1MJFA

Putative spermidine synthetase from pyrococcus furiosus pfu-132382
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
271
Chain Sequence
AFIEWYPRGYGVAFKIKKKIYEKLSKYQKIEVYETEGFGRLLALDGTVQLVTLGERSYHEPLVHPAMLAHPKPKRVLVIGGGDGGTVREVLQHDVDEVIMVEIDEDVIMVSKDLIKIDNGLLEAMLNGKHEKAKLTIGDGFEFIKNNRGFDVIIADSTDPVLFSEEFYRYVYDALNNPGIYVTQAGSVYLFTDELISAYKEMKKVFDRVYYYSFPVIGYASPWAFLVGVKGDIDFTKIDRERAKKLQLEYYDPLMHETLFQMPKYIRETLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PUTATIVE SPERMIDINE SYNTHETASE FROM PYROCOCCUS FURIOSUS PFU-132382
rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
molecule keywords spermidine synthase
total genus 83
structure length 271
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.5.1.104: N(1)-aminopropylagmatine synthase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 1mjfA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1mjfA02
3LCUA 3PS9A 3DTNA 5ICCA 4GOOD 4P58A 3LCVB 4QVGA 1XXLA 2IBSA 4M37A 10MHA 4YUVA 2I7CA 4BP1A 4PGHA 1YFLA 3C3PA 2IH4A 3HEMA 4YUWA 5FCDA 1JSXA 2NXJA 2QM3A 2JH9A 3KQOA 4HC4A 4OA8A 1NBHA 1EJ6A 1N7JA 5E1OA 3KPJA 4RTPA 3FUWA 2O07A 3A26A 2E5WA 3KQVA 2VZ9A 2ONZA 3MB5A 1O54A 2ZFUA 1XDZA 4FP9A 5GOZA 4E32A 5M5BA 5LQRA 3EVBA 5FADA 2P7HA 2ZCJA 3KPYA 2OB2A 4EQZA 3EPPA 4XCXA 5C9ZA 1XJ5A 2IH2A 4R05A 3HVJA 3EGIA 3M33A 4ER0A 1TPYA 3V8VA 2NXNA 3HCBA 4E2ZA 2YQZA 4FZVA 1R18A 3FUUA 3NDIA 4E31A 1RJGA 1VLMA 1XDUA 2AOTB 5C0OE 5K05A 2AN3A 3NTVA 2IP2A 2ZVJA 3FRIA 2BR5A 3EVEA 3K6RA 3MGGA 3OU6A 2HWKA 3I5UA 2ZWVA 3P2KA 1QAOA 1KXZA 2UYOA 4G56A 3G8BA 3CJRA 5EHGA 4EMSA 2PT9A 1EG2A 1NW7A 2PT6A 1X1AA 3AWIA 3EVCA 4PYNA 1SKMA 3O4FA 3RW9A 2JHAA 3GRVA 3OCJA 3P2EA 2GS9A 5JUWA 1KIAA 1RI2A 2AZTA 2OKCA 1RI1A 4AUKA 1L9KA 3P9IA 5U4XA 1NT2A 1YZHA 1AQIA 2ADMA 1F3LA 3QV2A 4GC9A 3PVCA 3BGVA 2EFJA 4HGYA 1ZGAA 4V0QA 5FHQA 2Z6AA 3A25A 3KR1A 5G02A 3DXZA 5E9WA 3TOSA 5DTMA 2K4MA 4K6MA 1SVUA 2FPOA 3HM2A 5BW5A 5HZMA 3SXJA 2CKDA 1INLA 1VP9A 2IH5A 3G88A 2YXEA 3UBTA 2JHCA 1M0EA 3EGEA 3LBYA 3P97A 5FWAA 2B2CA 2F8LA 3DUWA 5HEKA 5GIOE 3HA3A 3IHTA 4HSGA 4BLWA 4H0NA 4RTMA 2Z6QA 3BGIA 3SX0A 1QAMA 1EAMA 3TFWA 1AQJA 2C7PA 4PONA 3EVFA 3TM4A 3KR9A 5GWXA 3UJBA 5CCXA 3UJDA 3WSTA 3EVGA 1SUSA 2UYQA 1DUSA 4OBXA 3OFJA 2AOWA 2PJDA 1O9GA 1KYZA 1Q0SA 2PX8A 2ZZKA 3ER9A 3P9NA 5GM1A 4CKBA 1XCLA 2AOVA 3CJTA 3EMDA 4QPPA 3EMBA 2AVNA 3U81A 3C0KA 3VC1A 1PJZA 4ER5A 2BR3A 1X19A 3E05A 3KQMA 4CXMA 4E2WA 3VC2A 3DXXA 3HCDA 3B5IA 3PLAE 3AY0A 1FP2A 2HV9A 3UZUA 2H11A 5DTRA 1WZNA 2XYRA 3HNRA 4PIPA 4YUYA 4B17A 3B3GA 1EIZA 1P39A 4E33A 1R6AA 1RI5A 2O57A 2DULA 5CVVA 2FHPA 1V39A 2B25A 3MTIA 3VSEA 2PX2A 2ZZNA 4HTFB 3HP7A 3ELDA 4MWZA 4PCAA 4CTKA 3TQSA 3AJDA 1RJEA 2Y1XA 3CVOA 3ORHA 3HVHA 1RJFA 3LBFA 3MCTA 3PFGA 1XTPA 4QQKA 3KPWA 5FA8A 3PX3A 5LQAA 4DKJA 3ER8A 3OZTA 2QRVB 1T43A 2AVDA 2FYTA 1F38A 2PX4A 3UJ7A 2UYCA 4PYIA 5DRYA 5EOVA 1G38A 5EPEA 5DRTA 3UWPA 5ICGA 3KQWA 3UA4A 4RV9A 2VDWA 3IEIA 1NW3A 3KQSA 4HRAA 3DR5A 5MHTA 2NXEA 2XVMA 2V74B 5KQRA 3JWGA 3QOWA 3FUXA 5CM2Z 3TM5A 3F4KA 5LQUA 5DM0A 5EVJA 1M6YA 4KVZA 1EJ0A 5KVAA 1VE3A 1M6EX 1WXXA 1R00A 2AN4A 4EKIA 4YMHA 4RTRA 4Z2YA 2B78A 2VDUE 4RTKA 2PXCA 2PKWA 3BWBA 3KR2A 3GGDA 1DCTA 1UWVA 2ZBPA 3TR6A 1QANA 3PFHA 5CVEA 2YR0A 3KU1A 4QDJA 1Q0TA 1KP9A 2IPXA 1OR8A 4M36A 3NMUF 2CMHA 4OQEA 4RVHA 2PGXA 4ER6A 3LKZA 1JG2A 3BUSA 3I64A 3LPMA 3LSTA 4QDKA 5E1BA 4EK9A 8MHTA 2PLWA 3I53A 3E7PA 1UIRA 5GM2A 3LECA 2BZGA 3JWJA 2HTEA 3B7PA 4QVKA 3TKAA 4POOA 3GXOA 1N2XA 1H1DA 1L3BA 2VS1A 4P7FA 4WVLA 2PV0A 2OY0A 4V0RA 2JJQA 3MAGA 2WK1A 1L1EA 5E2AA 1BOOA 3KPVA 1WS6A 4C05A 3MQ2A 3DULA 1NW5A 1VPTA 3SMQA 4OX9Y 4A6EA 1SG9A 3UJCA 3NDJA 4GOLD 1ZHFA 1KHHA 3HCEA 5BW4A 4HGZA 2ORED 1B42A 5DT2A 5HILA 3SSOA 3JWIA 3EVAA 3UJ6A 2P3LA 4E70A 4C04A 5CIYA 4GBED 4BP3A 3E23A 7MHTA 2WA1A 1I9GA 4XUDA 2IDKA 3DMGA 1YUBA 3DMFA 2P41A 2FK8A 5FQOA 2JG3A 4C4AA 3TRKA 4E2YA 3NW9A 2NNWB 1XVAA 4OQDA 1D2CA 5DLYA 3GRZA 4DM3A 1I4WA 2FCAA 4DF3A 2BM9A 2NP7A 5JR3A 4PYKA 3G2MA 3FPEA 3GWZA 2CWWA 3KKZA 5E9JA 2WA2A 4QTUB 2LD4A 4IWNA 3C3YA 5BXYA 2OB1A 5E1DA 5ICEA 2BM8A 3X0DA 1EQAA 3EEYA 2OO3A 4YV1A 2Y1WA 5K09A 3FPGA 3G2PA 3G7UA 4YUXA 3HVKA 2JHPA 3I9FA 3M6VA 4RVGA 1VQ1A 4C08A 1KR5A 3G5TA 5LQCA 4GEKA 1ZQ9A 2CMGA 4RWZA 4XUEA 4RTSA 3BT7A 1HMYA 3OFKA 1R8XA 5KS2A 5DM1A 5FQNA 3M70A 3LX6A 4CTJA 3BGDA 4FS8A 4MTLA 2I9KA 2P7IA 5FTWA 2GH1A 2AR0A 5K8VA 1BHJA 3GIWA 3EVDA 4BLVA 2B3TA 3A27A 2YX1A 1MJFA 4RTLA 2ZIGA 2P40A 4KRGA 9MHTA 5KQSA 5D1NA 2N47A 5T6BA 5GINE 4AZVA 2YTZA 5DSTA 4F85A 2C7OA 2EJTA 1DL5A 4M38A 3LKDA 5EMMA 1JG1A 1NW8A 3S68A 4ATNA 1FJXA 3MHTA 3SVZA 3SGLA 3T0IA 3G5LA 4DCGA 1R8YA 5GIPE 3FTDA 4RX1A 1JSZA 2IIPA 3DMHA 4YV2A 3GCZA 3PT9A 2OXTA 4RVFA 1AF7A 5B1SA 3SR4A 2G72A 1IXKA 3KQTA 5EMLA 2JH8A 4AZWA 2NXCA 2P1DA 4KDRA 4KDCA 3THRA 4GOND 4IV0A 4LECA 1ORIA 1JQDA 2QYOA 1JR4A 3FPFA 4QTTB 5IKMA 4R8SA 4A6DA 3HTXA 1RJDA 2P3OA 3B3JA 3BKWA 2PVCA 4DZRA 5EZSA 3UJ9A 3T7TA 2PBFA 5EG5A 3R24A 2O0LA 1NV9A 3OZRA 3G89A 5E8RA 5CVJA 3FPHA 5HIIA 3ELYA 3Q7EA 4R6XA 1ZKDA 5EEHA 2FRXA 2KW5A 1JG3A 1WG8A 3FYCA 3HA7A 4Y30A 5E2BA 5ERGB 5H02A 1JQEA 5LSAA 5CUQA 5K0FA 1P1CA 2ZTHA 1Z3CA 2P3QA 3SM3A 2ZBQA 4KIGA 3M6XA 4YUZA 5DX1A 3KPUA 4PWYA 4F86A 4YV0A 1L3IA 3Q87B 3NVMB 4PINA 3IYLW 2H00A 5P8WA 3VYWA 1I1NA 4DQ0A 1KPHA 2GAFA 4NECA 2GA9A 2HR1A 1BKYA 1D2GA 3MERA 2G70A 2B9EA 4CWAA 1IM8A 2O06A 2IFTA 1KPGA 2VP3A 5DM4A 1BC5A 3TLJA 3M6WA 2AOTA 2A14A 2G71A 2OBFA 2OZVA 2QY6A 5DM2A 3MCZA 5K01A 5LQJA 2XYVA 2ZBRA 5LQNA 1D2HA 1N7IA 4EVIA 3GRUA 2P8JA 3REOA 2XVAA 4IV8A 3LL7A 3SSNA 3UFBA 5EC8A 4X61A 5HFJA 2ZSUA 3C6MA 1R74A 4KW7A 2Z6UA 3FTFA 3A7DA 2I62A 4PYOA 2PXXA 4IKPA 1QAQA 3LHDA 4LWPA 4HG2A 4X63A 4WXHA 2AOUB 1RI4A 1ORHA 2P35A 1JQ3A 5EZQA 1SQFA 1TW3A 1VBFA 3I58A 4L7VA 2ZZMA 3FPJA 1NE2A 3FUTA 3RODA 5K0LA 3UJAA 3TPZA 4E30A 3JWHA 4FGZA 3NJRA 4PGGA 1WXWA 3LDUA 4ISCA 3M6UA 4PCLA 5EIWA 5K0EA 4E2XA 3OU2A 3PTAA 4R6WA 2O05A 4GOMD 3K0BA 2AN5A 5HOQA 5DWQA 5CVUA 3GNLA 1XCJA 4RVDA 3RIEA 4X1OA 4X41A 3GRYA 1NBIA 2IDJA 4Y2HA 3R6TA 2CL5A 2ZIFA 3P9KA 5FA5A 1NKVA 5EGSA 2YXDA 4C03A 4P7KA 3HCFA 3HCAA 4XUCA 2GB4A 1JTFA 3CGGA 4GF5A 3ERCA 1L3CA 1P1BA 4OBWA 5K0CA 3R9XB 3DLCA 3OE5A 2HNKA 5BP7A 3H2BA 3CBGA 5T64A 5LR6A 2ESRA 3OZSA 3LDFA 3GRRA 5K0BA 3FRHA 5HIMA 4RTJA 1NV8A 3HCCA 3CKKA 3DH0A 4U7TB 1Y8CA 2XYQA 1IY9A 1JG4A 1YB2A 3M4XA 4P7GA 4CKEA 4YMGA 1G55A 3R0QA 5ICFA 2ONYA 2I6GA 2R3SA 5EKXA 1FBNA 2DPMA 2FK7A 3GDHA 4R8RA 5FUBA 2BH2A 1G8AA 3BKXA 4UOEA 3BWMA 3G2QA 3TMAA 3FTEA 2EJUA 3IV6A 3P9CA 2YXLA 1QZZA 2HMYB 3P8ZA 4AX8A 5EEGA 5K0JA 5K0NA 2C7RA 4BLUA 4KIFA 2QE6A 2VDVE 4ZTBA 4BY9E 3C6KA 2EG5A 2ZLBA 4LG1A 2R6ZA 5D1HA 3T7RA 4C07A 3QOXA 1G8SA 3ELUA 1QYRA 3BZBA 1UFKA 3HVIA 4LWOA 4P7JA 3THSA 3EEOA 1FP1D 2BR4A 3KHKA 4O29A 2AOXA 5DSXA 5KYGA 3A7EA 3ME5A 5HIJA 4C06A 4RTNA 5DX0A 1SUIA 4DCMA 5LQKA 2NP6A 3NWBA 1X1CA 4PIMA 3BXOA 4PNEA 2UYHA 3DOUA 2GPYA 3KR0A 2PSSA 2ZIEA 3GU3A 4FSDA 1YFJA 5FWDA 2PWYA 2QRVA 1SQGA 3OPNA 3ANXA 5EQJB 3LCCA 2V7EA 3DP7A 3ID6C 1VP3A 2ERCA 4FT4A 1RI3A 1NW6A 4GC5A 3UA3A 4RTQA 5DPMA 5IH3A 4QQNA 5GP1A 1X1DA 5E1MA 3EVZA 4DA4A 4HH4A 4F84A 2NYUA 1MHTA 2PY6A 3T7SA 2OYRA 1YF3A 4AZTA 4EKGA 1HNNA 2PX5A 4CKCA 3BWCA 4JXJA 5K03A 4FSXA 3R3HA 1KYWA 2ZULA 4KWCA 1WY7A 2AS0A 1ZG3A 3AXSA 4OA5A 3O31A 5DXAA 3L8DA 2EX4A 3LDGA 3G8AA 3LGAA 1PRYA 3PB3A 4FT2A 4MHTA 3D2LA 3ELWA 3FYDA 3O7WA 4PYQA 5F2KA 5E9QA 3EGVA 3KQYA 5FHRA 3NWEA 5CCBA 1FPQA 1X1BA 3B3FA 1P91A 4FR0A 2G8NA 4GUAA 3CCFA 3GO4A 3KQPA 1ZGJA 4PYMA 1VIDA 4QPNA 5DTQA 2PXAA 5EKUA 1KPIA 2Q41A 3OU7A 3PX2A 5DXJA 4U7PB 4MIKA 5E8JA 2PWPA 3OE4A 1VL5A 1XDSA 5DX8A 2C7QA 1G60A 5CVDA 1O9HA 2IGTA 1U2ZA 3NVKI 5EMKA 2IBTA 3DXYA 5T67A 3TKYA 1YZ3A 1G6Q1 2OPBA 3G2OA 3P2IA 4PYLA 4RSRA 4ER3A 2YUIA 4GQBA 3MTEA 4MQ4A 2YVLA 3B89A 3E8SA 3HA5A 3P71T 2ZW9A 4HTFA 4RYLA 3V97A 5F2OA 4RTOA 2G1PA 5CD1A 2XBMA 2AOUA 2GLUA 3GJYA 3UJ8A 4X60A 3KQQA 5EMJA 5K0GA 5HIKA 3CJQA 3FUVA 4DMGA 3BWYA 4PYJA 1AV6A 3A4TA 4AZSA 4ER7A 5EHIA 5FULA 2H1RA 3SSMA 2ZWAA 3FTCA 3FZGA 3DLIA 2UZ4A 1TW2A 4M7RA 5F2NA 3AXTA 3CC8A 1JTEA 5EIFA 5C1IA
chains in the Genus database with same CATH superfamily
2O1XA 3FKJA 1DUIA 3E4DA 4P58A 5F64A 5AKHA 3MSXA 1ODKA 5DH9A 3P2YA 4NZYA 2J9ZB 2X0JA 4PQRA 3DT8A 4BP1A 2K7ZA 2QE7A 3F8SA 2GLTA 2HQSA 2W0SA 1YDGA 4BFCA 4RQBA 2GFHA 2Z83A 5KCZA 3OIYA 3KVYA 4KO8A 4ZOLB 1JSXA 2WYWA 3JQ9C 5DHPA 3RLFA 3THXA 2NXJA 4Q47A 2OP1A 3T1QA 3RAJA 1MQSA 4FUQA 3RVLA 1X6VA 3UXEA 3VYTB 1O6FA 3JQGA 1I0IA 1EG7A 4B0OA 5AQEA 4UJ5A 1N2BA 3CR8A 3TVTA 2BGIA 5LOVB 3QUSA 4Q7QA 5DN6D 4WE3A 1R2QA 4L0MA 3TLXA 2DLCX 1POWA 4MKGA 4E3WA 1C8BA 2YN2A 3QMMA 4HDMB 4NR0A 1LPBB 2XOKD 2HSZA 3C3AA 3M9LA 3W5UA 4EUSA 1FUEA 2C9DA 4UTZA 2QRJA 4C5CA 3OEYA 3QKSA 3HXMA 2FUNB 2RGYA 4DPLA 4EMTA 5LJLA 3LUAA 5ALSA 2FFAA 3ADKA 3K5HA 3N74A 1X3LA 1UC9A 2GEVA 4CKWA 1SD2A 2A5GA 3QVLA 3K6RA 4GPTA 1Q19A 3PC4A 3U2QA 4BLSA 3A3YA 3TAHA 2QV7A 1VXRA 2L17A 3EQ9A 1AO3A 3Q3JB 2FOXA 2HMVA 3WNVA 1ZGZA 1KVTA 3A4YA 4RNCA 4DMHA 3MFYA 4ZI7B 1SEPA 4QRHA 4Q18A 4BO7A 4K8RB 1LBSA 4OKIA 1SN7A 1EWRA 3OUZA 3OCJA 3ONEA 3Q72A 3H1FA 1KIAA 2AC7A 1XROA 3A0UA 5U4XA 3NDRA 3O2NA 3CEPB 4G1BA 2YY5A 1XHEA 2EFJA 3WO1A 2IQIA 3IBTA 4V0QA 1T5IA 3BJMA 2WFAA 1E5TA 5B57C 1CT9A 1P2UA 2O23A 1UBHS 1FP6A 2C3MA 2JRLA 4FTWA 3VOSA 1AMUA 5EYPB 5B2EA 1HDYA 5JQGA 4G84A 4Y98A 5DNEA 4M9UA 3R3UA 2AZMA 2ZRIA 2GO1A 3Q5GA 1JT9A 1RQGA 1IQRA 4O1MA 2PLRA 4MR8A 4MPDA 4TWJA 1H4VB 3F74A 5HEKA 5I7HA 4H0NA 2H1IA 4YRMA 1JG6A 1MH1A 1KOGA 1PQYA 1YCDA 1PJ3A 4QRIA 3TL2A 3VDNB 1FSGA 4HEA6 4KQHA 1CR4A 2FXVA 1AXGA 3EA5A 1QP0A 2V7BA 4LOLA 3NQ41 5A4JA 3IDZA 1EB8A 3NAMA 1DZ3A 4W99A 5A3QA 3V2GA 4FZRA 3AZOA 3IEKA 4Q16A 1L8LA 4ZVOA 4BKOA 3ADBA 2ORYA 5AVJA 3OFJA 1R0BA 2VQEB 2JJ2A 1EBUA 2JG3A 1GD1O 1HI9A 2QD4A 1G8GA 3HR8A 3EGWA 5CFPA 3ZHTA 3QA9A 2C99A 4MIOA 1MA0A 1JB1A 5U9CA 4EG0A 4A0RA 1OFIA 2P5SA 4J2OA 4XTCS 1JKJB 4B43A 1G9XA 3X43A 4BUCA 1XZGA 1ZPDA 2GK6A 4CF4A 4B7CA 4WKOA 2HEGA 3RARA 1SCJA 1T6XA 2VYND 4C6SA 2QGZA 1MFZA 3KXPA 3ET5A 5BT9A 2XYRA 2ZDQA 1O8CA 1ODLA 1FTGA 3IPYA 5DNVA 3ZHBA 1I7SB 1T2CA 1V1JA 4XB1A 3RC9A 5C35A 3QBJA 1L8AA 4ON9A 5EUMA 1CUDA 3GEIA 4ZICA 4AJLA 4E4YA 1DX4A 3PR3A 1HZZA 4JP1A 4MWZA 4S05A 4PCAA 4KJZA 4P1ZA 5ITZA 1ZUD1 3D6JA 5LIRA 1M8JA 3RVSA 4OI0A 4KXFB 1RJFA 1VBNA 3WIUA 4ACAA 2GEFA 2E21A 3D7LA 4EO7A 1QO0A 1S3GA 4Z3DA 5CLLA 1MXFA 2AVDA 2D0OB 3DFUA 4MGZR 2QN8A 1QHHA 1IBSA 2QRUA 3WJ7A 3NRCA 1A4UA 4LF8B 2VJKA 3R2JA 5KYVA 3C14C 2MU1A 3R3SA 1J8QA 1CFZA 3DAHA 4K2HA 3KEFA 5KAPA 3NR2A 3E5HA 3SEZA 2KM1A 3ZY2A 5HPYB 1PJ2A 3TH5A 3WKCA 3W8FA 1EH5A 1I2CA 2CSUA 4LHXA 4XIIA 3WL6A 2XNKA 4B09A 1TM2A 2LIVA 2WM2A 5HIAA 5E6RB 3PHHA 4JXKA 1UBTS 5THQA 4L28A 4EG1A 3JWGA 1COWA 1EQ2A 3ZU3A 1GPDG 2X8JB 3VU8A 4CEIB 4RZQA 4BASA 5KVAA 4EKIA 3GROA 1KU6A 4BP8A 1T24A 3HXOA 3QXSA 2PXCA 3AZQA 4PM4A 4F8EA 4N0DA 1IY1A 2XTJA 4JOSA 2AD5A 4FQ8A 1WOYA 1Q0QA 1ADYA 2WJPA 3L1KA 5CJJA 4N7JA 4ZRDA 3PFHA 1YCHA 5FOUA 2ABWA 1PEYA 4L6IA 4YUAA 3ZU2A 3ZDAA 3MS7A 4NCAA 4V0MA 2BI8A 2QZJA 2ZRCA 4L4UA 3K96A 3TE7A 3VRHA 1UFQA 4OHWA 1MGPA 4BX0A 5C46F 1C7FA 3BE8A 1GV1A 3RK1A 4MS3A 3VR4D 3E9QA 2VO1A 3Q8MA 1H1TA 3CFYA 1JW9B 3GJ6A 1IAQA 4FHFA 4RY9A 1LVGA 3C87A 1UIRA 2IUTA 1M1YB 2NO7A 3LECA 2XGOA 2P6NA 3L4EA 2VUSA 3LZCA 3L7BA 4Z8XA 2OA0A 3TKAA 3WO0A 4POOA 4KAFA 4R69A 1S2DA 3CINA 4QWWA 2GASA 3BQ9A 4URFA 3T06B 5JZOA 1G8KA 4OQPA 1L3BA 2PRIA 3C24A 3LOPA 1W88A 3MMXA 4U9UA 3I6IA 2P91A 4IHAA 3HCNA 1YS2X 3V4VB 3ZY6A 1L1EA 3GA0A 4C6TA 2GCOB 5BW8A 1HT2E 5SY6A 1ZW1A 4EEZA 4EW3A 5JFTA 3GLIE 4U2BA 1A8UA 5CB0A 5A0VA 1T26A 3SVTA 2OHGA 5BW6B 4JLKA 1K88A 4FX2A 4CLOA 1NW5A 1VPTA 4BGUA 3P4XA 1NQOA 1GFSA 3SMQA 2V1UA 3UJCA 5JSQA 1EM8A 2XMRA 2FCRA 4TUYF 3UAZA 1WOMA 4DV0B 1E1CB 3CLTD 1U2PA 3GFRA 4RD6A 5DMXA 1KH1A 5CCEA 3OLQA 4HLCA 1OBHA 2W71A 5HILA 1E9BA 2R4TA 1DINA 3EVAA 3MLEA 1YMVA 4S35A 3DKVA 2H0RA 2X23A 4R84A 3F6CA 1CUWA 4GICA 3KOUA 3CRNA 3ENNA 1SK8A 5C5DA 5JH7F 5G4KB 3ZHUA 4RQTA 1D0SA 3E27A 4N9QA 4YR9A 4ISBA 3GRZA 4LWZA 3T35A 1VE5A 4EQ6A 3PEUA 1TJPB 4QGFA 1SRQA 1YDMA 2JVJA 2WWRA 2XZOA 5LMUB 1YBFA 4HS4A 4WD3A 2R8PA 4KREA 5JALA 1DC5A 3WWEA 5HUQA 4HPJB 3RUCA 1Q15A 1XLWA 2LD4A 3UUWA 5JBIA 3QTTA 4AL4A 1O6GA 4TQUS 5AK4A 5A62A 3V00A 4BB0A 2FRDC 1HTTA 4YV1A 2L19A 3I4CA 2ZBEA 3L8CA 1MAVA 3G2PA 2J7PA 4ZO6A 1YRLA 2NU8B 2WZDA 4WJKB 5HRAA 4Z4IA 1P9NA 1YR9A 4RF3A 4QQ8A 4EW2A 1K5PA 2BKXA 2WR8A 2HB6A 3GFGA 2JFXA 3R0JA 4AJPA 1X8JA 2M9MA 2CHUA 1A8SA 2JNWA 3PFBA 4RPLA 5IPFA 5FTWA 4N47A 4CDRA 4Z7NB 5MFPA 4GZ3A 2AR0A 5KWJA 3KJQA 1RXVA 4PXAA 2H6EA 3IESA 3UBTA 2XT6A 4L07A 4D02A 5LP1A 4C3UA 2BMEA 3U4IA 4NU5A 4DG8A 3CE9A 1CNFA 4F85A 2C7OA 2EJTA 2X9LA 2QTGA 2P1RA 3H9GA 2CJFA 1FJXA 1FDOA 1O77A 5JNSA 1S2GA 4FMDF 4L5CA 5GIPE 3C5CA 1KOJA 2P78A 3PT9A 2E1RA 4P08A 2JA2A 3D8NA 4R1SA 4RY8A 3SR4A 3PUJA 621PA 4FW9A 1ISHA 1Z5GA 3IELA 3W05A 4YMTA 3CPJB 3OFSA 2BTQA 2COUA 2FH5B 1ORIA 1W87A 1V8DA 3K8QA 2FR1A 1TKCA 5EZSA 3A9WA 4G1EB 1G4AE 4JBXA 3W3AH 2C9ZA 3WLAA 1CY7A 1P7VA 2E5LB 1NR7A 4BO5A 2VXYA 2PGNA 5KREA 5EIOA 1XDDA 2W2XA 3C45A 4I0WB 4LKOA 2D59A 1QOQB 3T94A 1K7FB 1NXVA 2XUGA 3QI7A 3KOXA 4IW3B 1DNPA 4JK3A 5E0OA 1S5PA 2J3MA 2UYGA 1A1SA 3I4LA 3FM9A 2G8LA 3VJMA 3KVRA 3QWBA 2RJOA 3RTDA 3FR8A 3UAYA 4TL8A 1IJFA 1AHNA 3GFOA 3NYIA 4DPKA 2GWRA 3K6SA 4IX1A 2ZYTX 3NBQA 5P8WA 2B92A 2ZGVA 4ZD6A 4FQ7A 1OH5A 4F96A 3MG9A 1TA9A 4M0DA 5DE3A 3WGYA 1ZIOA 4UXJA 3AUXA 2V6BA 4O2AF 1D2GA 4V02A 5HZKA 2G70A 1SXHA 2O06A 1ACJA 2NV0A 3V1MA 4K9DA 4TYQA 1U7DA 3QBEA 1FEZA 4BNTA 3PXBA 4RZUA 3NCHA 2BHLA 5LQNA 3V32A 3CWQA 4EVIA 5HW0A 1J25A 3U16A 3GRUA 2CF6A 2P8JA 5ALZA 8ADHA 3AJRA 3FHCB 3IO5A 4PHHA 4I9NA 1C3OA 1AZWA 1G0OA 2JK1A 1R15A 3C6MA 5ER6A 4B3JA 1SXQA 4KX3A 3A7DA 1N0VC 4B3GA 1UKBA 3H2HA 4PYOA 2NVUB 1LV7A 3LHDA 4XQEA 5FJJA 3P19A 2DFKB 1GYQA 4IDPA 1L4GA 4TMKA 5ILQA 2HF2A 4KIWA 1NMSA 3TW4A 2BFWA 3MXTA 4BNLA 4EY5A 2VZ0A 5KTSA 2F4VB 1IVSA 1VSBA 2G28A 1VC2A 2PSFA 1CP3A 1WDWB 2D4AA 4A23A 3MJ4A 4FGZA 2IF0A 1D4AA 4NBTA 4NG4A 1JJVA 3LDUA 1DCFA 1NJSA 1S8FA 5HK9A 3VA7A 3W5DA 4R1MA 1RLJA 3QKWA 1R9MA 1FMLA 2X22A 4MVYA 3NX4A 4A8JC 4CT4B 4D8YA 1CIPA 1QYXA 4MR9A 1EK0A 1HA3A 1UP7A 3NKVA 3O4IA 1I0ZA 4IDEA 4OUKX 2XUKA 4Y2HA 5B1DA 3PXGA 3KQNA 4LFAB 1FP7A 4NG5A 1NKVA 1XQYA 3AM3A 4MGYR 4BNZA 5BNZA 3BIWA 1PJAA 1I5OA 3WSVA 5HOEA 4B84A 3JD3A 3FSRA 4UHEA 1TUBA 4XFKA 4AJ4A 3RGWS 4CQMA 3L9XA 1WW3A 2WYIA 3OQPA 1JU4A 4I1UA 3V8MA 3D7MA 3X1KA 5ED4A 4IOKA 2X0EA 1E3QA 1NDHA 1UKEA 1JHVA 1AK9A 1B8PA 3G8YA 4FS3A 1LFAA 4P2GA 5YASA 1IY9A 3UB2A 3JQFC 3UYLA 2CVFA 1XRJA 5JC8A 1YJAA 1EFPA 1ULZA 1NF9A 3EDMA 5G41A 3ZEIA 3WZLA 2W9XA 4QUDA 5JS7A 1NC1A 2YFQA 1IQ0A 4H9JA 2HRCA 4QGGA 1NHGA 1FE8A 5LP6B 3BBPA 4AKTA 3VR6A 1UCFA 2WIAA 4BLUA 1T6BY 2OQVA 1G9TA 1N2HA 4BY9E 3QP9A 3JQEA 1TTHA 4LG1A 3H11A 3CG4A 1W94A 4YALA 5KINB 3ISVA 4CL3A 1Z18A 1CJSA 1DTSA 1E6LA 2Y4OA 3B70A 3I92A 3L0IB 3D43A 4MUFA 4YRPA 1QYRA 3E3AA 1LQTA 1QQ6A 3THSA 4B87A 3S8MA 4XKJA 1KQNA 2VJBA 5BY2A 1ZHHA 4C06A 3L5KA 5JOQA 4AI6A 3MINA 4OQYA 3FRJA 1X7WB 4C6HA 3ZWMA 1SPBS 2E87A 3PXUA 4OVKA 3O74A 1CZKA 2PWYA 5EP2A 1H22A 3HY4A 3UCEA 5T7BA 4K6CA 4PX2A 1ADJA 2WDZA 4DEXA 1QSGA 4RPCA 1VP3A 3DMDA 1TE2A 3C5VA 4RPKA 4GC5A 4C7MA 3EZ7A 1XDBA 2X0FA 4PR0A 2JVKA 3VGPA 4YHHB 1FFSA 2BW0A 5H0IA 1QGOA 3HU2A 3EDOA 3SIRA 3T1VA 2CBGA 3LT1A 2GNOA 1NG1A 5K3BA 4BJ1A 4I5GA 3AI7A 4EH1A 3R3HA 2DTDA 4JLVA 4KWCA 2P67A 4R9NA 1IONA 3QH4A 5HA5A 2EL9A 3VZSA 2QVCA 1QPZA 3WLSA 4BQFA 4DZZA 2X5XA 3PTZA 2J0UB 2R7MA 4PO9A 3ABZA 1GZUA 1PRYA 1K9VF 4RD3A 4ASUD 1SBQA 1SOVA 3GJXC 4FGWA 1HZZC 1T4DA 2Z58A 2QLFA 2HNBA 5EE5B 5FHRA 4EG3A 5BV8A 4BEVA 3AO0B 5L3RA 3RDPA 1EJBA 2QVLA 3GEEA 3NONA 4FR0A 4OLJA 2H3HA 4PYMA 3OZWA 4RHEA 2Y0EA 5EKUA 2I65A 1ESNA 2OCAA 2FUEA 3AONB 1MG5A 2AQKA 2XD9A 1CUVA 3QHQA 1C4XA 2VPXA 1M8FA 1T15A 2QX6A 1DVRA 3DXYA 1QLJA 5CH3A 3SHWA 2UVPB 4AECA 2BV3A 3HB7A 4TV8A 4B75A 2OV8A 3SR3A 4C3OB 1TLTA 3MILA 3M8KA 3R4VA 1RHUA 1YE5A 3HZOA 5EE1A 1L4KA 3GLVA 4B45A 4JBLA 4Q4AB 4BYMA 4F1JA 5HZHA 2WJZB 5ESWA 2REOA 4LJKA 3MW8A 1ATZA 1VHDA 1FXWA 2IEIA 3EFOB 3GBPA 3H5TA 3SQDA 3FUVA 4EPRA 3F7NA 1COZA 4DC9A 2RBEA 1A04A 3ZV5A 3LOUA 2PUGA 2IHJA 5AW1A 2M2IA 1JH8A 1W9HA 2O2CA 4J1NA 2PH5A 3WSWA 1L5HB 3CZCA 4QOIA 4KYVA 4DIOA 5KC9A 2DWQA 4F3KA 5K8LA 1U0RA 4PSDA 5I4BA 3HEBA 4HGQA 4XDHA 4RH1A 2A94A 3DDCA 3MIIA 2HPAA 4PLHA 3HM9A 3I8XA 4BJ6A 4PXYA 4IH1A 3SQWA 5ITZB 2O8FA 1J23A 1R37A 4C7KA 1N5RA 3FHLA 4F6LA 2G0TA 5IH7A 1KGDA 1ZFNA 3SC3A 4QUEA 1GY8A 4HGNA 3P9YA 1NBHA 3ROMA 4CDNA 4ZOLF 4H3SA 5E1OA 5BWOA 3KEMA 2FPPB 3A26A 4WGFA 4I1VA 3I62A 4CZ2A 4CL0A 3G2NA 4D9JA 1O54A 1NXWA 1R0ZA 4FMCF 2A1IA 1V47A 2Q5IA 4GVXA 4EPYA 4JNCA 2Q1YA 1DKQA 1LDNA 1Z82A 4XCXA 1TYBE 4CIYA 4DXAA 2FZEA 3QX9A 5JARA 3IOYA 1CG6A 1ZJ5A 3HU3A 3GPDG 4QEZA 5BR4A 4UQOA 4E2ZA 1PKEA 2YOHA 4EDHA 2ZYIA 3IQZA 1OZHA 4GWLA 4TRJA 4DSOA 1MEOA 3B6IA 2AFIB 2GTIA 2J09A 2R8OA 1NUAA 2ZJ3A 3AOEC 3TJMA 1J0AA 4P5EA 2DECA 4LTNA 3F3KA 3UOWA 4CEJB 1YZNA 1RKBA 2ZSIA 3URKA 1XJCA 3W2GA 4N40A 4NARA 3EAGA 4XM2A 4GPD1 1G5IA 2ZRGA 4QSHA 5DYIA 1KDYA 2PT6A 1ZSVA 3WLEA 3FFBA 3OQIA 1LWOA 3IEVA 1JWLA 4RK1A 1XNGA 3C8ZA 3QUQA 2I7VA 5JUWA 4DV7B 4U7WA 2XQFA 1NULA 5L4LA 2HRZA 1Z2EA 1LNZA 4IX9A 3JZMA 4F4FA 2V9ZA 4EUFA 5T41A 1T1EA 5DCYA 5JCZA 1P2TA 1BVHA 3O3NB 4B48A 3PLRA 2LCIA 4DAOA 4I81A 5CB4B 2ZR8A 3N0TA 3QPCA 2HRQA 3QKSB 1ETUA 2FFBA 2DQZA 3F3YA 1SVUA 3HM2A 5HZMA 3K0CA 2GZAA 3IE1A 2B3DA 4I5FA 5I7VA 1J33A 4AROA 4IEIA 4TMYA 4W5NA 1L4UA 3EXEB 3KTOA 1L6IA 3H1EA 3P97A 5IT5A 1VB3A 4FYVA 3EK2A 1KJNA 4LYHA 3BCRA 3HA3A 4FFVA 4WKGA 4PXSA 1HE4A 1X80B 5GVSA 7MDHA 1WM1A 4PAMA 3UT6A 4P4NA 2IKSA 1G21B 4LI0A 1K6EA 2E7ZA 1P1KA 4N41A 3SX2A 3O9VA 4MW2A 1PW5A 4WADA 1OXTA 1G21A 2O2YA 1GQSA 3IFSA 3SR0A 4PGMA 4MDFA 1U5CA 1DUSA 2UYQA 3H18A 3I9V6 4JOQA 1TI7A 1UEJA 3LUCA 1ONBA 2RHBA 2X14A 4N8EA 4OY3A 4P54A 5GM1A 3RSOA 5FR2A 2QP3A 1T0BA 2ZDHA 3ED1A 3T4EA 3OCZA 3EH1A 3ORQA 3K0AB 3VC1A 1XZPA 2QJWA 2BR3A 1X19A 4AMUA 3M2PA 1J9ZA 3C39A 2W8ZA 3EG9B 3KQMA 3NBYC 4FE4A 1T1SA 3ZDYB 1SKAA 4HNVA 4GMFA 1Q74A 4E5VA 3BIJA 2EKZA 2DTEA 2IW1A 2G9QA 2BEUA 2N1MA 1B14A 3MTJA 4MULA 4OCZA 4X00A 4YUYA 3ZBUA 5HOQA 2O2GA 2VYQA 3VDXA 4CU2A 3I5YA 2Q8QA 4PLVA 1E79D 2GLXA 2VQ3A 1T5TA 3DBHA 4V38A 3PGA1 1YR6A 2F00A 2OZLB 4TMXA 5F52A 2WSLA 1BMTA 3QFHA 2PX2A 1E4EA 4ZJUA 3GLHB 3HP7A 5J2UA 2NZWA 4F8JA 3CS3A 5GVRA 1Z2AA 3RUPA 2V9CA 2ZIZA 2VH5R 3RBAA 1H3NA 2Q9CA 1DBRA 1CQJA 2PG3A 4CBVA 2QRVB 3DLBA 1GG9A 2O2DA 1NUPA 1TC2A 1U7ZA 1Z8HA 3FDJA 3F7TA 3A9TA 1XAIA 4UBJA 3U37A 3PQ6A 1GAWA 1JKJA 3UAVA 4KLCA 4D8WA 2HA0A 1FFYA 4W9RA 4DLSA 3MFDA 4YY3B 2RI0A 4N3GA 3M5DA 3RYFA 5LYJB 5MHTA 1U8AA 1YU9A 4KWTA 3N0XA 4EIWA 4BQNA 4C0AC 1YR2A 3CW8X 4A26A 3NIBA 4BJ5A 1B6GA 5DNUA 3O95A 3RFCA 3PFFA 2GK4A 2YC2C 3NBKA 3PYXA 3R7DA 3UMJA 3A06A 1B6RA 2VDUE 1UMKA 2H9YA 3C1TA 1TDJA 5I7UA 1OFGA 3GEMA 3A6PC 2FKAA 1QS0B 4UU7A 2ZUCA 1GPH1 3BWDD 4WDRA 2VDJA 1F5SA 2C59A 3KFVA 5ENDA 5DYYA 1M2KA 2CD9A 3FAKA 2OV6A 1KJIA 4DMMA 1HEUA 2E6UX 1Z26A 3DS8A 3QVGA 4FU0A 4G3XA 3WYCA 4RKEA 1NDUA 5K99A 1R0WA 2QUKA 2XRZA 2F62A 2E4VA 4OJMX 2J48A 1LI4A 4FLMA 1APBA 2I33A 4YCLA 4K9RA 4I2NA 3E84A 1QFYA 3HLKA 3IDAA 4RGYA 1A5ZA 3VKVA 1QH8B 1Y81A 2V03A 5A0FA 2O8EB 2ZI4A 1ZJJA 1PFYA 6Q21A 2B30A 3BDIA 4X8HA 1HORA 5BSRA 1HWYA 4PSUA 2IUUA 5H9VA 3ET4A 1YI0A 3K1AB 4RKQA 2FW9A 4UEQA 1VE6A 3N2LA 4L50A 2MYTA 5KNBA 4H9GA 3E1GA 1O4WA 1QIGA 4RK7A 1Z4JA 1D2NA 4TMTA 1TX4B 2X5OA 3R3JA 1FX0B 1M7HA 1Q5PA 2R00A 4LGVA 4XXHA 1KDZA 3VKHA 1DI0A 4PS0A 4X44A 3WRVA 1EJ2A 4BBAA 4M0UA 1WXDA 2D7CA 3CKLA 5FEUA 4AKHA 3GAMA 2QTNA 3K0FB 3O21A 4X7BA 5A71A 4D9HA 3NAQA 4DSTA 5JSKA 4WLEA 3H0KA 5EE0A 3UGJA 2REBA 3IAS6 3ZN2A 4G0MA 1P5RA 3C7DB 3RFXA 3RU3A 3VAYA 1UXOA 5CIYA 4W5OA 1NBMD 3V80A 1U3DA 2H2IA 4JFAA 4DR2B 4RLSA 3ZXXA 3CUSA 1EVKA 1FVXA 4RD4A 2PKRA 2NNWB 5C51B 3E18A 2G9ZA 3PIIA 2WD7B 3B1KA 1YUNA 1GFWA 3KAKA 1T36A 1MTOA 4IDGA 4K8OA 1QR6A 4UEOA 1YGPA 3F2IA 5LCXA 1U0NA 2ZIAA 5JAMA 2FQQA 2Q8PA 4E51A 1ZMXA 2D5AA 1SUFA 1VG1A 3PUZA 3H83A 2WTAA 4BO8A 5TT0A 3RSSA 1VKHA 4MVJI 4BO1A 1E99A 1QVAA 1XVUA 2QT9A 3FDIA 4NOKA 4PZYA 3UBMA 1NG9A 2PJUA 4RH0A 4NBSA 1VQ1A 2PBLA 2Q62A 4BNNA 2YWJA 2BIFA 3TAXA 7AT1A 1K8QA 1HGXA 1LBHA 2ZOSA 3PFKA 1H2ZA 3P0JA 3QEBZ 3BT7A 4W9MC 1B0UA 4IGIA 3LX6A 3KJFA 2NGRA 3EF1A 4HFNA 3HXLA 1CEQA 1QIEA 2MSWA 3ZI4A 1MABB 1N2SA 5JRDS 4UAGA 4YXWA 1MJFA 4L2IA 4NH4A 1NN3A 2XF2A 4WJZA 4BNDA 2IOQA 3WK4A 2N47A 5AI0A 4YDQA 4MYSA 1LCIA 1NVEA 2OO5A 3IKVA 4PW0A 1DL5A 2ZG6A 3L7DA 1O5OA 2C96A 3DFZA 3LPAA 4MKZA 4Q12A 4GI1A 5T8KC 4KVGA 1ESCA 1YQQA 1Y3AA 3TS1A 1VE9A 5LZ2A 3V7YA 1SAYA 4KIJA 2V7QD 3NBAA 1AF7A 4WVFA 1M6WA 1G1MA 3AHIA 1CRZA 1IXKA 1K6IA 1ZMTA 3QKIA 2Q7DA 3LZ6A 3NRJA 3P32A 4C88A 1ZSYA 5KZMB 1UFOA 2XLBA 3C43A 1FDIA 3PC8C 5CH8A 1BQEA 4R8SA 3UG6A 1QQ7A 1EFCA 2ECOA 2A35A 1MC4A 2WBLC 3BF7A 3E1KA 3G85A 2OWDA 4B7UA 2B35A 4DZRA 3F3MA 1R6UA 2PBFA 2E18A 3CLSD 3R24A 2Z5VA 1NV9A 5C18A 2IDZA 2WE7A 3FPHA 1JWAB 4YJHB 2PZAA 2BP7A 4FZ5A 3R6WA 3FBWA 4Q00A 2EZUA 2X2OA 3HA7A 3WMEA 1N1DA 5FYDA 5ERGB 3DE6X 3RIHA 4LY0A 1P1CA 3GAFA 1KARA 2VA8A 3HS3A 5A5DA 2IQ5A 1SU4A 2RGEA 4YUZA 3ZCXA 2ZSKA 3FSJX 5I45A 1QQ5A 1VG0B 1IATA 2C82A 1CJMA 5K51A 5CAEB 4PLWA 1WZCA 5FPTA 4MVCA 3RS7A 3QSGA 4UUBA 2Q6TA 4HRYA 2QLMA 4TVKA 4FYMA 4L85A 4Y9DA 2D4HA 2Q2VA 1UKAA 1R3UA 2BI4A 2PGJA 1DKNA 2X77A 4MAFA 4COOA 1FLAA 1IHUA 3GGPA 1M9NA 2HHLA 5F76A 1TK3A 4DDMA 1GUBA 4MYTA 1L5FA 4FHZA 2IGBA 3K6KA 1LY1A 3NU1A 1QE3A 3H97A 5TQVA 2V1XA 3RJTA 2D2IA 3KKOA 1OLXB 1U1EA 1YS7A 5FO1A 1FYEA 1QU3A 4M6WB 3SSNA 1DTEA 1L7OA 1SUAA 4JVMA 4OQ4A 4WXEA 1FSFA 5D01A 4ARVA 4JA2A 3FXAA 3PNSA 1JU3A 2D1RA 3M6AA 4OK5A 2ZRFA 5TRTA 1EEXB 2KJQA 2WSIA 2XRFA 1DQYA 2R6DA 2PRSA 4JMPA 4X24A 3ECCA 4S12A 3JD2A 3C3BA 3Q12A 4PQGA 4KPEC 1VJ5A 2PMFA 3EZ2A 3ETLA 3G13A 3JU3A 1XHLA 1CQIB 1NAIA 4M1TA 2O5VA 1TTPB 2XTZA 4WOPA 4HVCA 5ICSA 3WQHA 3C4VA 4L22A 5J4YA 2C57A 2QSUA 3M6UA 3CZQA 1DIGA 3OJLA 4UVHA 1FX0A 4IQ8A 3JARA 4QXPA 3UHJA 1TEHA 2NU8A 2W48A 3GNLA 3S3TA 4Y9TA 3DHVA 1UOPA 5L8VA 2YCLA 5CK5A 3WNBA 3ZQJA 1EUYA 2PNFA 1LRLA 2WUWE 2Z08A 1H2FA 3P9KA 3GUVA 1HDOA 2XJ4A 3NM5A 4U0JA 4P7KA 3JQAD 3VR4H 2VPYA 4PZAA 4Q1VA 3FIJA 5GPBA 3CGGA 3S8EA 1RABA 5F3DA 1D4OA 3IQDB 4KOAA 4WLUA 4EJSC 2P9TA 4MS1B 3UT5B 4ZN6A 3Q7QA 2YIMA 5EZYF 3FRHA 3TSOA 2PKYX 4E1BA 4JELA 1UBUS 3OJCA 4P6VF 5D87A 2M6LA 4BFZA 3HVUA 4K6HA 2WU1A 3LBNA 3VH1A 1ZD8A 3SC6A 1WHSB 2ZT5A 1DOHA 1OLSB 2Q4BA 3EQZA 1PJSA 3RJ5A 3TLAA 1I5RA 3TR0A 3MWKA 1RJ9B 1TT5B 3N5CA 3BKXA 2IDMA 3OF5A 4MJ7A 3QLUC 3LCJA 4ZCQA 1GEEA 2BFDA 2ZWMA 4QUGA 2D13A 7YASA 4KIFA 2XD4A 1L5MA 3SJAA 1R3DA 3A4MA 3IA2A 4LF6B 2QNIA 1MKYA 1Z0JA 1W2GA 1GG8A 2HN9A 3T7JA 3U7FB 3HP1A 2CV0A 3AVVA 5CW2A 1KAHA 1LVUA 5C8XA 4EWLA 2OLJA 1ZM4A 2RH8A 1U11A 4TRMA 4WESB 4I66A 5I9BA 1XJQA 4E09A 4MV3A 3K4QA 1UDBA 3ROGA 5HIJA 3IODA 5DX0A 1GNQA 4N4AA 2UYHA 1T5BA 4RAQA 2PK3A 2KYRA 1QJ4A 3WK5A 2QRVA 4ZC1A 1L5OA 1TMGE 5TVGA 3TVYA 4E4TA 5KO2A 4ABTA 4PSAA 4QQNA 2UZ0A 4M0LA 5E1MA 4IYJA 4AKSA 2BKUA 2NYUA 1A27A 3AW9A 1LK5A 4Y2VA 3THWB 1RZRD 3KALA 2WT4A 4Y2QA 5BPHA 4E88A 4CIXA 2MJLA 4LF7B 2RGBA 4TTIA 1KTVA 4MGKR 1KDRA 2WKWA 3CB2A 1V48A 2JFUA 2AS0A 3WYFA 1OX6A 1ZG3A 1X9HA 5CHEA 5K5EA 1GPWB 3HMQA 1MT3A 4O1IA 2FPUA 5KTNA 4TL6A 1Z5OA 1XK7A 2I4RA 3CR3C 3EXFA 3JX9A 4IJ6A 1QUFA 1XZKA 2BFBA 2H2DA 2NO6A 2R1ZA 2EU8A 3HZHA 3O7WA 4RIHA 4U2FA 2IPAB 5T4FA 2O19A 1V4NA 4Z1OA 2G6BA 4GX5A 2DF8A 2IYZA 3GCWA 4Y9RA 4DS3A 1SKBA 1OFHA 5BMVA 1A8HA 3KQPA 4GGMX 4I8DA 4LBYA 2GZ1A 4JLSA 1CZOA 2G63A 4J03A 1L5QA 3PX2A 3H9QA 1HFJA 3N7TA 3QU4A 5E8JA 1H2AS 1NYTA 1VA5A 1N5KA 1Y4UA 1SUWA 4V0ME 4C2AA 3HXQA 1NVKA 1YACA 3HU1A 4V3CA 2YV4A 3RC7A 1DOAA 2GZ3A 2O8BB 2J5QA 2R0QC 3TEJA 5CG2A 3ZJUA 4BO6A 4HWKA 4P3XA 1EUCA 3IPAA 3P9RA 2EHDA 4RTOA 4BLOA 4OH1A 4D56A 3ZU6A 5J4HA 3A2MA 3GJYA 4TOIA 4YAWA 3ICPA 5FXMA 3KXDA 3GAZA 2IV3A 3ZZMA 1P1IA 4A8HA 5K0GA 3WBBA 1OTXA 3Q0IA 2J08A 3I73A 4Z0HO 5LZ9A 2KPOA 4QT0A 3MF4A 5DHAA 1GSIA 1I2ZA 5DNWA 5EXXA 3ED5A 1TB4A 3QMVA 3HJNA 3BG5A 4Q02A 2YHIA 1CF9A 1C1XA 1QYWA 3UWDA 1VYVA 2C2BA 2QXYA 3PLNA 4E08A 4S0XA 1UJ5A 4ZALA 4B4WA 5PNTA 4XX0B 3TYXA 2V55B 1UZMA 3G9QA 4GGPA 4GOXA 5CFNA 1HDGO 1HYBA 5FUYA 3MCUA 3D7NA 3NOXA 4BFUA 1OT5A 4KE9A 1DAIA 4MKXA 4YI3A 3LA6A 4YCMA 2GMWA 3U4QA 1ZWLA 1SHTX 1L0BA 1U2TA 2E9SA 2IEDA 4JLJA 4MEJA 1TC1A 1UBRS 2JH9A 4PG7A 4PAOA 1SGWA 4WN9B 4MDEA 1V7PC 2OBLA 1UWCA 4DA0A 9LDBA 4TQGA 1XWFA 3FOFC 1QRSA 4HS9A 3CIFA 1L7AA 1KI3A 1K6XA 2O1WA 3B52X 1ZUNA 3DW1X 3GMTA 2P0AA 5CT5A 5LQRA 3KPYA 4BN5A 1SCBA 1JLLA 4EQZA 1NU6A 4LJSA 2GXSA 2F43B 3DZFA 3HA2A 1YBAA 5IM4A 3JPYA 3UUFA 1CUIA 3TDKA 4B31A 3ND7A 3TQCA 3MJFA 3CF4A 1D4FA 1NQ5A 1JHZA 1CNEA 3NDIA 4E31A 1CKEA 4O4JB 4RFVA 1XDUA 5K05A 9GPBA 3KG2A 2AN3A 3C3WA 2Q5FA 2IP2A 4MITA 3X1JA 1MRNA 1V11B 3ZBTA 2MT9A 3S1AB 1EXNA 4YK7A 4MJLA 4D42A 5FOQA 3IO3A 1TU3A 2E6KA 2X1MA 1RLIA 2XB8A 2HJVA 3JZAA 4N3AA 4UNIA 1U0BB 1M1NB 1GZ6A 2CHFA 3FDZA 4L5YA 3OEED 1ZA2A 3WLPA 5COBA 3OIGA 1C1HA 3IVMA 4W8OA 4K9QA 1M34A 1NVWQ 1P7CA 2VAMA 2GCEA 2OKCA 2P8SA 1PT8A 4WCFC 1RAEA 2AJCA 5TJ9A 5F1KA 2Y1OA 5D51S 2C9YA 4QOHA 4WQMA 5HQ3B 4XPIA 3FWHA 4Q9KA 2WIKA 1T2NA 4YR7A 1BDIA 1GEGA 2IODA 2K4MA 2Q0XA 1YVDA 3UJPA 3JAMA 2JIPA 3B48A 3MBIA 4HN9A 4QDZA 5TMBA 3VYRB 4M1OA 4KODA 2ETXA 4K9LA 4OK3A 1DV1A 1Q0HA 1JQ5A 2A7XA 3AF2A 3H1PA 5EWLA 2VTBA 1Q7RA 4RH3A 3IVXA 2H92A 4GSKA 4WKPA 1FYXA 1WMFA 1Z6AA 3NCTA 2FF5A 5ESDA 3N8DA 3ILHA 4QO7A 1EAMA 4BNWA 1JJBA 1Y33E 2A1UA 2GRJA 3F9CA 4PONA 1AQJA 2GJ8A 3OETA 4UCQA 1NBAA 4KR0A 1C30A 4MI6A 1UJ2A 3Q5EA 4UDNA 2NO5A 1KI8A 4CKXA 2VDNB 2WKRA 1GU7A 3EUEA 4L16A 4WZBE 3IBCA 3IRUA 1O9GA 4LOJA 1XZAA 3P9NA 2ZR7A 5KOIA 4DQKA 1KQGA 4JZYA 1Z2NX 1KYYA 3KJIA 1I3CA 4KQIA 4Z51A 1I2DA 4NV1A 2WKQA 1Z2OX 2D06A 3JQ9A 4ENUA 1VLVA 3VTZA 4DLYA 2HLHA 3EBPA 1NUHA 3LO5A 4N5DA 2BL4A 4ZXFA 3W9YA 1W19A 3VO1A 4L78A 1XZQA 1V26A 5A2GA 5HF8A 1V5FA 5L3VA 4DBVO 3AGPA 2QLNA 2VBCA 2Y1FA 4PTLA 1VRCA 4WBXC 3I28A 4B3BA 3N7AA 1FNBA 1UDRA 3R1IA 2H4JA 3T7CA 3VBCA 1ISPA 1E9CA 5EIBC 2HK6A 5CBPA 4YRKA 4PLCA 2Q5QA 4DYVA 3C48A 1TNDA 2IHNA 4KL8S 5LWHA 2O8BA 2Q5OA 4PC2A 5AI5A 1V6CA 1MN6A 2OCBA 2QTMA 1L1FA 5HWSA 4KBGA 1ESZA 1RBZA 5DRTA 1NF8A 4FHDA 3W1WA 1EP9A 4L5AA 3RYIA 1MFPA 1MP0A 4LZAA 1W6RA 1GNTA 1QTRA 3VO2A 3ZGYA 1SULA 3AF1A 3L1JA 2O52A 2GILA 2I1VB 4ARZA 3K1ZA 3GFVA 4XR4A 4EMUA 3CW2A 3KQSA 4AQYB 2ZKLA 5EVCA 1CEEA 4QU8A 3PFCA 4BFSA 2FX3A 3G0HA 2V74B 3OIDA 2XCTB 3SJCA 3FUXA 4HB3A 1W4RA 4D44A 1T4MA 3D6AA 2PUAA 1KEEB 1ST3A 1USIA 1XTQA 1Q7EA 4DE5A 1PG5A 5D3QA 4S1PA 4FFNA 4XLLA 4YCBA 4HNRA 2IWHA 4KRYA 1SVWA 1QANA 3EIEA 1BEUB 4LHZA 4YBZA 3R76A 3R7SA 3ZV3A 3W90A 1AG9A 3HCWA 5TS3A 2PUFA 3U4DA 2ZR0A 4FB4A 1XIVA 4AULA 1L6RA 3UB3A 5CFOA 1MRZA 2R1UA 4Z86A 1D2MA 2C1EA 3GOQA 3OZFA 1OH7A 1I7NA 2P9BA 3F9IA 3E7PA 5GOTA 1L5YA 2ZUBA 3UB4A 3L7KA 3JWJA 3H8JA 3QW2A 4IL5A 4LC0A 4B6FA 1JA9A 2X7XA 5SY4A 3EUFA 1WHTA 2VXOA 2RBKA 2HLPA 4K46A 2PYIA 1FB5A 1QIKA 2WK1A 2QN6A 1G17A 1DRWA 3IP9A 3EYWA 1U1IA 1O95A 2LV8A 5DP2A 3R7WB 1N92A 4MQMA 3ROXA 5EERA 1M1UA 1P4HA 4RNDB 4EJ2A 3ASVA 5DN9A 4PC1A 5FRDA 3Q3VA 1IY2A 2CEKA 5FTLA 1KI6B 1OLUB 3V8NA 4JZKA 1ZHFA 2FGJA 2G1UA 4S1TA 2R6AA 4PFJA 3E9CA 1H2HA 2JF0A 2PD6A 2H2AA 4H77A 5AKGA 4AN1A 4B6EA 4ZAZA 2P3LA 3IAXA 5BQXA 3TBFA 1U9JA 2Q6IA 5EP4A 2WA1A 1HF3A 5JDIC 1H85A 2DPHA 4KV7A 3IURA 1W5EA 3MGKA 4QGHA 1Z16A 4PF1A 3V2HA 4P86A 4LOIA 3PJFA 3RQIA 5LKAA 2XSZD 2HLDD 1LWNA 3UT0A 3BD7A 5EXSA 3QZUA 3PR2B 2LCQA 1OIVA 4EPTA 2QA5A 4M0KA 1CW2B 5JR3A 1N1GA 2R7NA 4J2TA 1YH3A 4MAAA 2WWVD 2DKFA 4QHTA 4FX5A 2ATVA 4YVFA 2FSSA 4HGPA 4LVCA 2ZROA 4J9VA 4NNJA 3V1YA 3ZCTA 1Z29A 5E1DA 1OI2A 2ZUSA 2H4WA 5TGDA 1JR3E 3OJXA 4PRLA 3RSFA 4P3YA 4UXHA 1WTAA 1T8RA 5A5VA 4U7GA 4YCDA 3M6FA 3P2MA 5KYXB 1QNFA 1ORVA 1STOA 4TTSA 3MBKA 2A4MA 3VHXB 2DP4E 4C08A 1J5PA 4CLRB 5JNLA 3V4PB 3WOHA 2FWNA 4D0NA 4RWZA 4U7FA 2JZOA 3DD1A 3IOBA 3TE6A 3J7AC 4BO3A 5IUJC 1Y37A 2NVOA 2YJZA 3C8UA 4NCNA 4AWAA 4CIBA 3DBOB 1GVHA 3FWKA 3TI9A 4LUCA 1U0FA 4CM9A 3WA7A 3RC2A 1L7QA 3TG2A 1QYCA 3IMGA 1G2IA 3HUEA 3BRQA 3WQQA 4HNTA 4L3VA 1UC5B 2Z30A 4PLZA 3O8CA 3G0BA 1EA5A 4MV8A 4PZLA 2X5NA 3WBKA 2D0PB 2QTTA 4WA7A 4HB4A 1IBRA 2P1ZA 2CF5A 1PS0A 1ZM3A 3RVRA 5EMMA 1JG1A 3UPTA 1POXA 2IU3A 4MCJA 3K0AA 2IEZA 4IAOA 4XB2A 3CG0A 5F9MA 5C4GB 4J0QA 4DLWA 1T8TA 2VHXA 1QC5A 1MXHA 2BRUC 4UEWA 4ZRNA 3WQRA 2X9QA 2JH8A 4XVHA 1GGFA 1GHTA 3RU9A 3THRA 1T3ZA 1TQ8A 2A0UA 5JAZA 1QTQA 1JQDA 1DEHA 3WYNA 5JH7A 4O02B 4ZOEA 3MWFA 1PLLA 3BTSA 5EJ8A 3Q40A 2LWIA 3UK1A 5IBRA 5CYGA 1ZMRA 1AC5A 2FWMX 3AEZA 3QYFA 3PHCA 4OQZA 4NENB 2OLEA 3H6HA 3WYGA 3HFJA 2Y92A 3Q7EA 5BR8B 1AKEA 1KK0A 3KUKA 4KQ9A 3DTVB 1RWMA 4I50A 2FX2A 4BB5A 1AX9A 4G5OA 3IJ5A 5BYBA 3OOJA 3F6PA 4KFRA 3T7AA 2B4YA 1N0WA 3ABRB 4DUZB 4DNXA 4M1WA 5IT4A 2X9VA 3IUSA 4N8DA 2FKNA 3QQPA 2P9FA 3S2IA 3WK6A 2DVMA 4EYOA 2G36A 5AD1A 3B9RA 1V1MB 1RYZA 4BKRA 1TJNA 3P4YA 3ZR4B 4TT3A 2WQ6A 1DKUA 4DTIA 3T1NA 3E8XA 2XA9A 4P3NA 4AMZA 1CB0A 3MERA 5G0UA 4CCAA 3OE7D 3S1SA 3HDYA 3L6DA 2OZVA 1EHIA 2GF9A 2J3QA 3MCZA 2CLEB 1RYDA 3AF0A 3O03A 2XYVA 3WWDA 4KPYA 3DFMA 3OZDA 2BBTA 4NOJA 2WF8A 1JMKC 4QJ5A 2ZJ5A 2NZUG 1N25A 3FJYA 4JL8A 5K7SA 1KY4A 2PN1A 2R5NA 1XG5A 3BC1A 3DGEC 1FVOA 2BWJA 3EBLA 4PQYA 4M1MA 4YNBA 4DFDA 5ERYA 4II2A 1EFDN 3GDOA 3OQVA 4US1R 5CNKA 3WLIA 1MB2A 4J3NA 4J0CA 2PJRA 4MI1A 4AO8A 4LMPA 3BICA 3STUA 3ZS9A 1OZAA 1DAOA 2VJAA 4GM0A 4PPFA 3BEOA 4UASA 1TW3A 3QNWA 3RAGA 3PU6A 3DLPX 4H17A 4WLOA 3UJAA 5CLQA 5AYVA 5BSTA 1X39A 2ZQYA 3H2JA 2OV4A 4KK4A 5AH0A 3KT3A 4PCLA 2IXBA 3RH0A 5JNRA 1L1QA 1TAQA 4IUCS 2ZUWA 4JI6B 4H4CA 4NCJA 2EIHA 3R7NA 1UODA 1Y1RA 1J4AA 1U3CA 2DCMA 2ZJ8A 3E9MA 4UUAA 2C3UA 3PEVA 1LA2A 4P36A 2ZIFA 4F04A 3P52A 2NADA 3D6NB 1E2QA 1MVNA 2YXDA 1G4HA 2HF9A 4TWRA 3THOA 4A6XA 2VNHA 3GL9A 4RKWA 1QYVA 2FW0A 3W6OA 3VAAA 3OKAA 1QKIA 1RXUA 2GETA 1CS4C 1P1HA 2EJBA 5HJ2A 3VV2A 3G17A 3NHUA 3REFA 4UNNA 1KHTA 1NMEA 4X94A 3BXPA 2ZYDA 1TCCA 1PWXA 3COPA 4N3BA 1RAFA 2IYLD 3WRYC 2FZ5A 2QJFA 5GJCA 2W2LD 2YDXA 1WP4A 1BVYF 4IZIA 2R3SA 2YFHA 3EFOA 5K1ZA 1YASA 1A76A 3GLRA 2X7HA 3FI9A 1OA0A 3FFWA 1R27A 1E3WA 5JE8A 2VSXA 4G07A 2CEAA 1F0NA 4X71A 1QG4A 2PGDA 3QOFA 4OGLA 3LRXA 1THTA 2FRVA 1CQWA 3GXBA 4QBHA 5KWIA 2RHLA 3WXMA 4QJ3A 1A2KC 4QPCA 1W48A 3QOXA 4DLLA 5TSDA 1QIDA 3AIKA 1KBOA 3ELUA 3PUIA 3HVIA 1ZCAA 3Q8XB 2VXCA 4WZZA 4Q4LA 1DJQA 4NDNE 5E9AA 1UDWA 3M83A 2Y93A 2YZ2A 4CG2A 2NACA 3AKEA 5LQKA 4JLOA 1ITZA 4GRDA 5EWMB 1XNJA 3BGOS 4LBZA 4CUKA 4BN4A 2J07A 3GLGB 2ISSD 4K6OA 3EPJA 1GRNA 1NURA 4BX3A 3LWNA 3ANXA 1RYMA 3OPNA 4RZSA 5THXA 4DDVA 1XNQB 2ERCA 4JLNA 1XQ1A 2CXOA 2SKEA 5A7FA 2ID7A 5DPMA 4JI5B 4DIKA 5J5VA 4RTQA 5L4NA 1JR2A 1UMBB 3VPCA 3PBKA 1ISSA 1C0KA 2CZCA 3DNPA 4FFBB 3UV7A 1NN1A 2H7VA 3W34A 3ORRA 4J7UA 4CMKA 5ITVA 1ILWA 3IOCA 3MUFA 1QS0A 1SBZA 1V7QA 3EODA 5KOYA 3MLBA 2PX6A 2OP0A 3ILXA 1ONNA 2YXBA 3TLYA 5AI9A 1DQSA 1NONA 3HDJA 3I45A 3NUGA 5D5PA 1FX1A 5DXAA 3U7IA 3VU1A 1RPNA 5JXWA 5SV2A 1IXRC 1P3Y1 4MYCA 3EGOA 1FUYB 4JT4A 4MVJA 3QW4B 4U2GA 3L0PA 1PTJC 3OIVA 4F92B 3G7SA 2G8NA 2RH5A 3GFSA 5CVTA 2FMIA 1SCUB 2BTEA 1VIDA 3L7OA 2RDMA 1P2SA 3GLQA 2R25B 4YMWA 5DTQA 3TRHA 4ZZ1A 5AW0A 2EFCB 3S2YA 3C6XA 4Y6OA 2VTKA 3KWJA 1OJ7A 1P1FA 1T10A 2C2YA 2FE4A 1Y5IA 3L92A 5CDGA 1OWPA 4HPWA 2A0XA 4LRTB 4MMYB 4IMJB 2C2GA 2KLHA 5DZSA 1XP8A 3UANA 4CYMA 3KB8A 4GE0A 3SYKA 2QT0A 2HXYA 2C98A 4DPMA 4JCCA 1JLKA 1C7RA 3DKIA 1YVPA 3IAM1 4CLOB 1KL7A 2DHDA 1L7DA 1EXVA 3UJ8A 3IR5A 4CIAA 5A9RA 3S2UA 3GJZA 2QTLA 4I2VA 2R8ZA 5EMHA 4D9BA 1L5HA 5BMVF 3A4TA 4NMHA 4QO8A 1FUIA 2PGIA 1JIQA 4LDQA 4MRAA 3SNHA 1D9ZA 3ZNNA 3B6JA 3DLIA 5ED0A 4BVHA 2ENWA 2B61A 3DO8A 1E2MA 1C9JA 2CMDA 2W90A 1ZIPA 2EZTA 2XCQA 1MOQA 2AG1A 5C1IA 4LIPD 1YCFA 1MT0A 3IAFA 3KYIB 4R5MA 3ROFA 3ZWBA 3QJGA 2W2QA 4EJ6A 5EXPA 5KNCD 1Q1EA 4M37A 3KSMA 5JSZB 1N57A 1NPYA 4L72A 1H0HA 2QIPA 3WJ2A 3T41A 1SHJA 1XD8A 3GLGE 1NKTA 2WFZA 2DERA 3L0OA 1EPUA 3HJBA 1IIRA 3BFJA 1WJGA 4XDYA 3QU5A 3TVDA 4A9AA 1I1HA 2QM3A 4DADA 3D8SA 1FYDA 4MRSA 3DZCA 2P11A 5JYCA 2O07A 1G8YA 1KC1A 1SO8A 4L4ZA 4IPTA 3W04A 5JJCA 1Y48E 1L4LA 1GO2A 2AJLI 2XW6A 4E32A 2VF2A 3ADOA 4LQDA 3UWKA 4BNGA 1LK0A 1JHMA 5HYVA 4IDNA 1K6JA 3D59A 4XH9B 2ZCJA 1KEEA 4L57A 3FFAA 3A6JA 2H2FA 4XWWA 2ZRJA 1XDWA 3EE6A 3HKEB 3W9UA 1Z56C 2VWPA 3HMKA 4ER0A 4G36A 4P38A 1UMCA 1P7WA 2NXNA 3WDLA 5KWEA 4DMUB 4QXMA 3B2NA 3FUUA 3PGXA 5ELLA 4DRXA 4EEXA 1RJGA 1RRFA 3E0XA 4PG8A 1WDMA 5FAKA 5M34A 3G5AA 1DFIA 2RGNC 3IAAA 1ADFA 3T9BA 3FRIA 3CUYA 3FJOA 4IBOA 3SF8B 1ZRHA 3SVLA 1IEQA 3U4QB 5EHGA 4KHZA 3A05A 1QCCA 2LNDA 3FWYA 1PZFA 2PM8A 3UM9A 3PNMA 4GWKA 4ARIA 5KTKA 1DJNA 1M0WA 3CYFA 1DSSG 2QMEA 2VPTA 2VOEA 3IQEA 2WWYA 5JC1A 5JTUA 2CNDA 2PMKA 4C2BA 1RC0A 2QR5A 1QRUA 1SUDA 3EDQA 3EEQA 4AUKA 5JXHA 4KO2S 3WNZA 1SIOA 3A6HA 1KQ3A 3TK1A 3NP9A 4GC9A 2BBSA 5JQWA 5KPDA 2DKOA 3QFRA 1GU0A 2HK7A 1M2WA 3CLRC 3F5QA 1F8GA 1R9GA 4CI9A 5AFSA 5E9WA 1J09A 1FRZA 1P4GA 1R0XA 2V6JA 4L0QA 5DTMA 1K8XB 1O87A 1HSZA 3FLBA 3HV2A 3M6MD 1K8RA 5FR1A 3ZGLA 4JSTA 3C7AA 4OAPA 1OLXA 4D9KA 3LPLA 1VJDA 2HUPA 4H6WA 1C0IA 1U1FA 4BLWA 5C3UA 1OXVA 1T9GS 2PUVA 5CK4A 3K5PA 3WTBA 4EFLA 1FUKA 4CTOA 3HZZA 5FBRB 3TIGA 1NVVQ 2CLCX 3HUFA 3ZHCA 1SHLA 1E58A 4DJJA 2ACKA 2XUOA 1SUSA 3AR6A 2V8BA 1KRXA 3LVBA 4CF6A 2QD1A 1XALA 3C98A 1GZVA 1U8YA 2W2KB 4H7HA 4QPPA 4B6PA 1H9CA 2AVNA 3RWOA 3P0EA 1IRXA 3U81A 2NUBA 4ER5A 5HM8A 4BV2A 1HRDA 3CNQS 3P9XA 4E2WA 3IPXA 1P3JA 4AS1A 1VCMA 2OO7A 3LUPA 4OMCA 3UZUA 4RXTA 3FCOA 2VA9A 4TTJA 1ZOLA 1PLJA 4U2KA 1EIZA 3K0HA 3NHMA 1OI3A 3VI4B 4E2FA 3KXLA 5DLQC 5LC1A 1S8AA 2F9MA 1D2RA 2PDAA 3MTIA 4QLAA 4KFCA 2VT2A 1E3MA 1DQZA 2F2TA 4WEQA 4Q4AA 5F77A 5KJEA 4DNFA 2JC3A 4F9GA 1RJEA 2XNSA 4RLFA 3AVXA 2P9JA 2O2EA 5LBTA 3A9UA 4IEEA 5JNTA 4Q19A 4DUGA 2NVBA 4YCAA 5JSHA 1W30A 2FYTA 3Q4GA 4C6TB 4MCAA 4Z99A 1EBFA 2XHZA 1XB2A 3C16C 2BISA 1FQKA 3KYCB 3TFOA 4Z0NA 3OPYB 4EF6A 2QX9A 1PJQA 2C8JA 3U4MA 1I7PA 4MUBA 4GXNA 3GK3A 3GUZA 4N1AA 4JP2A 4A4DA 1O94C 2FSFA 2D5BA 2F1IA 3K0SA 1S8OA 4EATA 2AXPA 2ROQA 3FOWA 4TM7A 5CM2Z 1OJLA 1ES9A 4AJ9A 5GTDA 2Q8NA 3X2EA 5A5FA 2H1LA 1GQYA 1JPUA 1HT0A 2G80A 2L82A 1CLEA 2BKLA 4HDKA 4JLWA 3KR2A 1P8JA 3BWBA 1JE1A 1EE2A 1JQJC 4MYRA 4X1IA 4G09A 4Y7DA 5FT9A 3FWPA 2Q1XA 3KBBA 3OPMA 4OHUA 1NVDA 2R85A 2YOFA 1T5LA 3E3NA 3TR6A 3PEYA 3QA3E 1VRVA 1U1CA 2ZB2A 4C30A 4BNHA 4O4HB 2XJ9A 2ZTUA 3GGOA 4JYZA 1I1OA 2B20A 3NAZA 2CMHA 4V2IA 5LMZA 5JG7A 1U3GA 5FBLB 4NATA 3VNAA 3WGMA 4A0HA 3EQ8A 4FHEA 4CT5A 3ZCQA 5DASA 3GFTA 4LKRA 3ZD9A 4ZI2A 4PLPA 4ZHQA 3FUCA 3U09A 2G4CA 2Q3LA 4YYZA 4Y2UA 1I8TA 3GFFA 4FFRA 3UK2A 1JHUA 2A7QA 4GOJA 2DUWA 4A7PA 1FPMA 1LLFA 3BTOA 3HXKA 4DSNA 3D2CA 1CDZA 5LKRA 2YMPA 3OWHA 4UC0A 2HA3A 2VWHA 4Y6RA 2AXQA 1OU0A 2NVWA 2YJTD 3CBQA 2CXQA 2G5PA 4YIKA 3ZDCA 2X2EA 1MPXA 2RSLA 3LJKA 4JUIA 1KHHA 2JCSA 4PICA 5LZ4A 2Q2QA 4IVNA 2RKOA 2YWXA 4L3OA 2BGMA 4PPNA 1A8PA 1SZJG 2I1QA 3DYBA 1A5AB 5FBWB 5C7IO 5KYYB 1SBYA 4TTVA 3OE1A 4ND8B 1QHSA 4D81A 3PTLA 2DBRA 1YUBA 1FFHA 1N1MA 2ZSEA 2A8YA 3J80A 3NEAA 2G9NA 3Q3HA 3ZFPA 4F3CA 5JEDA 3NHFA 4JKYA 3GV0A 1F2UA 3FVRA 3PDIB 4YN3A 4BWGA 1OREA 1HX7A 1RPZA 4FDTA 3RC3A 4KQWA 1SC3A 5BN3A 1BW9B 2PGAA 4NS4A 1BHQ1 5ICEA 3DHNA 4EW6A 3KKPA 1TIKA 3U0VA 4JI0B 4FVTA 2I87A 2XMDA 4EFKA 4HX9A 3SKXA 4MDYA 3PPIA 3SFVA 2WINI 4MQEB 3MWYW 4UZEA 4R2XA 1L4HA 4AKEA 1SG6A 4GRAA 2KMLA 4S1OA 4KYIB 5JMOA 5AHKA 1DAEA 3EFHA 1WD7A 3FLMA 2NQ8A 2WU0A 5A0TA 1KSFX 3EIWA 3KVNA 4UTOA 3V4LA 2O5EA 2FN8A 3DVAA 2ZIGA 3FWNA 3KLBA 2C5EA 3Q6NA 4ARZB 2W37A 2AI1A 1PR5A 3OZXA 1CF2O 4YROA 3ZC3A 3L4KA 3VR5H 1IOVA 3DPSA 3SGLA 1B3RA 4DCGA 1JFRA 1JJFA 2V4MA 2HFKA 3DE0X 1T3TA 2I3ZA 1LF5A 3L18A 1R1DA 2PAFA 2QNBA 4CHTA 1E9DA 2P65A 4P80A 1W7AA 1MRSA 3VHXA 4LTDA 1JHRA 1D7OA 2Z0MA 3COZA 3ECAA 3NUQA 4PZZA 1XMVA 5J9FA 3PPVA 1T3SA 3OMWA 4IIJB 5BWNA 5J3JA 1FSPA 2PANA 1HL7A 4ZAWA 3OEEA 1PBTA 1RS0A 3DEKA 3G2IA 4X20A 4R2KA 4V0OA 1A71A 1Y42X 1VYTA 3KRTA 2R8BA 4ZOBA 2QG4A 3RKSA 3S4YA 3TLEA 1JEYB 4W5HA 1F51E 2H3EA 4LK3A 5A2QA 3I37X 3AL0C 1BWRA 5EEHA 3THYA 2YNMD 1AQYA 3UWSA 4P4LA 3N2YA 4CPDA 4EGJA 5K0TA 3VUFA 4G8DA 1JQEA 1P2DA 5DWVA 4ZCLA 3JVUA 4DQVA 1ZD9A 2P3QA 3SM3A 3DBVO 2ZBQA 1IHOA 3BE4A 1ECFA 1ZXBA 1K4YA 2OT3B 4XWTA 4K9PA 1KI2A 1R88A 2A9PA 2JS7A 2VG8A 3I72A 4U4AA 2A9VA 1GCIA 3PZBA 5EQTA 4JU8A 5DP1A 5JPDA 4JLPA 4H16A 4N0EA 3I39X 1UDXA 4DQ0A 1HUQA 5H16A 4LJ6A 4ZOLA 2ZRQA 4EITA 1E2BA 4IRXA 1PU2A 3GJ7A 1T2DA 2B9EA 5EP3A 5T6MA 2NWQA 4YPVA 1I10A 3USZA 2DSTA 2QTBA 4KUHA 5H1YA 1QP7A 1NJ6A 5IC6A 1Y80A 3EBOA 3G8DA 4Q21A 4FWTA 1HTWA 2FG5A 3WYBA 3CB4A 4CV0A 1T9HA 4IJMA 2JJYA 3DE2X 4H1TA 4LSMA 1DWUA 3KZXA 4BVAA 5DBGA 5LUBA 4YRNA 1UWKA 1II8B 5AUNB 4GT1A 3VR2A 4LNUA 4Y1EA 2JKZA 2V7UA 5B4VA 1SG0A 1DBQA 1W4CA 2C04A 4ZT5A 3FTFA 1PUJA 2D62A 1Y7PA 1XMSA 2C5GA 1Z38A 3H17A 4LWPA 2QZZA 1BS1A 2B5VA 3JD0A 1LPOA 5A4KA 3U48A 1RI4A 4QAQA 1CQXA 3PZRA 2P0YA 2XPCA 1VBFA 1SUBA 3QK7A 4CR6A 4LVOA 1W0JA 4BFWA 2BKVA 4ESEA 3D7KA 1WBJB 4RCVA 2HY7A 3B51X 1O8BA 3M4ZA 4GSLA 3DV0A 3JR3A 3ESCA 3IP1A 4ED9A 1KA9H 3CN7A 3EARA 5ECGC 1ADBA 2ODTX 4E2XA 2NPIA 2WTEA 2ZIUB 1J90A 1ZWKA 5E3IA 3O91A 4RD1A 5FLYA 3HGQA 1BW9A 4DW8A 4UUOA 1GITA 3QHAA 3SWWA 1BCRA 2OFXA 3SXPA 2CXNA 4GD3Q 3JY6A 3JZFA 1HLPA 3NT5A 3U61B 3JALB 4EOGA 4Q82A 2DZDA 2Q6VA 4TS9A 3QITA 3RS3A 1J97A 2JGLA 3OZSA 3ZHOA 3BILA 2OBYA 3FGPA 3D5EA 1V8ZA 4H4DA 1UXGA 5GJVC 1NV8A 2PKCA 1W52X 4HH3C 4BNUA 3RFVA 4H7FA 1Y8CA 4X3OA 4CMJA 1G55A 2G40A 2PGOA 3P20A 4RDHA 3UPUA 5ADUS 3TMAA 3FTEA 1Y5RA 1XCPA 3IV6A 2ACEA 3C8DA 4RA6A 5AOAA 3MMPA 3D6UA 3K0FA 4WKCA 1VE1A 4ZANA 4ARUA 2LPMA 3CRQA 1JXOA 1FQOA 2JFFA 3DBHB 2ZCVA 3T7RA 3SLKA 4G5RA 3FNHA 5JADA 1F3OA 5AIBA 1BS9A 1EP3B 4ZJZA 4P7JA 3WL5A 3EEOA 2QRPA 2R7KA 1JNYA 5DSXA 4XYGA 2HRBA 3PNKA 4LDRA 1X1CA 2AX3A 4W7IA 1DAGA 1YA6A 1K2VN 4ZHQB 5JJIA 3MVEA 1XRRA 2ZIXB 1XVIA 1JGTA 2EC5A 4BGVA 3TJZA 1E5QA 4G0UA 5F7JA 3LK7A 1MOPA 2BGUA 1RJ9A 1LQ2A 1Z4QA 2FJPA 4LZWA 5IWAB 5DNYB 2BFCA 3KC2A 3QKRA 4P3KA 5M2QA 2PTHA 2AYXA 2PLNA 3ZE0B 3EDCA 1LPSA 2C4MA 2ZULA 2ZXUA 1G41A 1SOWA 5ALJA 1I51A 3HBJA 3O31A 3PUHA 4J0GA 2FEWB 4QHYA 4MI3A 5D3MA 4JKOA 1AUOA 2B4RO 1MGOA 3GG2A 1K8YB 4RKYA 4Z1MD 4ARAA 2WM9B 4JY7A 3ETEA 4C9BA 2C5LA 2I4LA 3EGVA 4RULA 3NJ8A 1YO6A 3IILA 4YRZA 4R5HA 3Q11A 3LBHA 4PLYA 4ZEWA 1P6UA 3UHPA 5LDGA 2Q4TA 3NO4A 3LQ2A 5KU1A 2EW8A 1OYWA 4XRGA 3OU7A 5DXJA 2AMYA 1BJRE 1UWLA 2PWPA 3TCXB 1PFQA 1I94B 1ZMBA 1NVBA 3QTLA 1O9HA 2J5KA 4FCTA 1U2ZA 3E9ZA 5AJXA 4XVCA 1WETA 2O0KA 3TAUA 3CGWA 3NIDB 1EWTA 1MIHA 3W8NA 1CU1A 2DFNA 3WGLA 1BDMA 1J8VA 1ZBQA 2ES4A 3NIFB 2GEUA 3TD6A 5BSEA 1H4SA 4IQGA 2GLUA 4CTMA 1YR1A 4GKVA 4UDXX 3AYZB 4CEJA 2QIOA 1XCBA 1EEHA 3BWYA 3P9SA 5DB4A 5I7SA 1E59A 5DGCA 1RE1A 4GLBA 1QORA 1XKTA 1KBZA 3RRBA 1LKZA 4ER7A 2DUJA 1QNLA 3LXRA 3TO5A 3FZGA 4OV6B 4YRSA 5LVAA 4ZU6X 3HKBB 4BVBA 1BFDA 1UBNA 5LMCA 1ID8A 2XUPA 1KO4A 4TUYA 3TIXB 2DCUA 4M2LA 3ZTTA 1Z7WA 1ZIXA 2W8BB 2YHSA 4MUNA 4X7RA 5E7JA 3ZCVA 2DC1A 2JFZA 2DHRA 3IQXA 3MOSA 5HDQA 1NMXA 3C74A 4CVNA 4P92A 4NKRA 3H5LA 2JIQA 3AETB 5MGBA 4YUWA 2ZETA 2BY4A 4E5YA 3GLIB 4IH4A 3LRTA 2A5LA 1ZONA 3RUEA 5GJWC 1KDOA 5LWQA 5A4AA 3FUWA 5F51A 2WB2A 3DV0B 3HB5X 2ZFUA 4OB7A 1JR3D 1QC5B 1NUQA 2B4QA 3NC0C 4HV4A 2DPYA 3PNQA 1J2UA 2IH2A 2GAOA 1QDLB 3WIVA 3HVJA 1W73A 2ORWA 2QL7A 1QO9A 2X0KA 2Z43A 4FOOA 3B82A 4XWYA 2C5SA 4XSVA 2GJAA 4L3WA 1X1QA 1QDEA 1SCKA 1USUA 2OHOA 2GM4A 3UJNA 2R4QA 3V4OA 2V65A 1KXZA 2IKQA 2UYOA 2IYXA 4PRKA 2FEMA 3DM9B 2PMWB 2WYUA 3AFMA 1E62A 3JRWA 3DJFA 1EG2A 4F5ZA 1NW7A 1M5RA 1UPAA 2Q3MA 3MEQA 2NUTA 4MB2A 2PL1A 3BX1A 3MTGA 1ZIYA 3RW9A 2OECA 4TT3D 3GRVA 3UQZA 5CGZA 4ZDJA 4R8MA 2K5UA 2VZEA 1E0JA 1F1JA 3E5RA 3OE7A 4NX2A 5JEEA 4KR9A 3QV2A 4NBLA 2XQIA 4GP9A 3D8UA 4X6XA 5AKXA 2FG7C 1LEHA 2GN9A 1ZGAA 2QD2A 2W6MA 5ENVA 1MO5A 5I9IA 5DI3B 1QPGA 1I4TD 2IYRA 1OC4A 3MJSA 3V8PA 2O2XA 3EZ9A 3VVBA 3LDAA 2FPOA 2DBZA 4LXIA 2VT6A 3QMWA 4GH5A 2PA3A 1KI9A 2Z9CA 1JFLA 2I2WA 3AB3A 5DK4A 1DAMA 5J5CA 3G2LA 2RIRA 3BSYA 3IDOA 1BU5A 4ZQIA 2QMYA 1Y5LA 3LQ1A 4XUGB 3LCMA 4E5PA 4BQRA 3E7WA 4KN9S 1XWIA 1CSEE 4F6CA 2QGNA 3MWDA 5GWXA 5K3FA 2O3SA 1BMQA 1D07A 3EVGA 1F9EA 2VVTA 3VNRA 3LV8A 3UCXA 2PXHA 1ZISA 2A5JA 2NT3A 2WHPA 4H3VA 3TBHA 2EBHX 4AMBA 5JWOA 3R7WA 3KEGA 1ZXXA 4GL4A 2Q5EA 2YIDA 1PUIA 1HM5A 4JOBA 5JCOA 1ZW6A 2YV5A 2WAYA 5FAXA 4FE3A 1SZPA 3JV7A 3RLIA 3GEDA 5D3MB 2VPWA 5EXEA 4CL8A 5CDFE 2O3RA 2O7NA 3OHSX 1HNXB 3B20A 4HDAA 3DEAA 3PLAE 3PPXA 1V5IA 2J0VA 2X3YA 3DONA 1Y7IA 4O2LA 5DTRA 1BDJA 1PGNA 1REQB 4QPDA 2RAFA 4C0JA 3I0MA 2H17A 1IJBA 4LK2A 1GZHB 2ZB3A 2JLYA 1CR1A 3V7FA 2P0EA 3VSDA 3N6RA 3UJHA 5EIEA 1N4AA 1CIVA 1Z37A 2XTMA 5G0WA 4KNWA 1B8VA 5JLAA 1I33A 2AR7A 1GWNA 1KQOA 3T3NA 3MCTA 3KPWA 1YVEI 3UXHA 4I19A 3SJUA 5IKOA 3KQKA 4URHA 1Z4LA 1VI6A 2B36A 1F38A 2P4HX 1ONPA 2AJTA 2PQ0A 3DVLA 2XUFA 3JYOA 4IHQA 4LXTA 5A7GA 1DZIA 4KAAA 3DE1X 4MDHA 3UA4A 5IEJA 2VDWA 5IAOA 3WLRA 1RYFA 3EUWA 2CXRA 1A9XA 4EEKA 3EVNA 2PL5A 2YHBA 1CDOA 2CNWD 1Q44A 2A0KA 2BFBB 2EFEB 1JDTA 4G0NA 5ARCA 2OAP1 5KQMA 4X66B 2FXIA 4ALMA 3LXXA 3UPDA 4ITRC 1DC6A 1T1IA 1W0KD 2BGJA 3AF4A 3NTLA 1X87A 2WQZA 4HDCA 4ZCMA 4WECA 4Z5XA 1OBVA 4YMHA 3DXFA 3A4VA 2CVHA 1SB9A 2J46A 3UH1A 3X3HA 4ZGBA 1UWVA 1BU8A 1K3UB 1N9GB 2MYPA 2BVNA 2BGGA 1DV2A 3O2SB 2OZEA 1R5NA 4EHDA 4WXMA 3GCDA 1ONOA 2I76A 2C2ZA 1E6WA 1MQAA 2NX2A 2M6KA 1H6BA 1MC1A 2JJ1A 1Q0UA 2NUAA 3PENA 4V1CA 3O8RA 1ZJZA 2QVGA 2QAIA 3HGTA 1DDIA 2KI5A 3LT4A 4CFYA<