GFQA 4GP9A 1F9EA 3RYTC 1YF3A 4DJAA 4S1OA 3IYLW 1T15A 1MR3F 1U0OC 2X5JO 5H80A 3SPXA 2VEDA 2ODPA 2RK3A 4CR6A 1LFDB 5IM4F 1MA0A 2VP4A 4GH5A 4ICIA 3DL4A 3I9MA 4TLAA 3CUYA 4B5LA 4YT2A 2OV3A 3Q1KA 1X38A 4HTFA 4G26A 2V5UA 1MABA 3HYRA 1JIQA 2XZDA 5AW5A 1DC8A 1RWBA 2Y77A 2OPBA 1M1YE 4RL6A 2DJ5A 1ZH8A 4J76A 1LQUA 2OLKA 5DFAA 3AHEA 5FORA 4EX7A 1AK1A 3HE3A 1U2DC 4ZYUA 5A4KA 1U7OA 1I0IA 2ODQA 1LS6A 2MDTA 4H35A 2IYUA 4Q7LA 4XLZA 5EMHA 4WJLA 4YV0A 2DG2A 1P72A 4KR9A 3LQRA 4PM4A 3TR6A 1TMYA 1KEPA 3FPEA 5TDHA 2W5UA 1UEIA 4DJEC 5CLJA 4YCNA 3RU9A 3BA1A 4I5EA 4RS4A 1KSHA 3LWZA 4CQMD 4QJ5A 2ZAYA 3ZD9A 1JEQB 1Y3HA 4BMXA 1RYFA 3EB9A 2NXWA 3OVMA 1DCFA 4EHKA 1F4VA 1RWQA 4PEVA 3U1VA 1I0ZA 3LDGA 4KIGA 4FYVA 2P0YA 2QTFA 3TDMA 2CJWB 5EXSA 1HEYA 3PNYA 4TYMA 2IW3A 3T1TA 4C29A 3TS1A 5JQGB 4WEQA 4D56A 1KZ9A 4AG3A 1LW6E 1PR9A 1P3Y1 2GZDA 1ZIOA 3GOHA 1GUZA 2EBWA 3F8TA 3LOQA 1ZUWA 3EWNA 2BJVA 2FQYA 3F67A 4HBGA 4QBFA 4XR4A 4JSTA 1U3VA 3ID6C 5J2TF 2BR4A 3RM3A 3DMHA 4DIDA 4BP1A 4KQKA 1Q74A 3MJDA 1QBKC 3O82A 3C8UA 1A5ZA 1MENA 1ZN8A 2WHPB 3PDWA 1J99A 5CM9C 4Q4AB 2XLBA 2IX9A 3K1YA 4B8YA 4BAZA 1XEWY 2AC4A 2HMWA 3FF4A 3O91A 3PNMA 3DFUA 5J9FA 3TR0A 5FH9A 3HN6A 3SBOA 1SVKA 2NPFA 5DK6A 2D0IA 5JSZB 3ICVA 2CUTA 1YA6A 4FIDA 3H9QA 5ICCA 4XUCA 3RB8A 2O3QA 4V39A 2ZE8A 2EZUA 1W4LA 4ERXA 4K5QA 1KQNA 1WEHA 3D1VA 2CWDA 4O4IB 1B43A 1MC4A 3ZJ5A 4CT4B 4EECA 1CU1A 1ESCA 1XTJA 3ZKWB 1A95A 1E0KA 1L6RA 1N5MA 1QBGA 1BEEA 1ODJA 1QS0A 2FZ5A 3A25A 1ESEA 2H2DA 5ER9A 3IT3A 4KN5A 5G3YA 3ABOB 1YS9A 3FYUC 2LE0A 3S7TA 4BFTA 4Z53A 1P0FA 1F0YA 5DULA 3T3GA 1J33A 3FRHA 4J3JA 2ZS8A 1KGSA 3N2LA 5ICFA 2EGUA 2XZTA 4DDUA 2QX4A 2ZIUB 3B1XA 3DOHA 2ZRLA 1GPDG 4Q21A 5SYNA 4RXMA 1I7PA 4BBPA 2IDZA 4CM1A 4H1WA 2NZWA 2QX8A 1J1IA 2UZIR 2WZBA 3JW8A 3MBKA 1JFLA 4LY9A 1QVVA 3D81A 3S2YA 2CV1A 4HGQA 3H5IA 4N0QA 5HA5A 1R00A 2ZS9A 2VYQA 2VF7A 1NURA 1MB9A 1UUFA 3C16C 3ZTTA 5DW3A 5F4BA 1FPMA 2RHHA 3DC7A 4R5MA 1K92A 1T2EA 4ZOAA 2Y0PA 3E4DA 4EPYA 2JAUA 1XZIA 3EZXA 5EWLA 1QSGA 3IAUA 5ITVA 1P39A 5K6AA 3O3NB 1JYFA 1IB0A 3K15A 4HDQB 1QO0D 4I8IA 4IEIA 4M0LA 4ZOBA 3TW4A 3A70A 4R3UC 2O0JA 5TGTA 2QT9A 3B6IA 4YRIA 4TV8A 4NZMA 3ZBQA 2AE1A 3ZWPA 3RAEC 4C7KA 3C8ZA 4P3XA 3X1XA 1AQYA 4OSOA 2IWRA 4KGVA 4Z6KA 3RVQA 3OIFA 1E3MA 2N0SA 3G2JA 4DA9A 4Y2YA 1KI4A 4JU8A 4BLTA 1QJCA 4FWTA 2FR1A 3P2JA 1V7CA 1CX9B 1H2RS 2FEPA 4Z0TA 3O4GA 3RVDA 4AJEA 4YXFA 1HR0B 3QVWA 4GKBA 1Z37A 3M5WA 1MX1A 3ABIA 2YDYA 2HI0A 1TUBB 3JQFC 3V80A 5IKMA 2D8MA 4HNTA 3W2TA 3ABQB 3DPIA 3OUTA 4OYRA 2AZXA 2B9VA 3A6EA 3T5DA 5T6BA 4F6RA 1SCAA 2C77A 3E9RA 3KSAC 2FPGA 4PTLA 4WESA 2D7JA 1XNGA 3CMCO 2ORED 1HDOA 4E7OA 2EFJA 3ZDZB 3GUHA 3HC7A 5K6TA 4C05A 3KAJA 5DGIA 4FKZA 1DXYA 1B1CA 3RSQA 3AI2A 5IJXA 3N8IA 1NWHA 3TD2A 3UT5B 2Q21A 4IJQA 2XB9A 2KS6A 5EP3A 3TZEA 3OFVA 2EEPA 1QVRA 3TCXB 3V33A 4AMUA 5A4JA 5KVQA 3WGUA 4HQNA 3K6SA 4RK5A 2IOYA 4HH0A 4R05A 5CPFA 2G63A 3W34A 4O4HF 4LCBA 4G65A 3ELBA 1EBBA 3VSCA 4ZI7F 1AZWA 2B25A 5A5EA 2PBLA 5HKKD 1ZISA 4R9SA 5IWAB 8LDHA 1JT2A 1W88B 1CJKC 3F9CA 2AWNA 4EY8A 3AM5A 4QUDA 2QVXX 4XD7A 2FEMA 1RS0A 3FDFA 3D0QA 2FOIA 1KU6A 4E5PA 4O4IA 4ZT4A 5CB4B 1I6MA 1V8FA 5AUPB 1QCZA 1YRAA 3AGPA 3IR6A 1KEEB 3P0EA 2R9VA 4IIYA 1GOTA 3LO8A 5E2AA 3TM4A 2C3YA 1XC7A 4WVLA 2Q2OA 4ANFA 3O1JC 3RRZA 4QWMA 2J5RA 3PXCX 2RCYA 5A02A 1VGRA 2PT9A 2VTBA 4IGKA 1FE8A 4MLDA 4BV9A 4D80A 2J07A 3QYJA 1CUWA 2A5GA 3NZEA 3KBOA 5GP1A 4B6SA 3W9BA 4DMUB 4FFBB 5CFQA 2ZYDA 2W6OA 4MRRA 1F2VA 2NUPB 2GF0A 3AEQA 2X0EA 1FIUA 5B37A 2P9TA 1AMNA 3DUFB 1A5TA 2E2WA 4IIJB 4K1LA 3G8AA 3PG5A 4OG2A 3M0EA 2A94A 4G0WA 3UOGA 1WR8A 2ORIA 2FN3A 2QN6A 1M75A 2WSSA 2Z2JA 1GCAA 1E2EA 1XPUA 2WNIA 1ZJZA 1W94A 3S44A 2TS1A 5DNDA 1GEEA 3TXAA 1YBFA 4TZKA 3F73A 1YT5A 9LDBA 4RPLA 1XF1A 2QMZA 5FP0A 5IEBA 2DETA 3L6BA 1G20A 1P2UA 1SD2A 2FG6C 5JRDS 3GB9A 3E3AA 3II6X 4GL4A 4CCYB 4EY4A 2QN9A 5C5EA 1SA0B 4RTLA 1WZIA 5C51B 3LGAA 1KI1A 1PWEA 1T43A 2NO6A 4OHUA 2PZLA 1NLFA 1ZI6A 3COWA 3GG2A 3DEHA 4QAJA 4KLNA 2X9GA 3QF4B 3OH8A 1YRBA 3RU3A 2IYLD 4RV5A 4FJ1A 4YALA 3S6JA 3F6EX 3K5WA 4UMEA 4W1QA 3RKRA 3PUIA 1F0KA 1GYQA 3AR9A 3ZWCA 5TS3A 3G9TA 4PLHA 4ZPJA 1ULUA 2XUOA 3SS8A 1UEJA 3FAZA 1HE2A 1ORVA 1K5GA 4LIPD 4RGQA 3DT8A 1IN7A 4XVUA 5GJWC 3DL7A 3BRWA 3BH6A 3MTDA 4YV2A 2W9XA 4A2QA 1F6DA 1E64A 1UPUA 1KYZA 4V3BA 3Q6NA 4J6EA 3OETA 1VPEA 5LOVF 1PG2A 1Y1QA 2PJRA 3OZGA 4I2NA 2AR7A 1JDJA 1JW9B 1OT5A 5EUCA 3E58A 5FPYA 4EF4A 4JSRA 4PG6A 4ILKA 2CDNA 2O59A 2BFPA 2F1KA 4EO7A 5BV1A 3UIEA 2NTEA 3VPSA 3PHBE 1QO9A 3C3XA 1SXQA 4QDZA 1T1JA 2RE8A 2BM8A 1WETA 4PF1A 3QKSB 4XDHA 4JBHA 3I28A 2RJNA 4QYWA 1Y80A 1Z4IA 2HL6A 2X6QA 3K8ZA 4YRTA 5A4FS 3THYA 4BJHB 1A9XA 3IO3A 4PPFA 4XOUA 1XTUA 1MOZA 3ZNOA 1PCXA 1N2SA 4TGLA 4X66B 2B1QA 1JWBB 3OZTA 1G0OA 1MDBA 2GBPA 3CW9A 3FTCA 4X6LA 5BT9A 1RIFA 5CDSA 4IDEA 3EF0A 4YJHA 1D2AA 1MOPA 3K0EA 4ZQGA 2J9FB 1SKYE 3V3TA 3VKUA 3H6GA 2JHAA 2OOKA 1DJOA 1Y9JA 2ZFUA 3K9WA 1XZLA 1Y1PA 2HX1A 3PQ8A 3LE8A 2P4UA 4H3SA 1H5NA 2FMHA 4ZAFA 1KK3A 1J22A 4I6EA 4IVRA 3ZCSA 1O4VA 3TIVA 1HYQA 3DZGA 3O8OB 2OD2A 1WMFA 1RRFA 2C99A 3DO5A 5BSGA 5BSHA 3FMOB 1I13A 1UH5A 3OZCA 4QELA 1TZBA 1IAVA 3COJA 2OGWA 1Q2UA 4TSKA 5DM2A 3L40A 4FFDA 2C82A 1US8A 4G1BA 2C97A 4WY5A 3BYZA 2H4XA 4M99A 2BGNA 1N3IA 4FSDA 5AW1A 4ZTUB 1JR3A 3DLBA 3Q5DA 4MDHA 5LLDA 1NF3A 5EWJA 2QZ4A 5FA8A 1ZDMA 5BWLA 5I7OA 2XMCA 2XVZA 2G9ZA 3JARA 1XVVA 1QHNA 3DEZA 3NDRA 2YUTA 3C3YA 4H27A 4J0EA 2CFSA 4LHWA 5KAPA 3K16A 4F4IA 3EQ7A 5DYTA 3C74A 1IHUA 1QFZA 4CWAA 2WU4A 4I19A 3L7AA 1L7XA 3MS2A 3I2HA 2NZJA 3KHTA 4I9NA 3DQPA 3FB1A 1XZFA 2XMQA 1SUIA 1AS2A 1DEHA 1Q57A 4M22A 4N8SA 4Q4CA 2J67A 2JJ1A 5ALTA 2EARA 5GM2A 3R6GA 1VLHA 3LT5A 2JVIA 3B38A 3NYRA 3C5EA 1XQWA 3TM5A 1CP2A 1GITA 3I05A 3ZXSA 4BB6A 4LJSA 4E30A 2DHCA 3IOMA 5G0UA 4RJIA 1XDBA 2J8ZA 2GN6A 5JO9A 3R8CA 1NBEA 2W98A 3ILHA 3B9BA 2CB9A 3ND6A 3ZDQA 4KR2A 1JQDA 1TW3A 5D86A 1SIWA 1UODA 2CXRA 1BH6A 2CHUA 1SQFA 3IEIA 2GK4A 2R1TB 3PENA 4JJKA 1BDMA 1EAYA 3AVUA 1Z7BA 1SXGA 2ZJ7A 3KXKA 4OX9Y 1AHHA 1FLNA 2GD1O 2GPYA 3WLMA 2J9RA 4JYAB 4MS4A 1GM5A 1H0RA 5LPNA 1LK5A 3GJ8A 4ZHQA 1U7XA 4OM8A 4BUJA 4N8DA 4IH9A 4BO2A 2F43A 1IATA 1RM3A 3KJXA 1R5OA 4MKXA 4B8WA 3E7WA 4DA0A 1A88A 1L1RA 3QPVA 2RGEA 3SJAA 3CLSC 3I1JA 1P45A 3AZOA 3RYCB 3FLAA 4PBRA 3KC2A 1A4XA 1XXLA 4H7JA 5GV7A 1QE5A 4D9BA 3D6TB 3FNGA 3GA5A 2ZYVX 1BX0A 1NXSA 4GOJA 8OHMA 4F21A 1K0FA 1AOXA 1JQ3A 1TJ5A 4EARA 5AM3A 1E5XA 4CKCA 3AY7A 1H4VB 1Y5IA 4TLDA 3SLRA 3T5CA 3D6HA 3KZKA 3I5XA 5LN1A 2ILVA 3EVGA 3KQQA 2PQ2A 2XH8A 3CC8A 1SXJB 1Y8QB 3GPBA 3N58A 4YJGB 4JIGA 4ZEMA 5KYWA 2O8VA 3LDUA 3I5UA 1C4KA 1FPQA 4C4AA 1XPRA 1V35A 4QFMA 1I80A 4LXUA 3EC7A 4UUBA 5CGZA 3TNDA 1MQ9A 1G21B 2XV1A 3SY8A 1DZIA 4NCBA 2J48A 1R16A 1TFRA 5IP5A 4HX2A 1F6WA 3E7XA 3WYAA 1YJQA 3ESRA 4YO7A 4CNBA 5L40A 2ZSAA 2ZUFA 2O0KA 3BF8A 4XJTA 1ILWA 1S02A 4US1R 1J1ZA 4LXYA 2EGGA 5A7FA 3L6DA 2GVZC 4DYHA 1NMSA 3K35A 2PL5A 4WKCA 5E6SA 4JJGA 3LRPA 1GCUA 1ZL2A 5DSZA 1ZVVA 4ARIA 5JTUA 3NP9A 1ONNA 1E7RA 4URFA 4ZV4A 4K2HA 1T9AA 2B4AA 2VTVA 4XAQA 1L0BA 3OFKA 4I14A 3EWIA 4LRUA 4MGKR 3QKRA 4DDMA 3FOBA 3WHPA 1T9BA 4J1SA 3WLKX 1ZNZA 3T3EA 2DH6A 3CEHA 3W3AD 4JOQA 4DWOA 1M34A 1SU4A 2PCJA 2BEVA 2L19A 2QK4A 2REQB 2VDVE 1GIAA 4G0QA 4RX1A 1IXZA 2FSVC 4BTEA 2H06A 2JVKA 1NUAA 1A7UA 3P27A 5AKLA 1ZIYA 3TBKA 2HLHA 5HGXA 3N2GB 1RE1A 1DLJA 1SVIA 3BQMB 4XCVA 5D3MB 3D7LA 3TK1A 3ZBUA 4E13A 4CLXA 4P4TA 3BTOA 1JIVA 1QRTA 2W22A 1QDUA 4AYTA 3A9SA 2NU7B 3QZUA 5C8YF 4N9QA 2I34A 3OQ6A 2FGKA 1TU4A 3BHMA 4Y1RA 4A03A 1FP4B 4DY6A 3JD3A 1ZJWA 5TVGA 1SUCA 2OB2A 2RC6A 3K0HA 3QU5A 2BFEB 4MWTA 3NALA 3RRYA 3U3ZA 3ZK9A 5JWOA 5KMGA 3CHYA 3OCWA 3G2LA 5B7NA 3QYPA 4FDTA 1ATIA 2AYZA 2IEYA 1BA2A 2UUOA 3JVEA 3M6LA 4NBRA 3KR1A 5TF4A 4CI0B 3VHQA 4QPJC 2A9OA 3A9TA 5JEDA 3AETB 4NYJR 3DFKA 3E5HA 3FRJA 4DM7A 2JVJA 1EXDA 4E2FA 3ABRB 3IMFA 3WRVA 4AS2A 1IL0A 4G2NA 3JQBA 4IZOA 1GQRA 1NAIA 2EKDA 2PXAA 3FPAA 1N9GB 1RPJA 5F33A 4CHGA 5KJ1A 2DCMA 4BL5A 1SZPA 1WTAA 2Y2UA 2VYVD 3SMQA 4V2IA 2AKEA 2H29A 3F3KA 4MDEA 1JAZA 1YDGA 5T67A 4Y1GA 3FGOA 1CB7A 4O25A 4IIJA 3VTAA 2XTZA 3T06B 3VO2A 4AUNA 4GMKA 5L3QB 4CMEC 1TYDE 2VT6A 3PHCA 3LP6A 4MXDA 2R8EA 3RYCA 1YIOA 3DZKA 2YMQA 4QGGA 2GDJA 4RMHA 1P5HA 2IIBA 1OI4A 2FOLA 1QYWA 2G04A 3P52A 4FYWA 4WBSA 4Y7CA 2AG1A 2C00A 2D1SA 3CR8A 4PZCA 4R8KA 4EB3A 1GDDA 4MQBA 3U60B 1P1CA 4I99A 1I8TA 2O9JA 4ZMBA 1BCSB 3U1TA 2CMHA 3TLGB 1QH0A 1B8VA 4EG3A 2CL5A 3C3AA 2FUEA 3A6KA 1J0DA 4C01A 1UBKS 2BGJA 1LBHA 2ZUSA 1NM5C 3A10A 1TKRA 4NOKA 2IP1A 4C07A 4ENRA 3F7NA 3HZRA 2OCKA 1VMDA 4BX9A 4D0LB 4M46A 4J0HA 1YHYA 1ZCFA 3AWIA 3N53A 3P8ZA 2CMFA 3HB0A 1OI3A 2PKYX 3K8OE 4WA8A 1VPWA 3TCNA 1OZHA 4C6TA 1THMA 2P77A 5I8PA 2WU8A 3PUWA 2I9KA 3PUYA 1J9GA 2VPPA 5G4KB 4E1VA 3KR9A 1A7AA 3O8QB 2O57A 1CC1S 2YJ3A 1L4YA 3Q8MA 3F3MA 4X60A 4LC9A 3TRDA 5D6OA 3LT1A 2Q5QA 4NYMQ 4B3GA 3CXUA 3GDWA 1HI9A 4INJA 4KDEA 4JEIA 2XKBA 3Q85A 3BL8A 1AKVA 4HNGA 5DW0A 2IYSA 1Z5ZA 1G4AE 2C9ZA 1CEEA 1P91A 2J6BA 2LIPA 3V2HA 3VU3A 1KEKA 1RPNA 2V3VA 4X63A 1QOPB 2Q0QA 2HK8A 1NF9A 3EEYA 4M9UA 1AO0A 2ZWAA 3GJTA 5HMMA 3OTHA 1XKTA 3T12A 3WE7A 1C9EA 4J9UE 4B4VA 3T3IA 4BKOA 4F46A 3QBEA 2X8AA 4MUXA 2M32A 4UREA 1YQWA 1PR1A 4PRYA 4HLCA 2APJA 4MKRA 2ZZKA 2O2CA 5CCDA 1JYSA 4FCVA 1RKVA 2PDAA 2E0IA 3PU6A 3TLKA 3LTNC 4JLPA 1DE0A 2XGMA 3KKQA 1Q77A 3CS3A 2PUEA 4BO4A 3DBVO 1D09A 3HY4A 3JALA 4JLAA 2G28A 3C8MA 3HGQA 4KSCA 1XMVA 2QP9X 3KCNA 4DMGA 3B3FA 1G17A 4DLNA 1QIEA 4UDXX 4Y1EA 1T2CA 3KXDA 2NADA 1T6ZA 3FVVA 4IX1A 5G02A 2WABA 3FIJA 4IQGA 2A33A 2GN2A 5EXXA 3PQ7A 1JKJB 5KQRA 4D98A 1SXJC 2QX7A 1NXVA 1QQ6A 1U2SA 2GAAA 3MCZA 2IPLA 3OO0A 2FZLA 1FYDA 2O8EB 3K9HA 3UWMA 5JD5A 1CTQA 2C2YA 3M49A 1NI5A 1R88A 2V4UA 3DMDA 2F9MA 2XA9A 4LOLA 1ONOA 2ZM5A 4ZVRA 3UYKA 4R31A 16PKA 4PSCA 1TGYA 3NOXA 1YXMA 4E0BA 4BXOA 4ZODA 3Q72A 1ORIA 3CN9A 2NZVG 5IDXA 4X62B 4YJFB 4MIEA 3WIEA 1O1YA 1XMOB 2OXCA 4D2IA 1KNXA 2PX5A 2WAMA 1VA4A 2F6RA 3KJFA 2QRGA 4HPWA 3HY3A 4LRXA 1PZGA 3NG1A 3E18A 5AUQA 1OYWA 3FOZA 1Q0ZA 5IM5A 1LPNA 1R66A 2R8BA 3CLTD 2BGUA 5IULC 1FFWA 2FR8A 1ZOIA 1TOAA 2PUTA 4LHZA 3USZA 4DLKA 2Y1OA 5IVIA 3P9NA 1KWGA 2C1ZA 1BDBA 1OXXK 1X80B 2LGJA 1T8PA 3DJFA 1NA5A 1W4BA 1G66A 4FFMA 2VDPB 3E1GA 4HMQA 1U1DA 1R18A 3RV3A 2JFWA 4UHFA 1ZIPA 3ZPXA 1FYWA 3PQ3A 1DJMA 1DT5A 2JD0A 3PFHA 4O08A 2EZTA 5J4YA 1P75A 4HNVA 1RXSA 3I64A 3LYUA 5MN4A 1T2UA 3W5AA 3I1FA 2RHRA 1SH7A 2PU5A 2MSCB 4MICA 2FW0A 2FW1A 1TT7A 4FMCF 4UM7A 4CTKA 4D96A 2Z9CA 2KSQA 3AEZA 3JYNA 4IJUA 4BTVA 3MUNA 3OOWA 2WJ4A 4CQMA 1EP3B 1UMCA 4F2HA 1ZOOA 3EHEA 3GK3A 2OK7A 1PJAA 5JJKA 2EJTA 3T0GA 2EJWA 3THSA 1VKNA 2FHSA 1GXSA 1S8AA 1C8VB 1J8YF 2YV1A 1AKMA 1ZUD1 3GD7A 2BEUA 2HSDA 3FG9A 3KVYA 3MJ4A 3Q1LA 4L9WA 3WGMA 4C6TB 1T4CA 2V59A 4BNNA 5HRUA 3GXOA 3COZA 3KZ1E 4EA8A 3NHLA 1BKSB 1SA0A 1C7RA 2HU2A 2VDRB 2KQUA 3HXLA 4B6JA 3CX3A 4E2WA 4ZMSA 2PS9A 3LUHA 2PSDA 1G20B 4MP8A 2BMEA 4S35A 4FDLA 4I36A 3CTPA 3RE1A 3OT1B 4DCJA 2HNKA 3PCRB 4N48A