3CT4A

Structure of dha-kinase subunit dhak from l. lactis
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
318
Chain Sequence
b'EKIINQPQDVVSEMLDGLTYAYGDLIEKVPDFEIIQRKSPKSGKVALVSGGGSGHEPAHAGFVGEGMLSAAVCGAIFTSPTPDQIYEAIKSADEGAGVLLIIKNYLGDVMNFEMAREMAEMEEIKVEQIIVDDDIAVENSLYTQGRRGVAGTVLVHKILGAAAHQEASLDEIKDLADKVVKNIKTIGLALSAATVPDNEIEYGVGIHSEPGYRREKMKTSYELATELVGKLKEEFKFEAGQKYGILVNGMGATPLMEQFIFMNDVAKLLTEENIEILFKKVGNYMTSIDMAGLSLTMIKLEDDQWLKNLNEDVKTISW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-bind
molecule tags Transferase
source organism Lactococcus lactis subsp. lactis
publication title X-ray Structures of the Three Lactococcus lactis Dihydroxyacetone Kinase Subunits and of a Transient Intersubunit Complex.
pubmed doi rcsb
total genus 115
structure length 318
sequence length 328
chains with identical sequence B, C
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02733 Dak1 Dak1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1180.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Dihydroxyacetone kinase; domain 2 3ct4A02
3.40.50.10440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dihydroxyacetone kinase; domain 1 3ct4A01
3PNMA 3JR7A 1OI2A 4LRYA 3PNOA 2IU4A 3PL5A 1UODA 4LRXA 3PNKA 3FDJA 1PZXA 3CT4A 3PNQA 3PNLA 1OI3A 1UOEA 2IU6A
chains in the Genus database with same CATH superfamily
2IYQA 1CUIA 2ZROA 2C3MA 1SWWA 4NMLA 1KEZA 2Z3ZA 1F17A 5BW8A 1XZGA 1F60A 5B4TA 3I61A 4TKZA 3PIRA 3FMOB 1M1YE 3NYIA 4QPDA 1QG2A 3EVBA 1PJ4A 4X8OA 3L1JA 3RTCA 3NFRA 3R77A 4XA8A 2B2NA 2PMCA 3V8QA 1E2JA 2PJUA 3IPYA 3H5RA 2WJYA 1PWZA 1ZL2A 4OXQA 2GK4A 2R7NA 2WMYA 2F43A 2GKSA 1S9HA 3JRNA 4LDPA 3E1GA 2QRKA 2Z8XA 5F7ZA 2VHTA 5F7JA 3T1QA 4UASA 2DP4E 1F4PA 1E2NA 3PICA 4S35A 4A1OA 4B44A 3C7CB 2VLBA 4NF2A 1Z74A 5L4NA 3IJEB 1KR2A 1MC1A 1U9YA 1FRZA 2MT9A 3GT0A 4YN3A 4DVGA 1Z63A 4RVHA 4DIOA 3WFJA 2QVBA 1WXDA 3T5DA 1GU1A 3KTDA 5DTEA 3I4LA 4ZI3A 1NOKA 5BVHB 5ESDA 4PQEA 4PZYA 2W6QA 4TLDA 1H9BA 2ONYA 4NI5A 4BV8A 4LBVA 2W4MA 5F77A 4YRJA 2CVOA 4G5SA 3WO0A 2K2QB 1R4MB 3CE6A 3WB2A 1NXWA 5B30A 3I8XA 3H2GA 1PT7A 2A88A 5DO9A 1CKEA 2DUUA 4N5LA 4NU5A 4UTPA 1GZ4A 4L5CA 1ZNQO 4I4LA 5NULA 3S0JA 4C4XA 3JZFA 2YW2A 4DILA 2VUUA 1WW8A 4E1AA 2FOIA 2Q8PA 3FNBA 4QREA 5EMKA 2EKLA 4FYWA 4GOMD 2RD2A 5CVUA 4HH4A 4YRLA 2E7ZA 2O52A 2ZPTX 5HSGA 2G83A 2NZXA 1B8OA 3RU7A 5F1OA 5K7SA 4DB4A 3LWNA 5AK6A 1XCJA 2E4UA 1LNZA 4BZXA 5B1IA 5J58A 4GLBA 1U2EA 3E0QA 4M1QA 2R1UA 1NVVQ 3ZHOA 4RC9A 2JI8A 4AG3A 1QFYA 1JZQA 1EP2B 1NUSA 2B1JA 2CD9A 4L0CA 4MW7A 1S8OA 3FMGA 5F7OA 2O7NA 1IBLB 5GJCA 4YLYA 2E6UX 3KJNA 1ND5A 3F46A 1O77A 4OAOA 4LVCA 2GEVA 3ESDA 4M89A 5E0KB 4ENQA 5C0OE 3I39X 2WWVD 2F4VB 2XCRB 3BBPA 5TS2A 3F7NA 1NZDA 3KQSA 1C3OA 3F5DA 5HIJA 1ES9A 4TUYB 1CQJB 5KUTA 2XBLA 5BUSA 3Q85A 1CF2O 1VDMA 1QTQA 3B6MA 1YS2X 4L6CA 2XCIA 4YJ2A 2I4NA 2JFVA 3ZHTA 3OAAD 3UJCA 4MWOA 3SVLA 4YFVA 1CUYA 1E7MA 1KIAA 2DHCA 5MN6A 1WJGA 3SR0A 3AETB 1KYTA 5BT9A 3HWWA 1S2NA 4GOOD 3DTYA 3COYA 3SYLA 4XWOA 2JGEA 4YP6A 1CLUA 4HDQB 3H83A 1OTYA 1TQHA 2Z4RA 2W43A 3K31A 3OZAA 2Y1GA 4KXLA 5JC8A 1MXHA 3LXXA 3RBZA 3UKJA 3O4IA 1CZHA 2P5TB 3ZDFA 4YV2A 5A4MS 2ATEA 2B5VA 2D5IA 2QM0A 3JZDA 4B31A 2JD1A 4KAAA 1DRVA 2AK3A 4Q5IA 5FWXB 1RKXA 1E62A 3L9XA 1ICIA 4HUJA 3W8FA 5EP2A 1DPFA 3GRYA 5IXYA 1ISJA 1ANKA 2I62A 3BJMA 2Y76A 3VPAA 1ZUHA 2QT1A 3LMKA 3N70A 2ZSIA 4NYIR 2BGLA 4OREX 4OP1A 4OHOA 5EFZA 2HDOA 5CDYA 1MT3A 1A8IA 3CKYA 1QZUA 3U1BA 1I3NA 4K28A 4E09A 4PF1A 1WHSB 2C9DA 3QH4A 2VUSA 4J6EA 4GLJA 4DV0B 4RGQA 5BW6B 3O7MA 3SLRA 3JVDA 3JRWA 4X1KB 4KLZA 3W8DA 1YS9A 4B75A 1AC5A 3D8SA 3KL2A 7REQA 1O9HA 3O75A 1MTOA 3UXMA 1GV1A 2H57A 2ZCUA 4ZA2A 3AKZA 1YZFA 3LK6A 3LQQA 3ITDA 2WFLB 4JC4A 5CYOA 4HEQA 1KU0A 2WYWA 2HHCA 4UXHA 3S40A 4BXOA 3NBKA 3R5SA 1W85B 1XX6A 5CLLA 2OFWA 1QG6A 4YP9A 1CQIB 1D04A 2VHWA 3B1XA 5DNWA 1K9SA 1ZNYA 2CLFB 2H2GA 2VA9A 5DDIP 1U8TA 2Q99A 1QE5A 2J7PD 3AFMA 3I3SR 3PGJA 2C4NA 3VU0A 7YASA 2SECE 3K30A 3E7XA 1QBKC 2I54A 2Z5LA 2WZCA 4C3VA 2PXAA 4Z7QB 1I1OA 1N7GA 3QUCA 3MD0A 1OLUB 1ECFA 3ZU4A 4B35A 4OLBA 1QYXA 1IWPB 1D2RA 3DM5A 3WE7A 4I4NA 3GB9A 5C32A 3CUSA 3MNFA 5JCOA 4YAFA 4G65A 5EL0A 1GYPA 1M8GA 1NP6A 5K8CA 3UGJA 1RP7A 4CKXA 3EFBA 3N0RA 4RZQA 1JNXX 1U9IC 1OTHA 2GO7A 2IPLA 3DE6X 3PUVA 3VDNB 3I5XA 3JYQA 2GF0A 4PFKA 1Q12A 3U1TA 2J3JA 4S1TA 2Z98A 1VJ1A 2PZKA 3K4PA 3VPFA 2JFHA 4OBBA 1RBQA 2ZKIA 3K2IA 3T12A 1Y8RB 1JWBB 2ADOA 3NZEA 3R3WA 4JJKA 3EWSA 3PUYA 1PFYA 3WS7A 1NSTA 3I92A 3TAUA 2X6QA 2UUAB 4MW1A 3EG5A 4MVWA 4H1WA 1T9AA 3K0HA 4I1SA 3JVIA 3PWTA 5J43A 1Z8HA 4HF7A 1YBVA 3CHYA 1N5LA 2WSBA 4P32A 2WNHA 1DWQA 3VKVA 2Z57A 4AF8A 2OAGA 4DUZB 1OI4A 4OGKA 1ZK0A 1E1CB 5CEFA 4N8DA 3WTCA 1VSVA 1WF6A 1X14A 2PCLA 2V6JA 3QU4A 1AKEA 1BW9B 3G2JA 3C6QA 4P36A 5GIOE 2F8SA 2PJZA 2VPWA 3KB8A 4N0DA 3S1LA 4KQEA 4LBYA 1LTKA 1Z4KA 4RGBA 4OQNA 2NVUB 4F3YA 3KAJA 1YS7A 4KI0A 3WGQA 4KXVA 4YUZA 2C0PA 3IOEA 3MJSA 5E6SA 4WBNF 3TLJA 4ND5A 3ANSA 1BHO1 4A0SA 2IUFA 3GA0A 4OHMA 5AM0A 2H65A 2ZKLA 5T4FA 2FPPA 4JJFA 2VO1A 2PIAA 4UBNA 2AQHA 2YJ5A 1U63A 3PCTA 4HC4A 2X7XA 3IT3A 4D0NA 3FVWA 4RSMA 4QDZA 2W2XA 3W8NA 1VIDA 3AU9A 1TLLA 3U7IA 5FL3A 3VBCA 2C5BA 1ZESA 3USZA 3E03A 5KVQA 2FH5B 3MUFA 1V1RA 2HMAA 2ZVJA 3BICA 4RF2A 3C3CA 2R8BA 1Z29A 1OA0A 1H4VB 3ITNA 1ZVKA 4LYFA 2ZCJA 5GM1A 4NMMA 3C3JA 5H0IA 3RWMB 2IZOA 1AXGA 2NTVA 2PR7A 1T6ZA 3JQFA 4B2IA 5P8WA 1SKYB 2O5VA 3IAAA 3W34A 1SVIA 1CQJA 2K4MA 3ZCQA 4DXHA 1I51A 3B1WA 3NUZA 1KAGA 3SKVA 1W25A 5A3RA 4XQ0A 1GL7A 3ZIDA 4F56A 4NULA 1U7XA 2A84A 4WNAA 2JAQA 2JIMA 2HJHA 4AN0A 3RAGA 3I6BA 4WK6A 1E3DA 1RHKA 2QHXA 1HZZA 1M6NA 3A1SA 4YTEA 1I5RA 2W37A 2YWEA 3P32A 4QFDA 1BXKA 1PQYA 1XWIA 1YA8A 2CXQA 2IYSA 3A9CA 4R0NA 3RNLA 4A6DA 3T3DA 1O94A 4OYRA 3P0JA 1C29B 1TGYA 1X7GA 2VRWA 1OR8A 4OA8A 4WK4B 1NVBA 5F51A 3OCWA 3PHIA 4IYJA 4MW5A 3PDHA 1U3CA 2ZITA 4QQRA 3RODA 2NMVA 1EIZA 2BH9A 1EVKA 5REQA 4JWKA 2WDPA 4DMCA 1QDUA 3BRWD 3FZGA 1MHPA 1E1CA 2F67A 4HN9A 3ZBPA 5AVTA 1F7UA 5AK3A 5TJHA 2PH3A 2BPOA 3JQAA 5CDFE 1P2VA 3G7SA 3X1MA 2Z2IA 1QZZA 1KA9H 2HA6A 3ETDA 3A1CA 1LDMA 1C0EA 2D1SA 3UUFA 2QL5A 1R0KA 2R1TA 5LC1A 1G5HA 3F49S 2CFCA 4PBTA 3VRHA 1TKAA 3SNKA 4X92A 4ZCSA 5AUNB 2VHJA 1Q0PA 4M9ZA 2LE0A 2BBTA 3N87A 4HB3A 1TJNA 4PTZA 2CV1A 4MEJA 4WCFB 3WL3A 3OCCA 1XZIA 5EIAA 3C7KA 3S44A 5CB4F 1ZKDA 4DLAA 3F67A 1WWKA 4KV7A 4QDKA 1ECPA 3K72B 4ZO8A 1EFVB 1BS2A 1NBEA 1JECA 3C8ZA 3T1TA 2QV0A 1Q77A 1X7XA 4MVJH 4CGYA 1AN9A 2GHQA 2I2BA 4LYDA 4P6VF 3ES9A 1TEXA 2FPKA 2IHTA 2P5SA 2ILTA 3R3HA 3ESAA 3GDFA 5IPFA 1TGVA 1J1UA 4YJGB 3RT7A 4D9MA 4LF6B 3HCEA 4UPDA 1HDZA 4OFBA 5EHXA 4M0UA 5IS2A 1QPBA 4RTRA 1KVTA 2JLZA 2G0AA 2DCUA 1CB0A 1NIPA 1KNXA 1V8PA 1XK7A 2BFNA 3EH2A 3QP9A 4IFBA 1KK1A 5E6RA 3R76A 3D4BA 3SQWA 4NPAA 3PE3A 1PNVA 1NC3A 1KY3A 2QRQA 3C5HA 4HBZA 1EDDA 4QJBA 1E1RA 4BN5A 1BVHA 1P17A 2PZ8A 3ZV7A 3JYLA 2PLAA 4Y18A 4EY5A 5IKMA 2P40A 2F55A 4LQCA 1WLSA 3PE4A 3AG6A 4F5YA 2D3TA 4K88A 5JSYA 1AH2A 5TPZA 3NM6B 5ARDA 2Z5FA 3SQMA 3T9EA 4F2DA 1W4RA 2IDJA 1UFKA 2V55B 2YJTD 4ZCPA 4TPKA 4BQQA 4HZUB 3OF2A 5JHHB 1ARZA 2X23A 1N8SA 1IIBA 3DLPX 4OBEA 4G0OA 1ONPA 1DPGA 2WKRA 1KMQA 2P5YA 2Y9PB 4NICA 1QH8A 3W4KA 4F86A 2JFOA 5FCDA 5FOXA 4QG3A 3K5HA 3LFTA 3QYAA 4J2TA 3G5TA 3WQQA 1RQLA 2Q3DA 4XCQA 3GEDA 4CLOA 5C4GB 1OFVA 4OD0A 3OEEA 5TF4A 3SXUA 3WKEA 2RKOA 3HO6A 1SCQA 4G25A 1ILEA 5BP7A 2IS4A 1MA0A 1EAYA 1Q57A 2ON6A 4AMYA 1T13A 2ZUCA 2OYSA 3AFGA 1YJAA 3QWBA 1II8A 2X8JB 3DQQA 3EAQA 5E38A 2PH1A 3SE7A 1QS0A 4I5EA 4DCJA 4KREA 1CYDA 4BZZA 4N0QA 4I1UA 4BFTA 1BMQA 1G3RA 3NKLA 2B1RA 4MCHA 3TRDA 1BRTA 4EELA 4Z9AA 3DMGA 1JFVA 1HXHA 4HFJA 4X63A 4TMXA 1XSEA 3SS7X 2GBLC 5AKZA 1NBIA 4ZZ2A 3BVPA 2MHCA 3HUDA 3VR1A 4Z2AA 1QP7A 3EGDB 1V16B 3CW2A 2OCYC 3V80A 1WXQA 2FW7A 4C0LA 5L3SB 1I5OA 4JJ7A 2LV8A 2R4QA 2GK7A 3AR8A 5TC4A 1XTJA 4IF4A 2BKLA 3SWWA 3PNSA 3FRHA 2IV7A 4KHPB 1VMAA 3K0BA 2ZAMA 2I2DA 2FRXA 3M5DA 4Z0TA 1LV7A 3SXPA 1TCAA 5HEKA 5TSDA 5HS6A 4O8CA 3SLGA 4PQRA 4MRNA 4YMUA 3COVA 3HP7A 2YVLA 2ZATA 1KH2A 4A27A 3TSOA 4C7OB 4LK2A 1A27A 3V1NA 2WTEA 2JGAA 3LUCA 5GONF 3SF8B 2R6ZA 3W2TA 1J2EA 2O0HA 2YIMA 5J59A 4DC0A 1ML4A 5DYNA 4KQFA 5B7QA 2YJZA 3IELA 1JKFA 2C0CA 1R0SA 2NSHA 2R6DA 1BQ3A 4ENUA 5AVWA 2JCBA 3LUDA 3W3AA 1C3LA 3H16A 4PC1A 3EOAI 3ABIA 3U3RA 4NENB 4C05A 2C2HA 4OLAA 1X7WA 2WNIA 3PFFA 2L18A 1OBHA 1RI5A 3PXUA 1I2CA 4I3FA 3WP1B 2Z1DA 3MTIA 4CM4B 4RMIA 3KYDB 1KAHA 4XGRA 4NR0A 1WULS 2WY2D 3IUPA 5DM2A 4HV4A 5GOTA 1KDZA 3LW7A 4DV2B 4PANA 1E98A 4GEKA 2QTNA 1PKEA 1XKLA 2V6IA 3WBKA 1OFTA 1T1GA 4BRWA 4UCWA 2EKBA 5H68A 2GCEA 4O4LA 3VKHA 3LHKA 3AF5A 3UJHA 2G7MC 2L42A 1TPYA 2Z2KA 3O90A 4NAUA 3MWLA 2DERA 3UTCA 3LYHA 2X7JA 3PNLA 4FEYA 1U2SA 2VJMA 2WINI 1IIRA 3RH0A 1IZ8A 1GD1O 3MB5A 3SAJA 2L82A 3DL7A 2JFNA 2QT0A 3RWOA 4F4HA 1OYOA 4K9DA 1DEAA 5KSYA 1QKKA 1YR3A 1EBBA 3DVAB 1B6SA 1GRVA 2EJCA 1A9ZA 1E89A 3CRQA 3P0RA 3VR5D 4YEDA 1I24A 4GVLA 4RHYA 4XOUA 2M6KA 2OBBA 4QOFA 3LKBA 5DN9A 4TRMA 5AKLA 2OQVA 3VHRA 3AIMA 3ME5A 1TAHA 4JDPA 4I55B 3ROGA 4BNJA 4OI0A 3PGVA 3NBAA 4JSTA 4LV6A 2JIZA 1NX6A 3DZHA 1K08A 1CDDA 4GF5A 2WTUA 2GLTA 2Q5CA 1A9PA 1F9AA 1DKMA 2PZLA 2ZK7A 1A77A 3GNTA 3LC2O 2REQB 3O82A 3BRCA 4TLLB 3R7LA 4BO7A 3U7GA 4H7KA 4RSHA 1N75A 2Y1CA 4UVDA 4CIVA 1WUKS 3MT7A 2IITA 3QQPA 5AESA 4YMWA 1SXPA 2C2GA 3K9LA 2FUKA 4G24A 4AJNA 4UNIA 1DCMA 1RC1A 4OSOA 3VYTB 5B1EA 1GGVA 1OZFA 4Q47A 5DM1A 4RTOA 1FDOA 4M0MA 2QPLA 1YMVA 1CU1A 2ISSD 3A4YA 3ET5A 3L7LA 4DYDA 3OIYA 3B5EA 3WNZA 4JIMA 3ZVRA 2XIQA 1KY5A 4PCAA 4FZVA 4RDXA 5DMXA 2VG8A 2ATIA 2FSSA 2QUBA 4DCCA 1TJ5A 4PICA 3A4VA 4P08A 5EIOA 1DCFA 2VPQA 1VECA 5J2TB 2PHZA 2YWCA 3IX7A 2GXUA 1JLHA 2Y1WA 5E6SB 1PJCA 3NO4A 1TOAA 3OZTA 4IY1A 4OL0A 5HMLA 3WK5A 1MJGM 4BVHA 3FTEA 2I67A 3RUEA 2W2LD 1GQYA 4LRQA 1NFRA 5JCOC 1TW2A 3LNCA 3G8DA 1Z0FA 1L5OA 2AMFA 1P1RA 1PVVA 2Q5HA 3D9QX 3EGXA 2GJKA 3H2HA 3H6GA 3QNWA 4EX6A 5K0ZA 3AVYA 2HIMA 3O03A 4PBSA 3LOUA 3S6JA 1IEQA 3NRCA 4LXTA 4NY1A 3EYWA 1H6CA 4FQ5A 5HRUA 1YB1A 5G41A 2H18A 1DCTA 2FX2A 2XH8A 3GLIA 2LCQA 2DEUA 3NRBA 4YRQA 5EYPA 1MEOA 4P3XA 2HNBA 2J4DA 4Q39A 3DHNA 3S4YA 1P7CA 3KFLA 5DIFA 1KMNA 2ZB4A 2D5BA 1O95C 3SG0A 3PC6A 4OFWA 2N0SA 1Y8CA 3AUSA 4UE6A 3FPJA 1I80A 1A72A 1XNJA 4P4SB 5I8PA 4U2CA 4AI6A 1JIQA 5D5PA 3F6PA 2HQRA 3BWMA 1NJGA 3CUWA 4DPMA 4P0QB 1MCZA 1S96A 2IEIA 3CRRA 4GHWA 3ABRB 4O1IA 2B9EA 3VPHA 1O97C 5IABA 3O8OA 1ADFA 3MJVA 4OXRA 5DP1A 4DWWA 5AVKA 3AYZB 2PX3A 1IG3A 2JBAA 2X5NA 5CT8A 3WAJA 5KHLB 2WF5A 2PX2A 5SY9A 2WW8A 4C20A 5E3JA 5LVAA 1ORWA 4TROA 1DBSA 2M1XA 2AGVA 4UAGA 4PAOA 1NNSA 3OJWA 4N0MA 4JJ8A 2D5AA 4KDFA 2EYUA 4KXUA 1GDHA 2REOA 4TKLA 2PMEA 2O8DA 3FMFA 3UKDA 1TLFA 2PGOA 4KSYA 1P0MA 1O7JA 2OGZA 4XPIB 2HHJA 5H1YA 1W36D 3M49A 1YRHA 2BGGA 1PZFA 2BKXA 2I7DA 4HN4B 4HDMA 1KAOA 2AKYA 1J0BA 4E07A 1WKCA 4JS0A 4J29A 3DNMA 5AI4A 1FJ2A 1MH9A 1XEWY 2MSLA 2P3OA 2VNSA 3A7EA 4RVNA 4B3DA 2PQ2A 1MB0A 1DC3A 1E6MA 3NHFA 1N2HA 4EYEA 5CBPB 1EFLA 4IXWA 5B64A 3WYGA 4OPMA 4XWAA 1Y3BE 3FKSD 3PC3A 2AWOA 3AUUA 3PNOA 3NHMA 1OX4A 2R1VA 2JJ1A 2BMVA 3KJXA 2BFDA 1NT2A 2AUTA 4K8RB 3VMFA 2REBA 2WWYA 2F7SA 3BF8A 3KYDA 3AUXA 2PX6A 4OY3A 1AY0A 5BQXA 2YXBA 4Q1CA 2QA5A 1HSZA 2IIQA 3AJEA 4MVXA 4AROA 1PVOA 1CUBA 3VVMA 1YBAA 2P9YA 5IC4A 2ERCA 2C3YA 3ERCA 1G0NA 1EINA 3QJGA 4BE4A 3B1JA 3DDNA 3DE5X 3WB0A 4IAOA 2A3RA 4G0YA 3U17A 1JI3A 2PUFA 5LM3A 3B7GA 4L2IA 4EPRA 4K9NA 4W5OA 2EDCA 4DUPA 1FNCA 1KAQA 4LMPA 4GLLA 3RAJA 1UDWA 3IDZA 1RU3A 2E4YA 2ZE8A 3O83A 3B3AA 4II7A 1W94A 4P5PA 1QHNA 3G82C 4HAVA 4JBYA 4WKCA 3D8NA 3NVAA 1JT2A 3DAOA 3KU1A 3OE7D 1E3WA 2I8LA 5TPWA 4WW0A 5DGDA 4JLMA 5YASA 4RVOA 5CU7A 1PQPA 1GL3A 4O2RA 3WR5A 4NYJR 1BHQ1 4R8RA 1DGQA 3N1UA 3TQSA 3GN2A 3IP7A 3R2JA 5EXXA 7GPBA 5I5EA 2Z08A 1XDGA 4Q6WA 5DSTA 3RPEA 1PJQA 1Z4LA 3KHTA 5IF3A 4G9EA 1XEWX 5DW3A 3SC6A 1TJ4A 3A1WA 2Q1WA 3LDAA 4LJKA 3B36A 2I4OA 3GARA 3RANA 2ZIWB 1TCUA 4M99A 3VAZA 3WGMA 2P4SA 1K3FA 1PL6A 5CA1B 3PNKA 5TQJA 4GGMX 3HGMA 3THYA 4TYYA 4ZDJA 3GVPA 2OKGA 3E61A 4DBLC 1NW6A 2NO9A 3CQ9A 3WRVA 1UDXA 4UULA 1LI4A 4PHGA 4B5KA 1RI2A 4YB8A 1LBHA 4ZZ3A 2PZBA 4YV1A 5ICMA 1IPHA 4KPEC 4IO1A 1G5TA 3U31A 3WA7A 1K8YB 4OU5A 3RAFC 4BNZA 3FNEA 4TTSA 4WKOA 3PVCA 5DYTA 1Q83A 2XUJA 2IDMA 4FJ0A 3RARA 5JYBA 3D2CA 2PLFA 2PWAA 4C7XA 3L0SA 4GGOA 4WFQA 2RGRA 1Q7EA 4ZU3A 3FOCA 5C37A 5HRAA 2EKQA 4UM5A 4C6TA 3IDQA 4DM3A 4ZU1X 1WMAA 2ZOSA 2CNWD 2OCDA 4W5TA 1PJRA 1X13A 1ZIYA 2FAXA 4J3NA 1GITA 2EF1A 4OJYA 3AIOA 2VH1A 4YDSA 2EGHA 5I4BA 3WGKA 3GJRA 2BT4A 3WZ2A 3U4GA 1MJFA 3G2NA 5BO5A 3H05A 3MQ2A 4GXRA 2IYUA 2H17A 5F3RA 3PQCA 5KKCA 4BQNA 3HSYA 4F92B 1W9MA 2ZIXA 4TVOA 3GJ3A 3ICOA 3PC7A 4ZCTA 3CWQA 3IRUA 5JMOA 3RS0A 4EW6A 1JSRA 2P11A 3PTZA 5TQ0A 4A6EA 2JAPA 3CZPA 2P2ZA 3DSRA 3GFTA 3OPYB 3I6ZA 1VE9A 3VR0A 4YBRA 4F91B 3B6ZA 1KSHA 2CVZA 5DLPA 4TXMA 2FEOA 3R5TA 2DBQA 5DXAA 2IQ5A 1C3VA 1W59A 3UYKA 2YYSA 1JEYA 4MIEA 2IU0A 4ZDWA 1ZINA 4QZVA 2C2WA 9LDBA 2QEQA 2ZR9A 3NV7A 5ALFA 1RLJA 1M74A 1KYVA 4GZLA 3H9JA 4W1RA 3GG9A 5H4HA 4FR2A 3SF8A 5F33A 1Y9JA 5A7HA 1G4UR 3DEJA 4OGWA 1XA3A 3OLCX 2PV7A 4CUKA 5IAOA 3UFXB 4ZYYA 3V42A 4W7HA 2IXGA 2ALJA 1N6IA 2IBTA 2WVHA 2BI7A 3G9UA 1GEEA 2AW5A 1DQYA 3LHIA 3BJEA 4N9WA 3TOCA 4B3HA 5ENDA 3I1YA 4FGJA 2ZCVA 1RJEA 1JHUA 2FLWA 1RM3A 2CJYA 1SULA 2NUPB 2O2EA 4JBXA 3I58A 4Z1MA 5TARA 5JAZA 1OB5A 1DEHA 1P39A 3RHSA 1JRLA 3AZOA 3BE5A 4WCFA 3HUFA 4GUDA 3C5CA 2QR3A 4OJKA 4L4XA 4EI9A 1RSZA 4QXAA 4EQZA 3KS9A 3UFBA 1QYRA 1DX4A 3BGWA 3LVQE 1PR9A 4L02A 5FUMA 1P5FA 1AT1A 2XW6A 4R0MA 2C2ZA 1ELOA 1Z06A 2YY6A 5E8JA 2WIDA 1UANA 4U4AA 1WU7A 4BMVA 2HXGA 4DBLE 3O8DA 4GH5A 1NC1A 3CLRC 1MRNA 2ZVPX 4KE7A 5IZ4A 2FYTA 1U0BB 3A9RA 4JLWA 3D43A 1ONOA 4O63O 4V2UA 2QX8A 1GQFA 4H16A 1XTSA 3PLAE 5IH7A 3TECE 4Q01A 1Z73A 4RADA 3W6PA 1QV7A 4OHWA 4DJ5X 4RTLA 4NZPA 3UYLA 1QQTA 5I9BA 4KBYA 2GM4A 4JLPA 1U3DA 3R6DA 3GYBA 4HYQA 5FBZA 1E99A 3D6JA 5G2OA 2UZ3A 5LCXA 4ARUA 1MNAA 4GKVA 1OY1A 2E0IA 3BERA 4ZI7B 4ZYVA 2F8LA 4XVRA 4Q15A 2F3UA 4ITRC 3FROA 2VXOA 4DIKA 3HWSA 2IC5A 4R6XA 1P77A 1BEUB 4FXPA 4FSXA 5K0CA 2NV2B 2ASVA 3UFXA 4E14A 1L2TA 4UHCA 5HXAA 3LCUA 4W7IA 4RD1A 1JKJA 2ZBPA 1NVMB 1Z7YA 3AU8A 2ZBQA 5JCJD 1JH9A 2QR5A 2XGGA 1GFWA 3E9NA 4QPPA 1EQ2A 1P5HA 2V7TA 4CL3A 4ZTUB 3M0EA 5GVRA 3TWOA 1IOZA 1WBDA 2WRZA 4XX1A 3ZY2A 2Y9MB 4DWVA 4ZT5A 1EFTA 4A6XA 3U80A 1EMDA 5DV9A 4ZCMA 2Q21A 2VHVA 4U2KA 3E3MA 1NVXQ 1Y0BA 3UN1A 3QVXA 3AVWA 1FSZA 2C7QA 4OB7A 3ZNQA 3TW4A 3EZFA 3I1IA 3DXYA 3WGUA 3R8XA 4UQPA 2I6QA 1TZJA 1HETA 1LCIA 3AVUA 1YJ8A 1W2WB 3OT5A 3UOAB 5E95A 5FBKA 5KTOA 1K7YA 3I2GA 2Q46A 4U7FA 3DM9B 3T3GA 2BBWA 2C9MA 2HMSA 3JZMA 2ZT5A 3DF7A 3WNDA 2FZCA 3C3EA 1PTKA 1AHPA 2E4VA 1CX9B 1GGHA 3SMVA 4E21A 3BXPA 3IR6A 3WIVA 4X66B 1PHRA 1JFFA 2F9MA 3IP6A 4HXFB 2OZKA 4GOJA 1VGRA 1KS2A 1NW4A 4DTIA 4V1CB 4XIYA 3K0AA 2O7RA 2VP0A 2H54A 1Z88A 5F4ZA 2FG7C 4JYBA 2DAPA 2QTZA 3Q88A 4DZZA 2R00A 1UMDA 3P27A 1SCBA 2RGDA 1XTBA 4COOA 2XZTA 4HDRB 5A7GA 3SEQA 4G0VA 1AIPA 3ZWOA 1UWLA 1GUZA 3WFZA 2ST1A 5LIPA 1GPUA 4MK4A 3HZZA 4QXQA 4QSHA 1M6YA 3E4DA 2UKDA 3T5BA 4AY5A 1N2SA 3V97A 1LRJA 1UBEA 1XRMA 2B8NA 1RM4A 3E82A 1LBSA 2IODA 5CB4A 1DJNA 3OKCA 3PQEA 2IZ0A 2VCHA 1DG9A 4FSDA 2AZDA 4BO6A 4YT2A 3G9QA 2KBFA 2HMUA 1Q44A 1EJBA 2V4MA 1T0BA 3OU7A 4I8XA 1U1CA 3L82B 3NH9A 3NWEA 2PL5A 2PRZA 3F4LA 1FUUA 1Q16A 1MQAA 2CJPA 1JIKA 1M2OB 1OU0A 1YUMA 2QAIA 3FYUC 2I71A 3L46A 1CY8A 2G04A 4ZVRA 4B79A 2XKAA 4V2IA 3KZMA 1MJ5A 4RTKA 1H2ZA 4IGFA 1K92A 1MJGA 1ZM4A 3OIDA 2EEZA 3IFSA 3LT1A 4PO1A 3TE7A 5COAA 8LDHA 2QX9A 2CYAA 3B13B 1P0FA 2RGNA 4GBGA 1LLDA 1PD0A 3V4FA 4BNGA 4RKFA 4D8VA 3QF7A 5JO9A 3RUCA 2A5LA 1M76A 1P61B 1QM5A 1SUWA 1WUTA 3R6GA 4UAVA 3ZX5A 2XMGA 1PFVA 1SPXA 4TLMB 4ZALA 3RASA 1GLNA 1GTMA 4BMPB 4QT4A 4MKXA 2C5FA 2KQUA 3N59A 3SQNA 3TD6A 3VNSA 1AJEA 2A33A 3V2UA 1MOPA 4G1EB 5ALNA 3CLUD 4NP6A 3CZMA 3V4VB 3KYBA 3H0CA 4BZWA 1JXMA 3PC8C 3TBKA 4ZDIA 3A4LA 3FSRA 4S0XA 5AJHA 3ZUGA 2B69A 3PQ3A 4IHAA 2YYZA 2PFSA 3UMCA 4F6RA 3QEAZ 2Y0EA 5IARA 1R27A 3GV0A 4KR2A 1DO2A 4DQLA 5BXYA 1QS0B 4UNNA 1FMFA 5EPUA 3QU7A 3QWHA 1GKLA 2IU3A 1T29A 1NQVA 2R6R1 1APBA 1KAEA 3NMUF 3IHTA 4Z3OA 4EM6A 3H9QA 3RLFA 1QRDA 2IOFK 1LUAA 2VSQA 4DSAA 2OCLA 1IZ9A 3EQ7A 3HBFA 2OHOA 1XTKA 3FPAA 5FTJA 1ZM2A 4UFOA 3UJ9A 1PP4A 4EB8A 1T9ZA 4FYIA 3UAXA 5JXIA 5F78A 4EG3A 4X7MA 4QQFA 5GPBA 3DVQX 1GUBA 4BFUA 4MS1A 1AMNA 2IUEA 3G0CA 1QLJA 1OBVA 2P4HX 1OYVA 3G7NA 1H05A 1E1DA 4LNUB 2OORC 1Q1ZA 1NMXA 3YASA 3AJ9A 1PNTA 4L8YA 3KD3A 3P9ZA 1RPTA 2IYEA 2YVAA 1ZY2A 2VBGA 2ZE5A 2RKWA 3AERB 4NBUA 5ALOA 2EERA 4INZA 4IUBS 1GYRA 2FN3A 4D42A 1I7LA 4W9MC 3EBLA 3N6RA 3PKJA 1JG3A 2Y0CA 3AY0A 3OQMA 1JNYA 1M6HA 3BQNB 3LBIA 2GOYA 2EQ5A 3PGXA 1SKMA 1IJBA 2J4CA 1JYSA 1JFTA 4RHXA 1ORDA 4JB0A 4YAOA 2IPNA 1XTVA 3ETNA 3TJMA 1OASA 3SIXA 3OTOB 3PTLA 2FN4A 1PCXA 3A1FA 3N2LA 4LSWA 1QCYA 1YJ5A 4LHSA 2CB0A 1ECCA 3GPDG 4JR2A 3X2SA 5DN6D 2WG2A 1OX5A 2GSDA 5IKEA 1MJNA 2UZ1A 3FJ1A 2J5XA 3VZQA 5BMVA 3Q11A 2ATXA 4N7RA 1R5JA 1RTKA 5HW0A 5C53B 1V9LA 2D1YA 1E7QA 1SM4A 1UFVA 3SZGA 1N1GA 1E9DA 2BTEA 3R8CA 4OQEA 1YR6A 1RI3A 3RC1A 1J09A 1R0ZA 1JDVA 2A4MA 2LDBA 2O8FB 2BVNA 1ENPA 4BCCA 2FQQA 4BMSA 2X4LA 3FUCA 3TOXA 3TF5A 2W2VA 5GZ6A 1RJWA 1C5KA 1TUBB 2B5WA 2IXEA 2G0NA 2EHJA 1IYZA 3C8HA 2JI7A 5G53C 1M5RA 3JATA 3JAKA 2TYSB 5A6SA 4OGFA 3TNJA 4MCJA 2LGJA 3HJNA 2ZVDA 4FDUA 3KKQA 2VXYA 4O4IF 2ZTLA 2LW7A 5AQEA 4S24A 3WK4A 4DV5B 1IONA 2Q1SA 3DFZA 5DJ5A 4ATNA 1N5DA 1QONA 1DOAA 1H5QA 3HP4A 1EK1A 2H5IA 1L1FA 4YWHA 1ESZA 4MXDA 4ACBA 4MWBA 1ZU4A 1NSFA 2J85A 3LF1A 3NBQA 4WE3A 4MHTA 1EGAA 1TA9A 3KDAA 4TV9F 3RSHA 5MN5A 3FTPA 4WASA 3VR6D 1SOVA 1DZ3A 3O8LA 4RJJA 4WY5A 3HADA 4L7VA 2YW9A 1GSIA 1HKHA 2FFHA 4M22A 1USVA 2R1ZA 5H8WA 4JAVC 1HQDA 4ETIA 5CIQA 4DXAA 1UXOA 4LJ5A 1L4BA 3HPQA 4JGGA 1WAMA 2TRSB 4D96A 1PBTA 1OLSB 1RKQA 3WVNA 3ZY3A 3FYSA 1PGPA 4JLJA 5KTMA 2M6SA 3BDIA 4A2QA 3OQNA 1KVRA 4R69A 5JVDA 2ORIA 3NHYA 2W6MA 3QPVA 3SC3A 3AUYA 3KSMA 2QLNA 4NZOA 2FCRA 3IVMA 1JKMA 4CN9A 2JGIA 1C7QA 1UQRA 2IQIA 3ZV6A 1GSAA 3L8MA 3PDIB 1NI5A 1NFFA 1Z0DA 2XD9A 3AVTA 1TU3A 4LYEA 4KQWA 1H65A 1W5EA 1KJQA 3D8RA 2XUZA 2APJA 1RZUA 1BKYA 2VEDA 4MLCA 3QA3E 4A7PA 3GRRA 5JS8A 3L93A 2ODTX 2XHEA 3FCOA 1QQ6A 3OQPA 5LYJA 3OKAA 3RFXA 4BFSA 2I9KA 5KHAA 1VG0B 3SU8A 4Q4JB 5A5DA 3RK0A 4QJ5A 4DJAA 4RLHA 1S2IA 4I2NA 3UK0A 3IE1A 3F3SA 3O4FA 2JLQA 3OSUA 2D62A 1YE8A 2QIOA 4JB3A 4OA5A 5FLKA 3ZEIA 2D8AA 3DFMA 4J1TA 4LY3A 3Q5DA 1NIJA 3GCGA 1WL8A 1Z22A 3LECA 2C94A 3MTQA 4LJRA 4DIMA 4HGPA 3TTWA 1ZSVA 2HLPA 4QATA 2GF2A 1DDOA 3CISA 1CJTC 1NF9A 4RZSA 1JR3A 2ZETA 1T36B 1GZSA 5G4KB 1VA4A 3IA2A 3CF0A 1NXPA 4CLOB 3HSSA 3WRWA 4G4GA 1XXLA 4KO1S 1OHHA 1RBYA 5H7XA 3M5WA 4DVJA 5AW9A 3ROXA 3P2KA 2FUG1 1XZMA 4CKWA 3HCOA 4DARA 5HR5A 1HNNA 3K0CA 4GI7A 4ZVQA 2WYVA 3DV0A 4JFRA 1O0SA 4BUZA 1RCTE 1KBZA 2AZXA 4BQRA 5C35A 3H04A 4RZUA 4B3RB 3BXOA 3GLHB 4I2VA 4IW3B 4UUBA 4MGIR 2VCYA 4BNLA 4Y7CA 3W79A 1EU1A 2A0FA 1Q19A 3PNPA 1P7PA 3AM3A 4QGBA 2CMDA 4XRRA 2H29A 2ZSBA 3WMFA 3IPLA 3IBSA 3USES 2W6ID 4E22A 4G97A 3RFUA 3GP8A 1A9TA 1Q50A 2YTZA 1PDVA 2PM8A 4O2BF 3WB1A 5K0FA 1PL7A 4L3OA 4KR6A 4Q03A 3CGGA 1FBTA 4IHJF 1I36A 3ONFA 1GGMA 4QAQA 1FXWF 4F1JA 1JLRA 4ZVKA 4G0WA 1P9WA 3BCHA 1TKBA 4N5DA 1RWNA 2IXAA 5AHKA 1X8KA 4HKTA 4YRDA 1ZGCA 1V7QA 2C96A 2Q9CA 1YSCA 2R48A 2VTDA 4B45A 5IX8A 2C2MA 4GI3A 4MVJI 2J30A 3DR5A 3MLBA 5CFLA 4KITB 2VJPA 4JLDA 4OF4A 2Y1EA 2ZI9A 1PT5A 3ANMA 4CLDA 4QWMA 2G9UA 1X1SA 4M6WA 5F23A 2OMEA 2ZLBA 1NAIA 5ALWA 5BYJA 5KVVA 2DETA 1QOZA 1K7FB 3CIFA 2YJNA 3F6CA 5IM5A 4BU1A 3BA6A 2JA2A 3WJAA 4F4FA 3ADBA 3PJFA 1TU4A 2OGTA 2YOFA 2XTNA 4IHJA 1SKAA 2QVYX 3IERA 3CXRA 2QN6A 1KARA 4CMHA 3V4LA 1J22A 1N3BA 3E2PA 3EZYA 2G1JA 1JHXA 2QLFA 3MCAA 4IIEA 3RC7A 1H0RA 4GSLA 6CHYA 1L1EA 1XBTA 3LP8A 4DIBA 1KI9A 1ABFA 4XSGA 1UMCB 2H16A 2PUEA 1O94D 2XITA 3WQBA 2UUBB 1I3LA 1M0WA 3LXRA 4LXHA 3HI6A 1C30A 4EL0A 1IOVA 1UBLS 1DFIA 4R2LA 1L8XA 4LF9B 5H9VA 1RQ7A 3KWLA 1CBUA 1GNPA 1M8FA 2B8EA 3DTVA 3TTUA 4F60A 3BN3A 3ITKA 1XRJA 3BTUA 3MJDA 3V1YA 1HE2A 1C1XB 1RLIA 5E1BA 4CI0B 2OENG 5B6IA 4H1HA 1AA6A 1L9KA 1UJMA 2XYRA 2HM7A 5C5CA 1M2GA 2HIHA 2GCOA 1FJGB 3HSKA 4ZC8A 1I2ZA 1IQ0A 1YVUA 4Y2XA 3CPEA 4FYHA 5LXTF 3B2QA 3CUEF 1VI2A 3V5NA 3P9SA 4LDQA 4BLQA 3H9CA 4DLKA 2B1IA 6AT1A 2M1ZA 4U8HA 1TU0A 3L79A 2XB6A 4OK6A 3V7YA 2WT4A 3IYLW 1VA5A 3M70A 3DMPA 3MM4A 4CCAA 1PYOA 4P34A 3O92A 4E11A 3L1IA 4AIRA 5ITSA 1XNRB 4HR7A 1TNDA 1I10A 1EGHA 1ST3A 3AF2A 5ILOA 3CZCA 5HF6A 4CBVA 4DA0A 2CF5A 4L4UA 4V3BA 5KX5F 1G60A 2W71A 4OQYA 2XUGA 3KPYA 4CHTA 2O5CA 2CMKA 1T4DA 2YQ5A 2NVOA 1XJ0A 3K9BA 1W4LA 2DFNA 2PEYA 3M81A 1A5BB 3A9WA 4JEMA 1JAHA 3GD5A 3WY9A 1T3LA 1THTA 2I91A 1IXZA 1DKQA 2QN2A 4E1VA 3IB3A 1YB7A 2OV3A 1D09A 1XDWA 1TECE 1B93A 4JJGA 2GFIA 4MQ5A 4D7AA 5K45A 1L5HB 4DJEC 3QEMB 1G8HA 2ZIZA 1IHYA 2XOKA 1YOBA 1W7AA 2Z9CA 3AXSA 4W63A 1KYQA 4J07A 1IH8A 3OEHD 4D3ZA 4S2EA 3ELDA 2IYNA 1E9FA 1WMEA 2I6SA 2VUTA 2CJFA 2E6KA 3OU2A 2YKGA 3A1UA 4WN9B 4TYMA 5C1BA 3IQFA 3T06B 3R40A 3CRMA 5ECYA 3AILA 5AUOB 2OSVA 3BK1A 2VQSA 3B12A 4UOQA 2H1LA 3KDPA 1PO7A 2GZMA 3KXPA 1UPCA 4EKYA 5KNLA 3A28A 2FUG6 1XMJA 1WMDA 1TYBE 2J32A 3FOBA 3H1GA 5I5GA 2VFAA 1A9XA 1RADA 1XU4A 3ED5A 2P3SA 1NBAA 2ZUBA 5DXFA 3JQDA 3M2TA 3ZXSA 4DA4A 2W4IA 1JBQA 4P5DA 5JG7A 4O25A 1EWTA 1FTQA 1KFBB 2GEBA 2E9SA 2VK8A 2NO0A 3DHYA 3PU6A 2ZJBA 4IXMA 2VYNA 3QJYA 4J4HA 1ZZGA 2P4EA 1SIOA 1X74A 2JRLA 4BEVA 1QMPA 2O9JA 3DE1X 5HVNA 1ISSA 2YWFA 2VPZA 3N0TA 3AVPA 3PFHA 2VDMB 3EOBI 1L5FA 4IG9A 3LC7O 1KOLA 1R7RA 1TJYA 3PWKA 2P2LA 3QVGA 4KUEA 4Z4EA 2B8JA 3PQ5A 3OZSA 1HDRA 2CXTA 2R8EA 4I81A 4UBLA 3S8YA 4F84A 2XUOA 5ICGA 1G8FA 1GPH1 2NADA 3CF4G 5ECWA 5M5BA 5KYKA 4MVJA 5HCIA 4G4IA 2B82A 4TUYA 4YXWA 4ZQCB 1FPMA 3E2MA 1AV7A 2FWIA 4X9XA 3MXTA 1FYEA 3Q10A 4EW1A 4UJ3A 1E4EA 4D2IA 4JGIA 2HSJA 5IWAB 3OUTA 4OBXA 1N6PA 3WLKX 4V38A 1RPNA 3UB2A 3UC9A 2FZ4A 4RU1A 1VMEA 2O19A 3RU2A 4A91A 4J1NA 1H2BA 3EULA 2H2IA 3M34A 3R0ZA 4OUDB 4QEDA 1TTHA 1G41A 1Y6RA 5GZ1A 2F3RA 4WZBE 1XDSA 1PT6A 1KO4A 1YU9A 4KKVA 1YJBA 2XI4A 1UK7A 3C16C 3K5IA 4TOIA 4U7WA 2NG1A 2YOHA 4D0LB 3LDGA 4Q1DA 4URYR 4L6AA 3GO4A 4D0SA 1UJBA 3G5LA 4HGQA 4CKYA 2J9FA 3RFFA 4DM4A 1RJDA 3B2NA 5BN4A 4MS4A 4WRRA 5CB4B 3EZ6A 3L4BC 3F4KA 2ORWA 2EARA 3K6JA 3QENA 4X8MA 3RVQA 1Q0TA 3V4SA 1OQAA 3HCAA 5EWLA 3ZQ4A 4R3NA 5H80A 4BKQA 2BMEA 1IOLA 5T4HA 3WIEA 3WQHA 1SQFA 4D5EA 3VOTA 3ZI7A 4NRDA 3B38A 4GDMA 3IVCA 5LBIA 1TQ8A 3EC1A 1I7PA 4ND4A 3ZD8A 1CE8B 4UZEA 5AP9A 2HUNA 2GYUA 4RDCA 1BCSB 1JW9B 1I6KA 5DGIA 5JC1A 3LXMA 2ODPA 3DMYA 2IXDA 2VDQB 4XFDA 5FLYA 3SBXA 5BRJA 1NG9A 3HY4A 3WJ1A 4CQLA 4WLUA 1CZKA 1EGMB 2VXBA 1NMYA 3PUWA 4JLUA 3QFRA 2V7BA 2GZ3A 1EQAA 1U0JA 1M8JA 5GONA 4CUJA 6REQA 2WA1A 3TQIA 4ZYTA 2DSNA 4YNBA 1SVWA 1VPEA 5BSHA 2Y1XA 4RLFA 3HB9A 1J5PA 1LA2A 1WPRA 4RL6A 4S1WA 5CDFA 2J9ZB 4AWAA 5KYNA 4L85A 1J39A 1Q1EA 4TKUA 3V00A 1KYXA 3IEVA 1AB6A 5ALHA 4B82A 3I5YA 1HZJA 2BGNA 4S1OA 5JSHA 3AL3A 1SK9A 2Q28A 3H5IA 3PT5A 2UZAA 1RKUA 1LVUA 4YMHA 4ON9A 3C5EA 4NK4A 1AK2A 2NZJA 3C4QA 3FB1A 5AJXA 4U3JA 4W99A 1HQCA 1V8BA 2H4FA 1U11A 3C1UA 5DI3B 2R86A 3D1VA 4DTCA 1E6EA 1ZJ4A 3LDFA 2IKSA 5DB4A 1M73E 1JB9A 3RR2A 2Y1DA 5A0FA 4RPJA 4ZEWA 3AEYA 4U7DA 1I7NA 3AL2A 2JGDA 1O4WA 4O29A 1BO6A 3PSHA 4ETNA 2PGAA 4J7CA 1U2ZA 2M6LA 2C7RA 3GXBA 5F2EA 2V4ZA 2WT9A 3AV3A 3LO8A 3KO8A 1AGRA 1C7IA 2AC7A 2JDID 2VA8A 4R8SA 1XF1A 1JFSA 3S1AA 3BL6A 4RS3A 2DUNA 3F47A 1FTYA 3FVRA 1RCFA 5JIBA 2XAAA 1GCAA 4AMGA 4DEVA 3L8EA 4PLWA 4V0KA 5DLDA 3LY7A 4AJ1A 4DUGD 4AL4A 3ESRA 1DTWB 5CVEA 1V8DA 4BNKA 4OQFA 5FBLB 4YV7A 3ZQUA 1WBJB 1II9A 3LRPA 5ECGC 2XDYA 1T0HB 3ENZA 5D7NA 1T2EA 1EWRA 4EUNA 3DVLA 4MWEA 4CKWB 3OKFA 4G85A 3VZBA 3AEUA 4L0MA 4D8YA 1AKWA 2B3DA 4DLXA 1CHDA 1MJHA 5ITVA 4CLHA 1NVKA 4D80A 3CONA 3B89A 4OHBA 4XX0B 4AJ9A 3AB7A 4BUCA 5EE3A 1WZEA 4B3CA 4B6RA 4Y0AA 3V46A 3VZRA 4WBNB 4RWEA 4O4JA 5KMGB 2BKUA 1MABA 1ABEA 4NG4A 3MUNA 3E48A 1TM5E 5ALYA 1RAAA 4JX8A 3QITA 4A4DA 1NQAO 3TNDA 3NM5A 1TE2A 1YMQA 2QTLA 2XUDA 3E27A 3HBJA 2QZPA 4ECEA 2XQIA 3DT9A 3DDCA 4I50F 5CFOA 2XSZD 5T41A 3CVYA 1E4YA 5CD1A 2J9YB 3DP9A 3A6EA 1MGPA 1SG6A 2QAGA 1VSTA 2NIPA 4E4RA 3NEPX 1VKJA 3AR6A 3FCAA 1E2QA 2H1SA 4Y6OA 5JZVA 1NKVA 5IC5A 1X1BA 2FR1A 2O6LA 3EY4A 2QQGA 3Q72A 3SJ7A 4UE2A 3JASA 1AHNA 4G09A 3BULA 1BGVA 4I99A 2HXYA 1Q0SA 3IBTA 1O57A 1Y6QA 1O4VA 2D1FA 2BONA 3W5IA 5BOSB 1XAIA 5KDOA 5C8YB 1O87A 3RYFA 3WICA 1U04A 4D4GA 5HZKA 4BV3A 2V4UA 2BZSA 2ZXEA 4HFNA 2ZT6A 4NBWA 4M9XA 2FOLA 3ZE9A 3EGWA 4YRNA 4BVKA 4P0PB 3GBSA 4WFKA 1JL3A 3U49A 4IOJA 3EVCA 4LI0A 1K7CA 4WA8A 4HQOA 2PZJA 3T6KA 3AVQA 3EXIB 3JWGA 3GT3A 1T9DA 3TW8A 2IHKA 4QGAA 1I2MA 1RQ2A 3WNBA 3KBBA 4L27A 4AP6A 4BLUA 2G4VA 4F4DA 3MBKA 1P1CA 2FW0A 2WLTA 4GKAA 2RGUA 2VRCA 1O6CA 5THXA 3I9NA 1DHRA 1M2FA 2HEGA 3OPQA 4D79A 1XU9A 5KNBD 3LT2A 1X3LA 1GTRA 2ERXA 1Y48E 4ZWNA 4AN1A 4WGFA 2OZLB 3JY6A 2ZWIA 4OU4A 1X80A 2I1WA 2LCIA 3PF9A 4PC6A 5LP6C 3P45A 1UBFA 2HRCA 4NS4A 5BN3A 2MWMA 4N12A 3HDGA 1FE8A 1T10A 1U8FO 1E9CA 2PGNA 4QQKA 4JI5B 1TQ4A 1T2FA 3BKXA 3L6EA 3M4NA 4YGXB 5D01A 3EVAA 1HNXB 3BG5A 4HDAA 2XOXA 4C0KA 3C3XA 5EHIA 4CEHA 1FX1A 1VLHA 3HM2A 4A36A 1SA0A 4WLOA 4RHUA 2CBXA 4DA8A 2ZJYA 3DMFA 3ITEA 4EA9A 4L9SA 1UBMS 1T8PA 2BBSA 1FTWA 1QR2A 3N2EA 3VR5H 4OMCA 2QDKA 4B46A 1YS1X 1JSXA 4DV7B 4C7OA 4LTDA 1PVDA 3BHIA 3P2JA 1G21B 1OFGA 2F59A 2O2GA 5GOZA 1XFAA 5L7YA 3TMAA 4C0HA 1SCNE 3UZUA 1K75A 3C6MA 4LZPA 3THWA 1UXIA 1XIVA 3D0OA 4EL5A 2FP4B 1H3FA 3U3JA 4JXXA 2X6RA 4D4MA 1G2OA 3Q6NA 4IH1A 3R41A 4Q3EA 3AXTA 4M7WA 4WX2B 1EDBA 4DEXA 2KX7A 1E1QA 4CR6A 5DGXA 1D0IA 3UQZA 1AV6A 1DMRA 2NUTA 2DCMA 1NN5A 3IHKA 3T1VA 5ECDA 5HZGA 1OPRA 1NE2A 4PV7A 3UMRA 3BWVA 2GD1O 2CWWA 2XUPA 4YPVA 3T9FA 2W22A 4LE0A 3NFYA 1FJHA 4LJLA 5CVVA 3TZKA 3WADA 1TI7A 3A10A 1HDIA 3QELB 5TB5A 4RVUA 4UUPA 3V8MA 1JVSA 2V54A 5FI1B 3NV9A 4EJMA 4KVAA 1OXUA 1CUJA 4L0DA 3D3WA 1EFHA 2FP4A 2GYVA 2HF8A 4YO8A 4ALJA 2UZIR 4AU1A 3S8MA 1FP1D 3DD1A 4ICIA 1HO3A 2H8GA 1L7BA 1PS8A 1YB6A 4FDLA 1AUXA 2RGCA 3NP9A 4S3MA 5DEIA 1HDOA 4MLZA 4Q02A 1WXGA 3V1TC 3RKSA 4C03A 3JD4A 2BM8A 4DIUA 2XV1A 3GX1A 1JDSA 4JLVA 2NVUA 4GWGA 3VXKA 3SVZA 3GZNA 3G2MA 3SC2A 1H66A 5A2GA 3KU4A 4C6TB 4FN4A 3DMDA 2O54A 3RS9A 2ABWA 2I55A 4LTMA 4MKRA 1W5FA 2ZT7A 3G6WA 1TYEB 1CQWA 4Y30A 4RKYA 1H4QA 3TZQA 4EATA 1TJPB 2AMJA 1EZ4A 1W0KA 2EATA 2OHJA 3IVRA 3PBKA 3LCCA 4PCUA 4Z54A 2GD6A 4O3MA 4Z53A 2GA8A 2WUVA 4AZ0B 3C6BA 1G59A 1VBKA 2VDOB 3R5XA 5K2MA 1VIVA 4IJWA 1ZGJA 3KZNA 3RNOA 4BJ6A 3VSDA 3KQUA 2ZIUB 3JAWB 1U28C 3ZKAA 3TINA 4C06A 2A4KA 2ID9A 5FUBA 2GN4A 3ROQA 3PKIA 4OIFA 2IHYA 4J43A 5AJWA 1XZPA 4DJJA 5H70A 3CLSD 3B7WA 4R5HA 1AK9A 1KMHA 4TQ9A 2C0QA 4JN6B 3I5AA 1ZOPA 4DCTA 1YFJA 2YXLA 1AXRA 5DH9A 5A1TA 9GPBA 2OFFA 2YJ6A 2PBLA 4J1QA 5I4CA 2R7LA 3CUUA 3EMKA 2FVXA 4CM9D 1P3DA 2JRCA 1P74A 3DCJA 3M1AA 3LUHA 1CY2A 3LM8A 4EY6A 1JEAA 1IBRA 3OFKA 4B6FA 1DX9A 4ETWA 3EJ6A 1Q2XA 3EWIA 2OG1A 3P19A 4ZOQI 5F1KA 2WWWA 2EFDB 2IF2A 4KWCA 1LPSA 3UCEA 1ODTC 3Q3GE 3GT7A 4RL4A 4YP0A 3I3OA 5EINA 4ZVTA 2CW5A 2FMKA 1OFUX 3T7TA 5TIIA 5MFPA 1ZCAA 1OWLA 3L7DA 3QHPA 5HKKA 4XUEA 2Q5QA 3LPMA 2FETA 5EZYA 5JW6A 2PUWA 3K0CC 4DLNA 5EKUA 3OTIA 2CFSA 1JJBA 2EQBA 4BAGA 4G86A 1UAAA 2B61A 3HL0A 3UA4A 4F0JA 2B7CA 2FKNA 1R10A 5DFAA 4AS1A 2ETXA 1UK9A 2B37A 4F97A 1MXFA 2GAIA 4RD3A 4TQGA 2HQ1A 1H4TA 4TRJA 1PZMA 5JEEA 1ZFNA 1A2BA 2XWPA 1LPAB 1VJRA 2C97A 2PKYX 2R2GA 4RIEA 5GIPE 1GO2A 2BW0A 4QU8A 5ALGA 3LQYA 3L18A 1W48A 5IKOA 3JATB 2XRZA 1YASA 1NOJA 4A1FA 1AQ6A 4A0RA 1W76A 1IVNA 2QQ0A 3A1NA 4UBMA 4MVJM 2GRJA 2VDWB 5EI5A 1JB1A 2B6NA 5EVJA 5C7OO 5CDSA 2V9CA 3EGXB 2W0SA 1IHPA 1PLJA 3FI9A 4FCCA 3OX2A 3CT4A 3FUVA 2YWRA 2BFCA 4MUGA 2A30A 3I73A 4PZUA 4UDXX 1SCUB 3P52A 5K4HA 3W5HA 1KI2A 3P2IA 4KXWA 1C8KA 1QO0A 5IDYA 4PE5B 4Z4QA 1XVIA 1QZ3A 3IOMA 2OBLA 1BU5A 3LE8A 4W9NA 3G88A 2QJWA 2OO7A 3H6KA 2DQ4A 3HL4A 4LV8B 4XGIA 1JDPA 2DHDA 3JPWA 3I1FA 5J4LA 1UPAA 4LX0A 4TSFA 1V4VA 1LEHA 2V65A 2FPIA 3MLEA 3KPJA 1R4AA 5GM2A 4N48A 1IN1A 1AURA 2PFGA 3IR5A 2NGRA 4P4NA 2N47A 4MJXA 1Q1QA 2CUKA 2PKCA 3H8JA 1U0FA 3IJRA 2C2BA 1C80A 2KMLA 3KRTA 2Q6OA 3KKEA 3QEMA 4QRHA 4X60A 1NBOA 4CTKA 3IJ5A 3P5SA 4WESA 4EYOA 2SKCA 3KUDA 4M8IA 3FNGA 3HXTA 3MGBA 3BT7A 1ZD5A 3BSYA 3G7UA 5JNUA 2OXFA 1QNLA 4PN7A 2VHUA 2BHSA 1EA7A 2GXQA 3IBGA 4JA2A 5KAPA 5JSFA 3THXB 4MAAA 1ZD3A 3ONNA 1E1RD 1IUOA 1UXKA 2WUFA 1V5IA 4PGGA 5L53A 1RLTA 5EP1A 3S2SA 2FDXA 5LQSA 3BD6A 3R74A 1GKKA 1CV2A 2NZYA 3EXEA 3FGOA 1JZTA 5KTTA 4UOZA 1Y8AA 3R5HA 5HGJA 2PUGA 3O47A 4PG4A 5FFFA 1FUYB 1BD3A 1D1SA 3RFCA 3EXHB 3NBFA 1JKIA 1EQUA 3HKBA 3LG2A 4Q34A 4NXNB 2WPDD 4N7MA 3T3OA 4ABTA 2WFLA 1QFXA 2XTAA 1RXSA 3M6MD 4B74A 4EKIA 1WY7A 1RYFA 1E96A 1FUIA 5LMUB 4IEIA 4XLTA 4FOOA 1Q20A 3ILSA 4YX9A 3OBIA 4RXUA 1NPDA 2JI4A 2JH9A 1I7DA 4EYGA 4ZAGA 1P9NA 3MGCA 2XOEA 2WD8A 3IE0A 4H3SA 1A7UA 2EL7A 1ETUA 3AK4A 4FEGA 3VGJA 2BKEA 3ONDA 2IFTA 3LUBA 5IEJA 3L6BA 3OQIB 5EMLA 1A4RA 3RW9A 1D2EA 3FTNA 1HA3A 2BGTA 3IULA 1G7CA 2O6HA 3INYA 2Q2WA 3P96A 3BFVA 2Q5LA 5E6UB 5SICE 5GV7A 1R3UA 1SQSA 3R3ZA 3W8RA 4BGEA 5CMLA 2H11A 1PNRA 2C9CA 3RSZA 3CX7A 1CR0A 2PUHA 1D2NA 2Q0SA 2BKAA 3H75A 1DG3A 3N53A 4UCFA 4V0RA 4LRTB 4YROA 2C07A 3OHMA 1IQUA 2RE8A 4ZDKA 4ZI5A 2P75A 1I4TD 3D7MA 1X7DA 2CXRA 1PZHA 3RQIA 1Z6ZA 2AFIA 3RAPR 3MAAC 1YIDA 2WMDA 4IQ0A 2P0AA 3ANNA 4OVKA 3RYTC 3U39A 3VR2A 5CA0F 4Y9RA 3H9UA 3A36A 4CM6A 3PHCA 4KEAA 5TT1A 2CZGA 2G09A 1TVEA 1FXUA 5JH7B 1A8SA 5JCZA 2PNFA 3A14A 3NHAA 1GFZA 1PE0A 4UVHA 3SSMA 4H4DA 3W5VA 1I14A 1FB5A 1GZ6A 3FFWA 3U6KA 1PUJA 4AG5A 1B1AA 1M7GA 3CSDA 2FMTA 4C4TA 4N01A 2HN9A 4G8DA 1WKBA 1ZR4A 4QT0A 4AJPA 3NC4A 5KCMA 4B4WA 5FV4A 5A4JA 5KWIA 5BSFA 2BJVA 4LX8A 1S0UA 2RI6A 4JY7A 2P9BA 3UB4A 1VGQA 3IXMA 5K0BA 2ID7A 2ZYIA 1XNQB 3KKKA 1U8CB 4KYIB 1ZI9A 4R8LA 4Q9IA 3OX1A 4L15A 1GGEA 1MW8X 3U4MA 4RVSA 1QIJA 1U7HA 2EJWA 5JTUA 1JDUA 2ACWA 2XNDA 3EVGA 3FJOA 1UJCA 1VZ2A 3CEMA 3P1JA 4CV3A 4CETA 1TO6A 1VB5A 1L9XA 1XJ5A 1ZW1A 3AHCA 4TMYA 4I1OA 3GLGA 1Q0ZA 3ABOB 2VSOA 4TMFA 4XD7D 3L6DA 4KFUA 3WV5A 3VU1A 5FNVF 1SCKA 2ZQYA 3LLSA 4BEBA 5CRIA 1YHYA 1H4SA 3FYUA 5K09A 4YCDA 1YQDA 5KJ1A 3A3YA 2IYRA 4QG7A 1YKGA 2AL7A 2QM7A 2W8ZA 3ICWA 4RA9A 2G88A 3VZDA 4GP6A 4BMCA 2IDKA 4XWWA 4JEUA 3PGA1 4DLLA 5BPFA 5JT1A 2O5EA 4Y0VA 3MVEA 4RYLA 2W2LA 3NETA 3ZS9A 1COZA 3SI7A 3T52A 3LYUA 3O31A 1E2GA 3G79A 1LK7A 1U6KA 3ZWYA 2Q0HA 1S3IA 1VLMA 4RY9A 2C3OA 1XYYA 3KX2A 3TZEA 3U3ZA 3Q9UA 3L0OA 1ZL0A 1Z4NA 2L0XA 3A6DA 5F7XA 1DRKA 1OLOA 4JROA 3T54A 1R6DA 5FPPA 1Y4ZA 4PLTA 3BA1A 4WXMA 4RK1A 4DEYA 1QKJA 4PG6A 4F4CA 1ZN7A 1ZGAA 2VWPA 3KUUA 4K1XA 2ZRPA 1JQDA 2ZJAA 1KZGB 4N54A 4FNOA 2IXTA 2NZVG 5F3DA 4H4CA 4LGCA 3QVJA 2H06A 2PRSA 4PHCA 3WDKA 2OAQ1 4HNUA 1UXGA 1Z6PA 3JARB 3AY3A 3NDPA 4AQYB 1MZPA 4JI1B 2M98A 1E2BA 1USIA 3QELA 4GP9A 3LIPA 1PYGA 3SVTA 4WZAA 1YZ3A 4Q19A 3F74A 4F8EA 3B3FA 1BN7A 3VVCA 2N1BA 4HZIA 1MPTA 2XGOA 4PZ9A 5G4LA 2ADMA 2H0QA 5HM8A 4GG1A 421PA 5FI3A 1RZRA 2FA9A 3O8RA 2H6EA 2R8YA 1OLXA 3DZJA 5SZKB 1FLVA 3WK8A 4BBAA 3NHPA 5JJBA 1GUYA 2GLXA 5DTMA 3AOEC 3F1KA 3LFUA 1KY4A 1YH3A 4RKWA 1RYNA 1Z07A 3SHOA 4EHBA 1YGYA 1N8NA 3DEHA 2GGSA 2BL4A 4JB2A 1ZJ5A 3BGOS 4NAVA 4KL8S 3PI7A 1R6TA 1YI8A 3FX2A 3NIDB 1L1QA 5ESXA 2YYAA 4BIMA 4DQVA 2ZAIA 1B8VA 4G1BA 1WXFA 4FVTA 3LUAA 1IBSA 3OLWA 2OP1A 2QN1A 4JVNA 4AZ0A 4DCOA 1H8HD 2MYNA 3KVNA 1J8VA 4UHBA 3UTDA 3IESA 1GGFA 3ESXA 5TGDA 1H1DA 3TTXA 5I3ZA 1Z6TA 4RAOA 2VDLB 3IUNA 5TY0A 1D6JA 1YIOA 4LGVA 5JS1A 3UMGA 3ZGXA 3RYCB 2NW6A 1FU8A 5FP0A 1F0KA 2DQYA 2PSFA 3K8ZA 4IR7A 4RFSA 5C7YA 5LMCA 4BLSA 1Z82A 2X58A 3HR7A 3DEAA 3WJ7A 7ABPA 4C4PA 3D8UA 1NVWQ 3N0XA 2VBFA 2VZEA 4RM2A 3KWJA 5SZIA 1ML3A 2RKBA 5F73A 1RM5A 2GYYA 1GKYA 4LXYA 4KRYA 3VC2A 3VZPA 1YC5A 1NXXA 2FWJA 4LOJA 3O1IC 1T3GA 2EXXA 3T7AA 2IXBA 1ZISA 4I8DA 5BV7A 3KPWA 2FG5A 2ZBUA 3I9V1 3DB2A 1OMOA 4CTJA 4H2DA 1MFPA 2DTDA 4WT7A 2R85A 3BHMA 3AHDA 1XQXA 2DY1A 3OZDA 4ZO7A 2IYOA 3NDJA 2VAMA 5JBQA 1H1LA 1XMXA 4QPJC 3BRQA 3VU8A 4XWTA 4I1PA 1FU4A 1VPWA 4DIDA 1NW9B 3H87A 1MF7A 2AEEA 2J41A 2XVZA 3GLKA 4F9EA 3COSA 2EFYA 1O96A 3IBYA 3CG4A 2F48A 4O2BA 4B8ZA 5BVGA 3NP7A 1YZLA 1ZZEA 2WJJA 2QW0X 5C34B 5BRNA 2F3SA 1HDXA 3HJHA 2XCUA 4ZQEA 2CLMB 2QD1A 2NPIA 2QSYA 4XSHA 5FJIA 4G5XA 1T4CA 3Q3JB 3ZYCA 4AK9A 2P2NA 1SUDA 4JU9A 4H6VA 5DBOA 5ALIA 3HN2A 2MR6A 4JFAA 4LF4B 3UJ3X 4TV9A 3FNFA 3UJ8A 1BQ4A 3GUUA 5CLGA 5C8ZA 2O2ZA 1A3CA 2C59A 1T6NA 3AJ8A 3BJIC 4CL8A 3L7NA 4K9LA 2PZFA 1SA0B 3S68A 4YAIA 3KYCA 1C7FA 1CP2A 5IUJC 1Y33E 2WB2A 2J6BA 5DU2A 4X3PA 1N57A 2FRVA 1H94A 1WZ2A 1PRYA 3UMMA 2PD6A 1BROA 1UQUA 2EX1A 3L6OO 3WLRA 5KWSA 1ORTA 2YHAA 2W00A 3OHPA 3UY4A 2TMKA 1EK0A 1FNDA 3WLSA 3ZHZA 2NNLD 2BFPA 4TM7A 4CU5A 1EJ6A 4JI6B 4WLNA 1NDHA 1RACA 1N7IA 1FNBA 2IZ5A 1WZCA 2QF7A 3QLUC 1G7RA 1TCBA 2Q5JA 1DZIA 3CMCO 4OP3A 1FYDA 4PWZA 4RA9B 4Z9FA 1FYXA 1FQOA 3D5TA 1TEZA 1DWUA 1JSLA 2FSPA 4PZDA 2C61A 5BQ5A 1PGJA 1Z0UA 2B2XA 3JVEA 1OAAA 4QASA 5ABPA 5LNK6 2Q5IA 5C81A 3T7KA 3EDYA 3OJEA 1KI8A 3ER9A 4EHKA 4Z4FA 5BSTA 4B4KA 4O08A 1NGSA 2VYVD 4A8TA 3Q3HA 1E1YA 4YP5A 4RCVA 3OF3A 1N2CE 1JMYA 1DUIA 1MP0A 1WXHA 2B34A 4JJ6A 2XD4A 4J0KA 3PA8A 3PHLA 2H5JA 2P6NA 4AKTA 2C7BA 4NECA 4DPLA 1P2DA 2GAFA 2IH5A 2YXDA 1TCCA 4G5FA 3IT2A 4L57A 2YN4A 2BWJA 1J6UA 2JIRA 3HU1A 4KQCA 1Z18A 3M5PA 3PHJA 2JS7A 4NZYA 5B1SA 3WL6A 3NVKI 2FPGA 3SHWA 1T0PA 1T0IA 2BEVA 4WECA 3KJEA 2Q7OE 4BNWA 1RXEA 3U81A 4P82A 3QVWA 3KELA 4ALIA 5KTPA 4S05A 3NALA 3I4CA 2X3FA 1U2TA 2AG0A 1FDWA 4EB0A 3B53X 4FNAA 4DLRA 1M2NA 3WO1A 5JAIA 1E69A 3T0IA 1B16A 4FDTA 4B3FX 3D31A 3D8BA 3T3HA 4Z4IA 2VJYA 2LD4A 4QSMA 3L49A 4HRAA 5EJ4A 5EXSA 5I47A 3GJ7A 4X7BA 1ABBA 2O05A 1JDJA 1FVHA 2HEIA 4IXDA 2I7VA 2TECE 3T9CA 1J8DA 4RJTA 4BBPA 4YR9A 1S6YA 2E18A 3SZ3A 4BV2A 2R8ZA 3HVKA 3PR2B 3QMVA 1DSSG 2XYHA 4ARBA 2MIIA 4TN5A 1LF5A 1R12A 4Y2JA 2PS1A 1I3KA 2Z43A 3BF7A 3LBNA 1QSGA 3GFSA 3TCNA 2IZZA 1GNSA 2YY7A 5CTAA 3T3MB 5FAKA 4BASA 4KQKA 4QUHA 4OK3A 1TRHA 4EIWA 3NKVA 2WIAA 5CJPA 2VQFB 4JU8A 3OSZA 1C50A 4KO4S 3L43A 1F8GA 3HXLA 1KDVA 1B42A 3DBLA 2P9JA 3GZNB 2ZANA 3HEBA 2HSZA 3AFHA 3KZOA 4AWXA 1JJFA 4CXMA 1ORIA 2V7PA 1WO8A 1K2WA 1WG8A 4EJSB 4HWKA 4XDHA 4DLTA 2OM6A 3C3KA 3RS5A 2WWHA 2E85A 5BSMA 3A1DA 3RYCA 2F1RA 2RB4A 3LDUA 4R2KA 5SYNA 5IVIA 3ROEA 4D8UA 5K0GA 5EPOA 2ID4A 3MWDB 1P2FA 4IIHA 3EDQA 4HAYA 4ROSA 3NHUA 4GYWA 4F8JA 5LP6F 3RYHA 3N2IA 1HG1A 2BC9A 3AKEA 2DX7A 4TQUS 5LJIA 4IIYA 3PS9A 3BZBA 3EGEA 1ZJWA 3A9UA 3FYDA 1LPNA 1SR8A 2JPDA 3HRHA 1N9KA 1H1LB 5K0JA 1BXGB 1QHIA 2BFBA 2HZBA 1GSOA 3RVDA 1MFZA 2P9HA 1TZKA 4LECA 1M6VA 1ZH2A 2GEKA 2BGMA 1LKZA 3KT0A 3RC8A 1MBZA 3I2JA 2XZOA 2GHIA 2ZDGA 4J94A 3QFTA 3WGOA 1JAZA 1PSZA 2E87A 3RM3A 3UMYA 3O8BA 4LRUA 5FULA 1R3DA 1PWEA 4XSVA 1OV4A 2W42A 3ICVA 3NWBA 4MKIA 3I8OA 4IX9A 1T1RA 3CW8X 5K20A 3D64A 5FYDA 4MUMA 4MW9A 4ZJZA 3FPKA 2LP4Y 2BR5A 4RORA 1XZLA 5D00A 2HB6A 4R41A 5LZ5A 5JZSA 1UKZA 3NRJA 1NHWA 3NR2A 2QMEA 1N8TA 1Q7CA 1UP4A 2OCKA 4OOFA 1GG8A 3ZDCA 1E7RA 3AWDA 4DQDA 4MQUA 3I62A 5KREA 4XASA 3IAM6 2ZIAA 3MWFA 1R0YA 4ZV7A 2CUNA 2OZVA 4NJOA 3ZKWB 4DYHA 1CK4A 3KJQA 5IM4F 4Y2PA 3Q0IA 3OURA 2DPGA 3ZCVA 5BN3B 4NFYA 5EMMA 2Y93A 1Y4UA 3BILA 2CXSA 1I9CA 2Y4NA 4MR9A 1SBQA 1HLPA 4AC9A 3PG5A 1S8FA 3J81k 5CG1A 3DTNA 1I8TA 3TW6A 1M67A 5CT5A 5FEUA 1YCFA 3B9QA 3JAMA 2X2EA 5CXUA 4X91A 1GU7A 2NACA 2WJVA 3HNOA 2H7CA 5DNVA 1XP5A 4RESA 1E5VA 2QL6A 6GPBA 5CYFA 1E77A 1NMQA 1NF8A 4EG0A 5T8KA 4NFSA 3PIIA 1P6UA 4N49A 4RELA 3LVRE 2HFKA 1AQJA 3VO8A 3U09A 3ID6C 1BE6A 2J59A 4C0XA 3GJ4A 5A71A 8ATCA 2UXBB 5B53A 4ER5A 4I55A 4NYJQ 4D8TA 3GEEA 2UZ4A 1GYQA 5HDQA 4QRDA 4WNAB 1HEIA 5A4IS 5GGXA 1VQ1A 1YR7A 2YZKA 3E0XA 4G23A 1J0XO 4NTZA 4NV3A 1MQ8B 1WOMA 4QO8A 3IUYA 3VC1A 1K6IA 4KR9A 1GNLA 1QUEA 2VYVA 3QHAA 5ELLA 3KKZA 1Y1TA 1Z6QA 3NH6A 1O2DA 1L3IA 3K0FB 4PGFA 4WLVA 3O4HA 1P0IA 2YWBA 2GZ1A 4J9UE 4PHHA 3WMEA 1Z7WA 3QIVA 3M6FA 4DRYA 2JC3A 3L41A 1W581 1TUIA 1GGJA 5IAGA 1RAEA 2WJ6A 1B6GA 3RRXA 1HFEL 2GD0A 2OSBA 4I0WB 3ZW8A 3RTBA 3MHTA 5A2QA 3D4NA 1S01A 3REQB 3SLKA 3UM9A 5HQTA 1ZUNB 2BEWA 2XAUA 4ZYWA 3WGYA 4WY8A 4K9OA 5A5VA 3DEIA 2HCFA 1G2QA 4LZLA 1U2PA 3EHEA 3R09A 4DY4A 1AZTA 4CF3A 4Y2GA 2ZYTX 3LXUX 1K7EB 3KBOA 4XWKA 3Q8MA 1JH8A 1VPLA 3CEAA 5KBYA 1YS4A 4MGKR 2KHZA 3W9BA 1Y4DE 1AD2A 1E59A 1HEYA 4O4IB 4JBWA 1NULA 4ASUA 3HYRA 4DQXA 1U8EA 3DE7X 3EEFA 3QYJA 4NWIA 5FXMA 4EUHA 4CE6A 4EGCB 1AQUA 4XB2A 1QJ4A 3IALA 1DP4A 3I72A 1ZK1A 1P5ZB 5KX5B 5JVDF 5JS6A 2GMWA 1UAYA 2CYBA 2YN0A 4UTVA 5E8RA 1RXUA 4LDRA 4WBSA 1SCAA 2C00A 1H3NA 2H85A 2OZPA 2Y1OA 3EMDA 3UV6A 2A9FA 1LDGA 3RHTA 1G8AA 3HBAA 5L45A 4FYYA 2ODNA 2IE8A 3JYOA 4WZBB 4P9NA 3AZPA 1TDJA 1EK2A 1C8LA 3OA2A 1TQ2A 2CYCA 5A04A 2P4QA 3GJQA 4QTXA 4BNTA 3THYB 1OXMA 1FTNA 3KUXA 3VZCA 3S8EA 3NIWA 2O2SA 3I05A 3URMA 2IEYA 1PK9A 1U0RA 4YMIA 2MTBA 3CVVA 2QJOA 3RAEC 2PA0A 4FGSA 1QAQA 5B3JC 3DA8A 2BEUA 4FE3A 5KWEA 3V7FA 1BG6A 2AXNA 2P8SA 2C4HA 2J31A 2XUHA 3R7BA 1L7XA 4Z99A 4A0HA 4QQ8A 5L3QA 4DJDC 1U8UA 1MO4A 3ROZA 4RF5A 4PCVA 5MFZA 1ULSA 1SD5A 5T6BA 4WZBA 2FSVC 3W7AA 1Z83A 3KXKA 3P71T 1V2HE 3RC2A 4KR7A 3H5LA 2VQDA 3GELA 3KSZO 3HKCB 3QUAA 3TS1A 3V8PA 4JXJA 4AT1A 4AS2A 1O08A 4CMEA 2ZIGA 1QFJA 2YNMA 3E23A 4RE6A 1CEXA 2H1RA 1F8YA 2A67A 4EW2A 4X6YA 5AD1A 5I4KA 2GS9A 4IJVA 5AUPB 1T9GR 5FBQB 4RMJA 4EO9A 3IIIA 1QVRA 2I1LA 2GRUA 1H0KA 4LJ4A 3WYDA 2F8TA 3AEUB 5IXJA 4FMDB 6Q21A 3ADOA 3R4VA 4NEHB 3I6QA 4PQYA 4M0PA 1NTOA 1ZEMA 2NVBA 2YBEA 3C1AA 4PGHA 5I9NA 1XDBA 1ZXXA 1D4AA 4YIKA 1VCOA 3A1TA 2HSGA 4G36A 4UVEA 3SIPA 3WISA 1PZGA 1PJ2A 3B8HA 3V4RA 5JOQA 3HS3A 1BS9A 2QYHA 3ADPA 2XQJA 2PU5A 2ZSAA 5L8VA 4MR9B 1KP3A 2I9PA 4JVLA 5DT9A 4BX8A 1E3IA 3HV0A 1IBKB 3U60B 3O93A 4QPNA 3GDOA 3SDBA 1II0A 3MWYW 4G1MB 3W90A 3V8NA 4BJ5A 4W5WA 4ZIRA 5JTTA 1KEKA 1WZUA 4IZ6A 1ZLXA 2UYGA 3RKRA 3Q1KA 3JQ8A 5HQ3A 2IGBA 4HGRA 5TS3A 2IH2A 1HR0B 4MIOA 2HWKA 3EEOA 1UJNA 2RH5A 1U0TA 2YV3A 5T6MA 2FUEA 4G8BA 4AP9A 4E94A 4O0LA 3CTPA 1SOMA 4EHJA 3I9JA 4MINA 4PX9A 1HFJA 3TKAA 1WXXA 3RREA 1Y1KE 1DOZA 3RUAA 2AOTA 2ZUWA 2NYAA 3I30X 4NAHA 1NVGA 1TIPA 5JRZA 3LYLA 1XT6A 4QTTB 2RB5A 3ORHA 4EEZA 5BNIA 1W2GA 2ZP1A 4RF3A 1GXSA 2ZPAA 1JR4A 4BP1A 1WSDA 1TMOA 1YR8A 3ZWBA 4UFNA 2ETVA 3JD2A 3N7TA 3EFHA 4HHEA 2E5WA 3AIKA 1BFDA 3NEJA 1B3BA 1E2EA 1YRQA 3W5SA 2IJGX 5DX8A 4N8SA 1FOEB 2J9RA 2PRJA 4V24A 1U28A 1ZP6A 3ZWVA 3EXG2 1EEHA 3CT6A 4V0SA 1OA1A 1RI1A 4MUKA 1J33A 5B58C 1QU2A 2I3AA 3DHWC 3DV0B 3PNVA 1PR4A 1EM8B 1XTRA 4PO3X 2RH9B 5I7AA 3IV7A 1WUYA 3GPBA 4GLOA 2R60A 3TSYA 3L0BA 3FFBA 2PT5A 3EWNA 1DXOA 1IRXA 4TWAA 5B4UA 4ZEMA 1L8QA 1LVGA 1Z34A 4JDUA 1YE5A 4QYIB 3BK7A 2WJGA 1K88A 4LSZA 2J33A 3TKYA 2VR1A 1HE8B 3OIUA 4BWVA 1CULC 5LKRA 1SVMA 2GA9A 3GLIB 3IP5A 3RTGA 1X1QA 3S2GA 3CCCA 3S70A 4PVDA 5HFJA 1D7OA 1C9YA 2RCNA 2J5BA 1LPMA 2FZEA 3DZIA 4Z1MD 1N9GA 1C3XA 4AJKA 3D6UA 4I6EA 2ONZA 2OD9A 3HI4A 4RGVA 5GJVC 3K9CA 4RV4A 5HX7A 4ZVLA 3AHGA 1S4MA 1QIEA 1QLWA 1P6QA 1V5EA 4UEKA 5K3BA 3RIMA 4ALKA 2PGXA 1VRCA 2HSDA 2YS7A 2RGAA 4RACA 1AU9A 3W5JA 1P72A 4MSUA 1DI0A 3WSTA 1O0CA 2G72A 5FAXA 2IHBA 2Q3CA 2IOYA 4LF8B 4IDGA 1A04A 4NCKA 1IBMB 2CFIA 3KEGA 1XROA 5CXXA 5ITZA 3K9HA 4OYLA 2LKDA 1N92A 4FMCF 3EGCA 2JH3A 4QYSA 3IVGA 1JAXA 1SUSA 2OXEA 1NDQA 3F6EX 5KNCD 1X19A 1AGNA 3C48A 2P6PA 3H2BA 3ONVA 1UC9A 3A8TA 3GRAA 1HDYA 5AXDA 3QIAA 4EZBA 2OE2A 3P97A 1QG0A 2C95A 4Q1AA 5HBGA 3P8ZA 3GA7A 3IPXA 3ZK8A 3Q41A 2PUJA 1KFKB 5KNDA 5E9AA 2OHVA 4OP2A 4FM9A 1D2AA 4ISCA 3VU9B 3IHWA 4QDUA 3T61A 3OZXA 3WAKA 4RFLA 3KUCA 5CW1A 4YJ3A 3GHHA 4HEA6 4JLOA 3BX1A 1NQUA 2VP5A 1GU0A 1XQ1A 1SIWA 3FKJA 4MR8B 4DM7A 5CEEA 1YNOA 5LA6F 1XV5A 5KYUB 3DDSA 4LNAA 3G02A 3ZXYA 2O2YA 2Q7XA 1P6XA 2E37A 2JEZA 5FH9A 2FXVA 2I4LA 4TMVA 3BYZA 4I5DA 4ZAWA 3GMIA 1L5NA 3VPDA 4B32A 3CZ4A 1PZEA 5HKAA 4Q3DA 2ACEA 1V37A 3PQ2A 2MR5A 4X93A 4QM7A 1Y5MA 2MOKA 3IVXA 3LU1A 4EQ6A 3MCTA 4Z1OA 4QNNA 2YR0A 3DQZA 3F5MA 1LSOA 1MAHA 2E82A 3L0PA 5KI6A 3BIXA 1U2QA 2AXPA 5K4AA 2BGKA 1TIBA 4GU5A 3RCBA 4EG5A 1U8YA 5EJ7A 1GN9A 4UC0A 3VTKA 2XQVA 1JT9A 3GMSA 1X9IA 1WB6A 3MT9A 2UYQA 3V8EA 4EAAA 3CVUA 1VP9A 3TLKA 4CMKA 4CT0A 5LQKA 3PHBE 2VJQA 2QTGA 3NBYC 4K86A 1TFRA 1WCIA 1J4AA 4RYDA 1T5OA 1V71A 1UEIA 4K9QA 2G71A 4PRZA 1YDMA 4TSRA 2WKSA 3BWEA 4X61A 2XTMA 3GOQA 5COQA 3ND8A 4Q4LA 4LHYA 1AO0A 3EIOA 4XM2A 5LDHA 1XZQA 4QU0A 3H1EA 4R5MA 2Q6KA 1K7XB 4ZZ1A 2EBWA 4MULA 5DLYA 1DKLA 1G2IA 2VNHA 4CL0A 3N58A 2ZUDA 1MC4A 3QRWA 2PH5A 5DNAA 1BWSA 1UMKA 2GDJA 3NCTA 3PKZA 2EQAA 2GPWA 1LGYA 2JVKA 2WMOB 2H1VA 4U3JB 4LOIA 3ZXIA 1KNQA 3QBJA 5JDCC 1R2QA 1X9GA 2WIJA 3TNYA 2OY0A 3AHEA 1KBQA 2QG6A 5E7IA 2GEFA 5LZ2A 5AVVA 4OHKA 2PUTA 2FZKA 4CDNA 2QP3A 3DNPA 4MVYA 1JG7A 4P31A 2R44A 4YLGA 4BVLA 3HBLA 1A2KC 4E12A 3SJAA 3HYLA 1EHCA 4ZO9A 1Y3AA 4LXUA 2A0YA 3LY8A 4PAGA 4DSZA 3EMVA 1A5TA 3EFOB 2RHHA 2ZBGA 3ISVA 5EJGA 4ONEA 4M1EA 1ZICA 4RO0A 1ZR2A 3M6UA 3KEOA 3SM3A 1P2UA 5FTLA 1BYIA 5B2ZA 3KQKA 3GJ5A 4IMIB 3ZH9B 3K2EA 5GJWC 5K6AC 4NCAA 9MHTA 1WTAA 3HXMA 2R5WA 3P9CA 2HQBA 2ZB2A 4CDMA 1UBUS 2JLXA 1FVOA 4KXFB 5A0TA 1FC0A 3VFDA 4D5GA 2Q49A 4WLEA 5AKJA 1Z6AA 1W36C 2QU7A 2ICAA 1Y6ZA 5JCXA 2FMIA 3DAHA 1Z2CA 2PPLA 3DG9A 4ZQFA 5I45A 3GN1A 4HWOA 2Z2YA 3DVSX 3PPXA 3TBHA 2FSVA 4UUNA 3SSAA 1W88B 3WQSB 1T5HX 2QT9A 1CUXA 5JR3A 4KQJA 4KYTA 4K9PA 3STHA 3G13A 3X1ZA 3PVSA 3F9RA 1F6DA 1I7SB 1T24A 1E0KA 5DNDA 1K5GA 4NDZA 2UZ0A 4POAA 4D9GA 1UR5A 1WE2A 2WIBA 2X5JO 1ETHA 1ZMOA 3LBHA 4FP9A 1NLZA 1O6FA 5CT6A 5BSVA 3X1DA 1WUJS 2HCTA 5HJ2A 5BNWA 5GINE 4XX0A 1CC1S 3B6JA 4GI1A 2CXOA 2PD3A 2GWHA 4U7PB 1SHJA 5EWMA 3T94A 5BWCA 2XVYA 1ZGBA 2J0EA 2Z95A 4JMLA 3UT0A 4MPTA 4QLBA 1KH3A 3HXOA 5IAEA 4OUDA 1RYDA 1UDRA 4L16A 5DGHA 4Z0NA 4RA6A 4HZUA 2ZSUA 4F4JA 5CB6A 1OWOA 1XL0A 5ER9A 4FHDA 1Y9EA 1UWVA 2VNAA 2HFJA 1F2UA 1TA4A 1U5CA 3AUTA 2HF9A 1YVDA 1J99A 3GGJA 1DAFA 3O3NB 3TI7A