1MJFA

Putative spermidine synthetase from pyrococcus furiosus pfu-132382
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
271
Chain Sequence
AFIEWYPRGYGVAFKIKKKIYEKLSKYQKIEVYETEGFGRLLALDGTVQLVTLGERSYHEPLVHPAMLAHPKPKRVLVIGGGDGGTVREVLQHDVDEVIMVEIDEDVIMVSKDLIKIDNGLLEAMLNGKHEKAKLTIGDGFEFIKNNRGFDVIIADSTDPVLFSEEFYRYVYDALNNPGIYVTQAGSVYLFTDELISAYKEMKKVFDRVYYYSFPVIGYASPWAFLVGVKGDIDFTKIDRERAKKLQLEYYDPLMHETLFQMPKYIRETLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords spermidine synthase
publication title PUTATIVE SPERMIDINE SYNTHETASE FROM PYROCOCCUS FURIOSUS PFU-132382
rcsb
source organism Pyrococcus furiosus
total genus 83
structure length 271
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.5.1.104: N(1)-aminopropylagmatine synthase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 1mjfA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1mjfA02
5FQOA 4F85A 3DXXA 1EJ6A 4R8RA 3E8SA 4C08A 5C1IA 2LD4A 3QOXA 2IP2A 2GAFA 5DRYA 2IBTA 5E1OA 1P91A 3E7PA 2AR0A 3UBTA 1RJDA 5M5BA 2H00A 4KDRA 5DTMA 1B42A 3OPNA 2XYQA 5FCDA 4E2ZA 3DMHA 2AN4A 4U7TB 3ELUA 3ELWA 2VZ9A 4FGZA 2EX4A 5P8WA 2VDWA 1V39A 2CWWA 1JSXA 3LKDA 5EGSA 4EK9A 3OU2A 3THRA 3FPHA 2CMGA 3FYCA 2FHPA 1NBIA 2PKWA 3LDFA 2XYVA 2IDKA 1RI5A 3NWBA 4RVDA 4X60A 3UWPA 3TRKA 3KU1A 2ZTHA 1ZHFA 3GJYA 4YV0A 2Y1XA 1NKVA 5E1DA 2AS0A 3ER8A 3FYDA 4HGZA 3T7TA 4A6DA 4ATNA 1UFKA 5KS2A 7MHTA 3M70A 2AOTA 2KW5A 2B25A 3U81A 1DL5A 1WY7A 5LQAA 3CKKA 3BWCA 4P7JA 5EHGA 5D1NA 1R00A 5LQJA 3MGGA 3GXOA 5ICEA 3MERA 1M6YA 1MHTA 2YQZA 4OA5A 2B2CA 2GLUA 3NJRA 3TQSA 2PJDA 2P7HA 3BGDA 2FCAA 5DTRA 3TOSA 2WK1A 4RVFA 1MJFA 2P7IA 3LDUA 2NXNA 3R3HA 1YZ3A 4V0QA 3TM4A 4WXHA 3EVFA 3G2OA 1BHJA 5FHQA 4YUZA 5DWQA 3FPGA 3VC1A 2ZCJA 2C7QA 1WG8A 4AZWA 2GH1A 4G56A 2UYOA 4K6MA 5CVUA 5EVJA 5B1SA 3E23A 5K0LA 2Q41A 3G2MA 4QQKA 4AZTA 2R3SA 4EQZA 2HMYB 1H1DA 5K09A 5LQRA 5K0EA 3SGLA 4EKIA 1SG9A 3UJCA 3D2LA 3HCBA 2O05A 4AZVA 5G02A 4CTKA 1SVUA 2N47A 2Z6AA 1RI3A 2FK7A 3ELYA 4YMHA 2PX4A 3EMDA 1G60A 3G89A 3M6VA 2ZWVA 4PYLA 2Z6UA 3F4KA 3BGIA 3P8ZA 1Q0TA 1F38A 1U2ZA 3CVOA 3HVKA 4QPNA 5EPEA 3CJQA 3A7EA 3KPJA 1JQ3A 3NTVA 1NW3A 3KR1A 5F2KA 3PFGA 2P8JA 5DPMA 1DUSA 2GS9A 1TW2A 4GUAA 2PBFA 4F86A 3JWJA 3Q87B 1XDUA 4GOND 1ZKDA 4BY9E 2BM8A 4QTUB 2O06A 1UIRA 3LHDA 5EMJA 5F2NA 1L3IA 3DR5A 3EVDA 4KRGA 4QDJA 4X61A 5EMKA 3TM5A 2DPMA 3MCZA 1SUSA 5E2BA 1VE3A 2FK8A 2G72A 4HTFA 5K8VA 2NXJA 4RTNA 4ISCA 3ELDA 1X1BA 2GB4A 3DLIA 5BP7A 3B3FA 2HV9A 3DOUA 4CKCA 1BOOA 2OB2A 3HEMA 4Y30A 3PT9A 4H0NA 1O9GA 2XVAA 5C0OE 5T64A 3VC2A 2YVLA 3KPVA 4AZSA 1HMYA 2UYHA 2QRVB 5K0JA 5F2OA 1FBNA 4E2YA 5MHTA 2ZZMA 4PYOA 4MWZA 1BC5A 2OO3A 3DULA 3UJ7A 2YTZA 1KPGA 1XDSA 5CCXA 1YFJA 2V7EA 5E9QA 1SQGA 1KR5A 4PGHA 5EC8A 1P1BA 4AX8A 2AVDA 1EJ0A 5H02A 3ER9A 4FSXA 2AVNA 2P35A 2ZIGA 3KHKA 5CVEA 4FR0A 1RJGA 2AOUB 3DXZA 4B17A 1XTPA 4EKGA 3P9NA 4YUYA 2ZBRA 4U7PB 2EJUA 3HVHA 2PY6A 2ZZKA 3KR0A 3PX3A 3ERCA 2IBSA 1JG4A 4YV1A 1JTFA 1KHHA 2QYOA 9MHTA 1L1EA 1YF3A 5HFJA 2OXTA 1L9KA 1N2XA 3DMFA 4XUDA 2H11A 1PRYA 5CM2Z 2G8NA 3HVIA 4FZVA 2YXEA 2JHPA 2P3QA 4P7FA 5DX1A 3UJ8A 4OX9Y 3MHTA 3GRRA 5DX0A 1VIDA 3ID6C 3PX2A 4PWYA 3GCZA 5ERGB 3UJAA 5K0GA 4IV0A 1X1DA 3A26A 2NP7A 2ZZNA 2EG5A 5E1BA 3LCVB 1NW8A 1FP1D 2DULA 2ZIFA 4MIKA 2B9EA 3G2PA 3A7DA 4OQDA 2QY6A 1KIAA 3IV6A 2ADMA 5K05A 3O4FA 2GA9A 2ZIEA 3EEYA 3CCFA 3GNLA 4GQBA 2ERCA 5GWXA 5FA5A 1KYWA 3T0IA 4POOA 2PXAA 3BT7A 5GIPE 3PTAA 4C05A 4A6EA 4GF5A 3TLJA 5ICFA 3EVGA 1JG2A 1D2HA 4OBWA 3UJ9A 3FUXA 1HNNA 2IIPA 4YUVA 5DM1A 4ZTBA 4FT4A 2BR5A 4M37A 4R6WA 1QYRA 4CXMA 2B78A 2ZBPA 4QQNA 3KQMA 4JXJA 5LQCA 2VDVE 4HG2A 3UZUA 3FUTA 3SX0A 3FPFA 1G6Q1 4E32A 1JQEA 1JR4A 1INLA 1R6AA 3HTXA 2VP3A 3CGGA 1M0EA 2HNKA 1VBFA 3GDHA 5FWDA 1TW3A 3LDGA 5FULA 3BWBA 4BP3A 1PJZA 5DM0A 2I62A 3WSTA 3OE4A 3CJRA 3C3PA 2ONYA 3EMBA 1R8XA 4XUEA 5DM2A 5EZQA 4C07A 10MHA 2BH2A 4RVGA 2JJQA 2PWPA 3LBYA 3ANXA 4RWZA 4GOOD 2XVMA 4IV8A 5E8RA 1VP3A 2JH9A 3BUSA 4QPPA 4RVHA 3R6TA 3TKAA 3TR6A 1VQ1A 2H1RA 2YR0A 1NV9A 3JWHA 5KQSA 2YXDA 5HIJA 5LR6A 2AOVA 1ZGAA 4M36A 3I5UA 1NE2A 2OY0A 3LECA 5JR3A 5K0FA 3BWMA 1D2GA 3L8DA 3GRYA 4PNEA 5HIIA 2Z6QA 3G88A 2P1DA 3GRUA 1XXLA 4Z2YA 3BKXA 5HZMA 2ONZA 1WXXA 2JHCA 3SMQA 1M6EX 2R6ZA 3EVBA 3JWGA 4BLWA 5E2AA 5CUQA 5K0BA 2NXCA 4X41A 2PVCA 4C4AA 5DXJA 4RSRA 2ORED 1EIZA 2FPOA 3IHTA 1RI4A 3GRZA 5BW5A 1JTEA 3UA3A 2AZTA 1EG2A 5DSXA 3UA4A 3HCCA 3EVZA 3MAGA 4PYIA 5HOQA 4Y2HA 3I58A 3BWYA 5EZSA 1RJFA 2O0LA 4PYQA 5HEKA 5LQUA 5FTWA 1AQJA 5CD1A 3R24A 2I6GA 3HA7A 4IWNA 3CBGA 1YFLA 5D1HA 4YMGA 4GC9A 4CWAA 3THSA 3HCFA 5IKMA 4DA4A 3G5LA 1D2CA 2BZGA 3X0DA 1XVAA 3KQPA 5CIYA 1X19A 3AY0A 4R05A 3DMGA 3G8BA 2CMHA 3GWZA 5EMLA 5LQNA 3QOWA 4EMSA 3KR9A 2PXCA 4DZRA 5GM2A 2O07A 1YUBA 2XYRA 4QDKA 2ZBQA 3KR2A 5CVVA 1G8SA 1L3BA 1KPHA 3PB3A 4RTPA 4DQ0A 4KIFA 1ZG3A 3OZRA 5U4XA 4V0RA 4NECA 2Y1WA 3BZBA 3M4XA 2NXEA 3O31A 1TPYA 5EEHA 3RW9A 2NP6A 2E5WA 1FPQA 4MQ4A 4MHTA 2FRXA 2IH4A 1JG3A 2PGXA 3BGVA 1QAQA 3FRHA 5EEGA 5EQJB 5EMMA 1ORIA 2V74B 3OU7A 4F84A 5EKUA 4DCGA 1FJXA 3LGAA 1VL5A 4ER6A 3LCUA 4PIMA 3DXYA 3A27A 2JH8A 5BXYA 3EVAA 3KQVA 3M33A 3RIEA 1DCTA 3GO4A 4E30A 1RI2A 3SSMA 4RYLA 4PYJA 3P2EA 3LKZA 3NMUF 4DMGA 1AV6A 4FT2A 2OZVA 5EG5A 2AN5A 2WA1A 2IDJA 3C3YA 3ME5A 3CJTA 4BLVA 3OFJA 3P9CA 1WXWA 1T43A 3K6RA 4MTLA 2IFTA 2C7RA 4KIGA 4XCXA 2P3LA 3IEIA 4RTRA 5FUBA 3C6MA 5DLYA 4X63A 3M6WA 1OR8A 4AUKA 4C06A 3SM3A 5K03A 2XBMA 1QANA 2P3OA 4DM3A 3HA5A 1L3CA 4LG1A 4HTFB 4E31A 3FTCA 4RTLA 3HCAA 2OBFA 3HNRA 5FHRA 2FYTA 4PYNA 4P7GA 5K0CA 3KQSA 2PSSA 2PWYA 1VPTA 3G2QA 2WA2A 4KW7A 5DSTA 3EGVA 5GINE 3G8AA 3IYLW 3PLAE 5LSAA 1WS6A 1IM8A 3V8VA 3BKWA 3EGIA 4M38A 3MB5A 3MQ2A 4RTJA 4PINA 3KQOA 3DTNA 4RTOA 1NW7A 1QZZA 3T7SA 1NV8A 1XJ5A 1P39A 5HIMA 3EVEA 5ICCA 2NNWB 2HR1A 4DKJA 5CCBA 2PLWA 4RTSA 3NVKI 4OBXA 4GEKA 5GM1A 1G8AA 4LECA 3R0QA 1RJEA 1SUIA 3FRIA 1JG1A 3H2BA 3SXJA 4YUWA 5EHIA 3T7RA 3G7UA 3Q7EA 3FUVA 2PX8A 2I9KA 2BM9A 3PS9A 2F8LA 3OE5A 3UJ6A 3KQYA 3VYWA 3DLCA 5DM4A 1Y8CA 2ESRA 1AF7A 3I53A 4GBED 4R6XA 3DUWA 2JG3A 1VP9A 4ER5A 3AWIA 4GOLD 4ER7A 2K4MA 4HH4A 3A4TA 5FQNA 1SQFA 3CC8A 2PX2A 3NDIA 2PV0A 3KQWA 3NVMB 4WVLA 3GIWA 4O29A 3UJBA 3FUWA 3B7PA 2O57A 3KQTA 2GPYA 4LWOA 5T6BA 5DX8A 3OU6A 3R9XB 2G1PA 4HRAA 4UOEA 5E9JA 1SKMA 5DT2A 2BR4A 5ICGA 4ER0A 5LQKA 1NW5A 1JSZA 3HP7A 2AN3A 3GU3A 3EPPA 3NDJA 2JHAA 1R18A 4RX1A 3OZSA 2C7PA 5IH3A 3TPZA 4C04A 2OKCA 1VLMA 1YB2A 3KPYA 3P2KA 5EOVA 2UYQA 5KQRA 4X1OA 5DTQA 3LX6A 4E2WA 3LCCA 2QRVA 4PGGA 1EAMA 2UYCA 1IXKA 3G5TA 3SSNA 4P7KA 4FSDA 2VS1A 4OQEA 1KP9A 5EKXA 1O54A 4PCLA 1Q0SA 1ORHA 1XDZA 3AXSA 2OYRA 3P97A 4DCMA 3P71T 5HIKA 3MTIA 4BLUA 4RTKA 3NWEA 3LPMA 3S68A 2ZSUA 5GIOE 5DRTA 1N7JA 1R8YA 3LL7A 3TFWA 2IH2A 8MHTA 2PT9A 1NW6A 2AOUA 4KWCA 3V97A 5C9ZA 4GOMD 1WZNA 5EIFA 2AOTB 2C7OA 5K01A 3P9IA 4M7RA 1XCLA 4QVKA 2PX5A 3LSTA 4HSGA 2OPBA 4E70A 5FADA 3KPWA 1QAMA 5E1MA 3FTDA 2PXXA 3OZTA 3NW9A 4C03A 3HA3A 2ZFUA 4KDCA 1NBHA 1X1AA 4CKEA 4E2XA 1KYZA 4E33A 4L7VA 4RTQA 3VSEA 2EFJA 2VDUE 5GP1A 2OB1A 2CKDA 1ZQ9A 1O9HA 5E9WA 4IKPA 3REOA 5KVAA 3A25A 2G71A 3B3GA 3FPEA 3M6XA 4XUCA 3M6UA 3I9FA 4EVIA 1JQDA 1ZGJA 4PYKA 5JUWA 4BP1A 1I9GA 4P58A 3LBFA 3KKZA 1P1CA 3AJDA 3C0KA 3HM2A 1I4WA 5FWAA 5T67A 2B3TA 2HWKA 1UWVA 2G70A 3HVJA 5GOZA 3HCDA 3P9KA 3GRVA 4RTMA 5BW4A 5K0NA 3E05A 2ZVJA 4R8SA 3DP7A 3UJDA 2PT6A 1XCJA 1N7IA 4GC5A 4QVGA 4DF3A 2NYUA 3P2IA 3TKYA 4OA8A 2YUIA 3FUUA 3MCTA 4PCAA 3GGDA 3PFHA 5FA8A 4PIPA 4PYMA 3FZGA 3MTEA 2A14A 2EJTA 1G38A 2IH5A 1FP2A 1BKYA 1F3LA 4QTTB 1KPIA 2AOWA 2IPXA 2ZLBA 3FPJA 3PVCA 3FTFA 1NT2A 3KQQA 4CKBA 4ER3A 3KPUA 1EQAA 2ZW9A 1AQIA 4HGYA 2P41A 3I64A 3FTEA 1Z3CA 1I1NA 5EIWA 2CL5A 3O7WA 3RODA 5KYGA 1X1CA 3EVCA 3TMAA 5HILA 2ZWAA 2BR3A 3B5IA 2HTEA 1R74A 1G55A 3K0BA 3AXTA 5DXAA 2UZ4A 1RI1A 1KXZA 3UFBA 3C6KA 3JWIA 4FS8A 4YV2A 4LWPA 5E8JA 3SVZA 4KVZA 4PONA 1YZHA 2AOXA 3OFKA 3SR4A 2YXLA 3B3JA 2QM3A 3DH0A 3QV2A 2I7CA 4FP9A 4RV9A 4YUXA 3OCJA 3EEOA 4CTJA 2YX1A 2P40A 5CVJA 2IGTA 5CVDA 1IY9A 2ZULA 3EGEA 1QAOA 3B89A 3HCEA 3BXOA 3ORHA 3SSOA 2QE6A 4HC4A
chains in the Genus database with same CATH superfamily
3KKQA 2VHCA 1ZZGA 3EAQA 4RSGA 1JS1X 1T8WA 2REBA 1CQXA 3DXXA 3R8CA 4YT5A 4K28A 3NR2A 3IDZA 4ZWNA 1VGRA 2JLBA 3QOXA 3RROA 4CODB 2JIZA 3U7QB 2AC4A 1FYXA 3RC1A 1NBWB 3PD0A 1Y81A 4QO8A 3EQ9A 4BFXA 4QT0A 1KVSA 3QJ5A 4UJ3A 2NU8B 5CX1A 3ZE2B 5EJEA 1E20A 1A4UA 2O2SA 4JJEA 2HD4A 1DKPA 1DWPA 1N2SA 4HLNA 2VP6A 4JXXA 2C9MA 1DIHA 4U2KA 5F1PA 1K4YA 3M9LA 1AA9A 3OZWA 4MQEA 2UUPA 1YVPA 5H0IA 2QX6A 1J2TA 1BWRA 2IY7A 1HXHA 1ZU4A 2I3GA 4JSYA 5AHOA 5LC1A 3Q0IA 3AVOA 4Z51A 5BUCA 5JCOC 3GH3A 1VJCA 2EZ8A 5DNCA 3ENKA 3RJZA 1B26A 3C5CA 5F78A 3RSSA 3DPUA 4MUAA 2YHAA 3BJRA 2QQEA 2LDXA 2B25A 2H1IA 3RS8A 4IJ6A 3GFFA 4UU7A 4EPWA 2AKAB 3U44A 3B6ZA 6Q21A 2HCFA 4MDFA 3EGWA 1J21A 1VKNA 2I4RA 2OQIA 3IIJA 4R71A 4RS3A 4HWSA 3TOSA 1U2GC 3JQEA 3AM5A 3O90A 4QPJC 1CTQA 3EA4A 4H60A 3L5OA 5FHQA 5J43A 1OH5A 1NJ5A 3VC1A 1HZZC 3IQDB 4GVXA 4AJ9A 2HZBA 1I0IA 1QMGA 3ND8A 3NHKA 1V5IA 4H9KA 3I2HA 4M46A 4YEDA 5AVQA 3KWLA 5EVJA 2FR1A 4HH3C 5JY1A 1PWXA 4HAYA 2RH5A 5HKKD 3FBGA 3L6RA 1IH8A 4Y6GB 2ZKLA 1QTIA 1EBFA 4G2TA 5TJ9A 1CRQA 4PAOA 1MIOB 4KQ9A 3RS3A 1QHHB 2WIKA 3W2HA 3E6AA 1OPRA 3V8PA 2RK6A 1GZ7A 4JI5B 1UBSB 2VYQA 4QIHA 1DOAA 1RMQA 1SVUA 1YVEI 1ITZA 1FVOA 2ODAA 3JPYA 1PJTA 2PX4A 4HDKA 4LY3A 1VLJA 4DREA 3NU1A 4PHHA 4PYLA 4YGYA 5AOCA 1QGED 1D0VA 3KE9A 4FQ8A 4NYIQ 1BN6A 3F7OA 5BORA 3GZNB 2YFHA 4H77A 4LFAB 1YMUA 5DBHX 1TT7A 3I04M 1XYYA 4ML3A 3I6BA 2J5QA 1VRWA 2R8RA 3DR3A 1M0SA 3PGKA 5AKIA 3RJ5A 3W9BA 4DRXA 4PG5A 3TZCA 3QJYA 1Q0RA 3VTFA 2FMXA 2PBFA 2BDTA 4ALKA 3PHLA 1USUA 1RAGA 1NOIA 3DHYA 3FGNA 4ZO4A 1PG2A 2RGXA 3AIMA 2O8CA 2YKGA 4KWTA 1KKLA 2WSMA 2XNKA 3GOQA 4A8TA 4BIIA 4BLPA 2ZJ1A 1EUZA 3ZY3A 1QV7A 1UBOS 2X8LA 3EFBA 1YE5A 2DPMA 3OSUA 1WXDA 3Q6MA 4NH4A 3CH4B 1JQJC 4MR7A 3DBRA 1ZMBA 3V1UA 3HSKA 1YH3A 2GB4A 1FU4A 1XTSA 1YASA 3ZE8A 4I5FA 1BOOA 5AJVB 3HEMA 2DUNA 1O9GA 2Y92A 3L0OA 2AQKA 1HLFA 3T3DA 2QRVB 5THQA 3WQHA 3DE0X 1B2LA 1CZHA 3RC3A 3R5FA 3HFGA 3HLKA 4DXHA 4GP7A 3TZKA 2PR2A 4TXHA 2QVXX 3GNTA 3IMKA 2AEFA 4HF7A 4BYGA 1UKYA 3KJNA 1WHSA 2AZDA 3BN3A 3D6NB 2ZIZA 3RVBA 3S2UA 4E13A 4FYJA 1NVFA 3MBKA 4LJ5A 2B1IA 3RTBA 3KEFA 4I5GA 5KQMA 2P4UA 4HV4A 1PK7A 1ZJ4A 4MWEA 3V80A 2RG1A 2ZBRA 4NOKA 2WVGA 2XUQA 1KSGA 3ZQ6A 2RK4A 1I1HA 2ZRHA 3E9QA 2UVPB 1EFVA 3HVHA 4FOTA 5JADA 3C3KA 2B7BA 3OVMA 5JC8A 2JLVA 1UPXA 1KHHA 3WB1A 3UT0A 1XNRB 4PCVA 1TM4E 2H0RA 2P90A 1ZYUA 3CUVA 4DIEA 2HPZA 3GLHA 2WD7B 2PEYA 1XNJA 1HEYA 3WKBA 4EB3A 3DE5X 5FOVA 2HWWA 4HJXA 4XDGA 5E2IA 4IGAA 1SUAA 5EPUA 2JHPA 3SEFA 2DCUA 1LW7A 2CMDA 3MS7A 5TQ0A 3L7DA 4YMVA 3PDUA 3LF2A 1RC8A 2IELA 3LZ6A 4FHDA 2QV7A 4HN4B 4H0FA 4UDXX 2XMSA 5IASA 3E4DA 1NHGA 3Q7IA 4CMIB 1XRLA 2V7WA 2ZUUA 1NW8A 1ZMOA 2OORA 3GLTA 4KN9S 4NBSA 2BAGA 1FP1D 4JLPA 3VX3A 1NU8A 4HXFB 5KBYA 4M0UA 4MIKA 2YWFA 4YAEA 4B79A 3DOIA 3QUSA 1LPSA 4A8HA 4ETIA 1TT5B 4ZI7A 2WU3A 4M0MA 2YVUA 3SJZA 3E70C 4YIHA 1RHKA 2NV2B 4HFRA 2IT1A 3V7FA 1H1LA 4W5RA 2L2QA 3T1QA 1ZW6A 3W8EA 4ARBA 1G4AE 1EYZA 3HZZA 5A03A 5I7OA 3BT7A 4R2LA 1PUJA 4IFIA 5E6UA 1KZGB 1XXHA 3A6JA 3G8CA 3E9MA 3AR8A 2HWUA 4RJ2A 4DDMA 2H85A 2C29D 3EA5A 1CZRA 4NE7A 4AWAA 3JARB 1GKIA 1W88B 3VR6A 2C7GA 1XN1A 1OX4A 1YZNA 2IIPA 2OV3A 2XIJA 1M2OA 5KCMA 8OHMA 3D6JA 2PH5A 3EX7C 3FTPA 3V9PA 4DCNA 3SVLA 1A69A 3PLNA 4Q16A 3SC2A 1GXSA 2OECA 4JVLA 4LJ9A 3ZV5A 2R1TA 3OQ6A 1VLVA 3OQVA 4IMRA 4C0QC 4D6XA 4JAVC 2RE8A 4V0OA 1R6AA 2IYWA 1E3EA 3MD9A 2KHZA 1OT3A 4Q9JA 1BIFA 4I08A 3ZPXA 7REQA 3QGMA 2PMCA 4OHPA 4G8DA 2ZWIA 4FR2A 1I32A 2QM0A 1ISFA 2DSNA 5H68A 1R8XA 5EZQA 2P79A 2R4QA 4ECEA 1Z2CA 3KX2A 3BREA 4C21A 1IJEA 4KDEA 3ZDXB 4E94A 1NLZA 4MKHA 1ZICA 1WXQA 1MENA 1XZMA 2XV1A 3R4VA 4EDHA 1PVVA 2BFCA 3M6FA 2O59A 2VPPA 3AI7A 4QPPA 3WWEA 5CDGA 2O5CA 1YRQA 2X8WA 1EDDA 4XYMA 2QTAA 3P94A 1P0FA 3KFXA 4PSDA 1SBHA 4Y2JA 2D0OB 5KEIA 10MHA 2F4VB 3BTVA 4G23A 3K0CC 3IV7A 5DH9A 3VDQA 2IZ0A 3NHLA 5HIIA 2QLMA 4OHKA 2FFAA 4OAQA 1X2EA 4X85A 1M6EX 1VIYA 3FWZA 3DYIA 4AMZA 1FY2A 1HK7A 1F0NA 2JCVA 3IIMA 3EUFA 2PLRA 4PPYA 4I9NA 2ZYTX 1TKAA 1JTEA 3WYFA 1QXSA 1UBUS 1PSWA 4RESA 5EHNA 5JQGF 2IV3A 4TZ6A 2XWBF 2ZPTX 3I3OA 4NEGA 1HE5A 4PYQA 4US1R 1UQRA 5HKKA 1G16A 2DQSA 2FU5C 4N6NA 2I6GA 3MUEA 4OV6B 3CBGA 1YFLA 4JNCA 3U4GA 1RYYA 1THMA 3RSHA 3ILXA 3T7KA 2PUFA 5ALGA 2OHHA 5AIAA 1PW5A 1OFUA 4BKOA 3HXLA 4FIDA 2BZGA 1SKBA 1U0GA 2BHLA 2ZWMA 3QVMA 5GJWC 5HRCA 3A2KA 2WYHA 5LXTF 2FUG6 3MOGA 3L6BA 4JEIA 4JI6B 3ZBPA 3K70B 5J1TB 3TEMA 4JQYA 1K7YA 2HJRA 2WG2A 5DI9A 3VJKA 5F23A 2CD9A 5AI6A 3PGJA 2WW8A 1G8SA 5BVGA 1YUNA 2DKFA 2Q1XA 2Y2VA 3CEAA 3IMFA 4P98A 4DRYA 4L8LA 3G0OA 4H7PA 3OZRA 4IZIA 5BW6B 2YMLA 1ZIYA 4F72A 2VR1A 4Y2QA 4Y9TA 3CH5A 1RPJA 2PL1A 4MW2A 5BMOA 2BJWA 4UZSA 4DCSA 2O2IA 2X58A 4KFTA 4RO0A 4V1CB 2CZQA 4ZOLA 5EQJB 1PZGA 3ED5A 3EC7A 3EH1A 1QRRA 3E8MA 3OU7A 5I9IA 1FJXA 4M1OA 2FR0A 1L6IA 4LGYA 1P3DA 2WHQA 4BAGA 3ENQA 2OVBA 1U0OC 4YRTA 1DCTA 4ZKEA 1OXUA 1HYGA 3TLYA 2GYWA 2IYLD 2P0AA 2ZDQA 1IUNA 1NVEA 3BERA 1V11A 7AT1A 2DY1A 2QDKA 2GRAA 2V6GA 1YS6A 3FLEA 2Q1WA 3KSZO 5BNTA 1TUIA 2AFHB 5AICA 4U7GA 1X0XA 3EULA 1V1MB 1HDIA 3MCVA 4U7FA 1YB1A 4LQ4A 3W8NA 2DBRA 4FYIA 5DBGA 1NQWA 3MSCA 1C0EA 1N8SA 1JZTA 5DLYA 5GQSA 5JWHA 4J2TA 1ETHA 4OATA 4TMVA 4PFQA 3CEHA 1TLTA 3MB8A 3A31A 3O84A 1GPWB 3I73A 3SG0A 1YE3A 4MOWA 3DF9A 4HYQA 1EFPB 1KEEB 1P81A 1OWNA 1RKXA 1Y8QA 2IZ6A 2PWYA 4XA8A 4FOSA 1MA0A 1WS6A 2XQVA 5D5QA 3JQ9A 5BV7A 1RCUA 3HJUA 4M38A 4R68A 1J09A 2IU0A 1XMPA 1Z9BA 1E4EB 1Z4MA 4YT4A 4RTJA 4CIVA 4WASA 1ZISA 5FOQA 3BSWA 5G3ZA 2X0KA 3I9NA 5HXAA 2O2GA 1E3WB 4AG3A 1B3RA 4L08A 2IS4A 1WU8A 1OV6A 5DIFA 3OX1A 1SUEA 1X38A 1K5DA 3F78A 3HYCA 4LOHA 4NXMB 4JD5A 4B3HA 3ESXA 2HDWA 4MAFA 1KVQA 5IUKC 2WAXA 4UUAA 4AW9A 5L95A 2VC2B 2FQYA 2VKTA 4PRZA 3HVRA 3D59A 2C2GA 3IOBA 1CVLA 2BM9A 1JSLA 1P1KA 2FR8C 2VSNA 4E15A 1QFXA 2JBWA 1JL3A 3AR5A 2O4UX 5DM4A 3VR4A 2P4HX 4DN6A 1ZGHA 1E60A 1USKA 2HKIA 4R6XA 4IOJA 3FIJA 3AWIA 3ZFQA 3N2IA 3V8RA 4NX2A 4MKGA 1JR6A 2K4MA 3ZNNA 1MG5A 5A06A 4KSBA 1KR2A 1M6NA 2FQXA 4NC9A 1G7TA 3I6QA 4HK4A 1MJHA 2GO7A 3X1YA 1BXZA 3H05A 1VI2A 1G19A 3TR0A 1JEJA 3C39A 3BILA 4FMBB 1ZVMA 4IFBA 1E2MA 5J2UA 1VYUA 2M6LA 3GRPA 2NUTA 1QS0A 2G1PA 4DARA 3MVEA 5ICGA 1TEZA 1JIVA 1IHYA 4LBVA 1U04A 1LSOA 2H63A 2VUTA 2DE0X 3WLSA 4D25A 2GLTA 4RDCA 4QXAA 5FXMA 3GC6A 3GY0A 5AVJA 3T12A 3I01A 3VKGA 3JQAB 1GG8A 1N9GA 5FBQB 1L8AA 5LOVB 2ENUA 3LUPA 3EQ8A 4JC0A 5K6AC 1KQPA 1BQ3A 4XQ0A 4FOOA 5SICE 3EXHC 4FSDA 4V0KA 1Z4KA 1SQ5A 2EQAA 3RFCA 1QYVA 1LH0A 5JFOA 4W9MC 1I6LA 1P0CA 3NH6A 3P71T 4DCMA 1IN4A 2R8XA 3S68A 3T41A 2IU4A 1OOEA 4B6EA 5BW8A 4QC2A 1VSTA 1F8GA 3IBTA 1E2GA 1PUXA 4KWCA 2JF0A 4LQCA 1A9XA 3N59A 2GNOA 2Y9MB 4HSGA 4AS1A 1RHJA 2VQDA 4CEIB 1PFWA 3FOCA 2B8NA 1H6AA 2Q5OA 2ZB4A 4B6FA 5KVQA 1QIHA 1F48A 3V33A 1G9TA 1ABEA 2HEIA 4E33A 4L7VA 3RR2A 4WRRA 4F2PA 3WMWA 5GP1A 4MW7A 5BRAA 2I5PO 3WGIA 1N78A 1WUIS 4OLFA 2O3RA 3A25A 1O77A 3C1UA 3BDAA 1OWLA 2ORVA 4FILA 3FCOA 4LNAA 4EVSA 4BP1A 1EINA 1HMPA 2IUYA 1P17A 2B3TA 5IW8A 2E4AA 3NZEA 3ONDA 1ZI8A 2YZNA 3NOVA 1DKOA 1FF9A 3MJVA 5JCPA 1JHXA 4A3SA 3PT5A 1LLUA 2O1XA 2HWXA 4KTTE 2ECFA 3HWSA 4GR9A 4LTMA 4RCZA 4ZQGA 2V97A 4ZVRA 1CQWA 3G13A 3LK6A 3V4PB 3ZQ4A 2VK1A 4JOQA 5J4LA 3L1HA 1CR1A 4UJ5A 1E2UA 4J4BA 3QIAA 5AUPB 3VC3A 2AGVA 4RETA 5KYXB 1WMDA 2HU5A 4LYAA 2V45A 1R9NA 4PTLA 3EASA 2OZLA 1EWYA 3FTFA 3BSSA 2KBEA 1R4NA 3I34X 5CT5A 1MAVA 1GL7A 2VPIA 2WYVA 2XOKA 3NVAA 1JA0A 4AKIA 2CLDX 1OX6A 3FFXA 4W5HA 3VYRB 4BNJA 2WUFA 3IBSA 2WHPA 3AKDA 4M0DA 2P6UA 5JZSA 2JFQA 2XDQB 4RA9A 3IQEA 1G55A 4LMAA 3CLRC 2VZ0A 5FA6A 2XMBA 1DBSA 4Q39A 4AS3A 8LDHA 4MVJF 4LWPA 4WA8A 1EA7A 1BAPA 4PF1A 5LP6C 5H81A 1FDRA 3DH0A 2GN8A 4EG5A 5K4AA 4FP9A 2Y67A 3ONEA 2HA7A 2C4VA 4EVRA 4UHBA 4LVCA 5CVDA 3FE2A 2JDID 2OD7A 4OHWA 1SUBA 2QE6A 4KFCA 4ND8B 2RG7A 1V25A 4UAUA 5FQOA 3AEXA 3JQFA 3T9BA 5IT5A 1UXIA 4GX5A 1YZFA 3M6LA 2GAFA 3KTFA 1CIPA 2X5NA 4AKSA 2ZI4A 1AMNA 1P1JA 2BEWB 4X1KB 3WZLA 3KFLA 3E3MA 4HN9A 2PUHA 4X93A 2PGIA 3H9GA 3KT8A 3RPEA 1KQGA 1UBCA 4F5DA 3VXKA 3Q11A 2ZYHA 1Y80A 3ZHCA 3K4PA 1DIAA 3PG5A 3T9EA 3PCTA 3V7UA 2BFMA 2JRCA 2RDMA 3GJZA 1NZFA 3QUTA 4WZZA 3L2OB 4OQ4A 1LJ8A 2FHPA 4J1TC 3QFCA 2VYCA 1RI5A 3OMLA 4YPOA 3NAQA 3DEIA 5EWMB 4JJKA 3KU1A 2WYWA 3IVXA 2BLNA 1PV4A 2JGDB 1EE9A 4FFOA 1UFKA 1O87A 2MHCA 3HDJA 1SRRA 1P1HA 3KJEA 1KDPA 2V7UA 1ZFNA 1RKBA 3IERA 3O3CA 2VCEA 3DZDA 4X6UA 2HHCA 2V0NA 2VWGA 2Y0DA 4JJFA 2P3SA 4KAAA 4XD2A 4PZDA 5ED4A 3C6QA 3KTAB 3TQSA 4M8IA 2AX4A 2NW6A 2I8AA 1XQWA 1GPYA 3HWX1 3LQRA 4FJ0A 5DYYA 3RV3A 4FB5A 5BURA 1PJLA 1YBVA 3IP9A 3QYJA 1Z0IA 3QTBA 3VR5D 4CDGA 4HQNA 1O1YA 2R751 1QK5A 3QX3A 1SUDA 3TAXA 4MA0A 1S8AA 5F3DA 3K35A 4NFHA 4DG8A 4R9UC 1K2WA 3ZIAD 3CZ5A 4C0SA 2A92A 2HMYB 3GLFE 1P73A 2Q8QA 3TW6A 5IG2A 1NVKA 5E9AA 3CWQA 2SNIE 4B4DA 3HJBA 4X54A 5EESA 1CY2A 5JG7A 5LLSA 3UUEA 5KOHA 3G02A 3UWSA 4HQKA 3TMKA 4TZTA 1GDHA 3PFBA 1BXKA 2PS0A 1P5FA 3BBPA 3SD7A 3W1EA 4MAMA 3T9DA 4LEIA 1EXMA 5LNK6 2GUWA 3IE2A 2C8VA 3GQVA 3K96A 2B98A 3UCEA 2P9EA 2PUEA 4QUGA 3KPJA 4R1MA 1BVRA 4J9UE 4EP1A 3ANYB 3PFGA 5DPMA 5JAQA 2EJCA 4M9ZA 2GS9A 4GUAA 5ITZA 5BRNA 3FM9A 1JJAA 2A0YA 4UNIA 1NW4A 1XDUA 1VPVA 2BV3A 3NQ41 3ZR4B 2R86A 3A2MA 3G17A 3OZDA 4QTUB 1R9GA 3WV5A 3M2TA 1PL6A 5K4GA 2ZJ3A 4RD2A 4BX3A 1FVFA 3OD5A 4AZ3A 1CF9A 1VE3A 1QGDA 3WLOA 5C46F 5CFLA 1UQUA 3DEKA 1ADCA 4DIDA 3QF4B 5AVUA 3WMEA 3M49A 1OYOA 3UW1A 1S89A 2CNWD 3R75A 1EXVA 1GPLA 3BCHA 3KEOA 3KPVA 4H6XA 1AKUA 5I7EA 1XNQB 1A95A 1Y3HA 1K8RA 1FBNA 2GCOB 4AICA 4JBNA 4YLEA 4CF7A 1BC5A 1GNSA 3MGAA 4WXRA 1EM8B 1MABA 3GUVA 4QJBA 3VPAA 6ABPA 3OMXA 4QT4A 4XFJA 2OK8A 4ZZ3A 4YX9A 4H3HB 2BFFB 1BMTA 4WBXC 2ERXA 1H2HA 1KYXA 1PFQA 4C22A 1RIFA 4QBFA 3C6XA 2UXDB 2GKGA 1BX3A 3PJEA 4Y9SA 1KEVA 1Q0QA 3HN7A 1IY8A 3NVDA 3KJZA 5ALYA 3WGMA 4HS4A 4GPZA 4ALMA 1GTG1 3UENA 4U3JB 5AM4A 2DUJA 1I6MA 1Z08A 3KR0A 1O8CA 4GQAA 3V4ZA 1X1RA 3PD1A 4HFNA 1SJ9A 1QHSA 1P0IA 3NETA 4WT7A 4EW2A 1UMBB 4F9FA 2GPBA 1FUUA 1N2HA 1X9HA 2PANA 4XPIB 4BLOA 1JNXX 4JR2A 2D00A 2W6CX 2G8NA 4FZVA 1GNVA 1T10A 1OBCA 2YXEA 4UVIA 5F7JA 3WX0A 5FX2A 2KSQA 3BS4A 3GRRA 4Z3OA 2EF1A 5JHGB 5ELLA 5ERGB 3GPCA 2XYHA 4U7WA 4XARA 3ITKA 1ZR4A 1TZMA 3PQ7A 2QJOA 3FNQA 4QFMA 3U4MA 1K7FB 3WFJA 3TSZA 3WOHA 1Z4OA 2DX7A 2R47A 3LF1A 5JYDA 1RLJA 3FNEA 1ULBA 2QY6A 3AR3A 3AETB 3ONVA 1SVIA 1L4BA 4MWSA 4EJSB 4JV5B 2P9BA 3H1FA 2DPYA 1MJNA 3LDAA 5FUWA 1V26A 1QFSA 4IJKA 4LKOA 1G8YA 2CE2X 1HDRA 1Z56C 1LDGA 4N48A 3W05A 4E3WA 1U3CA 1O58A 2J3IA 2RCNA 2XOEA 3PPXA 5DGIA 1E63A 2ZUCA 3FNHA 3FRJA 3I2GA 1S2DA 3JQGB 3V1LA 4LF8B 3AB7A 1R0RE 2JDIA 1S3IA 5DWDA 4BO5A 4YUVA 5JH7B 3INTA 1DP4A 1PLLA 4ZEOA 4W7HA 3HYNA 3Q85A 4OSOA 1PZHA 5I3CA 3BB1A 3MXOA 3ZKWA 4B33A 2E4WA 1VTKA 1Y6JA 1G5IA 1YWGO 3BA6A 1ZOOA 4NJMB 3RFUA 3LDGA 1H4VB 5FULA 4UZFA 4C0WA 5JAIA 2ZSIA 1U0SY 4F71A 4OXNA 2ONYA 1P9OA 2H9YA 2JHFA 2JI6A 5A4IS 4YP9A 1EVLA 2XNJA 5HQTA 1K5HA 2QRKA 1BTOA 3TLKA 1A2BA 1VPWA 2GCEA 5GOTA 3EQ7A 3H11B 1RAAA 5E8RA 4ENVA 2P9JA 4BCBA 2XCRB 4DMKA 2A5YB 3KUDA 3M83A 1VQ1A 1QRTA 3D6FA 4BFWA 3B2NA 4C6SA 2FPXA 1CY8A 1FP7A 3LQKA 3QWHA 1X7YB 5DW0A 3L6UA 1SC6A 2I6SA 4ZALA 3DLPX 2HA0A 5F7OA 3AHJA 2OCBA 2C3PA 2X23A 3GRYA 1VI6A 1YTUA 2Y9PB 1Z0ZA 1VIVA 4PGAA 4F4UA 5LN1A 4XUGB 3SLRA 4YGXB 4QNNA 3VR3D 2ZXEA 1UZNA 4BV8A 3VR5A 4MSUA 2REQB 4QFDA 3OT5A 3IALA 5CA0A 3QWFA 1JDVA 4JJ7A 1XP8A 2IHYA 5HMMA 3T34A 1V8DA 2XDWA 3HCCA 1TUEA 5JMWA 1BU5A 3HUUA 4BWFB 2O0LA 1KJ9A 3GLQA 1BKDR 3MXTA 3QKTA 1EBUA 4FGKA 1I51A 3ZIAA 4AJJA 2V7GA 1K8QA 3GFBA 3HA7A 1I4DD 2XKJE 3GP8A 1TVCA 4P22A 3TZQA 1BXGB 2W2TA 5AVZA 2ET6A 3AIKA 4PANA 4CDMA 1D2CA 3LK7A 3ZCPA 1M66A 4WK4B 5J5VA 4JLUA 1GL9B 2WF6A 1FNDA 1K3UB 2A58A 3TBKA 2I2XB 3KV3O 3UYKA 4CTMA 4KMSA 2WABA 3IURA 1QCYA 4KX3A 4RD0A 4WL0A 3GJXC 2QRPA 3TNJA 4Q7LA 2G08A 3EPKA 1ONNA 1RLTA 4EAAA 3E15A 4G0QA 2XGGA 3RF7A 2BGGA 4MNTA 3AERA 2VDPB 3NHBA 4ZO9A 1CXZA 3SC6A 3DHEA 1MNAA 5AI4A 1K63A 1Q0HA 4LF7B 5GGXA 2CLHB 3C2QA 4M54A 2YHBA 4KMRA 4KR2A 1D2EA 4UVEA 1MB4A 1I13A 4TWRA 2A9VA 1HM5A 5CGQB 3VX4A 4F84A 3OF3A 4WCFA 5C4MA 5TMBA 3DTYA 1XAJA 1JJVA 1QH9A 3M33A 3S40A 3HXQA 2XD4A 5D3KA 1J2RA 3OWOA 4K9OA 5AJYA 2JGKA 3QXJA 4QELA 3WYGA 2CNWA 3MRVA 4WX2B 1OYVA 1UWLA 1YI8A 2APJA 3EEFA 3N28A 3OA0A 4TV9A 5D86A 3C3YA 1ZXBA 3CJTA 4M1KA 1OIWA 3OM0A 4IH4A 1I01A 1T43A 1ZK0A 2BKVA 1G3MA 4WOBA 4N5MA 4URXR 4J43A 2HOQA 1DRVA 1C8VB 1RWMA 2IGBA 3KV1A 3NOQA 3NOXA 4Q03A 4TL7A 5IEBA 3UPDA 5TPWB 5IDQA 2AI1A 3FDFA 4XCQA 5SZIA 3B6JA 1U7DA 2WQ6A 5F4ZA 4OK5A 4AK9A 4DBLE 4K3VA 5F9MA 2DGDA 2B0CA 4O5AA 4O2BF 3WYEA 5BV8A 3D54D 1XJQA 2CF5A 3L4SO 1A4XA 2OHOA 3NCTA 2ERYA 4IFTA 4P7GA 4UD2A 1RWOA 3CA8A 3RJMA 4B09A 3PLAE 1T5DX 1PGOA 2E7ZA 4BGEA 1M1UA 3UH0A 1GSIA 4H7DA 4QE3A 4URFA 3DTNA 4NBVA 1I2ZA 3IMCA 3P52A 4CLHA 4CCSA 1ZA2A 3EZYA 4CLRA 3I05A 3ZDAA 2IBMA 3RS7A 3D4LA 2I6QA 3K0HA 4BFSA 3JAMA 2PBZA 3JRWA 2MU1A 4J07A 2FZEA 4ZV7A 3RVKA 3GLGA 3F6BX 4ZEXA 5DP1A 1UAAA 4JL5A 3P0EA 4II7A 4C5BA 4IHJA 1TL7C 2FZGA 3F8WA 1GUDA 4GBED 2VHJA 1TYZA 3EGCA 1N6KA 4ITUA 4EO4A 3CVYA 3AQIA 1YMVA 16PKA 1BEZA 1EFKA 3GZ4A 5F51A 1EHIA 1LWOA 2YVKA 3ZHUA 3RFVA 4Q48A 4GOJA 5K3EA 2FFHA 1ZRHA 3CKYA 2NWQA 2YIJA 4DZTA 3R41A 3E5MA 3NVMB 4OMCA 1NVUQ 3A04A 1QYIA 1UM9B 5DN6A 4JYCA 1EWQA 5ED0A 4L51A 3K1AB 3LPDA 2Q7XA 2ZP1A 1WSAA 2GO1A 3PXBA 1WPQA 3ABRB 2NXWA 4QUIA 5E6SB 3IDQA 3PL5A 4DLZA 1IYZA 4UAGA 5GADl 4OB6A 1MGOA 1RS0A 1L5FA 2YWHA 2AN3A 4L4XA 2F3UA 4BMDA 1NVVR 4BQEA 2IU3A 1CUVA 3H7IA 5CT4A 1Y34E 4LF9B 3QG1A 2Y1OA 3H5LA 1VG1A 2J0VA 1YD7A 3QNWA 4YRIA 2FXVA 2PWBA 4V02A 1R5BA 1LPAB 1AGXA 5DTQA 2X0IA 4E2WA 2YWDA 2J9FB 3I5XA 2GEVA 4XOIA 4JROA 1ISSA 1W34A 1TVMA 4H31A 4LMPA 2YOGA 5KX5A 1NDQA 1ORHA 2CNNA 3AXSA 3AUSA 5EQDA 4Q9LA 2E2WA 2ZR8A 4UNQA 2EP8A 4Y6RA 4OL0A 4YCDA 2VHXA 3UCFA 2MTBA 1N4AA 2AEEA 1IOVA 4S2EA 3HY4A 4X1IA 4M0CA 3KD3A 8ATCA 4PN3A 4RLHA 1W2WB 4MMZB 3S55A 4QVKA 2IPOA 1Z68A 3OOJA 3OZBA 2ZT7A 3K0AB 4QVIA 1J0CA 4D3DA 1MAUA 4NPAA 2Q3MA 7GPBA 1JFVA 3N05A 4MW0A 1EFDN 1TLLA 2XTJA 4KDCA 1NBHA 1ULHA 2G7MC 1A1SA 3SBDA 5AW1A 4GSYA 2HSJA 1K6XA 4QJ3A 1SA0B 5FNVF 3AC0A 5HK9A 2G71A 4CHGA 2VPYA 4RNDB 3VR3A 1YA6A 4EVIA 1E2FA 1W73A 2VCYA 3NPMA 4P58A 3UWMA 3RRMA 1M2KA 5EKSA 1CJMA 3Q9LA 1CZNA 3GCDA 3E3OA 3W5HA 1IY1A 1EUDB 1I3CA 3MGCA 5JD5A 3V00A 4N9WA 1CRPA 4PV7A 4GNKA 4JVSB 2X1MA 4L8WB 3WIBA 1PIWA 2A1UA 5J9FA 2KLBA 2QLBA 5HM6A 1AGRA 2PT6A 3I8XA 4I1UA 1ZRMA 1DJPA 4WKBA 1X42A 4R8KA 5AVTA 3L8ZA 3TBHA 1PNOA 3QLTA 4OHFA 1NW9B 3H13A 4RDIA 3JVIA 4YQEA 3F6RA 1UMDB 1ZP6A 2CJFA 5TF4A 3CE9A 4PIPA 4QRIA 3MTEA 3QW2A 3UMFA 3VPBA 4D3XA 2R0QC 2UXBB 2EKZA 1R4AA 4IH9A 1DEAA 4OKNA 3ZLVA 1EQAA 3LUKA 4KN5A 2CJWA 4C1NA 3K6KA 3FTEA 4JB3A 2PL5A 1JLLA 1BA3A 2QUAA 4KNYA 1I3KA 1ISMA 5H8WA 3C5EA 2ZYWX 4QHSA 1SHZA 1NUTA 1MTOA 2R84A 1B93A 1OREA 3EC1A 1FCJA 4DWOA 2BR3A 3KWJA 3OQIA 4IWXA 3W7AA 3AXTA 2YCLA 1YDEA 5TMPA 1A5BB 1IPHA 1DAGA 2WJIA 3P5SA 4XKJA 4BQQA 4N3CA 2N0SA 1ODSA 3FIUA 4D26A 4TSKA 3IJRA 1QV9A 3RT9A 1TVKA 1VLZA 1U9ZA 3V8MA 1A9RA 4HOYA 3Q5DA 3PL1A 1UBNA 3B82A 3SFVA 3T3GA 3V8QA 3EZFA 5KZMB 3L0IB 3G2HA 4PFKA 3B9QA 4URYR 1QSGA 5LU9A 1CP2A 1PFGA 1W94A 1XPJA 2LIVA 2FLKA 4G8JA 4L22A 5AM5A 5K3DA 4FZ5A 1RRKA 3BIWA 4ME6A 4P2GA 3BF7A 2JFGA 3DL4A 2C97A 2I3ZA 4R8RA 1KYQA 2Y05A 2OMKA 1DBVO 1JA1A 4O4LA 3CB2A 1WR8A 4KN8A 5E1OA 3WL7A 2NZVG 1Z06A 4EA8A 2FKNA 4TMKA 4IMIB 3IXQA 4KDRA 1PYGA 4F2DA 3FNIA 3BD9A 5H5JA 2GR9A 3L0DA 5JDCC 2BTEA 5IJ9A 3KKOA 1CY1A 1NM5C 3RBXA 4ZCIA 4KLRA 4MQ5A 4Q66C 5EIBD 1N57A 2OVFA 2VDWA 2WAOA 1R5JA 1R5NA 3LOPA 3Q2KA 4YQYA 4B3IA 3VU8A 1Y6QA 3W77A 1GDDA 3S1AB 1SGWA 2FN4A 4N5HX 4XWWA 1GNPA 2E82A 3CPSA 1Z5WA 3M4YA 3AYXB 4I50F 4B8ZA 3A6PC 2EG9A 3NS7A 3ZLBA 3RUDA 3LNCA 1CR0A 1JTVA 2PJZA 2VQ6A 3F71A 1T0PA 5C3UA 3UK2A 1QZTA 1V6SA 5CK4A 1E5TA 1C2TA 5CXQA 1W75A 3ZBUA 3SQMA 2CUTA 3EJWA 3QVVA 3ADBA 7MHTA 1YACA 2RARA 1VBKA 2WUGA 3NIWA 4RLQA 1WY7A 3LNTA 3P20A 3VHQA 5AUNB 2RKOA 2MYUA 1C4XA 3NHAA 1C3JA 3AT1A 1IONA 1N5JA 2WT8A 4OA5A 5AW7A 1KY5A 3STUA 4OLBA 2B8JA 4ASUD 2CLCX 1KFEB 4IZ6A 3H3XA 4J0CA 4MRAA 1GSAA 2CVPA 3VR0A 3K15A 2QAGA 2NXNA 3C87A 4D3SA 3V2GA 3SKYA 4CEHB 1MV8A 2C5EA 2HSWA 3AOEA 3EVFA 4EBBA 3PUIA 1T0UA 1KIMA 4RXTA 1CU1A 1J25A 1NMSA 1SUPA 5DCUA 5I4KA 4IF6A 4RL6A 1X7HA 2B99A 5B4TA 1N33B 5K0LA 5JNWA 3G2MA 5HZKA 4B7XA 1QV6A 1VPDA 2J41A 2RAPA 1EGHA 1OGJA 1PLJA 1SOAA 2LV8A 2XY4A 5BYAA 4ZAVA 4A16A 3TUIC 4L9WA 1PL0A 1VHWA 1ZD5A 2VKQA 3HR4A 2BBTA 3ZXIA 1A1VA 1PKXA 1R6TA 3B6MA 4UHCA 1K98A 3LHIA 2EERA 5K8LA 4MUGA 2FPWA 3ZDBA 1WBJB 2Q3EA 1Q74A 2RH8A 4DWWA 2QE7D 5JYEA 2BKUA 1NJ1A 2I91A 3A7EA 4YHBA 4UPEA 3OX3A 3IP7A 1HDOA 1TTTA 4E3ZA 1DXYA 1S96A 3A1FA 3PGXA 1QIDA 5F5NA 5JZOA 2O2XA 5A9TA 1AKTA 2FP3A 3HKCA 3D0KA 3SIPA 4QOGA 4E5YA 5BN4A 3A4YA 3GXBA 3Q40A 1XZGA 1L7DA 4Y7DA 1ZKDA 1ZH6A 4PQGA 3RS4A 3ZXSA 4BKRA 2XUDA 1LRJA 1TNDA 4Q37A 3I9MA 3MJHA 4BJ5A 3KT3A 3LHDA 2NQ8A 3GPDG 6REQA 4CKXA 2YHSA 1YBAA 1T6ZA 1KC3A 4PSUA 1J5XA 1E9DA 3EHEA 2PSHA 3SE7A 4BNUA 3HWRA 3BIXA 3EDCA 4JOBA 3G85A 2GZHA 2X5KO 3TSAA 6YASA 3WL8A 2GEDA 1JHUA 1L7EA 2XVAA 3H9EO 4LTNA 4P3YA 3NIDB 3VNBA 1TKBA 1FFGA 1RYNA 1SCJA 3L7CA 4IJMA 4PBRA 5JMPA 4TUYA 4OXXA 2GVDC 1GITA 2FSIA 4MAAA 5AKYA 2IWHA 1J33A 2VAPA 4G36A 2AWOA 1IMOA 3M1AA 1TC2A 5FV4A 3ZVMA 4IIGA 1W4BA 2VJQA 5ALXA 2Y71A 4IFEA 5KJFA 2C9ZA 3GFOA 1NBMD 4PC7A 4UDYX 2GN0A 3WKDA 1J9ZA 3K6SA 1FJGB 1HLGA 2GBCA 3T54A 1Z34A 5C5DA 3G0DA 4X1KA 5FWXB 4Z4QA 1Y33E 4D80A 5AUQA 1I36A 2D2VA 1U7PA 1R27A 2QVBA 4ZI2A 5FI0B 1C1HA 3QTLA 4GBJA 3ZY5A 1QO0D 2MSNA 5FLYA 3M2PA 2C3UA 4I3FA 2CXHA 2Q21A 3ESDA 1DT3A 1JGTA 1ARZA 1MLDA 2HCRA 1Z73A 4XUDA 1Q77A 2VH5R 1KJ8A 3P7MA 2WILA 3HCWA 1ZSNA 4ID3A 1MA3A 1W44A 2KYRA 2XQFA 4MKZA 4XSGA 2VHVA 2FGJA 3JQDA 1G6HA 3GCZA 3GLRA 4KLCA 2Q2OA 1I7LA 3ZUGA 1GUBA 4F12A 1U28A 2HJHA 2HT1A 3FNRA 2DUMA 1PU2A 2PGOA 2A9RA 3HL4A 4IQ4A 4NU6A 3VAYA 1T1GA 2PQ6A 3S2IA 3HYTA 1OFUX 3LD9A 1IOWA 1RZRD 2P69A 3TLGA 4IF4A 4D9NA 3JATA 2HCBA 1DQYA 4K9SA 4CM9D 4JDUA 4C2UA 3QUQA 5CB6A 2CUZA 3UVEA 4NENA 1A8HA 2B4KA 3BVPA 2QU7A 3L1JA 2GJAA 3MK31 5E3HA 5JBIA 3PRYA 1JZQA 1N6OA 2QSUA 4ZQBA 1CE8A 1VCNA 3AUFA 2OFPA 4GU5A 3UC5A 3SI7A 1TQ6A 4B8WA 2ILVA 3REQB 3RHTA 2OXRA 1WXEA 1FB5A 5JAOA 3V42A 1H4QA 2WFAA 3E81A 4JXJA 2NO1A 2VBGA 4X00A 5LMUB 2BP7A 3HVUA 2FP4B 1G6Q1 4E32A 1A72A 1ECCA 2W2VA 4DG5A 3GDHA 3BK7A 4GXRA 2FZCA 1YJCA 1G8PA 5I8PA 1U9YA 4R1LA 3CJRA 1HV8A 3NT4A 4FE4A 4D82A 1QHFA 1JHVA 3FGPA 1G0NA 1JA9A 5C7YA 3O47A 2F9LA 2YMPA 1DHRA 2DU8A 4PG8A 4TX1A 2ZVDA 1SC3A 1T1JA 2QZPA 3CY6A 5BOVA 4A5SA 621PA 2R2GA 3DMDA 4OHMA 3L4KA 2DTEA 3QW4B 4ZV9A 3AY7A 4FNAA 2V0CA 1XFDA 4MRSA 4XZ3A 2EL7A 1IUPA 2JW5A 2Q2VA 2WDPA 4GPTA 4HH0A 5FI1B 4B7UA 2GZAA 3D8HA 5B12A 1CF4A 3BSFA 4B75A 5JAPA 4CG3A 3N8GA 4X44A 3VOSA 4NQRA 5EUQB 1IHDA 1KKUA 1ZGAA 1KU0A 3N8DA 4KBFA 1U7TA 2XMGA 2OY0A 3PXCX 2G8LA 4CV0A 3FAZA 3VTAA 1FTNA 3L8DA 4C3VA 4QOHA 4LW8A 2CGEA 4V0NA 4XD7D 2NU7A 2M6SA 2P1DA 4FUQA 4JENA 4M0PA 3D3WB 4DR6B 4GYYA 1WXXA 4NNJA 4TTIA 5CB4F 2GK4A 3HKDB 5G0TA 1KVTA 1C9MA 1YR8A 1J0XO 2R65A 3P2JA 1BRTA 4XI9A 2A94A 3ST7A 3KSBC 2QPAA 5FAKA 2NZXA 2CYBA 2HRDA 3FHOA 4K1XA 1K8XB 5A7GA 2FJPA 3WBBA 3G2IA 4JU9A 4YT8A 1SKYB 3IAM6 4HYEA 4TTVA 3EVZA 3K1YA 3ESZA 1Y1LA 2CZGA 4FGSA 1FUIA 3I28A 4YDSA 5EZSA 1DEKA 1V4BA 3WWDA 2XGMA 5FTWA 1WV1A 1TRKA 5DGDA 5AT1A 4DMCA 2D1SA 5LYYA 5B3KA 3O4VA 3HCFA 4IHQA 3G5LA 3KQPA 5J5CA 3EGDB 3VBEA 3O2NA 3OJCA 4OKIA 2J45A 3DMGA 4GZMA 3LG2A 4W5NA 4HMPA 4NZNA 5CLLA 3FYTA 5BVHA 4ZQEA 3B6IA 3CUEF 3MJDA 3QOWA 4I4TB 1D03A 2QE7A 2NUAA 2RH4A 2XYRA 3V2HA 4N0PA 3CXUA 3QLVA 3QH4A 3WK4A 2ZUEA 3GVPA 1R0SA 3T1TA 5TDHA 1JB9A 3TOVA 3BWEA 1W5AA 3P9QA 4TRNA 3M4XA 4KE6A 1CJBA 4GMFA 1X3SA 2QXYA 1U4SA 2ZIWB 1UBLS 3CEJA 3IP3A 2GYUA 4KR0A 4XGIA 1J42A 2ODWA 4ZHQB 3OJEA 3ZE1B 3COJA 1MIHA 1JG3A 2BM0A 3FR7A 2DHEA 2QUJA 1GARA 2R9VA 2C2HA 3KAQA 2BKLA 4BX8A 4BNLA 2CDBA 3NBFA 4IRUB 1MC4A 2JH8A 1IK6A 4K2HA 1N7HA 3RIEA 2OGWA 3EYAA 1TMYA 3GO4A 1NMQA 3IOYA 4KZPA 3UGTA 3TGPA 1Z6PA 2OHXA 2ZQYA 1PJCA 3P9XA 3QNMA 3ZWPA 3Q7RA 4CQJA 3AI3A 2O2JA 5IBQA 4DMGA 4YRMA 2J0UB 5EG5A 4LSWA 3VH4A 1QPBA 1T5LA 1JHOA 1LS1A 1F1BA 1U90A 2BWJA 3CPJB 2BGWA 4YAGA 3HBNA 4LC0A 4LDRA 3T5BA 4ZICA 1RWWA 4MTLA 4TKZA 3IAXA 4BAZA 4CT0A 4MULA 1ZVKA 3H97A 4S1TA 3L84A 3WBJA 4MKRA 3RG8A 1VDZA 2O8FB 4N6OA 1U1CA 3P4XA 5EE0A 3WRYA 3ZV7A 3MMXA 1E0SA 3DZFA 3CUUA 2CVQA 1ZH4A 4PQRA 2YNMD 1YHZA 4UFOA 1P2SA 1Z5UA 5ALVA 1EX1A 1H2WA 1J9EA 1M67A 2J30A 3KVOA 4MW1A 5JNUA 3RADC 1JUDA 1AM4D 5SYNA 5BR4A 1AHIA 1QO0A 2GAAA 4LNUB 4KQGA 5CG1A 4P4SA 1NQUA 3KEGA 4IW3B 1P5JA 3ROGA 1EDEA 1PZMA 1NW7A 4I5IA 4NJOA 3T7SA 2H29A 3TD2A 1XJ5A 2Y1KA 1Z4NA 5A6VA 3D8UA 3GT4A 4U2FA 2WZDA 1LVHA 3H18A 1NWCA 1SEVA 3BGOS 2JCBA 3FGZA 4Q1VA 3IAEA 4N40A 4EB6A 1H4SA 4X3CA 5CW2A 3ED1A 4BB6A 1QKIA 2HPVA 3QKSB 1E1DA 3V4OA 2ZIAA 1A9ZA 1BH2A 1M0WA 1M8FA 2GEKA 2MSDB 3PS9A 2CJPA 2XRYA 1QG2A 2LP4Y 2PMFA 2LW7A 2EJWA 3DBLA 1NONA 2C3OA 1BHQ1 3DMTC 3IBGA 4PYRA 3AEQA 1L4UA 1Y8CA 1RZRA 2HA3A 1I7SB 4GWKA 4J0JA 1RACA 1J7KA 2QTMA 1U0LA 2ECOA 2WF8A 4O5OA 3PDIA 1JSCA 2X5XA 4CI9A 3OECA 4CM9A 3LZDA 4E1AA 5K4HA 3AW9A 3OQJA 1AGPA 1GNTA 4E5VA 4WVLA 3UOAB 1E9AA 2AZMA 1H05A 4FS3A 3UICA 1JLHA 4K6OA 1CS4C 2HSGA 4EUSA 4D4JA 3K70C 2A5FA 3BX1A 4NZ9A 4DEVA 1ZD8A 3R9XB 1HFEL 1QZUA 2HFJA 3LXUX 4QLAA 5J2TA 2BR4A 2FNAA 1F60A 1PEDA 2HSZA 1JSZA 3AR7A 3V8NA 1SHTX 1Z5VA 2FPIB 2PKEA 4C04A 3HUEA 1E8MA 2M9MA 2IEAA 3WNZA 1Q6ZA 4MVXA 1T9ZA 3ZFUA 1KI3A 1N0WA 5EJMA 2B82A 4YJDA 3PR1A 1KEUA 2JPDA 2NUPA 4OFBA 1SXJB 3LUAA 4ZO6A 5LDGA 1JN0A 1O54A 1Z7WA 3JVVA 4PC1A 1FU8A 3MNFA 3OQPA 4DIUA 2PNJA 1JHDA 3PNSA 2Q3CA 3LL7A 3WLQA 2XUHA 4D02A 3AV0B 3N2GB 1SBTA 1W35A 2O8EA 1JKMA 3SR0A 5C9ZA 2C7OA 4P0TA 2HK7A 3Q98A 7YASA 5K01A 1PVDA 1HYBA 3DDOA 1QQ7A 4Z9FA 2I99A 2PX5A 1RM0A 2NU6B 1IXSB 2FFRA 3P0RA 1R4MB 4DHEA 4BN0A 4ENUA 4Z4HA 5BY2A 5KC8A 3CLTD 2CBXA 5KB3A 4LNHA 2J87A 4I4IA 2RI1A 2JFBA 1X1AA 4LA4A 5EZYB 3KWFA 1JHPA 2NGRA 4XD7A 1IL0A 5FIUA 1VDMA 3KALA 3UMMA 2TYSB 2VSXA 1UDWA 3OWHA 3QEMA 4I1PA 1G8HA 1NIPA 3NEYA 2X41A 2ZDHA 4B6PA 2JLAA 1CS0B 4GKAA 1KEKA 4QECA 1QX4A 3WWPA 4P38A 1QTQA 1PS8A 1E96A 3HM2A 4UASA 2OPHA 1DB3A 5F7XA 1M74A 2VP4A 5CLFA 4Y9RA 1JJFA 2PWAA 1N8NA 1NN1A 2QVYX 2Y0PA 4BWVA 4B3RB 4FEYA 3EEBA 4LISA 4ZAFA 4ZIRA 2IYUA 2CBZA 2IL1A 3AILA 4NZMA 2EX1A 4IUBS 3CLSD 4L28A 5CEFA 1OLSA 4OF4A 3X43A 4EHJA 1OU4A 5HJ2A 4DOMA 5ESXA 1RHRA 4ENPA 1BDMA 1KAOA 2IYNA 1PJ8A 3K05A 1ZUNB 3ET4A 2HFKA 3WA7A 3EXAA 1YI0A 1JLMA 4R98A 2H18A 4DR3B 4OAOA 1B4DA 1DIRA 4RSHA 3KPUA 4WOJA 5EERA 2GBFA 1T0HB 3WHKA 5CLGA 1IAVA 1K9SA 3K3PA 3LWBA 3ML1A 4E46A 1Q3KA 2D7CA 2DFNA 3UTCA 3L07A 1WB9A 1NJ8A 3BRCA 3NUQA 1V3VA 5GJCA 4EFKA 1TCAA 4E6PA 1IIBA 1Q22A 1YQ9A 4V24A 5BYBA 3SHVA 2Q1SA 1KXZA 4C4PA 3C6KA 1T9HA 2E55A 3DHWC 2V5UA 1UK9A 4NNOA 5IJAA 3VO1A 3P2MA 1UADA 3B12A 5H4GA 3L4JA 2I7CA 1FUYB 1SCUA 3A4VA 2DWOA 2ZRMA 2PGLA 4BVAA 2IGTA 4LUCA 1LPPA 2ZULA 2EQBA 4MIEA 1JI0A 3B89A 2RGNC 3DVSX 4HWGA 4OO3A 1F4PA 2QG6A 3NHJA 3LQ1A 5ER6A 2JI9A 3ROKA 1ULSA 2LZ0A 2PPVA 3NASA 2PRKA 3ZHXA 1V1JA 1YOVA 2RGWA 3FYSA 2GEUA 4FK8A 5ALLA 2IP2A 5DWVA 4D41A 1WDKA 1SK8A 1KYTA 2AL7A 4PTZA 2PUDA 2MSWA 1KWKA 2E3JA 2EW8A 1L5HB 3ZKAA 1XELA 1UJ2A 4MVJG 5EIWA 1F1JA 2YNMA 3CISA 3WRVA 2FZWA 3C8HA 3LH5A 2VHZA 1MX3A 4DUYB 1AJEA 2VVTA 3MIIA 4DHWA 1XZEA 2O7SA 3LKDA 5EGSA 5F64A 4EK9A 5B7NA 2RJOA 3WLNA 3A1SA 2CMGA 3C8MA 1KI2A 3Q2IA 2PKWA 3D4BA 4B7CA 4BBZA 4YCLA 1JKXA 3MLBA 1TJ4A 2DLDA 2FSVA 2F3TA 1XZPA 1A04A 3Q5EA 1NNI1 3CLKA 3FTQA 1VZ3A 1MAAA 1NP3A 1G9XA 2F1JA 2JKYA 2C0QA 3ESBA 3U9SA 1OH6A 4G63A 3UAGA 3SZUA 2ZCUA 4OI0A 3G6WA 4GDMA 2Z2XA 3ZWMA 4FGWA 4QDXA 1W59A 3MGGA 3VHXA 4B4KA 2ATVA 1C1YA 2ZS9A 3NRBA 1OUMA 4DBZA 4LVUA 2R7AA 4G2NA 2HDOA 1VG9B 1IQUA 3UJNA 4R7GA 3RFTA 4F5EA 1XHLA 3BHMA 3KBOA 1CUIA 5AOBA 4DQDA 5KHAA 3L7BA 3RC9A 4FU0A 4JK3A 7ADHA 1LQUA 4YHHB 5CVUA 1Q5PA 4LAFA 4KR3A 4NFYA 4PLWA 2VTBB 1DOHA 1LLDA 3EHDA 3RS5A 1EUDA 3TTWA 4FBLA 1GVNB 5G1PA 5LP1A 1DJMA 3VH2A 1FUEA 3L1VA 1ZCJA 5IANA 4AURA 3D64A 3F7NA 2RHCA 3UT5A 3V7WA 2NAPA 4HH1A 3WWYA 2RB4A 4NDAA 4CZ2A 1XX6A 2HDHA 3VAZA 1IWOA 1U65A 4I8XA 4EGCB 3G5AA 2EEZA 3DKKA 3GA5A 3QE3A 2SICE 2I2BA 3GLVA 5DNAA 3ZI7A 2FSHA 1KP3A 3HVKA 3CVOA 3WL5A 1FLAA 1G42A 2R1ZA 3RQSA 1NW3A 3FNFA 4JEMA 2I0FA 3OLXA 3UKOA 1T1RA 3AGQA 4L5IA 2ZXUA 2OV2A 1NR1A 2AZ4A 1H0HA 1Q12A 2FMHA 3JPWA 2ECQA 1IHXA 3Q88A 1R0KA 4ITVA 4HVLA 2O06A 5ADUS 1L7MA 5BXQC 1AKQA 3EGXA 4S1PA 3RYCB 1CW2B 2ID4A 4DSNA 4HTFA 3WK5A 1ZIXA 1C8LA 1FSPA 5H3HA 2DFLA 3PQDA 3ELDA 4K8OA 4UBIA 4EI9A 4BBAA 3OOWA 1S4QA 2L0XA 1SBIA 4HWKA 4AKTA 2ZEJA 5HZHA 4JYAB 1YAHA 1JWAB 2NTNA 5KYWB 1TFRA 5F2OA 3IPRA 4E88A 2YVQA 4MWZA 5FOUA 2ZJZA 1M2WA 2GNAA 2B4RO 2NSJA 3OIVA 4LY6A 2I2CA 4KQEA 5LP6F 2Q9AA 5DLPA 5CBPB 4UD6A 3U4QA 2UDPA 3I01M 1OW3B 3JZDA 4MR9A 2VDJA 3KEQA 1IEQA 3TDNA 4LJSA 5LB2A 1TRHA 4DA7A 4G4GA 1MUUA 5JRDS 3UAYA 1T26A 1PDOA 1ZJZA 2AG0A 2BHNA 4Q1AA 4WQMA 1WU7A 5BSMA 3DZBA 2VXBA 1PJQA 3I9V1 2PUGA 1QIFA 3M3DA 3ZC3A 3RF6A 4CIWA 1F5NA 5HFJA 4XVQA 3SQXA 4RNCA 5HNKA 1HA3A 4Q5IA 1KZ1A 3U7IA 1GGMA 2RD2A 2DQKA 4L85A 3W3AH 5L8VA 2DQZA 4LZJA 4ROSA 2OAEA 2AW5A 4RD1A 3LUBA 3PX2A 3LQFA 1S1MA 1UL1X 2NTVA 3TB6A 3A26A 1JDZA 1DKRA 1KE2A 1SCNE 3PGVA 5I9TA 3ZN2A 4ZCLA 4JELA 4HDMA 4L9SA 3Q41A 3I12A 4FWTA 3UF0A 1KA9H 3AL3A 2ZIFA 1XTUA 2GZ3A 1AKVA 4KXQA 2G7ZA 4N0DA 2P6PA 2QTCA 1H2RS 2QV0A 4E5MA 2ADMA 2OAQ1 4HDNA 3BBLA 1AH2A 2HHAA 5GWXA 4QSMA 4N01A 5KNDD 4LRUA 2V8BA 3T3EA 1H8ED 4O2AA 4DPLA 5L3SB 2YQ4A 5DGTA 1YRBA 2X3YA 3T0IA 2IE8A 2R96A 4IIVA 5TQVA 4TKUA 1U0EA 1ETUA 3PTAA 2J3MA 1UBKS 2IW1A 2OXFA 4A6EA 1ADBA 3HCRA 3C1AA 4OQNA 2BOVA 4NK5A 1EK1A 3IPLA 1YZTA 4MARA 1R12A 5ABPA 1D2HA 4DNQA 1BE8A 4MYCA 3TCNA 1PN3A 3CGWA 1XZLA 4NJEA 5LIRA 1CKEA 1PFUA 2ZKIA 3TBFA 3FMVA 2NVOA 1XWWA 1IN6A 1N6NA 3AVVA 5EAIA 5BT9A 4XQEA 2VDLB 1HDXA 3GH1A 3L4BA 2JVJA 1PBNA 4TRMA 5DVZA 4CCYB 1EFCA 4W4TA 4RK6A 1LFDB 1QK4A 4C6TA 2XGSA 1RP1A 3CGGA 4B3DA 2AFIB 2IOHA 2JJMA 2YWGA 2JANA 4BVFA 1HF3A 3OE4A 1AURA 2P6NA 5FYQA 3PUHA 2Q3BA 1LTKA 2AEJA 2GXQA 2EFEB 3NP9A 1P7PA 4AJLA 2RIRA 2ZETA 1ZONA 1JIQA 1LBEA 4AJ4A 4ENWA 3ANXA 1Y0BA 3CE6A 4EFMA 3L8FA 3GGCA 3TZBA 2EGUA 4U5XA 2C96A 3FKQA 1CR2A 2PA0A 3QQ5A 5G53C 4OKSA 3HKBA 3LQ4A 4PR0A 3VZRA 1H5UA 2R6CA 1G7CA 1HLDA 2C5LA 2QRQA 2YN2A 3W9SA 4EB6B 3IDSA 1KARA 2LKCA 1CRZA 3BGSA 2IYRA 5JR3A 1YQUA 1HC7A 5JRZA 1PTJC 3V1YA 4IJQA 1QM5A 1IEVA 2JHCA 4LBYA 4YPVA 1YR7A 2R6FA 4CIXA 1QFJA 2ZTLA 2BDEA 1CQZA 5CUQA 4XQCA 3W1WA 4YO7A 3GPIA 4C4AA 2NOAA 2AW3A 1KI4A 3L06A 4HL6A 4IEEA 4AJPA 1HFKA 2G36A 1T0JB 4A0QA 1LQTA 2HLDD 3MD0A 3Q8KA 1Q44A 3TVTA 1ZUIA 1E2QA 4G0VA 4DUGD 1IY2A 2YIDA 3LHSA 4GMXA 5J63A 2RHBA 1HKHA 1P2FA 1QH0A 1HTWA 5B64A 3T4EA 2BH9A 2QF7A 3IH5A 1FXWF 3PCXA 4RE5A 2HADA 3ADOA 5FR2A 1JWLA 1LZKA 3DTVB 3M81A 1L7NA 1VRVA 1X7XA 1UP4A 1TZBA 3Q3VA 2X6RA 3RU3A 2X2EA 2XWJI 3B7GA 1P5ZB 3K9HA 4Y0NA 3IB3A 4DIFA 2CMHA 4KPUA 3WGNA 5HZGA 2DC1A 5EXEA 1KTVA 2FOLA 4Y9UA 2Z5VA 5GM2A 4F4JA 5HRUA 5JJKA 4EJSC 1IBKB 3STWA 2YICA 5EWJB 4J7CA 2BUAA 4YC7A 3TUZC 3BZUA 2ANBA 3OWXA 1VPEA 1R7RA 2OBXA 1BCSB 4XCVA 5T6MA 5CTJA 3RYTC 1U5BB 2X9VA 3PXDA 5G41A 2VK2A 1QGUA 1ZEJA 2PGXA 3FRHA 4UTRA 2PUBA 1CSEE 5ALWA 3U7FB 4G81A 1QCZA 4CKYA 2W2NA 1VL5A 4I55A 4PLHA 4OXQA 1N3IA 3DZJA 2CD7A 2A7XA 3SZMA 2VYND 3OHMA 3R0IA 4RFLA 1QGOA 4PZ0A 1K7EB 1XVUA 1ZD2P 2XB4A 3WLPA 1O4WA 1PT6A 3ORSA 3JU3A 5GGYA 3VO2A 1REQA 2ST1A 1MPXA 3PEEA 4PZUA 4BLVA 2M1ZA 3QNUA 4FLEA 3DZ8A 4P54A 1P2TA 1DJOA 2COEA 3PNYA 2GJ4A 2IFTA 1TO2E 1WIWA 2HQSA 2ILTA 2QTHA 1TOAA 3DFUA 3N2KB 4GZ6A 4PZZA 3T7CA 4MYDA 2OWDA 4UTNA 2C7RA 1ZJWA 3VO8A 2WJGA 3ODPA 1LFAA 2X86A 2G09A 4LOAA 2VXYA 2Z98A 3QPWA 2UVDA 1BMFD 4B35A 1YS4A 2P3OA 1WF6A 4KK4A 1V8FA 2XYPA 1KEZA 3FCXA 3H87A 4UOZA 4RW0A 1GQQA 4CJXA 4HAXA 2FYTA 3EF1A 3O93A 4KNVA 1SXJD 2EBWA 1W6UA 1DPGA 4BE7B 1JEAA 5KPJA 1JEQB 3FI0A 3SR3A 1SHLA 4KPEC 4BX2A 5I8WA 4JI2B 4ESEA 4OJTA 2I4OA 2VNSA 2W2OA 4E0BA 1WF3A 3WHIA 4BNTA 1QPGA 1Y5IA 5JI3E 5IH7A 1CUEA 1NSTA 1E98A 1HRDA 1DO2A 3KQOA 1QLHA 3EJ6A 1SRQA 3MFQA 3BIOA 1O57A 2EFCB 1BWPA 2OO5A 1GA4A 2ZBGA 3T5PA 1VECA 2C2ZA 3WNCA 5JBNA 3IUQA 3LHKA 4DKJA 3UPUA 3CW8X 4NATA 3PLRA 3RSZA 1HQDA 1Q14A 2P9FA 5ALTA 3IBFA 1P62B 5IVKA 2EGGA 2BUCA 3G1UA 1VCOA 4XM1A 2QR3A 4UUNA 4EKNB 2F7SA 1J00A 3J80A 2WV7A 1TCUA 1YL6A 2WMDA 5TJHA 3UQYS 5KMGB 2Q5EA 3DJFA 2B8TA 2OD9A 1GRVA 2QD1A 3EVNA 1KJZA 4Q05A 3ROQA 3EIOA 5AKZA 3D3WA 4F6CA 3ROPA 3ICOA 1AF7A 4TTSA 5CNKA 4R1PA 1B73A 1NNUA 2G04A 1OLXB 4BTVA 1WJGA 2RHDA 1H8EA 5AXDA 4QUHA 2JFXA 4JIGA 3EXG2 3IKVA 3PNMA 4NQZA 3PPIA 3SHWA 4WEOA 2IK8A 2NAFA 4CMHA 5L4SA 2Z5GA 2IXTA 1IZ9A 1K8YB 4JQOA 3WIUA 2O57A 3KQTA 5DLQC 1FP6A 3AF1A 3RO7A 3EG5A 4BV9A 2V7PA 1WNFA 1U3FA 1XIVA 5IJXA 3RUAA 1UK8A 1Z0SA 4UOEA 3R8FA 1GDTA 3FPCA 2ZE6A 5A7HA 2F2TA 3MWEB 4LJ7A 3T95A 4C76A 1QF6A 1QH1B 1ESDA 1XDWA 1NQAO 3EGDA 4EFDA 1CCWA 1JMKC 4YBRA 5LZ2A 4UARA 2FPPA 1EWRA 1UKBA 3BAZA 2QMQA 2EL9A 3P9ZA 3K9NA 4CMGA 3UATA 1OY1A 1KJNA 2VN8A 1GYRA 2WJ6A 4TTTS 4P3OA 4L50A 5BWBA 3FCUB 4JT9A 3JR3A 1RFGE 2GZ1A 1FFXA 5D01A 3SSNA 2O48X 3TB4A 3NC4A 3I92A 3X2EA 4PCLA 4YR9A 5IYZA 4AQYB 1D5CA 1XDZA 4ZI3A 4BZZA 5D3MA 1SZPA 3EY4A 1RWKA 4BWYA 4RPIA 4AJ2A 5J4YA 2OLKA 4WESA 8MHTA 2CLSA 2W6NA 4LPSA 4Q7JB 1NMYA 2C9CA 4IUCS 4OYRA 5H4HA 2VPTA 3BXXA 5IUNC 3AF6A 1I0ZA 4MQ6A 3LO5A 4RUKA 3BIFA 2QL9A 3COSA 4ZT5A 1DBIA 4EPRA 1RWBA 2C07A 2JLYA 3HO1A 2NZ8A 3RK1A 1ZD9A 1V1RB 1YFKA 5IAJA 4KLNA 5LA6F 4BVBA 3BD7A 3DEYX 1JE0A 2ACWA 1H3NA 2EFJA 2J0UA 1YJ5A 1GPMA 2P78A 4Q4AA 1ADJA 5EIOA 1DQNA 3I30X 2WD8A 3L5KA 4IKPA 3T6KA 4TL6A 2VBFA 5BWOA 3GX1A 5J58A 2Q6TA 1I9GA 1QTNA 2HLDA 2OWEA 1P1CA 4G24A 4LI3X 4YJGB 3MG9A 1Z16A 2XPCA 3HBMA 1UWVA 3K1ZA 4N0MA 4NBWA 4DUGA 4GI2A 1CFJA 3GRVA 3OOHA 4UAVA 4NPHA 4HDSB 2GBLC 3KYDA 1X70A 4AN4A 5JECA 2IX3A 4YRQA 1RC1A 1V45E 3AW8A 2VSYA 3CTPA 1QQTA 2CC2A 1HDEA 2BBOA 4O1IA 5JROA 3PR3A 4E09A 2RHJA 2PZMA 5DYNA 5BOSB 5HSGA 4PCAA 3SYRA 3CF4A 3TW8B 3UOGA 2IYQA 3FZGA 4JUFA 3LUDA 4M9RA 4O02B 3BG5A 1OLUA 4X6YA 2O2HA 2ISCA 1SVOA 3B1ZA 3PVCA 1KGDA 3D2CA 4NPCA 3WSWA 1NT2A 3OFSA 4EKIA 1MT0A 4YAIA 2AUMA 2PZ8A 3ZWCA 1YMQA 3RIYA 2ZW9A 521PA 3LXRA 4RPJA 5ALDA 4E2FA 1CF2O 3B1WA 3MOIA 4O4HA 1RYBA 1T1SA 3S0JA 5CITA 2PMDA 3D6MA 3M6IA 1E77A 3TMAA 2GJ9A 2ZWAA 2WWVD 2BEVB 2HTEA 4LRYA 3RQIA 1DINA 4X7RA 1O6ZA 4NV1A 4Q7KA 2OOSA 3H2JA 4ZMBA 3GEPA 4P2BA 5TGTA 3BDVA 3DFFA 3OPQA 2HSDA 3PDJA 3K9QO 4RF3A 4TLEA 5REQB 2VOEA 3NEJA 4A82A 3WGUA 5HRAA 1MQ9A 1KERA 1RXWA 4JLSA 2HNBA 1OFVA 1V7CA 3TOXA 2P0EA 1YQGA 2Z0MA 4M86A 4AP5A 2VYNA 5I7RA 3IHLA 3NAMA 2MDTA 3BXOA 3IQFA 1N2CB 2ZU6A 4IV5A 3RTCA 1AGNA 5JANA 3PKZA 2WFMA 4AVYA 2OHGA 4IR7A 4GLBA 4RMHA 4R2HA 1KAGA 3MCUA 3PEUA 2AJ8A 2OQRA 3HKEB 1QOZA 1T8TA 2A67A 1XMJA 2IDZA 4Q3KA 1Y1SA 3G7SA 2WM9B 4DWJA 5DTMA 2X4IA 4ECAA 1II0A 2O1WA 3DBHB 4PEVA 2H2AA 3R7BA 2Q4EA 3WE7A 2A86A 4UAJA 3RVOA 2H1LA 1SOUA 1BMFA 1VE7A 1RBQA 1GGEA 2FSVC 3A6DA 3EUAA 3TL6A 3KJQA 1JFLA 1PQUA 3V32A 2FPRA 3ZE0B 1YB6A 2O7NA 2XUKA 4TWBA 3EAFA 4BN5A 4EYGA 5L4NA 2B4YA 3ZJUA 4PTYA 3P96A 4R40A 1EUQA 1JXMA 4PX3A 2TSYB 2MYPA 1IBSA 4KYVA 3UWPA 4KODA 4ARVA 1GPAA 3CVVA 2IXBA 4ZQCB 3CR3C 5TGZA 4RVNA 1W6RA 4D9BA 1B15A 4K6CA 5C1OA 4WNAA 1S9DA 1ULAA 5HPYB 3COWA 4E22A 2WMYA 3QPBA 4G5RA 3R76A 2G88A 3B1JA 4I81A 3LYLA 4B3FX 2R7KA 1PYDA 1Y3AA 1I3LA 5ETJA 1F6DA 1DC8A 1RJWA 3OTGA 2PJDA 5TXGA 2W6QA 1SFRA 1HT1E 4RVFA 1HNZB 2ZYVX 1KS9A 2CHFA 3DVAB 1LI4A 2BLLA 2QW8A 2ZZMA 1XZHA 4YUZA 1FBTA 3FPGA 2ALJA 3NV9A 4BS9A 2D6FA 3CO5A 4RD4A 2A6PA 3FLAA 1GYPA 3C4JA 1X7ZB 2Z2KA 2OSVA 3D43A 3E0QA 4H3KB 1U9IA 4HQ6A 4O4IA 3NHRA 3U3XA 4A15A 2QRMA 2CN1A 1PZEA 3R0VA 1R2QA 1XLWA 1RQPA 4N82A 3RAPR 2B0JA 3ZWQA 2OBBA 3V1NA 3WSVA 3DL2A 1PZNA 2RAUA 4C0LA 5KYUB 1LW6E 1SIBE 2W4MA 1HSZA 2GWRA 5DCLA 2QRGA 3THYA 1E6LA 1P1FA 1Z7BA 3CH6A 1IAQA 4ZAXA 2NPFA 1S6YA 5J40A 2FWJA 4COOA 5AVVA 5DYWA 3G89A 2H8KA 3M6VA 3NUGA 6NULA 5K9ZA 2BVNA 2VF2A 4DMMA 4EL0A 3U49A 2Q6OA 2FWIA 3RYHB 4EUEA 4FI3C 2ZWOA 4IUYA 1B23P 3SU8A 5FBWB 5GZ6A 4CI0B 4RY2A 1HTTA 3EIQA 4L9RA 4RJTA 2VF4X 4F86A 5BMVF 5KTRA 4CM8A 3OZGA 2F1HA 4X45A 4GOND 3PDWA 4KQ2A 4Q3LA 4QXQA 4E6EA 1E7QA 3TZHA 1QGAA 4ZAGA 1UPUA 5F2NA 2RGGA 2ZUBA 1I2DA 1O03A 2CMFA 2ZJFA 4QDJA 3OZVA 1TYBE 4BQSA 2AJCA 2QL5A 1BXRB 4L78A 1UDCA 1LDMA 4PNHA 4DC9A 3QY9A 1FUKA 3B20A 3AH8A 4K6FA 3UTDA 5MDHA 1Y5LA 4P83A 1H0KA 4W6ZA 4HZUB 5EHQA 2D5IA 1UKZA 3IMEA 1SQ0A 1D6MA 2CL6X 2UYHA 4RIEA 5K0JA 4E2YA 3KUUA 5MHTA 4MXDA 1PKEA 1LBQA 4RJKA 2XMRA 1BKSB 3AL2A 5AHXA 3SE0A 1KRXA 4BO7A 1BCRB 5LLDA 1R4ZA 3H0CA 3MAAC 3ND9A 1P1BA 3MA0A 4CN9A 4H1WA 1AQLA 4IDPA 4PAGA 2XMDA 3LY9A 2JAQA 2BEUA 4QGGA 4B3GA 1IVSA 3ZJYA 1XTPA 2R97A 3RANA 3R6GA 4UNPA 5K3AA 3ZZNA 1SH7A 2EJUA 1Y37A 4F6RA 4CQLB 3ZLJA 1BQ4A 1JR3E 3G82C 2IBSA 1SIOA 2QVGA 5AMXA 2C2BA 5DCYA 1UBMS 1PQYA 3A9SA 1R3DA 5FTNA 4XOUA 1YF3A 3QKWA 1DRWA 2ZT6A 1O95D 1WXFA 2Y1DA 4ZHSA 3UGJA 4CKEB 4ZVUA 2EZ9A 1DFIA 1XDBA 4J3NA 1UOQA 1RKUA 1WCIA 2H59A 2QY9A 2XZDA 3L05A 4IXWA 5A4MS 3KFVA 2AMVA 1LDYA 3MGBA 4YDHB 2NP7A 1X1DA 5JC1A 3GLSA 3VVCA 1JEYB 1S2NA 2J9ZB 2HJ9A 3K5IA 4FFWA 4EKYA 2B36A 2YJ5A 3DNFA 2DF8A 1EQ2A 2OGZA 2UZ1A 4RH3A 4JLKA 5B2EA 1S8FA 4QGFA 1Q83A 1KK3A 3G2PA 5IFKA 4NONA 4UULA 2WWTA 1TECE 3C3XA 4MA5A 2BJHA 3KEMA 1X94A 1KZHA 2I4IA 1OXMA 1MEJA 4JUDX 2PS9A