3AY7A

Crystal structure of bacillus megaterium glucose dehydrogenase 4 g259a mutant
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
260
structure length
260
Chain Sequence
HMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase 4
total genus 100
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay7A00
2BI8A 1MGOA 3JQBA 4ZRNA 1NM5A 3V1YA 5KWEA 1LQUA 4XRGA 2O2SA 1PJSA 1UAGA 4IJWA 3ZZNA 2ZCVA 3F1KA 5L45A 3MJ4A 1I0ZA 3PIIA 1DRVA 2DBZA 2WTBA 1U1IA 1IHXA 4BGIA 1QLHA 2Y66A 5K0ZA 3SLKA 1XG5A 3R6DA 2VTEA 3WLFA 2Q4BA 3BA1A 1LDNA 4DUPA 5T67A 4B4VA 3I6IA 2HU2A 1Q7CA 4WNCA 3JQFA 3LT2A 4TRJA 1FMCA 1DHRA 4EGFA 4QSMA 1GPJA 2X9GA 4PFJA 1JDJA 1NWHA 4Z0HO 1HZZA 4Z6KA 4JNKA 1ULSA 2CNBA 3WX0A 4CMHA 2BGMA 2HCTA 1XU9A 3CUKA 3IDSA 5L7YA 5KJCA 1YKFA 4FOOA 1Y8QB 4NU5A 5A3VA 2A92A 3WIDA 1WVGA 3AM3A 1N7HA 1ENYA 5T8KA 3PI7A 3RJ5A 1UUFA 1GQQA 3DB2A 3GEGA 1K89A 1Q7GA 2V7PA 4HFMA 5JDIA 1XA0A 2DFDA 4WLEA 2DC1A 1BW9A 4DC0A 1YVEI 4OXNA 3KYDB 2OP1A 3W6UA 2I9PA 2HKIA 2ZB4A 3CXRA 3VHRA 3KOUA 3ZH2A 3CMCO 2P4HX 3E8XA 1QMGA 3UKOA 3GMSA 8ADHA 3PJDA 3GA0A 3BMCB 4U6SA 1QP8A 5CG2A 1P1JA 3DC2A 4OOFA 4EUFA 2Q1UA 3CTMA 1JQBA 2QYTA 2RH4A 4G2NA 4TVBA 1FDUA 1C0IA 2TMGA 2IYPA 4MVJM 5EQDA 1C0KA 1VJTA 3PVZA 3TOXA 2O23A 3IUPA 3MJVA 1YQGA 1BG6A 1ZJZA 3V5NA 3M6IA 2DAPA 4LMRA 4XIJA 4KQXA 5BNTA 1DPGA 4BNXA 1JWBB 3ZWNA 5C5IA 1YO6A 1GYPA 3NT4A 4E5PA 4RZHA 2D8AA 4FJ2A 4RVSA 3N74A 5G4KA 2YHIA 1LNQA 1WZEA 4QFCA 2HK7A 3ETEA 1KC1A 4RPKA 3HN2A 1V3VA 2O2YA 5BSGA 2CMDA 2I3GA 4M55A 3Q2KA 1R4NA 4J4HA 4DQXA 3JQCA 3P19A 3AI1A 1LLQA 1NPDA 3FR8A 5KOIA 1IB6A 1Y9AA 4IQGA 2X1HA 4GLLA 1ONOA 3ZWAA 2NVBA 4IM7A 4LVUA 2Y0DA 4IGFA 3NDIA 3SEFA 4CM5A 1HSZA 4LRTB 4BKOA 2H1SA 2PA3A 3CZRA 3OF2A 1XSEA 5I7FA 1ISMA 3A1NA 3QVTA 2D59A 1PZGA 4AJ2A 3GVPA 4BGUA 4DLLA 4ILKA 2C2XA 4ZQEA 3Q9UA 1MG0A 4EBFA 3RC2A 4CLOB 3WGYA 1T2EA 4EI2A 1ENPA 3GAFA 3IMFA 4OQZA 2EP7A 4JIGA 3FNHA 4B7XA 5I9NA 4L4RA 2HQ1A 1SOWA 1L7DA 4XB2A 1IULA 1P74A 4YAIA 1Y8RA 2DTEA 3E9NA 1Z74A 3RCBA 4ZQHA 4J7XA 3VAZA 2YDXA 2JJYA 5HBRA 3GFBA 5HTOA 3PJFA 4Y9DA 2Y1CA 1EUZA 1VI2A 4WLFA 3X2FA 2Y1GA 2WD7A 1D3AA 3COSA 4IDAA 1UDCA 1EK6A 3AU9A 5H81A 3HUDA 2A94A 4CMIA 4PG8A 2NVWA 3LC2O 5EERA 3WBBA 1C1XB 3GC6A 3PZBA 4J7CA 3UCFA 3WQSB 3GRKA 5DBFA 3EY4A 1DIGA 1LC3A 2CZCA 3EHEA 3QWIA 1YL7A 3U4DA 4B3JA 1SNYA 2JFFA 1HDCA 4YRAA 1UP4A 3ZWXA 3FD8A 4JJFA 4NFYA 2DTXA 3LK7A 2BFMA 3V1UA 3GVIA 3LU1A 3TZCA 1N7GA 2V6MA 3VOSA 4E13A 4IIVA 5G4KB 3QP9A 1VJ1A 4YAKA 3CMMA 2BMAA 1PWXA 4IPTA 3DDNA 4WCFB 4FJ0A 4QQRA 2NVUB 3RUIA 1YJQA 1MFPA 1GDHA 3QQPA 1ZSNA 4JP3A 1H2BA 4DLAA 4RQTA 2X6TA 3QE3A 4PG7A 2FR1A 3UHAA 3HB5X 3HB4X 4DVJA 3HN7A 3NTOA 2D0IA 2W2LA 3C7DB 1IHYA 3BMQA 3DR3A 3DBRA 3PGXA 5IJZA 5L4NA 2PK3A 1ZSVA 3KV3O 1NHGA 2PD4A 4TZTA 5TF4A 3GY0A 1ISIA 2B36A 2VZ8A 2C2YA 4MVJA 2GNAA 4HX5A 3UGKA 4HFNA 1YE3A 1LDYA 5HS4A 1LLCA 3H5RA 3ZU2A 4OSOA 4XQEA 1EZ4A 1LI4A 4QFDA 5JAMA 1EVYA 4R41A 3GGPA 2AE1A 3DOCA 3BHMA 2G82A 2EJVA 3UN1A 3GVXA 4W99A 3FCOA 3GZNB 2GR9A 3MWEB 1QV7A 2Y68A 2AEMA 4CMCA 2JFHA 2GZ1A 2QRLA 2GUGA 2PKQO 3SJ7A 3I9JA 3QLJA 1FDVA 1UZLA 4EUHA 4II3A 1Z45A 3D4NA 3PJEA 3OJLA 1T2AA 2HJRA 3F5QA 1W0CA 2C54A 2BI7A 1HE5A 1I2ZA 1PEDA 3U5TA 2UYYA 2VYNA 3INRA 4OHUA 2PKQP 3WXBA 1U5AA 4GMFA 4BMNA 4AJKA 3JTMA 3MJSA 3W4KA 3TZ6A 2DFVA 1Q0QA 1JLLA 2BFOA 4AJLA 2PWZA 2D2IA 4NBVA 4Z9FA 3WSWA 1SEPA 4E2WA 4XQCA 4YJHB 1EQ2A 1I33A 3FF4A 3DOOA 3TL3A 3I9OA 3WFIA 1ZVMA 4MKXA 2X0NA 2AE2A 4EJ0A 3W8EA 3EAGA 4K26A 2JD1A 1TVEA 3INGA 4DYVA 3ZNOA 4ZA2A 1XU7A 3JQAD 2A35A 3DL2A 5I7EA 3NYWA 1YL5A 5MGBA 3AOGA 3F6YA 2OZPA 4E5MA 3RROA 4JJGA 2GF2A 4GLOA 3AFNA 4CODB 4MINA 1XELA 1NWCA 2Q2QA 1EE2A 2X0IA 4YB8A 4CM1A 3D5QA 1PIWA 1ZBQA 2X5KO 3GH3A 3OM9A 3WBFA 1ML3A 4DLBA 1J49A 2NV6A 2YY7A 3EGOA 4GWGA 3ROMA 4PVDA 4YJFA 4U0KA 1OBFO 3BXXA 4IDBA 3KHUA 5IDQA 1P1HA 4W82A 2WD8A 4EITA 4JBIA 4KUEA 4HXYA 2VHYA 1R12A 2JCYA 4LRSB 4EYEA 4CQLB 4LSWA 1WXDA 3ETGA 1T25A 4NU6A 1BSVA 1E7QA 3BMOB 4BO4A 1H2HA 3HG7A 4ZQBA 1HKUA 4XDZA 1GZ3A 1TEHA 3NJ8A 4L76A 4MJLA 3PJGA 2EKQA 1W73A 3C85A 3OP4A 4KMSA 3TSCA 4XYMA 3GAZA 3BTUA 3QWFA 3RUAA 1M6HA 3WDSA 4AVYA 5JAZA 4ROSA 4OH1A 1KYQA 4UEJA 4ZQFA 4NIMA 4R3NA 1C14A 3HJAA 3QWAA 3H4VA 3QVWA 3OSUA 1WDMA 1ZKMA 1SB9A 3GDGA 5G0VA 4AJPA 2OL4A 3B70A 3KSUA 5HS6A 4A73A 1V9LA 3VPFA 1MC5A 1WNTA 4PVCA 1IUKA 5CDTA 1WMBA 3ZV4A 3S55A 4EUEA 5DBGA 3QV1A 1JAYA 1C1DA 3PYXA 2FPGA 3L4BC 3P7MA 2YV1A 1GADO 3WTBA 1T26A 1A4UA 1QKIA 1U5CA 3GG9A 2CDBA 1TT7A 2O3TA 4M54A 4Y6SA 4R16A 3D5TA 4WLOA 3JQDA 3VVCA 3O03A 2NSDA 4GBJA 4OKNA 5F1OA 3F9IA 3RASA 2A9FA 2VN8A 1K5HA 3R1IA 1GR0A 2AQKA 4NH4A 3V2GA 1VKNA 2X4GA 1J0XO 2I66A 4CQMA 1KEVA 3DZKA 3OHSX 1QLJA 4MIYA 4QEDA 2OP0A 1P1RA 4BNUA 1XEAA 1ZNQO 4RDIA 3KBOA 4IZIA 2IODA 2CVQA 5JYDA 1XYGA 4QX6A 3WICA 3EC7A 1BXGB 2HMWA 4CR7A 4D0SA 4BQRA 2FN7A 4DQUA 2ZJ0A 2VYND 4BNHA 1BHSA 1O6ZA 1KBZA 1RM3A 4J91A 2Z1MA 1KVUA 1W6UA 1HE2A 3LF2A 4IJVA 1SZJG 1WAMA 2VYVD 5B4VA 4CL8A 4XWYA 4P4GA 1HE4A 5G0UA 1JA9A 1MV8A 5K9ZA 5C37A 4PG5A 2XXBA 4UUNA 1EQUA 3PXXA 2XPCA 3O8QB 4JBHA 3TWOA 4Z0PA 1PGJA 2IDZA 5G0TA 1G1AA 3S1LA 4YWJA 4ZVVA 3NKLA 2AG8A 2I3AA 4IIUA 1EVIA 5L53A 1BXGA 4E5NA 3AY7A 2R6JA 2EHDA 5L95A 2PR2A 4RO0A 3WR5A 3DFUA 4IMRA 1E1KA 4J1SA 2CF6A 3JQBC 5G0WA 1GD1O 1E3WB 3JQGA 1NX6A 3C1TA 4GVXA 1H6AA 5GY7A 1OFGA 4YJFB 1NPTO 1I36A 3FRJA 4CM4A 1KEWA 1GUFA 2GDZA 3ON5A 4UULA 1DIHA 5ENDA 2IEBA 2OOSA 4WEOA 2FHSA 2DVMA 3E5RA 4RDHA 5LDGA 3ZHYA 2SCUA 4MP3A 2D4AA 4HNHA 1JVBA 2VT2A 1QYWA 5JXWA 4E6PA 2PZJA 3OA2A 2HK9A 2Q1WA 3TL2A 1H9BA 1GL3A 4GPD1 1BVUA 4L75A 4JQCA 4IGEA 1XIVA 2E48A 3B20A 4ND1A 4BV9A 1P9LA 1A27A 2DLDA 3WYEA 4RGBA 1E77A 1V0JA 4B8ZA 4TVOA 3OQ6A 6LDHA 4PRLA 4BO6A 4OMUA 2VOEA 3OMLA 5KVVA 2BHLA 2FSSA 5ILGA 4D42A 3TF5A 3KO8A 3HE3A 2PTGA 4PLVA 3QWHA 1P31A 3C24A 2C7VA 3OJFA 5LC1A 5F3RA 1G0NA 4KOAA 1EE9A 4BNTA 2O3QA 4P22A 1QYCA 1KOLA 5ICSA 1JKFA 3JYNA 3QSGA 5TX7A 1ZFNA 4WPGA 1CIVA 3VH2A 3ITKA 3WJAA 5BR7A 4W6ZA 1I2CA 4MVJG 3QJ5A 5IZCA 4BO1A 1GV1A 4BB6A 4CV3A 4ALLA 1PTJA 4DC1A 3RFXA 3WGTA 2P91A 3RC9A 2W2KA 3LQFA 5KVQA 4N54A 1Y5RA 1AUPA 2ZTMA 4FC7A 4J4BA 1U7TA 4WLUA 4RV9A 2WYVA 3F5SA 1ONPA 2GYYA 2WYUA 1VL0A 4DQVA 3L0DA 1HXHA 5THKA 2X0RA 4NBUA 3IAHA 4HFJA 5KJ1A 4UUMA 1NHWA 1NFFA 3BTSA 1ENZA 5KTKA 3GHYA 5DP1A 3FWNA 3GMDA 4OGWA 4HNGA 3C1OA 4M8SA 4BO2A 3V8BA 3JQ7A 4QTZA 5EESA 1DFHA 3JCZA 3G1UA 5DZSA 1GCUA 4TQGA 5BSEA 3QA9A 1F0YA 3WGHA 3DBRB 5COQA 1GYRA 5CG1A 2Q49A 1Q1NA 4N5LA 4NK4A 4QUKA 1LDEA 5GMOA 3I9MA 2BRUA 1FK8A 6ADHA 1ADBA 3G79A 3FN4A 1MXHA 1VSUA 1HDXA 2O3SA 4OXYA 3ZHZA 3KXDA 4D3FA 1LDBA 1I3NA 4E30A 1UZNA 1K0UA 3Q0EA 5JO0A 1S7CA 2RHCA 3ZNNA 4WOKA 2BLLA 1DSSG 3WTCA 4CV0A 5H82A 4DWVA 3GT0A 2IEDA 2FPIA 1K3TA 2Y0EA 4NMHA 1PWZA 1GQYA 3QVOA 3L6OO 3HFGA 4ZRMA 4K9DA 1E6EA 3OFSA 8LDHA 5FEUA 2NTJA 1MX3A 2B5VA 1JWAB 4ND4A 2XOXA 3DQPA 5A03A 3NT5A 1EVJA 3DONA 2UV8A 4BNFA 3Q9NA 2XF8A 3V2HA 4RPLA 1C1XA 2GERA 4ZD6A 1EUCA 3ZW8A 4YRDA 1OC2A 3K2EA 3AW9A 2BD0A 5DULA 1NXQA 5G4LA 2CY0A 4URFA 1GEGA 3LDHA 4TKMA 4CM4B 4GX5A 4RF2A 4NBRA 4OXKA 3TZQA 4Y8VA 3DAPA 1H6BA 2EGGA 3E82A 1D7OA 2ZJ1A 3U0BA 1UXKA 4UEOA 4TSKA 1I10A 2P9EA 2DPGA 4I9HA 2C5EA 3K6JA 2RAFA 3FTPA 3SXPA 3G1TA 1PL7A 3DFZA 4FN4A 1LU9A 1CDOA 4YACA 1F8GA 3NEPX 4NFHA 4KQWA 1ISJA 1GCOA 1GPDG 1LSUA 4PRKA 3BMQB 4R1NA 2Q45A 4OL9A 2PY6A 1EMDA 4BO8A 5JS6A 3PHLA 3F3SA 3WGQA 4U6QA 4CLOA 1UDBA 3D7LA 5IZCC 1X7HA 4R3WA 3VKUA 2QQ5A 3RBZA 4GX1A 5L7TA 3CPSA 1G0OA 4MO2A 1LLDA 3IC5A 4PCVA 3OQBA 4XYGA 3M1AA 3WIEA 3R0IA 3WNQA 1AHHA 1A72A 2GASA 2VRCA 3OBBA 2DM6A 4H15A 4L4XA 4NPCA 1PQUA 2VRCD 1DIAA 3WB9A 5CEFA 4PLCA 3NRCA 3H9UA 2FP4A 2QG4A 3RC7A 5A5EA 2QHXA 4R68A 4WKGA 5IF3A 1E5QA 1LQTA 1NP3A 4E33A 4KP7A 5HM8A 3K30A 2AXQA 2OBYA 3AUSA 1R6DA 4DMMA 4B4WA 4CM3A 2NU6A 1ARZA 2B0JA 4CMEC 2X5OA 4R51A 4CLXA 2NVUA 4WCFA 1VSVA 4NNJA 5KVSA 1KVSA 2X9VA 1BDMA 4IXTA 1X1TA 4NJOA 4UREA 1PGOA 4B4OA 4Q3DA 2B4RO 5AVOA 4RLHA 4BKRA 2JFGA 2Y1DA 2BF7A 2HLPA 3UAGA 2J5RA 3GUCA 3JQGB 2V65A 4U0JA 1I30A 4AJHA 1H6CA 3TN7A 3PP8A 3OECA 5KKAA 4CV1A 5A04A 1M76A 1U4SA 1UXHA 3IJRA 3KVOA 3BMNA 1NR1A 1VLLA 4IDFA 2FRDA 1HDYA 1KS9A 3M1LA 3PWSA 3H65A 5EL0A 1S6YA 4U5QA 5A1TA 2HRZA 3OQ1A 1H9AA 3JQAB 4IDGA 3UUWA 1NVGA 5JY1A 2B4TO 2VT3A 3LYLA 5JMWA 3KYCB 1ZZEA 3U4HA 2GN9A 2YFQA 4J16A 1NVMB 2YW9A 4XDYA 4O0LA 1Z75A 3RFVA 1R0SA 4W7IA 3UF0A 4XIYA 3AOEA 2CDCA 2W4QA 2CDAA 4IS2A 1B8UA 4JP2A 2VCYA 4HUJA 1EVZA 3M2TA 3VZPA 4MVJI 2FZEA 1KEUA 3I9NA 4BKQA 4I1IA 1JU9A 4G65A 1B7GO 4U7WA 3ZCXA 4M86A 4YT8A 5BQFA 4RQUA 4OQYA 5F21A 1WLYA 3D3EA 1HEUA 3ENNA 3RWBA 3ZW9A 3OIGA 4A03A 2Q46A 3WGGA 2TMDA 4MVJH 4WASA 3I23A 4FSHA 4J3FA 3QIVA 2V6GA 3I9LA 4I08A 4DYDA 5T5QA 1HTBA 1CYDA 1UJMA 3SLGA 2BELA 3DZFA 3FWZA 4FFMA 1MUUA 3PWZA 4R69A 4AJ4A 1DRUA 3I1JA 3IL2A 1DC5A 4UVIA 3AM5A 4BKPA 4F45A 2Q2WA 3U49A 2QYSA 2VTDA 2G17A 3UFXA 4O5OA 2IZ0A 3B1KA 4XQ9A 1A4IA 2P9GA 4YR9A 1DOHA 4IJUA 3ZWYA 2AQIA 2UDPA 1MC4A 1ZK0A 2CF5A 2ZYDA 3JQ7B 4XGNA 3DBLB 4HV4A 4BNMA 4D7AA 4CMJA 1DHTA 1JKJA 1ORRA 3VH3A 4B7CA 5CDGA 2Q3EA 1C0PA 4ZQGA 4Z0TA 4DMLA 5CEEA 4MVJF 3ENKA 2FWMX 2FR8A 1U3TA 5TT0A 1PS9A 2QRJA 5KCZA 1XLTA 2BKAA 3GDOA 4PLWA 1BDBA 1BGVA 2Z1NA 2AMFA 2ZYGA 4RCVA 5ES3A 2EP5A 3RC1A 3VPXA 3E6AA 1X14A 2JL1A 1DDOA 1HYHA 1DB3A 4CUJA 4RF4A 3NV9A 3D0OA 4CLDA 5FYDA 1HYEA 2ZB7A 2WMDA 4CPDA 2PH3A 2A4KA 2O3JA 1RYEA 2YFHA 3WGIA 3VH4A 3KTDA 2GD1O 4P4NA 4WECA 1NAIA 1OAAA 1DLJA 3D4OA 1T4DA 3JYQA 3ZWMA 4AJNA 2BFPA 4Y6RA 4DIBA 1YGYA 1GY8A 4R9SA 3BMCA 3WFJA 4BB5A 3ROPA 2DTDA 4K1LA 4YJDA 5A05A 4UVHA 1LRKA 2V6FA 1BXZA 4G5HA 3VZSA 4E3ZA 5A3JA 1L7EA 3FR7A 4BO3A 3TZKA 1PSDA 2VWPA 1K6XA 4II2A 4ZGWA 5TS3A 4XX0A 5JDCA 4ITUA 4GGPA 3KETA 4CQLA 1I3KA 1Z73A 2IRWA 1ISFA 1YOVB 1PZEA 4BNNA 3QWBA 4Y6PA 5JDIC 4AFNA 1Y8QA 1A7AA 1WMAA 5A02A 4GX2A 3VKVA 1KVQA 1P33A 2J3JA 3SVTA 1N8KA 3OIDA 1DFGA 3BHIA 3DHEA 1KY4A 3KLPX 1IPFA 3I4FA 1Q7BA 1R37A 1PU2A 1PQWA 4XD2A 2O4UX 1DAPA 5TGDA 4W7HA 5A9RA 4TRNA 1U4OA 3Q6IA 4M1QA 5CHEA 2R00C 3ANLA 5K6AC 7MDHA 3GR6A 1ADCA 1GUYA 1B8PA 1RKXA 4FFNA 4J7UA 1L1FA 1QYVA 1SAYA 4E2YA 1VC2A 1BMDA 3VPGA 5C3MA 1IOLA 1SMKA 5CDSA 1IYZA 1NVTA 1F14A 3GNQA 3GNTA 5AQ1A 4BIIA 5H83A 1MG5A 1X15A 5CEJA 5LCXA 5B37A 3L9WA 4UUOA 3ZNPA 4CM6A 4KUGA 4YBZA 1VPDA 5F1PA 2QZ9A 3GEMA 4FGWA 3WS7A 4D46A 2X86A 2Q1TA 2WDZA 2PV7A 1RPNA 5TJHA 2GCGA 1HRDA 1XQ1A 1Y5MA 1E6WA 1UXJA 4YAJA 4BQPA 3C7AA 3JQ8A 3DTTA 2GPTA 1U3WA 3N7UA 1TXGA 2HK8A 3UCEA 2NUAA 2W2KB 4F46A 4L73A 1PS8A 5JCJA 4L4SA 2VUUA 1YB1A 3BTVA 4HBGA 2W98A 5TIIA 2AQ8A 4JGBA 4RVHA 3ZHBA 1B8VA 2WEKA 2NQTA 4OM8A 4R01A 3IKVA 1P77A 1PGPA 4JK3A 2D3TA 4HFRA 5ICMA 2D5AA 3DHYA 5DBIA 3TZHA 2W8ZA 4IUYA 3DMYA 2VHWA 3MCVA 1XWFA 3PHHA 1HF3A 1VL6A 4WUVA 5IXSA 3PDUA 3GK3A 1YL6A 4BNVA 1QV6A 1J6UA 3GGGA 3VTZA 2NWQA 1Q2XA 1B14A 4ALKA 4EEXA 4YT5A 3PQDA 4Z9XA 4O63O 4GVLA 2I67A 3E1KA 3ITDA 4OAQA 2EJWA 1BTOA 2JKVA 3IS3A 1GZ4A 2DU8A 2HMUA 4KDEA 1E92A 2HRBA 2DBRA 4UVGA 4XYEA 1PJ2A 3S8MA 3ZI0A 1T4BA 4YPOA 2X0JA 4HADA 3DBVO 1T2CA 4Q3EA 3AUTA 4PN3A 1X0XA 1NASA 1O9BA 1YB5A 4ZICA 4NQZA 3MJTA 1PJCA 3ZWBA 1E5LA 3Q1LA 1GTMA 5A9SA 3GLQA 4J1TA 5IN4A 1OI7A 1DAOA 2JCVA 2NNLD 5L9AA 1PZHA 1PJBA 3DWFA 4J49A 3ADOA 4KTTE 5JC1A 4DPKA 4FFLA 5AXDA 5I9MA 4BNIA 1V3TA 5IZ4A 1PJQA 1GQ2A 3TFOA 4MPDA 4GL4A 3ZWVA 4E21A 4GSLA 3H7AA 2GO1A 4JROA 4PLZA 4J6FA 3JQ8B 2AQHA 1E7SA 3SC6A 2O7SA 3BHJA 1ZEMA 4R5HA 3ZWPA 2VWQA 2QX7A 2ZB8A 5U1PA 4A27A 5F1KA 1YH3A 1BVRA 1BWSA 3D64A 3WG9A 2JHFA 3NJ4A 3MZ0A 1U2DA 5TNXA 1YXMA 1ISHA 4XJSA 2D5CA 3MEQA 2NU9A 2PD6A 5FWNA 3I9KA 4NG5A 4GAEA 1OZAA 1RJWA 4FS3A 3X2EA 2QRKA 4A0SA 3KEOA 1BW9B 1A71A 1DC4A 5T6BA 5T8KC 2C07A 4BHTA 1PL8A 4I9NA 1LTHR 1RWBA 1NNUA 3VVBA 4CJXA 1SCUA 4XR4A 5COBA 4WJZA 3B1JA 3JV7A 4GGOA 4BS9A 2WWRA 4RORA 3DTYA 4ALIA 5DCYA 3RBVA 3K31A 4N5NA 4IZHA 5C7IO 3VZQA 3WWYA 1GAEO 4MDHA 4WCDA 2OGUA 2BFAA 3G17A 3JD3A 4IDCA 1YONA 4JCOA 2X8LA 2FOIA 1SOVA 1NTOA 1YQDA 5ITVA 1V6AA 5U9CA 1Z82A 2Y67A 3F4BA 4NBTA 2BGKA 4RVDA 4BVAA 3FNEA 4L0QA 3VDQA 5A5FA 1E7YA 3UICA 5CDYA 3DHNA 4EEZA 5L51A 4BKUA 4PLYA 3H3JA 1P0CA 1HDOA 4N5MA 2VHVA 4GH5A 5LDHA 4BMSA 5JY6A 4W9NA 3H9JA 1I32A 2HDHA 5MDHA 3PLRA 1PR9A 3DZJA 1EFLA 1ZXLA 2CUKA 1IY8A 3JQ6A 1PL6A 4PG6A 3PEFA 1O94A 1YJ8A 2PD3A 5KIAA 1EDOA 2AA3A 3W1VA 1EUDA 1R0KA 1Y6JA 1YS4A 2NTNA 1E3IA 2XAAA 4PLTA 3HDHA 1B0AA 4JXKA 3ST7A 3RIHA 4KWIA 2W90A 3AK4A 1TT5B 3QRWA 2W2LD 3NGLA 5U4QA 4RZIA 2ET6A 1X13A 1OMOA 5EIOA 1HT0A 3IOYA 1GZ6A 4I8XA 4WLVA 4YQYA 3CKYA 2Y99A 2J5KA 4EZBA 1N5DA 1VRWA 3HHPA 5IN5A 3UCXA 2J5QA 3ABIA 5THQA 5K6AA 1FDTA 3RUHA 3PDJA 2UVDA 2WSBA 1O5IA 4D3SA 1O95A 1NYTA 1OOEA 1DLIA 3E03A 3ZWOA 3PGJA 2QW8A 3OJEA 2O3UA 4CM8B 4J0EA 4YT4A 2NU7A 4WOJA 2YYYA 5C7OO 4XKJA 4B8WA 4WNIA 3GPIA 3K5PA 1ZSYA 3G3EA 2Y0CA 4BNJA 2OXIA 3ONEA 4E5KA 2RIRA 3KYDA 1SBYA 3SC4A 4UAGA 1P45A 3DZBA 3WYBA 4XZ3A 3AY6A 4OIMA 4WK6A 4R4JA 3V2UA 3QY9A 2D1YA 4E0BA 4IMPA 4X54A 1I01A 4QO8A 1HDGO 2BGLA 2IXBA 4I5GA 2HO5A 3CZMA 3LT0A 1HZJA 1LA2A 3MOIA 1Y81A 2GN6A 5ILOA 2ZATA 4D79A 5ENVA 4FPXA 1PS0A 4CMIB 3L07A 2ZIZA 3K9QO 1A5ZA 3PQFA 3RJ9A 5TQVA 2YZ7A 5AXCA 1E3SA 2OO5A 3L77A 5EN4A 1PGNA 4J2OA 2NU8A 5JC8A 5DN9A 1NPYA 1U7HA 3L4SO 4CMEA 2R2GA 2B37A 4FIZA 5I7SA 1CETA 1CEQA 1UDAA 4L8VA 3UVEA 4BUCA 3ZU4A 2J3HA 1VJ0A 3N58A 3RQSA 1B2LA 4HP8A 2FZWA 2ZQZA 4TMFA 2YHUA 2HMTA 3ETDA 2EG9A 2O7QA 5AXBA 1E3EA 1U8FO 3G49A 2H9IA 2ZCUA 2ZTLA 2IXAA 2H6EA 3U3XA 1LXCA 1BRMA 3GRPA 4CR8A 4PZEA 4DTIA 3S2FA 2R00A 4HKTA 1RYDA 1D1TA 3DMTC 3QVXA 1I24A 1M6WA 3CH6A 3JQFC 4YDRA 3RI3A 4XQGA 3TFQA 5DCUA 1AE1A 1R15A 4J9UE 2V6BA 3OICA 1LSOA 4A7PA 1QG6A 2I5PO 3L4BA 3PWKA 4PG4A 3OEWA 5B1YA 3MTGA 1F17A 1WZIA 4GX0A 4CUKA 4PLFA 1HL3A 3A14A 1GU7A 2Y1EA 3H8VA 1UH5A 2JD0A 5L4LA 3JQ9C 4BGVA 1ENOA 3GOHA 3ICCA 2POQX 4JBGA 4H16A 4UVDA 5COAA 3GG2A 2CD9A 4IQ0A 3P2OA 1B3RA 4LW8A 3H3FA 4BNZA 3W4IA 3PFWO 5JCJD 1WWKA 5JFOA 2YDYA 3ZV3A 1CERA 3W6ZA 1T2DA 2OFPA 4NHEA 2WJPA 3A9WA 4R9RA 1IZ0A 3DEYX 4XGIA 1I2BA 4O1MA 3WMXA 7ADHA 4DL9A 5A9SB 3AUAA 3F47A 3PLNA 1FXSA 1DEHA 2FPPA 1GFSA 1U2GA 3W8DA 4DREA 5KVCA 2GZ3A 1SB8A 4BMVA 3B1FA 3D1LA 5JMPA 1I3MA 4C7KA 2GN4A 3O26A 1PJ3A 1EEHA 1U9JA 4PLPA 3OIFA 1CQIA 4MKZA 1E1NA 3H5NA 5F5LA 5AYVA 1H0KA 5BNFA 4TRRA 4TZKA 2EEZA 3B6ZA 3FNFA 3C3XA 3ZV6A 3BIOA 1C0LA 3E9QA 3HWRA 1U8XX 4OJNA 4RL6A 1MB4A 1QYXA 5G0SA 1ZH8A 5T64A 2C0CA 2QIOA 1ZEJA 3GFGA 5EMHA 5JLAA 3ZDFA 2JHGA 4AL4A 4HY3A 4LGVA 4XEHA 5DCWA 3TOZA 3WSVA 1F06A 2P5UA 4J1NA 1C1DB 2CFCA 2CSUA 1P44A 2YQ5A 1C3VA 3JD0A 1NR7A 1NQAO 2J8ZA 2PNFA 3GGOA 2Q99A 4WEQA 4CMBA 1Y8RB 3WYCA 2PFGA 3TQHA 2DQ4A 3BZUA 1Q0LA 3AOEC 4Q3NA 4EDFA 2X23A 2E4AA 4DIOA 1QSGA 3H2SA 4ALJA 2PZLA 3E9MA 4F3YA 4CL3A 1T24A 2IYOA 4IDDA 4FOSA 1V8BA 3D3WB 3KYBA 2NADA 1B15A 1GEEA 3LZ6A 4R1SA 3EUWA 1E0DA 1LDGA 3AWDA 4MVJD 5TRTA 3LT4A 4FQ8A 2OORA 1QYDA 3AI2A 5IXYA 1NFRA 1KC3A 3K92A 3OETA 5B4UA 5G2OA 3T4XA 2EW8A 4PIVA 4IDEA 4BNYA 3GHHA 3FPCA 3RSHA 4B4UA 3OH8A 1ZMOA 4P38A 3RAJA 4Z3KA 1ZUD1 5JPIA 5I9LA 2CVOA 3H9QA 3PYLA 1TI7A 4YJGB 3AY3A 5EJ2A 1LDMA 2VHZA 4RLSA 4WE3A 4BV8A 1VL8A 2VWHA 3TPCA 4YJHA 4CUZA 4NR0A 3GZ4A 4INAA 4P4LA 3K96A 5DT9A 2VNSA 2E6UX 4BNGA 1RM0A 4Z9YA 1Z7BA 3U4CA 4YVFA 2C29D 3GN1A 3VH1A 2GN8A 3HZZA 1AHIA 4LISA 1M75A 4R54A 3AM4A 1N9GB 1U28A 3FSRA 1P1FA 2VHXA 2YJZA 5AXAA 2EIHA 4DXHA 1HLDA 4RPJA 3K73O 1H94A 5CPBA 3GQVA 1HYGA 4YJGA 2X9NA 3HADA 2DPHA 1EBUA 1CF2O 4BO9A 1F12A 3Q3CA 1N92A 5F5NA 4G81A 5CFZA 2C7GA 2GGSA 3L6DA 1K6IA 2ILTA 4Z3DA 4EJ6A 1UAYA 1DFIA 1IPEA 4R1TA 3RUEA 3WGZA 2WM3A 3WWZA 1VE9A 3FHLA 3JYOA 3O9ZA 1P1IA 3BAZA 1FDWA 1U3VA 2NACA 3OJOA 3RFTA 4FD3A 4E32A 4BNWA 2XXJA 1XDWA 4OYRA 2OMEA 2NLOA 5BT9A 5FI5A 1JN0A 1CJCA 3BMOA 4DPLA 3AJRA 2ZK7A 3C7CB 1JVSA 2LDBA 3DBHA 2B35A 1QORA 2G5CA 4BNLA 2RH8A 3EVTA 4MP8A 4IBOA 4MP6A 2JAPA 3EZLA 1NQOA 1YDEA 3L9XA 4ZU3A 5I7VA 5L40A 4WLNA 3ANMA 3RD5A 2EV9A 2CVZA 4Q3CA 4S3MA 1UZMA 2F1KA 1ZK4A 3LLSA 1O0SA 1V35A 2P5YA 2E49A 5JAQA 2VZ9A 4MIEA 4TWRA 4CM9D 3ROQA 1MP0A 4ID9A 4BO7A 2WE8A 4YTEA 4TROA 2DUWA 4M87A 3DBLA 3VDRA 4BL5A 5JCXA 1XKQA 4ND2A 4DBZA 3H5AA 4IY1A 4DGSA 1PJLA 1R4MB 1JW9B 1WP4A 4AJ1A 4XJTA 3ZV5A 3E5MA 1I5RA 2PH5A 1M2WA 3A4VA 1SEVA 4RVGA 4Y98A 4OOEA 4YCAA 3ZU3A 1PR3A 4D41A 4DRYA 1J4AA 2RBEA 4J0FA 3ZGYA 1Q0HA 1YBAA 2Y1FA 1N9GA 4FC6A 2HMSA 1ZK1A 5DOZA 4RF5A 4XA8A 1MA0A 4MIOA 3EDMA 3FTNA 1EDZA 1D8AA 3LT1A 3NAQA 4MVJE 1P0FA 2ZB3A 4CR6A 2P68A 2P9CA 1PX0A 4QXMA 2X5JO 2UUPA 1HDZA 4D43A 3CSDA 3I83A 5KJEA 3CEAA 2DBQA 4GI2A 4LSMA 1OC4A 4AICA 1H5QA 1KY5A 3PYMA 2YV2A 2JAHA 4PLHA 1NFQA 3C1AA 2G0TA 1R16A 4Q39A 2EGHA 1ZK3A 5BSFA 2I99A 4MKRA 4A10A 2FSVA 1XQ6A 4PZCA 3EMKA 2O50A 3HQ4O 3KYCA 3WJ7A 1GYQA 2GSDA 2DBVO 2B69A 1VKOA 4KWHA 2EWMA 3HNPA 1E7RA 5GZ6A 3VPHA 3JQAA 2VNAA 3MTJA 1PJ4A 2WD7B 5J23A 3D4PA 3QVSA 1ONNA 4NJMA 3WLEA 4CM7A 5KJ6A 4FFRA 3PK0A 3E48A 4JLWA 2GRAA 3GF4A 1E3LA 4CLRB 2Y1OA 4B79A 1H6DA 1E6UA 2NM0A 4CMGA 1WPQA 1IZ9A 3LC1O 4YQZA 1B16A 1EFKA 3FBGA 5EINA 1HLPA 4DIFA 4ZHSA 4GSKA 2DT5A 5BNIA 3FNGA 1EBFA 5CDUA 4CQMB 1ISGA 5B12A 4FR5A 4M89A 4ND5A 4C4OA 2C82A 3WMWA 5EQFA 3R3SA 3CE6A 2VZ0A 1UXIA 2EKLA 2P2SA 4RJTA 2GZ2A 5IAAA 2QZZA 5CP8A 4Q3AA 2UAGA 2PZKA 3U9LA 3ONFA 2J3IA 4H3VA 3DAFA 3EW7A 5JO9A 3UXYA 2AG5A 3ZN2A 1A7KA 5BSHA 4J43A 4J9VA 3EZYA 3DAGA 5B4TA 2AEFA 4O59O 4ZN6A 3WGOA 1DC6A 1RM4A 4RVFA 4LCJA 2B83A 2EW2A 2ZTUA 3ASUA 3LC7O 3P5SA 4O6VA 5JE8A 3QW2A 3DXFA 4UVEA 5DF1A 4JN6B 1RM5A 3NT2A 4E2XA 2JCXA 4KUHA 5JYEA 5KKCA 1KVRA 4GKBA 1AGNA 2H5LA 3EYWA 3STHA 2PGJA 1SPXA 1YDWA 3FPLA 2O3RA 5JBIA 1YRLA 1DRWA 1HSOA 3DO5A 3HDQA 4ESOA 4FB5A 1LC0A 1KIFA 3NTRA 3NDJA 4OSPA 3JD4A 2B4QA 4CLHA 4DBVO 2HUNA 4ALMA 5CAEA 4A26A 3KSZO 3GN2A 3ZNQA 4E12A 4XGKA 4ALNA 1XCBA 4KDFA 5IG2A 3HFSA 2PGDA 3TNLA 3IJPA 4PLGA 2PLAA 4AJEA 3RUFA 1DC3A 4NI5A 3DBHB 3PQEA 3ZHXA 2H63A 3DZGA 4YYZA 3KRTA 3OJ0A 4K6FA 3T4EA 1LLUA 1ZIDA 3H9GA 3F1LA 3VZRA 1SC6A 1XR3A 4N18A 1V3UA 3L6EA 4EW6A 1NQ5A 2FMUA 4Q3BA 4NJMB 2FY8A 4WCFC 3MJEA 5IDXA 4H7PA 2IZ1A 3DMTA 1TT5A 3S2EA 3S2IA 1HE3A 1GUZA 1DJNA 1HWYA 5TLSA 5JAIA 5HRUA 1JKIA 5FF9A 4XR9A 3RU7A 1E7WA 1X7DA 3H6KA 3P2YA 3IKTA 1NAHA 4NFSA 4QT0A 1ZMTA 3WQRA 2Q50A 1DXYA 1HETA 4J2HA 4C7JA 3A28A 3IIEA 3ORFA 4LCEA 3JQ9A 4E5YA 3UOGA 1PZFA 3F46A 1X7GA 1NBOA 3JD2A 1KERA 4JJIA 3NUGA 2VWGA 3IQDB 3LF1A 3JD1A 5TC4A 3PRJA 1DJQA 1PGQA 1YBMA 3PHJA 4XCVA 4LMPA 4IINA 1X1EA 1FF9A 4IXWA 3ROKA 3AFMA 3T7CA 3SBOA 2AEJA 2Z95A 1B3BA 3MJCA 3PTZA 3BYZA 3FBTA 1X0VA 3TJRA 4CMKA 5I8ZA 2VUSA 1CWUA 3K8ZA 3MOGA 4EJMA 2B5WA 3KB6A 3T7EA 4DA9A 2VUTA 4R5MA 3FI9A 3KUXA 4AJOA 4E2ZA 1Y1PA 1R0LA 4FBGA 1EK5A 5A06A 5C7LO 2ZTVA 3AUUA 4L74A 4JX8A 3IP1A 5T57A 2YUTA 5ER9A 3AU8A 1E7MA 2F00A 2OUIA 3GNSA 1XHLA 1A9YA 3SJUA 9LDBA 4W4TA 1T1RA 1Z6ZA 4KZPA 5JNLA 4K28A 1LUAA 3K2BA 3HDJA 4NZ9A 1LSSA 1W8DA 3GVCA 3GZNA 1VM6A 2DUUA 3DZIA 2X58A 5DNAA 2YQ4A 1H93A 4TRMA 1ADFA 1TLTA 1DIBA 3KZVA 1DO8A 5ER6A 3U09A 2IE0A 1CQJA 4HWKA 1KETA 4IS3A 4MOWA 1M66A 3ADPA 1HDRA 4CV2A 2Q4EA 1CRWG 3U4IA 4GWKA 2FR0A 3INTA 1YQXA 3VTFA 1JTVA 1UR5A 1AXGA 1Y9EA 4B7UA 1P1KA 3KLMX 5HWSA 4RVUA 5AOVA 1MXFA 4LVCA 2VYVA 1ZJYA 2OBNA 2RCYA 1E3JA 3IUSA 2JD2A 3NGXA 4I5EA 4I9UA 3JQEA 3KEQA 1IL0A 1N1GA 4NBWA 2HMVA 1ZO8A 4YEDA 3S2GA 2LDXA 2C5AA 1F8FA 2J3KA 4LN1A 5IFLA 1PQPA 1ULUA 4I5FA 2OHXA 2HJSA 4A5OA 3SX2A 5GZ1A 3JYLA 3H2ZA 5CPFA 3G0OA 1LRLA 2X7HA 3LSYA 2UUOA 1D4FA 3DZHA 4GQAA 3ASVA 1ZXBA 4S1VA 2YV3A 2GLXA 1N1EA 5EPOA 4RPHA 1Y7TA 1O89A 4R1UA 3GUYA 3CINA 1W4ZA 4K6CA 2DKNA 3UH1A 1JAXA 3I6QA 1UP6A 3Q2IA 4BNKA 2NTVA 5DOVA 3Q11A 4NK5A 4CLRA 3KSDO 4PZDA 3GEDA 4FDAA 3PFFA 4ZJUA 1J5PA 3F4LA 2EKPA 3WOHA 4CQMD 4YRBA 2E82A 4YXFA 1N2SA 1Z7EA 4RPGA 5ITWA 1ZCJA 4MVJP 2IZZA 3E18A 2PKRA 1FDSA 3CIFA 3PPIA 4OKIA 2ZKLA 1D1SA 4YAEA 3O38A 3NTQA 4XRRA 1LBEA 2I65A 3PZRA 2ZQYA 5L4SA 3RVDA 4M49A 1E3WA 3VPSA 1NQTA 3ZU5A 4ONEA 3U62A 2PGLA 1WDKA 1A9ZA 4PGFA 9LDTA 1I8TA 5IDYA 1LJ8A 3LLVA 1R66A 4BOYA 2BH9A 4E31A 2VOJA 3ZWCA 4XYBA 3ICPA 3RKUA 2PZMA 2Q2VA 3LVFO 2EERA 3V1TC 4CLEA 3O8QA 4BO0A 3IP3A 2WE7A 4J90A 3RBXA 4XYLA 3ULKA 1YBVA 3I52A 3PHGA 1FJHA 2AHRA 4YA6A 4E4YA 4FCCA 4YAGA 1U3UA 4P8RA 2P4QA 3I3OA 3D3WA 1YB4A 3JSAA 3JYPA 2VQ3A 4Q9NA 3W8FA 4BO5A 4FGSA 4RF3A 4Y67A 3BMNB 1AN9A 5KJFA 2HSDA 1K2WA 2I76A 3I5MA 3ZWWA 4F6LA 1O8CA 3H9EO 4D45A 3BTOA 4I5DA 4ND3A 1LEHA 4CM9A 1SO8A 5TT1A 3UW3A 1XGKA 4U8GA 4NDNE 1R4NB 1DIRA 5L3ZA 4CMAA 4YT2A 2O48X 4FFPA 1KVTA 4WGGA 5HA5A 5JW6A 2NQ8A 3ANNA 4QECA 1LRJA 5GZ3A 3RUCA 1LX6A 2YHIB 1KEPA 5TSDA 3TDKA 1MLDA 1ZK2A 5FI3A 5IDWA 1TB4A 3R3JA 3VC7A 4B3HA 1UP7A 4OO3A 5A4DA 2AW5A 3KM0A 4GMGA 4FW8A 4A2CA 1ID1A 4J1QA 1MFZA 3OEYA 2EF1A 5I8WA 4LK3A 3NDRA 3WQQA 2Q1SA 1P3DA 2J6IA 4GKVA 3GDFA 3PHIA 2E37A 1E1MA 3MWDB 1YOVA 1WW8A 5JDCC 3W4JA 5L7WA 1LSJA 1WDLA 4L9RA 1ADGA 1UXGA 3I4CA 1BXKA 3EVNA 1R4MA 2Y93A 3M2PA 4UEKA 4J4TA 4FFOA 2RHRA 4QO7A 5KNLA 4XB1A 3O4RA 5DP2A 2X22A 4CM8A 1B26A 3HDYA 2C59A 2O4CA 3AI3A 3RKRA 4KTVE 5DDIP 3TRIA 4AG3A 3HSKA 2Y05A 1K6JA 4AJJA 2C20A 4D3DA 1YWGO 1QR6A 3A06A 4FJ1A 5A9TA 1T1SA 2ZYAA 3EK2A 3QHAA 4F6CA 4N7RA 4IQ8A 1AXEA 1GV0A 3C8MA 2WYWA 2I6TA 1T2FA 4D0RA 3GPDG 3RU9A 4W9NC 3WNVA 4AJIA 4BGEA 5ADHA 3RUDA 3OA0A 1QRRA 2EXXA 4B3IA 1G6KA 5TJ9A 3DOJA 1DBVO 4D44A 4IJKA 4TKLA 5JSFA 2Z5LA 1I3LA 2G76A 3NX4A 4UUPA 5FFFA 1QXSA 1TA4A 3GVHA 3PIDA 2HAEA 1E1LA 3ONDA 4DPMA 1IE3A 1ZW1A 2G1UA 1M67A 1PJTA 2VRBA
chains in the Genus database with same CATH superfamily
2ZRDA 2O54A 2FWIA 2QPAA 3IIMA 4C20A 1UBFA 2ZAGA 2IHUA 3IBYA 1Q91A 4IEEA 4DGQA 3BD7A 3D2LA 4C7VA 1UAGA 1A9OA 4F5DA 1GLVA 2P6NA 3F1KA 2GYUA 4Y1RB 4IDNA 5EXEA 1I0ZA 4EYKA 3JAKB 1DRVA 1T1JA 1IHXA 3F78A 4Q3OA 2R1ZA 3DE1X 4YUWA 1SHJA 1S3SA 3HFRA 4DMHA 3EZ9A 2WJ3A 2R87A 4QWWA 1YD7A 4Z53A 1PR4A 3OWXA 3QXJA 1C7RA 1FMJA 1P75A 3ABRB 5F64A 1PUJA 2ZJBA 3AFHA 3NYIA 5T67A 4V02A 2BM9A 2PZFA 2VSXA 1R9JA 5EWLB 4BN5A 3UY4A 3AHHA 5BQ3A 2QLNA 3D6UA 1NDQA 3JQFA 1FMCA 4LHVA 2B8WA 4TTVA 5B3JC 4EGFA 3BZWA 3FYUA 4HUQB 2Z6UA 2OM2A 8AT1A 4PFJA 1NWHA 4TVKA 4Z0HO 1RS0A 1HZZA 3HI4A 4YP5A 3WX0A 1X70A 4QICA 5FA8A 5CGQB 3SYTA 1XPRA 3D6JA 1J1ZA 3LHDA 2WOOA 3FGPA 4FOOA 3KR9A 1HRKA 2A92A 1N7HA 1RI5A 2RHOA 3PI7A 4LVOA 3UHOA 4JVOA 4KITB 1FQWA 2GPBA 2ZWIA 3OPQA 2W42A 1WETA 1UUFA 2WM9B 5ELMA 1KIAA 1MEJA 1Q7GA 1YQ9A 2QR3A 2Z9DA 1NVVR 3ES9A 1KYIA 2PX4A 2ODWA 3M5WA 1PJRA 3EFHA 4EL0A 1KJIA 3G8CA 2PGXA 4YREA 3V7UA 3LW8A 2ZB4A 3CXRA 4S35A 4BWYA 2ZAMA 2YZGA 3TJMA 1PJ8A 3O8LA 3VHRA 3KOUA 3LT5A 4FNGA 2P4HX 3ZH2A 1HNWB 1A69A 1I3CA 4PZ9A 1OB2A 2QQ0A 2P3OA 2DUNA 5EZYA 3BRWD 5L6MB 4C87A 1R8SA 4A0FA 3L7YA 3LBYA 3DCIA 1JWLA 3GH1A 1ZS9A 4EIWA 4XFDA 5JD6A 1HK7A 4R2IA 3BT7A 3FVWA 4F2GA 4UD2A 5LJIA 5KTTA 1BC5A 1J2JA 2RGWA 2X7XA 3MHPA 3RDPA 3H4IA 2KW5A 2EX1A 2Q1UA 3HA7A 4RVNA 1ORWA 1KNXA 1FFXB 3ZKAA 5JALA 2RH4A 1E6LA 2O2EA 1C0IA 1P7CA 2P9BA 2TMGA 4IO1A 4O4HA 1JDNA 1C0KA 1VJTA 2X3FA 2DCMA 3GGJA 3IUPA 3PHCA 4MS3B 1YQGA 2C9ZA 1P60A 3P71T 4LDQA 4R31A 3SKYA 1BG6A 1FSPA 2IHTA 2MCFA 3V5NA 1TJ3A 1OILA 2DAPA 3VHXB 4LMRA 4KKXB 2VDNB 5BNTA 3KKNA 1JWBB 5AVZA 1FVHA 1TU0A 4M60A 3ZWNA 3C4QA 3D8BA 2XJ4A 3JWGA 4L4ZA 3KR0A 2C96A 4YNBA 5I4KA 4P58A 2D8AA 4FJ2A 1IWPB 4PYIA 1SVLA 4RZHA 4LXHA 1Z7YA 4PYNA 3A1FA 3DMNA 3DUFA 1VP9A 4R2KA 1JKJB 4M9CA 2X42A 2AJCA 4BJ5A 1M1YA 1LNQA 1WZEA 4IIJB 1QRUA 5JJKA 2HK7A 1NQVA 3ETEA 4RPKA 2PMBA 3ZDAA 4MUHA 1FYEA 5HZGA 4YRFA 1GGJA 3CCBA 5D6OA 4WKOA 9GPBA 4AX4A 4NEHB 1WZ2A 4J4HA 4DQXA 1U3DA 3E7WA 3EGEA 5G1PA 3TNFA 3P19A 5F78A 3AI1A 1LLQA 2A5GA 5KOIA 3FCSB 1UBCA 3PEYA 1GAWA 4MGEA 1CF9A 5HE9A 2JARA 4C0QC 3AW8A 4IQGA 4FWTA 1IXYA 1QU2A 4UOZA 2B7CA 1OVMA 4IM7A 2VP9A 4LVUA 5B3AA 3IIJA 4MPTA 3V2IA 2P0AA 4ZVSA 4ZJYA 1Y4DE 4O8CA 3W5AA 1HFEL 5CYFA 1ZOIA 1VLQA 2A1TS 2H1SA 4UHHA 3CZRA 4BB9A 3CRRA 3KQNA 4LF9B 1ISMA 4Q4HB 3VOAA 2CNWD 3RVQA 5CFLA 2H1VA 1UDWA 2PKCA 2ZROA 1LVHA 3GJYA 2JLSA 1MA3A 3QOYA 4AU1A 4BGUA 3HO6A 2C2XA 4WKCA 1UM8A 3FMFA 3SQXA 3BL8A 1PYOA 3GNLA 2H1CA 5ALKA 3RC2A 1KO1A 3F6RA 3SKVA 2BN4A 3KT0A 4MRSA 3WGYA 1XA4A 4LJ9A 3G0IA 3D8SA 1YU9A 3PEVA 4JIGA 3SNHA 5FAKA 1ZPDA 2EFGA 5I9NA 3BDVA 3PBKA 4L4RA 2HQ1A 3UWSA 3AT1A 1SOWA 4P92A 4ZJZA 1L7DA 3BRWA 1I5OA 3D8HA 4PZZA 1XHFA 1IULA 4RSRA 2QLFA 4ENWA 4ZCTA 1N8TA 1JR2A 4JI6B 1Y8RA 4CKXA 3K6SA 2Z2JA 2X1MA 1OXXK 1Z74A 3ISJA 3OO1A 3T9DA 4RTKA 3HP7A 4HWGA 1HYBA 1Z6XA 2P5TB 3UPDA 1CPYA 2HR1A 4OMDA 1KL7A 1VI2A 5AW0A 4WLFA 4MAMA 3VDNB 1Y3FE 3L8GA 3X2FA 3ZDXB 1U2EA 2Y1GA 2OO5C 3ZE8A 3COSA 4PC2A 3AU9A 1E5XA 3OBIA 3HLTA 1VYTA 2PEZA 3W3AA 3KWJA 2FJPA 5H81A 2A94A 5IHPA 4CMIA 1WXHA 1WP9A 1JFSA 1XQ9A 2XOEA 1C1XB 1DBPA 1ES9A 4IGAA 4J7CA 3TL6A 3UCFA 1CE8A 5H16A 1GTSA 1T6YA 1O6BA 3BB4A 3M0EA 5DBFA 1EQAA 4FYJA 4YHBA 1DIGA 2CZCA 3I2YX 2A9QA 3ACDA 3EHEA 3QWIA 1K66A 3JPYA 3AIKA 1VG1A 3U4DA 1RIIA 1GSIA 1HDCA 2EKBA 5CTJA 2WMYA 1BZYA 2V9ZA 1UP4A 4GR4A 3VBEA 1NRXA 1JTEA 1XXHB 3AB7A 4MYUA 4YGYA 1UPCA 1UBHS 1XJQA 2DTXA 3KUKA 3P9CA 3R0XA 3LK7A 2PRKA 4M8NE 2DR3A 4ZDWA 1SBTA 5B58T 3GVIA 4PYJA 2UXCB 2BONA 2V6MA 3MYYA 4HB2A 3VOSA 4E13A 4N8EA 2N75A 1QBKC 3I12A 4WBSA 4IIJA 4CQJA 5L3RA 3HM2A 4N5IX 2FFBA 1OYYA 1U94A 4YAKA 2IXEA 1XPJA 4G0XA 5H4HA 3COYA 1NXVA 4NVRA 5DGCA 1YJQA 4TZ0A 3NAGA 2W6JA 1CR1A 3W5VA 4JP3A 4KVGA 1CP2A 1YJ5A 2PUHA 3R3HA 3M6FA 4M6WA 1A04A 3OQIA 3OIYA 3P9IA 2IYYA 1GNRA 1J8VA 1O54A 2D3WA 2X6TA 2FR1A 4OP2A 5FUYA 2JFZA 3GPCA 3LLCA 3HB5X 3HSYA 4KC0A 2PG3A 3AUKA 5T3YA 4MR7B 5F76A 4FSXA 1O1YA 1OH7A 1IHYA 3PGXA 3DR3A 1M72A 2PK3A 4RK0A 3JZDA 4KIGA 1N6NA 1ISIA 2BBTA 1RLJA 2ZRNA 1EA7A 2AKAB 2OD2A 4BE9A 2D5LA 5CDFA 1YE3A 3WMEA 3JW8A 1LLCA 1O94D 2HLDD 2NQ2C 5EHGA 4AXXA 1F20A 2O5EA 1IHOA 4M76B 5FI1B 1EZ4A 1G5FA 3NFYA 4RESA 1LI4A 4C4PA 1NI3A 3PX7A 3R3VA 4R41A 4BFXA 1KAHA 4H35A 3T99A 3IA2A 2V3VA 3WKDA 3VZCA 1SBIA 3UN1A 3ZD7A 1SHTX 1TGYA 5LP6F 1XVIA 2GR9A 4L57A 2C4WA 2DPYA 3M5PA 4FDUA 5HRCA 3ZQJA 1ZJ5A 1XEWX 2QPTA 3IOCA 4MW7A 4CMCA 4DKJA 5HIMA 2HY7A 5FTLA 2GUGA 1HM5A 3ZGXA 3I9JA 2GEDA 3FWYA 4II3A 4ZOAA 4IP0A 2VNIA 1BEZA 1JEAA 1RJFA 5FEMA 4F21A 1FL9A 1NVVQ 3D4NA 2O1EA 3C8DA 5AK5A 1MBZA 3F7OA 5MFPA 1W0CA 3N6XA 4TV9B 4DVGA 3AG5A 3NTVA 2ONJA 3FVTA 4DDUA 3EWIA 3FYHA 5B58C 4Z8YA 3INRA 3DNFA 1P5FA 4GMFA 3U44A 3OD5A 3KUCA 2JGDA 1G4UR 3N9IA 3IXMA 5KHAA 3KNZA 1GWNA 1RWVA 3ED1A 5DHRA 5LU9A 1Q0QA 3PPVA 5ECWA 4B44A 5J4KA 3O2SB 4I2NA 2D2IA 2V96A 2ADOA 3C7KA 5I7UA 4BE7B 4YJHB 1D2MA 1EXVA 4RE6A 1QGYA 4C6SA 3FWPA 3WBJA 1FVXA 2KBFA 4WFKA 4R1PA 1IC6A 4D96A 1GKUB 3DWGA 4BUZA 4DYVA 3TAXA 4ZA2A 3V4FA 5HGXA 1DG3A 3LTEA 4UU7A 3I39X 1SD5A 1Z5WA 3LX8A 3NYWA 3VBCA 3ETCA 5JBQA 5MGBA 4M3NA 3SXJA 2OZPA 1LPBB 3OCUA 2F43A 4HPWA 2HU8A 2FPWA 3ED5A 4GLOA 4MINA 4CODB 2Q2QA 1JFLA 3EQ9A 4KGDA 5LQJA 1Z4OA 4GKAA 1EE2A 1QKKA 2X0IA 4YB8A 4UXIA 2HO4A 3GUUA 2FP3A 1PIWA 1ZBQA 2O5VA 4NBKA 2R60A 2FWBA 3C16C 4DLBA 3ZJVA 2C9YA 2PA0A 3BGSA 3AJAA 4MW9A 3PCXA 2XI4A 2OK7A 1V5EA 2YWRA 4GWGA 3KB2A 4YJFA 4ZZ3A 3BXXA 1P1HA 1ZMRA 1FDIA 2FFJA 4W82A 1TF2A 1S8AA 1M7GA 1DQSA 2VHYA 4EB8A 4LRSB 4MVYA 4CQLB 1ZM2A 4JL6A 1J8QA 2OGTA 2II6A 4M83A 4F4IA 3CZCA 1V7ZA 2IS1A 1TDJA 2FWRA 3AIMA 2PCLA 3ND6A 3A6DA 3G1WA 5LUAA 1O9HA 4BO4A 1R6BX 3G0BA 3B1VA 2R7LA 1R3DA 2WU1A 5EIAA 3ESXA 3TIVA 2O2CA 3UT5B 1CY0A 3NEJA 1PG0A 3PJGA 5AVUA 1QHHB 4UBIA 5FNVB 1W8IA 4XD7A 1VJRA 2VK4A 4JC4A 4W1PA 1KQNA 1TQHA 1TD1A 1M6HA 4FYKA 3RUAA 3WDSA 2AJBA 2PJDA 1QTNA 5EIFA 4OH1A 4EYOA 1KYQA 5I6DA 4UEJA 1K7CA 8OHMA 1EVKA 3I1YA 3KAPA 1C14A 1COWD 2FG5A 2YZNA 3FHOA 2G67A 3AV0B 3HJAA 1XT6A 3QPWA 4HC4A 4LPKA 5CURA 4O02B 5H59A 3ZI7A 3VKHA 1NXOA 4L3VA 5C81A 1HMYA 3OSUA 2DE0X 3PDCA 4TTJA 2WNHA 1WMSA 4W5HA 5JQGB 5AW1A 3X1WA 1G1MA 4URVR 3B70A 4G56A 3PR2B 1H8HD 2VYQA 3QF4B 1J21A 2VHCA 3SVLA 3ETHA 4S1WA 1IUKA 5JEDA 1BVHA 1MU0A 2OA0A 2BHTA 1C7IA 1NKTA 3LFTA 3ZV4A 5DTQA 4D92A 2VJNA 2O1XA 3UJDA 3ESQA 5AW8A 5KYVA 2DR2A 3WTBA 1A4UA 1DZIA 1MN6A 3GG9A 3KVRA 2CDBA 2XCUA 4DMKA 1DKLA 3C8UA 3WAJA 5AW2A 4Y6SA 4TXHA 2PX2A 4MARA 2Q62A 3HLKA 2XTMA 2PZBA 4WLOA 4L22A 1AGYA 3VVCA 2FFRA 1SD1A 1WW2A 3A9RA 3F6CA 1E1RA 2DHDA 1AUVA 2XR1A 5JFGA 4ZZ1A 4G8BA 1K5HA 2G3YA 3BBPA 3NPMA 4G1FA 4TPKA 1FP4A 5ALUA 1DG9A 2FLVA 1KEVA 2X0FA 3OHSX 5HDQA 1QLJA 4QEDA 1X9IA 3BE6A 4MV0A 1P1RA 4BNUA 4DCJA 1B2RA 3KBOA 4KQFA 2IODA 4ZDJA 4Q4AA 1XYGA 1TA0A 2JVKA 3EFBA 1F6WA 4EARA 1TZCA 3LWDA 2DFNA 4N0MA 2GKSA 3DEFA 4D0SA 1L1QA 3T38A 1SC3A 1O6ZA 1KBZA 2AL7A 1NC1A 1G98A 2EBWA 2M1ZA 2SNIE 3CW9A 3S2YA 1QB8A 2BGIA 3O1JC 1KVUA 3BIWA 5A7GA 2OXCA 4OIFA 4IJVA 1I4WA 2VYVD 1RPZA 1K63A 2J9FA 2ZIUB 1S89A 1Y63A 2IYRA 2NZVG 2QI9C 1MV8A 3NHRA 1VCNA 2PYDA 4PGAA 5K9ZA 5KBYA 4ZYTA 4UUNA 1ZM4A 4G41A 2XPCA 1HNZB 1RVDA 2C8VA 1YQWA 4JBHA 4JLVA 3LQKA 1KI1A 1Y1LA 5G0TA 4ZVVA 4DR7B 1UOQA 1AKNA 4P4SA 3AYXB 1L6IA 2I3AA 4G07A 4IIUA 1KJWA 5L53A 3UXEA 3L4KA 2RE8A 4E5NA 2CV1A 1D09A 4C21A 2EHDA 5SZIA 1WV0A 2ZE7A 4HGOA 2PR2A 1Z2CA 4MSUA 3QMPA 3WR5A 5L95A 5LIPA 1GT91 4RS3A 2NYUA 2AI1A 4LWZA 5GV7A 4PNHA 4HWSA 3FG9A 3BXOA 3FCAA 3QF7A 1GD1O 4YDHB 2HT6A 2R7AA 3KAJA 1YFJA 3VNUA 1H6AA 3IAM1 1MAVA 4MEBA 1NPTO 1VE6A 5IHXA 1I36A 3VNVA 1FYFA 4LE1A 4I4NA 4DHWA 1UWLA 3GFQA 4LHXA 1K8XB 5DNCA 1C5KA 2GDZA 2O20A 3WB0A 2H2WA 4OA5A 4UULA 3DKKA 2J6HA 1KQPA 2DVMA 5LDGA 3P0FA 4FYIA 3BN3A 4L9SA 3HBFA 1EEXB 1CEXA 4MP3A 4UXJA 3TUIC 4B32A 2VT2A 5CB6A 1QYWA 3NU1A 4YP6A 1J25A 2AFVA 2RC6A 4N0QA 3V9PA 1GL3A 5BORA 5EP3A 4LC1A 4RTOA 2O8DB 4IGEA 1XIVA 3BFJA 3FMVA 3B20A 3PR3A 4ND1A 5GAJA 5AVVA 1P9LA 3QLVC 4OK5A 1FYXA 4MCAA 4NPHA 4UM9D 3U17A 2DLDA 4IWNA 4OX9B 3FSGA 2V8OA 4RGBA 5B1EA 4B8ZA 5F9MA 4F4JA 3BE4A 3F71A 3OQ6A 4B6GA 1IIRA 3RC3A 1CJTC 4XWKA 4PRLA 3LM8A 1FY2A 4E7OA 1ZI9A 5KVVA 2IU3A 4CTOA 2YY6A 2YCLA 5B3LA 2FSSA 1Z56C 4Q4JB 4A92A 4R6XA 5KYKA 1P31A 1X7XB 4N5DA 3EJWA 2XRZA 5LC1A 4KOAA 3CEPB 2Z2XA 2IYEA 3CRQA 1IHUA 4P98A 4EQ6B 4JT8A 5ICSA 3TIIA 4ATNA 4HF7A 1OLSA 5TX7A 1ZFNA 2VF4X 3ITKA 1T9ZA 2BLNA 3F6PA 5DEIA 2XGSA 1I2CA 2AD5A 2QP4A 4QDJA 1SHKA 4O4IB 3W5IA 4TX1A 4ZAXA 4AMYA 3L43A 4ALLA 4DC1A 5C2JB 3QX3A 2P91A 4YECA 3H17A 5IUKC 2OV4A 2Q07A 3R0VA 5DM4A 2WT9A 1Q16A 2HJVA 3LBNA 2WWVD 4D4KA 1AUPA 4MHSA 2ZBGA 3BA6A 4JUIA 4TMVA 2ZTMA 4EELA 3SBXA 1YA6A 4D8XA 1BH6A 3P2KA 3W7AA 4PGMA 2X4DA 5CNMA 5AW3A 1ONPA 2GYYA 4ER5A 4RMHA 4KE7A 2ZI7A 5A3SA 4DQVA 5JTTA 3IAHA 3PEEA 4YR7A 3L1UA 1H69A 1NFFA 1U28C 3BTSA 3QBVA 5KTKA 3AUFA 3A4MA 2O2HA 4EECA 5F3DA 4EYQA 5DP1A 1A9TA 1V8OA 4HVLA 1XMQB 3H1TA 4N6GA 1GL7A 4NQRA 3T15A 2P78A 1MJFA 3CU5A 5FBZA 5MGNA 2HL6A 3EFOB 3RVPA 3B1XA 5TMPA 3R7FA 3VX4A 4BO2A 4CEHA 5K3FB 2EZ8A 4C6TB 5EESA 1DFHA 5H9WA 5TVKA 1WU7A 5DZSA 5K05A 5SY9A 4M1YA 1GXSB 3E5HA 2VDUE 1UF9A 4TKZA 3QA9A 3MBKA 3LHSA 3T7DA 4LY9A 2FWJA 4WFIA 4YJ3B 3V8EA 1E9BA 3CNQS 4O4LA 1VA4A 1F0YA 3PFGA 3WGHA 3ZE2B 5LVAA 5IKXA 1Q1NA 4N5LA 3LPLA 1OFTA 4R1LA 4ZU6X 5EIXA 3K1YA 3SIPA 3ND9A 4W5TA 3U7HB 2VQ6A 5KYUA 4O4JB 2HZBA 3QIAA 5TF0A 3SS7X 3FN4A 3KXLA 1LV8A 3QV2A 1SBZA 4EQ6A 5HFAA 2FR8C 2O3SA 1W25A 4TWAA 1HUQA 4P08A 1I3NA 1U8UA 4GDMA 3UG6A 3NC4A 1N6IA 1S2MA 1YZKA 3FGZA 3ANYB 4G63A 4QYTA 1E8MA 2HWWA 4HGYA 3VYWA 4PHHA 3CONA 2RHCA 3AHIA 1BMQA 1Y9ZA 1RYNA 2RI6A 2GEVA 3HXPA 2AG0A 3EOBI 3WTCA 4LNAA 5H82A 1L5YA 2O1SA 2PIAA 3NALA 4DWVA 2IEDA 1SOAA 4MUFA 4PX3A 4TVSA 3BE8A 3TE6A 5DE3A 1FRFS 5BN4B 3KJEA 2CHFA 2W48A 3E9RA 3DD5A 4K9DA 5EJGA 2D62A 3OFSA 1YBHA 2NTJA 3M5CA 1N5MA 4KDCA 1ND5A 4MV3A 1JWAB 2XOXA 4HNAA 3EC1A 3PNLA 4QOIA 1EVJA 1Z22A 2UV8A 3DONA 4BNFA 5CB0A 1KAEA 2XWSA 4KRYA 3B9BA 2VKTA 1AUOA 3S5JA 4QWMA 2B25A 4UC0A 5DASA 4ZD6A 4QVIA 1JSZA 3PXCX 4FBMA 4TS4A 4QGSA 3CVWA 1FXWA 4X85A 5DULA 2R4QA 3CB2A 2XQJA 3OQHA 5BWBA 2XF2A 1GEGA 4URFA 2TSYB 3LDHA 4A36A 2B0CA 1AQYA 3BSFA 3LG2A 2YZKA 1A9RA 4NBRA 3TZQA 1QH0A 4ANFA 1E2KA 1T3GA 2H4YA 2VQFB 5AKLA 4RNCA 1BS1A 1D7OA 2G5GX 2WG2A 2ZJ1A 4YY3B 1P4HA 4KQCA 4TSKA 2DPGA 3K6JA 4H4DA 3TQCA 3CR8A 1SXIA 3FFXA 3DKRA 1VFNA 1OLXA 3O2NA 4PPQA 4P1ZA 1EXDA 1LU9A 2ATIA 2B2XA 3C6QA 3CKMA 2P9YA 4KNWA 4AS1A 4KQWA 2NO6A 1U1CA 2ZSUA 1QZUA 3L7JA 4PRKA 3SYMA 4C4ZA 5JZBA 5LR6A 3KWFA 5K1ZA 4OL9A 2PY6A 3ZD8A 1SKQA 4NICA 1NE7A 3HCOA 5CJJA 4U6QA 1L0BA 4RJJA 1IK4A 1AQ6A 2QYOA 1UDBA 3ET5A 2GCPA 2AWOA 3OQIB 4R3WA 3VA7A 1RXIA 2Q5EA 3MTIA 3G8AA 2QQ5A 3O93A 4WINA 5AHOA 2V0CA 3P9SA 2HRQA 1DP4A 2ZDQA 5FV7A 2YL2A 2I2WA 4PFKA 5BURA 3L02A 4XYGA 1TTPB 4UTOA 1WHSB 1Y37A 3NHBA 1QE3A 5K3DA 3PR1A 5EZ5A 4E33A 5DW0A 4AY2A 3OBBA 3CNHA 4MQ4A 4FOLA 4L4XA 1D2GA 3K7EA 3X1YA 1DIAA 1VGRA 3K2IA 3KJIA 1SD2A 3TXXA 1LBSA 2WYOA 3IKMB 3QNWA 3RTAA 2C2GA 1YJBA 2HBYA 3MD9A 1PK8A 4C4TA 3EUEA 4LRUA 5A5EA 2QV0A 4GPIB 1WLSA 4K9LA 5KNCA 1DBWA 1E5QA 1I7PA 5LOVF 1Y7LA 1OIXA 5ALEA 1BQ4A 1Z8HA 5BV8A 5AUQA 4OLBA 2QM0A 2QMYA 2Z58A 3DT9A 1XD2B 2O6HA 1B6GA 3RYIB 4EO4A 3T5PA 1PV2A 3MD0A 3HYLA 4JUAA 1E2LA 3B9QA 2QAJA 1V1MA 1CE8B 4IFEA 5TPWB 3AVPA 3AL3A 4TXJA 5HKKD 3PE6A 1FIUA 4RA9B 1E1DA 3DDOA 3PPYA 4ZVKA 1YI1A 2ZRCA 2ZRLA 2EZTA 2NVUA 3W8RA 5FV4A 3AVQA 1KVSA 5ALJA 1BDMA 2XUIA 1X1TA 4IXTA 4NJOA 3CNNA 3VZDA 4F9EA 3QX8A 1UMBB 5CVDA 5CLFA 3V34A 3IUJA 3SYRA 3PT9A 2JFGA 4ZYYA 2HLPA 3KVYA 2OT3B 3UAGA 1C2TA 1XKLA 3JQGB 2DSTA 4U0JA 1QQ5A 1KA9H 2BKUA 1YZQA 3L1IA 3QITA 5BOSA 4LBZA 1VLVA 5AI0A 1H6CA 1FTGA 3QLEA 5KKAA 1CVLA 5LPNA 2EBUA 3MK31 1QMPA 1UPXA 3NWPA 1U4SA 2EYUA 1UXHA 3EVFA 3GYBA 5EJ9A 1NR1A 1N9KA 1VLLA 3OE7A 5EPUA 2FRDA 4HAXA 5EJ7A 3GXBA 4QU8A 5EKSA 2EWWA 5BVHB 2VAXA 1KS9A 2ZS9A 4A91A 4A3SA 4UASA 1WCXA 3WY9A 4CG0A 4OTZA 4JLKA 4ZI5A 5HFNA 5GM1A 1ZU5A 3VV3A 4AKHA 3JQAB 1XZQA 3PUZA 5DO9A 5IK2D 1C7FA 2B4TO 3DEHA 3G9TA 2DWOA 1UKVY 3KYCB 2A2ZA 4UUAA 4X20B 1UINA 2XVZA 4WXHA 1NVMB 3GROA 4CIYA 3TW6A 1ZH0A 4HMPA 2RK3A 4J0JA 4V0MA 4XDYA 3C3YA 4YAWA 1ZNWA 1Z75A 3UANA 1JJVA 5LQNA 2O5CA 3KS9A 3PA8A 2X14A 1UZAA 2WKSA 1C0EA 2ON6A 1JU3A 1WCIB 2H18A 3DJFA 1SELA 5FADA 4XD7D 2XB9A 4BVGA 2ZM5A 2ISSD 2VCYA 3M2TA 3VZPA 4MVJI 4EENA 1YGPA 1CUYA 3SMVA 2FZEA 2LZ0A 3FYTA 2ZS7A 2VJYA 3I9NA 4CF4A 1CIJA 4G65A 1QO9A 4IXMA 4U7WA 3I0NA 5JANA 1VKJA 2WAXA 2GX6A 3E3MA 3NM6B 4M86A 4TTAA 2FJUA 4OQYA 1QIFA 4RQUA 1KDRA 1A9XA 3D3EA 2NXWA 3ENNA 2GN2A 3FWHA 3KWLA 3RWBA 3OIGA 3CXUA 4Q7EA 2TMDA 4OUDB 1FSSA 3WGGA 5KDDA 1J2RA 3LV8A 3FCUB 3FIJA 4MVJH 4YV2A 1YNOA 5F7JA 4QZVA 5KOHB 3OZWA 3I23A 4J3FA 4HZUA 3C3CA 3M1YA 3E3OA 5SYAA 5T5QA 1DGQA 1CYDA 1YDGA 1MPTA 3LY9A 1XNRB 5AHKA 3DZFA 3FWZA 2G9NA 2BUCA 2HDWA 1TEXA 4R69A 3FJ1A 1F6BA 1ZGZA 4LHZA 5J4LA 3WHKA 2WB2A 3RHSA 1DG1G 3BRCA 4IDHA 3HVJA 4L28A 3RFUA 1KSJA 2VT6A 5AUOB 2CXUA 2P9ZA 4QEKA 2GT1A 4BVBA 1GA1A 2IZ0A 3B1KA 4N39A 1A4IA 2AQIA 1X7YA 3KFVA 3EISA 3OX3A 1ZK0A 3JQ7B 5BR4A 3DBLB 1JI0A 5AW9A 2A9OA 1XCJA 1JIKA 1Z36A 4BNMA 1DWOA 1DHTA 1XWIA 4KIWA 1ORRA 5EE3A 2ZIXA 1N0IA 2ZGVA 5HF9A 2JF0A 4C43A 5CDGA 1DL5A 1BS9A 4MX8A 5CVTA 3WK4A 3UK2A 1JAHA 4JVNA 3RSCA 1US8A 4Z0TA 1WF6A 4RTQA 3P9RA 5CEEA 3ENKA 3MIIA 3ACCA 3N3AC 3OT1B 3EIQA 1XK7A 5TT0A 2Q5IA 3TZBA 5KCZA 2QEQA 1XLTA 3GDOA 4PLWA 1BDBA 1BGVA 4OQQA 4PFQA 1T9GR 5HKBA 2W2XA 4RCVA 5ES3A 4A1FA 1BNCA 1U8TA 4N9QA 1X14A 2ZJ4A 2JL1A 1ZJ4A 2QN8A 3VPXA 3SCZA 4M8LA 1DB3A 3T7KA 2P62A 3D0OA 3CEHA 3P97A 3WADA 5FYDA 3BEDA 2XNJA 1SKAA 4KX3A 3ZGLA 4EWLA 4AM8A 3ZHTA 5A4IS 1C1YA 4G3XA 2QE7D 2SHKA 2BH2A 1BXRA 3KTDA 4P4NA 1Y6QA 3WK9A 1DLJA 3D4OA 1T4DA 4C04A 3DB1A 1QH9A 3WL4A 5AW4A 5F98A 1YGYA 1C3LA 1QOZA 2HADA 2XA1A 1O6CA 1YCDA 1GRNA 2D13A 2DTDA 1NYRA 1Y7IA 2G8NA 2H8GA 2JIPA 5BNZA 1GQRA 1CX9B 2ZG6A 4LE2A 1U0BB 4HDRB 4MWTA 2V6FA 2YN2A 4MHOA 1YZNA 1BXZA 3NEAA 2PS9A 3RT9A 5JZOA 1EB9A 1G5TA 3B52X 3UUFA 3VZSA 4BO3A 2B78A 1E6MA 3FZEA 1P9OA 3DYBA 3C15C 1DJOA 1QFSA 2G08A 4OFBA 1HX7A 4II2A 1GU0A 4M1WA 4UE2A 2GRJA 1ITZA 1JSCA 3B3FA 3A1EA 4DSZA 1D6NA 5J4HA 3IDQA 1DT3A 4IMIB 4H1VA 1Q7TA 1GITA 1Z73A 4P53A 4GYJA 1GPWB 3OCWA 1YR8A 4Y6PA 5CMLA 5I7OA 4HWTA 2AJ8A 2L0XA 5A02A 3M4YA 4GX2A 4IHKA 1XV5A 4LOLA 2MU1A 4ZYUA 1CDEA 1KVQA 4EJFA 3QPDA 2HA2A 1N8KA 2FW8A 1K6EA 5IJ0B 2ZPUA 4HDKA 4HNTA 4ZK2A 3PLAE 4F2WA 4UM9B 1AKRA 1UWCA 5IT4A 4DHEA 1L7OA 3EGVA 4Q9DA 1GT6A 1UODA 3H5IA 4RZQA 4X8HA 2Z6QA 1MMFB 2CYBA 1EUQA 1DAPA 2R44A 1KBQA 2IWRA 4W7HA 1E3TA 4TRNA 2B5OA 3UJNA 3N28A 3KV1A 1T1GA 1VP3A 1VIAA 2FOLA 3ANLA 3BH6A 3HWWA 5ADWA 3WNDA 4LTMA 1ADCA 5F9FA 4WD3A 1KKLA 3OEHA 3NH9A 3OU7A 4F8YA 1QYVA 2ZWAA 1YRQA 3A1DA 1QFJA 4E2YA 1BYUA 5JSYA 5C3MA 1IOLA 4LX0A 3CRVA 4D9EA 1JE0A 3MWEA 1F14A 1IZ7A 3GNQA 1KI8A 1N2CA 3ASZA 2D7JA 4YUVA 4DLZA 3R7AA 5AQ1A 4BIIA 3CCCA 2CMKA 2RAUA 3OPMA 5LCXA 3PU6A 5B37A 2HHJA 3L9WA 3E3LA 4UUOA 1U7DA 2FQYA 2ZPTX 3G2QA 5CUQA 4CM6A 4YRMA 2QNRA 2GJ4A 4HGQA 3P4XA 1R18A 3M33A 3GEMA 3CVXA 3WS7A 10MHA 1KMIY 2AWNA 1T6ZA 5DGHA 1J39A 2PV7A 2WDZA 2QNIA 3H05A 4KCGA 4MR8A 3D59A 4RY9A 5FNZA 3EDQA 3PQ2A 3UKJA 4WQMA 4ZDIA 3UO8B 3JQ8A 5IS2A 3NW9A 5TV2A 3L18A 3L8MA 3T3HA 4B2YA 3EOZA 5GONB 3ICOA 3MYRA 4BPRA 2W2KB 2CSXA 4Q7LA 4DE5A 5E7JA 5JCJA 4L4SA 2JIDA 1Z6PA 5FWAA 2DB3A 2QI9F 2M6RA 4GIBA 1YB1A 3BTVA 1HURA 2O52A 2W98A 1QAMA 1XLTC 1CZNA 4B7AA 3KX2A 2WEKA 2NQTA 3A2KA 2PT5A 4R01A 3LBAA 1DNPA 1PGPA 3KAKA 1ULBA 5KOJB 4EB6A 5ICMA 1DXHA 4YRJA 1DQRA 2VP3A 4AN0A 3DMYA 3MCVA 3PHHA 1XWFA 4H6WA 1VL6A 3IHLA 4WUVA 5IXSA 3ZHUA 4LWPA 3PDUA 4BNVA 4IYJA 4TN5A 2BGNA 1NXWA 2XA9A 4PZLA 2NWQA 2RARA 4RAOA 4FLEA 4D4HA 1B14A 5CIYA 2ZSEA 4Q03A 2DPMA 5LZ8A 5FP0A 2IPXA 2A9RA 3DPIA 3VSDA 3U61B 4RHXA 2A0UA 3E1KA 3PPWA 3ITDA 3WE7A 5FWYB 1LWNA 4WHMA 5DFAA 1AKVA 1Y1KE 1IJBA 4XYEA 3S8MA 2DEUA 1T4BA 2ZI4A 4ZALA 2C3UA 2Z98A 4D56A 4U2CA 2ENWA 1D03A 3DBVO 5K0GA 1JYSA 1UQRA 4RPCA 4A0RA 5KSZA 1AS2A 1PLJA 2W8BB 3D3JA 5BSKA 1VXOA 4F5WA 2L82A 1ZM9A 3BXPA 1LTQA 4LF6B 4NQZA 5J5VA 3QKTA 1XHEA 1P0IA 1DWQA 1GTMA 1AXRA 4HAUA 5ALNA 2F55A 2YN4A 3P5BA 4OB7A 1LF5A 1QCZA 2AMLA 5AR1A 3G2KA 5IN4A 1D9XA 4TSFD 4UHJA 1PZHA 3A3KA 1U0NA 3ADOA 3G7NA 4KTTE 4CIWA 4KWEA 2REOA 3RVKA 4DXAA 2YXBA 4P7KA 3D9QX 2CK3D 5DNEA 5JC1A 5FTKA 5AXDA 4MS3A 4BNIA 2VFAA 5IZ4A 2PGIA 3OWOA 1YZTA 3GRYA 4PGGA 5EXSA 2GSWA 2GCIA 4Q7JB 5KI6A 4GSLA 4DEYA 1CNMA 1DADA 3B6MA 4R9UC 4F4UA 1IN8A 1FFXA 1FX0A 4FFVA 1Y3BE 4F6RA 3IEUA 3SC6A 3OPXA 2O7SA 1OTYA 5TQJA 3SPXA 3BHJA 3LA8A 2B8NA 4DUYB 2AJTA 3A9UA 2YC4C 5U1PA 4CFZA 3LCRA 2LIPA 2VH2A 1BVRA 1QVRA 2GN1A 3SZUA 5CVCA 3AVWA 3UMJA 3ABQB 3B2NA 3I8SA 1ZMXA 1ISHA 1G7CA 4QXOA 3B5EA 3OP1A 4JSRA 1GNSA 2PD6A 4CYMA 2I7TA 1XTVA 1XDSA 2AG6A 3JWJA 5FWNA 4FMPA 3QYAA 1ZVKA 2R8RA 3HO1A 2JJ8A 1A0OA 3OZFA 4QOHA 1EIZA 1PFGA 1P2SA 1JQKA 2FDXA 1PDVA 1KY3A 3GFPA 2FZ4A 4I36A 1KDYA 4BP9A 3LECA 3VNQA 2Q3BA 5T8KC 4QQKA 1UOOA 5JUWA 2HYIC 3IESA 1QWOA 4CJXA 3VVBA 4D9BA 5DGIA 1CDZA 1P2VA 2X2PA 4WJZA 4DWWA 4GNKA 2C00A 3V8VA 1LPPA 3F7TA 3OZGA 2LGJA 4QC2A 3RIEA 5HCNA 1W4LA 4ALIA 2H1WA 5DCYA 4RGYA 3DV0A 2QRGA 2R6R1 3UGJA 1QIMA 2H4HA 4IZHA 1J20A 2CNOA 5EHQA 4N7MA 3ELUA 3NLLA 3K35A 3WLAA 4QG3A 3G17A 2WTEA 1YONA 3C6BA 1BWQA 4K0RA 2C88A 3THXB 3PWTA 1Y3DE 1H42A 1SOVA 2F1HA 5CDFE 5U9CA 3ZLUA 1Z82A 4IJMA 4JB3A 4H6XA 1G21E 2OVBA 4P7BA 4WRRA 5K3SA 1RTKA 3DFFA 3HZRA 3DHNA 4IG4A 2ZVPX 2F9FA 5CX1A 3TS1A 4BMYA 4CIDA 5L51A 4B3MB 2VHVA 4GH5A 5JSZB 3IQHX 3CX7A 3BE5A 3NM4A 4YXWD 4TQAA 2BKLA 2C94A 4OQPA 5JY6A 4W9NA 1J8YF 3FDXA 2HDHA 3H9JA 4WXMA 2X8WA 1U1GA 4G1EB 3A37A 1USWA 1EESA 5BN3B 2QPOA 4CWAA 5D85A 2GZDA 1ZXLA 4RIIA 1WXQA 3UJ3X 3T9AA 4WTOA 4KU4A 1YI8A 1TW2A 2HLHA 3PEFA 3TX2A 1OD6A 3VAAA 1O94A 5KIAA 2ADFA 5A4FS 1XPOA 3W1VA 3E2MA 1ZUIA 1HDIA 1AN0A 1PYDA 2FHPA 3AR8A 1A5SB 2R66A 2XAAA 3ORYA 2W0SA 2YV5A 4JT2A 4LHEA 4PLTA 1L7MA 5LQKA 3ETJA 4AAYA 5JCOC 4KWIA 1PD1A 1E66A 1UJ6A 3THSA 4CI9A 1Z5VA 1Q3KA 4Y2GA 1XXLA 2ET6A 3OE4A 5L3QA 1V4VA 3FFBA 1LWOA 3IOYA 2WWIA 4O2BF 1G41A 1GZ6A 1WY5A 2LCQA 1A3CA 2XSZD 1ZGJA 3PXAA 1I6WA 2J5KA 3UGTA 2HJ9A 3FMGA 3D6AA 4Y2RA 3U26A 2CMGA 2QMZA 2RKWA 2ZUEA 2XRYA 1POXA 1VIMA 4N01A 5EJIA 5JADA 4GBMA 4LJAA 3VO9A 2I4LA 4AD8A 3RUHA 4ROTA 3Q8LA 3EF1A 1TUEA 2WSBA 3AUJB 3PDJA 3GL9A 1ILEA 5C31A 3IT3A 4DARA 3PJRA 3MWYW 2P3SA 1QNFA 3MGGA 1IN6A 4UUQA 3LUDA 4EG7A 4XUEA 4LZZA 4D3SA 4ZTUB 1OOEA 4G8JA 4TXLA 3KPYA 2AS0A 3OLYA 3GT4A 3PGJA 2QW8A 3OJEA 2O3UA 1XCLA 2HSEA 3I6MA 2FW1A 2YX1A 4YT4A 4OHYA 2NU7A 5FIUA 1MC1A 2NO4A 3L6RA 2IELA 4LSGA 4BAGA 3VNAA 3GPIA 1F7UA 1GKKA 2QTZA 1P5HA 3C8HA 2P6RA 1JG6A 1YZGA 3S28A 3DTVB 3PX3A 2RIRA 3ABOB 2B94A 3LUKA 1SBYA 1UM9A 4NG4A 3SC4A 3I9V6 4UAGA 1P9NA 3F3MA 4ZIRA 3WYBA 1AM4D 4OFWA 1UPAA 2SKDA 2X4LA 4WK6A 1Z39A 4R4JA 3OM1A 2PKEA 4Q4CA 4OGFA 1UL1X 4E0BA 4IMPA 3EXG2 4CCSA 3WGJA 1HDGO 2FPIB 2HO5A 3GLSA 5GV8A 5ERXA 2HQBA 4TM7A 3P9QA 3IDOA 3ZTYA 3BQMB 2XCIA 3D54D 1V5IA 4HVAA 1VTKA 2RMKA 4C08A 5KQRA 1TU3A 3G0CA 3Q3JB 3K9QO 3RJ9A 2XKKA 3KCNA 2YZ7A 5AVJA 2D74A 2X0EA 1E3SA 5IT9A 2FI1A 2WFLB 3L77A 1Q6ZA 4KMMA 1R5JA 4L0DA 5EN4A 3T4UA 4J2OA 1GG9A 2R8YA 4D0NA 3MWGA 1G42A 2FDCA 5DN9A 1TZJA 3FKSA 4W8OA 4AW9A 1W5EA 2WC1A 4X7PA 2B37A 5I7SA 1OLUB 1UDAA 2YMQA 3O1HB 2GXSA 2J3HA 1VJ0A 1NXPA 3EPHA 4TMFA 5HCIA 2W70A 4NCKA 3CVYA 4EKEA 4E1AA 2HMTA 3IVMA 4UTXA 3T9BA 3X44A 4EATA 3CKLA 2CNWA 4X3OA 4D4IA 1HFWA 5KC9A