3CT4A

Structure of dha-kinase subunit dhak from l. lactis
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
328
structure length
318
Chain Sequence
EKIINQPQDVVSEMLDGLTYAYGDLIEKVPDFEIIQRKSPKSGKVALVSGGGSGHEPAHAGFVGEGMLSAAVCGAIFTSPTPDQIYEAIKSADEGAGVLLIIKNYLGDVMNFEMAREMAEMEEIKVEQIIVDDDIAVENSLYTQGRRGVAGTVLVHKILGAAAHQEASLDEIKDLADKVVKNIKTIGLALSAATVPDNEIEYGVGIHSEPGYRREKMKTSYELATELVGKLKEEFKFEAGQKYGILVNGMGATPLMEQFIFMNDVAKLLTEENIEILFKKVGNYMTSIDMAGLSLTMIKLEDDQWLKNLNEDVKTISW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Structures of the Three Lactococcus lactis Dihydroxyacetone Kinase Subunits and of a Transient Intersubunit Complex.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transferase
molecule keywords PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-bind
total genus 115
structure length 318
sequence length 328
chains with identical sequence B, C
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02733 Dak1 Dak1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1180.20 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Dihydroxyacetone kinase; domain 2 3ct4A02
3.40.50.10440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dihydroxyacetone kinase; domain 1 3ct4A01
1UOEA 1PZXA 3JR7A 3PNKA 2IU4A 4LRXA 1OI3A 3PNMA 3PNLA 3FDJA 4LRYA 3PL5A 3PNQA 2IU6A 3CT4A 1UODA 1OI2A 3PNOA
chains in the Genus database with same CATH superfamily
1BEUB 3FPKA 3ZLUA 1WMDA 5KEIA 2D3TA 2OHOA 2PD4A 3PJGA 3CX3A 4L51A 3K20A 5EE3A 3S0JA 2BSAA 1T5IA 1OXSC 4N7BA 1H6BA 3NOOA 4R9SA 4RXUA 4BAUA 3MEQA 1X1EA 4AZSA 3QYFA 2HRZA 1OB2A 5EIEA 1XC7A 4KN5A 4HRXA 4M7OA 3V1YA 2AW5A 4MQUA 2MSCB 4RD1A 5FIUA 4AJJA 5KNCA 2C7OA 3SYRA 4TV8F 1BH6A 1U5CA 2VFAA 5GOZA 3JASA 4CTJA 1MG0A 1OHHD 3K5HA 1MUUA 1PGQA 1ZEMA 1A9YA 1UBCA 3A9WA 1C3OA 1P1RA 2R4QA 4I3GA 3CXRA 5DMHA 3IHTA 1RM0A 4MVJA 3QXGA 5EKTA 3B5IA 5JZSA 1G18A 2G71A 3LC2O 4XIYA 2QLJA 1G5IA 1M2WA 4L02A 3E9QA 4CKBB 2GN0A 3FMFA 3DKPA 1EAYA 3QEKA 5DOZA 4DGSA 1WE2A 4NC9A 1XZCA 4YJ2A 1PZNA 1TCUA 1J5PA 1YKSA 2O0LA 4BLQA 2Y8EA 3RW9A 1X86B 3CX6A 1JW9B 5F73A 3BB1A 1YOBA 3M8KA 1DQZA 1FSZA 2AG5A 721PA 4R54A 4IGKA 1DEXA 3ZU5A 5IYZB 2JLYA 3KLNA 1IHDA 4DPKA 1OE0A 4JC5A 3WICA 1ZBDA 2JA2A 3OX1A 4IHQA 1WEHA 2PXAA 1SELA 4ZU1X 4M0UA 2YVUA 1JA1A 4PG4A 5FL3A 1PGJA 2EKLA 4E5PA 1QOZA 5IW8A 4QGGA 3A4NA 1D6SA 2BTOA 3TI7A 4QBIA 1ZK2A 4H0FA 4YRIA 2IP4A 1Y8QB 1EDOA 5TT0A 4F1JA 1ELOA 2CLCX 3WMGA 3PXGA 2C4VA 5IT4A 5EMJA 5HGXA 3K16A 1CF2O 1YI0A 2K7FA 3PJRA 1T10A 2Y2UA 2NXCA 3OA2A 4TM8A 3IA2A 3K1AA 5HKKA 3PQ6A 1I4TD 3V7UA 4BU1A 3PWSA 5TGDA 5B3LA 3F7OA 4LBYA 4Z7NB 5DHSA 4M55A 4OU4A 1MPXA 3JAWB 2NUAA 4IDOA 4ZOEA 3TGPA 2J6HA 1Z2OX 3SNKA 1EVIA 2FMKA 2AG1A 2ZJFA 1RZVA 5F3DA 4FKBA 1LTQA 2WB2A 4TTTS 4ZDIA 1KI3A 1QV6A 4FB5A 3U4IA 16PKA 2D5IA 4CM9A 3RRXA 3USES 4KACA 3QKTA 1YOVB 4J0KA 4DSNA 3KKEA 4GKAA 3CLSC 3E2IA 3L7KA 1Q11A 2J87A 1JPJA 4N6GA 4OI2A 4OLHA 5HTOA 2PJRA 2GRAA 5L4NA 1QONA 3KLOA 2C9ZA 3B82A 5TMPA 3WAGA 1JFRA 3GCDA 5C9ZA 4HXGA 3BIFA 4UNSA 4DPMA 4WY5A 3OJCA 4N9WA 1KSJA 4UHFA 5ADVA 3EZ9A 2JK1A 1C1DA 1QNFA 5JVDB 2GDZA 3VVLA 1E98A 2RK3A 4MA5A 1XTVA 3GARA 3ROKA 3W5JA 2A4MA 2NWQA 3H2KA 4RL6A 1POXA 2WFLB 1PU2A 1FZQA 1E1RD 2EHJA 4NNPA 3OBIA 3RUHA 3T94A 4EDFA 5CG2A 3QFFA 3RVLA 2QN3A 4Y6OA 3S28A 1C41A 3F90A 3PR3A 3QTTA 2XYRA 3MMXA 5JHHB 3I5MA 2C3PA 1DXOA 5HG0A 2NUAB 4D9JA 1YRYE 4LNHA 4MEJA 1JR3E 4M2LA 4NSNA 5TQVA 1PVOA 3PC2A 2YWBA 2XF2A 5I4BA 2DR0A 4M6WA 4X8HA 1GTL1 5BT8A 1UJ2A 1GGHA 2QT9A 4E3WA 2FWPA 3MCUA 1CULC 5I4CA 3DGEC 3O8QB 4ACAA 5JWOA 5TARA 5IVPA 1XMJA 2I62A 1B16A 1HGXA 3HCEA 1WKVA 3L7JA 4HXEB 2BBTA 1BHQ1 1SPBS 1FBNA 4CFSA 4MQMA 4EA7A 4V38A 4JI8B 4D4GA 3QPVA 1R6UA 2XNDD 3TNFA 1YVPA 1MQ8B 3P2OA 3CE9A 4E46A 3CMCO 3QVUA 1JDTA 4NZNA 5EQDA 1ULSA 2GUGA 2QNRA 2XUOA 1VA5A 3KDAA 4HVAA 4RKEA 4W1SA 3H11A 3AR6A 3BFXA 2Q5JA 3VC2A 1C0KA 5E2IA 2W4QA 3L5OA 1HNNA 3D8HA 3PHLA 3IULA 1OREA 2BN4A 4GOMD 4HPWA 5J40A 1C9DB 5BW8A 5E7MA 4O4JB 5L6MB 3BIOA 3O4VA 4BO4A 4HNTA 5HZGA 3WVNA 3LU1A 4PN7A 5E7JA 4CEJA 3H6KA 5BQ5A 3V8PA 3ZZ1A 4IDEA 3E61A 2G1UA 2PMWB 3K9CA 4JQYA 4D0GA 4E21A 2PX4A 4YMTA 2NXWA 4M6WB 4ZJPA 1TZJA 2Q99A 5IT5A 5FWXA 3T54A 3KQKA 3C6BA 3CJRA 1YZGA 2JI6A 2HQRA 2WSYB 4XJTA 4DM4A 2FPKA 3RFCA 1M9NA 2OWEA 2Y1WA 4GP6A 4OX9B 2YZKA 3KK0A 1ZJ4A 3NHBA 3F47A 5EXDA 2C2OA 2J9ZB 2YY6A 2UXDB 3WYDA 2ZYGA 1OZ0A 5JQGB 3MIZA 3UJ3X 4NMHA 4B2IA 1I0ZA 4BQPA 1O3YA 3DFFA 2ZI7A 5C3UA 1BE1A 2WV9A 3EG9B 4Z86A 5BN5A 1IN1A 3NVAA 4GICA 1ZM7A 1ZMOA 3U7FB 4EUFA 3AVQA 1IOVA 4CL8A 5J3JA 4UASA 2WTXA 3H8VA 3NVKI 4PLWA 2ZRDA 4IL5A 1IL0A 5B7GA 3GIDA 2VWGA 5HBRA 4DC0A 2OXRA 4URWR 2IFTA 4DADA 1WQ4A 8GPBA 1U2ZA 2QY9A 5EQJB 4C0JA 4Y98A 2DT8A 4WKPA 3QLEA 4XRGA 4MYCA 4OSPA 1P5JA 1N2GA 5CEEA 5AHRA 4MP6A 1SH7A 2O0HA 1OBHA 4QM6A 3ZBQA 1YB5A 1Z29A 4JUBA 3UXHA 4AL4A 1SBCA 2PD3A 1YQXA 4M1WA 4EJFA 5KNBH 3K1ZA 2H1SA 3WL5A 4X90A 4M87A 4HDSA 2QGFA 3HM2A 5JSZB 4IDAA 4KQGA 4ZZ3A 5JASA 2NO0A 1RRKA 2F59A 1CXZA 1WUKS 2C5FA 2XOKA 4YMSA 1P0FA 1VCHA 2F8SA 2ZB4A 4MW5A 3DF7A 4LJRA 1N5JA 4INAA 1U4NA 2CJWA 2CVQA 4UVDA 1LK7A 3M5CA 4RY0A 4WBNF 4DABA 2ZAGA 4NULA 5GGXA 3OQVA 4DT1A 3DDWA 3ZD6A 3HKBA 5IJ9A 3ZU3A 1Z18A 3VV2A 4DV2B 4MGEA 1OCEA 1PWZA 4D8XA 1WU7A 2HD4A 2MMCA 3H6HA 3WL8A 3KKLA 4KQMA 3BMQB 2PR2A 3V4VB 4B3XA 1K2WA 1D6JA 2GWRA 4JJEA 3VC3A 3NMUF 3R0VA 1AXEA 1UXJA 2QMUA 3IIEA 1SKQA 4P93A 2IYEA 5AOBA 3VC7A 2N9UA 3DZKA 3NKVA 5LP6B 2PSEA 3UV7A 5JG7A 3IQGX 1PAUA 4FUTA 5J2TB 1H8ED 1CTQA 4LF5B 5TPZA 1IQUA 4A1OA 3UK0A 1F6WA 3LAWA 3GLQA 4L16A 2WG2A 2RI1A 3GCGA 2YASA 4RABA 1Z13A 3RJMA 1P1JA 1UOEA 3A2MA 3BM5A 1T3LA 2E4ZA 3DEJA 5REQA 3S44A 1EXDA 4EEKA 1JFFB 1VLJA 2Y6VA 2ZE7A 3FY4A 3PI6A 2J9FB 4Y18A 4MV7A 5DSZA 4E2XA 2IU0A 3I01A 1FTWA 3S8EA 1QM5A 4V3CA 4MRAA 1Y1SA 3P0HA 5ETJA 5J43A 1O5IA 1RWVA 2RHHA 4LZOA 2A33A 3PFIA 5AVXA 5HSGA 3D59A 1NRIA 4YRKA 4JIMA 1Q17A 1NBHA 2C2HA 3AW8A 4B83A 2YL2A 3F6BX 1P4GA 4NARA 3GFRA 3I4LA 4MJ7A 2OKGA 4R1MA 1CZUA 4DS3A 1A9RA 2ZSAA 1E62A 2GF9A 1PD0A 2VAPA 1R9JA 2ZBPA 2UVQA 3I01M 3T95A 3VOBA 4AF6A 3UGQA 2PNFA 1FUKA 2DVMA 3E48A 2W2NA 5AW3A 3E3LA 4KQWA 4ZREA 4D80A 1VLMA 2L0XA 3WOHA 2DHDA 4HAXA 2I1QA 4OHMA 3MRXA 5T6MA 4OHVA 2RI0A 3GVCA 3PHBE 3I5UA 1JTEA 1RQPA 2DWUA 2IOFA 3KJEA 4CW7A 2DERA 1L5VA 2ATIA 2IUTA 4I0WB 4NYIR 1XOIA 3C14C 1G5QA 1PKXA 2A9KA 3BMOB 3MGBA 3RJ5A 4B6OA 3CISA 1YA6A 3GQVA 1USKA 3T1QA 4ZQIA 4PNHA 3NI2A 4FX5A 2GJ9A 4DNXA 3LFTA 3H17A 4OV6B 5AI0A 3MJHA 3DYBA 4NDNE 4OJMX 3TCXB 5LPNA 3CCFA 1FFCA 4BX9A 4KQIA 4EGFA 1U4OA 4K6GA 5KYWA 1BYUA 4OU5A 3EUEA 3VNAA 1TF5A 3FCOA 4RTRA 2A14A 1Z2CA 4QC2A 1T9HA 3OM9A 2DCUA 4E5KA 1BMFA 4Z49A 5HVNA 5JD4A 5ILGA 3CCBA 5A4DA 1SIBE 4FEYA 1HF3A 3OC6A 3GLUA 4NV1A 4S0XA 2NV6A 3JRXA 4CR8A 3UYKA 2BMAA 3QTLA 1WU8A 1R0KA 3GGGA 4KQFA 1G9XA 1INLA 1A8IA 1O6ZA 4F4FA 3FZYA 1NQAO 3KUKA 4JOSA 1G55A 1PZFA 2QN7A 1KZ7B 3KZNA 3HR8A 4M9SA 3UMSA 1HM5A 1DKOA 5ALIA 1ZD3A 4JQOA 3L6CA 1GRQA 2X9QA 2OZKA 1DAHA 2C7BA 2VJOA 2VF7A 1HOXA 3OIDA 2EXXA 3D4OA 1K98A 2GS9A 1ZKDA 1AUXA 2B8EA 4QUHA 4YNBA 4YROA 1JEAA 3GIWA 2OV2A 3HG7A 4FCWA 2CXUA 1K6IA 1TM2A 1OFHA 1TRHA 2REOA 2XNHA 1ODLA 4KVFA 1XU7A 2DQSA 5CYPA 1XWWA 2FUEA 2GFIA 5JXGA 1TO2E 1BNCA 1TUIA 2VUUA 3WXBA 2WKQA 3IKTA 2ON6A 4DIDA 2IEDA 3MAAC 1EYZA 5BMVB 3H5NA 4JP8A 2CXSA 4UEOA 2LCFA 4BDSA 1DOAA 3CG4A 3H8WA 3HL0A 2GHIA 3PQCA 4FS8A 4NHOA 1XK7A 2GLUA 2Y1GA 3E3OA 1TLFA 5H8WA 1FRQA 1HQCA 2Z83A 2BGRA 3N2GB 3NAZA 4RLSA 4EEZA 4AMUA 1RACA 2CL7X 2DY1A 1LPPA 1CC1S 1U8ZA 4OP2A 1RPAA 3WQRA 1M0EA 2PBFA 4C3OB 4UNQA 4NP6A 4GPZA 1FE8A 1SXHA 4NLLA 2C59A 1T2VA 4MV0A 2CB9A 1UC4B 4IDGA 3AUSA 4RMJA 2NZUG 5LWHA 3RFTA 5LB4A 1F9AA 2BISA 5TIIA 1A8PA 3KZMA 4JL8A 4TQAA 4BQEA 5D2CA 3ZDBA 3LOPA 1GTSA 1L4NA 3DAOA 2VF4X 4E30A 1GPYA 3H11B 4UUBA 2HL6A 1AKEA 5BQXA 3LP5A 5FR1A 1EXNA 2AJDA 1RJ9A 1SCUB 3VDXA 3OOJA 1AX9A 2PVCA 4ZCPA 1BFDA 1CUSA 3FR8A 5K6AA 3TECE 2QUZA 3RANA 4XLTA 1QYRA 1NMEA 3E1SA 3QM1A 1L4MA 2WUDA 3T4UA 1W2HA 3W7AA 1N6IA 1J33A 1GZ7A 2HHLA 3DEHA 4H4DA 1F51E 2Q7OE 2BM9A 4B7ZA 4XWOA 5C18A 1LQ2A 4CKZA 3R4VA 2B8JA 3RUPA 2WFMA 1U8FO 1VCNA 4DMRA 4HRAA 3EDYA 1F12A 3AEUA 5JEEA 4RU1A 1XLTC 4BNUA 1HDZA 4A23A 2RGRA 4GZ5A 1LSSA 3MG9A 4MB0A 1TK2A 4NNOA 2YIDA 4C0HA 2P1DA 3CSUA 4B3MB 3ZCTA 4YUYA 3FPSA 5U9CA 3PDJA 2Y27A 3FDIA 1AQYA 3I61A 4GW3A 4D4MA 3L1VA 3EDOA 5FRDA 2HMWA 4CUZA 3ZGXA 3GB9A 3SE0A 3VR0A 1XZMA 4QWMA 4DV7B 1D2AA 4QREA 1XNJA 4GKKB 4KQXA 5JCZA 3UUGA 2NVOA 4JR1A 3WZLA 1CY4A 1MB9A 2FPGA 2WZCA 2YZGA 3MVEA 4BNZA 1RMQA 3UQZA 1P45A 4KQKA 3EXIB 5CMLA 2JNWA 2XQIA 4RFSA 4EW3A 3VPGA 2D2EA 4G0NA 1BDMA 3NV9A 4B32A 1DBWA 5KNDA 4S24A 2PLWA 4KO2S 1X1RA 4PNPA 5J4LA 2ZVPX 5ISMA 3ZQ4A 1Y37A 2VJQA 1NNUA 2IOQA 4QULA 2OZLB 3L0OA 4I08A 5KSOA 3ICPA 1FLVA 1AD2A 1IEVA 2CFCA 1AE1A 2A9RA 3EEQA 3L18A 3MJVA 4JMLA 2MYNA 4QXQA 5H0IA 1XX6A 3RHTA 4D4KA 1ZQ9A 4AG5A 1HDYA 4IUYA 2NSDA 4CODB 3FKSD 2GILA 2I2BA 4Q3KA 1PEAA 4IWYA 5JYBA 1S1CA 2A9JA 2PXCA 2GBCA 3QSYA 2NQTA 5L6LB 1X39A 2VXYA 4OYYA 2EKPA 3H5VA 4J0HA 2FOIA 5ALYA 3W3AH 3LX4A 1FSPA 1A71A 4UM8B 4LDJA 1IYZA 4OQLA 1Y3FE 1YRHA 2JF0A 3SHQA 4LXIA 3JQRA 4EPRA 4JI4B 3ERCA 2DHEA 4AJPA 1HT3A 3QK7A 1IBCA 3GG2A 4OHZA 5GPBA 1Y6JA 2ZUBA 1Z4JA 4QOEA 4BFLA 3PFWO 3ZJ5A 3ZI4A 4PYLA 5IVHA 1M7GA 1TYDE 1F0NA 2Y9PB 3CX7A 4XQ0A 3UGKA 2QLFA 5FI5A 1KWKA 1UJ5A 3VR3D 1R3UA 4TYNA 1EMDA 1ZGJA 2A0KA 2WIJA 2ZUUA 3CIOA 4LV8B 5AVSA 3DFIA 2EZTA 1D8TA 4PPQA 1H4SA 1T6ZA 3C7AA 1WD7A 5F1KA 2X1HA 4CMJA 2PIAA 1M2OA 2IKSA 2Q6LA 2ZYAA 3CUWA 1Z37A 3ILHA 4O4IA 2VN8A 2ZI6A 2E37A 4QGFA 3UO8B 2AZXA 2UKDA 4Q21A 4D9HA 3AEKA 1WB6A 1P4JA 1NN3A 5FDFA 1NX6A 3NETA 4FZRA 2ZJ7A 1ISMA 1Z4MA 1MXFA 2FWJA 4RVUA 3NPAA 4ZVQA 3KEGA 5K4AA 4PTZA 2E2WA 4TTJA 2H51A 1CY0A 3OCJA 3M2PA 3TLJA 1OKKA 4LKRA 5IK2D 1OFIA 3ZHCA 3PIDA 2WIGA 1D3AA 3IVMA 2PQ6A 3KQLA 1SZDA 1JG4A 1Q0RA 1D4FA 1H93A 1YE3A 5FTLA 1OKKD 4J6FA 4CLOA 4Q6BA 4ZHQA 3EHEA 3IVRA 1JILA 2WSSA 5K4HA 1P7PA 2OK7A 3P2EA 3HJFA 4L9RA 2O8VA 1W47A 3WO0A 3RYCB 1XA0A 2GPJA 4JA2A 2IEZA 1K9VF 1KSGA 1X1TA 1EFRD 1GSHA 1VP9A 4NAHA 4X6YA 4K40A 4NMLA 3NBUA 4HRYA 5K3FB 1Y7LA 5WRFA 2UUAB 3U3KA 2W42A 1TZKA 3RC7A 1TVKA 1V1MA 2ZIXB 2XTAA 1Z07A 2YRFA 2JD1A 1XD2A 3OWHA 4MDHA 4O4HB 1ZK4A 4HGOA 4X66B 5G0VA 2P6UA 1C7JA 2V97A 1GG9A 1TPYA 2Q3FA 2QE7D 1NNSA 3H9QA 3ESYA 2P9GA 1EHIA 3KEQA 4PGHA 4QEDA 5KBYA 3TQHA 3WNBA 2AC7A 4ATNA 5LQCA 4EY7A 4FFSA 1YULA 3T1YB 2Q0HA 4R1TA 2QI9C 2B1JA 1XJ5A 4N3CA 4ERXA 3SK0A 1D9ZA 2INGX 2VPYA 4M7RA 4D9KA 2VSNA 4WIAA 3AYXB 3LQQA 2R6DA 2ZK7A 3QEMB 4IIUA 1DC4A 5L8VA 5IS2A 4KGXA 3HVIA 3IGFA 1UDAA 5H5JA 4UMDA 1QOQB 3ROXA 3WI7A 2IOHA 4AURA 4D45A 1PLKA 3CZRA 1VJGA 3I42A 4FEAA 4FGLA 4QYXA 1Q1AA 1GXSA 3BRWD 1TVMA 2GKSA 3KWLA 3GWZA 5AICA 5DEOA 5H9VA 1TW2A 4CMKA 4D42A 5JMWA 1SUBA 4NCAA 4F7WA 1Q1BA 2ZTMA 3CN9A 3EXG1 5BPFA 1E7SA 4TMWA 2DECA 4RMNA 4HLCA 3UWSA 2JFOA 2JGJA 1W6UA 1Y7TA 2IJGX 1ZUHA 2QVGA 1RAEA 4HAZA 5F2OA 4CZ2A 3KBOA 2ALJA 2NU9A 2Z5GA 4PQGA 5BOVA 1GU0A 1JJFA 4HVCA 4FCCA 1EK2A 1X94A 3S68A 3SQNA 4BLTA 1BFKA 1Z7BA 2GESA 4TRJA 4TZ6A 4O2AB 2G72A 3U3OA 4ZDKA 2OXCA 5EZYA 1Y7HA 4UBJA 4OXKA 4Z3KA 3DE1X 2JEZA 1BD3A 2B61A 3E0XA 3FSRA 3NEPX 4HC4A 4EARA 1KPIA 1E9EA 4AQ7A 1UDBA 3RS5A 1Y4DE 1ZUNB 2PGLA 5JPIA 3CPSA 3M9WA 5JZBA 3SWWA 3U7HB 1U3WA 3NX4A 1CUHA 1IG3A 2IVZA 2PFKA 4RGYA 3MSCA 3FCAA 3GRAA 1JG2A 3KVNA 2RHGB 3Q3JB 1JSRA 3IP8A 4KWHA 1QH9A 1FRNA 4PO8A 2H52A 4TVOA 1A04A 4KI0A 3QVTA 3ZCXA 1RZRD 2W6IA 1OT5A 2Q2VA 2AR0A 3D2BA 4O2BA 4ALJA 3RLFA 2YJZA 3L7CA 1UC9A 2HH9A 3G0HA 3BFKA 3IOBA 4XCXA 2EX0A 2YXDA 4FFLA 3FN4A 2BR3A 1M1UA 2F62A 2FPLA 2E4VA 3C8ZA 1YK0A 4IH9A 5AW7A 3SEZA 1UODA 2QK4A 5HUQA 2HHAA 2WP8J 2MSLA 2JLCA 3LLSA 5E3IA 3OJ0A 4EPYA 3E4DA 3W5IA 3OKAA 1FXWF 2GF0A 2WFLA 3T41A 3BAZA 3JD4A 4MIEA 1FFBA 3LZ6A 2HTFA 4P33A 1M67A 1QRRA 2J31A 5FJJA 5CD9A 4EVQA 3FOAA 5IDWA 2DWQA 5C8YA 3W79A 3TUJC 1P80A 3MJTA 5GGYA 1L3CA 4HDRB 2ZI4A 2JAXA 4MXDA 2QTVA 5ECGC 3WLSA 3WWPA 2WJZB 2LE0A 3W06A 2J3MA 1FNBA 1Z8NA 4Z2YA 1QNLA 3C1UA 3WIEA 4DR2B 3TLGB 3AHCA 4MI1A 4B85A 5DRTA 4UTPA 3TPZA 1DU4A 2FK8A 1XNRB 1T5SA 2BEUB 3RSQA 3HDVA 4UVEA 5KWVA 5KPJA 1OLUA 2M2IA 2D8AA 4P22A 2P6PA 3TTUA 4QOSA 2EL7A 3GPIA 2BVNA 1DDOA 3UOGA 1MVLA 1EG7A 4EYKA 1VHJA 3LUPA 3DZGA 4DXHA 3GVHA 3QKSB 5T3YA 3IE1A 3AF5A 1LU9A 2VYCA 2WE8A 4X45A 1JDBC 1XTRA 1XQ9A 2EJBA 2QJWA 2XYVA 5GY7A 3CLUD 2VS1A 4COOA 3EF0A 2PCJA 4LS3A 1L5FA 4MCAA 2OCDA 4R5MA 5H83A 4RDXA 2FVYA 5A02A 3ND5A 1PJRA 4KZKA 7YASA 5KMGB 2HWYA 4IMIB 3JASB 2XQGA 3ADCA 3KAPA 3DLAA 4ZP1A 2G6TA 3PNSA 4NPCA 4EJSC 3DWFA 3PDIA 5DYTA 4OOFA 1QC5A 3KDSE 2BGUA 1HC7A 4M8KA 1EEHA 3UHAA 4MUKA 1GSIA 1T1RA 1XTQA 3GA7A 4HP8A 4PX3A 4R83A 5C7YA 2CVOA 3S81A 4UU8A 3ETJA 2E87A 1HZJA 1MD9A 2DY0A 2QRJA 1SQ0A 3F6YA 4W5WA 2H0QA 4FGKA 5E7IA 1PDVA 4ZANA 3OPYI 5TPWA 3FIUA 2NYUA 4J1TA 4L0DA 1HL7A 2FJUA 3CKYA 3FJYA 1EE9A 3HUEA 4KXUA 2MMGA 4XVCA 1WV0A 1YDHA 3DMNA 5BN4A 2GPNA 3L8DA 5K0BA 4ZVPA 4JODA 1N1DA 2PGDA 3VAAA 2AZTA 2FZ5A 4ZV7A 3SJUA 1IZYA 3FVRA 3U6BA 3AI3A 3M5PA 4JYAB 2W5UA 3TOCA 1ZRMA 1M1YA 1C3OB 1Q0ZA 2CLSA 4TTVA 3G59A 4KPUB 4LN1A 3U16A 5IRCD 2BRUA 3WSWA 4AQDA 1PKEA 3JQAA 3UV3A 2XYHA 4D92A 1NF2A 1Z22A 2VYVA 1PGPA 2C4NA 4ZYUA 3I9LA 5EWMA 4BNKA 3GWGA 1SOMA 1EESA 3AFGA 3WDSA 3OE7D 3GLFE 3MAGA 3GHYA 1GPMA 2V9PA 3CINA 3MGKA 3BSYA 1Z3CA 4Y2QA 1Y82A 5JS7A 1WMBA 5EVJA 3OEWA 1X0VA 3B78A 2D2IA 3KJIA 3OLXA 1QYVA 1SHTX 1VI2A 2I8AA 2J3KA 1VE3A 2P3SA 5EUBA 5CLFA 2G4CA 1OAOC 5JQGF 2EZ9A 1E9AA 4Q93A 2VAXA 3TTVA 1YZYA 4V0MA 5K6AC 3UTCA 4UHBA 1D6NA 3CRZA 4H35A 4HUQA 4P7KA 2G7MC 3TL2A 4BASA 3R9XA 1SKMA 1M33A 2NVBA 2IOFK 1J9ZA 2PFSA 1CS0B 3I3SR 3SS7X 3QTBA 1H8EA 5KOYA 3AEUB 1CRQA 1JAHA 3ET5A 1M2HA 5B4TA 5KYTA 1X80A 3B36A 1D4ZA 4FDAA 4EDHA 5LYJF 4DG8A 2QM3A 2P5TB 2G1AA 2X5KO 3FRIA 4K9LA 4ENRA 1PIWA 3O4GA 4URUR 4F72A 4TLCA 1BMTA 2Y68A 2VP2A 3LNTA 2ZSIA 3B70A 4I5FA 5CDFA 5IF9A 1U8EA 3SX4A 1HYQA 2RONA 3WV4A 5HTKA 4MDYA 3B1KA 1XEWX 4A0QA 4AP9A 3LBFA 1Z6TA 4DKXA 3RYFA 1IBLB 2AWOA 4UM9B 2C3MA 2PWYA 5MF6A 5KYXA 4ZDWA 2FUG1 1YC5A 5TJHA 4CM7A 4TLBA 5REQB 4DBVO 3R1IA 3ONNA 3V4OA 4D3FA 1PV4A 3EOBI 1WBJB 1TT5A 4CM9D 2IU6A 4FX2A 5BYKA 2IUSA 5SZKB 3IELA 1S2LA 3NIBA 3NJRA 1E1QD 1NYTA 5JAUA 1R18A 2UZ0A 1SJ9A 2PUBA 4NENB 4U9UA 2V5VA 3OIWA 4L9AA 5LQRA 3G2KA 2H63A 3OLQA 4RD2A 4WUVA 4PTYA 4J0CA 4WW0A 4XVUA 1YQUA 2AN3A 3LGSA 1OI3A 2AFHE 3G9TA 4F84A 1KGDA 1MR3F 1B1CA 1Y5RA 4QUKA 5JVDA 3CRRA 4WXEA 3WGUA 1RT9A 5C1BA 7MHTA 3LSYA 4M49A 1UZAA 4FZ5A 3UJDA 1EUZA 4NBLA 3AR7A 1NGSA 5LLTA 4U9IS 3STYA 1GRVA 4QBGB 1RYZA 3T3DA 1U1EA 1TTHA 4EG1A 2P27A 5JYEA 2ESRA 4BRZA 2FOLA 2RGNC 3OJOA 3O73A 3ZCPA 4QLBA 5JE8A 1I24A 5JQGA 1IN4A 3T52A 1QFSA 3TB4A 1EJ2A 2AJLI 3F5QA 1Z8HA 2ZREA 3F3YA 3QJ5A 1YR7A 4PAOA 3CO5A 3HXQA 5D7NA 3VXKA 4M8IA 4RS4A 1V47A 4ZCTA 1RFGE 1KY3A 4Q9JA 1M34E 2AUNA 2QEQA 4TKUA 3IPCA 2FF7A 3LCRA 4BHTA 1F2UB 1H2BA 1XN1A 2O3TA 4PR0A 2DEUA 2YCBA 3TLKA 3VO1A 3T9DA 3WL3A 5DI9A 2YFHA 2OFFA 2NVUA 3H19A 4DA0A 3F96A 4RLQA 4WXRA 2RGYA 2ZWAA 3QOWA 3BQMB 2EW2A 3JWHA 4KQ1A 3N8IA 3TBFA 2PAFA 4RSGA 5LYYA 2J4DA 1UFQA 4I9UA 4FC7A 1SHKA 3SIXA 1Z4LA 5EJAA 2AR9A 3TEFA 5A9SA 5LQJA 1G3RA 3C6MA 2O57A 2VPQA 3UH1A 1RJFA 2Z2KA 4TX1A 4IV0A 1DJOA 5BMOA 2YWRA 3JQ7B 4BQQA 1SY7A 3D4BA 1O6BA 4WLOA 5DO9A 1QQAA 3VTAA 4HVTA 2WMNB 3WR5A 7REQA 3UHJA 1EEXB 3EHDA 3G9ZA 4IIJA 4E2ZA 1NQWA 1V71A 2A0UA 3NGMA 3OFKA 2IDKA 3WKEA 2PWPA 3JYNA 2WJAA 3LVRE 4I9FA 4J3JA 3VOTA 6YASA 1V2GA 1Y1LA 4RO0A 3LUFA 2H5IA 3BFJA 3EBLA 4JOBA 4RANA 4XEHA 2ZM6B 3ZXXA 3W5AA 2CJXA 3MHTA 3P45A 1QTNA 1YZHA 2DT5A 1GCOA 2NU7B 5THKA 4CQJA 4BLPA 3DBHA 1GZDA 2WIAA 5F9MA 1JP7A 4JJ6A 5IJXA 1RRVA 5AH0A 2FEXA 4Z1MD 3FLAA 3D6NB 4C05A 2HEIA 4QWWA 5IYZF 3K32A 1KZGB 3DXFA 3GRZA 4K05A 4UNNA 1KDVA 1E77A 5FOVA 1E94E 2GFHA 3NU1A 1L1FA 4DXDA 3D8TA 6GPBA 1XTSA 2AJTA 3I9V1 1JAZA 1MB4A 3O3CA 1NI5A 4D9IA 2QR3A 4G65A 4YRSA 3TZHA 1J5EB 4OVKA 1CEYA 1DBSA 3PGKA 4QU0A 4AZ0A 2DAPA 1ODJA 4TMKA 2J48A 3VPFA 1W87A 1R37A 2HDWA 5JDCA 2VDVE 3OZXA 5L7TA 3W5HA 1EBBA 4JLUA 2G9UA 3D5QA 2ZRIA 4DIEA 3PIRA 1XZKA 2ZBQA 4QXAA 2W0SA 1MABB 3R7LA 1FFGA 1JU3A 3F3MA 4BVGA 1HE4A 1UADA 1XJ0A 2JAWA 3C7KA 1UKCA 5EIHA 4ZTUB 2ZSFA 4EQ6A 1I4LD 4BL5A 2QNBA 3VGPA 4ID9A 4MO9A 3PQFA 2V03A 1P9WA 2IXFA 5JNVA 3QVGB 1AK2A 2B8TA 2UZ1A 4K9RA 5JSHA 2PUDA 1ADYA 1XAJA 3LW7A 4XGNA 3FZQA 2DBYA 3EC2A 1MX1A 1Q19A 4EVSA 5HQ3B 3KYDA 2DR3A 1R16A 4HFNA 1YQ9A 4CTKA 4R2LA 1OI4A 4C7OB 4ML3A 2O1WA 4DNOA 2P9JA 1NBMA 1DQNA 3M6LA 4PVCA 1R4NA 3B1ZA 1IB0A 1PGNA 2PVSA 3L06A 4HYEA 5J2UB 2XXAA 1N7JA 4JI1B 3WGNA 3HMKA 1X3LA 1DZIA 1L7PA 1R9NA 2NO7A 1O6FA 3T3NA 3JQQA 4ZHQB 4V0SA 1W88B 1W0JD 3ACCA 4PN3A 3K4PA 4B71A 4YR9A 3S5JA 3BMOA 3QPUA 1UZUA 4RVFA 1E6MA 3DDHA 3VZDA 2QAGB 2GPYA 2CF5A 1USUA 4AS1A 4ILEA 3FNQA 1T8SA 3FYDA 4Y6LA 4KV9A 4B3CA 4JT4A 1SRRA 1U2PA 1OLSA 2Y3IA 4GXQA 4TXLA 1IEWA 1KR2A 1P5RA 2O2XA 3OMLA 4IFBA 2EV9A 3SYKA 4Z4EA 5E3JA 4D7AA 1RBMA 1NSYA 2ZIFA 1N2JA 2FQQA 2IEGA 2XMPA 1R0YA 1YU9A 2YWHA 1FQJA 4HJXA 4L6AA 1TKRA 1N3YA 5KYUA 1VQ1A 2PAAA 3EIXA 3NR2A 4RYDA 3LBNA 5JZMA 4O4HA 3DW1X 1QIGA 3T3MB 4CQNA 2Y6UA 2Y0DA 2R44A 3KQVA 5K0FA 1W4AA 1G60A 2PEYA 3EQ9A 1OOEA 4ND5A 1VJ5A 4NZOA 3UW1A 4XQCA 4AP6A 4UMFA 1H2XA 1I0IA 3TOSA 1Q6YA 4R0MA 1TM7E 2B0CA 4RA6A 3AI7A 1OB5A 4YACA 4LDZA 4KO4S 5G3ZA 4DJDC 2P9QA 5AVWA 3ANSA 2CJFA 4ZOCA 3T7KA 1U94A 5AVKA 1JXOA 1SCAA 1ZD5A 1GGJA 1PNTA 3MB5A 1V1RA 3QUTA 4M4SA 4NTZA 2IZ7A 4MPPA 5EZYF 1VL6A 2PZ8A 5CBKA 3BT7A 2O2HA 2LGJA 5BSEA 2GD1O 1Z08A 4BO5A 3M4YA 4GSYA 4DJAA 1LC3A 1SCIA 3IJPA 1P74A 4P4NA 3V8VA 1TF2A 3DZDA 1D4OA 5ALDA 4CM8A 1JSXA 4HGQA 3AONB 4BMYA 4A0HA 4C9BA 2VTDA 1B0ZA 3QV2A 2ZT7A 3WG9A 3L05A 4N01A 1OHHA 3NYWA 1DIRA 3MWFA 1FJ2A 4BP8A 5FPTA 2O2YA 2Q29A 3B3AA 4KQJA 1QDLB 1ZGBA 1WMFA 1QZTA 1Q0LA 1PL8A 5EE5B 1QP4A 1E1YA 3ENQA 1JLSA 3VPBA 3NNNA 3R6LA 4EO4A 3CVUA 2ZUWA 5ED4A 3P9ZA 4MV6A 1N7IA 3VPHA 3T4EA 2PMBA 2X1LA 4P7JA 1A72A 1U6IA 1YDEA 4RKWA 1R2QA 4HB0A 3REQB 4Q03A 1G7CA 1KFKB 4A0RA 3SF0A 1L7NA 2ODAA 3B9QA 3UAXA 3DTTA 1ILWA 5DBFA 2JH9A 3AM3A 4G36A 3IHWA 2ZJ3A 5FUMA 4FT2A 2A9OA 1XEWY 2Z9DA 1O5OA 3I2YX 4ICIA 1DIHA 1E4VA 1I7PA 4DCMA 3OI7A 2AFIE 4G1BA 2IPAB 3GP5A 2XMZA 3IMEA 3BA6A 3SSMA 4CL2A 1TM3E 4HMPA 4NG5A 3LIPA 4DEXA 4ENVA 4HGZA 1NG9A 3MM4A 3ZD7A 4W4TA 3NT2A 1IY8A 4Q4JB 4D1YA 5AFSA 1OH8A 1XTPA 5HFNA 3GUCA 3E9DA 1RPTA 2FCAA 4F8YA 2C20A 4M7WA 3MRTA 1UKEA 4IZ6A 5AKYA 4YRAA 1HMYA 2XRYA 2X8BA 1JEYB 2ZFUA 1BCRB 2QUIA 3I6BA 3IQEA 2VAMA 4EA8A 2JIZD 4MHOA 2D8MA 1BFUA 1WQ1R 1XBTA 2D5CA 5FCDA 2HJGA 4LXQA 2DWCA 3I5XA 1EFDN 2YS7A 4RKRA 4XW2A 3UBTA 1DIAA 2W4IA 4UZFA 2P2DA 4PLZA 5JXIA 3AJ9A 4IJUA 4XI9A 4X93A 2PWZA 4DILA 1DWQA 4JH0A 1JIVA 1Y1PA 4OL0A 2DRIA 2Z3ZA 2A9PA 4OK5A 4NPHA 1KY5A 3OZFA 3VZCA 1IXRC 1TL7C 3SZ3A 2BDEA 2C2XA 3W77A 2OOKA 1XDDA 1RQRA 2OO5A 1O08A 3RTEA 3ZKWB 5LSAA 3PVCA 4M8SA 4ND2A 4QO8A 1Q1GA 4TVSA 2GRUA 5C8ZA 3L82B 1DO2A 4TV9B 3PWTA 5DV9A 3CX8A 4MQFB 4E7PA 3O2NA 4CLRA 4I1UA 3ETNA 4UKDA 4MITA 1JAYA 1JECA 3E05A 5AJXA 3Q5DA 1N1EA 4O4IF 3BS4A 3OUUA 4IRMA 4CKXA 1ESZA 1L5OA 3B53X 3I28A 4JL6A 4Y7DA 3ZS9A 4XA8A 2CGEA 4IR7A 4BVKA 3AINA 5GVSA 5K3FA 3EE6A 1MDBA 4HNAB 3U80A 4ER0A 4B3SB 3IOMA 4OQZA 2YQZA 5JH7F 3G1WA 3GY0A 2GZHA 2HQBA 4NMMA 4UUNA 4RIEA 4TKLA 2RHDA 3MRSA 3A7EA 3S40A 1KY4A 1VPLA 3DZFA 3AEXA 4FQ5A 4AJNA 4EJ2A 3PHGA 3CV3A 5J2UF 1JHDA 1POWA 3OSZA 1FNCA 2C3UA 1DRJA 2FPOA 3NQ41 5J2TA 4JIGA 4MQBA 4KR9A 1EFHA 5KHLB 1KI6A 2GJ8A 4DRYA 3IP7A 5J4YA 3J81A 2WSSD 2E9SA 2GCOA 3UBMA 5DBEX 2X23A 4Y2RA 1OF1A 1T8UA 1ULZA 3N86A 4FFOA 4QPNA 3WGQA 1IH8A 4HLDA 4XYLA 3HY4A 4PEVA 1B93A 4JKIA 4RAQA 2M1XA 4L07A 2FAXA 3PPYA 4G81A 5GJBA 4IRUB 1NVKA 5JAHA 2QN9A 4YJFB 2GGSA 1UF9A 1NOJA 2MIIA 3HNOA 4P80A 3K8ZA 4F3CA 2I3GA 2X3FA 3OFNA 3QUCA 4JLPA 4KKXB 4PHFA 4RX1A 2Q3EA 4TSRA 1P60A 1Q3KA 3K5WA 2OXFA 4P5EA 4QXPA 1NMZA 1MFPA 4M98A 4RMIA 2BGGA 1U8YA 3UWPA 3WZMA 2IEAA 2ZBFA 3WB2A 4EH1A 4QJ3A 2HYDA 5FTNA 3STVA 4BKRA 1QTQA 2JI8A 5BQPA 2Y66A 2BCGY 2P9BA 2EFCB 2HRQA 2R6R1 2VBGA 1TM5E 4FKMA 3DOCA 3W9SA 2Q1YA 1FYFA 4AZ0B 4BMXA 3E9YA 1UP4A 3SQDA 1CR2A 2HNAA 1AHHA 1DTEA 2P6MA 3PCXA 4QYIB 1Q92A 5D3ZA 4ZC1A 3B7GA 1KYWA 4NENA 4HZGA 1I3NA 3CNBA 1DPGA 2H4HA 2PZGA 2QYOA 4D74A 2CW5A 1NONA 2RBEA 3NVMB 1W29A 1BXRB 4X0EA 4XUDA 5A5FA 1C5KA 2CL5A 4WESB 1L4FA 1YZVA 3JY6A 4MAMA 3MBOA 2BHNA 3T15A 2CMGA 3FCUB 1RI5A 1U0TA 3R0XA 3M70A 3HN7A 3N7TA 3QPBA 4U7HA 2AYYA 1SXJB 3QITA 2QRMA 3ORHA 1WAMA 4DCSA 4RMGA 1NBWB 1Y5MA 4XSHA 2F3TA 4GS5A 1I6WA 4K87A 1MX9A 2Z2IA 1SA0A 5EIBC 2R8RA 4BB6A 3PUWA 3RSSA 3MINA 5JHGB 5L3VA 1EJBA 1H5NA 2VSXA 3TNYA 1AGPA 1V11A 1RABA 3JYQA 3CZAA 4JCOA 1KA9H 3PWZA 4BYMA 4DA7A 4BJ3A 4LQ4A 3I64A 7AT1A 1MZPA 1E69A 1K6XA 3FI9A 4U6QA 1J8QA 4C21A 3VR1A 2CVPA 5LMZA 4MRMA 1MRNA 3AFOA 3QKSA 5ALSA 5CX4A 4ZAVA 5GONF 4B5LA 4H1WA 4B82A 4G4JA 2C96A 4FHEA 4E1AA 5I5EA 3WBBA 2V7QA 3HN2A 5HOEA 3H3FA 5K3EA 1Z4NA 3GN1A 2FHPA 4Y2SA 5BMVF 4HY3A 2AS0A 1W34A 4EKIA 2NVUB 4TYWA 2PYZA 2EP8A 4E94A 3SQLA 2WT8A 5BR1A 2I6SA 4BWFB 1V6CA 4R3NA 1X80B 4E07A 3B3GA 4EMTA 4D9NA 3PNQA 2B1IA 3FZGA 2FZLA 2R66A 5BUQA 3RAEC 4NIMA 4KPFC 2MSWA 1RPZA 3AVUA 1QWOA 1YMVA 2Q9UA 1KAQA 1SVWA 2RGCA 2XUZA 3P2YA 4NZMA 5J58A 4Z9BA 1FW6A 1FDWA 1OI7A 5HS4A 5AKJA 2K4MA 4U2KA 2PUCA 5E1OA 1P2FA 1GA1A 2GXUA 2HKIA 1T0UA 1G41A 3LS2A 4HAOA 3D8SA 4KFSA 5C1IA 1G98A 3RSZA 2BRUC 1CVRA 1PS9A 8ABPA 1V1RB 1L7DA 3HDYA 4LEIA 3WHIA 2ZCVA 5KJCA 4A6DA 1VBKA 2Q0XA 4AS3A 2NZWA 3LRXA 2L2QA 1ICEA 3KB8A 4LXUA 1ZOPA 4NDZA 3GFOA 3W6ZA 2B5VA 2JGKA 2Z2JA 5AUOB 2KW5A 3IEKA 1PBTA 2XZTA 3FX2A 1E3SA 1GKIA 5FWNA 1N9KA 3K6KA 1XRPA 1ZXBA 2VDLB 3IVGA 4BECA 3ZY3A 4YS6A 1TZCA 4ETWA 2Q27A 1O87A 2ODTX 2CFOA 4YUWA 4FXOA 3LZDA 5LBUA 1P6UA 2QVZX 2XJ9A 4HMOA 4HYYA 4NOJA 3FMPB 5BN3A 2Z1MA 1Q22A 4LJKA 1JX6A 2ZRHA 4JVSB 4P4UA 3BJRA 4R31A 4C4TA 2PO5A 3G0CA 4NXNB 3M3HA 1E2KA 2Q9CA 3BN3A 3BERA 4IIXA 5E2BA 4GM4A 5BORA 2PBLA 2TMDA 2TMYA 4QGSA 3GYGA 5CG1A 4DWJA 1X42A 1EFKA 3PITA 3FI0A 2VDPB 5BSMA 2QVBA 3HCRA 4QASA 4U6NA 3CWZA 2FFRA 3DA8A 4X7MA 2H65A 4IMRA 3CVYA 3VPSA 1P62B 4FIZA 4QNMA 2AN4A 3WLKX 4JBGA 1JVBA 2F3QA 3MLAA 5ITSA 3HWSA 4PIPA 2VI5A 2XA2A 4Z4GA 2OGUA 1IN6A 1NW9B 3DCJA 3G5MA 3GW8A 4U2CA 4V0OA 1XHEA 2BHLA 1JWLA 3EEBA 1I3MA 3C85A 1ZGHA 2QRHA 1U0FA 4WA8A 5DTEA 5C8DA 1RWWA 5G2OA 4G89A 2EIHA 4QATA 5DNCA 4KAAA 4KHZA 1KI6B 1U0EA 3EAGA 4YPFA 5DB4A 5I7HA 5ILOA 1L1RA 1S2GA 4MYRA 3M1IA 4LXYA 3KHKA 1G6Q1 4DBLE 4E4RA 3WNQA 1YDMA 2H9IA 4NPAA 3K0AA 3OMXA 4RF2A 3VR2D 3QVJA 3QWAA 4A3SA 2Y93A 1KVTA 4QBTA 3E5RA 4YJ2B 5CX1A 4M1TA 1HR0B 4Q4LA 4F71A 3B6ZA 3ABIA 1VG1A 2CXQA 3B6MA 4P8RA 4EYEA 4XB1A 1P3DA 1A9SA 3LG2A 4DNPA 3Q2OA 4RQAA 4CBVA 2NGRA 4CQMD 1PD1A 3HABA 1RP7A 4BDTA 3L1IA 2NO6A 3W4KA 5JYDA 1HYHA 2QUKA 3SS9X 4V02A 4MO2A 1CNEA 1GLGA 4M54A 5TDHA 1ABBA 3RRMA 1HO3A 2QUJA 4CM4A 3HXPA 3HWX1 4DHEA 5AVUA 1NUUA 3H1TA 4LWPA 4J0EA 2QPAA 1KYZA 1JHAA 2W70A 4LFBB 2DU8A 1WRBA 1GDHA 3RIGA 1R74A 1Z5OA 3C5VA 2C5HA 1REQB 1RPNA 3LMKA 1SQFA 1KQNA 4YVFA 2HUNA 4CQMA 1HQDA 2ZE6A 3A6PC 3CW2A 4GP9A 1ZLYA 3BWBA 3HB4X 4KRYA 2JLSA 3HRKA 3IQIX 1OYVA 4UUAA 5ILQA 3W8EA 4WLVA 2AOXA 4IG4A 1M0WA 2WF9A 4CR7A 1M1NB 3KTAB 2DKFA 1PZXA 4YRBA 1P91A 2LKDA 1GOTA 4UE2A 4FZJA 4OSEA 2YQ4A 4J3NA 2ZS9A 4G84A 4ZVSA 4CEIB 1T26A 2YNMC 1R00A 3I83A 1JT9A 1BW9A 2O54A 1XTTA 3N3BC 2GLTA 1XQ6A 2E7ZA 2HSWA 2GZSA 4ZO6A 1G16A 1T9GS 4OTZA 5JXHA 2JLZA 2HNBA 3NOVA 4I9GA 5EWJA 1UWLA 1N6HA 3D7MA 2VF8A 5JY6A 1L8XA 2EX1A 2Z4SA 2W8BB 2FP3A 4HEQA 4KYTA 4BFWA 1LEHA 1K7CA 2AI3A 3ZZTA 2GCIA 3ADPA 2WWHA 3KYBA 4J0FA 3F7NA 1VKOA 3J80A 1ZC3A 1ZNWA 1KFCB 1XZDA 4J4TA 5HK9A 3UVEA 2CV1A 5CLGA 4KC0A 2X5OA 2CXRA 2W6OA 3V8RA 4UBIA 1TIBA 1UUFA 4LZPA 1WETA 1ZG3A 1G1MA 3U4HA 4IF4A 3OE5A 4OD0A 4YAUA 3KQQA 1KQ3A 2C1XA 4FN5A 1PHRA 1XO1A 1H9CA 1YXMA 3I9NA 1ZMTA 2QGZA 4P4GA 5JS1A 1SO8A 1TZMA 3R23A 1W48A 3WWCA 4BNIA 1D1SA 121PA 3ZPXA 4TKMA 3WJ2A 3U09A 3X1MA 1QGYA 3Q0TA 1XTZA 2WHPA 1ZUIA 4RPKA 1Z4KA 3M4NA 3JR3A 4NCJA 1ZWKA 3G85A 4JZYA 3O8NA 4Q9NA 3EMKA 1KRWA 4OQPA 1YIOA 2WTAA 3DE2X 4P0TA 5CNKA 4HNUA 5JD6A 2PJDA 5JSZA 3WHLA 1VL1A 3GPCA 1EPUA 3ZGYA 2AEFA 4G24A 1KAGA 4IXWA 2VXBA 2B83A 1DKRA 3WMFA 3AF6A 1SUDA 1SCBA 2H2AA 3L7IA 1T4CA 2HBQA 2OL4A 5KSZA 2COEA 1UMBB 2ZT8A 4DWVA 4I8IA 2Q1UA 3Q3IA 4LBZA 4WL0A 4CG2A 1VB5A 4QQFA 2EZUA 3KOOA 5LJLA 4RA9A 3RTAA 4BVFA 2FJPA 2QQEA 4D99A 3WK7A 1W4BA 1QS0B 2JDID 2FXVA 1E6KA 1RKXA 2TRSB 1A4IA 1YB6A 4XGRA 5DYYA 3LBYA 1VKNA 4KH1A 3GUYA 5FV4A 5CH3A 1UPUA 3GJ5A 1BYIA 2J85A 3PZRA 2QTCA 3DO6A 4ALNA 1JJBA 3Q12A 1BRTA 3VMMA 4EKDA 1N25A 1E7RA 1SOAA 3FOBA 4X8OA 5ENVA 4ZTBA 1MJFA 1XL0A 3PJDA 4J03A 4RL4A 4Q9AA 4GOLD 4B2LA 4Q47A 1S9HA 1W9HA 2WK1A 5KYVA 3V4LA 1ZUNA 4R05A 5AVZA 3I1IA 1UJNA 4E5SA 2XAUA 1N33B 4JWKA 4DA8A 4M86A 3W3AD 5TB5A 1RU3A 4WKBA 1YS4A 3BDAA 3OZVA 3OG9A 4WTOA 3U7JA 4BEJA 3U1VA 3QKRA 1JG1A 3WRXC 1ZD1A 1MDFA 4I99A 4MH0R 5JUWA 1ID8A 4MNTA 2VH2A 3BK1A 5AXAA 5JT1A 5EJ2A 4D96A 1PVVA 1JHVA 1UZLA 3COWA 1VE7A 4KWTA 2NPFA 3SZMA 2RE8A 1UK6A 3NTXA 5HF5A 1OGYA 1Y9ZA 3PGJA 5H4GA 3VYWA 2ORYA 3SSAA 4BEVA 3R3UA 4OH7A 3PFGA 2PZMA 4GSLA 4MVJD 4ZOLA 1JHUA 3C4QA 1L4EA 1JYEA 1U02A 2PUHA 3Q8XB 2HM7A 4KK4A 2HIMA 4FGSA 4GOKA 3H9UA 2OHFA 2IH5A 3P97A 2X6QA 3K1TA 2JJ8A 5FT9A 1RI2A 3CG0A 2I3AA 4MS1A 1N6PA 5JALA 2P65A 2JFHA 2FW1A 3NOQA 1JS1X 1E3JA 3Q85A 2QJTA 3T1VA 3PEYA 4NH4A 1SCNE 3A2NA 4HQKA 1OIWA 1L6IA 2WPNA 1RBZA 1DINA 4XWWA 4MPRA 4UDYX 1A82A 2BMJA 3O21A 4KDRA 4YK7A 3ZWYA 4XDZA 4CR6A 2RD2A 3VSAA 4ROTA 4TSFD 5FTWA 4BMCA 4CFYA 5U4XA 3OZAA 3ZW7A 4FFNA 1C7ZA 1LSOA 3KUDA 1K8QA 1DBRA 2P3QA 3M4JA 4DEYA 5C4MA 3UH0A 1DAKA 3KV3O 1JEEA 1N2HA 3COZA 4LF4B 3B48A 2DHCA 3P4UA 1WW2A 3OC0A 3WV5A 1Q7GA 1CY7A 4NAUA 2NPIA 1SC4A 3WA6A 13PKA 5BN3B 3DUFB 2BTQA 3FCYA 5KTYA 2I9PA 2RBGA 1ZINA 4AJ2A 3GFGA 1SIUA 2DMRA 3ZJYA 1QPGA 4B0PA 2ZRKA 4HDKB 2C8VA 2WUGA 1WXWA 3EG9A 3PNBA 1D2HA 4Y6PA 3DFKA 2FMTA 4OHFA 1CIJA 4O4LB 4L95C 5AVRA 1M73E 2VUTA 3BGIA 1AVTA 1XJWA 3UJHA 4CT0A 5JAPA 5ICSA 2MINB 5AUPB 3UMBA 1IHXA 1JLLA 1AG9A 2KBEA 1SXJC 2WVJA 1SQSA 3KKNA 4E08A 3E7FA 5BXQC 4KUEA 3WMWA 3ICWA 4YREA 2FPUA 3TPCA 1C3EA 3W5DA 4H7PA 2VQEB 2V6IA 2AUTA 3TLYA 2ZTVA 3Q7RA 4BO6A 3DBIA 3DC7A 3ZHOA 3AQ4A 3V1TC 2FUCA 5CFLA 2VHTA 3X1XA 4BIIA 1YA4A 1ZIXA 2C42A 3HCCA 5KOIA 4XARA 5JJLA 3IR6A 2VTVA 2AE2A 3IAAA 3H0KA 4LJ7A 3RO7A 1LDYA 2QBYB 3ZQUA 3NASA 1VE9A 1KK3A 2FN3A 4FSDA 4ECAA 1FP7A 1SKBA 3TE6A 1NBMD 1EFTA 2WNHA 5BR8B 2CHGA 3AERB 1RJGA 4FHCA 4Q7MB 3X2FA 3I9FA 1GQOA 4N49A 4DVGA 2DWPA 1HY3A 4OHCA 1MKYA 5CAEA 4BXOB 3TMAA 3MZ0A 5FPKA 3EPKA 1RS0A 1UFVA 3CE6A 3DL7A 2IS2A 3F5SA 1NXSA 2BFFA 2GZAA 1RRMA 2HRRA 2IHYA 4J2OA 3U26A 1Z4PX 4R68A 1VCOA 3L84A 4TV8A 3ZY5A 2OA0A 1NLUA 3DBOB 4CKYA 4WNIA 3F4KA 2OQRA 2X9VA 4EKNB 4ENWA 1SWWA 1I13A 4BNGA 1OUMA 3EH2A 4G5HA 2RHLA 1XT6A 4HLQB 2X8JA 1E9SA 4WRRA 1P2GA 3N7UA 2G1PA 2YJNA 4CM1A 3O8OA 2ERCA 5ALHA 5IDYA 1FFYA 1D7AA 1RXSA 5FWDA 2VNAA 1A5TA 2J3EA 2JGDB 1I4DD 3A6DA 2C07A 1QO7A 3B85A 3IEXA 2Z1DA 3I9OA 3QG5A 4L4SA 1H5UA 2PPVA 5EJGA 4C0XA 1B26A 3SICE 3SJAA 2ZXUA 2WFZA 3DBHB 3KOYA 5DNEA 5K0NA 3I32A 5SICE 4JHLA 4RZQA 4ZD6A 1JFFA 3QE4A 3C3YA 3JARA 1R0SA 2ISSD 2WKPA 3TQQA 2XMQA 2OVFA 2IIPA 5EE1A 4GDFA 3TWOA 1UBOS 2RGWA 3DAFA 3GMTA 3I5AA 4AUNA 1UCFA 1XD8A 4TSFA 4X20B 3NS7A 3RABA 1OI2A 2OR3A 5C2JB 3MJSA 2ZYSA 5GZ3A 4AMBA 1P7VA 3A4TA 5L40A 1CDDA 2LVBA 5DTMA 4KREA 2XCSB 3DCNA 5BVHB 1QGUA 2ATXA 1KKUA 2ZJ6A 2HU2A 3OPVA 4GVPA 4ETIA 2PWBA 5AK5A 1JKIA 2A92A 2WWRA 3CURA 1ONNA 2OHHA 2ZJ1A 3B89A 2E4WA 1FYXA 2JFQA 2RG1A 3CEAA 3HJRA 5BMVA 3IIKA 1ZW1A 4FONA 4B3GA 3GX1A 2G0AA 5HCUA 3SP1A 4MX8A 1T3ZA 1RTKA 2WLTA 1UWVA 4RZSA 2WJWA 1N5OX 3VKUA 4BNXA 3P5SA 4O08A 1CHDA 4ED9A 1JG6A 1RVDA 4C7OA 3A27A 2XGMA 5BQ3A 3GLIE 4N3NA 5EN4A 1TZBA 3HCWA 4UXJA 1XRSB 3L7YA 4HNHA 2HNKA 5AKZA 1QFJA 4MOWA 2Q6IA 2IV7A 4HDMB 3AOEC 4BZPA 1LSUA 4EPVA 1H85A 4CEHA 3OUZA 4QARA 5LMCA 3KPYA 1LF5A 4ZEWA 2XZOA 2HYIC 4BGVA 5K3BA 2H0RA 2A5JA 1ZRHA 3OFSA 4X00A 2HXGA 2W2KA 1NVTA 4CG3A 1NMSA 2BFPA 3EODA 4NOKA 1BGXT 1D7OA 3GLHE 3ZR4B 4C1NA 1HFJA 1RADA 2Q2QA 4V24A 4BN4A 4PLYA 1U1FA 3EGIA 1QPZA 4R3WA 1G0OA 1MPTA 3HUDA 5G1OA 3VDQA 1FP2A 5E4TA 3A70A 2NUTA 3TMKA 3KLBA 4OBWA 4CMEA 4OQQA 2FDXA 1LX6A 1FIUA 2Z5VA 4MHSA 3SBEA 1PUJA 4L5AA 4ZJYA 3OKPA 5KCZA 3NFYA 5D5PA 1YBVA 3O92A 4PRLA 4L76A 1PFQA 3AGQA 5ER9A 4ZVNA 3L6EA 2DLNA 2X2EA 4XDYA 2ZJYA 4EZEA 2PKXA 4FOPA 5FPQA 4RPHA 3TG8A 3A28A 1BXGB 3CEPB 1TKAA 3E8SA 3V5NA 4E12A 2I2AA 2JGIA 3FYUC 3Q7TA 2FUNB 4EGSA 2PKEA 3FMVA 4FWBA 3AJDA 4HWTA 2V3CC 4ZZIA 3ZXYA 1QIDA 3N2GA 5AQ1A 3O95A 3K1AB 4QFMA 1EINA 1T8PA 3RVKA 4JY7A 5FFMA 2CNLA 3DHEA 4H1TA 4PQFA 4BLVA 2D5AA 1LPNA 4M0CA 3GJ7A 5H70A 4Z4HA 3F73A 4MV1A 2VAWA 4NCHA 5J59A 4E88A 1DOZA 2BIFA 2OXTA 1CUZA 1JR4A 2X22A 3QIVA 4WNAB 2GVDC 3PUJA 3VTKA 2YJ6A 4QTTB 5L3RA 4UTVA 4YRZA 3TJRA 4US2R 1Z7WA 1L3IA 3X1ZA 4W6QA 2PRYA 2FP4A 2CB0A 1G8AA 2GAOA 2XVYA 4PPYA 3RFFA 2VR1A 4WPGA 4BNDB 2J0UA 3D1VA 1L5MA 1HOTA 1VYVA 4TMXA 1VDZA 3QE2A 2DWOA 1I1QB 1I7LA 4XVHA 3RYTC 4A36A 5HS6A 3IEIA 2C5SA 2ERYA 2QX7A 3KE8A 5ELXA 4ANFA 1YJ8A 1S6YA 2GTHA 3NGLA 4GYYA 3EXEA 3INNA 4NCNA 1A2KC 3HS3A 5FTJA 3RUDA 1IOZA 1SRQA 4GZMA 4I1RA 4LJ5A 1FSSA 4O0LA 5COQA 2YYYA 2PS9A 2CXTA 4BB5A 3S1AB 2O23A 2PT9A 2PZFA 1C29B 3FDFA 4O63O 2V45A 1ODIA 3BTVA 3OCUA 1TCAA 3NANA 4UE6A 2XB9A 1YB1A 3JATB 4AAYA 2I8LA 4PZDA 1TT7A 2B35A 4Q05A 4B5KA 4CQLB 1J2TA 1TJ4A 3MINB 3RC3A 3LI2A 4KR0A 5CDFE 2VHEA 4ME6A 4Q48A 4TQGA 5TSDA 2H1LA 1AO0A 1SOVA 1PP4A 3QEMA 5I7OA 1SVMA 2D2XA 3GGCA 3BIJA 4IHJF 2R8YA 3NOXA 5IH3A 1Y1KE 1WXIA 1MABA 2Y0BA 2YXNA 2ZDHA 3DPSA 4GMXA 3HA7A 4Z4CA 4QL3A 4YJ3A 3SC2A 3V4PB 1T9ZA 1JLLB 3HI6A 4G09A 2D54A 2P35A 5F1PA 4LDRA 4QAQA 1OH6A 2D0IA 1XXHA 1UBUS 4IZIA 2Q46A 2RGXA 3QXHA 1ORHA 1RM4A 3AIOA 3C5CA 3GRYA 1VBMA 3R7WB 3RLIA 3UCEA 1LZLA 5JI2E 3X1KA 1VKJA 4KPYA 1YGPA 5TY0A 4J16A 1P61B 5G41A 5F2KA 3WQBA 4YT4A 5LL6P 5FTMA 3DT6A 2XADA 5BNZA 2C84A 2X0EA 1XDUA 2H2DA 1JU4A 2BD0A 4IZHA 2ODEA 3IC5A 4Q6WA 5AOAA 3IUNA 5JSFA 3U5TA 3DULA 1A7AA 1E2NA 3FH0A 3SYNA 3G2NA 1SG6A 3DE0X 3LCJA 1E0KA 3ZHYA 3ZE7A 3ZXIA 4F6RA 2WHPB 5E2AA 3GJSA 1YMUA 2XCUA 1YNOA 4YCSA 3LY5A 4P4SA 1ZIPA 2WM3A 1KETA 3GHHA 4MSUA 3GFQA 2QP3A 4EVIA 4L3OA 2ZSHA 2XMDA 3EPPA 5DHTA 4G1EB 5DGTA 4WASA 5I45A 4IDQA 2G0TA 1QGUB 3KEFA 4R01A 5IBRA 5K8VA 4DKJA 3ABQB 3B6KA 3O8LA 3MTGA 2VCHA 4D3ZA 4RPLA 2PUWA 2QDKA 1NAIA 1IPEA 4YCLA 4IXTA 3B13B 3AUAA 1JF8A 3LT2A 3R5SA 2VCEA 4IXMA 5KAMA 1NM5A 1GNRA 2ODPA 2KQUA 3AKEA 3EGXB 5DLYA 2DFKB 3TD6A 3OECA 1FX0A 3ZZNA 5LUAA 2CEKA 4YGXB 3MCZA 4UEQA 1PK8A 4XLLA 2FWMX 2AX3A 4Y1EA 4FYHA 3QOFA 3STUA 1RHQA 1BS9A 1ZD9A 3ECCA 3NHYA 2YN0A 1IWBB 5EEHA 3N1UA 3RVNA 3YASA 3BZWA 3OJXA 3TM5A 2AWNA 3C5HA 2GYYA 2IDJA 4MLPA 5BUCA 3GNQA 4NJEB 4L2IA 1SD1A 1DBQA 3RBVA 1NLMA 1UT8A 2JPDA 2YY7A 4UMEA 1P33A 5IDQA 1Z45A 1ZU5A 2QRLA 2VP0A 1IZ8A 3GBVA 3IX7A 4HAYA 4J7AA 4M99A 2QUAA 3RBXA 4DTCA 4RTNA 2IUFA 4KFRA 1UPFA 2AOTA 5AHWA 3VYTB 4CMIB 1ZN2A 1M6HA 2CKMA 1SA0B 3AFHA 4PG6A 2XSZA 2ZRAA 5EZ6B 1NYRA 5BSWA 1L5NA 3EZXA 2N1BA 1L5ZA 1Z68A 5A9RA 1Z62A 2HF8A 1S7CA 2BHRA 4H7IA 2JFFA 3HLKA 3HYCA 1I3LA 4YB8A 4PO3X 4BU0A 2QZ4A 2WUWE 4RXTA 3WGHA 3DYVA 2QG9A 5FPHA 1O94C 4OIFA 1ZPDA 5AW8A 4DMHA 4RY9A 1DC8A 1JT2A 3CKKA 3ELUA 4ARBA 2V4UA 3P71T 4YAOA 3VPDA 1QTRA 4PC6A 5E4YA 1R64A 3FPFA 2FEKA 4YRFA 1U0HC 3FNGA 1I51A 1B2LA 4JXKA 1JLKA 5CTJA 5DIZA 4CETA 1BVUA 1U81A 3IL2A 1K6EA 3MWDA 4IM7A 4M1MA 1ID1A 2QT0A 1XLWA 3L0PA 4NKRA 4M21A 5IU6A 1T8RA 2O20A 4D9MA 1AQNA 3KQUA 1EFPA 3OTIA 4MS3B 2CZGA 1Z6ZA 2NU7A 3HE3A 4L5CA 2QTNA 4X61A 4EX6A 3K9HA 4F2HA 3U39A 3OPXA 5DCWA 4DTIA 5EJ9A 3RD5A 5GADl 4FDVA 3ETEA 2WHXA 5KWSA 3PNKA 4FU0A 4YMIA 2VHXA 2G08A 5HA5A 2X19A 1QIHA 2EKDA 1QDUA 1A27A 2VUHB 2WZBA 4FJ2A 4OJQA 3ANYB 3UJ9A 3VSBA 4WK6A 2V7VA 5EKSA 3A6ZA 4MWSA 4TN1A 4H3HB 2JAHA 1G8KA 4TT3D 2VRCD 2ZT5A 5HIAA 5JXJA 1MIOB 1LDBA 2ZIUB 1JMYA 3L49A 4N5DA 4NBSA 2BSQA 4G0WA 3FLMA 4WN9B 3CNOA 2QROA 4D6XA 2IIQA 4EFNA 5E0KB 3IOEA 2BE7A 1KC3A 5IWAB 2JAPA 4J0GA 4EK9A 3SJ7A 1S8NA 1VIVA 2NXNA 4PZPA 1L4HA 1NDHA 2J8ZA 2JKVA 3KKKA 5IM4A 1NNEA 3DMTC 1P5ZB 1DRVA 1HEIA 2VQSA 4LE2A 4UUMA 3TIFA 4L08A 5KX5B 1B4DA 4TKVB 2VDRB 4KQ2A 4IDHA 4PFKA 3CKLA 2I66A 1P75A 2VRCA 3DP9A 3DQQA 4HNVA 1DO0A 1J2EA 2HRBA 3F67A 4I14A 3ZQKA 1ND5A 5LB2A 4G5QA 1PJCA 4HKTA 4C4OA 4KR2A 1K4KA 5FH9A 1PGOA 1ADCA 1OBCA 1FTYA 4XGIA 3PVSA 4IOMA 3A14A 1O0BA 1BHO1 1XDWA 4ZQGA 4QT4A 3KAQA 3VA7A 1BO6A 1E1MA 5E8JA 3KAJA 4Q3EA 4D6PA 3RT7A 5K7SA 3KKMA 4OXYA 1II8B 2Z8YA 2WMYA 4CV1A 1LI4A 4BMSA 1ZGAA 3RYIB 1JFLA 1PW7A 3E5NA 1VXRA 1LPSA 4LMBA 4WESA 2JFWA 4XYGA 2XNJA 2ZLBA 4R9NA 1NFRA 1SKYE 4B40A 4B3JA 3G02A 3NHKA 3ZIAA 1X7YA 3NH6A 1YQGA 3P8ZA 2DCMA 1RKBA 1VJDA 3FWHA 4UBNA 1PJ2A 2ZRJA 1MCZA 5JRZA 2RARA 5LA6F 3WMRA 3MTAA 4JJZA 3IH5A 3CVOA 1TX4B 1T91A 4S2EA 3RKSA 3W6PA 3DVSX 3DR3A 1T2DA 1PJTA 3LXUX 4TWZA 1WF3A 4JJIA 1ISSA 5EUQB 2WQZA 4A91A 2E4YA 4P4TA 1J6UA 3CEJA 1A4UA 1CVIA 4LQDA 3UAZA 3E8XA 1GQRA 2V8OA 2JZOA 2OUIA 4UBMA 4Z51A 2O0JA 1KI2A 2A1TR 2JJ1D 4EWLA 4LW8A 3CH4B 3G6KA 2QNIA 4DA9A 3M5DA 2OM6A 1GUFA 2XLCA 2BYTA 1OPRA 3LQRA 4BOYA 1FUEA 1WIWA 1QKIA 4AKEA 2BJHA 1DAIA 1M54A 1ULHA 2EYQA 4ZHSA 4BXOA 3FW1A 1JH9A 1O9HA 1AF7A 1M0TA 2VDNB 3EIQA 4V0KA 1RWMA 1PL7A 2G9NA 3UUWA 2FEAA 3ZIDA 2D7DA 4MHTA 4GIBA 4MKXA 1OFUA 2I7XA 4RTKA 3IB3A 4EQZA 3E03A 2IXAA 3VR6H 3HKEA 5EG5A 1JLHA 3OKCA 2XNKA 2ZG6A 2G8LA 3DV0A 3O3OB 5F7ZA 2V7QD 3PXCX 4MW0A 4NMWA 5AR1A 4K6KA 3U3RA 4EENA 4X62B 1OH7A 4DIFA 3GDWA 1N2CE 4E2FA 4LUCA 3P20A 1YDFA 3F71A 3DVQX 4M76B 1ZO8A 2C7VA 4MAAA 2VHUA 3I8XA 1USGA 1Y3DE 2WZQA 2HK6A 3U9SA 3ZY2A 3JWPA 10MHA 3QELA 3OZUA 2CYBA 2YJGA 4U7JA 3HADA 2VYND 1EGVB 1ISHA 1CLUA 1ST3A 2OORA 1N0VC 3BD7A 3ER6A 3PPIA 4JA0A 4EPWA 5A4AA 1E79A 2JFPA 1XZGA 2EJCA 3VDMA 1U2DA 1JUDA 2FPSA 1E58A 2X8LA 5M3BA 3VAYA 5I9IA 1HZZA 3OQHA 4HF7A 5AYVA 1NBEA 3BA1A 3LOQA 1P2UA 3AG5A 1LF0A 5FOUA 3L3BA 1SCDA 3HWRA 3GGJA 3DUFA 4NU0A 2O8EB 1I3OA 4B6GA 1Q1QA 3GUZA 3IMCA 1O95D 2ZDQA 3TZLA 1IK6A 1HDOA 1BCSB 1QB8A 2DM6A 5CB4F 3JARB 2QSZA 2Q9BA 3PDCA 3VSDA 1MA0A 2Q0QA 3DMYA 1U28C 4L4XA 4WV3A 2PKQO 1K5GA 1U2EA 3AR4A 4MPJA 3SHFA 2AQIA 1KJJA 1NASA 1PV1A 2WMOB 2W9XA 3A26A 2NT4A 3V9AA 4DRXB 2XODA 3VR4A 4AM8A 3ZVNA 3BJZA 5EXPA 5BXYA 3PNOA 2N0SA 2X1VA 3P9KA 4J07A 5JFTA 1DKQA 1S01A 2N46A 4KRGA 4C04A 2CFTA 3N2EA 3UXEA 1A5BB 1NZJA 2VDQB 4M9QA 5LYJA 3OICA 1MJGM 4ZC8A 4DHWA 2WDPA 4FK8A 1KI9A 2A30A 4B9EA 1FNMA 4DSTA 1I14A 2GRJA 3AR8A 4OA8A 4BX8A 4NJEA 2NOAA 2RB4A 3BMCB 1SIWA 3TVDA 3IPYA 1EE1A 1XFDA 4GPEA 5J5AA 4C03A 5A1JA 3ONWA 2WJJA 1YR1A 4HDQB 1PSDA 1VP3A 4TL9A 3UWKA 1FTNA 2A67A 4V1CB 4BTLA 3MWYW 5IEJA 1GRNA 1Q7CA 3LKDA 3WL7A 3WKBA 3D02A 4PBSA 3PNLA 1N7HA 2YFYA 3L93A 3TR6A 5DASA 2QPOA 3GVIA 1QHEA 5C7IO 3TMYA 4LDAA 1XRRA 1DEKA 3BAFA 3I2GA 4W1RA 3MCWA 1FZTA 3IUJA 5EHXA 2C94A 3QOXA 4HNAA 3ROMA 1X74A 4QYMA 4KTVE 5HDQA 3SLKA 2C8LA 4WCDA 3ZNOA 3A3YA 2GEUA 2M32A 2R87A 5KINB 2EW8A 2ISCA 1J4AA 1WCWA 2JA1A 3HSKA 3UGJA 4MUMA 3WLFA 2ASEA 5B1HA 5B1DA 5E6RA 1LC0A 2WSBA 1JQJC 3OU7A 4PZ9A 3WYEA 4Q1EA 3WL4A 4BMOB 1Q74A 1UDRA 2HWUA 2ONCA 3ES9A 3RIHA 1DIBA 1PJZA 3UWMA 3G5AA 3SDSA 4LOHA 3CF2A 3AV0B 1WMEA 3OEED 2DX7A 2FQWA 2Q5FA 2OBLA 3PUIA 1M2VB 1PF7E 3EOZA 4MGYR 2ZIAA 4RC9A 4H1UA 3SPXA 4F86A 5IVKA 3OHSX 2H1HA 3HY3A 3OCWA 5BQFA 3RS3A 1QFXA 4CCSA 2R62A 4FHDA 2J6IA 4A2WA 4BTEA 4IBOA 4G0MA 4GX2A 2B5OA 2F17A 1NV8A 1RHMA 3AJRA 4KOEC 1UMBA 2EFJA 3PDHA 3U9TA 2GEBA 2J33A 1VLLA 2JFNA 4G1MB 4DSUA 1QVAA 3B2QA 3LHDA 2CNOA 3EK2A 1RXIA 4MVWA 1X13A 1IXKA 1EFRA 3T61A 2V96A 4AK9A 3ECAA 4CUJA 5LU8A 1LQTA 3GOHA 3QEOA 4YJHA 1CX9B 1DFIA 1PG5A 4FKZA 2VT6A 1AKWA 3E4CA 5B1IA 4AO8A 4J7XA 1MAUA 3AL3A 3TKLA 4KUGA 1HT2E 3ICQB 2FOXA 1V9SA 4ZVTA 3W90A 1EAMA 4NJMB 1ORVA 3R8FA 5DYIA 1V3UA 1GSAA 3ZJVA 3DB2A 4OK6A 3KVVA 4IIEA 1WCV1 4E15A 4YLYA 2NO4A 2OAEA 4PXSA 3FHTA 1AURA 3K0CA 2FHSA 2JLAA 3DWEX 3UHOA 4UPVA 3RG2A 3STXA 3DMPA 3ZE2B 2IHTA 2A57A 3M6MD 3RARA 4URXR 3ESXA 3QVSA 3FHJA 4PLVA 3KWMA 3R74A 2ECPA 1RYNA 3EGDA 1WSWA 3CW8X 5KU7A 5DFAA 4DY4A 1MX5A 1RXCA 2HK8A 3SC3A 2BW0A 4FYIA 3QA3E 1ADBA 4TUYF 3HC7A 2WOJA 3HY6A 1JNXX 3U48A 1E96A 1VPTA 4RD3A 4MVJM 1HSOA 5DISB 2EGGA 3WRWA 1GZ5A 3ADKA 3BWCA 3BJMA 1N3BA 4I1VA 1S02A 2XOXA 1VYHA 1DIGA 3VRHA 2A3RA 3AEQB 3KEOA 4D9FA 1WVIA 4DLBA 2QA5A 3PS9A 2CCJA 5D87A 4DWWA 4EO9A 3LUHA 4U7PB 3G0GA 3VVCA 1CQWA 3TZ6A 3WXMA 2GVNA 4TS9A 2KJQA 4JJGA 4HDNA 1EUCB 1XCMA 4NCIA 1XXLA 1YZUA 1OH5A 5AJZA 2JLXA 5F4BA 3WYGA 2J0EA 1VYUA 2KM1A 4M9UA 3A2KA 2CZQA 4N18A 1AKMA 3HJHA 1CQIB 5D01A 5IC6A 2XKKA 1LNZA 1JQDA 3IT2A 1BA2A 4FHFA 4BJ5A 4H15A 5SZIA 4OHKA 5CYGA 4AY3A 1M75A 4LPKA 5KYWB 2NQ8A 2B3TA 1Z39A 1EK6A 2WUVA 3KZ1E 4XM1A 5EPOA 5E9AA 1N6OA 1ZUD1 4UEKA 3SOZA 3UY4A 3L0BA 4IY1A 3AQIA 3CRVA 3QYAA 4JK3A 5FFNA 3ZLTA 5JNLA 4K7JA 2WOOA 2WJHA 2ONZA 1K0FA 3QUAA 4K9KA 3AF3A 4O2BF 2A9QA 5BO5A 4HDAA 5D86A 2E1PA 1ISRA 1WXQA 3C3AA 5TF0A 1GUYA 3O4RA 2G9QA 5DWVA 1GZUA 4O2RA 3UICA 3KHSA 2NZXA 2H31A 2NZ8A 3CVJA 1AMNA 1O94A 3C5WP 1GQQA 5C1DA 1V3VA 4QQ8A 1VIDA 1LVUA 2IZOA 2P5UA 2QM8A 2V4MA 4N0EA 5CAEB 3ZHZA 5K8JB 3GFBA 1QLJA 4DB4A 1ZRNA 4JKYA 1Q0PA 1U8CB 3R3VA 3WKDA 3M5WA 1BEEA 5PGMA 5IDVA 1GKYA 2YXBA 1G9TA 1TGYA 3GJXC 4JB2A 4R2MA 2XE4A 4W63A 1HORA 3FA2A 5AKLA 3VDRA 3PNMA 2GEDA 3KR1A 5ALMA 2ZVDA 4MYTA 2JEYA 3N0WA 4G07A 3KXDA 1FJXA 1F8XA 1G66A 1G8PA 5B3KA 5JPCA 1NVFA 4Z7OB 3WWYA 5LXTA 4DAEA 4J0DA 2UYCA 2JGNA 3R5JA 4JLJA 3GDGA 2C0CA 2OBFA 1NI3A 3H2HA 3NCTA 2FPXA 4OHUA 4HO1X 1FSGA 5AJVB 5IXJA 4BLSA 3CA8A 2UDPA 3BG5A 3WRXA 4BFYA 4X7RA 1Z16A 4AKIA 2H1VA 3DT9A 3RREA 5J5VA 1NVBA 5DPMA 4L2IB 5HQ3A 1J70A 4E7OA 3U3MA 1JEDA 1P2VA 1WKCA 4E51A 3I9MA 2ZUTA 1RXWA 3GRRA 2EDAA 2O2GA 3WLTA 3LYAA 1I01A 1GKUB 5DDIP 3ANXA 4U5XA 1CQXA 2JAOA 4Q7QA 3EJWA 5KYYB 2LW7A 4AQYB 3O83A 2ADMA 1QRUA 4Y1RB 1C1HA 3PD7A 4HAIA 4BUZA 4LF9B 1W94A 4UEWA 2XEDA 4M37A 1KMCA 2PUEA 1Z5VA 4NYMR 2Y0EA 4FLEA 4DCTA 4X1YA 5IAGA 5A3QA 4IUBS 3MJCA 2QU7A 1ZCJA 2HBYA 1RAHA 4BVEA 1P29A 1NTRA 2OAGA 2K6GA 3L0YA 1DJNA 1J0BA 1PFYA 4ZVLA 3SZOA 1MVOA 4I50B 1UBKS 4E4TA 1R10A 1VJ1A 1CZKA 1NYQA 3GT7A 2ZB8A 3LLCA 5EYPA 5LIRA 3ZJTA 1C2YA 4PAWA 2WG0A 4MJXA 3L2OB 1C9NA 2FK7A 5I8PA 3TZKA 5IUNC 5JRJA 3W2FA 4OQMA 3DF9A 5LA6B 2XCOA 2XQJA 3H4VA 3R40A 4MWEA 4DRXA 4HVLA 1FYEA 3NBXX 3QXXA 3G0OA 3ZNQA 1L5WA 4BX0A 1MOQA 2VJMA 4L50A 4TMYA 2GQ0A 4IIDA 4L6IA 1D0VA 3NXKA 4CCAA 1JA9A 1Y81A 3KZOA 1NJGA 2FF5A 4KKVA 2C04A 1XZIA 4ZARA 1RBQA 3K05A 4PIVA 3UMJA 3O2QB 2BCJQ 2IY8A 2UYGA 2V9CA 4PGGA 5HF8A 9ABPA 3WK8A 2CMKA 1EX6A 2ZANA 4CIBA 5JFOA 4G2NA 1EWYA 2XCRB 1H0HA 2BP7A 3M6XA 2PBRA 5CDHA 3MN1A 4I50A 1EGQA 3DNPA 4QUGA 4X41A 3H16A 2D1TA 2O5RA 5EOVA 3MWJA 4B2YA 2GH1A 2QTTA 2FW8A 2L69A 1W35A 4IS2A 4HATA 3DJFA 4QOFA 5IJ0A 4F97A 5DSXA 4PS1A 1NV9A 1E2PA 4BLOA 1AZLA 1EDEA 1KOFA 3OQ6A 3PYMA 4LZWA 3VYRB 1AQIA 5D3MA 3LDUA 3D6TB 4WZBB 3I4FA 3V1UA 4FYXA 1YONA 2GN2A 2CYCA 1ZH8A 2DBZA 2XNDA 2B99A 2QRVA 2QTAA 2XWJI 3OAAD 4N5LA 4Y8VA 4RVCA 3EFHA 3LCVB 2IHNA 5KJ6A 3GZNB 3ZWNA 1DX9A 4WN9A 2RGNA 2D1SA 3GAMA 1V6AA 3WNVA 3ZCRA 3Q3GE 2CY0A 4GPAA 3PD1A 3ROGA 1PR9A 5D1NA 3QU7A 2EZ4A 4EVRA 4K9MA 3PV0A 2W22A 4HEHA 3I0MA 2R4TA 1I4WA 1XK6A 3GRVA 5JCJD 4WY8A 5DOVA 3W3AA 1YHZA 2BGNA 2H1CA 1NUQA 1ZL0A 2QPTA 1GL7A 1H3NA 2YVAA 1Y63A 3PF9A 3LZCA 4TSKA 3UJPA 3WLEA 3I8OA 4EHKA 1UOQA 1KPGA 1XQ1A 2OILA 1PNVA 2FN7A 3B1FA 3E1GA 3OLWA 3V4SA 5IJ0B 1NRXA 3GP3A 2DTEA 3K9LA 5GP1A 3ZIUA 4MTCA 4FW9A 1V45E 2DPYA 2NUPA 1UXKA 3KT3A 2R1ZA 4NE7A 4C7BA 2V0GA 2Q41A 4R8MA 4ZQHA 2Z09A 3EVTA 3F3SA 5IAAA 3LWNA 5EJ4A 1NA5A 5HIIA 4A26A 2YWEA 1JXMA 2NV0A 3IDAA 3JATA 3NBAA 5AK3A 3VO2A 4BO0A 2ZCJA 4L3WA 2OZVA 2GTIA 3HJNA 2VK1A 3VYUB 1WTAA 2ET6A 2ODQA 4II2A 4Z5XA 2AJCA 4GMHA 4TS3A 2VPZA 1FF9A 3MFQA 1ZRSA 1J8YF 3OOHA 2GK4A 4OB7A 8MHTA 1UWKA 3ZE8A 2G4VA 1R12A 3LJKA 3RYFB 2YIJA 2IGBA 1TVCA 3A1EA 1RWKA 3ZNNA 3JQBA 3RIYA 3V7FA 1J1ZA 3OO0A 3AF2A 1BZYA 1H9BA 1X70A 4GI3A 4H17A 2H1IA 4UAVA 1YS2X 1L7MA 1CW2B 3M9XA 1IN7A 3VSEA 1F2DA 2TS1A 3UF0A 5I3ZA 3CR8A 5ECDA 1UJMA 4DCNA 1XZBA 4OREX 2ZR7A 4C3ZA 4AF7A 1EG2A 2PL3A 3NC1C 3M6AA 4HSEA 3OQBA 3UPTA 3DXYA 3ZCUA 3SDBA 2ZCUA 4O5OA 3FSJX 4RLFA 5HW0A 4D3SA 3WP0A 3THOA 3SVLA 1I6MA 2EKZA 1KI7A 3LLMA 4YCAA 2ZB3A 4WWHA 4JS0A 3LK6A 2FSGA 3HUUA 9LDTA 2VT7A 3A1NA 3SKVA 3OESA 4LK2A 4PCLA 3HYRA 3RH0A 2FTKE 3SR0A 4NHEA 5ALZA 4DLWA 2FFAA 3FOZA 1NUHA 2FWIA 2A78A 3W4JA 4WZAE 1DJLA 1AHPA 4MW7A 4LOAA 2CD9A 2GJAA 2OEPA 1G21B 2H7XA 2SHKA 1O94D 1XVVA 3I6MA 4QNRA 4GR4A 1VG0B 2CLEB 2POQX 1C8KA 3UC9A 4BZZA 1EZ1A 3T7TA 1I2BA 2BBOA 4R1LA 4YV2A 1N4DA 3NPMA 4XWGA 1W59A 3Q2KA 2ATCA 4C29A 2C03A 3PQDA 1AGYA 1WZ2A 3GNSA 1AS2A 2ZJ2A 3MUNA 3T0IA 4DQ0A 9MHTA 2SKDA 5J23A 1KAMA 4KR7A 2PRKA 2X4IA 5BSKA 1N7GA 3G5LA 3EYAA 3NTRA 1CZHA 4Q1CA 1A2QA 1LFDB 3GLHA 3IJEB 1KH2A 3KCQA 2O19A 5KQRA 1M2VA 2ZYIA 2J9YB 5BN4B 4UTRA 2PA0A 5LD2C 2MT9A 5BWLA 5T4EA 1OFUX 3AJ8A 4MPDA 4ZN6A 3G0DA 1Q2XA 3DDZX 3IQHX 3EQ7A 3HHEA 2FW0A 1ORRA 3TW8A 4JR2A 5B1SA 2X77A 2WTEA 4IAOA 2VJNA 1E2FA 3DMGA 3UJ6A 4XCVA 3MJRA 3QPAA 5CXUA 5DBIA 1UDCA 4Q1FA 4Y6QA 5M34A 2WF7A 3COPA 1T2EA 3G49A 4M88A 1S2NA 2VAVA 3WGIA 4M36A 3AXSA 4XD2A 3GR6A 4G4IA 2CBZA 4QRDA 1NHWA 4MKRA 2I91A 2C5EA 4F3NA 1MAAA 5AW2A 3BE8A 1FLDA 4UDXX 3GBSA 1D03A 1ADFA 3KELA 3F49S 2HY7A 3E3AA 3PUZA 3A6LA 4HX5A 1E61A 3IIJA 4XB2A 3TLBA 2QF7A 2WWGA 2J5RA 3NEJA 5IHXA 2FEPA 2HXYA 4GC9A 4P38A 1SXPA 4AWXA 2E82A 5JTTA 4IVRA 4B3HA 1C4OA 3PCRB 5CNIA 2C58A 4W82A 1QG2A 1WUJS 3F5DA 4FQ7A 1EU1A 4OJKA 4ZI3A 2YV1A 4L9WA 4EEXA 1OBFO 3RI3A 3N2KB 3ETCA 1YQDA 3BL6A 1ZQ1A 3I6IA 5AXBA 5HM8A 1CS0A 1QVRA 1YBMA 2BFMA 3RWOA 1Z7EA 3AZOA 4PSUA 4C4RA 1EJ6A 5BR4A 3HDQA 3HB1A 1KK2A 2E3JA 1N9GA 3DPIA 4MINA 5AJHA 1GL9B 3UOAB 2XUAA 2A1UB 5FBWB 1R8JA 4MUXA 3VR4H 1SVOA