1MJFA

Putative spermidine synthetase from pyrococcus furiosus pfu-132382
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
271
Chain Sequence
b'AFIEWYPRGYGVAFKIKKKIYEKLSKYQKIEVYETEGFGRLLALDGTVQLVTLGERSYHEPLVHPAMLAHPKPKRVLVIGGGDGGTVREVLQHDVDEVIMVEIDEDVIMVSKDLIKIDNGLLEAMLNGKHEKAKLTIGDGFEFIKNNRGFDVIIADSTDPVLFSEEFYRYVYDALNNPGIYVTQAGSVYLFTDELISAYKEMKKVFDRVYYYSFPVIGYASPWAFLVGVKGDIDFTKIDRERAKKLQLEYYDPLMHETLFQMPKYIRETLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords spermidine synthase
publication title PUTATIVE SPERMIDINE SYNTHETASE FROM PYROCOCCUS FURIOSUS PFU-132382
rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
total genus 83
structure length 271
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.5.1.104: N(1)-aminopropylagmatine synthase.
pdb deposition date 2002-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 1mjfA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1mjfA02
3C3YA 5EGSA 3KQVA 5EEGA 2ZVJA 2FCAA 1KPHA 3A4TA 1FP1D 2JH9A 5HIMA 3HVHA 5T64A 3SGLA 4RTNA 2PX2A 1BHJA 2NYUA 5DM2A 3P8ZA 3HP7A 4F86A 2I6GA 1OR8A 3LPMA 2JJQA 1RI5A 3FTFA 1INLA 5EIFA 3CCFA 2O05A 2QY6A 1WG8A 3AXTA 5EIWA 5GOZA 4RTOA 3E7PA 4XUDA 5E1OA 5EG5A 2XVAA 1RJGA 3LDFA 3KR0A 1L3BA 2CL5A 3B7PA 1P91A 2AZTA 4DM3A 1XDZA 1EJ0A 2ONYA 5D1NA 4RTSA 3G8BA 5T67A 2JHPA 4GOLD 5FHQA 5IH3A 1YUBA 1QANA 2OKCA 2P41A 3TFWA 3D2LA 3ELDA 5F2OA 1U2ZA 1VIDA 4Y2HA 3LCVB 3KHKA 1KYWA 5P8WA 3T7TA 3E23A 4RTMA 1WZNA 3IHTA 2UZ4A 2ZBRA 3UJCA 4PYOA 2VDWA 2B3TA 2O07A 3OFJA 4CXMA 3LCCA 3M4XA 3H2BA 1AV6A 4PCAA 4EKIA 1XDUA 2ADMA 3HCAA 5EEHA 3NJRA 4PGGA 2VZ9A 3UA4A 1D2HA 4RWZA 1JSXA 3UWPA 3CJQA 5KS2A 5C1IA 2ZIEA 5BW4A 4V0QA 3A26A 4Y30A 2AOUB 3DLIA 5IKMA 2H1RA 9MHTA 5C0OE 4XCXA 1RJEA 4E32A 5K0CA 4PGHA 2B25A 3M6VA 4RTPA 4RVHA 1DUSA 5DT2A 4MIKA 3E8SA 3EGVA 2BR3A 3UJ8A 2IDJA 3LL7A 4HGYA 3OPNA 3FTDA 3HCBA 1JQEA 3DTNA 3SX0A 3EVCA 4AZVA 3KPUA 5GM1A 4CTKA 3ORHA 5KVAA 3DMGA 3OFKA 2P8JA 1VP3A 2BZGA 4QPPA 5HIJA 2V74B 5FTWA 2UYOA 4ER5A 3MB5A 1L3CA 5K8VA 1L3IA 5K0BA 2CKDA 1SKMA 3I53A 3ERCA 5EMJA 4PONA 2KW5A 2XYQA 1NW6A 3EVZA 4UOEA 1NW3A 1FBNA 3GNLA 3GRVA 4M37A 3U81A 3UZUA 4AX8A 1N7JA 3EVDA 3A7EA 5ICEA 3EGEA 4PYLA 3VSEA 5CCBA 1N2XA 1SVUA 1ZGAA 5FA8A 3TQSA 4YV2A 2ONZA 3GIWA 4OBXA 4GC5A 2G71A 1O9HA 2PY6A 4U7TB 2O0LA 1EAMA 3HNRA 3MTEA 4PCLA 4RTRA 5EC8A 3G5LA 1NBIA 3GWZA 4AUKA 5DRTA 5CVJA 1Z3CA 2ERCA 1XCJA 3LHDA 1ORHA 3AXSA 5DWQA 4YV0A 5CVVA 1YZ3A 3TMAA 5FWAA 1RI4A 3BWYA 3FPHA 3BGDA 4NECA 3PVCA 5ICCA 3DOUA 3MGGA 2YXEA 3HA3A 3FTEA 4R8RA 4RX1A 1VBFA 2H11A 4CKEA 4B17A 4MWZA 5FCDA 5FULA 4HSGA 1UIRA 2NXNA 3VC1A 5HOQA 2HNKA 1L1EA 4YUYA 3GCZA 1ZG3A 4QPNA 1O9GA 2PX8A 5T6BA 2BH2A 5K01A 3P9IA 4DCGA 2NP6A 2AVDA 1VPTA 3ID6C 5DLYA 2ZIGA 1RJDA 3KR2A 2OYRA 3LECA 3CJRA 2PWPA 1V39A 4P7KA 5U4XA 4YUWA 3B89A 3KPVA 5E9JA 2G8NA 5EKXA 3LDUA 2P7IA 3Q7EA 2YXLA 4OBWA 3CGGA 2P3QA 5H02A 4Z2YA 2BR4A 1L9KA 1YFLA 3HEMA 2FPOA 3TR6A 4PWYA 1PRYA 3G8AA 2Z6UA 3IYLW 3BGVA 3LDGA 2B78A 3GO4A 5K0JA 4OX9Y 3A25A 3HA7A 2ESRA 1NV9A 3HVKA 4HTFB 3UJAA 2ZZMA 5DX8A 1MJFA 2PX5A 4MHTA 3CJTA 2AN3A 3L8DA 3KQTA 3OU2A 3GU3A 2FRXA 3SSNA 2YR0A 3EVEA 1NV8A 5EMLA 4PIMA 4OA8A 5E8JA 1YB2A 1DL5A 3HCCA 5GWXA 2IP2A 3P71T 2PT9A 5LQAA 1JQDA 3BZBA 2QRVB 3P2IA 4P58A 1WXXA 4QVGA 5EQJB 3TPZA 1XTPA 1EG2A 3CVOA 1JG4A 4GQBA 1JQ3A 1SQFA 3FYCA 4QDKA 2XYRA 3FUUA 2HMYB 5EZQA 1KYZA 1EIZA 2H00A 3UJ7A 4PINA 3G2MA 4A6EA 2HTEA 4FGZA 5FQNA 3A27A 4E33A 1G8AA 1R6AA 3PX3A 4DMGA 4BLUA 3FPGA 1T43A 5HEKA 3O4FA 3PLAE 1KPGA 3EVBA 3GRUA 3FZGA 2I9KA 1WY7A 3SSMA 3HTXA 3HCFA 1B42A 5HILA 4MQ4A 4BP1A 3OE4A 5MHTA 5GP1A 5CVDA 5DTQA 5DRYA 5CD1A 2AVNA 3LKZA 4CWAA 3M70A 4FZVA 2NP7A 3ANXA 3T7SA 3M6WA 2ZLBA 3PS9A 4R6WA 2XBMA 3RW9A 1MHTA 1X1CA 2Z6AA 1R18A 1ZKDA 3KQPA 5LQUA 4C08A 2XYVA 2DPMA 1QAQA 4OA5A 2B9EA 5B1SA 3V8VA 5F2NA 3PFHA 5CCXA 2N47A 1X19A 2OPBA 4KDRA 4RTKA 3G7UA 1QZZA 5K03A 3HCDA 2E5WA 4FSDA 3GJYA 3BWMA 1BKYA 2WA1A 5E2AA 2PKWA 3FUVA 3Q87B 5DM1A 4EQZA 2VDVE 3ELUA 5F2KA 3MCTA 3MCZA 5LQJA 1Q0TA 2WK1A 5FWDA 2CMHA 3MAGA 5E8RA 5LQKA 4FT2A 3EMDA 2ZSUA 4DZRA 3GRZA 3AY0A 2FHPA 2AOUA 4FSXA 4R8SA 5E9WA 1I9GA 4C04A 5BW5A 1IY9A 2BM8A 1IM8A 2GS9A 3I64A 1XVAA 2P7HA 1N7IA 1KPIA 2HR1A 1JR4A 2ZULA 3VC2A 3ELYA 2WA2A 4MTLA 4PYNA 4QTTB 3GDHA 5K05A 4YMHA 10MHA 2IH4A 4HRAA 3LKDA 3DP7A 1O54A 1X1AA 3I9FA 3M6UA 4P7FA 1X1BA 1NBHA 2ZBPA 4P7JA 4AZTA 3BWBA 5FHRA 3G5TA 4IKPA 2OXTA 3TRKA 3B3FA 3E05A 4KW7A 3THRA 1QAMA 5G02A 4YUXA 4E2YA 5HIKA 1DCTA 4QQNA 3C6KA 4GOOD 2NXJA 2NXCA 4XUCA 1VE3A 1XDSA 1R00A 3KQYA 2LD4A 3FYDA 3NW9A 1ZQ9A 3AJDA 5CM2Z 3BKWA 3NDJA 5LQRA 1SUIA 4POOA 5EHGA 5D1HA 1NW5A 5CIYA 4YV1A 5DXAA 5DM0A 3TM5A 1YF3A 1I1NA 4KIGA 1D2GA 4LWPA 2B2CA 2YUIA 4QQKA 2ZZNA 4DCMA 3EGIA 3MHTA 1KR5A 3FTCA 3C0KA 3G88A 3OZRA 3TOSA 1XCLA 5LQNA 1P39A 4O29A 4OQDA 3REOA 3LBFA 1RJFA 2UYQA 4EKGA 3KPJA 1ORIA 2ZW9A 1AQJA 3P2KA 3LSTA 5KYGA 1BC5A 4A6DA 4HG2A 3BXOA 2P35A 5LR6A 5FUBA 1NT2A 4HGZA 5JUWA 1JSZA 2AOTB 1WS6A 1Y8CA 3FRHA 3NWBA 2PVCA 3SMQA 4CTJA 1G55A 3O7WA 1WXWA 3B3GA 2IPXA 5FADA 4E2ZA 5LQCA 5EPEA 1G8SA 4E2XA 5K0NA 1VLMA 3LX6A 1TW3A 4FP9A 3EVAA 3S68A 3R3HA 1ZGJA 3TKAA 3CBGA 2UYHA 3DLCA 5EKUA 4PYQA 4KWCA 3TM4A 1AQIA 2OZVA 5HFJA 5DSTA 1RI3A 3KQSA 2GLUA 5DSXA 1SQGA 4K6MA 5DX1A 3THSA 4CKCA 4R05A 4PYKA 1M6EX 5CVEA 3BKXA 1VL5A 1TPYA 3FUWA 4DKJA 3KR9A 2PBFA 2VDUE 2ZCJA 1RI1A 3GRYA 2JG3A 3G2QA 2G1PA 3KQWA 3FRIA 2NXEA 3OZTA 3NWEA 3DUWA 5GIPE 5CVUA 5GINE 3F4KA 1UWVA 5C9ZA 2PXCA 1M6YA 2FK7A 2JHAA 1XJ5A 4ZTBA 2GB4A 3R0QA 2IBTA 3KQMA 2PGXA 1HMYA 3K6RA 3JWIA 1JG3A 3DXZA 3KU1A 3M6XA 4HTFA 5ICFA 4C07A 4DQ0A 3R24A 2PLWA 3CC8A 3KPWA 4CKBA 3T0IA 1TW2A 1YFJA 2EJUA 3UFBA 4DA4A 2EG5A 2G70A 4GOMD 4M38A 3EVGA 2FK8A 4RVGA 5DM4A 2AR0A 3FUTA 3GRRA 1JTFA 2IH5A 1UFKA 2QRVA 2HWKA 3CKKA 2XVMA 4C05A 5EOVA 1H1DA 4LG1A 3EEYA 4E31A 5DX0A 4RVFA 5DPMA 5JR3A 3PX2A 2YTZA 3FPJA 4IWNA 2R3SA 4JXJA 3A7DA 3AWIA 3EVFA 4KDCA 2ORED 4C4AA 1BOOA 4PIPA 2P3LA 5E1BA 4WVLA 3UJBA 1SG9A 1R74A 1NKVA 3KQQA 3BUSA 3V97A 5BXYA 2OO3A 3SXJA 2C7OA 2OB1A 5M5BA 1YZHA 3P97A 2GPYA 2DULA 4KVZA 2VP3A 1JG1A 4V0RA 5DXJA 4E30A 5DTRA 3UBTA 1F38A 3NMUF 3C3PA 5KQSA 3LCUA 2YXDA 4FT4A 2C7QA 3ER8A 3EMBA 2P3OA 5LSAA 4HC4A 2EJTA 2NNWB 3GXOA 4ER6A 3UJ6A 2I7CA 1FJXA 2ZBQA 1KXZA 3PT9A 4X63A 5EMMA 4RTLA 4FS8A 5K09A 3OCJA 5EVJA 1NE2A 3K0BA 3KQOA 1NW8A 3FPEA 4GBED 2YQZA 2EFJA 2EX4A 4C06A 3JWHA 2QM3A 3EPPA 1G60A 3PFGA 4HH4A 3P9KA 4GUAA 4PYIA 5GM2A 1SUSA 5E1DA 5HIIA 3UA3A 4KRGA 5HZMA 3PTAA 2BM9A 3DXXA 5EZSA 3JWJA 4EMSA 4ER3A 5KQRA 3EEOA 2JHCA 3G89A 4X61A 4BY9E 3JWGA 3NTVA 3OU6A 2ZZKA 3P9NA 3NVKI 2OY0A 3BT7A 1G38A 1QYRA 2ZWAA 3ME5A 3P9CA 3HVJA 3DH0A 3MTIA 4WXHA 2PV0A 3NDIA 1NW7A 3FPFA 3BGIA 3OZSA 4IV0A 4P7GA 5E1MA 3DULA 3OE5A 3KR1A 1EJ6A 3DR5A 2F8LA 4XUEA 2O06A 4F85A 2GA9A 2QYOA 4RYLA 2AN5A 3UJDA 3SR4A 4X60A 4QDJA 4RVDA 4U7PB 2PWYA 3UJ9A 4GOND 1KP9A 1PJZA 5K0GA 3HVIA 4RTQA 3BWCA 2BR5A 1P1CA 2CWWA 5E9QA 2PXXA 3M33A 3LBYA 4X1OA 2Y1WA 4RSRA 1D2CA 4M36A 2VS1A 2AS0A 3RODA 2HV9A 2OB2A 3HM2A 3IV6A 3TLJA 4EVIA 2P40A 2I62A 2Y1XA 3HCEA 4BP3A 3DMFA 2JH8A 2IFTA 2IGTA 1AF7A 4PYMA 4L7VA 4LWOA 5GIOE 4X41A 2QE6A 1EQAA 3TKYA 4ATNA 3ER9A 8MHTA 4QTUB 2AOWA 2PXAA 3PB3A 4IV8A 2PX4A 5CUQA 2Q41A 4G56A 4GC9A 1M0EA 1P1BA 4FR0A 5K0LA 3SSOA 2ZWVA 3KKZA 4C03A 1HNNA 1FPQA 3KPYA 3G2PA 4YUVA 2IBSA 2PSSA 4ISCA 3B3JA 1VQ1A 3GGDA 3QOXA 4KIFA 3FUXA 1VP9A 4YUZA 4DF3A 2C7PA 1ZHFA 3B5IA 1IXKA 3R6TA 5E2BA 1F3LA 2AOVA 4E70A 4LECA 5FA5A 5K0EA 2ZTHA 2YX1A 1R8XA 4BLVA 7MHTA 5ERGB 3ELWA 3R9XB 4AZSA 5BP7A 2PT6A 3HA5A 4AZWA 3DMHA 2GAFA 3G2OA 3NVMB 5FQOA 2K4MA 2GH1A 3T7RA 2AOTA 5DTMA 3OU7A 2CMGA 3IEIA 2C7RA 3QV2A 3O31A 3QOWA 4R6XA 4EK9A 2UYCA 3X0DA 2AN4A 3VYWA 2A14A 2IH2A 4PYJA 4E2WA 4YMGA 3MQ2A 1X1DA 1I4WA 1KHHA 1FP2A 2O57A 2YVLA 3SVZA 3I58A 2P1DA 3SM3A 5ICGA 4OQEA 4F84A 4RTJA 2FYTA 1QAOA 1R8YA 4GEKA 4QVKA 4GF5A 4PNEA 3C6MA 1KIAA 2PJDA 2V7EA 2R6ZA 3DXYA 3LGAA 3MERA 2IIPA 4RV9A 1JTEA 4BLWA 4ER7A 1Q0SA 2AOXA 4M7RA 2ZIFA 2G72A 3P2EA 1JG2A 1G6Q1 3RIEA 1XXLA 2ZFUA 4H0NA 5EHIA 2IDKA 2OBFA 5EMKA 3I5UA 4ER0A 2Z6QA 1RI2A 3WSTA 5K0FA
chains in the Genus database with same CATH superfamily
2B4YA 3RS4A 5EGSA 2J87A 1Y9EA 4H1HA 5B58T 3GFVA 2CXSA 4FMDB 4LBZA 5T64A 5JTUA 1T2CA 1V8PA 3OTGA 4B3DA 4JU9A 4BFSA 4MAFA 3FR8A 4DA8A 1M2GA 1NLYA 4WFKA 2NU8A 2OL4A 5FH9A 2E55A 4BQFA 5LMUB 4BPBA 4IR7A 4LXXA 1LSSA 1OFGA 2NX2A 1SVWA 4EG1A 3O2QB 4KK3A 3E18A 3GDFA 3UAZA 5IU6A 2DHEA 1MT3A 1C3JA 2W4MA 1OFIA 3SYTA 2BKVA 2GBLA 4OJNA 1A1SA 1C30A 3WDMA 5A3JA 5H8WA 1RM0A 4ZYWA 5A7FA 3NWOA 1M8KA 1QG4A 4FW8A 1U2QA 2JGLA 3U3ZA 1KVSA 3ZCSA 5LLTA 3DE4X 5JJKA 1EDBA 3ZZ1A 2QSJA 1XKLA 2CLEB 5GV7A 3K1AA 1ECCA 3CW9A 4BQPA 3DV0A 2K2WA 3DOOA 1D09A 3IT1A 5BSKA 4H18A 3VSCA 4XWWA 4L0QA 3V80A 1QO0A 3IHTA 1JKJA 4QO7A 4A6PA 4EEXA 1ATZA 1G8GA 1L7VC 1LPAB 1TM1E 2HAEA 2X1LA 2ZAYA 3KEOA 3AJ8A 4TUYB 1AV7A 4C4YA 1AV6A 2O3UA 2RGXA 5ADVA 2H3HA 2ADMA 4OK5A 2M2IA 3FHLA 1LPSA 2XCUA 4TXHA 4AJ1A 4D81A 3NJRA 4ECEA 1ZH6A 4JEHA 2C98A 1TJPB 1Z5ZA 4MIYA 2XA2A 4G1UC 3UTDA 1TT5A 5DGIA 3DZKA 2DBZA 5CGQB 2IYQA 2X41A 2YFKA 1BXRA 1SHZA 1TJ5A 1OX4A 2W8BB 4PNHA 3AM5A 5A9TA 4AM8A 4CMIB 1NAHA 5F7JA 2R1TB 4MYSA 2QYTA 3TJRA 4DLVA 3AR5A 3DPSA 3VJLA 1II0A 2EKZA 2OCXA 2I2CA 1OVMA 4V38A 1ATIA 1I01A 1N2CB 2BI7A 3WGNA 4BE4A 3IEKA 3HCBA 4G41A 3LT4A 5LC1A 4JLSA 2C2HA 4ERXA 1SK8A 4FUTA 2Z5GA 4ARVA 3WBBA 3D4BA 4GWKA 4KQ6A 4RNDB 3TSYA 4JASB 4NEGA 1TTTA 1RZRD 3QVVA 1O87A 3RQSA 4IH1A 1E1YA 2A4KA 5A1JA 3ENQA 4J0KA 4JBHA 2I6FA 2XZLA 2XECA 4Q7KA 2YHSA 1TVEA 2CXHA 3Q1KA 1GPMA 1NKTA 3FIUA 4F97A 1GFSA 2R7MA 2BGRA 3A1VA 2CKMA 5E7IA 2QNIA 4B8WA 3EGEA 1NMZA 4ZAYA 1DT5A 4H16A 3FRJA 4L9AA 2E48A 5K99A 1Y1RA 4J1SA 1FYVA 3CPSA 1KTIA 3R8FA 3TQSA 3ZU5A 1UK6A 4J1TC 4CMCA 1G2QA 3C3JA 4HTAA 3RV3A 4XRGA 1H8EA 2G71A 1ST2A 3FVRA 4AICA 1XTTA 4LJYA 3C85A 4Z4IA 3NDBB 4EI2A 2NNLD 5FLYA 1KJIA 3FZEA 4O8ZA 2JBWA 3DZIA 3WLJA 1FRQA 1H2AS 1B16A 2G83A 2QLLA 3AXSA 3R7NA 1DRUA 5BNZA 1X7YA 3X1ZA 1R0SA 1CIVA 1GG8A 3PRHA 3VPBA 1Y80A 3D2CA 3OP1A 1G1MA 4LXQA 4YGYA 3ADDA 2FR1A 3JZDA 1J99A 2QVZX 3L7JA 4RX1A 5CT8A 4CM5A 2CF5A 4CGZA 3SEZA 2PFKA 3TE6A 4ZALA 4QYMA 4JITA 4QPNA 3W6ZA 4N6OA 1VIAA 4MKIA 4Z3OA 1KETA 2QTBA 3UK1A 1SA0B 3WFZA 4ZDIA 1USUA 2FSHA 2AVDA 4PLTA 2J5BA 5B3KA 3G8DA 4F3NA 1T1GA 3EBLA 4MWOA 3PXCX 2A67A 1SXJE 4EBFA 2I6TA 5LMCA 3F5SA 1I5RA 2YIDA 5IRCD 4OBWA 4WOPA 2AG6A 5AICA 4WZBA 4ZJZA 3WLLA 1BN7A 2AZ4A 3ISVA 4Y1GA 4ILEA 1SUDA 4X90A 2FPOA 1ZGCA 2L42A 1YHNA 4M0MA 1S96A 1YONA 4S1TA 2VUIB 3N86A 3RTEA 4LV6A 4M7PA 3LDGA 3FZNA 3NFRA 1QRTA 2LIPA 2R48A 1MIOA 1N7HA 1SKUA 3ANYB 4Q3BA 4ZPJA 2OYCA 3FOCA 1KAHA 3UJAA 5DX8A 1MJFA 4DSAA 3SZRA 2IS6A 2PX5A 5EKTA 2AEEA 1Y7TA 4PX5A 4FMDF 2EQ5A 4CEIB 3GJTA 3HUMA 1CT9A 1U0LA 2AN3A 2CFOA 3PTLA 4PAQA 3VOBA 2NGRA 4AS2A 5EZYF 5IJ0A 1RRGA 3NANA 4P1ZA 4OAPA 4YTEA 4XYMA 1DL5A 4ML3A 1IL0A 5LQAA 1W36B 3FF1A 3QPCA 2J9XB 3PNVA 1TJYA 2Z57A 3Q5DA 3LY9A 1L4HA 2P6RA 1PU2A 3DHNA 1EG2A 1XRSB 1K6EA 1MNAA 2B8WA 4D46A 2BEJA 3ETCA 4GMHA 3FUUA 1M5RA 5CAEB 5EZQA 2XZPA 3OQVA 3A6JA 3CRMA 2ZPUA 3VNRA 5A5FA 1PS9A 4Y2UA 4CM9A 1QBGA 2WRZA 3I4FA 3EXG2 5GTDA 3A27A 1AB5A 4KUEA 4LOLA 3FGNA 4YEDA 3UGTA 5EY5B 3FPGA 3PEEA 4PZLA 4DDKA 3C5VA 2YFYA 3UFXA 4HVAA 4EATA 2BGIA 3INRA 2QQEA 3QLUC 2Q2QA 1LFDB 4HUQB 4M9CA 3K20A 4BFVA 5KX5A 1A9ZA 4YT8A 1PR4A 2WUVA 5DBOA 1MTOA 1OPRA 3FCCA 3DCNA 2BCJQ 4XWOA 1GQFA 1LQ2A 2PT5A 4TQUS 2C1ZA 3TL6A 2W5UA 3C14C 2YWXA 3A6DA 1PEKE 2CDAA 2BF7A 5AIBA 2VQSA 3T7KA 1Q3KA 2G1JA 4N3AA 2H4WA 3QVTA 5P21A 2O0JA 5I9NA 5CCXA 1G7SA 2VG8A 4BX2A 5AK5A 4DT1B 4KZPA 5JH7B 1H5UA 1USGA 4KRYA 2XQIA 4BVGA 4F6RB 5K03A 3LYLA 3W05A 2GKOA 3FUVA 3IE2A 4FINA 4CG2A 2DXIA 3CY6A 5DGTA 3DB1A 5I3CA 2BM0A 3KTOA 3N2LA 5KAPA 3IP7A 5A7GA 1PR0A 1TZBA 4H7DA 5AK6A 1BD3A 3RS9A 2AOUA 4DCTA 3BL5A 4GRDA 4J7AA 2O8FB 1F3OA 2XCOA 4FCCA 1YB1A 4RKFA 3PQ6A 4X54A 1ZMXA 4PRLA 4V0KA 1JR4A 1SPBS 3UENA 1R4MA 1WHSB 2XUFA 1L4YA 5LZ5A 2EJBA 2FN7A 1YKFA 1P9WA 1NXTA 2JI8A 3AVOA 3I9FA 3LKDA 4FOOA 4M9UA 1FNBA 5J4LA 4G1FA 3QVLA 1L5FA 1PZNA 3S2UA 3W5IA 3AB7A 3RYIB 2O3RA 3MVEA 1BVHA 1AGNA 2A9RA 2ZJ7A 2F3RA 4HPXB 5FWYB 1SOMA 1J4AA 1RHQA 1Z26A 4GOOD 4NPHA 2NXJA 3JY6A 5KWSA 4MYUA 3QFHA 3P0EA 2ORIA 3A1FA 1YVPA 1U2DC 2CLOB 5C3MA 4QYIB 1Y8ZA 1Q0UA 3ZE7A 3RYCB 2RI6A 2Y0PA 2Y1OA 4BTVA 5IAGA 3Q3GE 2UUOA 2V5UA 3AUSA 4RPHA 4TXNA 5GAJA 2QLJA 2JAOA 3B5EA 3F6SA 4DIOA 4W63A 1E2PA 1P1RA 4V3CA 4HNUA 3HGQA 1GSHA 3K0SA 1RTTA 4BYGA 5BWOA 3T8YA 3C0KA 3BRCA 2L18A 4ZMBA 4ZMRA 4OQDA 5K3BA 3E53A 1TYBE 2HCBA 1Y42X 1RXYA 3C4QA 4HS9A 2D59A 1PGQA 1YV9A 4YPVA 1MO5A 1NMYA 1XEXB 2FZWA 1HT0A 5CX1B 4K7JA 3R7WA 3A9RA 2FUEA 3FE2A 4ZOLA 1W44A 4I0WB 4F21A 3JWPA 1T2EA 5KOHA 3WNQA 2ANCA 3AEUB 1MB2A 4IGFA 1VTKA 1MG0A 1DINA 4B84A 1IUNA 4DDVA 4TS9A 4AG3A 3DWIA 3DE0X 4Q9AA 3D5QA 3T4PA 5L3QB 3H1FA 1G59A 2J41A 3VOAA 3ZY5A 1HZZC 3BJEA 5FAXA 2WINI 2BFEA 3N1UA 1BE8A 4PYQA 2XDAA 4AFNA 2Q6TA 3FLMA 3I45A 1J56A 3Q41A 1UBRS 2C04A 3AG6A 1QHHA 2O5VA 3HB7A 1M66A 3GJ4A 1NBME 4R01A 5C8ZA 3P4YA 1BXGB 1UOPA 3ABZA 1N4AA 1D0SA 1GRQA 4LTDA 2QE7D 3RV4A 2B35A 1IQPA 2DWCA 1XUOA 2VDPB 2J7KA 2FPPA 1XZHA 5FUYA 3BH0A 4BBAA 1F48A 3JSXA 3IPLA 5C9ZA 2JIZD 3JS5A 3MSCA 5JTTA 3GT7A 4GLLA 1GGJA 1RWPA 1W1WA 2GHTA 3IP8A 4YJGB 3RB8A 3OZUA 2GF0A 3KQMA 4D7AA 3AU8A 2O2EA 1JG3A 3JWIA 4EYGA 2BGTA 4CL8A 1WZEA 4RGQA 1EFRD 2C97A 3C3WA 2IS2A 4ZVVA 2ZIUB 4OHBA 5BQOA 2B0JA 1E7MA 1Q2UA 3O4RA 3VI4B 1LS1A 4YP1A 1QYVA 4MV8A 1I0LA 2ZSFA 3KAQA 3CO5A 4IKEA 5DM4A 3TTUA 2OG1A 4OQZA 2WYUA 1BMFA 2DECA 1KBZA 1YRWA 1UFKA 1C3OB 3CKKA 2ZQZA 3HKEB 4IUYA 1V26A 4QDTA 3MS4A 4WCFB 4YBZA 4YAUA 3KOZA 1CR0A 3FDJA 1E2NA 4G5XA 4RGBA 5JR3A 1ZHOA 3EXFA 1F2UB 4JT4A 1JJ7A 4JOCA 1XRPA 2GFIA 5JASA 1E7YA 4JJFA 1UQUA 3IT3A 1J42A 1I6WA 2EW8A 3OWXA 4G8BA 3IL2A 4GPD1 2B7CA 3ECSA 4KJZA 3EUAA 1N2GA 2J46A 2MSKA 2WKRA 3ND5A 3NEJA 4EB0A 2ZJOA 4YJ2A 1FDIA 4FYXA 2PQ6A 1T8YA 4L57A 1CEQA 2LZ0A 1EEHA 5M5BA 4FYYA 1YTLA 2EIXA 4LK2A 721PA 1G16A 3O03A 4MVYA 3ST7A 5DTRA 1SVLA 3NXSA 5JH7F 2H0AA 5CXQA 2WFLB 3HXMA 1PEDA 1NW9B 4CUJA 3V9PA 1NASA 2B6NA 3W3ZB 4NWIA 4CMAA 1K7XB 3VDMA 4OGFA 4EY5A 3UJ6A 2WZBA 3OI7A 3QYJA 2UXCB 1S1CA 2H5EA 3X1XA 1VKNA 3COWA 3ACDA 1IN1A 3KBBA 3UGJA 3FPEA 4IOMA 3BMOB 3VVBA 1WUYA 4G85A 1QKIA 3OIDA 2M32A 4KSBA 4GUAA 4JELA 5HZMA 4E5UA 1EFPB 1TQHA 3FMFA 2HCRA 3DO8A 1OY1A 4MQFA 4MA0A 4RIFA 2HZ7A 4QLAA 4E5VA 1Z0ZA 1G0NA 4KUHA 2P5YA 3LUBA 4NF2A 3U49A 1R4NA 1DXYA 2AW3A 1XN4A 3FNGA 2VRNA 2G80A 3MT0A 4G97A 3CNLA 4K0RA 2X0DA 1RT9A 5CA1B 3W3AH 1QVVA 2DF8A 1XTRA 4C1NA 3X1YA 1E7WA 2AN5A 4EHAA 3U0BA 3FMPB 2Q8QA 1TJNA 3LOPA 3P52A 4RVDA 3I32A 4UAJA 4BNHA 2ZXFA 4QQ8A 4WADA 3B2QA 3ROXA 1E6KA 1JG7A 2CDCA 3SIWA 1G5FA 1B93A 3F6PA 1W46A 2VRBA 4POAA 4RSRA 1UBEA 3FBTA 5SYMA 3MQ4A 3JZIA 2QJRA 3UWSA 1U0GA 1Z6TA 5EYPA 2WG2A 1GTG1 1QORA 2P40A 4BKUA 2HXSA 4HXFB 2JGEA 2C5BA 5HKKD 1S7GA 2WOOA 1XD8A 2VHVA 4XWYA 4Y9DA 5F1OA 4CMKA 3WB0A 1NBEA 3AYZB 5DEIA 2JLUA 2NUPB 1XLVA 1QU3A 2GVDC 2O3QA 2PWBA 5FPYA 2IHBA 2OM2A 4IJMA 3PSAA 5JLJA 3FNHA 4NFSA 1S1MA 4FNGA 2SKCA 4C03A 2RGAA 1GG5A 3WGZA 1V8ZA 1H4VB 2C4VA 3GLTA 4N5MA 3F3KA 4IVPA 4R2MA 5DCUA 3VZCA 3IBGA 4AWAA 3B3JA 4CV0A 2ZSDA 1DHRA 3E9ZA 5C1BA 4FE4A 4JLPA 1MAUA 4MO9A 1WMBA 3OOJA 1GNSA 2NO5A 2V0CA 3P1JA 1YR9A 4NMMA 3ROEA 1CY0A 2DH6A 3FJOA 2P9QA 3NCHA 4B85A 2AG8A 4NFYA 5ERGB 3ELWA 4BC1A 4J0IA 2GQ0A 3IT2A 3CUTA 2Q5FA 4GOJA 4RK4A 2JFYA 3QVJA 4ZVRA 4MRAA 3PUYA 1P45A 1H3EA 3LBNA 4L16A 3BXGA 4Y7DA 5DNUA 2KI5A 3VR2A 3UWDA 1G8MA 1ENZA 3V34A 1BYUA 2J1LA 4WDRA 1PP4A 1GKYA 1U0BB 1EFHA 4J16C 4J9UE 4HLUC 3DV9A 3KT8A 1CJKC 1P0CA 1Y8QB 4LMPA 4ZT4A 5I9IA 2PTHA 1QIJA 4L9RA 2A92A 4UTOA 4JR1A 1OA1A 1T9GS 3GHHA 4TZKA 5T41A 3W78A 1XZJA 4GEKA 2O2DA 4DTCA 1GNVA 1UKVY 2QG4A 3TAUA 4EJSC 2AF4C 1KIAA 1X80B 3LO5A 2GFQA 3OX4A 3UCEA 3GRPA 1Q0SA 2AOXA 4J0DA 1TAUA 1B2RA 1XXLA 1ISGA 2YOFA 3C6ZA 4YRRA 4BLUA 4TMYA 1MO2A 1KORA 1HDOA 1M2EA 1UXIA 3MHPA 2R11A 4NEQA 2C2OA 4QPZA 3QE0A 1M34E 4UE2A 4BBZA 5CJJA 1YHYA 3G02A 2D0IA 5EEGA 4PPNA 2VHJA 5HIMA 4Z2AA 3QA3E 2PUBA 3HVHA 2UXBB 3EXIA 3DR3A 4OMCA 3HU2A 1OD6A 3HFJA 2AMLA 1MO4A 3MT9A 4MRMB 4ACBA 4C5BA 3WMFA 4CG0A 4PN7A 1WKVA 4LOAA 4BZXA 5HDBB 5BT8A 2JIOA 1NVVQ 3NHPA 3CCFA 1P72A 2FUG6 4NATA 2VBFA 1PZGA 4MJLA 4JUIA 3AEKB 4DMUB 1EEXB 5JSZA 4OXYA 4RKYA 3D43A 1T35A 1IN7A 2AN9A 4D9NA 4FUQA 1NWCA 4Q39A 1YUBA 2P2CA 4PICA 3KM0A 2CLHB 5JC1A 1XXHE 3UK2A 1GT6A 4K9SA 4XA8A 1A9XB 3VR0A 3AVYA 4XPIB 2Z30A 4CM3A 4ZDKA 3N0XA 3E2IA 1OWMA 3VR4D 3RS0A 3GLSA 3ZY4A 3EUWA 3EF3A 2GZ3A 2GJ4A 2XB6A 4M49A 2X1HA 4ZQGA 1H85A 1XRQA 2V7UA 1K5GA 4LGMA 2IUSA 3PF9A 2R84A 3HCAA 3NKLA 2B9VA 3UWKA 4M0CA 1OLSB 2ECPA 2V58A 4OM8A 5D3MB 5D7BA 4J49A 1AHPA 1YDWA 2I8AA 3DLPX 1O97D 5FOVA 5C1IA 4Q4AB 3DYBA 3B9RA 1NUUA 3NTQA 4GPIB 5FOWA 1X7ZA 5IKMA 4TKZA 4EPYA 2H1RA 4JEMA 1JHMA 2NO7A 2AA3A 2PL5A 1CEXA 1DUSA 4Z4CA 2I6UA 2XRMA 5CW2A 4DCUA 3E8SA 1R64A 2OXFA 1TFRA 5THXA 4R41A 3AY7A 3HYSA 2W6QA 1JL3A 4ZRNA 2N1BA 3DMRA 1ZHHA 3N9IA 4Q9IA 3T34A 3SX0A 1PUXA 2GFHA 2HMVA 4NH4A 5GM1A 2NV6A 3OJ0A 5LQMA 5CLQA 1TOAA 1Y5MA 2BZGA 4Z4QA 3WK9A 3HR7A 3O8QB 2BC9A 5FTWA 1PT8A 2H9IA 3H75A 4KCGA 4Z6KA 2FWIA 3P4XA 3BTSA 4IGKA 2CK3D 1V5WA 3IVAA 2W4IA 3VPGA 3TO5A 4C3UA 2PJRA 1I3NA 3T7TA 3WLNA 3OCUA 2HMAA 1ZITA 2JFGA 3NT2A 3ZU4A 1H2HA 4DQLA 1D5WA 2BMWA 2FJPA 3EVZA 3R3YA 1PNVA 3GPLA 2WF6A 1NJFA 4IWYA 2E3JA 2ZI7A 4XKJA 3PJRA 4TZ6A 2ZANA 1UBNA 1YQGA 2CFIA 3BL6A 2JL1A 3JV7A 4FI3C 3GJ5A 5DT9A 4DDHA 1E2IA 5DHFA 2EEPA 1U7HA 1YVUA 5UKDA 1OI4A 4O02B 1JMYA 5D00A 5LKRA 1VDZA 2QTZA 2HO4A 1XMPA 3PC2A 1TYCA 3TIXB 3JQDA 2QJWA 4WBXC 2O6HA 4B6PA 4BNKA 4DVJA 1T5TA 1MF7A 1P60A 5LA6F 4UATA 1CE8A 5FNVF 1CUFA 2ERCA 2R47A 1OXKB 3A1SA 4G01B 4RQUA 4TMFA 3WLEA 4H60A 4FLFA 4US0R 4IF6A 4GYWA 2MSCB 4G09A 3PU6A 3CX3A 5FNZA 4IYJA 2GRAA 5AD1A 3UMYA 4J29A 4X64B 3VO2A 1GZ7A 3ZDAA 3O2JA 3BEDA 3AX6A 4GXRA 4UHKA 2FCRA 2Y77A 4QQFA 4HO1X 4DC1A 4OHVA 3THXB 4RGVA 2NPOA 1W7AA 1A9TA 1RJDA 3EIWA 1F8XA 3E35A 3N8DA 1IOZA 4CDRA 1J00A 3MPUA 2H1SA 3GDGA 2R97A 3LWDA 3B53X 2A0WA 1E59A 3A10A 4J0JA 1T5LA 2AJDA 3E3NA 2YJGA 3CGGA 1IZYA 2JCXA 1WPRA 1YQWA 2OZLB 3UY4A 5AW6A 4RH1A 5ECGC 1F1BA 1AOXA 4K6GA 1KO7A 1H8HD 4YHBA 2WTNA 5CRIA 4ZD6A 4JHLA 3V8RA 4LHVA 1BHQ1 4IZHA 5EP1A 1P9LA 1OH5A 1A9PA 2IP1A 3D3WA 4OPMA 1M34B 5E9AA 4P31A 3RTAA 4UHJA 4FILA 4LKRA 2ZUSA 3K31A 2FETA 5FTJA 5KYYA 1ULSA 3V9AA 3DQZA 2YBDA 3RK1A 3AONB 5KTTA 1JLHA 1T6NA 3DEZA 3F6RA 3Q9UA 2WTMA 3ZKWB 3BDAA 4NZMA 3E22B 1VLJA 1YL7A 3Q5GA 4Z3KA 3Q9NA 3DDNA 2C83A 4YXWA 4KI7A 3NM5A 3RIYA 1D03A 5DCLA 3PXGA 3LX8A 4TTIA 2ZYIA 4XD7A 4OB8A 1CQXA 5BUSA 1PV4A 2XUOA 2MMCA 5CXXA 3A0RB 3L92A 1U1DA 1YBFA 1YDGA 1QVRA 1XKQA 4C7BA 1BH2A 3WKAA 5MDHA 1J22A 4M99A 5BN3B 2XWPA 3E2MA 1OBHA 1NVFA 3E03A 1O8BA 1XXHB 4NZ9A 4YNBA 4ZA2A 4ZT3A 3RBZA 2XOKA 3RTBA 1TKCA 4DMGA 1YNSA 1B73A 3O4FA 4K6FA 4PANA 1E6EA 1B6TA 1W19A 3C3CA 1HURA 4GXNA 5EIHA 3V4OA 3NC0C 3OJLA 1VHLA 1JYEA 2H17A 4TV9B 3WIDA 3IUYA 3PSHA 1NXOA 5TRTA 1GP2A 5AJVB 3SFZA 5FFNA 3RR2A 4Z1MD 4ENUA 4HZIA 1Z39A 1M2WA 4J94A 3ZY3A 1GKLA 1OZ0A 3RSFA 3KLNA 3NHAA 5GONF 1YJAA 3V1UA 3KQPA 1KYVA 5T4HA 4HMOA 2XYVA 4INPA 2UVPB 3CS3A 1MC8A 3H18A 4ZAVA 3WLIA 2LNDA 4TUYA 3IVGA 2CNDA 3JVDA 3MXOA 2IY9A 3OZWA 3LGSA 3PT5A 4YCDA 2Y05A 3TIIA 3LOQA 4B9AA 1R2QA 4GSLA 1E3DA 1PS8A 3AGPA 2DX7A 1MR3F 2NN3C 4X8OA 3OOWA 3W1EA 2OKGA 1ETHA 4R7TA 5BPHA 4QHYA 2AI3A 4C89A 5KPDA 4HQ6A 4RD3A 2ZBFA 4G86A 1I5OA 1XF1A 2EKPA 2CMHA 2P2DA 3DF9A 3H16A 2M98A 2ZSUA 5ESXA 4B09A 3IPYA 2W8BA 4O0LA 2PKCA 5IYZF 3O95A 5AXDA 2FI1A 1NVDA 4CMIA 3VH2A 2PRIA 4C04A 1UJNA 2R1TA 4C0HA 1AKWA 3I37X 4C20A 5EHZA 3EPLA 4HAWA 5DNWA 4LYYA 1N7IA 1GAQA 4XIGS 2OHJA 4JK3A 4M60A 2CC2A 1N2CA 1H2EA 2P65A 4ZEOA 5CG1A 3KQKA 5G0TA 4DJAA 1A5SB 4QGHA 1O54A 3M1LA 4ZI7F 2AJBA 3OLWA 2X9VA 2W2OA 4QC2A 3BWBA 4FQ8A 5KPJA 5FHRA 3G5TA 4D6PA 2H4YA 1A8SA 1UMDB 1WBJB 2COEA 4LE1A 4EKDA 1GQOA 1E5VA 5ECDA 1SZJG 1WHTB 2JAWA 1X74A 1LCIA 2WILA 3ELBA 4JBGA 3IUJA 4ID3A 4TOIA 1EGAA 2B5WA 4WASA 4DIUA 5C2JB 5IJZA 1BE1A 1U7XA 1M7GA 4G84A 4FHFA 1AGRA 3VTKA 1Z25A 5IMSA 4DR3B 1VMKA 2HLHA 1S4QA 2J7PD 2RD2A 3IUSA 4B3TB 4F11A 3B6IA 3GD5A 3GG9A 3DFFA 1LSJA 4DCMA 3VDRA 2GXQA 4X8LA 4M8KA 1A1VA 2NG1A 3TOSA 4B48A 3TUIC 4K9QA 4NH0A 1OV6A 5DYNA 3U4MA 4A8JB 1Y5RA 1AE1A 2A5LA 1H2WA 3JVIA 4JLWA 5JOQA 4COKA 3AKEA 2OV8A 3TG8A 3CHYA 2C2MA 4P3NA 4PZ0A 4QXOA 1GU1A 5GZ6A 3WG9A 1FX1A 1NT2A 1Z38A 5JUWA 2FSVA 4DOMA 1FU7A 2AL7A 4LJ9A 5G1NA 4GP9A 2NU7B 2ZRFA 1OGIA 1HG1A 2OVFA 3S2ZA 1P0MA 1XLWA 2ZIXB 3NU1A 2KM1A 3M34A 4US1R 2SHKA 5EWMB 3EEBA 3K16A 1NI5A 2ZSKA 3QBJA 4BFUA 2DUMA 4Q82A 4E6PA 2G40A 4TL8A 1K8QA 4AROA 5G41A 1SA0A 5HFJA 4B8YA 4DCJA 4QTXA 5LMZA 1NMEA 4CM8B 3LO8A 5ED4A 5D3ZA 2ZYWX 2R6HA 1GRCA 2GCIA 5JNTA 4IMPA 1N2SA 1DQNA 4DKJA 1IE3A 1XELA 1JHRA 1UOQA 4Q9DA 2UV8A 3OZDA 4TTPA 1GT91 4URYR 5G4LA 3VYVA 2NZYA 3ZQ6A 2GWRA 2JD1A 4UU7A 5E0OA 3I39X 4IQ8A 4NI5A 2QAIA 1VMDA 2IYFA 1J39A 2AI2A 1A2BA 3C1TA 3GEPA 4E94A 1Z4LA 4FFSA 4EQ6B 1DJOA 2PGXA 1AKTA 1TUEA 2I4NA 2YL2A 3JSAA 3L06A 4CETA 2RCYA 3IUQA 1N6IA 1ULUA 3WISA 3KFLA 1YCFA 1YFJA 1KZ9A 4CEIA 2AZXA 2W2LD 4CPDA 3MWLA 5AOAA 3SZOA 1KMIY 1N2HA 1Z4KA 2BGUA 4S0ZA 3T5GA 2YV1A 4N18A 2B1QA 4F3TA 2C9OA 4FFRA 4Z9BA 4A10A 1OU4A 1G3QA 5D3QA 4WN3A 5A6VA 1SC3A 4QA9A 4ZVSA 5DNAA 2J3JA 2XWSA 1TD9A 3TNYA 3GMTA 3I4LA 4Q3CA 4EHBA 3NBFA 2C7VA 1Z82A 1I2DA 4FBLA 1HNWB 3SJAA 3O8CA 4JYMA 4ZRMA 3EGXB 5F78A 4KGXA 4QHTA 2CYCA 3AI2A 5CAEA 4BPRA 3FR7A 1EWTA 1QF6A 4JVMA 3AHEA 3EQ9A 3ZW8A 2XWJI 3LXRA 4EVRA 3WL7A 1NKVA 3KQQA 5J2TF 2J3LA 2R79A 4X94A 4CF3A 3DPIA 3PFFA 4X65B 2OB1A 3ONNA 2IVFA 2V7XA 2CXUA 2Q8PA 3CZAA 1ZIPA 3TEJA 5TE9A 5HHTA 2GWHA 1EP2B 4KIUA 4RVNA 5L3SB 5AW1A 3R74A 2YJ5A 4M3NA 3NQ41 4HUQA 2QMYA 1SULA 2VLBA 4WPGA 5DJ5A 1CVIA 5KNBD 1Y1KE 3BBLA 2W22A 2DVMA 4ZVTA 1ADFA 3WGKA 3DFMA 2VQDA 3L9WA 1K27A 4HFMA 1QK4A 3FHCB 4A2PA 4WY2A 1UAGA 2PWAA 1RLTA 3AC0A 1G63A 3V1NA 1RQRA 2AUTA 1SUSA 2QVYX 2RHLA 2ET6A 4KRGA 5HIIA 3UUEA 3OH8A 3ZS9A 2YWDA 3DG9A 4I2NA 4MJ3A 3ZJ5A 4ER3A 4DT1A 2YJ3A 5JH7A 3TFOA 3E70C 3L7DA 4X61A 2HLNA 1Q0RA 1T2DA 4F6RA 4WOJA 5KOJB 2NZ8A 2Q5QA 4KYVA 4HT3B 1WX1A 3OLZA 4JYCA 3A3KA 2XEXA 3TF5A 3VR5A 2AD5A 2AZDA 1KFJB 1DLJA 2BGLA 2IYEA 2JGDB 3H1EA 3SOPA 1AQNA 3Q8MA 4DIKA 3OJXA 1A9OA 1H0KA 1RWKA 2GARA 1R6XA 3R20A 1Z6AA 3A6KA 1ULHA 1KSFX 2EBWA 2Q0HA 1AS3A 2WWWA 1KFCB 1XK6A 2I7TA 3QMWA 1QJ4A 1NVBA 3WL6A 1ZVKA 1CULC 1KP9A 3EIQA 2B30A 3O3OB 4TTTS 4WAUA 5K0GA 5MFPA 1KOJA 2WWHA 4RAOA 1WHSA 4QODA 1N6OA 5D8DA 3MWGA 4XB1A 3RC2A 3HM2A 4AYTA 2XDYA 1CQJB 1E3WB 1KQ3A 1CIPA 1R16A 3C39A 3DC2A 3OE7D 1AN9A 1UZLA 2ZI9A 3D4LA 4HGOA 1U0JA 3DMFA 3HACA 1QDLB 4LY3A 4WTOA 5FWYA 5INTA 4DUYB 1TUGA 1H4SA 4XJTA 3OTOB 1TK9A 2XNDD 2DB3A 4YREA 4JQOA 4X41A 4QYIA 1O0CA 2GERA 4G81A 4K6OA 5K8TA 3HJCA 1L7EA 5K6TA 1KJZA 2AOWA 3RYCA 1CR1A 4GX5A 3AUTA 2OOKA 3ROFA 4AN1A 4WY8A 1O3YA 3OOSA 4JA0A 4PXSA 2ZB3A 1J70A 5CDTA 3LC1O 2R6JA 2RHJA 3M83A 3ESXA 1G6HA 4YJDA 1IEXA 3EGDB 2J85A 2IEBA 3D81A 3O9VA 2BPOA 4OGKA 4P4TA 1U28A 4W5QA 3FOEC 3B20A 1Z2OX 1PJTA 2QAJA 2FW8A 2VDMB 1C8VB 3G5MA 3HBJA 3L8HA 4TKLA 4CKWB 4F5YA 1Z5PA 1UP7A 2VSQA 1DDOA 4ZOAA 1YZTA 2E4ZA 3C6BA 2Y93A 1JEAA 1UM9B 2A88A 2VJPA 3P32A 2XDQB 4Y9SA 1XEXA 2OWEA 3GR6A 2JFBA 4QUHA 4Y1FA 5CX1A 4B81A 2XSZD 2KPOA 3GJXC 2QZ9A 2C03A 4NE7A 5K5EA 3IP3A 3C43A 4LJ4A 1OCEA 1F0KA 3AEUA 4AF7A 4U39A 3B78A 3H7AA 1U2GC 1NQOA 4MMYB 3ABQB 1I4EB 2JW5A 5IUKC 3CUWA 2QTTA 1AZLA 4PPYA 2AV6A 2JVKA 4EI7A 2YVLA 4HLNA 4MPTA 3SVZA 4EM6A 3MXTA 4X84A 1EK6A 1L5KA 3SM3A 3ZCTA 4HDAA 2VTEA 3WQRA 2GI4A 2C78A 4G67A 4I5IA 3P9QA 1ZP6A 2PJDA 1FYEA 2EZ8A 3BE4A 4JUFA 4AJLA 2VDNB 3DNMA 4G0YA 5IANA 1BXGA 2A3NA 2QTLA 3ESAA 2PUDA 4BLWA 1SQ0A 2X9NA 3QQPA 4D96A 1GAEO 4NV0A 5FRDA 3J81A 2RGYA 1LLFA 2YZNA 4QJ3A 1UJBA 4Z7QB 3D2AA 1FFBA 2ANBA 3CWZA 5ER9A 3HZOA 1WCWA 2Z09A 3OHSX 1PDOA 5ECWA 2F4VB 3F71A 1DC8A 1FP1D 2JH9A 4YJGA 4N47A 4RTNA 2AXNA 2COKA 4A82A 1ADCA 2IP4A 2ZYGA 4IOKA 1RAFA 1N5RA 1GV1A 2XKAA 3UMJA 5C4IA 3OC0A 5LP6C 4Q3DA 3LCJA 4A3SA 1SRQA 1U3VA 1ES9A 2V7QA 3E9EA 2EW2A 4MI1A 4PQGA 1DAPA 2O05A 2QY6A 4L74A 4M1TA 2N0SA 5EIWA 3WTBA 4RTOA 3AF4A 1I4DD 1HE3A 1M1YB 1ZKMA 3S55A 3WB1A 4DNXA 2ZJAA 2Q6KA 4FYVA 2DPHA 3O91A 4ICIA 1MRSA 1C3OA 3T9DA 4D43A 3HKEA 1KY4A 4WCFA 1XRNA 1WLYA 2Y2VA 1CTQA 3FYTA 5TMPA 1I6KA 2VUHB 3HP4A 1U9IA 1BEEA 4WECA 5FBRB 1VSTA 4KPFC 3S8YA 1F2UA 3D2LA 1OE0A 1Z06A 2EKBA 3DBIA 1MVLA 1WZNA 3W9BA 2O7NA 2GPWA 2PL1A 1TPZA 4M21A 2B3TA 4NPAA 3UB2A 1DJPA 4RMNA 4LFBB 1G5HA 6CHYA 2OK7A 3NBYC 3T15A 2BSXA 1Z13A 2P8SA 3WO1A 2X15A 2LBPA 3OY2A 2R6FA 3QE2A 1PG0A 3VR6H 4DCPA 5KNCD 3GPBA 1XZBA 1C9JA 1XNQB 3SX2A 1ZD2P 3IMFA 4ESOA 1B76A 1I7NA 3OM0A 5BN1A 2WFLA 1E7QA 5JAZA 2IDZA 3CWCA 3Q2KA 4WA8A 2JKZA 3RH0A 1DTWB 2FSGA 3WLAA 4BKQA 4LCEA 3T95A 1ZD4A 4IJQA 2YHUA 3MUOA 4D80A 4ZREA 1KK2A 1QGAA 1BS9A 5BYKA 3SEAA 5FUWA 3ZDCA 2A9QA 4YRDA 3PKZA 4OMUA 3RHZA 1U6IA 2XUIA 4WE3A 4P0QB 5C8VA 4GH5A 1V5GA 3BMOA 4FGJA 3RWMB 2GBCA 4EW3A 1B00A 1E2BA 2M6KA 4N6GA 1EINA 3OX3A 3CSSA 4G1EB 3V2GA 3DTNA 1EU1A 2X0JA 2C57A 1W0JD 4NBLA 5LXTF 1EFPA 3HB9A 3QF7A 3WB2A 3ORHA 5J2UF 3AR6A 4QD3A 5KIAA 3TQQA 4F8YA 3ONWA 1UKAA 2Q1SA 1FMFA 1YR3A 1TF7A 2FWMX 3IAHA 2WJYA 3O83A 4OSPA 1FQKA 4BEJA 2CXRA 1QHYA 4OP2A 3W8FA 1L6IA 1A71A 3HI4A 5CA1A 1N6RA 5IX8A 1GSIA 1OROA 1T6XA 3CZQA 3HH8A 2D3TA 1SUEA 2X0EA 4JWTA 4ABTA 2FG6C 3MIIA 4F3CA 3MCWA 4I1IA 3R1IA 3U81A 1H66A 5ER6A 1JFFB 1VJRA 4OQQA 2PUAA 2OFWA 3WRYC 1N7JA 2VZ0A 5IARA 4EGCB 4X8MA 5KI6A 3N74A 3JQ9A 3PGMA 2NYVA 3P7MA 2IWHA 1OF1A 2JS7A 5BYAA 1JUDA 4RA6B 3WVNA 3ODGA 1WQ1R 1ZH0A 2C82A 3V4ZA 2CFSA 3MELA 3QY0A 3WDKA 1FSPA 4MVJG 2CNNA 3QBVA 4TS3A 1IQUA 4TSRA 4HNQA 2PKQP 4QU5A 2GAAA 4S05A 2WWRA 3STWA 4R2JA 3CF4A 3LHDA 1N1DA 3OLYA 1F17A 2CBXA 3QVXA 2PEZA 3OTQA 1RI4A 5GOTA 4DABA 5JCJD 5EUMA 3NEPX 3PVCA 2NUPA 5B2FA 4E07A 3P2OA 4UVIA 1A4RA 4ZYLA 4M8NE 3KEQA 4UDYX 4DAEA 2OFOA 4FEYA 5ADHA 5L51A 1Z6QA 3KOXA 5BW6B 1FQJA 5AVOA 4QKQA 3AV3A 1BJTA 4MWBA 3W2GA 5HOQA 3VNBA 1LI4A 2X4IA 4QNMA 3ACCA 4ZV7A 5JADA 2RGWA 2NVBA 3VR3D 4CCWA 1QQ5A 1GPWB 1IUKA 4E3WA 4EMBA 1SCDA 1NQ5A 4OIFA 2NP6A 4JWKA 4K03A 1UC4B 2H18A 4UEQA 1G3RA 1ODTC 2WE8A 1W87A 3F3MA 3TD6A 1P19A 1JI0A 2VPQA 1BFDA 1ZNYA 3B60A 2UAGA 4DG5A 1XZQA 1RRMA 2P9BA 5EQFA 3ONEA 4EY4A 5KWIA 5DGXA 3AOGA 3GQBB 4KMSA 1JYSA 5BVGB 3KALA 3RS5A 3Q6MA 4JLKA 1EXDA 1GZ3A 1FFSA 1PSDA 1LLDA 1VYHA 2Z08A 2MINB 3EZ7A 1SHUX 3LJKA 1Y8QA 3N2GB 1KZ4A 3DQPA 4J6EA 3WC4A 5JAOA 3ZDZB 1IWOA 3R3VA 4AP9A 4BN0A 1P4RA 1VZ3A 1YZLA 2O0MA 5B4VA 1X7XB 1ODFA 4E5NA 4UDOA 4ES6A 2D13A 1I13A 2NV2B 3AHFA 1X80A 1XJ0A 4GVLA 4X7BA 5FOUA 2IP2A 3U31A 3DKIA 1ZR4A 3Q85A 1AKMA 3HVRA 4MYCA 5AI9A 1KU6A 3W5HA 5D3KA 1PFUA 1XA0A 2XUPA 1EG7A 3DP9A 3TPZA 4U0KA 4WERA 1NVTA 1XT6A 1N2ZA 2Z5LA 3C45A 4G26A 4EMUA 5KYNA 1B15A 1P8JA 4BWFB 3RRJA 4V03A 3MLBA 3O1JC 1RXIA 4PINA 3UJ3X 2GF2A 2I29A 3F78A 4YBRA 3ZHTA 3S81A 4MRMA 5DHUA 4A1OA 1K3UB 1E89A 4DLKA 5AVZA 1MG5A 1YU6A 3WLFA 3X1KA 3EB9A 2OLEA 5EN4A 5EUQB 3SBDA 3R7LA 3EOAI 2ODBA 5BSGA 3GRUA 3CUVA 4O59O 3AK4A 1O57A 2VRCD 2H5IA 4D26A 4LJ5A 1O7JA 1C8BA 1SVNA 3AEKA 2VBGA 3REFA 3VPSA 1L8XA 5EI5A 1ONOA 3K35A 2ODQA 3OHPA 4DV4B 3HGTA 4LF7B 1Y5LA 2Z56A 2HY7A 4DRZA 3DE2X 3ZHZA 1TCVA 2ZLBA 2VNKA 3A37A 1ULZA 4Q21A 4HQFA 1N5KA 3HQ4O 2XBLA 4KVAA 4GGMX 4EOGA 1EXVA 3LPCA 1A9XA 3OIUA 4XPIA 3R76A 1JMKC 2HOQA 2QW8A 5LQUA 1U8AA 4CRWB 2KJQA 1NVVR 4C4TA 3PNQA 3FKQA 4GM0A 4QUKA 5CHYA 3K5HA 4KBGA 4W9MC 3RF6A 5A4DA 1QIEA 1HEUA 2R8PA 3BWMA 3INYA 4MVWA 5JY6A 1E3JA 3RG8A 1J8VA 4EQZA 1OLSA 3M6MD 1WDMA 3D6FA 5F2KA 2FMXA 3U7EB 5D3MA 1MC1A 1NXVA 2X13A 1CUJA 4OHWA 4QFBA 3KQUA 4Q4AA 5FUVA 3VBEA 3WNDA 3QKIA 3UTCA 2WPDD 1I9GA 1KU0A 1MB9A 1RKVA 3RJZA 2XKKA 2JPDA 5KHAA 1ZINA 3WBJA 1BVRA 4ZYUA 5HZGA 1OZFA 5CM8B 1DUIA 3ELYA 4JIMA 3C6XA 1COWA 2ZUFA 2ZRKA 3BK7A 1K97A 3PNLA 2VH2A 1X92A 3RK0A 2CSXA 2GTIA 2JHFA 3IQWA 2ZZNA 3GFFA 3ZFTA 3WLMA 3FSGD 3CNQS 3KC2A 1UC5B 4RF4A 1B0AA 1GGVA 5E2IA 3GGGA 4YP6A 4CL3A 4DR7B 2Q3FA 3O8QA 5HUQA 4RLQA 4D5GA 1B0ZA 4DNQA 2JJ2A 4XEHA 4MUXA 4ASUD 1I5EA 1R00A 1I1QB 5A5EA 3NUGA 2HTFA 4BQNA 3M2TA 5IHXA 3ASYA 3IV7A 4I4TF 5LLDA 5HRCA 3CT6A 5CBKA 1QP4A 1DKUA 1YS9A 2HWWA 3HBMA 4Y7CA 1YCDA 1XVIA 1Z4IA 2XJ4A 3BG5A 2G8LA 2P9CA 4PRZA 5A4FS 1P0QA 2HXYA 5FOTA 3D7SA 4F9TA 1SD1A 5EJ4A 1B3BA 4Q93A 4HX9A 4DMCA 2PUVA 3N0VA 4QBGB 3TLMA 1JJVA 1XYVA 4AJHA 4AO6A 1IEWA 5KCMA 4BNWA 2PMDA 1B8UA 1KR5A 4OXXA 1U0NA 1UK9A 2PR7A 3AVQA 2RI1A 2UYQA 1Z36A 2PBZA 1GARA 2ZW9A 4A73A 4UEKA 5EJ2A 3KKKA 5HZHA 2VXOA 2VT6A 4ND4A 4A6XA 4PFQA 4WW0A 5EJ8A 1G3MA 3R9IA 2AOTB 1JB1A 5SICE 3RVLA 1Y8CA 2P11A 4OXIA 1FL9A 4TWJA 2CVHA 1M3SA 3CUKA 3OETA 1KSJA 4MPJA 2IPXA 1EWKA 1QCDA 1C4XA 1QX4A 2EC5A 1B6SA 2YV3A 3E82A 3FWYA 4MARA 3TL3A 2F90A 3TOXA 3CR8A 4XWAA 2D5AA 1MB4A 4LGCA 4Q1FA 3TKAA 2UDPA 2PZBA 3WHLA 1W73A 1OWOA 2DFTA 3CLUC 4UUNA 3EA0A 4QFDA 1KMCA 1BU5A 1ODIA 2OZVA 3HABA 3VJKA 4OLHA 1M7BA 1NZFA 2P2NA 5AVKA 3THXA 5I7HA 2X76A 4LFAB 1SQGA 2H85A 3A32A 1M10A 1O94A 1Z0AA 2ZAIA 1BMTA 4M0KA 3WA7A 1JEDA 4XAQA 3DLTA 2WSSD 2JCYA 5KNDH 4KQXA 3KR9A 2OHFA 2PX6A 2VDUE 4XFKA 3GRYA 1LNZA 1W34A 2OZLA 4ROTA 5EXXA 5TS2A 4EF4A 2UUAB 1H5NA 1RXEA 1O6ZA 4R8VA 4Z8XA 2NXEA 1D2AA 2AHRA 3CX8A 4MKZA 1BGXT 1AUQA 2C5AA 1DG3A 1WQ4A 2IYXA 2R8ZA 2XMZA 3UH0A 3TYXA 1Y4UA 5U9CA 3WAGA 3SEFA 1DAKA 2EX1A 1QQAA 1EMDA 4PIVA 4CDGA 4KQFA 1ZIYA 1L4BA 1PLKA 3K6RA 2MCFA 3T1QA 4F9EA 1QO0D 2NOAA 3KOYA 5HKAA 5I4IA 3PGVA 4LVNA 3UANA 1M34A 2A8YA 2PLWA 2D2EA 2WQZA 3CC8A 1RM5A 4PC1A 5IT4A 4F4UA 2QYSA 3DDHA 1DXOA 3G0CA 3QFFA 4ADSG 5TS3A 3V8EA 4BRZA 2G70A 4Q1AA 4JSYA 2Q9CA 4JU8A 5D6OA 2FK8A 5IDQA 3FKJA 1GQQA 3ZCXA 3ZKWA 2QX6A 3K9LA 1R5BA 3E22A 4KBYA 5FORA 3SI7A 3NHFA 2FE1A 5ALPA 1HH4A 4E08A 2HNBA 3PCRB 4DLBA 4RKWA 5AOCA 2G9VA 4HX2A 3R3UA 5DX0A 4F38A 5BUZA 2VP9A 5AP9A 1N36B 1IPEA 1E2DA 4XIYA 4FYKA 4I4IA 1DPGA 2QLBA 3L7AA 1W30A 3N76A 4D9HA 3EVFA 3R5XA 1IVNA 2VPTA 1WMSA 2VDWB 4EGJA 5BN3A 1HDCA 1JPVA 4DCCA 2FW7A 1XXHA 3VTFA 3TQHA 4TV8F 1M8FA 3IDFA 3N3BC 1KGDA 3LUGA 4WJKB 3P27A 5DDIP 5FBQB 5E3HA 4DA9A 1Z68A 1ESCA 4AJKA 4BV3A 1VIYA 4YALA 5DXJA 3UGKA 2JI4A 4AL4A 1X7GA 3R8XA 3WYCA 2AE2A 4TV9A 4YA6A 1L5WA 4XW2A 5TARA 4QVIA 1YQDA 4O1IA 4K1XA 3DE1X 4I7EA 2DBYA 3ICOA 2NNWB 5ERXA 2F64A 2GPAA 4E5MA 1KXZA 3GLQA 2G7MC 4FS8A 2OUIA 1M2NA 1RWOA 4HK4A 2RHMA 5DULA 3R8CA 5ALEA 1K0FA 2FN3A 1KI1A 1KY5A 3UHFA 1G2IA 5JBQA 2QM3A 1EP9A 2Z3ZA 3EPPA 1QH1B 3R5SA 1T4GA 2UVPA 4N12A 3KAPA 4R71A 2CHGA 4DCOA 3AU9A 1H8ED 1T1JA 3SIXA 4BFCA 1ILEA 3JWGA 1XAIA 1X94A 1YR7A 1C0IA 3AJRA 3EIUA 3P9NA 3WL4A 5AVQA 4HLDA 5ALSA 3ZBPA 4R5MA 2D1RA 2E18A 2Q5LA 4HQRA 1F14A 3QELB 2IEDA 3PE3A 4OHPA 5BOVA 1YACA 1WW2A 4GR4A 1GXSB 4XUEA 4EKNB 2WMYA 5D01A 3UNXA 2FW9A 3LM8A 1OA0A 4QJ4A 1UT8A 2Z58A 3TI9A 2IW3A 4M9RA 2IE0A 1NP7A 1ID1A 4MVJE 3LUKA 1Z2PX 4UBLA 3VKFA 2P69A 5JC8A 4XWGA 3H0CA 1LX7A 4GKKB 2BR5A 4XVCA 4M53A 1OSNA 4B6EA 4G24A 1QPGA 1D2CA 4JB2A 1E2QA 1PJ2A 1B4DA 1G41A 1PTKA 4MUGA 4ND5A 4CKZA 1DJNA 4CT4B 2PSDA 4JLOA 4BFLA 3BICA 3GJQA 5DASA 1CYEA 1Q0ZA 1UMDA 3OCVA 1YL6A 4G0OA 1FF9A 5IT9A 1GLGA 3KOOA 2E89A 3J81k 1AS2A 3FETA 1YE3A 1WHTA 4DLSA 3L79A 4N5LA 3C7CB 4GVXA 2HWUA 3HC7A 4AG6A 1TUIA 4KPGA 5CFNA 2DHDA 3HKDB 5EXPA 2PGAA 3K2QA 5CYOA 4LE0A 1CUXA 3TW8B 2A94A 1ZN8A 5J5VA 3ZZNA 1TJ3A 2QMEA 1PX2A 3LNTA 1Y6GA 1P5JA 3KPYA 3KL4A 4EITA 4GFDA 4REQB 3INTA 3IPCA 1ZOPA 1SC6A 1MPXA 2HH9A 3IALA 4K8RB 3AL3A 3U3OA 2C7PA 4NCNA 2I4RA 4A8JA 5B2EA 2AOVA 2X7JA 3JQQA 2OHVA 3QNUA 4E70A 1G2OA 4PR0A 1H05A 4QUAA 2ID9A 1G8KA 1ZGGA 2J0VA 4I36A 1XQXA 4QUBA 1YRHA 3O0TA 4PY2A 2YWCA 1VB3A 3AH8A 4IQ0A 2ODPA 5FQOA 1F0NA 3BZWA 3T7RA 4ECAA 3GT0A 1JLKA 1TYDE 5DTMA 3S44A 4BRSA 4I1PA 3SHTA 1J06A 2NU7A 2QN8A 4BNVA 1XZDA 2ZIXA 5IK2A 3JRNA 4K9RA 5EWMA 1HLFA 4YCCA 2Q0QA 4LSWA 4WMLA 5DNVA 5TGTA 3VH4A 1QDUA 1JSCA 4JDUA 1GO2A 2O57A 4WVFA 2HJGA 1BOFA 1DX6A 3ZLBA 4A0RA 2VXBA 3E2PA 3SM9A 2ZAMA 5CXSA 2JZOA 4CM8A 1CR2A 2APJA 3SLKA 4Y2YA 2Q1TA 2R6ZA 4RAQA 4XOIA 2Y1GA 3TTXA 1DI0A 1P2GA 2G04A 2R5NA 3DOEA 2GNAA 5ICMA 3FTFA 3GRFA 3OC6A 3PA8A 1JG2A 2RK3A 3KSMA 2XV1A 2Z6QA 4R1LA 2WPNA 4I1YA 2QRKA 1R8QA 1E4YA 1RYEA 2R66A 2WYHA 3C3YA 3KG2A 2C4HA 2YNMC 4L6IA 4UVDA 5ADUS 5DFAA 1ZK0A 1H65A 2AD1A 5JFTA 4IJVA 1NNEA 2N42A 4JP3A 5HE8A 3KT3A 2KX7A 1NVXQ 4RMIA 1QGED 2D7JA 2NYUA 5DP1A 3N0RA 1ZW6A 4DR1B 4K9PA 3F4LA 2JANA 4YPOA 5A3QA 3NTOA 3ETGA 4BS9A 4FCTA 3I9LA 3UAXA 1P18A 1ECPA 3N05A 3LRXA 1LKZA 3E7PA 2ONJA 1E32A 2XVAA 4P32A 4DHWA 1QH9A 1A77A 4IIBA 5A02A 3HXQA 2QUAA 4LDQA 4XVQA 1I32A 3IP6A 5CK4A 5I8ZA 5HVNA 2Y1DA 2AZTA 5LB4A 3II6X 1T1IA 3SNKA 4E03A 2CV1A 1JE1A 1CZRA 4NYIQ 5JS8A 2YWJA 5FL7A 3FWHA 5A4IS 5TGDA 1ZGHA 1QMPA 1RABA 2YYAA 3OKCA 2JA1A 1XF9A 3EGXA 2ODNA 3F90A 3KHKA 5HGJA 3MRXA 4P38A 3DDZX 3WWCA 5IKPA 2H1OA 2G4CA 4KACA 3IOCA 4P36A 3QK7A 5IC5A 5KMGB 4TKMA 5KTYA 4L2IB 1WDKA 4GM1A 3LXXA 1NNSA 3WIBA 3S2FA 4OHKA 3QLJA 4LC0A 3NTXA 1A8QA 3EXHB 4W5OA 5L3SA 3MD0A 4C6HA 1RP7A 1W5TA 1U0HC 3H11B 4IFIA 4AUEA 3T1YB 3CJQA 3TJMA 5JRJA 3ZVMA 1IBLB 3U7HB 4H7KA 3B6KA 5BMVF 3RTDA 3DLIA 3EWAA 2O2SA 5TT0A 4MUKA 1SXJC 3HO8A 2W6CX 5K0ZA 3L9XA 3DS8A 1KDVA 4G5OA 3EYAA 3ENZA 4BVAA 5T7BA 3GBSA 4OHOA 2WWYA 1EK5A 4MPPA 5FP0A 1EVIA 4N1AA 4LDRA 2TYSB 3UG6A 4QXRA 2GK7A 1S2GA 4M7OA 1RAGA 4MA4A 1SOAA 4HQKA 4F1KA 1JVNA 2V0NA 3AI3A 3I23A 3RKSA 3LUPA 5KOJA 5AVJA 3SOZA 1BCRB 3RI3A 1L3IA 4U7JA 4K2AA 3A3NA 1L4FA 4KAFA 3RU7A 3I53A 2JGDA 4RKEA 5JD6A 1FVFA 2VHTA 3O84A 1FDOA 2VSYA 4LY9A 4QLOA 5D5QA 1U2SA 4OQLA 3FFXA 3DWGA 3DYVA 5HF9A 3GYGA 5ECYA 4HX5A 4MI9A 3BFVA 1I36A 4D5EA 4KKXB 1PG2A 3BWDD 1QPZA 1UJ5A 3HZRA 3Q2OA 3IAS1 3SC3A 1EAMA 4YGXB 3ED1A 2Q3MA 3AKCA 2DHQA 3H4TA 2IXTA 3PQ2A 2GCNA 1Z62A 4W4TA 1CQJA 1E3WA 3U3DA 1QSGA 3EDOA 2NZVG 3HUTA 2DGDA 1FS6A 1VKRA 4JI1B 2GPSA 4DJDC 1WW8A 2EJCA 2ID4A 3GUZA 3L7MA 4V0NA 4XJVA 3ZXSA 4CMEC 3FPHA 4X5OA 3IA2A 1BA2A 4EWLA 2G76A 3ICEA 1KAGA 1PWYE 3AM1A 4O33A 4UHDA 4JJKA 2G06A 1DELA 3DE6X 1FSZA 4ODIA 2OM6A 3WIOA 1H2XA 1N0UA 1Z08A 3HL4A 1XU9A 3RIHA 4FB5A 3IDZA 5FCDA 3QBDA 3TLYA 3EYWA 1FW6A 5T3UA 1L8OA 1BE0A 1RZVA 3BE8A 4DUPA 3EGDA 4ND1A 2VHZA 3QVGB 5CDHA 3RNLA 5TR9A 1MH1A 2C94A 4CKWA 2IU6A 3CJRA 4YUWA 1KI7A 1KJYA 3P9ZA 1DAHA 4JNKA 1UM9A 2VQFB 1IJEA 2XDQA 5B37A 1RU3A 5DM60 4Q6WA 2GRUA 2P9YA 3HEMA 1T0JB 1R0XA 4JVNA 1E1RD 4LX8A 5DZSA 4WXYB 4DCVA 4MUFA 2J30A 2XTMA 5EZ5A 1FUUA 3ZDRA 3GO4A 2EZTA 3RJMA 2QQFA 4JGBA 4JROA 2W37A 3IVRA 3H42B 4GHWA 4WNCA 5DHRA 1UDRA 2JBHA 1JRLA 5EJ6A 1IJKA 4F46A 1FNNA 2GDJA 1UZMA 4PLWA 3KQTA 4L3OA 4UBJA 5CEEA 4PU0A 1R88A 1P5ZB 1V6SA 3AM3A 3IGFA 3QWIA 4O5OA 3A1EA 4Z0NA 5GWXA 3RFUA 1G21E 5I9BA 3RVSA 3V00A 13PKA 3TCNA 2J0EA 3CB2A 3HLKA 2H2HA 4MAMA 1L4MA 1T9DA 2CNBA 2X8WA 3BGSA 1HT1E 3IOBA 3MMZA 2CUZA 3SHQA 4BL5A 1J33A 4E88A 4DG8A 4EY3A 3GLFE 3IBSA 4H6PA 3MILA 1PFKA 4JP8A 2VWHA 1KXJA 3ETHA 4CUZA 3EIOA 3F4BA 3PI7A 3QJGA 3U7FB 4TZ0A 1EFUA 4A6EA 1Q1BA 1OFHA 1E3IA 1U7OA 2BGKA 2DFDA 2F59A 2I65A 4H59A 3W77A 2J9RA 4A2CA 3WK6A 3AESB 2Q6OA 2OSBA 2NSJA 1QQTA 3NDPA 2CLMB 3MFQA 3NIBA 3OKPA 1SBTA 3CZ4A 3PQEA 4MGYR 4HDMB 3GH3A 1L4EA 1WY7A 2AFRA 4IGAA 3VZBA 3WL3A 1DAMA 3SBXA 3MGKA 1M1YA 1ZUD1 3PFCA 5HFAA 4EG4A 4Z4EA 4EHFA 3TSOA 1DBIA 2L17A 3NHUA 4ZO9A 5GP1A 3S40A 4DV0B 4QBHA 1XR3A 4FDTA 1JFVA 3U44B 1XDWA 3HNPA 1VL2A 2NZWA 2NP7A 3ANXA 1WPQA 3T7SA 1L5VA 2J6HA 4CG3A 2XBMA 3WZLA 1WU8A 4BFZA 5F4BA 5AH0A 4EB6B 1N32B 3QXCA 4DWJA 4JYZA 1NNI1 4DJFC 3FMIA 1DIGA 2FWRA 3B9QA 5B1SA 3E15A 5JY1A 3PFHA 2RGGA 2N47A 1ORVA 1ZM9A 4OM7A 2XMQA 4M7WA 1O5IA 5IEBA 4H6XA 4MS4B 2PNFA 2B1JA 5DBIA 2Z04A 4GPTA 4WXHA 3W6NA 4FC7A 5J4HA 2OCBA 1C0KA 1Z47A 3FF4A 4MVJF 2AFHB 2IYVA 5CTAA 3T5TA 3WMRA 3GCDA 2XQGA 1Q0TA 3R44A 5JG7A 4EECA 3MB8A 3BCHA 5DBEX 3H87A 4FQ5A 3QITA 1DTWA 3KUDA 2WU4A 1KYXA 4D0RA 3W1WA 3ZHQA 3A3PA 2BEWB 3QBTA 3QKTA 2QEQA 1L8QA 2P7HA 1EESA 1Z75A 1KPIA 1NVWQ 2ZR9A 4OQYA 3ZGLA 2ACWA 1A5BB 4PHFA 4KQ9A 1F9AA 3KO8A 3TVDA 4D82A 4DPKA 3W5SA 2J6IA 5A1TA 1EXWA 3HXLA 3H2KA 1K6XA 3E1KA 1ZONA 4HWSA 4XZ3A 4E2YA 2OWDA 4C0QC 3QY9A 1QMGA 4FN5A 1AKUA 3PRYA 4CUKA 3Q98A 3A58B 4QATA 2Y0DA 2PSJA 1OX5A 1Z4OA 1ZNWA 3BRWA 2VHUA 3GY0A 5FLXA 1ZQ9A 1JU4A 1OAOC 4FOPA 2A86A 3A6GA 3QEMB 3R7DA 3UHOA 3ZQKA 1EQUA 4BZQA 4Q4JB 1F12A 1Y6FA 1B1AA 4L8WB 3K0CA 3VR2D 1JFFA 4NNPA 1LB1B 2R7LA 1PTJA 3P0HA 5C31A 4IFBA 5TMBA 3HR4A 1A0OA 3T12A 2DETA 3PFKA 3IS3A 3T9EA 3T5BA 2E4XA 4NCAA 5EJFA 5A2QA 4RA6A 1V1JA 1E58A 4DLXA 5LQNA 3NYRA 4RY2A 3UB3A 1AQJA 4BE9A 3LSTA 5CT9A 5KYGA 3I76A 3PFIA 4AF8A 2OILA 3GLIE 2NQ8A 4GBMA 2V6JA 5IH7A 5BXQC 2HJVA 3AHIA 1IBCA 1VKOA 5KDLA 4MV4A 4NFLA 2XMCA 4ZAXA 5MN6A 4R5HA 3HCNA 1RBQA 4QFMA 1X3SA 5JRDS 2G1KA 5K0NA 4ZHQB 3AZQA 4OUKX 3S68A 3MLAA 4K9LA 5JEDA 2EP5A 5C35A 1E60A 5JXIA 1T3SA 4IQ4A 3TM4A 2XQVA 1IN5A 3UG7A 3DDCA 1LUAA 1HBJA 4H77A 4OJTA 5ULLA 3KQSA 5DSXA 2DTXA 1Z22A 4GYYA 2M6SA 5A0FA 2B99A 1NX9A 2W6OA 3KIPA 5JXGA 1JEOA 4I5GA 1QCCA 3PYLA 4C0SA 1PLLA 4P0PB 1VL5A 3RVBA 1H4QA 1CB7A 3VOSA 1L1QA 3UHJA 4B0PA 1BQ4A 1FCJA 4TTVA 1RMYA 4ZCSA 4TQAA 3TEFA 3VUEA 3GQBA 1MFPA 5BVGA 2J48A 2VPWA 3F2IA 2D8AA 1B8NA 4MLPA 4WXPA 3CR3C 3HSSA 4Q9NA 1W5EA 1M8JA 1XDGA 5ERYA 2MINA 2G25A 3A28A 1U9JA 1YVEI 2WUFA 2ZT5A 3N2GA 4GM4A 2C9MA 2W2TA 3KPWA 4HWOA 4O4IF 2DUNA 2HDNB 3K09A 2AKYA 1Y37A 4IP0A 3NOXA 3LBIA 3NVDA 3DWFA 4MDYA 2EG5A 3FNFA 5CJPA 4EGFA 1X7XA 1V4NA 3IMEA 3L4EA 2PUCA 4DNOA 4MVJM 3NHRA 4RH0A 2HREA 3ROZA 5TY0A 3PDWA 1B6RA 1AUOA 2G9QA 4H1TA 3KEMA 4X1KB 2YDYA 4E31A 1QBKC 2YTZA 2D3WA 2I3GA 1UC9A 3UK6A 3PPYA 2H2GA 3L43A 2QAGB 3I8XA 4WOCA 1PQ4A 4DY6A 3PHBE 1DWUA 2BHNA 1ZWKA 4WZ6A 1O8CA 3RPEA 1U3UA 4MKGA 2ISQA 3SXJA 2CVOA 4D8WA 4U5QA 3BHJA 4LHZA 4CMGA 2ZBDA 2O52A 3K9CA 4Q16A 4E30A 2CT8A 1LJUA 1CR4A 1LXCA 5AHWA 1Q7RA 3WXMA 1L8LA 2GBGA 1G66A 1QQ7A 3GVPA 3CG4A 3ODPA 2UZAA 1LF0A 1U7ZA 1OOEA 3K9HA 5HUHA 5JNVA 3I72A 4Q4DA 5LN1A 4NRDA 3H5RA 2WB4A 2V7GA 2EFYA 4RSMA 1NE2A 3FPSA 3ZBQA 3CV3A 4BLRA 4IYRA 2KHZA 4G0MA 1IZ8A 1QGDA 1S7CA 3BRSA 4B4OA 2QD3A 4ZK6A 3L7YA 4EY8A 1KC1A 3F6YA 2J3HA 4JEUA 1FTSA 4JI7B 2VA9A 1B26A 4OB6A 4BUCA 1MD9A 3QFSA 2P30A 3G89A 2XB8A 1JHDA 3OU6A 1ND6A 4MB6A 3QMVA 2BZSA 2AX3A 2WJPA 3KE8A 3FFWA 1ZI6A 2WDPA 3H2YA 5AXCA 4P7GA 3CPEA 3OZSA 1NMSA 2I3AA 2F9LA 2ZIWB 3PZRA 3G8YA 1KH2A 2H8KA 3H9JA 3NV7A 3O21A 2VL7A 4K9MA 4AKSA 5BY2A 1RCTE 2XX3A 5BV1A 5LM3A 1PR6A 2AI1A 4ZCMA 4FMCB 4JL5A 3AF6A 2ZYDA 1C3VA 3FOWA 4EYSA 3CLRD 1PDVA 2OBYA 4GOND 1Q7TA 3EODA 4AWBA 2VH1A 4FOSA 4C0AC 5E9QA 4BX0A 3LA6A 3SQOA 4EABA 1VE7A 5GQSA 1PIWA 4NULA 1SVSA 3W5DA 1YRYE 2VS1A 3HJAA 4E5SA 2OB2A 4RELA 1U8TA 3PHHA 3JATB 4TWIA 2DM6A 3UW3A 2ISCA 1TZCA 4PSVA 1AF7A 3G2HA 4OLJA 3LI2A 3O82A 2XODA 1P4JA 2M9MA 1CP3A 1EQAA 3A1TA 3PC3A 4IKOA 3TGWA 1UKZA 2WIDA 4G56A 4PZYA 5EMHA 1CX9B 2PWZA 4FDVA 1R0YA 3BJIC 4R83A 1NSFA 2D62A 3LY5A 4B6RA 1GEGA 4P35A 2P1RA 4YUVA 2QJOA 2A57A 1KK1A 2VTDA 3NO4A 4WKPA 1KL7A 1ZMTA 3TQIA 4F91B 1FQWA 1TO1E 3ND6A 1ZHFA 2L82A 1DU4A 2WVGA 3FYUB 2PZJA 4PLYA 5DYIA 2IDMA 4N8EA 4TLBA 2F9FA 5G0SA 2XKJE 3HA2A 3KXPA 3RBXA 1PZFA 3DCYA 4PVCA 4CHTA 3M6LA 5B2ZA 1JDNA 1A7KA 2ZR8A 4YXWD 4L4XA 1NLUA 2GH1A 2AOTA 4B6QA 2OQ2A 3K6JA 4IDCA 4R98A 5DV9A 1U8CB 4XD7D 4EF5A 5DTIA 5IS2A 1X1RA 1D5CA 3P0JA 4P4NA 2AN4A 4QAJA 4YY3B 3IJ5A 3VU8A 2GZDA 5LD2B 3IH5A 3CW8X 4KTVE 3KE9A 2ODAA 1ENOA 1E7RA 1QYXA 2ID8A 2II6A 5ICGA 4M1OA 2KLBA 1IRIA 2Q9AA 4INOA 3GFTA 4JT9A 3TBHA 5AVXA 1IOLA 2BMJA 2XOKD 1O58A 2FWBA 3AYXB 3CISA 2C58A 3D4NA 1IZ9A 4OHCA 5CBPB 5J63A 1T15A 2V7EA 1KIFA 3IXLA 4BUJA 3V4RA 3QEAZ 4EP1A 3SU8A 2WTUA 4LY0A 4NLLA 2F48A 4YIKA 3EF0A 1TCBA 2ZIFA 3EEIA 2HXGA 2XE6A 1RIFA 3CLTD 4LVUA 2OBFA 5H3HA 5HQJA 1HEYA 2V7VA 1UFQA 1E9EA 2F3QA 3C5HA 2ZEJA 4JGGA 4YHHB 3H5WA 2FPLA 1JLSA 1Q7BA 5JDCA 4D6YA 3U7GA 4DLWA 3QIVA 1DC5A 1OI3A 2GK6A 2ZYAA 3UPUA 2OCGA 2AC4A 4CKXA 2YW9A 1RI5A 2RIRA 3OFSA 3M5DA 3RC1A 3T4UA 4ZZIA 3G13A 5C7YA 1YBHA 1NGSA 5C8YF 3C8HA 2HBZA 4BFWA 3PX7A 1SHTX 4S04A 4MH0R 5BOSB 3JQ8B 5JZMA 4EVQA 5BN4B 3NIDB 4UNNA 2HF8A 4IXDA 2JDID 3Q7PA 4L27A 4RTSA 2GBFA 1W75A 3ZFQA 1J0DA 2OKCA 1QANA 3MMPA 4HNHA 2WV9A 4U2FA 4ZKEA 2ACEA 1P75A 3CLKA 4NZOA 2PUJA 1O5TA 1YOVB 4NCJA 1L4NA 2W98A 4RMGA 3WADA 2VDWA 2QD5A 3LAWA 3OFJA 1VJ0A 4DARA 1GZ6A 2VVTA 3KXIA 1PL6A 2O2JA 1W94A 1ECBA 2ZDHA 4I3FA 5G1PA 4D3YA 1N57A 4HVLA 3B3AA 1XDUA 2J5XA 1GTVA 3GG2A 1NVAA 3A2NA 3ZYZA 2HPZA 1VGVA 5AKLA 5EEHA 3VHRA 3N75A 4WA7A 4W5RA 4KQKA 1UPCA 5GJVC 3F96A 4RWZA 3ZFUA 4V02A 3IODA 1VYVA 4D9EA 5EP3A 2E0IA 2WQ6A 3K70B 2B7LA 2O8NA 3KXLA 1J5EB 4U7FA 1Z33A 2Q3LA 4E32A 1KJNA 2JJYA 3DEJA 2EGHA 4FX5A 4AU1A 1ZRSA 4PGMA 2R00A 3TR0A 3VNUA 1Y3DE 4BRWA 1DBQA 1MX1A 4HFNA 4IGEA 4U00A 1JR3D 3CH6A 5KJCA 1QH1A 2WNHA 1II9A 1TMYA 1MN6A 4XYBA 5BR1A 3B1FA 4MDFA 1TQ4A 3AHJA 3OAAD 3USZA 3RT7A 4ILKA 4XB2A 2QTGA 2RK6A 2ZWPA 1P7YA 4DA0A 3R9WA 5CDSA 1T3TA 4YK7A 2GBIA 5K8VA 1TKBA 3T7EA 1GRVA 1CJMA 3LVFO 4L15A 4LXIA 3VC7A 3QELA 1SKMA 1EK2A 3O0DA 1GXSA 3IQZA 1CRZA 1U02A 2D2VA 1FNDA 3WI7A 3O94A 5KX5B 1KYTA 3WKDA 3E5HA 2PH5A 4NV3A 2WM9B 1HKUA 3OESA 2E4UA 4EJFA 3OA0A 4RF5A 3UJPA 1B8PA 3AB8A 2CLDX 3Q6NA 5LDHA 4TN1A 4HNSA 3HB5X 1J6UA 4M2LA 2AN1A 1I2ZA 3LUHA 1XYYA 1HZJA 1ZUIA 3D7RA 3GUHA 3K5IA 2QGFA 3SE7A 3UOWA 2JI7A 4URFA 4A15A 2Q8NA 1L5OA 3PCXA 3TMAA 4Q3OA 1H9BA 1NN5A 4TYYA 5A2GA 3TGLA 5AVYA 3PWSA 1XB2A 3AKDA 1JIUA 1KNQA 3B51X 4LYDA 3DOUA 5AJHA 3GELA 3LT2A 1XCOA 2Q3DA 3K6SB 3HKDA 1SOWA 5AW3A 4LF6B 3NT4A