3AY7A

Crystal structure of bacillus megaterium glucose dehydrogenase 4 g259a mutant
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
260
structure length
260
Chain Sequence
HMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase 4
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
total genus 100
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ay7A00
2ZB7A 3ZU2A 3WFJA 1NP3A 3KYCB 3C1TA 4NBUA 2VUTA 1A5ZA 5ADHA 1R4NA 1HL3A 3JCZA 3MOGA 1GZ4A 1T24A 4RORA 4MOWA 3A4VA 5JBIA 1Y9AA 3AM4A 1PZGA 3DBHB 3B6ZA 4P4GA 4NFYA 1NWHA 4ZQHA 2EEZA 3FNEA 2PA3A 1S7CA 3WOHA 5I7SA 4GMGA 1JKFA 1E3JA 2PZMA 4UVIA 3JQGA 4N5LA 3A9WA 3CMMA 4JNKA 3RFTA 2B5WA 3F5QA 4L9RA 3VKUA 1FDWA 5GZ3A 4GX2A 5K6AA 4E2ZA 4RLHA 3VPSA 3OQ6A 2Q99A 3QJ5A 2CZCA 4MIOA 1O95A 2NQ8A 1UXHA 4YAJA 1R4MB 2AMFA 4XR9A 5DBIA 3MWDB 5TRTA 2ZJ1A 1IHXA 4P38A 1CDOA 1KETA 5TF4A 3BHIA 1SEVA 3KZVA 3PJEA 4W82A 2J5KA 5L45A 1B8UA 1DRVA 3MZ0A 4L4XA 3D4PA 3LU1A 5H83A 1YBAA 4Q3EA 4YRBA 2UDPA 1EVYA 3CTMA 2Q3EA 4DXHA 3D3EA 4XB1A 4BNZA 2H9IA 4K6FA 4WUVA 1R0LA 1VJ0A 5A5EA 5T57A 3JQ7B 1DDOA 4HBGA 4XX0A 2B83A 3FTPA 5ITWA 4RF3A 5GMOA 1V3UA 4PLHA 1CQJA 4J90A 4G81A 2Y1FA 2HRBA 3D4NA 4FFNA 1LQUA 2W98A 3AUTA 1GV1A 4WPGA 1BHSA 4LRTB 1QYVA 1Z82A 1UZNA 1UXJA 3PYMA 3GFBA 3HE3A 1BGVA 3LC1O 4IQ8A 4JLWA 1ADGA 3HB5X 4IMPA 3SC4A 1DSSG 4TKLA 3PI7A 1WMAA 1FK8A 2PV7A 2DPHA 1Y6JA 4GI2A 1N2SA 2Y05A 2C7VA 2QG4A 5EQFA 4FBGA 2Q2WA 2DTDA 1P0CA 2ZATA 5IDXA 2A9FA 2OZPA 4CV2A 3EGOA 3BMCB 3VH4A 2DQ4A 3I6IA 4YACA 2RIRA 1HWYA 2IZ1A 2YYYA 2P4QA 3RCBA 1YDWA 4YAKA 2V6FA 2JFFA 2DBZA 3EVTA 1I2ZA 1RPNA 1NX6A 1XQ1A 3TF5A 1QYWA 4URFA 1E1KA 3PLRA 3NGLA 3PHLA 4IGEA 1NQTA 1O6ZA 3MJCA 1VI2A 3O03A 3OIGA 3KEQA 3UXYA 1GQYA 3K9QO 5CG2A 5I7EA 3VPGA 2IZ0A 2JFHA 2G82A 3RSHA 3IAHA 2B4TO 2EP7A 1KVTA 1PEDA 1HETA 1QKIA 3C8MA 3T4XA 2VTDA 1G0NA 1LRKA 3DAPA 3BTVA 4OQZA 1R37A 3WYCA 2ZTMA 1PJ3A 2I5PO 1IZ0A 1W6UA 2NTVA 1U1IA 3GVPA 3LF2A 4YJHB 2DTXA 3GOHA 3I9KA 2AQKA 3IJRA 1SB9A 3I4CA 6ADHA 3Q3CA 2PD4A 4WJZA 4PIVA 3JQDA 4DYDA 5L7WA 1I3NA 2AEFA 2EGHA 3JYPA 5HTOA 2WTBA 5AQ1A 2O2SA 4ZRMA 1CF2O 4ZQFA 1Q0HA 1ZJZA 1JQBA 2OOSA 5DN9A 1DRWA 3DBRA 3HADA 1FDTA 3U4DA 1PL8A 2GNAA 5A02A 5IG2A 5JAZA 3IJPA 3JQ8B 4ND1A 1DIRA 1HE5A 1HLDA 4A27A 1YXMA 1J6UA 3BYZA 1ONPA 1DFIA 4LVCA 4AJ2A 2TMGA 3IP3A 4A03A 3ZNQA 4BVAA 3PFFA 1HE2A 4TRRA 3JQFC 2C29D 1WMBA 1D1TA 2QZZA 1ISFA 2BFAA 5TLSA 1BVRA 2EJWA 4NNJA 4QECA 2Y1GA 4TVOA 2FZEA 2WD7A 3AUSA 1ADBA 1LLUA 1MG0A 4WLOA 1T2AA 3QVTA 5BR7A 2D5CA 3F9IA 5CP8A 4E5MA 1NR7A 3L9WA 1DC4A 3OETA 3QWIA 2C07A 4Q3AA 1NASA 4ZD6A 2NVUB 4MVJE 3GGPA 7MDHA 2CF5A 3NDJA 4IIUA 4NK4A 2ZB8A 5I7FA 2Q2QA 3TSCA 4M49A 4XQEA 3CPSA 1O5IA 1FXSA 1CERA 3EAGA 5B4UA 1N92A 1RYDA 4MIYA 1MFPA 5HA5A 5J23A 5I7VA 2X1HA 4YBZA 3KETA 1ZXLA 4I08A 4E33A 4IUYA 4LMRA 2I3GA 4NJMB 1ISHA 3AM3A 4DMMA 1P45A 3H3JA 1VRWA 4XZ3A 3IS3A 1K6XA 4CL3A 3F4BA 4XWYA 1PJBA 5TNXA 2EW2A 3U5TA 2AQIA 2X4GA 3C1OA 1WZIA 4WCFA 1Q7BA 2GERA 1HZJA 1ZFNA 2H1SA 1IE3A 1XGKA 3WGTA 2Q4BA 1ZK3A 2OHXA 2VCYA 5A03A 4WNCA 3OBBA 3U4HA 5COBA 3TFOA 4PLGA 4RF5A 4AJPA 5G0UA 3G1UA 1WXDA 4JX8A 1I36A 7ADHA 4FS3A 1KC3A 1UH5A 2EP5A 5A3VA 2NADA 3AFNA 4CM8A 1OBFO 1PGQA 1MFZA 4FW8A 1EDZA 5HS6A 4KZPA 4IJVA 1VJTA 4DQUA 3FPLA 4RLSA 3MEQA 3MJSA 3UHAA 3PYXA 4FB5A 3QVSA 3TZQA 3DMTA 3ONFA 4BO2A 2Q45A 3INTA 4CLDA 4NJOA 4IDAA 1X0VA 3NEPX 1BXGB 1LI4A 4Y6RA 3OJFA 4TSKA 1IY8A 4NIMA 1P1FA 4YCAA 4EGFA 4OKIA 4J0EA 3UGKA 2I99A 1T2CA 2V6BA 3D5TA 4TRMA 2QRKA 2W90A 3V2UA 2UVDA 1XU9A 1I3LA 3OF2A 1HKUA 3FD8A 4BGUA 4M87A 3EZLA 5CDSA 3TZKA 1MUUA 3T7EA 3AOEC 4MP6A 3KYDB 2AXQA 3ASVA 1P44A 1KEUA 3DBVO 1GEGA 1B0AA 4J1TA 4YAEA 3L77A 5TGDA 4OKNA 3QWFA 1PZFA 4AVYA 5C7IO 4E6PA 3GZNB 1JTVA 3UH1A 3BTOA 3KUXA 3PHHA 4O6VA 2NACA 4CM5A 4YAIA 3UCXA 1N1EA 2D4AA 2X0IA 3TL3A 3U62A 4RF4A 4E5PA 2HO5A 2Z95A 2ZQZA 4PVCA 3WR5A 4AJEA 4DPKA 5L53A 4YRAA 3UCEA 3GGOA 4Y98A 2VZ9A 2Y66A 3ZWXA 4PLWA 4XKJA 1TVEA 5DBGA 3JD0A 4JJGA 4Q3BA 4D46A 2JD0A 2QW8A 3DXFA 1ZEJA 3HDQA 3OQ1A 5AXDA 3DHYA 4BO1A 1HDCA 4BNUA 3N74A 1C0PA 3S1LA 2ZB3A 4P22A 4NFSA 3N58A 3FNGA 4IS2A 3DFZA 3DQPA 4ALMA 5CDUA 2WDZA 5EJ2A 4RPLA 4YT8A 4QFDA 1IUKA 1Q0LA 3FI9A 2DBQA 2BGLA 2FZWA 2C54A 4JJFA 4ZA2A 3RBVA 4IQ0A 3JQAA 2Y1OA 4CLRB 1IB6A 3QLJA 4WLFA 1UAGA 2HMWA 1E5QA 2V65A 4ND2A 4KUGA 3E1KA 4DYVA 1YL7A 4CM3A 5C7LO 3Q2IA 1I8TA 3I1JA 3VVCA 1TEHA 1HDRA 5JYDA 3GHHA 1LQTA 4YVFA 3JSAA 1BSVA 1X1EA 4CV0A 2B4QA 1K0UA 4BKPA 2E37A 3RFVA 1VLLA 3PJFA 4ONEA 4YAGA 1AHHA 1D7OA 1AN9A 3WSWA 1EUCA 1N8KA 2EV9A 3HFGA 4U6QA 2E6UX 1Y5RA 4D41A 4DBVO 4MP3A 3JQ9A 5THQA 4D42A 4DLBA 4J1QA 4AJHA 2DPGA 2E49A 2X86A 5BSGA 1NVTA 5KJEA 4BQPA 1QYDA 1SPXA 3OP4A 3OHSX 4MVJI 3DOCA 4JP2A 2C0CA 3WMWA 2W2KB 1YB5A 2X8LA 4ND4A 4KMSA 4GX5A 3TL2A 3ZWCA 2BI8A 4JGBA 1C14A 1HDXA 1P33A 1EVJA 3AUAA 3VDRA 1OI7A 2HMVA 1Q7GA 1V3VA 3A14A 3D5QA 4Z0TA 5A4DA 4UVEA 4LVUA 3L6OO 3C24A 4CMBA 4S1VA 3E5MA 4CV1A 3TOXA 3C7DB 3GC6A 3Q11A 5AVOA 2BFOA 1YJQA 1R12A 2EIHA 4ZRNA 3WBBA 4FOSA 1WPQA 3QE3A 3CE6A 5JSFA 2QHXA 3NX4A 3BA1A 1NPDA 3NAQA 1W8DA 1ULUA 3PK0A 2YHIB 2PLAA 1XLTA 4A0SA 5T64A 3WJ7A 2DU8A 1E3WA 1VC2A 3DONA 1C1XA 1EEHA 4EZBA 2W8ZA 3WNVA 1K89A 2GLXA 3ICCA 1JLLA 3EY4A 1XIVA 1AE1A 1LEHA 5GZ6A 2O3SA 3U49A 1DPGA 1U5AA 2HCTA 2AG8A 3SLGA 3L0DA 3WLFA 5KIAA 1F14A 4EUHA 2X5JO 3U3XA 1CJCA 3M1AA 3BMQB 4CUZA 2H6EA 1I2BA 3JQ6A 3ZNNA 4MJLA 4K6CA 3DZHA 3D1LA 1E1MA 4BNHA 1WNTA 3AU8A 5LDHA 3C85A 3ST7A 4ZGWA 2NWQA 4GGPA 3ZNPA 4WOJA 3WSVA 4BKQA 2EKPA 4E30A 1I10A 1D1SA 3GT0A 4CV3A 5T6BA 4EBFA 1PJQA 2FRDA 2OFPA 1UAYA 2D5AA 5FF9A 3ZZNA 2O50A 2EKLA 4YJFA 4HX5A 4PLTA 5IF3A 3OECA 1LSUA 2GZ1A 3E18A 4BO4A 4ZJUA 4NU6A 4B3IA 2FPGA 3JD2A 3H9UA 3DC2A 1GDHA 5DP2A 1LDBA 4BQRA 1GYPA 3LZ6A 1I32A 1RWBA 3GA0A 1Y8RB 4GH5A 4ZQBA 2PFGA 4OJNA 4AJ4A 3G3EA 3RUCA 5L51A 4XB2A 2OORA 3V5NA 1HE4A 3QY9A 4U8GA 2AG5A 3LVFO 1P1HA 5IN4A 4CMCA 3JQCA 5DCWA 4BS9A 3GMSA 3RD5A 1U3TA 3ANNA 3P2OA 2FSVA 2FR0A 4B3HA 3TDKA 2I65A 3FRJA 3CXRA 1KC1A 1VL0A 3ZU4A 1Y7TA 3ZWWA 4B7CA 3TN7A 1XKQA 1IZ9A 1W73A 1TT5A 1DIBA 4NR0A 1WAMA 3ZN2A 2WWRA 2X0NA 4BV8A 9LDTA 1X14A 1Y81A 3NTOA 5CHEA 2DUUA 4HFMA 4OXYA 3LT2A 5JCXA 5DDIP 2Q49A 2FPPA 2HRZA 2P91A 1YL6A 3QSGA 2VZ0A 4MVJP 3RUFA 4GPD1 1U7TA 2GN8A 2B37A 2LDBA 1Z45A 2VRCD 4LW8A 5KKAA 2PGDA 1QP8A 4CMEA 4C7JA 1YL5A 1GAEO 3KLMX 4FJ0A 5F1PA 1V0JA 5L4LA 5A05A 4L4SA 4J4TA 1UXIA 1ZBQA 1K6IA 4OIMA 3RJ5A 4EW6A 1T1SA 4BNKA 1SCUA 4J9VA 4JP3A 3CKYA 2ET6A 2B5VA 5BNFA 2VOJA 4CMGA 3K6JA 4LN1A 5JDCC 3SC6A 1Y8QA 2GGSA 4BNIA 5EN4A 4A5OA 1FJHA 4OSPA 1B26A 5CPBA 4MKXA 4I5EA 4PFJA 3UVEA 4QX6A 2D0IA 4E21A 3OH8A 5EL0A 3GGGA 3QWAA 4Z9YA 2QYSA 2NSDA 2Z1MA 3PTZA 1E3EA 4ROSA 4DC1A 2BGMA 1JAYA 1B3RA 5IZCA 2OGUA 1YE3A 3ADOA 1SNYA 4TQGA 2OBYA 6LDHA 4II2A 2QRJA 1NAHA 1YQDA 4IJUA 2EHDA 3K5PA 3QRWA 1P31A 3K96A 2YDYA 3BMNA 4IZHA 3HDYA 5A9SA 1HDYA 4MVJH 2VHYA 3K92A 4XJSA 1B2LA 1B16A 3LDHA 1NPTO 4M54A 4YEDA 1CIVA 1I24A 4XGNA 4C7KA 2HSDA 4L8VA 4M8SA 2P68A 4O0LA 2RHCA 4XRGA 2PKQO 1OAAA 4HFNA 4A26A 4HNHA 2O3QA 2PNFA 1O94A 3KTDA 4L73A 3KYBA 4DL9A 4H16A 2BHLA 3AJRA 4LSWA 1R6DA 4TRJA 2FR1A 1Y9EA 3LLVA 3U9LA 3ONEA 1B14A 3I9OA 5G4KA 2CVOA 4FSHA 4LMPA 1ISMA 4PLCA 4CQLA 3DO5A 1P77A 3H7AA 1XYGA 1GEEA 3H2ZA 1QSGA 2EWMA 4N54A 2DTEA 1LRLA 3H6KA 3RUHA 5A9RA 4BKOA 1JDJA 3WQRA 4HUJA 1UDAA 4AJ1A 2NVWA 4Q39A 2XAAA 4R51A 1PU2A 4DPMA 5JDIC 2J5RA 3DR3A 3JYQA 2GUGA 1F12A 3PQEA 4GX1A 1C1DB 3PQDA 3WIDA 2O3RA 4KDEA 3PXXA 2AEMA 2XOXA 4FJ2A 3L07A 5AYVA 3IL2A 2PZJA 4XQ9A 1I3KA 1K6JA 3DAGA 4BNFA 5LC1A 2FSSA 3HDJA 1LA2A 1BW9B 1SMKA 2D59A 2PH5A 3OJEA 5T67A 3DTYA 4IMRA 4ZICA 1XHLA 2I6TA 4CLEA 1P3DA 4F6LA 3LC7O 4IDEA 4ALLA 5JS6A 2ZK7A 4PGFA 3PGJA 4MIEA 1ZSNA 4QSMA 4EYEA 1HSOA 1E7MA 3FN4A 1DAPA 2W2LD 1ENPA 1SOVA 2Q4EA 2JAPA 2VRBA 3WICA 2GDZA 4NBVA 2WSBA 1WW8A 3GLQA 4XJTA 5IXSA 4XCVA 4ND3A 4Z6KA 1AHIA 4J1NA 4EJ6A 2HQ1A 5C5IA 2J5QA 3ZWPA 1LU9A 1ZNQO 2DAPA 2O7QA 3FWZA 5KJ6A 5BT9A 4UUOA 3GAZA 2GZ2A 1JA9A 2XPCA 1EBFA 2ZYDA 1SAYA 3MTJA 1HDZA 1DJNA 3WMXA 3EUWA 4JCOA 1NNUA 4OOEA 1RM3A 3GDGA 1FF9A 1DLIA 1N7HA 1U2GA 1TB4A 1YONA 3EK2A 1GZ3A 5G2OA 4MVJG 4FQ8A 4Y6PA 3R3JA 1DLJA 4EDFA 1XG5A 4RDIA 5KVQA 4D44A 1M75A 2WE7A 4L0QA 4RGBA 3O9ZA 1XR3A 2Q1SA 3GG2A 1PL6A 4CMAA 4XYEA 1UP7A 1LXCA 4BNVA 1PJ2A 4DLAA 3BZUA 2Z5LA 5JY6A 1YO6A 2YQ5A 4J0FA 4QO7A 3RUIA 5L40A 4Z9FA 3ZW9A 1GU7A 4AJOA 4OQYA 2YJZA 1U8FO 4U7WA 4RPJA 4DQVA 4CR7A 1BDMA 3AY6A 3H8VA 4NDNE 3HG7A 1MV8A 4GKVA 4IJWA 3D0OA 5DT9A 4CLOA 5ICMA 1ZO8A 3MWEB 1UDBA 2PZLA 5HWSA 3KM0A 2D1YA 3E8XA 3BXXA 4TZKA 2ZQYA 4WLEA 4BNXA 1Y5MA 5BNTA 4KQWA 1X1TA 3A1NA 3EMKA 3S2GA 4XDYA 4WLVA 3ZHBA 1VM6A 4G5HA 4U5QA 2VWPA 4HKTA 4LGVA 1W4ZA 4BO5A 2J6IA 2PKRA 1PR3A 3AU9A 4PLVA 3X2FA 3AFMA 4XYMA 4YJGB 3VDQA 5JPIA 1YRLA 4E0BA 3S2IA 5CFZA 4B4OA 5TJ9A 2IYPA 2VHZA 3IC5A 3SX2A 1HYEA 1R0KA 1XA0A 4DWVA 2HAEA 4FFMA 1X7GA 3JQBA 3VZRA 1NHWA 4CLHA 2E82A 1ZW1A 4XIYA 4PLFA 3RC9A 3GN2A 2ZKLA 4J6FA 5F1KA 2WYVA 2QQ5A 3G1TA 3DWFA 3H5NA 1GZ6A 1VJ1A 4F45A 5TX7A 3RAJA 1NXQA 3I6QA 4D3SA 4GSKA 1E5LA 1PWZA 4BNMA 1SO8A 4O63O 4F46A 5KJCA 1NVMB 1V35A 3Q9NA 5ER9A 3WQSB 4OH1A 1TLTA 3NTQA 4R1SA 2HJSA 5U1PA 2VNAA 1U5CA 1YS4A 1NTOA 1ZKMA 1M66A 2Y1EA 3Q0EA 4YT4A 4DLLA 1ZJYA 3HNPA 2DT5A 4R41A 3LT1A 2C7GA 2GR9A 1RM0A 3NGXA 1ZH8A 1IOLA 2EERA 3E6AA 2VHXA 2EW8A 5COQA 5EPOA 1NHGA 1YJ8A 3GF4A 4G65A 5FWNA 2BKAA 2A94A 2YW9A 2O2YA 2NU8A 3FBTA 2ZTUA 1U28A 4FN4A 1QV7A 2CDAA 3FTNA 5GY7A 2BLLA 4D0SA 2WM3A 4YYZA 3ENNA 4EEZA 3GPDG 1ENYA 4EEXA 3GEMA 3GUYA 1E7RA 1PJLA 4GLOA 4CMKA 2I3AA 3MTGA 4CM6A 3GDOA 3WQQA 1QLHA 1LLQA 3LQFA 4JK3A 4AFNA 4M89A 5C3MA 1YGYA 4CPDA 2HK9A 2O4CA 5CG1A 4IGFA 1HYHA 1PIWA 2EKQA 3UICA 3DBRB 1P1RA 2R00A 1BWSA 4OXNA 3C1AA 2RCYA 4JROA 4E32A 3DMYA 2HK8A 3I9NA 3K2BA 1NBOA 2Y93A 4WOKA 1H9BA 3RUAA 4OOFA 5G0VA 3IDSA 4QT0A 4RVDA 2G76A 1BXGA 4UEOA 2YZ7A 1X0XA 5B4VA 3X2EA 5T8KC 2X9GA 4LK3A 1HEUA 1EMDA 1U4OA 3KSZO 2AEJA 4PZEA 2X58A 2CSUA 3ZV5A 5KOIA 3VTZA 1T2EA 5TIIA 3I9LA 2OXIA 2DFVA 3GR6A 5JC8A 4UVHA 1LDMA 2C82A 3VZSA 4DVJA 1LTHR 4FFPA 1GL3A 4RDHA 1MC4A 3AI3A 2Z1NA 3GZNA 2JHGA 1O9BA 1KVQA 1A9ZA 5KWEA 3WXBA 3GRPA 1I33A 1L1FA 3F3SA 2VWHA 1YBVA 1LLDA 2W4QA 1DIHA 1ONNA 1K2WA 2HMTA 4D3FA 5BNIA 1WDLA 4LRSB 1QYXA 2O48X 1F8GA 3FHLA 1JWBB 3CSDA 2FMUA 2ZCVA 3RC2A 4XIJA 3B1JA 1SC6A 3PLNA 4FR5A 4J2HA 5KCZA 2DBVO 3IQDB 5B1YA 2JD2A 1A71A 3AOGA 2PGJA 3N7UA 3TOZA 4D43A 1M6HA 4BNLA 3GHYA 5JY1A 1DC5A 3L6EA 3FWNA 3NJ8A 1A7KA 3TJRA 4J4BA 3G17A 1NQAO 4LCJA 3DB2A 4XQGA 3I4FA 1EUDA 4K28A 4WCFB 3WBFA 3F5SA 2WJPA 4N18A 2CF6A 5KKCA 2W2LA 3WIEA 4IDDA 1GTMA 4YQYA 2GD1O 3W4IA 4CMIB 1PJCA 4I9HA 4BO7A 3L6DA 4GBJA 2YY7A 4GSLA 3HZZA 4BKRA 4ZN6A 2B35A 4HFJA 4I5GA 4ZU3A 2FP4A 3O8QB 1ZXBA 3RI3A 4B79A 4CMEC 3BHJA 2NU7A 2R2GA 1H6BA 4GX0A 4LISA 4E5NA 4W9NC 1E92A 1Y1PA 4MKZA 1U3WA 2V6GA 4R5MA 4YR9A 3D3WA 3ZHXA 4KUHA 3W8FA 3BHMA 3JYLA 3S2EA 1VPDA 4FC6A 2I66A 3UF0A 4AJLA 5K0ZA 2RH4A 1QRRA 4J2OA 4Y9DA 3BMOB 1JW9B 2B36A 4J91A 3LLSA 3PRJA 1DIGA 3UCFA 2DKNA 4FFRA 3R1IA 4RO0A 3T7CA 3ZI0A 4IBOA 2GASA 2H63A 3CUKA 1J5PA 1XSEA 3Q9UA 4INAA 3RROA 5ICSA 2IXAA 2Y99A 3QW2A 4CQMB 3U09A 3M6IA 4XGKA 2V7PA 1B15A 3TRIA 3KSDO 4EUFA 1KVRA 4MKRA 2D2IA 3KB6A 3ITKA 4YB8A 4R01A 1D4FA 1Q2XA 4E5YA 1KBZA 4KDFA 4QFCA 5HRUA 5G0SA 1E3IA 1V6AA 5IDQA 2HDHA 4P4NA 4LCEA 2IEDA 3TZCA 2YUTA 3H2SA 1Q1NA 1D3AA 4U0JA 3QVWA 1JVBA 1HTBA 3VPXA 3H9EO 2AE2A 1GCOA 4PG6A 1CRWG 2JJYA 3VC7A 4B3JA 1NFFA 3QWHA 4YT5A 4CM9D 1KERA 2ZCUA 4NHEA 1CETA 4PRLA 4ALKA 4H15A 4Y6SA 1N1GA 4MPDA 2JD1A 5H82A 4G2NA 5TJHA 4BO6A 3K31A 1MC5A 4CM4B 4J9UE 4DGSA 4BNYA 5JXWA 3RVDA 2WYUA 1BTOA 3WLEA 2ILTA 3H65A 4FD3A 2IE0A 1TI7A 3WGHA 1U7HA 4WECA 3EYWA 3JQAB 1GUZA 2J8ZA 3RKRA 5L95A 4CODB 2EJVA 5IN5A 4K26A 4BNGA 1UJMA 4RV9A 3UN1A 4EI2A 2CDCA 2F1KA 2PY6A 4CUJA 4BNWA 3VKVA 3ZCXA 3DL2A 1QORA 3JV7A 3RC7A 4KWHA 3ZU5A 1DXYA 3P19A 1LSJA 3L4SO 4IJKA 5K6AC 3ZWOA 1LDGA 1B8VA 3C7CB 2X23A 2XF8A 5TS3A 3NJ4A 3HHPA 4E13A 3PZBA 3JQFA 4R16A 4Z3DA 2DC1A 5JMWA 1PS8A 2PK3A 4HFRA 5KVSA 1A7AA 1ZMTA 4E31A 2PZKA 4BMSA 5JAQA 2CMDA 4ALIA 4GGOA 1ZMOA 1E7SA 4ZQGA 1WDMA 2DVMA 4L76A 2GF2A 3DAFA 1P1IA 2BD0A 1M2WA 3LT4A 1PQWA 4RVUA 4RPHA 1DFGA 4DREA 4UEKA 1VKOA 4KTVE 4BOYA 3HB4X 4IDCA 2OL4A 1E6EA 1LBEA 3ZWNA 3EW7A 3RUEA 3DZGA 4GL4A 4PG4A 1IHYA 1XDWA 4RZHA 4IQGA 2P5YA 3DEYX 4XEHA 1I2CA 1T4BA 2FHSA 2NV6A 3F46A 4HXYA 3FF4A 4E4YA 5JYEA 5C37A 1ZK4A 1ADCA 3PJGA 3GEGA 3SEFA 1U2DA 4Q9NA 3CH6A 1YOVA 3D7LA 3PZRA 1X7HA 1H94A 4R54A 4ZHSA 1DOHA 1LUAA 1LLCA 3B1FA 3NV9A 2YFHA 3P7MA 4FIZA 1DBVO 3DBLA 4NH4A 4JIGA 1B3BA 3GK3A 4L4RA 2C2XA 4J43A 3GPIA 3W4JA 1H2HA 3CINA 4OSOA 2B0JA 4FFOA 2OP1A 5JO9A 5A04A 5AXCA 5MDHA 1C1XB 1VSVA 4Q3CA 2P5UA 4D7AA 2BI7A 4CL8A 2XXJA 4NG5A 2RH8A 1XWFA 4J7XA 2TMDA 3WB9A 5MGBA 2ZYGA 4FDAA 5COAA 3GNTA 1IPFA 5THKA 3ZV6A 1OMOA 3V8BA 4EITA 1PZHA 3ZWAA 4FFLA 5F21A 4BKUA 5A5FA 3IOYA 2FR8A 4UVGA 4BNTA 1KIFA 2C5AA 1XU7A 1VKNA 5DBFA 2BFMA 1JKIA 1C3VA 1H93A 5FYDA 4BNJA 3OSUA 3B1KA 5KVCA 3E82A 8LDHA 4UREA 4W99A 5I8ZA 4CR8A 1ZK0A 2HMUA 3FR8A 1HRDA 5ILOA 1ML3A 1CQIA 2AE1A 2WYWA 4DIFA 3H3FA 4AJIA 2VN8A 3ENKA 4J16A 4YJFB 4NMHA 3RC1A 2CD9A 4YJDA 1QR6A 2Y1DA 3SJ7A 5JFOA 3H5RA 4CLXA 3STHA 3AOEA 2PTGA 2WEKA 1DO8A 3DZFA 1DFHA 3OICA 4UVDA 4ZVVA 4RVGA 1GQ2A 2DUWA 5CDGA 2PR2A 5ENVA 1SOWA 5LCXA 4B8WA 4RPGA 2NU9A 1PSDA 1JVSA 3GZ4A 1WP4A 3HJAA 3WGQA 1KEWA 2JHFA 2PGLA 2HU2A 4P8RA 1AUPA 3H4VA 5L9AA 1BMDA 1KYQA 3PYLA 4GQAA 2Y68A 2PKQP 5DOZA 2P9EA 3OJLA 2HJRA 3D64A 3RIHA 1R0SA 4N5NA 1TT5B 3JD4A 1AGNA 4YXFA 5DOVA 5ENDA 2BMAA 3FPCA 1NR1A 3LSYA 4EUEA 2D3TA 4IZIA 4UEJA 3ONDA 3PHJA 2Y67A 3CMCO 3WGOA 3C7AA 3LYLA 4AJJA 4K9DA 3KYCA 3DZKA 3OEWA 4WGGA 2EGGA 3PHGA 4B8ZA 3Q2KA 1A9YA 3GN1A 3UKOA 2O3JA 3BIOA 3CZRA 2X5OA 3E5RA 3KHUA 5L7TA 1YKFA 3EVNA 1HE3A 3QWBA 5CDYA 2X0RA 2FY8A 1J4AA 1MA0A 2NU6A 5B12A 3NT2A 4TZTA 3FCOA 2X5KO 1NVGA 4Z0PA 4JBGA 4WEQA 4BO9A 3DBHA 1N9GB 4BV9A 8ADHA 1MGOA 2HKIA 1C1DA 3JD1A 4N7RA 3ZU3A 5I9MA 2YFQA 1H9AA 2FPIA 2P9GA 4BHTA 2JCYA 3QQPA 1P9LA 1PZEA 4AICA 1E1NA 1GQQA 1U4SA 2R00C 3WGGA 3PWSA 3GRKA 5TC4A 3ANMA 2DM6A 1R4MA 4CM9A 1BW9A 1DJQA 3G79A 1F06A 4WCFC 5DF1A 5DULA 1EBUA 3IUPA 5LDGA 2NLOA 1TA4A 1OC2A 3V1TC 4BO3A 2C59A 4P4LA 4C4OA 4OGWA 2YDXA 3GNQA 5EMHA 4IPTA 5KNLA 5JAIA 1Z6ZA 2RAFA 1C0KA 3ZWBA 4A7PA 1E6WA 1WWKA 2Y0EA 3ETGA 3ZDFA 4DIOA 4TROA 3MCVA 2EF1A 2A35A 5A1TA 3JQ7A 5CEEA 4QQRA 1RM4A 1ZIDA 4B4UA 3F47A 1BXZA 2VYVD 1C0IA 3BMNB 5A9SB 1R16A 1KVSA 1EK6A 1BDBA 3VOSA 1LC3A 1P74A 5CPFA 4OO3A 3ZGYA 3DMTC 3ORFA 1N7GA 1DAOA 4PCVA 4A2CA 5AOVA 1EVIA 1JAXA 3PFWO 4E2YA 5H81A 1VE9A 4PN3A 1K5HA 4JBHA 2VOEA 4RZIA 3COSA 4DMLA 3GH3A 3L4BA 1Z73A 4RCVA 1EK5A 4OMUA 4HY3A 3ABIA 4NU5A 1HYGA 5G4KB 2GYYA 2IDZA 4CQLB 3PDJA 3WNQA 4RPKA 5BSFA 3QVOA 1EQUA 2CY0A 2J3KA 1M76A 2Y0CA 5DNAA 3ROQA 3BMCA 4DTIA 5FEUA 4CQMD 1R4NB 4HP8A 2V6MA 4AJNA 4PG8A 1T25A 5HM8A 3I5MA 3E9MA 3HN7A 1M6WA 4TRNA 3S2FA 4BB5A 1DC6A 1MXFA 4MVJM 1PS0A 2YQ4A 3HDHA 3GNSA 1HF3A 3I52A 3B70A 1NFRA 1YB1A 1TXGA 3RBZA 1BXKA 1I0ZA 3JQGB 1YQXA 2E48A 3ZWVA 1UZMA 3EDMA 1M67A 2VYND 5A9TA 1ADFA 3ZH2A 4DC0A 1KEVA 3HQ4O 4KUEA 4QUKA 5TQVA 4AG3A 1PGJA 4KOAA 3SVTA 5IXYA 4GLLA 4WNIA 1Z7EA 4YJGA 1EE2A 1A4IA 1OC4A 4K1LA 1HDGO 2RHRA 3PPIA 4PLPA 1U8XX 2ZJ0A 1OOEA 1FDUA 2VHVA 1XQ6A 3NTRA 4YJHA 5EIOA 2WE8A 3SXPA 3WDSA 4IXWA 5CAEA 2CVQA 2QX7A 3A06A 4H7PA 1DEHA 2VWGA 2AQ8A 1BRMA 1ISIA 1R66A 1SZJG 1VSUA 2CFCA 5CEFA 3PP8A 3JQAD 1RKXA 3NKLA 4FC7A 3K30A 4IINA 4B7UA 1WZEA 1HLPA 1JU9A 3DFUA 4NBRA 1LDNA 3MOIA 1QMGA 2OP0A 5ITVA 2UAGA 3IKTA 4GWKA 3JQ8A 1KS9A 3JTMA 3E48A 4NI5A 5AXBA 1NYTA 3EHEA 2JCVA 2CNBA 4IY1A 1IULA 1EFKA 2POQX 3WG9A 4WLNA 5JCJD 2VT2A 2O23A 3ROKA 4CM1A 3Q1LA 3R6DA 1KEPA 2YHUA 5IZ4A 4TKMA 3JQ9C 5BQFA 3PGXA 4GVLA 3EC7A 4MP8A 4XRRA 4YWJA 4BO0A 4E2XA 1A72A 1H6DA 2C5EA 1AXEA 1B8PA 1PR9A 1IPEA 3KVOA 1VL8A 1PGPA 3PWKA 4U6SA 1SB8A 2AA3A 3TNLA 4YPOA 1NQOA 4OYRA 1K3TA 2NVUA 2VRCA 4J49A 2HMSA 1DIAA 1E1LA 2QZ9A 1ZVMA 4CJXA 5FI3A 3WWYA 1ZK1A 2BELA 5G4LA 3DTTA 3Q6IA 4O59O 4CM7A 4PG7A 1MG5A 1UR5A 5L7YA 3ETEA 2WD8A 3E03A 3R3SA 3SJUA 4BB6A 4Z3KA 3WTCA 4NK5A 3SLKA 1U3UA 2GN6A 4IIVA 4CLOB 3CEAA 2NQTA 1X15A 2OMEA 2Y0DA 1TT7A 3K73O 1GD1O 3PVZA 4YDRA 3WWZA 4ND5A 4PG5A 4PZDA 5DCUA 3GEDA 1PQPA 4NJMA 4WLUA 1EVZA 1GPDG 3ROPA 1MXHA 3NDRA 1ULSA 1XEAA 2OBNA 3ZNOA 1E7QA 4XDZA 1ZSVA 1CWUA 5JDCA 5A3JA 3WYEA 2HUNA 1F17A 2UYYA 3LT0A 4GKBA 1LRJA 3HSKA 4RVFA 3UAGA 1ZK2A 1DRUA 4MDHA 3LC2O 3U0BA 2ZYAA 1CEQA 1NAIA 3BTUA 1NFQA 2WMDA 3M1LA 4GVXA 3QIVA 1KY4A 4FGWA 1UZLA 2VTEA 1U3VA 3H5AA 2H5LA 4I5DA 3LF1A 3UUWA 4AL4A 1G1AA 3E9QA 3IMFA 3OIFA 4QXMA 1YDEA 2G1UA 3VPHA 2CVZA 4W6ZA 5L3ZA 4IDGA 2X9VA 1OFGA 3ETDA 1IYZA 3B20A 5EQDA 3ZHYA 1U9JA 3HUDA 3VHRA 4Z9XA 3W1VA 2OUIA 1LC0A 2C2YA 2VWQA 5U4QA 3W8EA 4D79A 1LDYA 3DZBA 2VNSA 4XQCA 4BO8A 4JXKA 1Z74A 4HV4A 2QIOA 4JN6B 2EG9A 5IDWA 3ICPA 2FN7A 4QEDA 5KJFA 1EZ4A 4WKGA 1XCBA 2VT3A 3I83A 1SBYA 2IRWA 2WD7B 2I9PA 3KLPX 3RQSA 1QYCA 3W4KA 1XELA 2XXBA 4DQXA 3AW9A 3K8ZA 4UUMA 4XR4A 3KYDA 2EXXA 4HADA 3UFXA 4N5MA 2LDXA 2X0JA 2B4RO 2JFGA 1V9LA 3QV1A 4FCCA 2O4UX 3ROMA 4BL5A 5B4TA 2JCXA 1H0KA 1FMCA 4FGSA 1P1JA 4R3NA 2SCUA 4CMIA 3I9JA 1HSZA 4EJ0A 5TT1A 1A27A 3WFIA 4QO8A 1E7YA 5JDIA 1HXHA 4HNGA 2VYVA 3O8QA 4IDBA 4CMHA 4E5KA 1GFSA 3GVHA 5ILGA 5F5LA 1GV0A 3C3XA 5EERA 4CMJA 5BSHA 1WDKA 2Q2VA 1Z75A 3GUCA 4DA9A 1DHTA 4YA6A 4ITUA 1YWGO 3OJ0A 4ID9A 5F5NA 3E9NA 1D8AA 3DHNA 3OM9A 1V3TA 2Y1CA 2BH9A 1VL6A 4YRDA 1ZZEA 5JNLA 3BMOA 1A4UA 5GZ1A 4EJMA 2UUOA 1EFLA 1GYQA 2VQ3A 3PEFA 4WK6A 2GPTA 4CLRA 4J4HA 5I8WA 2X22A 3FNFA 3AY7A 3NT4A 3ZWYA 3A28A 2AQHA 3INRA 3PIDA 4CM8B 4CQMA 1NQ5A 4KWIA 1SEPA 2G0TA 2NTNA 4PZCA 3P2YA 5FI5A 1MX3A 3VAZA 3GDFA 4R9RA 4J3FA 5L4SA 1PX0A 2GSDA 3NYWA 2IXBA 2D8AA 1E7WA 1DC3A 4IM7A 1PL7A 2Q50A 1Q7CA 3EZYA 1JKJA 3OFSA 2A92A 4UUPA 1RYEA 1BVUA 4CUKA 1I01A 2VYNA 1ZCJA 1JWAB 3F1KA 1LJ8A 1FDSA 3KXDA 4OL9A 2FWMX 2RBEA 3O26A 4E3ZA 4R9SA 4XYLA 4ALNA 2G5CA 4R3WA 5JLAA 2Q1WA 4TVBA 4XD2A 2BGKA 4KQXA 1O0SA 3RKUA 5IZCC 1QXSA 4I9UA 3VH3A 1JN0A 3VH2A 1PQUA 3MJTA 5TSDA 1H6AA 3H9JA 4HWKA 1T26A 4CM4A 2W2KA 2YV2A 1O8CA 1YVEI 4B7XA 1YQGA 2VUSA 5CDTA 1GUYA 1P0FA 2IYOA 3RWBA 3TFQA 1KY5A 1W0CA 1E77A 2J3HA 2DFDA 5FFFA 4I8XA 1HZZA 3O38A 1J0XO 2NM0A 1T2DA 3WGZA 3KOUA 2ZTLA 3BTSA 1F8FA 3MJ4A 3GVCA 3F4LA 1G6KA 4Z0HO 3AI1A 1ID1A 3OQBA 4MVJD 3WX0A 4IS3A 1PJTA 2F00A 3DZJA 4Y8VA 5JCJA 3D3WB 3AUUA 4A73A 2AHRA 1E3LA 3ITDA 4OXKA 1ENOA 2YHIA 2VUUA 4JJIA 4DRYA 3H9QA 4PLZA 5JO0A 5DP1A 1GPJA 3KRTA 2NVBA 4NBWA 4AJKA 3AI2A 1EDOA 3F6YA 3WYBA 2CUKA 3GVIA 4KP7A 1UP6A 2GRAA 3ZWMA 5KJ1A 4ALJA 3MJEA 5JC1A 4BUCA 3JYOA 4OHUA 3O4RA 3F1LA 3QP9A 2GO1A 1RJWA 1T2FA 2NUAA 1YB4A 2FOIA 3VH1A 2I67A 3BMQA 3PJDA 4MINA 1PGOA 3QVXA 4KTTE 4GMFA 3GG9A 5KVVA 2I76A 2JAHA 1I3MA 4J7UA 2AW5A 1T4DA 3DHEA 2ZTVA 4ZQEA 1QG6A 5T5QA 4UAGA 2PWZA 4JQCA 3CIFA 4YQZA 1WLYA 2VZ8A 4DBZA 3FSRA 3JD3A 4LSMA 3FBGA 4D0RA 3OA2A 4DUPA 3WGIA 4J1SA 4PLYA 5A06A 1KVUA 2P4HX 5JW6A 5G0WA 4UULA 4D45A 1G0OA 3FNHA 3I3OA 4RL6A 2YV3A 1NWCA 3AY3A 3GMDA 3V1YA 4W7HA 2A4KA 2G17A 4DIBA 3L4BC 5EINA 1EE9A 1PWXA 3ADPA 3ASUA 3M2TA 3RJ9A 3IP1A 4DPLA 2HK7A 4RVSA 2IZZA 3P5SA 1LNQA 3OMLA 2DBRA 4Y67A 3NDIA 1Y8RA 3PDUA 1IL0A 2J3IA 3ZV3A 1T1RA 1ENZA 3RASA 5ES3A 1CYDA 5AXAA 4II3A 1NPYA 3AK4A 1X13A 1QV6A 4R1TA 1R15A 3SBOA 4MVJF 1AXGA 4NFHA 3W6ZA 2BFPA 3ULKA 4QTZA 2B69A 3NRCA 4M55A 1GADO 1MB4A 3ZW8A 1X7DA 3R0IA 4W4TA 4NBTA 4F3YA 4S3MA 3TZ6A 2Q46A 5BSEA 1ORRA 5G0TA 4XYGA 1WVGA 1UXGA 3ZV4A 2PH3A 1C0LA 3JQEA 4WEOA 2O3TA 3PHIA 3ON5A 3W8DA 4Q3NA 3AWDA 3PQFA 3RBXA 1HT0A 4XGIA 2CDBA 3VTFA 2QRLA 1UP4A 4X54A 1KOLA 1Z7BA 1E3WB 2J3JA 4BNNA 1OZAA 3MJVA 3HN2A 5T8KA 4FJ1A 2PD6A 2P2SA 3GY0A 2P9CA 3KO8A 3BAZA 3IKVA 4XYBA 5K9ZA 3QHAA 3KSUA 4M86A 1PS9A 4BGEA 1EUZA 3OEYA 4I1IA 1UDCA 4B4VA 1P1KA 2JKVA 5HBRA 9LDBA 4WASA 3WJAA 3HFSA 3S55A 3RUDA 4BGIA 4GAEA 3OA0A 4UUNA 1YH3A 1I5RA 1HDOA 1LX6A 2X6TA 5JMPA 1E6UA 3DOJA 1DB3A 5CEJA 3H9GA 4BMVA 5I9NA 3D4OA 3UW3A 3DZIA 4A10A 4PRKA 1E0DA 4I9NA 4Q3DA 4R69A 1H6CA 2UUPA 3QA9A 3VZPA 1YOVB 1UXKA 5HS4A 3VZQA 4L74A 2GCGA 2NTJA 5U9CA 3DOOA 4O1MA 3GQVA 3DBLB 5EESA 2OO5A 3JQBC 2X7HA 4IDFA 2C20A 1QLJA 1ARZA 1YBMA 3KBOA 3GFGA 1B7GO 3ZHZA 4RQTA 4B4WA 1GR0A 1MLDA 3U4IA 5I9LA 2Q1TA 2QYTA 4RJTA 1GUFA 2JL1A 5B37A 1J49A 4RQUA 2GN9A 1S6YA 3PWZA 3TPCA 1ZUD1 3WGYA 4ESOA 5IFLA 1LSOA 3V1UA 1L7EA 3VVBA 4OM8A 5IDYA 3VPFA 1ZSYA 4D3DA 1FDVA 3DDNA 1N9GA 1ISGA 4E12A 2X9NA 4IXTA 5L4NA 3WTBA 3JYNA 4W9NA 1L7DA 4YT2A 4O5OA 3TQHA 4BIIA 4I5FA 4TMFA 2BF7A 5TT0A 1GCUA 3OJOA 1BG6A 3RU7A 1UUFA 4R68A 1O89A 3NUGA 1PJ4A 4OAQA 4WE3A 5IJZA 3CZMA 5IAAA 2UV8A 3NT5A 4TWRA 1H5QA 3W6UA 3KEOA 4NZ9A 1F0YA 3IUSA 3M2PA 4PVDA 4ILKA 4M1QA 2ZB4A 4XA8A 5DZSA 3V2GA 1LSSA 1RM5A 2Q1UA 4BGVA 2IEBA 1GY8A 1E3SA 4JBIA 4NQZA 1MP0A 3WS7A 1NM5A 4L75A 5KTKA 2NNLD 5DCYA 3ANLA 3L9XA 3T4EA 4F6CA 2E4AA 1H2BA 5JAMA 2O7SA 3TWOA 3GAFA 2DLDA 3INGA 4WCDA 4RF2A 3IIEA 2R6JA 4NPCA 1EQ2A 5JE8A 4E2WA 3LK7A 5ER6A 3U4CA 3S8MA 4FPXA 4FOOA 2PD3A 5F3RA 4J7CA 1PGNA 3GVXA 2BRUA 1ISJA 2GZ3A 1ZEMA 4H3VA 3OIDA 3G0OA 3I9MA 2GN4A 1Y8QB 4MVJA 4BMNA 4U0KA 3RU9A 3UOGA 1LDEA 3KV3O 1PJSA 4R1NA 3FR7A 1ONOA 1GYRA 1V8BA 2IODA 5C7OO 3G49A 3I23A 4R1UA 4RVHA 3K2EA 3TZHA 4R4JA 2VHWA 3PIIA 3V2HA 4YTEA 4CR6A 2YV1A 1PTJA 3AM5A 4GWGA 1N5DA 4W7IA 4MO2A 5F1OA 2HLPA 3RFXA 2O3UA 1I30A 4R5HA 2ZIZA 1DHRA 1Q0QA 3HWRA
chains in the Genus database with same CATH superfamily
2WABA 1BCSB 2Z2KA 3ZU2A 1NP3A 4EHDA 3JTEA 4R31A 2VUTA 5E8JA 4HJRA 2HDNB 5ADHA 4GU5A 5FYQA 3UJAA 1NBIA 1QBGA 2PMEA 3P71T 2NZYA 3I2IA 3S99A 3MOGA 1T24A 3BQNB 1MU0A 3QTLA 3L7LA 4X71A 3B1ZA 2VAVA 1DDIA 2ADMA 3QMWA 1Y9AA 3C4VA 4QZVA 5HZHA 3OY2A 1E5VA 4QEZA 4P0PB 3H2BA 2EEZA 1S7CA 3OCUA 3D0KA 3G23A 5I7SA 1RC1A 3A9UA 2R60A 3WRYA 3JQGA 1E6LA 2QRNA 3A9WA 3RFTA 3RV3A 2B5WA 2IZ5A 3U31A 4D9GA 4P34A 1Q7RA 4BDSA 1SN7A 3J7TA 3OQ6A 4LMAA 2Q99A 5AKYA 1G2IA 2CZCA 4N3AA 3FPHA 1W4BA 1DINA 1R4MB 1QPBA 2AMFA 3OPVA 3BUSA 2WM8A 2P35A 4JODA 3W8NA 1II8B 3QG5A 5KX5F 1IHXA 2GF9A 1CDOA 4B3CA 3BHIA 1ZAKA 3KZVA 4IF4A 5L45A 2G0AA 4WXMA 3MZ0A 4QUHA 5F52A 3SQMA 1NVXQ 5JR3A 5H83A 2EBWA 2QD4A 4E11A 2Q07A 3K1AB 3MMNA 1NG9A 1KOGA 1C7FA 1EVYA 2A88A 2JJ1D 2VZLA 3OZBA 3NRBA 5EP2A 4DXHA 3D3EA 3F2VA 3NBYC 4HZIA 4LE1A 1ESZA 4BNZA 1FFYA 4O25A 4LOIA 3HCDA 1T29A 5A5EA 3UAXA 1C7RA 1M73E 1DUIA 5ESRA 4Q4CA 1JEJA 3FTPA 3U7FB 2FTKE 5ITWA 1W36D 1G5IA 1TGYA 1G4AE 3O9VA 3ZTWA 1R9MA 5IKMA 3UPUA 3QE0A 2OG2A 1ONSA 2GHIA 3QXSA 1V3UA 4EENA 3I4LA 3DKVA 4J90A 4Q18A 3DT6A 2O52A 2UUBB 1T3GA 2HRBA 1QVVA 3SYMA 2JATA 4HAVA 3IQZA 3DA8A 1S1MA 4G0QA 4MLCA 1QYVA 1ZITA 4MW4A 1UZNA 3COVA 3PC8C 3G0HA 3HVUA 3UV7A 1UXJA 1T1EA 1GU1A 3PYMA 3IEPA 5E1DA 2C77A 3OKAA 3CISA 3N2GB 1QWSA 3HB5X 4QNNA 4TKLA 3KQTA 1M83A 2P0EA 5CD1A 2V7QD 3MWLA 1EGVB 3T1OA 5LLTA 1K8YB 3TPCA 1KDZA 3HCAA 1SZCA 3VR4D 3GLIE 1WQ1R 2FW7A 2JIMA 2Q2WA 3NNSA 1CS0B 2JGIA 2NZVG 5DMHA 1D5WA 5FL7D 3F74A 3WYNA 1Z8HA 3H5TA 4QYTA 3VH4A 3I6IA 3AILA 4HDOB 3WK8A 4CKEA 2IZ1A 1XK6A 2WUVA 4ZYTA 5IJ0B 2HSEA 4DTCA 2V6FA 3TZEA 4PSAA 3EVTA 4OYLA 1I2ZA 5LQSA 1DEXA 3IRVA 1XQ1A 4GD3Q 1XJ5A 4URFA 1IM5A 3KFXA 4EARA 2ZJ2A 4YUAA 4IGEA 1XZFA 2AGVA 5DEIA 1JVNA 3MJCA 3I04M 4TKZA 4JWTA 3CBQA 3GBSA 2EZTA 5BN5B 1M2NA 3UXYA 4RA9B 5A2QA 3WI7A 2V7XA 3K9QO 4FYYA 5CG2A 3LVQE 5C3UA 2XHEA 2GCOA 4Q9DA 3ELDA 3A2KA 1O1YA 1PFVA 4QLOA 4EKNB 2WTAA 1SXJD 2CKMA 1P7ZA 3DAPA 3BTVA 4P4TA 1IPHA 3O91A 3OZIA 4UBLA 4DLRA 3K32A 4FR0A 2MIIA 5GJWC 1YAHA 3TS1A 1PJ3A 2IUEA 1IZ0A 3LF2A 2NTVA 1U1IA 5LQDA 3JZMA 1IAQA 2IZ6A 2VPPA 3GAMA 4FK8A 2XBMA 3HHEA 3I9KA 2AQKA 6ADHA 1NT2A 2BWJA 2PD4A 4PIVA 3JQDA 3KKPA 3D8BA 3QLUC 4MQUA 1EK0A 5EZ6B 4EG8A 1BKDR 5JSQA 1I3NA 2C2GA 3JYPA 5L7WA 1K68A 5HTOA 3R9XB 5CLHA 3MRSA 2LKDA 2O2SA 4LY0A 4U7PB 3TQTA 1WA5A 2UVQA 1T8TA 1ZJZA 2QD5A 1Z13A 4IIYA 1N6IA 1IEVA 2OOSA 4KE7A 3DBRA 2DWQA 3G5LA 3U4DA 3GEHA 3ZE2B 1LCIA 2ZUUA 1DIRA 4ND1A 2HFJA 3IA2A 2C5BA 5BSMA 1KQ3A 1X3SA 4LVCA 4C20A 5C1OA 2TMGA 3IP3A 1WS6A 1VMKA 2ONZA 2ZT7A 5B53A 3ZNQA 3DL0A 3ZBTA 3SVZA 4Q01A 2ACWA 4TRRA 1JMKC 2BFAA 4INJA 1X7YB 4PR0A 5I9IA 5CT4A 3TCXB 3N8HA 4TVOA 5EKTA 1SCQA 2CCJA 4D4JA 1ELOA 4LECA 4LQ4A 1RI3A 2XVYA 2XHZA 2O8DB 1MG0A 3WX0A 2FVYA 2WR8A 3IV6A 1BS2A 1GTL1 1QFJA 1HI9A 2AH5A 2D5CA 3N2EA 4MVXA 4FOPA 4X93A 1VMEA 1WQ3A 4HGNA 4LV8B 4UE2A 4B3FX 1NUTA 3ETLA 4HNUA 5K3OA 3ZLBA 3FOZA 4Q3AA 3FB1A 1NASA 1A9TA 4N49A 4P7FA 4DNXA 2X40A 2NVUB 4GOJA 4MVJE 3ER6A 1IRXA 4UAUA 3L1UA 5EXPA 4OI2A 4DABA 5HF6A 3QF7A 1JSLA 3VR5D 4TV8F 4JJ8A 1RBZA 3C0KA 4RWZA 5BURA 1KFEB 4BRZA 4MMYB 3QE4A 2WZQA 5J23A 1X7WA 1FFSA 1JZTA 3ICOA 4YBZA 4H3HB 3EZ6A 3L7BA 3JARA 1MAUA 4PBRA 4QVIA 1K8RA 4E33A 4IUYA 4XM2A 1ZN8A 2ARKA 3NTLA 1DDGA 1MO5A 1ISHA 1Y9ZA 4Y1RB 1WMEA 2NUTB 5CVJA 1JL3A 1NNSA 1XAJA 3D3NA 3H4TA 3OOHA 5FAKA 3LDFA 1Y6GA 1VRWA 1U8AA 2XYHA 4FZJA 4MDYA 1K6XA 1V39A 3FB4A 4JSYA 4KAXA 4OQDA 4XWYA 4CL3A 1J5EB 1DCTA 2ZBDA 1P8AA 2DFNA 1V16A 1DKQA 5C8YA 2NU8B 4QELA 1VP9A 1M34E 2O2JA 2H08A 2X4GA 1YR7A 2BMVA 2K7FA 1LK7A 4OTZA 3AO0B 1QGOA 1WW3A 3G13A 4PO9A 2OHHA 5EJ4A 4L6AA 2ZWIA 1HZJA 3K0FB 2Q5QA 4MR7B 1IZ7A 4GO1A 5IT9A 3WGTA 2PS9A 1Y7IA 1P17A 1SVIA 1U6IA 5A03A 2H1RA 3OBBA 3V4OA 1WO8A 3U7QA 2XZTA 4AJPA 4YLYA 2Q8QA 2VSQA 1WXDA 3H0KA 3T15A 3LKZA 1I36A 7ADHA 2QT1A 2PO5A 4KXQA 3OWXA 2J9FA 3AFNA 1OBFO 1PGQA 1QQ6A 2R8XA 1CG6A 3R23A 4FMDF 2YCBA 1EDZA 3I5UA 2WA1A 3HLTA 4IJVA 5DM4A 4ER6A 3P94A 4DQUA 4RLSA 3AHDA 3FCEA 1G3QA 1C3OB 1LS6A 5DLYA 1IY0A 3PYXA 4FB5A 1IJBA 3TZQA 4ZT6A 1NNEA 5DI3B 3ONFA 3DBIA 4O4IA 5CXQA 1POXA 2D1QA 2HA0A 5FX2A 1X0VA 4CEJA 1GSIA 1XNGA 4O4LF 1WPGA 3LM8A 1D2CA 1Z4NA 5D1HA 2FH5B 3I62A 2ECKA 3DPSA 4QU8A 4JI2B 2OC4A 1P60A 1GFZA 2PV0A 1SXHA 1P1FA 4GE3A 4NIMA 2ENWA 2CMFA 1EFUA 3B60A 3HBNA 3MMXA 4OKIA 2RGNC 5KYYA 5CVCA 3I42A 3ETCA 1XP8A 2W90A 3V2UA 4B6QA 3VU0A 3UGQA 4RKEA 4EQ6A 1O58A 3EZLA 5CDSA 5HGXA 2F3QA 1P62B 2VDKB 3DTNA 4IDNA 1UK7A 2QENA 3AOEC 4MP6A 1RJ9A 3DBVO 1A2QA 3ASVA 1SUBA 1DX4A 2O1XA 2NW6A 5TGDA 3NP7A 3G2PA 3QWFA 2ZUWA 3TIFA 1CFJA 1PZFA 1FFBA 3UH1A 1WTCA 4RXTA 3KUXA 2WU4A 4O6VA 3VO1A 2AJLI 4XUEA 4CM5A 4E5SA 4KJZA 1A2BA 4N03A 3F3MA 2Q6LA 3KD3A 3KTFA 3UCXA 1N1EA 3ICQB 3KLBA 4A2QA 5ALKA 3JATB 2H1LA 4AJEA 2Z95A 1M0SA 3LCJA 4OK5A 1E9SA 3HJBA 4WDQA 4ZZ1A 2QX4A 4C4SA 5LQCA 1QUEA 2X3UA 2QI9C 1TAUA 2EOAA 1TAQA 2VZ9A 2IWHA 4OFZA 2WWGA 4A0GA 4PLWA 1JU3A 1SBQA 2OCYC 2WTEA 2FWAA 5AW5A 4B6GA 3FHCB 3L1IA 5DBGA 1A9XB 3WB0A 2P75A 4TQAA 3DXFA 5CRIA 4ZT4A 4L1KA 1ZQ1A 5AXDA 1KR2A 4XWTA 1VIDA 3C8HA 2ZIGA 4W1SA 5TY0A 4ZZIA 3L0PA 1G8GA 2P6PA 1NOKA 3ZQKA 4Z4GA 5KPDA 3MLEA 3HKDB 3FNGA 1JHPA 4MCIA 1G60A 1MQ8B 4NS1A 2E55A 2WTMA 4Q24A 4ALMA 4YT8A 1PZMA 1PLJA 2EJTA 2J9RA 2YYSA 1T5LA 4P93A 4X8OA 2OD9A 2BGLA 3HUEA 3C1UA 2C54A 1U5BB 3JQAA 4IQ0A 4CLRB 4TTPA 2Q4RA 3EDOA 3UYKA 1ST2A 4FGKA 3VYTB 3NBZC 4D4HA 2HMWA 3SS7X 3QHPA 4K3VA 3BWMA 3U16A 1E2LA 3SP1A 2PO7A 4ND2A 5DHPA 1T5TA 3L0YA 2YJNA 3SJAA 5HCUA 4TZ6A 2OSVA 3PXDA 4URWR 3RTBA 4CU2A 5I3ZA 3Q2IA 5CK5A 3OOSA 3V8NA 1CF9A 3I1JA 4JWKA 3TAUA 4TV9A 3GCXA 1FXWF 3FCCA 3GHHA 2BTEA 2ZETA 2GO7A 1R4AA 4YVFA 1JFRA 4JZYA 2XSZD 1K0UA 3B6JA 1XZNA 2DHEA 2E37A 3M7IA 1XVIA 4FLFA 4JASB 4X64B 1VLLA 4M0KA 3F96A 2A3NA 3WL6A 4YAGA 1AHHA 4P3OA 1KSJA 2DPMA 2YWBA 3BA6A 2C8LA 3K9WA 2NP7A 1Y5RA 3HDGA 2C3MA 2LP4Y 3ZGVA 3JQ9A 4DLBA 2C8VA 1UBHS 4XM1A 2E49A 2X86A 2GHTA 2R8RA 1NG1A 3UTCA 5K05A 3OP4A 1SPXA 1CT9A 1NDHA 2AX3A 2H5EA 3OHSX 2WJGA 4KIGA 5ALIA 3F7NA 1JKMA 4MVJI 1F6BA 1B4DA 1DJOA 1GT6A 1OLXB 1V7ZA 2FMXA 3DOCA 1XQ9A 5G3YA 3WMWA 1XD2B 1A8UA 2C8JA 1PZNA 3WQHA 3E7FA 1VQ1A 2YXLA 2E1PA 1KP9A 3L0IB 3Q0TA 3CC8A 4U9HS 1XMXA 1QS0A 2XOKD 2IBTA 4GGMX 5KEIA 1QANA 1QNLA 2IXDA 4O02B 1EVJA 3IV7A 4FYPA 5ARBA 1RQXA 4QLBA 1Z6YA 3RRXA 3VDRA 1P7YA 3HU5A 2BJWA 1UBOS 1ZUNA 2HMVA 4FFSA 3NOQA 1V3VA 3PB3A 4ZKDA 9MHTA 4Z0TA 1UT5A 3X1JA 3C8DA 1TUEA 2INGX 5AM4A 2P6UA 1MEOA 3FWKA 4ZZ2A 1L5GB 4CV1A 4MROA 1CHNA 2ZI9A 3THYB 1JH9A 2BFOA 1R12A 1WW2A 1VDMA 2EIHA 2OZVA 2WOJA 3OZVA 5NLLA 3WBBA 1SIUA 2ADOA 3QE3A 1FNCA 3BA1A 3AEUB 2VBFA 2XD9A 1R6UA 1ULUA 2XCQA 2I6GA 2YHIB 3GOQA 3PHCA 3RANA 2PLAA 5FBQB 4AXBA 1T1JA 1LBHA 1O95C 2NO9A 2A58A 2YIDA 3H1GA 4IRMA 5T64A 1VC2A 1JWLA 3NOOA 4QBFA 1C1XA 2OB1A 4EZBA 2W8ZA 2IUFA 4W5JA 5C1IA 1XIVA 4I4LA 1LEHA 5FPQA 3SLGA 1G21E 3WLFA 1E0KA 5MN6A 1Z8NA 3UWKA 4EUHA 3WDLA 2X5JO 4K2AA 2NUAB 3U3XA 1N3IA 5BP7A 4RHYA 4F9TA 1CJCA 3M1AA 3LQ2A 3Q2OA 3IOCA 5ELXA 3YASA 3ZK9A 2H6EA 5DYWA 1I2BA 2YC4C 2ETXA 3F3KA 4GOXA 1K3FA 4HN9A 4LIPD 2RKWA 3KPUA 2GBFA 2QL5A 3DZHA 4U00A 5D7NA 2HXGA 4YWHA 4H0NA 3T3PB 2O0MA 4Q66C 4KFTA 2PUGA 4COOA 1U8CB 5LA6B 5JNVA 1M2HA 3C85A 2FLKA 3VI4B 5LDHA 4ZGWA 4BZWA 2NWQA 2LRHA 4PCAA 3ERCA 1U2PA 3GFOA 1T0PA 3C3KA 4LF4B 1FSFA 4Q02A 5FWYA 1O0CA 3NAGA 1RI4A 3RK4A 1ZKDA 3NAMA 1SUAA 4CV3A 4O2LA 5K3SA 2FRDA 4ARSA 5E7QA 5FF9A 2OT3B 3ECSA 3R3UA 1NJFA 4MAMA 4YJFA 1VPTA 4HX5A 2G8NA 3MILA 4PNZA 4BZPA 1BIFA 1LSUA 2GZ1A 2ZJ3A 4OB8A 2XT6A 4NU6A 5LQJA 1KWKA 5E3HA 3LX8A 2GPBA 2R2AA 2YXPX 2PBFA 4S0XA 3RYIB 4MYUA 5CFNA 1SFRA 5LMCA 1KARA 3PUVA 5SZJA 5TIIA 3P1JA 5JQGB 4NARA 3GJTA 1QCYA 2QUBA 2F8MA 2PFGA 4GH5A 1VCHA 2IELA 4Y9SA 2UVPA 721PA 4MW6A 1D7AA 1JR2A 3CX8A 1UBNA 3QY9A 5DYTA 3AJDA 1YI0A 5BYAA 4DLTA 4KXFB 4ECEA 1GPKA 2QTAA 4J0IA 4CMCA 5IN4A 1SVLA 1EGAA 3EF3A 3GMSA 1HG0A 2VP2A 3RD5A 4QBGB 2C2OA 2AR7A 3TDKA 1E2IA 5CTJA 2EZ8A 3CXRA 1KC1A 2JI7A 2CK3D 4TTAA 1Y7TA 2I4RA 2OB2A 4LF6B 3KJXA 4AY4A 5LZ9A 2ORYA 1D04A 1ZD3A 3EIUA 4IIJF 5E6UA 5C7YA 3L3BA 1EWQA 4JNCA 1CB0A 4NCKA 4B7CA 1EVKA 3AV0B 2OV3A 3B7PA 1TT5A 1EFCA 4A0QA 1HNWB 1WVIA 1FW6A 1CY1A 1FSGA 5EOVA 3OPYB 4U2KA 4FYKA 1KK1A 2VZEA 1ZJWA 2JI6A 3OKCA 3RTDA 2IJGX 4RV4A 4DEXA 3VDMA 3A2NA 3ZE1B 3UK2A 3EXIA 3R24A 4U4AA 5DDIP 4TKVB 2VYQA 1JS1X 2P91A 3AF6A 2Y1XA 3QGMA 1L7MA 3IUNA 4HYEA 1PKXA 1XCOA 2H2FA 2VZ0A 5DU2A 5DWQA 4B6OA 3RS3A 2GBIA 1G6HA 2GN8A 4BP1A 5LOVB 2B37A 2VRCD 2J9XB 5IT5A 2C84A 4LW8A 2PGDA 4JLBA 3I6BA 4IH9A 4DAEA 4OMDA 1V41E 4C7JA 3E27A 1MB3A 5F1PA 3TQOA 1V0JA 1HK7A 3T3HA 4C9BA 5L4LA 2FPUA 1ISRA 4LWZA 4OV6B 4TT8A 4COKA 4CG0A 3QPAA 3T5TA 4D82A 2D5LA 3L1VA 4OIMA 2V7UA 1T1SA 1GQOA 3RREA 2NUBA 1WCXA 1EH5A 2XT9A 5I6DA 2PS1A 4UHEA 1DS6A 4P4SA 2B5VA 2L17A 4L4ZA 3PU6A 2YV5A 3FUTA 2DX7A 4ZVQA 4CMGA 1XTVA 3B1VA 4DCPA 2NZJA 3H0EA 2YS7A 4IIGA 3GT7A 3SC6A 2GGSA 1FL9A 4KFUA 4A5OA 1FJHA 4RDCA 2I4TA 4CQJA 1B26A 1X87A 4ESOA 2BEKA 2QRQA 4YAIA 1DRKA 4RJ2A 1BEZA 3N1UA 3ZGXA 4XJVA 4E21A 2KBFA 3UKDA 1PJAA 1XZAA 5EL0A 2QM0A 1E8DA 5IWCA 1E3EA 4ROSA 1JAYA 2FF5A 1RQPA 4IFEA 3FETA 1MX9A 5EGNA 5F3WB 1ZMRA 3G9XA 4TKUA 1OI4A 2FSGA 2OBYA 4HH0A 6LDHA 4K9OA 3HZHA 4II2A 5FD8A 2O54A 4R2JA 3KQHA 4AZSA 4C5CA 1TQ8A 1Z7YA 1KJWA 5DSZA 4GVPA 5LP1A 5KSYA 3E9RA 1XDGA 4IZHA 1I4WA 1G2PA 3MBIA 2G5GX 4F91B 1HDYA 4JXXA 3K1ZA 2FRXA 3NHKA 1X3LA 4JKYA 3COWA 4HDKB 1EFAA 3SF8B 5A3SA 5F35A 1SXJE 3LAWA 3P26A 2FFJA 2XB6A 4YJ3B 4LJ4A 2D54A 2P68A 2RHCA 2GWHA 2R66A 3JAKA 2F9MA 4BRWA 3D7RA 1X80A 3T1VA 1XRMA 1H66A 3EAFA 4ZDWA 3KYBA 1W2WB 3TNFA 4H16A 3ZZTA 3HRIA 1R6DA 4FWIB 3K3PA 2AOVA 3DCJA 3ONEA 1B14A 3CLRC 5GJCA 2B99A 3GPBA 3I45A 4PRYA 1K4KA 2A0XA 2ZAMA 5AK0A 1J8QA 5JT1A 2CJXA 1DKRA 1BYIA 4LTMA 1GEEA 4OL0A 4PXYA 4N54A 4P3PA 1T35A 4KWTA 4L4YA 4P36A 3LCCA 5A9RA 5CDHA 3L7JA 1PHPA 1K4MA 3EFEA 4HB3A 2H2WA 4BLQA 3G9ZA 3K1AA 1A50B 2IW1A 3V97A 2PA0A 5BXYA 1P9RA 3SHFA 4JFAA 2W37A 1MC1A 1NSFA 1W44A 3JYQA 4HVAA 2GUGA 2ZRJA 3NVAA 4QQKA 1ZC3A 3PQDA 5HX7A 3LG2A 1BKSB 4GOKA 3A10A 1ODCA 3GRYA 3Q41A 2XOXA 3M5WA 5AYVA 4L0DA 4AMBA 2C95A 3GMTA 2FZLA 4PZPA 3ZCPA 1CXZA 2PZJA 2IYEA 4MWTA 4XQ9A 2DCUA 3ET5A 1ZM2A 1K6JA 4BNFA 1KZ4A 1FVXA 1T13A 3DDZX 5ANRB 1D6MA 1SMKA 1BW9B 2PH5A 2SECE 3BWYA 3O95A 5SY4A 4BNDA 3DTYA 4HDMB 2E9SA 5JPCA 1WD5A 1KBOA 2OEPA 3H5IA 3WB1A 1GN8A 4F6LA 1DAKA 1STOA 4Y7DA 4MR9B 3AC0A 4C6SA 1RXIA 3I6YA 5CT9A 1COWA 3O8LA 4PGFA 1NT4A 3N2GA 3CJTA 1HFKA 2J0UB 3HFRA 4MIEA 1KK2A 1WHTB 1X19A 2JFUA 2W6QA 1ENPA 1EWRA 5AVQA 1SOVA 1A8HA 4HNAB 3CTPA 2VRBA 3H5OA 5PGMA 4NFLA 4BWFB 2GDZA 5K3FB 3GLQA 1U7UA 5IXSA 4Z7QB 1GVNB 2PUVA 1CS0A 2WF7A 3K9BA 5K3CA 3W7BA 5I01A 2WYIA 1MB2A 2XQKA 2V3VA 3CLTD 2D7JA 4Q7KA 3PNBA 5JS8A 5C5IA 2J5QA 1VG0B 2CWDA 3LTNC 1LU9A 2CJWA 2BM8A 1ODIA 2Q3BA 3DV2A 3I73A 5CBKA 4RTOA 2Y1LA 5KJ6A 1UPUA 1F48A 2R6ZA 3IEKA 5KTPA 4OQMA 4C4XA 1JA9A 1Q57A 1EBFA 1TJ5A 2AUMA 5GGXA 4YO8A 4Z99A 5JD5A 1HDZA 2GX6A 4GRIA 3EUWA 1NNUA 1RM3A 3GDGA 4RNCA 1MAHA 1DLIA 2HD4A 4URHA 4B4KA 4DCMA 2OILA 2VI5A 3G68A 4X92A 5GVSA 5BN5A 3IHWA 4RA9A 4HS9A 1J23A 1R4ZA 4KR0A 1M75A 4D44A 4DF3A 4JLAA 5IUKC 3W5CA 4HGYA 3GG2A 1C7ZA 5BVHA 1NY5A 1PL6A 3HO8A 2RKOA 4JLNA 1TAHA 3IAXA 3F8TA 5DX0A 1VRCA 3N2LA 1L7VC 3PXGA 2FQWA 4QO7A 3BGWA 3RUIA 3BEOA 1GNRA 4C22A 5BUCA 3KT3A 1F2TA 4ZOBA 2HYDA 1MNQA 3SYNA 3ZW9A 5HHTA 1Q1ZA 1OV6A 2G67A 2VDWB 2H0QA 2H4ZA 3NG1A 4OQYA 4AMGA 4ZYLA 5KNBH 3TUJC 1CR1A 4U7WA 2J07A 4F9EA 1XXHE 5IAOA 2I87A 3D1VA 5KNBA 5K8LA 5JECA 1M10A 2XTZA 3H8VA 5AK6A 5EYPB 5GP1A 4Z3OA 4P7GA 2ERXA 4B6JA 3N8IA 1MV8A 2C1XA 2GZAA 4GKVA 5ICMA 1U0HC 3KB8A 3MWEB 1UDBA 3UNXA 1VPLA 1XX6A 3KM0A 5HWSA 2WHYA 3E8XA 3BXXA 3LS2A 2B8JA 4TZKA 4WLEA 4BNXA 2J5XA 1ZUHA 3NIFB 3CVJA 3A1NA 3EMKA 4OGLA 3Q15C 2LIPA 5JXIA 4JUCA 4WLVA 4ZK2A 3VPBA 2ZRBA 5B1EA 5AOCA 1J56A 4HKTA 2L2QA 3I01M 1QC5B 1RCTE 1V8DA 3GELA 1NVWQ 4OLAA 2WUGA 1CUAA 3IJEB 2J6IA 4ES6A 2ZULA 4ENQA 3DE3X 4L27A 1D1PA 2I6XA 3VDQA 2DHDA 4AP9A 4ILEA 4E0BA 1AGYA 1JBKA 4ZI2A 3P0EA 1TKAA 2R8BA 3GARA 3QYAA 4PO1A 3D6FA 4MI9A 1BE8A 1RJFA 1X7YA 2Y6UA 4M1ZA 4C21A 5H8WA 1AS3A 5IP5A 3GX1A 1R0KA 5C5DA 1N5LA 1KY3A 2HDOA 3UAOA 4CLHA 5BUQA 1V11B 4PLFA 2WPDA 4L2IA 3KAQA 3GN2A 4QXPA 1N2EA 2ZKLA 1E9AA 3MYRA 4K46A 3TTVA 2WYVA 1A9QA 2QQ5A 2LCQA 5ERYA 4KYIB 3EPLA 1ONBA 4JL5A 2C5LA 4IV8A 2FFRA 1JV2B 3GA7A 4R0VA 4DMRA 5LIPA 5EWMA 1H1DA 3RAJA 3I5YA 1S8NA 3LY5A 4NZZA 3UG7A 4ZDKA 3OU6A 1XRLA 2HJHA 3OSZA 4GSKA 2B8WA 3KELA 3Q9SA 4O63O 4JBYA 3C2QA 5ER9A 4MUHA 4TS4A 4Y9RA 3KZOA 4R1SA 4V0NA 2D0DA 2R5WA 2ZGVA 5B2FA 1CTQA 2Y1EA 1NTOA 2ZITA 3K4PA 4X8MA 1GSOA 2ATCA 1ZJYA 3N3AC 2DT5A 4R41A 4DLLA 1VHJA 2GR9A 2R87A 1QFXA 4KR7A 3OU7A 2L18A 5COQA 1CUFA 1SR8A 5LP6F 1YJ8A 4DCOA 1F7UA 1CEEA 2B8TA 1RP1A 4G65A 3V9AA 4G85A 2A94A 2YW9A 2QN7A 3UHJA 4CKCA 2NU8A 2H2GA 5JROA 2QN1A 2X8JA 2AI2A 2ZZKA 3EXG1 1UPAA 1KI7A 3AB3A 4KDCA 5D3MB 5JTUA 1MW9X 3P9ZA 3RIXA 1KFJB 1LBSA 1HTWA 3EVDA 3O7MA 4G2TA 3BM5A 3ABRB 5GONA 5KU1A 2CDAA 3K0FA 3O8DA 2Q9BA 2WJHA 4MR7A 3SPXA 8GPBA 2CD7A 4LBYA 3BILA 4D0SA 2WM3A 2E1RA 4YYZA 1G18A 4P1ZA 1ENYA 3BK2A 1E7RA 3EQ8A 2H85A 3G2JA 5CHYA 1J97A 3O75A 1IJFA 3BREA 1WPRA 1IN1A 2G3YA 1WU8A 5BRAA 4D26A 3E9ZA 4UZSA 1LLQA 4EK9A 1PT9A 4GQIA 4OQFA 2H4FA 1C9KA 4AFNA 4CGZA 3OAAD 5KYUB 1V47A 5F7XA 2AFHA 2O4CA 5CG1A 3C3YA 3EG9B 4U2EA 3VR1A 1E2MA 3KVRA 1OX4B 1XA4A 4PWZA 5CYFA 1EKXA 4RZ3A 1G59A 1APBA 1NZDA 4DA0A 4FKZA 4OHRA 1AQYA 1DMRA 3OCWA 1OE0A 3K2BA 5E4YA 3RUAA 1NIJA 4JOCA 2LR0A 2FFQA 3C15C 4ZVKA 3TNYA 4F1KA 2O2XA 4QT0A 1E8NA 2V5UA 3A70A 3RSSA 3FLEA 1X0XA 1LNZA 2IUSA 5T8KC 1SVNA 2YX1A 3DFIA 1CP3A 1HEUA 1ZZGA 3BSYA 1W1UA 2FJ0A 1U0TA 1HFJA 3AEQB 4GI1A 1X9HA 5GV8A 3RRNA 3Q40A 3K0CA 3TR0A 2PS0A 2BHTA 1EZ1A 2B9EA 1M74A 2CSUA 3PNKA 4HUQA 3E22B 3AHGA 3CLUD 4UATA 2A0FA 4QU5A 2P2YA 3HU3A 2GYUA 4V0ME 1T2EA 2XLBA 5CM2Z 3T9CA 3I9LA 1RQ7A 1GPAA 5D00A 1ZIPA 2CSXA 4H4DA 5JSZA 5JC8A 1ZINA 2RKBA 3MPUA 3F3YA 2CXHA 1CUCA 2WT8A 3EJ6A 4ZODA 3RHTA 4PPGA 3SQXA 2V5VA 1KYYA 1Q74A 3DSRA 4UZFA 1A9ZA 2MSLA 4URXR 3WXBA 5KWEA 2H2HA 1OHHD 1TD1A 3MIIA 4LRUA 3W5JA 1OZHA 1IHUA 2E85A 1UKEA 3JATA 2H5IA 5DWDA 2HMTA 4IUCS 1MQAA 1GA1A 4UTVA 3DTVA 4ACAA 2ERCA 1DELA 3UZUA 2DP4E 1F8GA 2A1TS 2PSJA 3FHLA 1JWBB 4FXPA 3AHJA 3MCAA 3PFBA 1VDZA 3ZLUA 5A4MS 4LY3A 4E6EA 1SC6A 1LPBB 4OPMA 4J2HA 3TM4A 2GKSA 4J94A 3RK1A 2JD2A 4D43A 1NF2A 2PGJA 3N7UA 2Q4DA 4HWSA 3ZXXA 4BNLA 3L6EA 1N3BA 2FZVA 4NDAA 1T8WA 3FWNA 3T0GA 3NM4A 2WINI 4BASA 1NQAO 1CD5A 2GJ8A 2JDIA 3W8RA 4GXNA 5GM2A 4XQGA 2NXWA 4K28A 2P2DA 3OQVA 4N5IX 2B7BA 3HKDA 3O3OB 4WCFB 3ZE0B 4DSOA 5J4VA 1W96A 3UBTA 2JASA 3EQ2A 2R7NA 3NHFA 2C04A 5B1DA 1IK6A 4IDDA 2AOUB 5TV2A 1YQQA 3WIEA 3S0JA 2GD1O 3A2MA 4YUYA 5JZVA 2PYIA 2PS3A 4GBJA 3R3XA 5HCIA 2YY7A 2Z9CA 3CNBA 4MQFA 1MORA 3D7NA 5A7HA 4BKRA 2VTBB 5D7BA 3DYBA 1OGYA 3V6LA 3N28A 4HFJA 1N5JA 4I5GA 5DXAA 4ZEWA 5IASA 5LMZA 4B32A 5BR1A 2WWWA 4B79A 1ZXBA 2X1MA 2ZUVA 4AY5A 4CMEC 4DMKA 1DU4A 2VTVA 3MCTA 2H3EA 3CT4A 4KI7A 4E5NA 1WU7A 1TO6A 4W9NC 3DE7X 9GPBA 1E92A 4MKZA 2QRVB 1D0SA 1J0BA 2EX4A 3DM9B 3GGDA 5JSYA 3ZYCA 3C48A 2IF0A 4B81A 1AVTA 1MEJA 1C9DB 2VQDA 2C5SA 5HF9A 3HB7A 2QQGA 2FPMA 4G8DA 4PC6A 3UT5A 5JYBA 3OCZA 1Z2EA 5GAJA 3S2EA 4DIMA 4FZ5A 3K09A 1I1OA 2HV8A 4B74A 5KZMB 3EUAA 5M5BA 3B6EA 5K0ZA 1US8B 1AV7A 1WDTA 2AN4A 4DUGD 1DIGA 1VB5A 2IHKA 2DKNA 1N34B 1RE1A 3EYAA 2YASA 1JG6A 1QQAA 2D5BA 4AN4A 4WVLA 2CJYA 2V54A 3GRUA 4H4EA 2EWVA 5AI9A 3M4XA 1J5PA 1PR2A 2I7TA 3I28A 3RROA 5ICSA 1XYYA 3U7GA 3ZE6A 1J1UA 4DNPA 2Y99A 2AN1A 2VUIB 4LVNA 4CQMB 1B15A 3WAJA 1SXPA 4YB8A 4YV0A 4EDHA 3AYXB 3TRDA 3ZD7A 5EY5B 2IPXA 4U02A 4AXXA 5C80A 4F38A 4IEIA 3FHJA 3QJYA 4UBMA 4RC9A 4LF7B 4QOGA 2E4WA 4IEFB 3IDOA 3KXKA 1UM9B 3HO6A 2W6IA 2O8CA 2H92A 1RHJA 4U0JA 5C31A 5ESDA 1EVQA 1QKJA 3FLMA 1NJ2A 3L6RA 1FQKA 1C3LA 1CRWG 2QMHA 2FN4A 3S5JA 3VC7A 1P4RA 1NFFA 3E8MA 4OB6A 3QY0A 3HV2A 3LYAA 4YT5A 1YA4A 3D8HA 4RD2A 2JK1A 2NZWA 2ZCUA 3BD6A 1O94C 3B2EA 3CWZA 1N1GA 3TX2A 4Q1EA 3ZDBA 1WKBA 4MPDA 1QO0A 4OREX 5TJHA 3QFSA 2VHTA 2OZEA 1PNOA 1MC5A 3M9WA 4E4RA 4OHWA 1P18A 1AUQA 3W0LB 4GKKB 5TMEA 3JW8A 1Z07A 4FD3A 4FN5A 4DOMA 2DG2A 1TI7A 1DTWB 2ID7A 2ST1A 1U7HA 2MT9A 1T8UA 3AIMA 1DOZA 2AFVA 3BFPA 3EYWA 3HRKA 4JLDA 5TF0A 3ORHA 1GTSA 5L95A 3KD2A 2CDNA 3A1EA 1KAQA 3GJRA 4IHJB 1CZLA 5E7IA 1OA0A 3DFKA 3GJ0A 4DZRA 2W22A 3VOTA 3DLAA 4Z2AA 2A4MA 5GIPE 3EIHA 3REQA 1TOAA 4B87A 2I62A 5EJIA 3MW8A 5EVCA 4BNWA 1E2QA 2IPAB 4QSHA 2EC5A 1QORA 3JV7A 3RC7A 3TUIC 2VDUE 5LA6A 4RHCA 3CNOA 2Q5EA 1JG1A 4C05A 2JGMA 3R5JA 5AM2A 4QDXA 5JIBA 3T06B 1NY6A 2B0CA 3SQDA 2XF8A 3TMYA 1DKOA 1DMSA 1V1MB 3U3RA 2WIGA 3JQFA 4Z3DA 3P97A 3R76A 5JMWA 3PUXA 2KQUA 4V2IA 3FAZA 5B36A 1T91A 4PS1A 3AV3A 1OFUX 3EBPA 3T7AA 4GGOA 5EAIA 2Y9PB 3H6HA 4C3UA 3VC2A 1X2BA 3NORA 4ZQGA 3DF7A 2AW3A 2CYBA 4PSCA 1WDMA 5ALXA 5D5QA 1MO2A 2O05A 3Q87B 4EQZA 1P1IA 4WBNB 4AURA 2HRQA 4HGOA 1S8FA 1MOQA 1TJ3A 2IX9A 4RVUA 4NMLA 3VM6A 1RHRA 1UFKA 4TQUS 3RYIA 5KUTA 2B1RA 2A2ZA 1HE8B 4JOSA 4M1MA 2WQZA 1F0PA 5K51A 5IKPA 4MGIR 1IXYA 4DDKA 1LBEA 5K3DA 2PXXA 3T52A 1YQUA 3EW7A 4DNFA 1EFRA 3BKXA 2GBCA 2HHCA 2OCGA 1YRAA 3DZGA 1N3LA 2IHTA 1LZLA 1NN5A 3UK0A 1AX9A 4IQGA 5FHRA 1AKEA 3D4LA 1I2CA 1HG1A 2NV6A 3II6X 4E4YA 4XASA 3FF4A 5EC8A 2WT4A 4DLNA 2QRGA 1ADCA 1RW4A 5E2IA 5E4TA 2YWEA 2YWHA 4QPPA 5CM8B 2R8YA 3PDIB 1U2DA 4TLCA 3CH6A 1ECPA 3UQZA 3SXJA 3K9GA 4R54A 4F1WA 4FYMA 5CBPA 4IGKA 3TW4A 2O19A 1LLCA 2WBLC 3B1FA 3H17A 3P7MA 4FIZA 2WOOA 4OJMX 5IK2A 1DBVO 3DBLA 4L4RA 4J43A 3KC2A 1NR5A 5CLGA 3W4JA 3W5IA 1H2HA 3CINA 3FDXA 4CN8A 5JD3A 1XUOA 2D1FA 4ZCIA 2O5RA 3WL3A 2QJRA 4YK7A 4B9EA 1VSVA 3AG5A 1ZGZA 5A6SB 4N6GA 3JVDA 3AW8A 3F9RA 2JIDA 2D1TA 3TE7A 3OQNA 3S40A 3OLYA 1REQB 1XWFA 3DF9A 2E4ZA 3DLCA 4KMOA 4KQMA 4BEJA 4DR5B 3PQ8A 2RGGA 1EXNA 3WYAA 3B12A 4AO8A 4Q3KA 1HNNA 4PFKA 3VNBA 4NOJA 3U1VA 4KXUA 1MJFA 1ZUWA 3CVUA 3LP6A 1ZD8A 3CZAA 2OV4A 4BNTA 2PX3A 1KIFA 4XOIA 1PNRA 3OCCA 1XU7A 1NZJA 5JEDA 1WQ4A 3DUFB 1P8JA 2IKSA 1GPNA 1G8KA 3NBXX 5CVEA 3GJXC 4ZI7F 3EZFA 3V48A 1JKIA 3AINA 3BIWA 1H93A 3WLTA 4AULA 4DS3A 3OSUA 2RJOA 4OUKX 5K0BA 4MYSA 2YWCA 1CYEA 5I8ZA 3P0FA 5TVGA 3PE3A 3PTAA 2YL2A 3RAEC 4O4JF 2XRZA 2PVSA 3MTDA 5AHOA 4EO9A 1HRDA 5ILOA 1CHDA 1CQIA 2YINC 4MSUA 4DIFA 3JAWB 1GGNA 3HNOA 1UZUA 5HEKA 2PSEA 1PL0A 3K5IA 2WWTA 3JR3A 2B94A 4J16A 4M9CA 2HQBA 3OFKA 1KEZA 5BYKA 4FVTA 2Y1DA 5IMBA 3F6SA 5JFOA 3H5RA 3STHA 3ZIDA 2WEKA 1DO8A 1DFHA 5JJBA 2ONJA 2ZUFA 1R50A 3T1QA 3AG6A 3W04A 4HQRA 4DIDA 4RVGA 3IMEA 4UFPA 2F90A 2XD4A 5ENVA 1G17A 1T3TA 2JBWA 4IOJA 5LCXA 1CKEA 3GLIB 2XCUA 2K2WA 1T9AA 3WGQA 5I7WA 2VO1A 1KEWA 2JHFA 2ZP1A 2B9VA 2HU2A 5BOSB 3QOFA 2FB9A 1QV9A 2KLBA 3H4VA 3HDVA 4UM9D 3ICVA 1GRCA 1UBGA 1QAQA 1TW3A 1G3MA 4RJKA 1Y4DE 3DL7A 2JLAA 1L1EA 3PNQA 4FDTA 4ON9A 4EFLA 4F5EA 2Y68A 5BQXA 1RLMA 1B0PA 2X5XA 3H18A 1LPPA 5DOZA 5K0LA 3OJLA 1I7LA 1R0SA 4XFKA 1PT7A 1B6SA 4HAXA 4NMXB 4OJTA 4M0CA 5EE9A 4H31A 4XVUA 2HBQA 4L72A 3LLMA 4IZIA 3VYWA 3PHJA 4XCQA 1SGWA 3NIGB 1VLJA 2ZJ6A 4K9DA 1NJGA 2J9YB 3LPDA 3CZPA 3GJZA 1A9YA 1AGRA 4RK6A 4LYFA 3KHUA 4HVCA 1TU0A 3T1YB 4G01B 3PX7A 1FVHA 4I8DA 1HE3A 5BV8A 1J4AA 3RIMA 3T34A 3NT2A 3C3CA 1U0GA 4X1YB 4Z0PA 3DBHA 4BV9A 4P5EA 3DE2X 2BFFA 3C6MA 3MWFA 4JXJA 3Q7QA 4N7RA 3JD1A 5EJMA 3ND7A 5C2JB 1GTZA 1UKCA 1KMMA 1H9AA 1J70A 4FP9A 4CT5A 3IIIA 2JCYA 3PDHA 4BHTA 3SKXA 3LPMA 3WV4A 1E1NA 3IPRA 1MIOA 4JT8A 4AT1A 3M83A 2HYIC 2RB4A 2EX0A 3P0JA 1QB8A