3CT4A

Structure of dha-kinase subunit dhak from l. lactis
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
318
Chain Sequence
EKIINQPQDVVSEMLDGLTYAYGDLIEKVPDFEIIQRKSPKSGKVALVSGGGSGHEPAHAGFVGEGMLSAAVCGAIFTSPTPDQIYEAIKSADEGAGVLLIIKNYLGDVMNFEMAREMAEMEEIKVEQIIVDDDIAVENSLYTQGRRGVAGTVLVHKILGAAAHQEASLDEIKDLADKVVKNIKTIGLALSAATVPDNEIEYGVGIHSEPGYRREKMKTSYELATELVGKLKEEFKFEAGQKYGILVNGMGATPLMEQFIFMNDVAKLLTEENIEILFKKVGNYMTSIDMAGLSLTMIKLEDDQWLKNLNEDVKTISW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-bind
publication title X-ray Structures of the Three Lactococcus lactis Dihydroxyacetone Kinase Subunits and of a Transient Intersubunit Complex.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transferase
total genus 115
structure length 318
sequence length 328
chains with identical sequence B, C
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02733 Dak1 Dak1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1180.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Dihydroxyacetone kinase; domain 2 3ct4A02
3.40.50.10440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dihydroxyacetone kinase; domain 1 3ct4A01
3JR7A 3PNMA 3PNOA 3CT4A 3PNLA 3PNKA 3FDJA 3PL5A 1PZXA 2IU6A 1OI2A 1UODA 2IU4A 1OI3A 1UOEA 4LRYA 3PNQA 4LRXA
chains in the Genus database with same CATH superfamily
1VJ5A 3KCNA 4RK6A 1E6CA 3RODA 1YZKA 4JUFA 3LCCA 2IW1A 5EMLA 2Y2UA 4OXKA 1E2IA 1ZGGA 5HUHA 3E58A 1E0JA 4UNPA 3RASA 4D81A 2XBLA 4MNTA 4Z9YA 1DBSA 5U4XA 2CMDA 4G0UA 3MIIA 2GAOA 2WJJA 1RWXA 3ZWAA 5A04A 2MSWA 5C81A 2WMDA 2B1RA 1S3FA 3HJRA 2IUUA 3Q2OA 2JEOA 1TF2A 4Y2GA 4NDNE 1WXQA 2WSSD 4RPGA 4K9NA 5I7WA 3AYZB 1QMGA 1E6EA 2FUG1 3H0CA 4BQQA 4CI9A 3L04A 1DFHA 1HOXA 3PHGA 3S8YA 3ORYA 3R77A 4BEBA 3GJYA 4HTAA 1VKZA 5F64A 1LX7A 3PKJA 4DWOA 3FJOA 1QLHA 4WY5A 3ZTWA 1EG7A 4D3YA 5IKMA 2W6PA 3WMGA 3B70A 2AKAB 3WMFA 4BCDA 1OXSC 2FG7C 5L95A 3KX2A 2GERA 1YQ9A 2ADFA 3LTNC 4J1NA 4KZPA 2I1LA 4IIEA 3ZCSA 3ZV3A 4ALJA 3UMSA 4JODA 5FFMA 2LCFA 1N5IA 1V1RB 3HJGA 4J0EA 4G8JA 2I3DA 2ZRAA 3TIIA 1SBQA 4YRSA 3A4MA 4JJ4A 4CIVA 2HFJA 1H2FA 4QDOA 3V4RA 1B23P 3ESZA 1A7KA 2CB9A 4ENWA 5C52B 1S1MA 1F51E 2DPLA 3LHFA 3PEFA 4U9HS 3M8KA 4DLVA 2OCBA 3KALA 2NO6A 3D7KA 5FR1A 1OAOC 4XGQA 1E5XA 4WL0A 4QLAA 2UYQA 3WYFA 1T24A 3A1EA 3F2VA 1SKYB 2CL0X 1LK5A 3KQYA 4C7VA 1N6HA 1V1RA 2WB2A 2AB0A 4P31A 1MOZA 2H1CA 1SVUA 3O0TA 2DPMA 4JI5B 4R5HA 5AKGA 1D0VA 2PKEA 2BHNA 2ZTLA 3HHEA 5EIBC 4OXNA 1P2SA 2BISA 2PRJA 3FLEA 1CUUA 2WF6A 3GEEA 4DQ0A 3FB1A 3WLSA 3NOQA 3CF4G 1K7FB 4LKOA 1XMXA 3RIXA 2A88A 1SZJG 3SFVA 4FC7A 3WNVA 2B83A 3KOXA 3LGXA 3BWDD 3FAZA 4PFJA 2JCSA 3UJ6A 4WPGA 4LRSB 1AXGA 2MOKA 3BD7A 3HLYA 2W6NA 3B5IA 3IBSA 1CS0B 3K05A 5CU7A 2H7VA 4JI4B 3SYTA 5ALWA 4QGSA 5KVQA 1TC2A 1X2BA 2JGJA 2J9XB 4TROA 3SC2B 1P2UA 4PG7A 3AGPA 2R8PA 2D0OB 2RAUA 5IJWA 1JJAA 3F5DA 3OZBA 5CTJA 2G88A 3G9TA 3PDIB 5IS2A 1UKYA 4K1LA 1LRLA 1OBOA 4HEA6 5HGXA 4P3KA 1R5NA 1VE3A 1O58A 1Q0UA 2JATA 1R6DA 3L7KA 1TCVA 3PHIA 2WM9B 4LZOA 3II6X 1CS0A 3CHYA 4D3SA 5BRJA 1DJMA 2VNHA 2C2YA 4YAFA 3SC2A 2QSZA 1YRQA 1HDZA 4M0EA 2PA0A 5A7HA 3TLZA 2B4AA 1PG2A 3NMUF 5FTWA 4A10A 1K5HA 3HGMA 4YJGA 3U6BA 5K3EA 4WACA 3P52A 2ORIA 2CUKA 5ER6A 5DYGA 1L8QA 1MHTA 3WE7A 4FJ0A 4EO7A 3TFOA 2YZGA 1JDTA 1I3CA 3C14C 3FZYA 2YWFA 4PSKA 2A78A 5C1BA 1DAPA 3I8OA 3UKDA 4BHTA 1GU7A 3QE9Y 1SURA 1G6KA 4V3CA 1Q1ZA 3EH1A 2PZGA 3ONDA 1QV9A 3SCZA 1KJ8A 2VJMB 4YK7A 1XVUA 2QV7A 1QH9A 2NTNA 4RVNA 1W75A 3UJ8A 4XB2A 2E82A 3AOGA 2Y1KA 1BO6A 1CG6A 1MAWA 4N65A 2DAPA 4TV8F 3ZJUA 3W6OA 2QTGA 4MEAA 1CULC 1PLLA 4Q05A 1GYRA 4QHTA 1OIWA 4WOBA 2JI4A 4LNAA 5ICFA 3NX4A 1GZUA 3HP7A 1GHTA 4UAVA 2V6GA 1O2DA 3LOQA 3BG5A 2XTAA 4AY2A 5DI9A 3WISA 2PRYA 3HR7A 4BRSA 4D6PA 2HWYA 4R98A 2CMHA 1RYHA 1V6AA 2V7TA 2VJMA 4KQGA 4BO6A 4TS3A 1P1CA 1P3JA 4BECA 1BCSB 1DS6A 2IPXA 2PPVA 3OE1A 4NARA 3VVMA 4ZI7F 4RVOA 2EP5A 5KSZA 5IG2A 3BFKA 4NP6A 2GJ4A 2NXJA 4O1IA 2VPQA 4V02A 4MW6A 3EEQA 4D82A 4UXJA 4D97A 4CR8A 1J25A 1IDN1 3D0KA 3EZGA 2IDKA 3QPWA 5T41A 3WFZA 1G4HA 5MFZA 3PEWA 1OIVA 3S2UA 2GLXA 2PR7A 2D5AA 4U0JA 1Z9BA 1GTMA 4DQKA 3EIFA 4N18A 3E7FA 3QRWA 1G7CA 1UEIA 4MW5A 1K6JA 1H69A 1RKXA 1BCSA 3GFPA 4RGBA 2B8WA 5TS2A 4PZ9A 3C24A 3T5PA 1P5FA 4NICA 3RWBA 3SF0A 3QY0A 5LZ4A 4EG3A 4JROA 4BPRA 5LZ8A 1VJDA 1NW3A 2W0MA 2QRQA 3LL7A 1KIFA 1U8EA 1WXHA 3LRXA 2ZDQA 1W7AA 3JXEA 3EZ2A 2MYUA 4NATA 1VFNA 3MA0A 5JARA 2ZM5A 3I01M 3A3NA 4G4SP 1UWKA 3RH0A 4JMPA 2F3PA 1G17A 4N0MA 1YB2A 4U3JB 1OV4A 4FNMA 3A04A 3F7MA 3BCHA 3LC2O 3P5BA 4LDRA 4KR2A 2BV3A 1ZUNB 4IDHA 8LDHA 1WU7A 2Q3LA 5ALLA 3MMZA 1GQQA 4IF4A 1OB5A 3TCXB 2E18A 1EUDB 3OP4A 3X2FA 1OX5A 1YOVB 4IZIA 1IN7A 4HZUB 3F46A 3FYCA 1Q7EA 1HO3A 2AVDA 2BTQB 2XEDA 3LPCA 3PQ7A 2WWVD 1DCTA 2GF0A 3ZIDA 4CM6A 2D0DA 4OG2A 3T9EA 4ZHSA 1P2TA 2P62A 2WZQA 4KQJA 1E4YA 1I1HA 4MLPA 4U3JA 2GXSA 2WWYA 3IJEB 5A3VA 5T4FA 3QA9A 1ZUNA 2EERA 4HDMA 3LW8A 1F8XA 2C0QA 2A5YB 4GM0A 2XZLA 3PC4A 4OB7A 4NCJA 1BEUB 3K2BA 1EUDA 2VF4X 1ZN2A 1QZUA 1YOVA 4ZOAA 5K0JA 1H0RA 2DJ5A 1UC9A 2ATVA 3KLMX 3O3OB 3IPYA 1RBZA 4NTZA 4TZKA 4EATA 1EQUA 2BTQA 5JI3E 3WWYA 1K8RA 2Z0MA 2ECFA 4FYKA 4US2R 1W36D 3DO6A 4XYEA 4EX7A 3VGPA 3GEHA 3OFKA 4RFSB 1V25A 3IIKA 4D4IA 5H0IA 2H1OA 1X7DA 2Y71A 3PPYA 4PQYA 5DHFA 1YIAA 3KT6A 3L3BA 4XX0B 2QG4A 4I1IA 4FX2A 5BP7A 3BB4A 3MW8A 2BGLA 2R6HA 3KCQA 4YMSA 4L22A 2PY6A 2ABWA 2O59A 3H9CA 2WB4A 4NBNA 5B3AA 1NHGA 2I6SA 3TL3A 1LLFA 4F5DA 4MQBA 4TM7A 3W8FA 3DE5X 5G0SA 3V4VB 4UUBA 3E3LA 3KQPA 4R5MA 4RFSA 4BV2A 4G9BA 4JEHA 3R5TA 2XGMA 1JDUA 1ESDA 3IVMA 3PJDA 4DB2A 5EWLB 5P8WA 5SYAA 4XX0A 1QPBA 5BORA 4ACAA 5AK5A 1A1SA 3HDVA 1E9BA 4ZEOA 3DBVO 3W5IA 1FP2A 1YBHA 2PSHA 2C57A 3RK4A 1V5GA 1C4OA 4G5RA 2P91A 1L8AA 2X8AA 2A58A 4ND4A 4P6VF 4B3XA 1VG8A 2ECKA 1KF0A 1TRHA 1J8VA 3OZAA 3BSYA 2EBWA 4PXYA 3VA7A 1KFEB 2N47A 4IL5A 4HO1X 3GFGA 3OOSA 3RSFA 4Y2XA 1SVNA 3I28A 4TT3A 5JZBA 4G89A 2E1PA 3GD5A 4DZZA 1LFDB 1P1HA 2VN8A 3PC6A 4JQOA 5EWLA 5ERXA 4A0QA 5JS7A 4DB4A 1EIWA 3P4UA 4OUKX 2X8WA 3ZVMA 1T0HB 2ODQA 2PN1A 3VNBA 4C0KA 1MOQA 4ZMBA 4MIOA 1PWXA 7ADHA 1I7QB 2WV7A 4MYRA 4I66A 5LBIA 3WKCA 1D7OA 3ZJ4A 5M29A 4HDQB 4BKOA 2HV9A 1UZMA 5BWOA 5A4DA 2ZU0C 1EDZA 2I91A 4AF6A 3V3KA 3T7JA 4JLMA 2EZ4A 2W4QA 8ATCA 1DKNA 1Z0ZA 1HX7A 3OZDA 4J0GA 3NFRA 3R0ZA 3MWFA 3QEAZ 4OIFA 1KMMA 1N8NA 1OY1A 1T6XA 4Y9SA 2VCEA 5LD2B 1Q2UA 2O19A 2VATA 1W4BA 2VLIA 2IIPA 3H7IA 4HGPA 4REMA 1NUAA 1D04A 1IJKA 1G3MA 1ZC4A 1ZD4A 2CVFA 5DLYA 1RR6A 1WUJS 4LMPA 3SEAA 1Q1AA 2BR5A 4ZXPA 3WIVA 4N01A 4EYSA 3TYXA 3GEMA 4BU0A 1Z68A 3F73A 3DFZA 2QD1A 4DSUA 4A4DA 5ALYA 3GHHA 5BURA 3HSKA 3PQ4A 1CEXA 4H0FA 2OORA 3BJRA 1UXHA 1F2DA 1N8TA 2GHRA 4JWTA 4PO8A 5D3ZA 4ZCIA 3SC4A 3R4VA 1Y5RA 2QY9A 1UKAA 7AT1A 2HDOA 3TNJA 3MTBA 2AYYA 2JJMA 1QBKC 2VRWA 2FLKA 2UUAB 4BFUA 1E3TA 3DVQX 1E7YA 4OFZA 4WK0B 4X85A 5ECGC 5EQFA 3VR3A 3ZQ6A 2JGKA 4G5YA 1PFKA 5I7HA 4D41A 3P9ZA 3U44B 4QM7A 3W9YA 1Z0IA 1B0PA 3AGQA 3EPRA 3HSYA 3TLKA 1Z56C 2HCFA 1UM9B 3JQ9C 4YJ2B 3IUSA 4JJKA 5AKLA 2FW1A 3HKEA 4DJ5X 4X1IB 5HFAA 1L5QA 4TL8A 1FVFA 4Y1FA 2ZRLA 3H2ZA 4BVEA 1S4QA 2BMWA 2SICE 3GU3A 1Z5VA 5EZSA 4DMCA 5JXJA 2ZPAA 1U63A 5AVYA 4E4YA 1E79A 1P7ZA 4X95A 3ETHA 3PYMA 4EKEA 3DDCA 2FFBA 3O1JC 4R2WA 5CNIA 4LXGA 1SB9A 2C4VA 4YRPA 3WLLA 3U44A 1MG0A 2ZP1A 4BEWA 2J6BA 1XZEA 2PQMA 2HLDD 2WD8A 3HH8A 2GPTA 4IV0A 1QZ3A 3SE7A 1UM9A 1CY2A 1XF1A 2ZRMA 3TS1A 3L93A 4EB8A 4YJ2A 4X1IA 2C8VA 2ONJA 2UVQA 4JI1B 4DIMA 3VBCA 1HTWA 2ZDHA 1GAWA 2P2DA 2X8LA 2HJHA 1K3TA 2W83A 1BA2A 1XF9A 1FMLA 2AG8A 2IRWA 3DZBA 3OPQA 4BASA 2W48A 4FMPA 2WW8A 3MJSA 2VHCA 4KPEC 2CDCA 3A3OA 3JYPA 2JD0A 2H0RA 2GESA 3V1MA 1XD8A 4O4IF 5DYYA 2QT0A 4E2XA 4BLTA 2DGDA 1HOTA 1JIKA 1XZJA 1G9TA 1R0CA 1KVUA 4HL6A 1PHPA 3ZZ0A 4I1SA 2F1OA 3NRJA 5DHAA 2XWBF 4IY1A 5DN9A 1KE2A 3U3MA 1JYSA 3ZOZA 1FMCA 4EJMA 1JL3A 1UBGA 1HNWB 1ZK3A 1LPSA 3HA2A 1S96A 4LTDA 1N1EA 4PAOA 4QDTA 5LLSA 4BMVA 1L5WA 4FDAA 1KORA 3UGQA 1SIOA 1TMOA 1RE0A 2BTOA 2Q3JA 4GP6A 4XZ3A 3WYEA 1L6IA 2J9ZB 2WA2A 4MWTA 4N47A 2KM1A 4KQ6A 1GKLA 1BN7A 1NJ5A 5ADWA 5KBYA 2G1KA 2NNWB 1KFBB 5EMJA 4EKNB 3LBHA 2KB0A 1QLWA 1WUYA 1C9NA 1F60A 1N2SA 4MR8B 1G55A 1LA2A 4J76A 4QXMA 4DBLE 4JL6A 1ZUD1 2QAGC 3I2YX 4GVPA 3CYFA 1EWYA 4WT7A 5BUQA 2B4KA 2H4YA 3CN9A 4F7WA 1E2DA 3QFTA 2OBNA 3GI1A 2PRZA 1WZUA 3CMMA 8ADHA 4EUHA 3ZKWB 3NBMA 5IX8A 3L1JA 4G8BA 1E32A 1S2LA 2EHJA 4BLQA 3U56A 4K2HA 3JQAB 3IYLW 4CUKA 1HZZA 4LI3X 3JYLA 1Z47A 1R18A 3ZWKA 4GE0A 4LSMA 4DJDC 4LRWA 3VYUB 3Q3VA 4JEIA 4MR8A 2JGNA 5HQTA 4JI7B 3H04A 3MCUA 1DCMA 3HVHA 5BW8A 1CHNA 2VKQA 1HUQA 3L0ZA 4JSRA 1KZ7B 3DM5A 2O2ZA 3ZKWA 4AX4A 3DXZA 2G82A 4M2LA 3WL4A 4ETIA 1AZTA 2OFOA 3JQAA 2ZRIA 3BXXA 4GRIA 4WVFA 3IELA 3GCDA 2BYTA 3A0RB 5FR2A 1PL7A 5B3JA 5AJUA 4HX5A 1KR2A 3GJ8A 2WIAA 4AWAA 3BTSA 4OJYA 4RMIA 2BGUA 5IKPA 3FI9A 3U7GA 2BE7A 1V5IA 2XDWA 3BTOA 2VDQB 1NFFA 1H66A 1B6GA 3D5TA 1VGQA 1ZI6A 1L8LA 2EFYA 1B8OA 4GI3A 4I46A 4W5OA 1XNQB 2VXBA 4E14A 1W35A 4JX8A 1A9QA 1BROA 2GN6A 4L5AA 2ZJOA 4NYJR 3IQEA 2GJAA 2Z09A 1ZR4A 4I4IA 3FCEA 5AJYA 4EG1A 3K7EA 2G04A 2FMXA 4OJTA 1FSZA 4AK9A 1SJ9A 4FDLA 1PD1A 3EG5A 1Q22A 2BRUA 2R8RA 4NPHA 4R2LA 5B58T 1EWTA 3WICA 1MO6A 3VNQA 4AKEA 1ZZEA 3KXDA 2I33A 2H2FA 3PX3A 4GP7A 4Z51A 1WCIB 3DEJA 3VYWA 4WXPA 4MI6A 3B53X 4JENA 5JCPA 3DEFA 2GKOA 5HM6A 5BMVA 3IMKA 4GI1A 1T9KA 3SX4A 5JAPA 5IWAB 1I9CA 4NULA 3A1DA 1OAAA 5C5CA 5KI6A 1VZ3A 3GRFA 1N75A 3KOYA 4JZYA 4TZ6A 2QD2A 1UXKA 2RG1A 3U3RA 4O2BB 4CCWA 4PCUA 1MA0A 1TRKA 4QU9A 5CFNA 1O0SA 3MCZA 4RF4A 3TAXA 1YUNA 1EB8A 1HL7A 1WNFA 2CE2X 3DAYA 5SZKB 1AKTA 3SDSA 1WCIA 3IBGA 1TTHA 2GN4A 3DFMA 1EUCB 2Z4SA 3OA2A 3DTYA 3S2GA 1Q6ZA 4HWPA 3EFHA 2O3UA 1IWOA 3L7CA 1K7EB 4OB6A 4PWYA 4NONA 2AJBA 4MQLA 3MTAA 3MRXA 4EMBA 4DPMA 2OHOA 5LXTB 3CMCO 4Q9KA 1C0IA 4O2BA 5TX7A 4YMTA 2DECA 4AY5A 4C7MA 3ZXSA 1DQZA 1L1EA 5KNCA 2EP7A 3JPWA 4KBGA 4RPLA 2XZOA 2IA5A 1T5LA 3F6PA 4A2WA 1KIAA 1EUCA 4O4LB 4WNCA 4K3VA 4QYMA 2NPIA 3CLUC 3VR4A 1G19A 1PWEA 2OC9A 5A2QA 1ZLXA 4KB5A 2O4CA 1V95A 2AF4C 2D62A 2WSYB 3PUJA 5KSPA 1G5HA 4OHOA 5E1BA 5JW6A 1GAJA 1LLUA 1J0XO 2Q21A 3ZY6A 1ISIA 1A9PA 1ULBA 1JGTA 4AKSA 5LXTA 2F1RA 4LMBA 1C4KA 1N0WA 4IGIA 1VYVA 3AR8A 1WW8A 1W4ZA 4EH1A 1JU3A 2FWBA 2MT9A 4RY8A 2PS0A 1II9A 1MNQA 3S5JA 1W0CA 3ZDQA 4ARUA 4O4LA 1N34B 3F49S 3C3XA 1L2TA 3OCVA 2QE7A 3ACDA 4TTQA 4KWEA 5DHUA 5KPJA 4G5QA 4CF4A 3LZ6A 5HF8A 4JP2A 3K5HA 3AEXA 4MKGA 4QXPA 4B0OA 3H97A 4PNHA 1N2IA 3K6SB 3OD5A 3IIEA 4P7GA 3LY9A 3FIJA 3KQOA 1AO3A 1LLCA 1LRKA 3CX8A 1HK7A 2C7VA 2Y0CA 1NZFA 4TRMA 1MD9A 1QX3A 2R3SA 2W2VA 3S7ZA 2BMEA 3JWHA 3AI2A 4KDRA 1M1YE 1NGSA 2ZUBA 1XRMA 3C8UA 1C9EA 1K66A 3R0VA 3PD7A 1IEXA 4MQ6A 3U13A 4HG2A 1YVPA 3T7KA 3F5QA 2X3YA 4EJ6A 3T3MB 1TQDA 4IXWA 5EZ5A 1E2UA 4D4JA 4YP5A 5IZ4A 4CEJB 1NLUA 2RAPA 4I1YA 3NPMA 4J0FA 5CNKA 5AM0A 5JROA 1PP4A 1AV6A 3ZLTA 5DNCA 3K6SA 1GRCA 2PBFA 9LDTA 2O5EA 3AF5A 4KR6A 2P2SA 3COPA 3DE2X 3KVRA 3T7CA 3ADBA 1O4VA 2B8NA 2OCLA 2WOJA 3N0TA 2VHVA 3STUA 1WPQA 2B8JA 1SCNE 3ZHCA 3FR8A 5KIAA 3DL0A 1Q16A 2EV9A 2RIRA 4D8VA 3KQKA 3L43A 4CCYA 2Q9BA 1Z13A 3AUYA 5BNFA 5A1TA 4QEKA 3WV4A 4ZOLA 2FQWA 3RI3A 4F2WA 4CEJA 5I01A 4EEKA 3SYKA 5BPFA 3WOVA 2C97A 4A3SA 1Y4SA 3AIOA 1I24A 3PF8A 4P08A 5ENDA 4G41A 2XCIA 3L02A 3RPEA 1MVOA 4BLWA 2ONKA 3KVNA 4OHWA 2OGTA 2HWWA 4ZALA 4ZYXA 1CDZA 3FDIA 2B61A 3RARA 3TB6A 3Q1LA 1NT4A 1DPGA 4H17A 3FSJX 3JRWA 1Y0BA 2X0RA 4J9VA 4ME6A 2HMSA 1N6NA 5FBLB 2WZDA 4F4JA 1UJBA 4FOLA 2HIAA 1VLQA 3TTWA 3PYXA 2VJPA 4RCZA 3KG2A 4ROSA 4M1QA 4M9RA 4MUBA 4J0KA 4CKBB 1NSYA 4MAFA 5IN5A 1JSXA 1R0RE 3WGOA 4A16A 4DJJA 4YREA 2UZ1B 1Q1NA 2PBZA 5JLJA 1A5ZA 2A14A 2J5KA 3BOSA 5FQNA 2Y99A 3ZY2A 1VLHA 4KSBA 4W5RA 4RPJA 2X0EA 1JVBA 1NW8A 1R6AA 2QQEA 3PXXA 4HYEA 3UMVA 2QR5A 2WSBA 3HUUA 1QHIA 2WKPA 1NJFA 3IOBA 2JJQA 3Q15C 4XD7A 5D87A 4K6OA 3HFGA 2IPMA 4ZGGA 2FB9A 1PR5A 3A9SA 3JZDA 3U9SA 2UAGA 4WQMA 4CETA 1OH8A 3I9OA 2FSHA 3B1KA 3EAQA 1T9CA 2DP4E 4CKBA 5JVDB 3W6PA 5ESXA 5AW4A 3GJTA 5JUWA 4ERXA 2UZ1A 2XUHA 4AJ2A 1S9DA 3N1UA 1WCYA 8OHMA 1Z6ZA 2VTEA 4BEVA 3PC8C 3QLUC 2PL9A 3ND6A 3G2IA 1L5FA 1QCYA 2FYTA 4G85A 2FP4B 4YMVA 2H08A 2FR8A 5F1KA 2W2TA 5JBNA 2BLNA 3ET4A 4XFDA 1Z6PA 2QTMA 1KY2A 1K6IA 3HCRA 3K0KA 4FEEA 5JS8A 5JVDA 4MULA 2ZROA 2K6GA 3BRCA 4LY9A 4Q3NA 5BR7A 2P4SA 1GSAA 4DEXA 5NLLA 2HMYB 5E4JA 2BI8A 2ZCUA 3UATA 2P2CA 3C6ZA 1NJ1A 3N07A 2QL7A 4JQZA 4URXR 3SZMA 3TB4A 5HZHA 3OKAA 1MDFA 1WVIA 4DM3A 4GU5A 2AN3A 3AFNA 3AILA 3BF7A 4PPFA 1XRNA 4Q48A 4YS6A 5CG2A 4G4JA 3AR4A 2FP4A 2ZB2A 3CO5A 5C1PA 1NE2A 2XHEA 3ENWA 4IEIA 5TQ0B 5BR4A 4XYLA 1LQTA 2G63A 1EFVB 1DTWB 1W29A 1F6WA 1YACA 3W34A 3U48A 1QHYA 3BCRA 1U0SY 3CNBA 3PJRA 2ZS8A 5CX1B 2A33A 1QCDA 1J00A 5E2BA 1VKHA 1NF8A 1YQXA 5J23A 1W2HA 2ZREA 3BXZA 4Y2PA 5JNSA 1A96A 1F0NA 2IU3A 2XE8A 3MBOA 1Y42X 5CK5A 4Z4EA 2QRUA 4MVJF 1Y1KE 4Z6KA 4TVBA 3WMXA 2ZUFA 1U0TA 3VAAA 1ISJA 2XYVA 3VO8A 1QG4A 2FZLA 4GGOA 4R1OA 1FXUA 2M98A 1RXVA 4FXPA 1WHSB 1EFVA 1DTWA 1NVUQ 3KM0A 2HPZA 4IH4A 4C2BA 3TQCA 5A02A 5K01A 2P2LA 2NXEA 3QU9A 2O3JA 3M5PA 5CX1A 4TSRA 3PTLA 1XDWA 2YWRA 3SYRA 1QG6A 1T34A 1UZLA 3OQHA 5IBRA 3TQTA 1SQGA 4DMUB 3VOSA 5ICEA 4F84A 4US0R 1PEKE 3ESYA 3OOJA 3NEAA 3D7SA 5ITWA 2FGKA 4X9XA 5FAKA 4CV0A 2Z30A 4TT3D 4MUIA 4ZV7A 3S55A 3CXUA 2WUVA 2Q8NA 4GPD1 4GPZA 4BLUA 3HBNA 4G07A 4RTJA 1WHSA 3HVUA 2J3KA 3PUKA 4L28A 4YI3A 4QUDA 3TUIC 4UUPA 4W8GA 3HN6A 3N6VA 1AXRA 2CHGA 3FMIA 4TVOA 4DNXA 1ISHA 2ZR7A 4H08A 5KYTA 1N2CE 4P7JA 1Z5WA 5C1DA 1KJ9A 3KEGA 4TTIA 2WM2A 5JAUA 1JAIA 4ZT3A 1TT5B 2WWFA 3NTOA 4NBKA 4UCQA 3U62A 3UCFA 1JU4A 3C3CA 4YHHB 2EDCA 1H2BA 3IP6A 3ZWYA 2R8OA 1N5DA 2BSAA 2GHIA 2AZ4A 3OPYB 4GMFA 1FK8A 3EXG1 3WIBA 2B21A 4AJLA 5BSTA 1J0BA 2YW2A 2LNDA 3SEFA 2R4TA 3O91A 5EMHA 3ZDRA 2HU5A 1NW4A 5B7PA 1YL6A 2QMHA 3QVTA 4B3HA 1Z22A 2N75A 2A84A 3H83A 4GNKA 5CDSA 4A0FA 5HPYB 4GD3Q 4ZPXA 5EJIA 2CLCX 3P9PA 5YASA 5IF3A 1MABB 3HUTA 4IQFA 1TT5A 3MT8A 5F2EA 3E27A 3WNBA 5ALQA 1KETA 4UVEA 1MAUA 2DFDA 3OPYA 1ZKMA 3QXGA 3JQQA 4GM1A 2GD2A 1LS1A 4YCMA 3EASA 3R3WA 4H1TA 5DT2A 2XY4A 4EDFA 4DC9A 1EBUA 3T4PA 5AW3A 4ZT6A 3L5KA 3UMYA 2HW8A 1C1HA 1T4DA 4INAA 1E1RA 2WJWA 1ZAKA 4E1AA 1MABA 4GPIB 4OGKA 4RADA 3VR3D 3K0CA 1SBHA 1YUMA 2ICAA 1G21B 3IDQA 2ILTA 4R16A 1CY7A 1WXIA 3P20A 5JAQA 1JALA 2CL5A 4EEXA 1YQGA 1TIKA 1LSUA 2G1AA 3THRA 4HN9A 2H92A 2ZUEA 2A0KA 2GK4A 3PD0A 5D86A 2H8GA 1H5UA 2COUA 1Z82A 3IJPA 3OZXA 4M6WB 4JVSB 3Q7TA 2YN2A 3K6JA 3DEAA 4M86A 3AF1A 1Y8RB 3AK4A 2J3LA 4ONEA 3TSWA 3LHDA 3QXJA 1K08A 5FYQA 2ZFUA 1Q83A 3I45A 2WSLA 1QB8A 1SKBA 3ZEIA 4WUVA 4DR6B 1XZFA 5KJCA 5JOQA 5T6BA 3HWSA 4P93A 1O9GA 2JFHA 1ZCAA 3D3JA 3NGXA 3QX9A 4KLZA 3RLFA 5L51A 2IYFA 4EY7A 3QEOA 1QO7A 3PKZA 4MVJP 3V42A 1FLAA 4UOEA 1F14A 2C94A 5B55A 5KTKA 1Z15A 4IG4A 5K3AA 4DPKA 2QPLA 1Y8RA 3F4LA 4JJ8A 4PN7A 4ENSA 3NAQA 2VQSA 3EA5A 2OL4A 2R4UA 1NULA 2IIQA 4UEKA 3LVFO 1IXYA 4F46A 4JIGA 1Z74A 2PQ0A 1TAGA 1UP7A 3VZSA 1MC4A 2R6GA 4GNRA 3FOFC 1BFUA 2AGVA 3E48A 5JATA 1ZH4A 3IX7A 5B7NA 3CB4A 3PB3A 2AQIA 4HQKA 1QIGA 1WUIS 2HHJA 2JRCA 2VRBA 3N39C 5J9FA 1DDGA 4MX8A 4BVHA 2AUNA 2WUEA 4JUDX 1WUTA 4PZZA 1RQNA 4KGVA 2HK6A 2V0GA 3AI3A 3CUKA 3U61B 3KWMA 2EWVA 1T4BA 3K0AB 4KXLA 5CLJA 2Y77A 3NCHA 4U4AA 4YRMA 1SXJC 1CZLA 1NRWA 1VSBA 3PA6A 5GMOA 1A9SA 1SBZA 1FNSA 3QBVA 4RDCA 1OE0A 3IP3A 2IHJA 5ER9A 3TJMA 5FBKA 2EVWX 5JS2A 3NIWA 1C7IA 1VKJA 1T4CB 5GTDA 3B3GA 4X8HA 5M3BA 4BE4A 3IAS6 2FPRA 1M83A 1QKKA 5BN3B 4FTWA 4DF3A 1FUKA 1M8JA 5K3CA 2ZATA 2XTJA 3TTSA 3C3EA 2C2ZA 1JTVA 2I2FA 3K0AA 1ECLA 1ZH2A 1HH4A 1B26A 2VHYA 4PC3A 1GEGA 2M2IA 1QHNA 1YKSA 2E89A 1NI5A 4DDVA 4ZI7B 3ASVA 3VAZA 2UYCA 1G4UR 3B1YA 4TV8A 1A5TA 2QR3A 2JFFA 2QJTA 4Q1BA 3N2NA 2VP4A 5EJAA 1B8VA 1HV8A 2DQYA 4P5DA 3S27A 5JY6A 2A5FA 2ESRA 1GYQA 1T4CA 1OGYA 2Z8XA 3D6FA 2D2XA 3NALA 4IOKA 4DABA 1E2HA 3LXUX 3LLSA 1YO6A 5BN3A 1V1JA 1Y98A 4FW8A 1KTIA 5TC4A 1UP6A 3OLCX 4CQLA 1U0RA 4FHFA 1W5SA 2ZIXB 4LGMA 2XITA 4BUCA 4GAEA 1ZVQA 4ZI7A 1XK6A 5FBHA 3KZOA 1SFRA 4MUGA 1A7AA 2ZYAA 5AVUA 5CFRA 1RVV1 2MSDB 2PWYA 1PHRA 2ZRKA 3FTCA 4J6EA 3VVBA 2HMAA 1LZKA 3JQAD 3K94A 4YLEA 5DW0A 3OZWA 2CNDA 4HFNA 2Q27A 4RJJA 4RW0A 3UJCA 5JAIA 1A95A 5EIFA 3V4SA 1Q0TA 2J6HA 2J0EA 3C7AA 3VPGA 1GQ2A 3ADOA 3HU1A 4HTFA 2VHJA 3IHLA 2ZIXA 3TZCA 1H1LB 4CI0B 4C7KA 3PEUA 2Q28A 1Z4IA 4OKSA 2YJ3A 2YX1A 2E87A 1X42A 3VJMA 3PKIA 5HJ5A 4NU0A 2B0CA 3N3BC 5EA2A 2FSFA 3ICCA 2Y66A 3OVMA 3W2FA 5C37A 1MCZA 4FX5A 1Y3AA 1I36A 4U7HA 1JMVA 1T13A 5DK6A 5EWMB 3UK0A 2PYDA 4F5WA 3GPLA 3UPTA 1Z5PA 3KQQA 1IHUA 4HATA 1YZQA 1NF3A 2I71A 3FNEA 5JT1A 1H1LA 1SCQA 1PQWA 1V8FA 3C6QA 3PGVA 5FA5A 1Y6RA 3DQPA 1FU4A 4YNBA 4BS9A 1KU6A 4FWBA 3ZWMA 3FWHA 4BFXA 3OUZA 4PRKA 2Y1XA 4O1MA 2I66A 4IVPA 1SA0B 4K05A 1RM5A 3SIRA 4IDDA 1JHQA 2J3JA 2FW8A 1IONA 3N75A 5LOVF 3Q3EA 2RSLA 3TQRA 3V2IA 3L4JA 1WUKS 1M2FA 4MINA 4L8LA 3UW3A 1EK2A 1XCMA 1ELOA 4C2AA 1EVQA 5EXSA 3BMOB 3D02A 3GA0A 2PYIA 3KZXA 3WP0A 4DIFA 1AZWA 4WE3A 4B76A 1UIMA 3FI0A 1IQRA 1STOA 4J94A 3ZJVA 2IEIA 1SA0A 1M73E 3GFFA 4JUBA 4IMPA 2V1UA 1OBFO 3GLHB 3ETJA 4X60A 4Y18A 4KXQA 1ECPA 1NU8A 4TWRA 3T5AA 5KNCD 3GRPA 3PT9A 2DHRA 3AM5A 1JTEA 3P96A 4YFVA 2OO5A 4P33A 5GV8A 5JSQA 2JFGA 1DRUA 3ITDA 1XEWY 1NIJA 3Q88A 3VR4D 4DV2B 4NRDA 4FN4A 3QVOA 1C2YA 1K6EA 4NHEA 1ZGCA 2ZJ8A 1LH0A 3BMOA 2YFHA 3T6KA 3EGOA 1N5MA 3K35A 4NXNB 1H1DA 1NNI1 3J7AC 4MLZA 1NLMA 4KYTA 4GWGA 1MQAA 3LPNA 3GLHA 1X1TA 2VYNA 4XVQA 2W98A 1Y6FA 2OKCA 3V8NA 5AOAA 4GSYA 4BFWA 1ZESA 3OLVA 2HX1A 2X8BA 2F48A 1H6CA 1F0YA 2Y1CA 1OYYA 2V9PA 1KVRA 2OAQ1 1Z5NA 1E99A 3CUWA 3JQBC 4JH0A 3L0BA 1PGJA 2QE7D 3B9BA 2DKNA 3UTDA 2EX0A 2EQAA 1HE2A 1JLHA 3QF4B 4FFDA 3ER8A 3VDRA 3M49A 3EXIB 3LQKA 4PFQA 1M66A 1NAIA 3CUVA 1KXJA 1JG7A 3PRHA 4UTZA 4ZVVA 1KKUA 4FW9A 1PRYA 1UPFA 3GH1A 1JFLA 2PL3A 1OFUA 5CURA 1BVUA 2WF7A 2IYVA 4ANFA 1IEQA 1U2DC 1YD7A 4K1XA 4EF5A 3ZU6A 1SZPA 1N7GA 1UFKA 2BKUA 1LW7A 5DT9A 2FFRA 3EVNA 1Q0QA 4Q3LA 1R0YA 1G59A 1O87A 2E6UX 3UTCA 3Q8MA 1U4SA 3IDAA 3R3HA 5MGNA 4M1TA 3EXIA 4M60A 4CF6A 3DOCA 4XWOA 2W6MA 1Z6YA 3BCUA 3KTOA 3LV8A 3ZJTA 4BN4A 5IDVA 1SU8A 2EKQA 1RWPA 3ZVNA 5CIYA 3MGGA 1RI2A 4I2VA 3O2JA 3WBJA 2WPDA 1ZL2A 2CBZA 2CJWB 2WFMA 3JPYA 4JHLA 2M6KA 2C2BA 1F6BA 1FTWA 3TMYA 3AT1A 1THGA 4B82A 5K0TA 4ZA2A 4KHZA 1BDIA 4LE1A 1MX9A 2ZJ2A 3VGJA 2ES4A 2D4HA 3OQJA 3MLEA 4O0MA 3CW9A 4CPDA 1C8BA 1DV2A 4Y1RB 4EUKA 2Y9MB 4QG3A 2X0JA 3K4HA 4XIYA 4L4SA 4PYMA 2EWMA 1OI7A 1Q74A 2CJWA 3PL1A 4TSFA 4XVRA 3PXDA 4BC0A 4GBJA 5IRCD 1U3CA 2HYDA 3MWJA 4XLTA 2Y8EA 1NPDA 3O1LA 3PWZA 4TLMB 3OO0A 1IC6A 4RHFA 4DL9A 2AJ8A 4JI0B 3M34A 5KC8A 4YMLA 1N4DA 2CDBA 3I4CA 3MCAA 4UEWA 4ZICA 2RKOA 4FFNA 2D5CA 3MGCA 4L9WA 1U28A 4FFVA 4QPNA 1TZBA 1NI3A 2PFKA 4Y1RA 1E94E 3QXSA 4RIHA 4Z2YA 1RHRA 4KRXA 1Y7PA 1KMNA 3AM3A 3HACA 5CM2Z 1BFKA 2XWJI 4DR3B 4CODB 4RKRA 1LNSA 2OLEA 3R7LA 3RREA 1PL6A 5BSHA 3AW9A 1CQPA 3UA4A 2I7XA 5FNVF 3NV7A 3DHVA 1MUUA 2FEKA 4XD7D 4Q7LA 4QTTB 2I4RA 3EA0A 4M49A 3Q40A 4B8ZA 1ZDMA 5JJCA 3ZXUB 1BOOA 4M0MA 4I0WB 4X65B 2ZRQA 5CT8A 1ETHA 4FYXA 1K7YA 4GQBA 1FYEA 3P9NA 4NF2A 1W85A 3TEJA 4OBWA 4E5DA 3SD7A 3WOHA 3MHPA 2OSVA 3MN1A 3RVDA 3VVLA 4O4IB 4RZ3A 4MUAA 5K0LA 4QJ5A 1IPHA 1WDMA 1RC8A 1RQGA 4U7TB 1VLZA 3AY7A 3Q2IA 3SYMA 2FCAA 1I2AA 4IVRA 1HFEL 1W8IA 2CD9A 4K8OA 1P0FA 4PYIA 5B37A 4URVR 1C3EA 2BY4A 1CERA 4NPAA 1YJBA 1T9GR 1XZMA 4LPSA 1T2AA 5E7MA 5KNBA 2BT4A 5ILGA 2VJOA 3TW0A 3TSOA 3S68A 1PUJA 1E8NA 1JV2B 4A1OA 1MOSA 2BKXA 1QOZA 3PCTA 1S0UA 3TG8A 3OHPA 3DT8A 2QRMA 3BIFA 4O4IA 4AQYB 4A7PA 1KGSA 2FW0A 2IS2A 1P17A 2OMKA 5B1DA 4EAAA 2HI0A 2HA2A 1N6KA 1EFTA 5KYKA 1DKOA 2ACKA 3JAKB 1D5CA 1Q77A 4YO7A 2JIMA 3C4QA 3VM6A 1LNQA 2KYRA 2NYUA 2ZUDA 2VK8A 1VTKA 1K3FA 2P6MA 4FR2A 4IPTA 3AEYA 4D8UA 3KUKA 3OMLA 3FVTA 5LMNB 2NMVA 4LUCA 3D8SA 3IP5A 3GMTA 2QTZA 3EQZA 5HOEA 2R7NA 2JHGA 3H2YA 3BJEA 1RMQA 3L4KA 3BVPA 3CNOA 4N0QA 4KUHA 1P9RA 1PYDA 1N57A 1XDDA 2AK3A 2G06A 1H3FA 2JW5A 2YUTA 3DAOA 3DO8A 3JAKA 3SSOA 4CL3A 5B3KA 2ETXA 3DF7A 1UJNA 2BFDB 1GZVA 5EQDA 1X7WB 5GWXA 4YEDA 5LUBA 5DH9A 2PD4A 4BB0A 2RBKA 5D6OA 3MJEA 4RORA 4N5LA 3MNFA 1LV7A 1K4KA 2X14A 2DQKA 3G6WA 5D85A 5IT4A 3RS5A 4AL4A 4GI7A 3E4CA 1Z37A 4KQCA 4L4UA 4II3A 3W05A 3MRTA 1KK3A 4IM7A 5JC1A 1VIMA 1LKZA 4KV9A 1L8OA 3SBXA 5JEEA 3UICA 3WLEA 4PX5A 5ALOA 1S01A 1YVEI 1IXZA 2QVCA 4G5FA 3B7WA 3EIWA 5K5EA 2A9KA 1SUPA 2GNAA 4E5YA 1SQ0A 5FHQA 1NJ8A 3AMVA 2OPHA 2BFDA 1TF7A 3HJBA 2YHIB 2WQZA 3QV2A 3L07A 4RXUA 1QE3A 2FA9A 3Q9NA 4IMIB 1P1BA 2DTXA 2JIZA 4NFHA 4QAJA 3N7AA 3R7AA 5IEBA 1ZLYA 2DTDA 3QX7A 4FPXA 4P7FA 3OLQA 3TX6A 3VUEA 1PJ8A 1XCBA 2P8JA 5F7ZA 3AC0A 1RRKA 1FFXB 2R8XA 5COBA 3V80A 4KNVA 2PXCA 1DJPA 4JJGA 3WB0A 4D9NA 1YR6A 1UZUA 3FKQA 5KMGB 1DIGA 4YRBA 1Z29A 3K0SA 3SJ7A 4BO7A 5JNTA 2XMBA 1G5PA 3AZOA 3HM9A 5SZIA 2MYTA 4H1VA 4MMZB 3HB9A 1VECA 4NAUA 2UUOA 3TIFA 2A86A 3QJYA 2HRBA 1IK6A 2XVAA 2EQ5A 5JRJA 1BE0A 3QEMA 2RHLA 2VNKA 3WRXA 1FFXA 3CPJB 5E3IA 4N8SA 4D44A 3F6CA 1AC5A 3P4YA 1O94A 4KFTA 3B60A 5TQ2B 4ZI3A 5KMGA 4C87A 1ESCA 1X8LA 3IR6A 4PZPA 4R9UC 4X3PA 4WJLA 4UUNA 3BA6A 4AZ3A 1GSHA 1G6Q1 2J0VA 2ZBGA 5HUQA 1PTJA 3HNRA 2FHSA 2EKZA 3Q3IA 3LHIA 2Q3EA 3NDBB 2H8KA 1E1RD 1J2JA 2PZ8A 3PNPA 1XDSA 1RLOA 1UZNA 1T1SA 3D3EA 4JJEA 5C5DA 2VF2A 4YDSA 3V7FA 5LZ5A 2ZI7A 1XEXB 4C0JA 1NVKA 3KPYA 5TQ2A 4Z99A 3H05A 3MXOA 4OI2A 4CDRA 1AGPA 4QYWA 5TMPA 4WLOA 4I50F 4KUGA 4X93A 1XYVA 1GPJA 1DQYA 1EWQA 1LPMA 1Y8QB 1E5VA 2JNWA 3D8BA 5KKCA 1EVJA 3ENZA 3FNBA 3EIHA 4O08A 1VJTA 3DP7A 1AMUA 1IG3A 4LK3A 5BT8A 5FF9A 4D26A 2OILA 5I4IA 3HTXA 3FNHA 4Y2HA 3B6IA 2EWWA 4FMDF 1ZXXA 4XEHA 5DX8A 1NP7A 2VA9A 2HHLA 3OJCA 3D8NA 4LA4A 1QQ6A 4E0BA 3E0QA 3FFTA 2EG5A 2LIVA 3UWDA 2IZ1A 4PXSA 3VPDA 3DXFA 4DTCA 5IHXA 1N32B 2IHNA 1E1QA 2NT4A 3R9XB 3WHPA 2V7BA 1Y8QA 3G0CA 2Q45A 3CLKA 2JEZA 1XQWA 2NO1A 4HAZA 1K8QA 4OU4A 4DLWA 2ZJ6A 5JRZA 4RZHA 1R5JA 4KX3A 3RUDA 1JFRA 1BD3A 2IS6A 4BAUA 4OQLA 5FV4A 5KYNA 3LVQE 4QBHA 3MOIA 2I2WA 3QE4A 4E2ZA 5GIPE 2IS4A 5JCOC 1XCOA 3G6KA 1XVTA 3CVUA 2ZE8A 2XUOA 1HQCA 3J80A 1WP4A 2CXHA 3DT6A 5J5CA 5T57A 1XPUA 4HCJA 4TQGA 5CMLA 4J2TA 4UDOA 3GZNB 3W06A 3A9VA 4AS2A 3R9XA 4Y2RA 4E7OA 1XQVA 1KZ6A 3LXMA 3U81A 1F0PA 2E2WA 4RTPA 2D5LA 2P7IA 4Q03A 4ZQIA 2QQFA 3CPSA 3BDIA 2CYBA 1JVNA 1QK4A 4LOHA 3BIJA 4L02A 4YV0A 1U6IA 3VKWA 2HQRA 2UV8A 4WJKB 1UC8A 4AJHA 5HRAA 3RBXA 3WWZA 3BERA 1AMNA 2Q46A 1CETA 1A1VA 3RT1A 5JFTA 4D9BA 4Y0VA 4YRZA 1PR9A 1ZC3A 1W30A 2A9RA 2DMRA 4KFSA 4XCVA 2V9CA 3IV6A 3BXEA 2X6QA 4H77A 1NR1A 1JHMA 2PLNA 5KQRA 5F76A 4UOQA 3U6KA 5DIFA 4UM7A 1N2BA 4NZYA 4B6QA 4U2GA 4RZIA 2WYHA 3IV9A 2IYOA 5JZVA 3O7MA 4L75A 5SY9A 5J4HA 3REFA 3D3WB 2Z6QA 4HWGA 1PZNA 2Y6UA 1U8ZA 5DGHA 4IV8A 2D6FA 1NVFA 5KNDA 2YVLA 1B0AA 5H8WA 3FZEA 3W5UA 4MWEA 3AU9A 3WGTA 5HZKA 4B7CA 5C51B 2VT3A 2CK3A 3OF2A 5AK4A 4OK3A 4Y9DA 4BGUA 3ZI0A 2I2AA 2VDKB 4J7XA 3F6YA 5H16A 2F1KA 2ZZMA 4HEA1 4EY4A 4UMFA 3ZQ4A 2WIDA 4W5WA 1SUFA 4GEKA 3UK7A 3F74A 3T1OA 3AVXA 2OFWA 4BJ5A 2X0FA 4HN4B 2J85A 4W99A 2ISSD 1WPXA 1NR7A 3GCGA 4ZVKA 3D3WA 1O96B 2WABA 4QWWA 5EAIA 3NKLA 1M8FA 1PKXA 2VHQA 4XCXA 3O8BA 1U98A 2V54A 3QY9A 4YACA 3HLKA 1SO8A 2AFHE 1YRHA 3P97A 2PVPA 4B17A 2AOUB 1DKMA 1Q15A 1Q1QA 2Q29A 4RVUA 1U2PA 2VAPA 2E4YA 1GTJ1 1QV7A 1SC3A 3ABSB 3QXHA 4UE6A 2IHYA 3GZTB 2DQZA 3IPAA 2IV3A 3SR0A 1TK3A 2XVYA 2QSUA 2WVJA 3ZE1B 2P78A 1SC6A 1VA4A 4BVJA 1R0ZA 1ST2A 4ATNA 1RVDA 2PX8A 1UMBB 1JHOA 3OA0A 2HQ1A 3D4BA 4JA2A 2Z83A 2DFNA 1N0UA 4J1TA 1V3TA 4F8YA 1MJGM 2ZVDA 2Z4RA 2AG0A 2I29A 2BFPA 3EBLA 3F5MA 3GJZA 2GD1O 4PZUA 2YOFA 2RKBA 5HF5A 1HE8B 2H52A 2VHTA 3QFSA 4MA5A 1XPOA 4W82A 3QSYA 1BQEA 1R8JA 5HMMA 2G4VA 4EB0A 1P2BA 1NZJA 1VGRA 1UDAA 3V1LA 4E09A 2GZRA 1UMBA 2BDEA 3MAGA 5G1PA 5DKFA 5D3KA 1CUGA 2X58A 4TMWA 2CF5A 3U60B 5EJ7A 3DZGA 4QFCA 3RC2A 3I32A 1E9RA 5J5VA 3ID6C 2B30A 2D2EA 3EPJA 4B4WA 5ICGA 2C0PA 3MPOA 1L7QA 2ACEA 2IEZA 3OOHA 3Q5EA 4ND3A 3QLEA 1CZKA 4KBFA 2EBHX 1Y8CA 3JRNA 4R1TA 3H1GA 3JZMA 5GOZA 1E2QA 4ZDWA 1ULTA 1GU0A 2C2GA 1DARA 2D0IA 3HXTA 4R8SA 3T7IA 1U8UA 3UHOA 1XDZA 4IDNA 1N6PA 1AKRA 4MUYA 1VCHA 3DZFA 2HC9A 2O2JA 4YJ3F 4NNPA 1BJTA 1SG9A 2QW0X 4BO1A 2AXPA 4YXFA 4QPPA 3TLJA 3SG0A 3E8SA 2XMPA 4YXWA 2VYND 1IJFA 3TAUA 2PSEA 1J5PA 1R8QA 4I8DA 2MSCB 3MBIA 5ADUS 4NZOA 5LJIA 3UAWA 4BVAA 4F9TA 1ZH8A 4MVJA 3V8VA 4K6CA 5FBRB 1NONA 2RI0A 1NBHA 1TJ4A 2WWHA 2F3UA 3CRMA 5KQGA 3U3KA 3ICEA 3OUUA 2C78A 1QV6A 1QS0B 2O3SA 2XQVA 3PR1A 4AG6A 5FEUA 1P9LA 4IHQA 3VC3A 3QIAA 2WHRA 1Q91A 2XJ4A 5IYZF 4LRXA 3ZBUA 1IHPA 1LJUA 5LL6P 1MO4A 2BOVA 3GT3A 3V8EA 2H5JA 3I5AA 5EVCA 3FTQA 3SC6A 2NSJA 4OBXA 1Z73A 3AONB 4YP0A 4QIHA 1U2RA 3NNDA 3A2KA 3ZQKA 1RRVA 2AMLA 1KH3A 2WKSA 3HCAA 2N1BA 4UJ5A 3FYHA 4X63A 2DUUA 1U1IA 2ZTVA 3D4LA 4HADA 3A14A 4M9QA 4WEQA 1JVSA 2O52A 1RAGA 3JYNA 3WK5A 4TLDA 3DMGA 1KDOA 2ZETA 4NMMA 3FZQA 4P3YA 2WDPA 5CHEA 2R66A 3HZHA 4OFBA 3CZCA 3HADA 1KI6A 2WF9A 4UEOA 4BZQA 2WTBA 4H6XA 4DIUA 1QGAA 4JT8A 1GFIA 1RQPA 3GXOA 4K86A 1CY4A 3OZCA 5LPNA 3E3AA 2WWGA 3G8BA 5AOCA 5FUMA 1HXHA 1N5OX 4LHZA 4LV5B 5CD9A 4KFRA 2QZJA 4TMZA 1EUYA 3TTTA 3A9WA 4DS3A 3AYXB 5M7EA 1Q1GA 2V1XA 3KLNA 4BO8A 1U9YA 5AM1A 2FFAA 5E0OA 5KTPA 1ES9A 2Q5LA 5D1HA 1AQYA 3EFOA 3NASA 3W2EA 3UOGA 1XU7A 2CDAA 1FYWA 4IXMA 4XH9B 3AVYA 2AR0A 3ANTA 4TSFD 3OFSA 1JG2A 2ANCA 2XIJA 2C96A 3B13B 4KMRA 4NEQA 4ON9A 1RFLA 3WMRA 4XX1A 4OOEA 1KAEA 1V45E 3N2GB 4MIKA 3THSA 1F12A 4H16A 2IEAA 5A7GA 2IWHA 3LZDA 5I51A 1E4VA 1CS4C 1OFVA 4MA0A 4AB1A 3MWLA 2H4JA 5IN4A 1RYEA 3F6SA 2PS9A 1AK2A 4NFYA 5C8ZA 3KO8A 1L7XA 1G0OA 2GZAA 3GJ5A 3EPKA 4UBLA 3AUKA 2H2HA 2BGTA 1UJ2A 1M0TA 4R9VA 1X3SA 4K87A 4A6XA 3QEJA 5EFZA 3VI4B 1SM4A 1JKJB 1XHLA 2NO7A 3N2GA 3D5QA 1MP0A 4G67A 2ZI9A 4UU7A 2QZPA 3HN2A 1II0A 3FRIA 3O8OB 4B75A 5TIIA 1AH2A 3HE3A 4RK5A 4YRJA 4DDWA 2ZAGA 3BFXA 6CHYA 5HS6A 2WJIA 1RACA 4XJVA 4MW7A 4OVKA 2H51A 5I9MA 3NHRA 4O1HA 2GDZA 1WV0A 3LX8A 3AF6A 1CUYA 3EWSA 3H2JA 2FPSA 4L7VA 5JAZA 4PZLA 2F8SA 2OOSA 3MS7A 4EI7A 2FWNA 1RE1A 1RYBA 1UFVA 1JKJA 2GZDA 3DE6X 4YR9A 1UQTA 2PMFA 2GBCA 3O8OA 1YOBA 4P0PB 4DA9A 1UBOS 4RLFA 2C7RA 1B73A 2GN8A 2JARA 1YA8A 3LUDA 4GPTA 1XJQA 3RHZA 1VMEA 3TOXA 2XXBA 5HCNA 3PFBA 4LJRA 5KNBD 4NAHA 1RM3A 1ZJJA 2W90A 4DA6A 1OTHA 2GSWA 5DTJA 5HIIA 4M1OA 2L69A 3C97A 5CVVA 4D0SA 2P8SA 2D1YA 4A8TA 3CEAA 5F9FA 1K9VF 1NSFA 2GLTA 2WIKA 1JDSA 3DV0A 4QREA 4Q4AA 3VNRA 3R8FA 2QVBA 4UBKA 4YMHA 1GV1A 1THTA 5CDFE 1G2OA 4JXJA 5EYPB 3N5CA 5IVPA 4PWZA 1TADA 3LVBA 4P92A 3VBEA 1CR6A 5KOHA 1XBTA 1VI2A 4N54A 4YYZA 1O89A 3NONA 3EMDA 2H6EA 1Q84A 3SQLA 5HE8A 3HJTA 2ZSBA 1GGJA 4QGHA 1HWYA 4HWTA 3RYCB 1P1FA 2VJAA 4QGBA 4RPIA 4L4RA 3N2KB 1IQUA 2WILA 3EOBI 3G7UA 3M9XA 2QIPA 4MIEA 2HMWA 4TTVA 4V0LA 1CBUA 4A2PA 5C0OE 3H6HA 2Y6VA 2IP1A 2BC9A 1M2JA 1XTVA 3O9ZA 1CVLA 1PCXA 4ETMA 5JYCA 5IABA 3KD2A 4EM6A 3P9QA 3PI6A 4QELA 2V45A 1WB9A 3NATA 3TLXA 1GTZA 2EJCA 3HMQA 4WNYA 5AVSA 1L9XA 1QMPA 2O2IA 1UZAA 5JANA 4N49A 3RYCA 3GLQA 4JLBA 9GPBA 4BKUA 1D2HA 3KL4A 1KJZA 4F60A 4QU0A 1HC7A 4UXHA 1M8GA 4B6OA 3TIXB 2HK8A 2P79A 2REQA 2GO7A 3A32A 2XYGA 1NBME 1YRYE 2QZ4A 1OXMA 3G89A 4RKQA 5A3SA 2A9OA 1TAQA 5TNXA 3QWHA 4WFJA 1NBAA 3W90A 1DC3A 1BHJA 1DKRA 4FOSA 4PAWA 4RAOA 5SICE 1G7SA 3WDMA 2Q6VA 2PWAA 2VDVE 2E7ZA 1I9GA 2QF7A 2IXAA 2ZT6A 2OHIA 4CG2A 3VKGA 1HQYE 1SXQA 1T4GA 4YCCA 4UBIA 1WIWA 1TZMA 1NUPA 4FS8A 1DFGA 1H93A 1UADA 1UM8A 3HZOA 2PAFA 4FINA 1GZ4A 4JVLA 5FXMA 1E7WA 3O74A 2BWJA 3V34A 2R4QA 3CJQA 4AMUA 1JQAA 4UQLA 3W3ZB 3T41A 3CEMA 5AKHA 4B2PA 1PSWA 4A2CA 4C0XA 4CM3A 1W36C 1RC1A 4K6HA 2HBQA 3SIWA 2C9MA 2PUGA 1U1DA 3CZPA 4UDYX 1PL0A 5T6MA 4JI8B 2EIXA 3PGXA 4TMYA 2HO4A 5GZ6A 3EY4A 1XP5A 5C7YA 3ZTYA 1HG1A 1XMQB 1M1ZA 1TTQB 2BONA 2IZOA 3CTMA 4QGGA 1O94D 3SBEA 1HLPA 1NKVA 3QKUA 4K0RA 4OYLA 4WX2B 5A0FA 1DRKA 4EA8A 1MHPA 3M6WA 3IIMA 2Y1GA 4KZKA 5HGJA 2PSJA 3REOA 2X2PA 4V1CI 5L3SB 5LOVB 2WJVA 1CB7A 2VUIB 1GPBA 1N9ZA 1WDTA 3QVWA 4I7EA 2BE9A 3P27A 4MUMA 3KTFA 2L19A 4Q9JA 2Y3IA 1XTPA 3PNMA 3B89A 3BA1A 2VG8A 4LZLA 3C6BA 1PJAA 3E23A 3PGJA 3ESBA 3H6KA 3I2FA 4I5EA 3ONVA 1L5NA 3ROZA 1XMVA 2YWCA 2P9GA 4WOKA 3EODA 5GM1A 3G0OA 3UAVA 1WZIA 1X3LA 3QVXA 4L4YA 4XB6B 2X77A 5DZSA 2DU8A 1FFCA 1K5GA 5KNCH 3W8RA 4YONB 2X2FA 5KB3A 5L3SA 4YHBA 5KTMA 4P83A 3HRKA 3RUFA 2QNBA 3KLPX 2JZOA 2DPHA 1P0IA 4R3NA 4OHPA 4TXLA 4BTVA 3W8NA 1D9ZA 1E9DA 2J09A 5JIBA 1TA9A 4M1KA 3CZ9A 4IYJA 3BPSA 1EFPB 1NMEA 3LG2A 2GYYA 1PJLA 3CT4A 2H4FA 3E84A 3ICVA 3KVOA 3L4BA 4FHDA 4LHSA 1XZCA 5IASA 4I19A 4WDQA 4W9MC 2B69A 4DSOA 2JLSA 3FOWA 1V0JA 2ECPA 2QOEA 1MAHA 2HFKA 2LPMA 4QAQA 2W93A 1I1QB 4JELA 3C87A 1QE5A 3R8XA 3UH0A 3ZV4A 1SK8A 1DUSA 1E1QD 1RJ9A 1WDWB 2FAXA 4OL0A 5BNWA 4RD6A 1SXHA 1ZJ4A 3EG9B 3R4CA 2QE6A 4HDNB 3ISTA 3KEFA 3NEYA 3N2YA 4YRDA 5FBVB 3AUSA 3LT1A 3P2OA 2QTFA 2C04A 1NX6A 2R62A 4BNZA 2ZM6B 4L50A 4D7AA 3OY7A 1PQPA 1OCEA 3DKKA 2FNAA 1KEZA 3WTBA 3PNQA 521PA 3F9IA 5LIRA 2GJ9A 4MHSA 4BWVA 5JNRA 1XNJA 1ECJA 5KX5B 2RGBA 4KXNA 4FYHA 5CIWA 5CVCA 2XUDA 4Z8XA 1FUEA 2GPYA 2OLKA 4I9GA 3ZDYB 4F3RA 3W5BA 1QVZA 3WI7A 2GK7A 3EG9A 1JJVA 4P22A 3OZVA 2ZIFA 2BEVA 1JJ7A 1XJWA 4R2HA 5DHRA 4DUYB 3THYB 3QUQA 3QXCA 2R65A 3WVNA 1GD1O 2JGRA 3P0JA 1UBEA 3RO7A 4A92A 1K2WA 4EG8A 3MMXA 1TB4A 1BD4A 3K9QO 1OGJA 3D6TB 3TBKA 4GH5A 4BX0A 1Y7HA 4I4CA 4W4TA 2V98A 2A1UB 4FFBB 1OILA 3TRFA 2C4WA 4NS1A 4AJEA 4ZYTA 5K2OA 1CEYA 4MR9B 4NR0A 3VPCA 3O0DA 4WOCA 5E4YA 4E88A 1CFJA 5K0BA 1JQJC 2R6CA 5GAJA 1WQ1R 4QDUA 4UNSA 3HNOA 5AUNB 4QM6A 3DEIA 2QTHA 4LYFA 4CUZA 3EEIA 2QU7A 3FPGA 3MRVA 3PHJA 3LWBA 3SHFA 4IJ5A 4L9SA 3HJAA 3UOAB 1E62A 5ICMA 3IL2A 2D7CA 4L15A 5DLEA 4DMHA 3K0BA 1ZM7A 1AURA 1ZHHA 4LDZA 3DWGA 3V4ZA 3C74A 3M3HA 4B80A 5EJ6A 2A1UA 2Y1EA 3IT2A 3QMVA 4FFBA 3QQPA 4HS9A 4RO0A 4XQ9A 5KNDD 4MR9A 4BTEA 3LTEA 1XX6A 4LRTB 3TW8B 4C0LA 3N8KA 4Q1DA 4KH1A 1UC5B 3MT7A 2XMSA 2OECA 2B6HA 1UXOA 2YC2C 4C06A 2HEIA 5I7SA 1TJPB 1TKAA 2JLXA 1L7MA 3FPHA 3N5KA 1E3EA 3T4XA 3DDOA 1AK9A 4G1EB 4I6EA 2ZB3A 4CV1A 5L3ZA 4A8HA 5J4LA 5KHOC 1W5BA 3Q6IA 5HJ2A 2BJWA 2IHUA 4A6PA 2WQ6A 3FVVA 5KAPA 1TZJA 3TW8A 1I2DA 3EXFB 3OE7A 1FCJA 3BDAA 5ARDA 2X2OA 1OPXA 4KMSA 5FNVB 3WY9A 1QCCA 2OSBA 2XKAA 5B4VA 1E5QA 3UIEA 4F6RB 5JMOA 4Q1EA 4UU0A 5JQWA 4AY3A 2OAEA 2NUTB 3GZ4A 1MXHA 1MGOA 1YDWA 4G4SO 2GK6A 2VZ0A 3A0UA 4H7HA 5BN1A 1TQ2A 3W78A 1M2HA 1RPJA 1HZJA 2B4YA 3I1IA 3KEQA 4FKBA 3WNCA 3JVEA 4IDPA 1NG1A 4QEZA 2ODTX 1JG1A 2IE0A 2XA9A 3EXFA 1M5UA 4NC9A 3L06A 2Q41A 5GM2A 2Y1FA 1BX1A 2YHUA 4IIHA 5FNVA 3KNZA 2WU4A 3WWOA 2GLUA 3FJ1A 3WRYA 1GZHB 1IM8A 1MBZA 1TK9A 1XELA 4PX9A 2GWHA 4KXWA 2PIAA 4PC7A 3FBTA 2NUTA 4TMKA 4JR0A 4BNIA 3B20A 4PLYA 2M6SA 3OD1A 4D3ZA 1NW5A 2NQTA 3NANA 4BO5A 1YIDA 2V8OA 3VKFA 4ALKA 3MTEA 3RJMA 3BK2A 3MAAC 1A04A 5CH8A 4GOMD 2NSLA 1QDEA 1Z7YA 4QLOA 3K32A 1ODLA 5D51S 1BKYA 2GWRA 4U7PB 2PX6A 4JP1A 5IFKA 3JR7A 2A1IA 4QATA 1M9NA 2DFTA 2LE0A 1A4UA 1YUBA 3H3FA 4WA8A 5JCJA 1T0BA 3ZGYA 4BB5A 4D3DA 4F4UA 1WS6A 1ZICA 2B25A 2J9FA 3HLTA 2VZ9A 3ZZUA 3L0SA 5CITA 4ZVQA 2ZRFA 4BNUA 1KERA 3TIGA 4M98A 3ZV7A 3ADDA 4QO8A 4ARVA 1RI1A 2JCBA 1QRSA 4DBVO 5JXWA 3N6XA 3WAKA 1C1YA 4N7JA 2JGIA 1W94A 4PQEA 1R7RA 5HFNA 5EIOA 5DNAA 5ECWA 1EFHA 2OORC 4YUVA 2BM9A 2BF4A 4BIMA 2I03A 3IVCA 3Q6MA 4MWDA 2ZJFA 5ALSA 2CHEA 3HJNA 5LD2C 3UJ7A 4F5ZA 1N3LA 2NV6A 1R4NA 2JJ8A 1JR6A 4WCDA 1VL0A 5EXDA 3ETLA 4YXWD 2DUNA 4BFSA 1BQ3A 2ST1A 1U9IA 3CGWA 3N86A 2VJQA 2GAIA 4OI4A 3L7MA 3VXKA 4K0KB 5PNTA 1L5KA 2VWHA 5BQPA 2GZHA 4ZZ0A 4E5VA 1O9BA 2XNJA 1K75A 4MVJD 4CKYA 1M34E 4IVQA 2X2EA 4UM5A 2CF6A 4OQXA 1N92A 2OBXA 1OBVA 2ZI4A 3AZQA 4UHBA 1GCGA 2ZRPA 4Q37A 3BRWA 3ZGXA 4DCSA 2ZIAA 4P3NA 1QGYA 3RAFC 5JNUA 4ZYLA 3T3GA 3QJGA 4LOJA 5DW3A 3REQB 2REOA 2OA0A 3EULA 2B4TO 4KCGA 5A4JA 1JR3A 2ACWA 5J47A 1T1RA 5FTNA 5ED4A 3GWZA 2QKYA 3LQ4A 2ZTSA 1XI2A 3DHEA 3EUWA 4IJ6A 1CNMA 4J0JA 2Z43A 3KYBA 3C3AA 4FYPA 1PJBA 1W581 3PQDA 3FOEC 4MCAA 1LI5A 4HGYA 2A7XA 3HV2A 1TK2A 3UB4A 4U8HA 2PXAA 4EY6A 1ZBQA 1C3OB 1G8AA 1TKRA 2WG0A 1O54A 3HCBA 3OG9A 2IU0A 4BC1A 3SR4A 1Z5GA 1JG3A 1IH8A 1KMIY 2VPZA 4BGEA 3REQA 3IQHX 4U2DA 3EXAA 3FRJA 1MX1A 2H1SA 3HU5A 3DNMA 2YXPX 3EZ6A 3NC0C 3QLJA 1RM0A 5DBOA 1PT9A 2GEKA 3PFGA 3F78A 1AGYA 4DLUA 1QAQA 3IP1A 1IEVA 2IOHA 4QUJA 1OZGA 4WESB 4CN8A 3FD8A 1UOEA 1DG1G 4A0RA 4LFAB 3MB8A 1RKUA 4FVTA 3WGYA 1U2SA 1QE0A 4YAJA 2MU1A 3OFJA 3IOCA 1BDBA 3S44A 1E1MA 4B6GA 1C3OA 1E2KA 3EC2A 3NM6B 3IOEA 1JPVA 2VHXA 3BQ9A 3AU8A 1IQ0A 1J56A 1UJMA 2YYSA 2H1HA 3GLIE 1KPHA 1GY8A 2X1MA 4TTAA 4E5SA 1P29A 5B5SA 3GY0A 1USVA 1A97A 3A26A 2JAUA 1US8B 2OOKA 4MZXA 3E3MA 3EEFA 1A71A 1MX5A 2YIDA 2B3DA 1ZONA 4YUAA 1AD2A 2DQSA 4H60A 1HT0A 4N8EA 4BL5A 2P27A 2FR1A 2HCJB 3AHGA 3NOXA 3R9KA 3RB8A 4FBMA 2RGGA 1TU0A 3I04M 3QM1A 4J16A 5C53B 4UVDA 3MFQA 4RSGA 4JDPA 2SECE 5FX2A 1J5EB 1RHKA 5I6DA 1Z5OA 1C3LA 2AYZA 4I50B 4P4TA 1SZCA 4NV3A 5IC5A 4PV7A 5F7OA 5DE3A 4OHKA 1K7SN 3T3DA 1NRIA 2PTGA 2IPNA 4RABA 1US8A 1H5NA 1SELA 3ZE2B 1P5ZB 3NBAA 2BFCB 1BHQ1 2C1XA 3PDCA 4DR5B 1IPFA 4HEJA 1MT0A 1HZZC 2ZE7A 1V6SA 4FMDB 4P82A 5CHYA 1ONNA 2H00A 3WHLA 3B38A 3PCRB 3W5SA 1A76A 4CHTA 4WCVA 3Q11A 4Z9XA 3N8HA 3URKA 3L05A 1QPGA 4I50A 2V55B 3MMPA 1PVDA 3VH3A 5IEJA 3CA8A 4O3MA 3FYUB 3FTEA 4LWQA 5TJHA 3RC9A 1SCKA 2Z1DA 2XADA 3F3YA 4EJ0A 3CJTA 1A50B 2I34A 3BHMA 1WE2A 1E63A 1EK5A 3Q87B 4AN4A 2I6TA 2GEVA 1YGYA 2GPAA 1P4SA 2BFCA 3AZPA 4RZQA 3T9CA 3I9MA 5DBFA 2Q4DA 3DGEC 4GDFA 3SJUA 2Q5OA 5B3JC 5DM70 3KB8A 4PC6A 1RU3A 4MW9A 4LCEA 4M53A 5AUOB 1CWUA 1GJRA 1YQTA 1LUAA 5E95A 5EGSA 3TR0A 3W6NA 3RF6A 1ADGA 1CUHA 1GRQA 4IOJA 4GBGA 4MYUA 3FYUA 4XWTA 4NNJA 2PRIA 1E59A 2HHCA 1ESEA 4ZVMA 1ST3A 3UWPA 3BYZA 2P0EA 2C7OA 1FQOA 1TYZA 3P94A 4KODA 3AY3A 3NB0A 1FBTA 3DTVB 4FGZA 3FCCA 2QX8A 2BRUC 3GAAA 1U7TA 4L07A 3DR3A 4WKCA 4D6XA 2QT9A 4EUFA 3DLPX 4YCNA 2JCVA 1DL5A 3RUCA 1P39A 4E51A 4X3CA 2FZ4A 3FHTA 3GDHA 1XA4A 1R12A 5EPUA 3NC1C 1LDBA 3VU9B 3AVUA 3OLZA 4O2AF 3E7DA 4X8LA 4XDHA 5EQTA 2ZCJA 2IU6A 1CT9A 2I3ZA 2P9FA 2Y68A 1FQWA 1IB0A 2W2KB 5K8JB 2NU8B 1JIQA 2GM3A 4Y2VA 2LR0A 3MWYW 2ZUSA 2VH1A 4UAGA 3DTVA 4X6LA 3D0OA 3LFHA 4BU1A 1MJ5A 1VPEA 1G5FA 1PYGA 3H9UA 2JGLA 5G1NA 2BMFA 4C0BA 2CHFA 1M5TA 3P9RA 5J1TB 3AERB 3L7AA 2V96A 4HUJA 1JDVA 4D96A 1MRSA 1C7FA 2VWQA 2ZUTA 1NQOA 1P0CA 2QX9A 3BJZA 3P32A 4NCHA 4TQUS 3SX2A 1R5BA 2YW9A 3JALB 2W2KA 4DQLA 4PX2A 2IXBA 4UVHA 2NU8A 4TLBA 5T5QA 2HL6A 2HSDA 2FXIA 3IEXA 1E3DA 3W5AA 3GLKA 3ACCA 3RSOA 2B34A 3H18A 1M8KA 4EI8A 2QM8A 3CKLA 2V5AA 3AERA 1WD5A 1WZNA 3BD9A 4W1PA 2PX4A 3V3TA 4LHYA 2DTEA 1GPAA 1M10A 3S5UA 4Z4CA 1O77A 3A6GA 3JALA 1LBTA 2ET6A 1V1MB 3A6DA 3LS2A 3U19A 5A6SB 2JLQA 1QZTA 3NVMB 3COJA 4PLVA 3QW2A 2FHPA 4S04A 5ALDA 1UT5A 4CL0A 3Q12A 2JANA 1CQZA 3BILA 1GPDG 3CLRC 3K4PA 1XN1A 5FOXA 4NBWA 1HE3A 2VF7A 1IWPB 1TUGA 2OZKA 3HKDB 3M5WA 3R2JA 4FFLA 3AHJA 1UDBA 3KC2A 4EW1A 4EZEA 1MVNA 1IATA 1Y1QA 1YRBA 3IAEA 3M6UA 4PG4A 4DNQA 2V5UA 1L3CA 4OQPA 4XM2A 4I9NA 2RHTA 1O7JA 1BXKA 4CKCB 1ZZGA 1V1MA 3JASA 3AH8A 1NA5A 1X1DA 2POCA 3H5AA 3DHYA 2BBOA 4FQ7A 4KDEA 4MEJA 4IMRA 2QGFA 4I81A 3DAGA 2ZSDA 3UO8B 1CRZA 2RB4A 4BV3A 2PGIA 4LI0A 4EKIA 2J5QA 2JL1A 2A9VA 2GGSA 1CQXA 3HJCA 3IAS1 1OF1A 1EVLA 3EEYA 4IIXA 4D4GA 4H7FA 3SHTA 3WDLA 2VYCA 2A1TR 421PA 2MMCA 2NYAA 4GSKA 4YRQA 1CRWG 1NVAA 1X2EA 3HKDA 4CDMA 1TE2A 3WGNA 2ZS7A 3ILVA 3ITNA 3KTAB 4DLKA 1KJNA 5ES3A 4RIFA 1TQ6A 2WDZA 4CKCA 3LT0A 1RMTA 3KXLA 5CXQA 4EW2A 2YWDA 3K31A 4C7OA 2O1EA 3UK1A 5FPPA 4ZYWA 5AUPB 4DNFA 1QIFA 3VO2A 1FNMA 4J9UE 4HMPA 2EIHA 3RWOA 5IM4F 1U0FA 3GGOA 2FN9A 4II7A 4ZT2A 2W4MA 5D1NA 3ZY5A 3KJZA 2RCNA 2W8BB 2FWPA 2O3RA 3H4TA 5ESRA 4AXBA 4BLRA 3CX3A 1EHCA 3GV0A 4LV8B 1LSSA 3OFVA 3EISA 3SZUA 4UNNA 4HVTA 2BELA 3JX9A 5A0TA 2G8LA 4TQAA 3A2LA 3G2QA 4YJ3B 1YMQA 2QAIA 3AL0C 3NYRA 3HM2A 1QHXA 2G9QA 3KOWA 1U1FA 3FLBA 4RY0A 3QHPA 5DSZA 1B74A 3F9RA 3BSWA 1E89A 4XA8A 1SCUB 4ADSG 2W8BA 3WGKA 4DC0A 3D1LA 4PCVA 2WAOA 4UHFA 1XTSA 1BCRB 4Z3DA 3G79A 2OB1A 1IBMB 3TN7A 1VOTA 4V03A 1YVRA 3DDSA 3DFUA 3N8DA 4Q0MA 4YJ3A 4DVJA 1XXHE 4UNQA 4P0QB 5D3MB 1NQUA 1YB1A 3PGLA 4CLRB 3LF2A 1K4YA 5IYZB 5LP6F 4ALNA 3MJRA 5EJMA 2BN4A 1KIMA 1ML3A 1FTQA 1CR4A 2AH5A 3UUFA 1USIA 4Z5XA 1AS2A 1SCUA 2PGDA 4HDSB 3A3KA 4P98A 4TXNA 5LQMA 3MWGA 2D5BA 4L0DA 4L57A 4EVIA 2CWWA 3ZGLA 1BCRA 2I67A 1GG8A 3JQGB 1NOJA 4Y6LA 3TL6A 1I6LA 4XVHA 1VRWA 2F43B 3I6MA 5DGDA 3CUUA 2WUDA 3NRBA 5IH7A 3O83A 3NWPA 2LVBA 5D3MA 4CLRA 5IYZA 2YFQA 3A4TA 3H8WA 4HEHA 1WMEA 4GMHA 3A6LA 4B87A 1ZK0A 1YJ5A 2C29D 1OWNA 4JJIA 2B94A 4NHOA 4HDSA 3A1FA 1CHDA 4CEHB 4GVLA 3IMEA 2DY0A 2C92A 1LI7A 1GKUB 2QG6A 1BMFA 3JQGA 1CY8A 3ZI7A 3UXEA 3ZTTA 4V1CB 3VKHA 1LS6A 2FR8C 2F43A 1YS2X 2DWQA 1U5CA 3M82A 5IM5A 3N58A 4TS9A 2QN3A 4R0VA 3OM9A 4NK5A 4CXMA 4D92A 5AK3A 5KHAA 4BWYA 1O97D 1UAGA 3BUSA 1JLLB 4C4SA 1UMKA 1JXOA 3NP7A 5IAJA 1K88A 8GPBA 1NXXA 1TM4E 1DO2A 1ETUA 1M2OB 1M1NB 1ZK4A 3MOGA 4K8RB 3RS9A 3IP7A 4DAEA 4CEHA 4CMIB 1TYAE 3HRIA 5EG5A 1YC5A 1RQLA 1QRAA 2H0QA 2JFQA 3NGLA 3HB5X 1QRDA 3ILYA 4Q39A 5JEDA 2VEOA 4YAGA 2DKFA 1O03A 5BOSB 3FA2A 2XH8A 4ZPJA 5FO0A 5LLTA 4Z1OA 2XAUA 5H83A 3PRKE 3MCTA 1Z18A 3V1YA 5LOVA 2PLFA 3DOOA 4A1FA 1Z07A 3WX0A 4OAPA 3T3HA 2CD7A 1DAMA 1RRGA 4RJIA 5TLSA 1QK5A 1M2OA 1M1NA 1O8CA 3FGNA 3KPWA 3I62A 2O20A 4CMIA 1EWRA 2QVLA 4H7IA 3GO4A 5TXGA 5BSVA 1PWHA 1MEOA 5JNLA 3OE7D 4XOUA 1OVMA 5GJWC 1NWHA 5BOSA 1J39A 4OPMA 4R8MA 4E94A 2P9TA 4IYRA 3MTDA 5KNLA 1RYDA 4XYGA 1DBRA 2BFEB 2NXWA 4M1ZA 4DMMA 1HFJA 1A0OA 4JY7A 5H5JA 2DXIA 1I14A 1NVDA 3CC8A 1C1XB 1TUEA 5TT1A 3QPDA 4I14A 1CZHA 3V7YA 4BB6A 5KYUA 4BNNA 4F9FA 1D4ZA 4TKUB 3U4IA 4FZ3A 2ZIEA 1YDFA 3X44A 3WQHA 5CDHA 1PNTA 4WZAB 2TMDA 5D00A 2VQEB 2ID7A 2UUCB 3H6GA 2VP0A 3NOVA 4QEDA 5TE9A 4CLOA 4FGUA 5L3QB 2W71A 1E58A 2B78A 3VR0A 4YAUA 2GEDA 4LC9A 2BFEA 2R00C 5FLEX 4NXMB 5AICA 1S89A 2XAAA 3BKWA 3I05A 4INPA 3A9TA 4J0QA 1FYDA 1ZU4A 1PJSA 1E7QA 3HYNA 4QUGA 1IQPA 3TW4A 1CJMA 1IJBA 4GKBA 1G8YA 1C1XA 2DE0X 4DLRA 5KNBH 1ODFA 2XSZA 3U7EB 2JVKA 1KI9A 4TKUA 1QK3A 2I6XA 2GKSA 3E4DA 4QXAA 4WZAA 4XPIB 1PSDA 4D9FA 4I2NA 1V43A 3L92A 4QTZA 3RQIA 4PHGA 3VO1A 5L3QA 1USUA 2Z98A 3CNQS 1SK9A 5JCJD 2I3BA 3D8UA 5U1PA 3OPNA 2BKLA 2DHQA 1OX4B 1Q12A 1SRQA 3OOWA 4MPJA 3D3KA 4UM8B 4DSZA 3U4QB 1VB3A 2OVBA 1DEAA 1ZM3A 2ZUVA 1DWPA 1YNOA 1Z5UA 2I80A 2NZXA 1MVLA 2O07A 3OCCA 4J2OA 1L5ZA 3HA3A 1XMJA 1ZISA 2JLUA 4BY9E 4MJ7A 1KARA 2GJKA 4XPIA 1IY8A 4RA6B 4BQIA 1DKUA 4WIAA 2POQX 3HKBA 3LZCA 5KQLA 4UU8A 3LDHA 1GUDA 1G66A 2KX7A 3MF4A 4IJKA 4V39A 1Z12A 1GGNA 1FDOA 2EOAA 3BL6A 4KTVE 1OX4A 4QU8A 3U4QA 4HYQA 2VWGA 5JC8A 3MZ0A 2O8EB 1RW4A 1EXMA 1UFRA 3VHXB 2GBLA 4MCHA 4BZPA 1UKZA 4K26A 3B2NA 1ZD9A 2PO5A 4MROA 1FFEA 4BJ3A 3TLBA 3FTFA 4Z53A 1X1QA 5E6SA 4FE7A 4RA6A 3F4KA 4FMCF 1YBFA 4FUTA 5F23A 2BGWA 4FYJA 2YINC 2Q3HA 1OU0A 4PW0A 4NVRA 1GNVA 1WQ3A 4KMOA 3LI2A 3BRWD 3THXA 2WKQA 1I2BA 4L4ZA 1UEXC 2ZZKA 1JFSA 1NVGA 3I72A 3X0DA 1IRIA 3WK8A 3T06B 3VHXA 1N7JA 5I3CA 1JR3D 1JNYA 1OXKB 4XM1A 4D74A 4B9AA 1YXMA 4QQKA 2Z3VA 1DX4A 3PE4A 3AEUA 4HPWA 5LDHA 1FFHA 1CK4A 1XA3A 1P3Y1 3EVEA 5JTTA 3DZIA 2V6MA 4JUCA 3CLTD 4Q7KA 2WYIA 4ZD6A 4ZDIA 3C45A 2D2FA 1C8LA 1LSJA 3FAKA 2EP8A 4FLMA 1FEZA 4BO0A 3ZNQA 1CYEA 2R60A 5BQ3A 1KZ1A 4DR1B 3K6RA 3SEQA 4QT0A 4XWGA 4R7TA 4ARAA 2NAFA 3F71A 3PWKA 3WHIA 3ZCPA 3OCYA 4BX9A 5IU6A 1E5TA 3D54D 2IODA 3HR4A 1W87A 3DCYA 1WZ2A 5B6JA 4QHYA 2K5UA 2XMGA 4RK4A 4H0CA 1YNSA 2DYKA 1CF2O 4LY0A 2WWTA 4OQNA 2SBTA 1TIPA 4ZJYA 2XOXA 3HCEA 1QUEA 4TYPA 1JEOA 2D2VA 5FFFA 1ISRA 1VCMA 1TKBA 3MBKA 3GGDA 4C1NA 2IX9A 3MCVA 1RLIA 1P44A 2O2SA 2ZB4A 4U6NA 1LW6E 5DGXA 1MB9A 3X1XA 5KOJA 4I8IA 4HAIA 4RSRA 1KYQA 1BJRE 3KU4A 1MXFA 4FR0A 2YJNA 5FKJA 2D8AA 4LZNA 2NZVG 4Q93A 3LC0A 4QOEA 3ZZMA 2J30A 3NUZA 1H2XA 4LVOA 2JI6A 6YASA 5JAHA 3LC7O 5A9TA 3YASA 3MJDA 2XMDA 1CUDA 1BGWA 3BB1A 3KHSA 2J45A 4EHHA 1JIJA 1BA3A 4PPGA 2ZWVA 4GLJA 3I3SR 5G4KA 1LVUA 1JF8A 4ZEXA 1VHTA 5K8TA 4M0FA 2W2OA 1XEAA 2ECQA 1ONOA 5F7XA 4KG7A 4RD3A 3UGKA 4L0MA 1U0EA 4MVJG 4QTXA 2FFHA 3UHJA 1CNEA 1FVHA 1KWGA 1W5TA 1I80A 2Q6IA 1I8TA 2XRZA 2LKCA 2AEFA 4OGFA 2L0XA 3SE0A 2CJYA 1D6MA 2YV3A 5CT9A 5DCWA 4BATA 4OJNA 3ZCUA 1JE1A 1G3RA 3FWNA 2QVGA 1DAFA 4F21A 4QYTA 1F0KA 1I32A 1BGXT 5TV2A 2AQKA 2X5KO 3VTKA 16PKA 5A4AA 3ZU3A 2NTYC 2Q5FA 5B7GA 2AJLI 4QBTA 3UANA 3VU0A 1QZZA 4IH1A 4CIBA 2H31A 5JJBA 5FOUA 2I4TA 2AUTA 3C70A 3U4MA 3IXMA 1D4FA 2XGGA 1H65A 2EJTA 5HRCA 1ZSYA 4ZGWA 1UWLA 3M0EA 5C9ZA 5IKEA 1RAEA 2QU8A 5K0NA 4EQ6B 4TM8A 2Q6TA 1UMDB 3RGWS 4A03A 2X0DA 1BC5A 2QT1A 1XWIA 1GNSA 1L1RA 4Y6SA 1CXZA 1X9HA 4DLBA 4MDEA 3GVHA 1OYOA 3HDTA 1JBKA 4EHLA 3EUEA 1RPZA 1L5MA 3OIWA 1NJ6A 1ONSA 1R0WA 2H57A 2QRGA 3DQZA 3QVLA 3ZCXA 1RNLA 4N39A 3FTDA 4HGRA 1J23A 3WGHA 1OREA 1T2VA 4LBYA 3VOTA 2O8BB 1TMKA 4FKMA 1T3TA 3GT4A 4G5HA 1EFDN 3P2EA 4HH0A 3PUWA 4A26A 1P7WA 3THWB 1RC0A 1H6DA 4JLDA 2XQGA 3JQDA 3UB2A 4IKEA 4TTSA 1UMDA 1Z38A 4R68A 2BM0A 3PHHA 1HSOA 1GFSA 3EZLA 3I8SA 4GIBA 3VVCA 5DJ5A 4EJSB 4TLLB 2CEKA 4F04A 1XZPA 4BDSA 3OIDA 4X1OA 1E6WA 4DCCA 1E4EB 1XFAA 2RI6A 2C2MA 2EFHB 1JDNA 3DTVD 2I22A 3CONA 1X7GA 4OQDA 4QNMA 2O8BA 3LE8A 5IVHA 4CGYA 2DFVA 4J03A 4IZ6A 3LGAA 3U7IA 3A06A 3THWA 1XWFA 5AYVA 2HM7A 2YY5A 3QVSA 3QMPA 4KACA 1PJ2A 1Y1LA 3H99A 1LDGA 4NJEA 2OC4A 3HP4A 3U1VA 4C14A 5KNDH 2N9UA 4MPTA 4LF9B 4EJSA 4IUYA 1MJFA 2HIGA 3N76A 3VV3A 1QQAA 3I4LA 3HWRA 3S8MA 2JCGA 3GJSA 4AN1A 1U3GA 1W48A 1WF3A 3AETB 4OQEA 3CCCA 1MO5A 2CMFA 2O48X 3L0CA 4KWCA 4Q66C 4CZ2A 3I52A 2P2YA 1U3TA 1D5WA 1ZEMA 2AD5A 4JEUA 2LV8A 1SULA 1B4DA 3DMPA 3GLFE 4OLBA 1Q0ZA 2OO5C 4DY6A 3RYTC 1AGXA 5E1OA 721PA 5IDYA 3EDMA 3HDHA 3ULKA 2YFKA 2GS9A 2E55A 1UKBA 1P4GA 4PXAA 3KHUA 1JFTA 1M1XB 3KKEA 2QEQA 1GNPA 2RKWA 4IW3B 2WK1A 4E2WA 1TO2E 1SUWA 1XAIA 2OD2A 4U2KA 2GPJA 1Q1EA 2AE2A 1XAJA 4D2IA 1GAXA 2YVQA 1J21A 2EKLA 1ZIXA 1DAIA 2QWXA 3WL6A 3CN7A 1FXWF 2D2IA 2WJ4A 5AW6A 2EGGA 1KEPA 3E2MA 4PSUA 2WJZB 4HB4A 4AXXA