4H7EA

Crystal structure of haloalkane dehalogenase linb v112a mutant from sphingobium sp. mi1205
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 112
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7eA00
4HVTA 5AM5A 4OU5A 5EFZA 5ALTA 5E4JA 1EK1A 5DWDA 5JAPA 4H0CA 1JU3A 4ZGBA 2RHWA 1O6FA 5IVKA 4I19A 1GKKA 4Q82A 1I6WA 3DKRA 4BTLA 1ZICA 4UBIA 4GECA 3WZMA 1QO9A 3AIOA 3R3WA 4AXBA 5AP9A 3G0GA 4KJXA 1CUFA 1ODTC 4ZV9A 4BBZA 2BGRA 4PSCA 2YXPX 4X94A 5CH5A 3WJ2A 3STVA 5AI5A 1EK2A 4X3CA 2PSEA 2AJDA 4E14A 1OCEA 2OCKA 1E8DA 1L7QA 3D4LA 5D6OA 2PPLA 4G8DA 5KWJA 3V48A 1AKNA 4GHWA 3I6MA 3OC0A 3STYA 3R3UA 3PUHA 3UUEA 2H7YA 1R3DA 1IMJA 1Q0RA 4I4CA 4E15A 2VJAA 2PU7A 4PNZA 2ZJ7A 4UHHA 5A62A 2XMCA 4MJ3A 2XMSA 3ZV7A 1CUVA 3FYTA 5CBKA 4DNPA 1E3QA 1CUHA 5LKRA 4Y2PA 3PDCA 4Q1VA 3WJ1A 2DFPA 2E3JA 1F8UA 4DM7A 3G9XA 5AK6A 1SCIA 1AUOA 1QIEA 1FFDA 1J2EA 3DLTA 1P0IA 1W1IA 3GBSA 5HCUA 4Q3LA 5FP0A 4U2EA 1SC9A 5JIBA 3NWOA 1HDEA 2WTMA 5ISMA 2RAUA 1YB7A 3B5EA 3BF7A 1BRTA 2WUFA 3SC2A 4M0EA 1WB5A 1IUNA 3HRHA 2GYWA 2IITA 1TCAA 4Y2RA 3K2IA 2V9ZA 3FYUA 5T4HA 3EQ8A 1CRLA 1XRQA 4LIPD 2CMFA 1U8EA 1LPNA 3RM3A 2Z3WA 5K3FB 5HQ3A 3WKBA 1EX9A 3ZLTA 1BS9A 4F0JA 4EY4A 2QXUA 5AHXA 3M3DA 1E8MA 4YASA 4EY8A 5JALA 2Y1KA 1R4ZA 4FDMA 1XLWA 1E5TA 5LZ7A 5HFNA 2XUJA 3IDAA 1K6EA 3DOIA 2HFKA 2WIGA 4KEAA 1N8SA 2XDWA 1RP1A 2QJRA 3IULA 1QLWA 4A5SA 4KE7A 3EQ7A 5AIBA 3QPAA 4DMKA 4WY8A 4Y7DA 3E4DA 1N5RA 2WIJA 3C8HA 4WY5A 2QZPA 4Q3OA 3ICWA 1KU6A 3BE8A 3H2JA 4ZRDA 2BCEA 1BU8A 4CG2A 4DLNA 5A6VA 4AMYA 1YS1X 3NUZA 2XUDA 5A2GA 5JANA 1XZLA 3RLIA 3BL8A 4EHBA 1EVEA 5HK9A 4X7BA 3WK9A 4C4YA 2W6CX 4CI9A 4B80A 1YA8A 1ZJ4A 4H7IA 3F67A 4QWMA 1LPOA 3PFCA 1NU6A 3HEAA 5C8ZA 5DLPA 4DMCA 2CUTA 1QIJA 3G9ZA 1ODCA 1QO7A 2WG0A 3L1IA 3B12A 5HQ3B 1SCQA 1J06A 1ZOIA 1VE6A 3H1AA 3FBWA 3OTQA 5AKKA 5CT6A 1EDDA 5CMLA 2HA2A 2QMQA 2VTVA 3WIBA 1BN6A 2B20A 3WL7A 2XQGA 1XZHA 2WIFA 3N2ZB 2WHRA 4MXDA 5SYMA 3WL5A 1YB6A 3LCRA 4G1FA 3BXPA 4GW3A 1ZGCA 2AJ8A 4BAZA 2BKLA 5AKGA 4NVRA 2DQZA 5FUMA 2HA3A 3G8YA 5CH3A 2OLEA 1AC5A 2XMDA 4W1PA 1AURA 4Z49A 4B0OA 5E4YA 5SYNA 5AKLA 3D7RA 5EIHA 1LPSA 2CZQA 2J4CA 2YH2A 5JAOA 4DNFA 1CUDA 3LP5A 1QZ3A 2VF2A 5BWCA 1Q84A 3QPCA 5AK4A 3O95A 4AQDA 1YCDA 1U65A 4JUIA 1HKHA 2Y2VA 3R3ZA 4H7EA 3H17A 4DNQA 1UOOA 3C5VA 4JEIA 1JI3A 2R11A 1CV2A 2VAXA 2GBFA 2I78A 1TIBA 4BE9A 1XZEA 2J4FA 2JGJA 4MYDA 4UHEA 1JJFA 2QVBA 2WTNA 3H2GA 3PICA 2ZVDA 3I2HA 1WPRA 4BC1A 1RWQA 1G4HA 3H19A 5ALPA 2HADA 3G7NA 2XUAA 3A2LA 4FLFA 2GZSA 2HU8A 3WK8A 1XZGA 4MQMA 1TAHA 3ESBA 5E4TA 2WILA 3KDAA 2C0QA 1L7AA 3I1YA 4FNMA 2DCMA 3FWHA 3DCNA 2V97A 5DNWA 3SWWA 2XUGA 4K6KA 1C7JA 2WLSA 3OURA 5AKXA 3H1BA 3L1HA 5DYTA 3PF9A 4UBOA 3T4UA 1ACJA 3AZQA 4C89A 3FSGD 1MX1A 1XLVA 5JATA 3QM1A 1KEZA 3VVMA 2PUJA 5FRDA 4TGLA 1DQZA 4WFJA 3Q8WA 4AZ0A 2BFNA 4X92A 3D0KA 1QFSA 1Y37A 1H2ZA 2P8SA 2OCGA 5ALSA 4GEGA 1XZAA 4GI1A 1PFQA 2XQKA 4C01A 4QDTA 2R8BA 4BE4A 2WFZA 3VVLA 4ZI5A 2PKYX 3SK0A 4GBGA 1NU8A 1EB8A 3YASA 4UFNA 3G0DA 5J3JA 5ALZA 5HK8A 2XUPA 1CUXA 3AINA 4F21A 4H7HA 2ZYIA 3GZJA 4UUQA 1H23A 5K3BA 1WOMA 4X91A 1P0MA 3V9AA 5I9IA 3HI4A 5C8XA 1XZJA 2B61A 4KYVA 1VXRA 3VKFA 1W4LA 2LIPA 4WCVA 2CKMA 2EDAA 2I3ZA 2XUHA 1SFRA 1XRPA 4QLOA 4RE6A 3WKCA 2JGIA 5BV7A 1UKBA 2DQYA 4DTCA 2VT6A 4B82A 2QRUA 3ESCA 4IH4A 5ALMA 2XE4A 5AKHA 5ALWA 1CUUA 5C7YA 4RNCA 2AJCA 4BCDA 1EH5A 3H2KA 3GA7A 1QE3A 1VA4A 4LKOA 4MWSA 3WKDA 4TVKA 2RIPA 4E11A 4LXIA 4M0FA 1BROA 3N0TA 2K2QB 5ALEA 4CCWA 2RI6A 4H7JA 1ZI6A 1XRNA 3M82A 3FSGA 2OAGA 1A8UA 5A71A 4KE9A 4ZV7A 4P08A 5AJHA 4Q3KA 3LS2A 4P9NA 5ALXA 2V96A 4K6GA 3OOSA 2JGEA 2OCIA 2OQIA 5ALVA 4U2GA 4IH9A 3DQZA 1UKCA 3TRDA 2H7XA 3W05A 1EB9A 3W9BA 5ALIA 4B81A 3K9BA 3O0DA 4B84A 4DSZA 1C4XA 4NZZA 3IVMA 3QPDA 5ALOA 4EB0A 1LBTA 3HACA 4W1RA 3C8DA 2HU7A 1ZI9A 3BDIA 3PUIA 3SX4A 3WL6A 2VJBA 3RARA 4N5IX 5K3EA 3F98A 4PW0A 4YPVA 4QE3A 4HRYA 4O08A 3W06A 4DMFA 5AKYA 2PSDA 5CT4A 3HXKA 5AOAA 4DSAA 4GWLA 3IUMA 5ALQA 1MTZA 1CQWA 2Y6VA 5ALYA 2XMGA 4B85A 4BDTA 3I2IA 1F6WA 4UFOA 5CW2A 4ETWA 1CFJA 2D0DA 4J03A 4XIIA 3EF3A 3C43A 6YASA 1MX5A 2WM2A 1XRRA 1K8QA 2HRRA 4J0DA 3P2MA 1LZKA 2XQFA 4FFVA 3WQHA 2Q0XA 3QYJA 4ITVA 2BJHA 4BB0A 4LXHA 1SCKA 2PVSA 3KD2A 2XMQA 1IVYA 5CT8A 5EGNA 3WK7A 3FCYA 3MVEA 3DYIA 3S2ZA 3WIOA 2G5PA 5D3KA 1GZ7A 2HA4A 2WIDA 2JGMA 4ZXFA 2CBGA 4AO7A 2OCLA 1E89A 3V1LA 2X76A 4CCYA 4YK7A 1BE0A 1CUBA 4RGYA 3F9CA 4MWTA 4H35A 3LLCA 3C6XA 1IZ8A 5AM4A 4C4ZA 1EXWA 3JYHA 3D59A 4HAIA 4X90A 1ZIXA 4CIAA 1GT6A 2HA5A 5CT9A 3ANSA 1CIJA 4U2FA 4QZVA 1GPNA 4UBNA 5AKEA 1Q0ZA 3NOXA 2O7RA 1MN6A 4FHZA 5JASA 3FLAA 4FOLA 5DTJA 1ZD5A 2WQZA 1XRMA 2AJLI 2XLBA 3HZOA 4IHAA 4QLAA 2Z3ZA 3I6ZA 5FPQA 3G9TA 1MPXA 4N8DA 4C88A 2GBCA 2ZSIA 1WHSA 4J0IA 3I6YA 1R9MA 1X2EA 4ARAA 4BZZA 2WU4A 1EDEA 2XLCA 3D2CA 4AO6A 2XB6A 3JW8A 1XKTA 1CUGA 4LYDA 4OD0A 1WCYA 2WFLA 5LLSA 1LPBB 1SOMA 5DJ5A 3T52A 1VE7A 1U4NA 2W22A 2PU5A 2XMZA 5A7GA 2J3QA 3ZWQA 2BUAA 4QNNA 2OPHA 4QDUA 5KWIA 4FBMA 1MAAA 3A2NA 1CUZA 4FFWA 1XZFA 5CH8A 4A23A 2ACKA 5HKAA 4HRXA 1FSSA 3QMMA 1DT3A 3BJRA 1OILA 4CIBA 2GYVA 4JNCA 2XI4A 3ED1A 4Q05A 1CUJA 3G9UA 1XZDA 5AKJA 1USWA 3ICVA 4GDMA 3FOBA 3A70A 5AKIA 2HFJA 3BDVA 4QDOA 3CCCA 4Y2XA 3C6YA 4AZ3A 5LKAA 2WG2A 5JD4A 4LXGA 3OPMA 1WM1A 4J0GA 5C81A 1XZMA 5AOBA 4W1QA 5T4BA 3H04A 4UBJA 5CT5A 5JAHA 3L1JA 1IUPA 4G4IA 1EI9A 5DYYA 2CEKA 4FLEA 1UK8A 3WWDA 2HDWA 1JT2A 1XFDA 2QS9A 1ORVA 4AN1A 1VA5A 2WIKA 5LP1A 4JH0A 1QIDA 4RE5A 4G9GA 3IB3A 1GGVA 2VEOA 3E3AA 1QIKA 2HL6A 2PSHA 3WZLA 1IZ7A 4Y2UA 1TCCA 1FFCA 1J07A 4FBLA 2OQVA 4W9RA 5HKBA 4OCZA 1FJ2A 2PX6A 2OGSA 1CUSA 5EHZA 4U2BA 3M83A 1DWPA 3WMRA 4I3FA 4N5HX 1F0NA 4J0CA 1MAHA 4BP8A 3UUFA 1H2WA 4J0KA 4J3JA 1ZD4A 3O4HA 3WK5A 1CUYA 3RKSA 2VA9A 1N5MA 3DNMA 4Y2YA 3WWCA 3PI6A 4X6UA 5LZ2A 3C6ZA 1DTEA 2I3DA 3H18A 1QIMA 4HXGA 1S8OA 1GKLA 3ESDA 1AZWA 1LZLA 2JGKA 4OB6A 4PSDA 4XJVA 3A6ZA 4JYMA 3H2HA 4C87A 4UBLA 2WSLA 2QUAA 4IH1A 5T4FA 4EY5A 2BGNA 5FOQA 4OSEA 3PFBA 4BCCA 4G8BA 2PBLA 5HFAA 3AUKA 1NX9A 3AFIA 1QIFA 1H2YA 3FCXA 3WL8A 3TJMA 4UBKA 3G0BA 4F5ZA 3LIPA 2XT0A 1YS2X 5HF6A 2DHCA 3F8SA 5YASA 2PUHA 2Y2UA 5K3AA 4BP9A 5LIPA 2WFMA 3B3QA 4H7DA 1MX9A 5IH7A 3K6KA 3STTA 2QUBA 3ANTA 1DT5A 5AM3A 2ORYA 1A8SA 2ZYSA 1ODSA 1AQLA 1A8QA 1WPXA 2QXTA 1P0PA 4EY6A 5FV4A 2Z5GA 5ALUA 1YR2A 4XVCA 4GXNA 3DD5A 4BAUA 4DYHA 5AI9A 4A16A 3VJMA 1JFRA 2NW6A 1E8NA 1UOQA 2QTBA 5JD6A 4K5QA 1CR6A 5AM2A 4DMHA 4BCBA 3WI7A 1ZJ5A 2ZJFA 4AN0A 1ZD2P 4QA9A 1G5FA 5AOCA 2FJPA 4INZA 1HLGA 5CTAA 3C45A 5BOVA 1K5PA 5ALGA 3QZUA 5ALDA 1WB6A 5AH0A 5HZGA 4Y2VA 3UMJA 2WJ4A 4CFSA 2XUKA 2BAGA 3DEAA 4P93A 5DNUA 1B41A 1XQYA 1QJ4A 4HXFB 4KR0A 5ALNA 4W1SA 3WK4A 1CUIA 2FJ0A 5A7FA 3WKEA 2VAVA 5AM1A 1DX6A 4PF1A 2OAEA 4FTWA 1VLQA 1DINA 2YYSA 5H3HA 1ZGBA 5A7HA 4KAAA 3DOHA 3C5WP 1LGYA 3FLBA 4CG1A 4CG3A 3BJMA 3QH4A 4BRSA 5AIAA 3WWOA 1BCSA 4X00A 4KE6A 1QIIA 2RGUA 3I2KA 2O7VA 4X97A 1B6GA 2VT7A 1CUCA 5LZ8A 3QBJA 4OB8A 4X6XA 2JIDA 2C5GA 4GLBA 4CCYB 5JZ9A 2JF0A 3R0VA 5ALHA 1EA5A 1G66A 1CUAA 1YASA 5ALJA 5ALRA 5ALKA 3FYUC 2GBIA 3JWEA 1KU0A 3C87A 1LPAB 3I2JA 1Y7IA 4PV7A 2CB9A 1YAHA 1XKLA 1CLEA 4WJLA 3FVTA 3BIXA 4N8EA 3MUOA 1UK9A 5DYWA 2PSFA 1ZIYA 1XRLA 4FWBA 4QDZA 5HF8A 1QIGA 3HABA 2JGLA 3PE6A 1CEXA 3WWPA 4H7FA 1MNAA 2HIHA 4AB1A 4ROTA 4Y2QA 4QDXA 2JBWA 1QTRA 5ALFA 3HSSA 5AKZA 3CXUA 5D7BA 2UZ0A 5EHXA 2C7BA 1UK6A 3KOOA 3TEJA 1DX4A 1AGYA 5JD5A 4BYMA 4PQEA 5CXXA 3WK6A 3E1GA 1U2EA 1IUOA 2GYUA 1VXOA 2G63A 1QGED 2QT9A 3STXA 3KXPA 4FNGA 3GUUA 2OGZA 3QVMA 4X93A 2WG1A 2AJBA 1A7UA 4X71A 2VSQA 1R1DA 1UOPA 2WUEA 1XZBA 2V98A 5EIEA 1MU0A 1X2BA 2ZSHA 4OYYA 3CCBA 4Y9SA 4WFIA 2RHTA 1BEEA 1EINA 2HU5A 5JYCA 1VKHA 2BUCA 3MGAA 2XUFA 4EZIA 4EA6A 5AM0A 1HL7A 4ZWNA 2H7CA 2XUOA 3OM8A 1G42A 2C5FA 1JKMA 5KREA 3RK4A 3NGMA 5AI4A 4XWGA 2XUIA 5LZ9A 4DGQA 2JEYA 2OXEA 5AK5A 3O9VA 1Q83A 3CN9A 4HXEB 4AX4A 2XQJA 2VJCA 4N8SA 2I03A 4EUSA 2B9VA 1YA4A 4G5XA 5T4EA 4UBMA 1WB4A 3R40A 3HYSA 4EBBA 3KWFA 3V1KA 1GPLA 2O2GA 3U0VA 1QIHA 4HS9A 4QWWA 3WYDA 1Z68A 1BN7A 4U2CA 2X8BA 4KACA 3AZOA 3I2FA 1LLFA 1JMYA 1TK3A 2HM7A 1HQDA 1EDBA 1W76A 1AMNA 4BVLA 5K3FA 3HLKA 2WUDA 3ESAA 4HTAA 3BIWA 3WWEA 5K5EA 1J1IA 4C6HA 2H9YA 4KE8A 4XX1A 3IURA 3FYUB 1TRHA 3BF8A 3LIIA 3C6BA 2EEPA 3IA2A 4WDQA 5FDFA 5IVDA 4H7KA 2FUKA 3I1IA 3R41A 4OUKX 4PSUA 1QTIA 4WFKA 5JZBA 5EHNA 1THGA 4UHDA 1WHTA 4OPMA 1GPKA 5CRIA 4AO8A 1XZKA 2HA6A 3G02A 4L72A 1CVLA 1RYYA 4UHCA 4Y2SA 1GXSA 4D9JA 3O4IA 1H2XA 1YSCA 3E0XA 1W6RA 2QOEA 3VJLA 4U2DA 2WHPA 1ZD3A 7YASA 1DWOA 1XZIA 3V1MA 2VQ6A 4B0PA 5K3DA 4BDSA 3DKKA 3AILA 2RONA 5ALLA 1FFEA 1ISPA 3U1TA 4W63A 4J7AA 4X85A 2WUGA 3KWJA 1LBSA 2WJ3A 3AIKA 3ZPXA 3D5EA 4MEBA 4WDRA 4B7ZA 1C7IA 1VJ5A 5D3ZA 4H18A 3BWXA 2WHQA 1QFMA 2GZRA 4IO0A 3ZLUA 3H0CA 2PM8A 3DYVA 3WA7A 4UFPA 3I2GA 3W2TA 1E66A 5AK3A 5AO9A 3KSRA 1HPLA 3O4JA 4L9AA 4ARBA 1MT3A 4BATA 3FAKA 3EQ9A 2JEZA 4BRZA 1VZ2A 3Q0TA 1UXOA 5EIAA 1XQWA 4X95A 1VOTA 4ZREA 5AICA 4FMPA 5BWBA 4LYEA 2VATA 3F97A 1K4YA 5DTIA 2XUQA 2IIVA 5LYYA 2H1IA 4K6HA 3WKAA 1N1MA 5JADA 4KAJA 4S0XA 1XLUA 1FFBA 1LPPA 3IUNA 5I8PA 5FLKA 5FKJA 4YX9A 3X3HA 1EHYA 1BCRA 1LNSA 1DQYA 1XQXA 1UKAA 1QOZA 2HRQA 2ONCA 1THTA 2JGFA 4G4GA 1W52X 3IUJA 4OU4A 3D2BA 4MYSA 1LPMA 3M81A 1UT6A 3G0CA 4B9AA 1M33A 2WJ6A 3DDUA 1O6GA 1TCBA 1R50A 2DR0A 4L0CA 5CXUA 1DWQA 4BTVA 2DSNA 4V2IA 3I28A 3ZLVA 4M0MA 3HJUA 4JYPA 2FX5A 4L3WA 3IUQA 3O4GA 2QM0A 5IVHA 1AX9A 2WFLB 2HA7A 3GELA 2XMRA 4KRXA 4Q34A 2QJWA 2G4LA 2C4HA 5IKXA 2O2IA 4C4XA 1T2NA 1ACLA 5I7UA 3G0IA 1JMKC 4FLMA 2ACEA 1EVQA 3DL7A 3CN7A 4F60A 1D07A 2ZJ6A 3QMWA 1F0PA 2QR5A 2ECFA 5FPPA 5EI5A 1VZ3A 4Y2TA 2WHPB 1PV1A 1TKRA 4BC0A 3AJAA 3OG9A 1QONA 4DNOA 2Z8XA 3ZI7A 3DS8A 3O9MA 1GQRA 3FNBA 1H22A 4H77A 1W75A 4J0HA 1DU4A 2HHAA 3EBLA 4MQLA 4BVKA 2OGTA 2DHEA 1L7RA 3QITA 1K63A 2EDCA 1T4MA 3DL4A 3IIIA 3AIMA 5DNVA 5EHQA 2C0PA 4G9EA 1UK7A 1UFOA 4K2AA 4DIUA 2WU3A 2J3DA 2YASA 5LZ5A 3F96A 2WKWA 4UHFA 5F4ZA 3GFFA 1BEZA 2OG1A 1OXMA 3R3XA 1X70A 1R9NA 3HC7A 2C58A 4KAFA 3VDXA 1YAJA 1XZCA 2X5XA 5K3CA 4G4JA 3V1NA 3WA6A 5JARA 1UWCA 3FVRA 3DJYA 4HZGA 2DHDA 5KBYA 3GROA 4IQ4A 3EIOA 1JJBA 2PL5A 2GBGA 3STUA 3AZPA 4P92A 1JU4A 1Y7HA 1ZI8A 3D3NA 3PF8A 3WYNA 4Y2JA 5C8VA 3D2AA 2QKYA 4E46A 1CUWA 2XMBA 3TGLA 3VJKA 3IBTA 1PJAA 4X6YA 4G8CA 2IX9A 2Y6UA 5JAUA 1ETHA 1FFAA 2B4KA 2PSJA 5AI0A 4B6GA 5CURA 5IVIA 3S8YA 4KRYA 4BZWA 3QMVA 2AXEA 4OYLA 5E2IA 4EY7A 1ORWA 1TQHA 4PO3X 4TPKA 1UZAA 1MJ5A 3STWA 2ZYRA 2HA0A 5HF5A 3VISA 2D5LA 3WLAA 4B9EA 1HBJA 3R3YA 2ES4A 3MUNA 3FLEA 3W9UA 4OB7A 1R88A 2VJDA 5AI8A 2G5TA 4NMWA 5LZ4A 1JJIA 3A2MA 4J0JA 4BAGA 5ESRA 3C70A 2ROQA 3ILSA 1CQZA 4LHEA 4UPDA 4FKBA 5JZSA 4BVJA 1CUEA 4B83A 3H2IA 1A88A 2O2HA 4MEAA 1MO2A 1GQSA 2BUBA 2XQIA 4UHBA 3R3VA 1CPYA 5HF9A 5FXMA 3W04A 2CJPA 5AI6A 4AMZA 3VXKA 2ZYHA 4NS4A 1P0QA 1XQVA 1XROA 1MNQA 2Z8ZA 4QEKA 4RPCA
chains in the Genus database with same CATH superfamily
1OU4A 5CDGA 1ZUWA 4XARA 1ISFA 2HSWA 3DYBA 3IGFA 3CRNA 1YFZA 3PGLA 4IXDA 5AM5A 5C34B 3ZU6A 5CD9A 5IZ4A 3NS7A 3DDCA 4JUCA 2VUHB 4E5PA 4EG1A 4DLRA 2ZXEA 3ZHUA 2BH9A 4ZVPA 5E4JA 1T5DX 3A1TA 3CO0S 1AZLA 4LGVA 1KMHA 4LJ9A 4RJJA 4NENB 1X86B 3U3MA 3DJFA 1U0FA 4HWKA 1WABA 1L5WA 5F5LA 4ZMSA 5JAPA 1TM1E 1U2QA 2GQ0A 3NRCA 1VFPA 1MABA 5FHRA 4D5GA 2QRZA 4X44A 4YCDA 1RC1A 3H86A 4ZOBA 3I9JA 4K81B 2JEOA 1NW7A 1YC5A 4WA8A 4AY3A 1N6HA 1X1EA 3UG7A 3PYLA 5AW2A 5IVKA 4UUOA 1H9CA 1XOIA 2YBDA 1TD1A 2XAAA 4PNEA 1SKMA 4I19A 3C4QA 2ERCA 4NQZA 4YJHA 1PJ8A 2CVZA 2HK8A 3F5MA 4RH3A 3TNDA 3VMMA 3VOBA 3DKRA 1QYWA 3NG1A 4BTLA 4MUYA 4DUYB 1HYQA 1JSZA 1T9CA 4Q5IA 4R9VA 4W8GA 1QO9A 4WXEA 4J2HA 2AKYA 4DCJA 1AVTA 1ZUNB 2FQYA 3N8IA 4KSYA 4MW0A 2Z1MA 4OA8A 4RA9A 4RXTA 3O3CA 5GVSA 3PP8A 1WXQA 5AP9A 5LP6B 4KJXA 4F2WA 1S8AA 4MKXA 3W2EA 1ODTC 1FE8A 4G0QA 1BDIA 4YBRA 1E2DA 3ZCUA 2H48A 1UFQA 2BEWB 3B3JA 4YN3A 2FZLA 3HBMA 1XMXA 1G8YA 3E9DA 5CAEB 5J2TB 3O2NA 1N75A 1RKVA 2GBPA 3AM5A 3EGDA 3L0DA 4M53A 3DO6A 4PANA 4XEHA 3LE8A 3GG9A 1AHIA 3IUYA 1YHZA 3D6FA 4EO7A 4O4JF 1HTBA 2OMKA 4Z4FA 2B7LA 1PZEA 4EITA 4ZVNA 4OXXA 3TSCA 2O2XA 4PC2A 1MQ9A 4FCCA 4I50F 4CM7A 1L7QA 3GFSA 3OQMA 4ZVSA 5A4DA 3U4QA 4MUHA 2PPLA 3T3GA 5DBOA 1E62A 5KKAA 3TAUA 1TKAA 2ZBDA 4FEYA 3BORA 3DVRX 4V0KA 3CRQA 4LHYA 1RRMA 1AKNA 1K2VN 1P4HA 4EJSB 1NUTA 2NSLA 5EJ8A 3I6MA 3DQQA 2IZ7A 3GNQA 2C7OA 4P58A 1N2IA 3WSWA 3OBIA 3MJHA 2ZSFA 1TGYA 1HOTA 3LCMA 1AKVA 2H7YA 3F0TA 5J4LA 3QNUA 1VPVA 2OB1A 1T2CA 2EARA 4RD2A 2DH6A 4I4CA 3UYKA 3VX4A 4E15A 2E82A 1GCIA 2VJAA 3I23A 4MYCA 3SBOA 4CEIA 2RHDA 5FBHA 4C03A 1YOBA 1DQNA 2A94A 5HIKA 4DUZB 1ZYUA 2FZ5A 2PU7A 3PVZA 2GCEA 1DJNA 1G3IA 1C9KA 1N5DA 1FP2A 1H42A 2FRDA 2XMCA 2ZJ7A 3OPQA 4FDUA 4EATA 3F46A 3ZV7A 1Z25A 2BMFA 2VH1A 4LV6A 4PX9A 4Z4QA 2IS6A 3ZC3A 5F3RA 3ZGOA 1L5GB 1Z7YA 3ZHCA 4JQYA 2O3UA 1BQEA 1AO3A 1L6IA 3LX5A 2BFOA 2VSFA 3AP2A 3LA8A 4OP3A 1E7YA 4WK6A 1AUPA 4QUHA 2H18A 1GL6A 3JZAA 3CNBA 2J7KA 2G83A 3MBOA 1H66A 3UJ8A 2JFUA 4GS5A 3PYXA 5JPIA 3GJ5A 1N34B 4OLJA 1J9ZA 4ND4A 1P80A 2OK7A 3PC2A 3D5QA 4J8PA 3SS8A 5AK6A 1Z62A 2WKPA 3KEFA 4AUNA 1VPEA 1JNYA 2YV3A 1R3UA 2A7XA 2IH2A 1FIUA 3DF7A 1AUOA 4R2MA 3M6MD 1P9LA 2Q3JA 2YL2A 4LUCA 1X9HA 3VU9B 1O0BA 1FZTA 2P9ZA 2QTLA 2GVDC 2ONYA 4NULA 4M0UA 3OX4A 1W1IA 2W43A 4FYIA 4HH0A 4XPZA 2X1MA 1MR3F 4QBHA 3ZE8A 4HOYA 3B2NA 3GBSA 5IAAA 4R9NA 1Y3IA 1X38A 1SC9A 2NT4A 2NU6A 1HDEA 2QRQA 1ECBA 3A10A 3L8EA 4WNIA 4DLTA 5K03A 1V6CA 4DSOA 4CQJA 1L7VC 1XLTC 3FZQA 2OLJA 4I5GA 3IVAA 1YB7A 3F6PA 3KZNA 4PO8A 4OXQA 4I0WB 3THSA 1EXMA 1M6NA 1T10A 1OASA 1PZFA 1CIVA 1OQAA 4QYMA 5IULC 4RTMA 2HOQA 2OM6A 3BF7A 1BRTA 3DEYX 4HY3A 2BEJA 5CDYA 4OLAA 1TZCA 1L5MA 4YJ2A 5E0KB 5TB5A 1IUNA 4UTVA 2W2OA 5HXAA 4G09A 1KIFA 2RGWA 3HRHA 4P7GA 4Y2RA 5JXJA 1O77A 4MUAA 4H6VA 1A8PA 2X8AA 1SIBE 2H9IA 4URWR 1SD5A 1E5QA 1XTKA 2FN9A 2IUFA 3JQDA 4ALNA 2HSGA 3CB2A 1QG4A 1Z15A 2FN4A 2BMJA 2V4MA 2CMFA 4QASA 3J81k 1U8CB 5FT9A 3E9ZA 3QXSA 2FWJA 3VHXB 3P97A 5EWJB 3RQIA 4FX2A 4LJ5A 3W79A 1UP4A 2IU3A 4WASA 1MZPA 1EX9A 3K2BA 4M7OA 4CT4B 4Z4GA 1W94A 4QX6A 4F0JA 2QD3A 3OZCA 4CL2A 1P1HA 2OD9A 2EP8A 3HY3A 1UBFA 1PUXA 3INNA 4KNWA 4KXYA 4QECA 3CZRA 1TC1A 2OV8A 3TZQA 5E3HA 3K6RA 4HNVA 4YASA 3RWMB 1OPRA 2ONZA 4HNAB 4IAOA 1BVHA 1VSTA 1JJ7A 3NAGA 3AEUB 5LYJA 2B37A 4O3FA 3VO8A 2OE2A 4PN7A 3ST7A 4E7OA 1MA3A 1J42A 1GFIA 4QYSA 3HUUA 1Z35A 1W7AA 2JIMA 3IEXA 2OORC 3VR0A 4BMSA 3N5CA 3D8BA 2M6RA 4PRYA 3S1LA 4NZ9A 5DVZA 4HF7A 1J0XO 1M2WA 3ZE1B 3NBYC 3PXCX 5DB4A 4ARZB 5ECYA 2WIGA 3C3BA 3FF1A 3ENZA 1N8SA 4P22A 1RP1A 1GGFA 4GKAA 1YZLA 5MGNA 2JIZA 4PE5B 1L5KA 4A5SA 3TQHA 4ECEA 4WK2B 3WLRA 3EQ7A 4ZJUA 2J41A 2BDTA 2YXDA 3LC7O 2OAP1 3OM0A 1Z56C 4DQKA 4TXLA 3U3XA 2W6NA 2P2CA 1C41A 4DMKA 2ACWA 4WY8A 1A4UA 5F76A 3OWXA 2IYNA 3BWVA 3G2QA 1EJ6A 3BM5A 3HU2A 4JJ8A 3MJFA 2Q1TA 4K87A 3RTGA 2I2BA 3LW8A 2DHQA 4QQKA 2WU0A 3I42A 1ZOPA 1J0AA 2KWIA 4TOIA 3OEEA 4C0QC 2FXVA 4LYGA 2OFFA 2PV0A 1KJ8A 3VGJA 3WO1A 2I6SA 4GPD1 5IDQA 5IBCA 2XD4A 1N2HA 3BE8A 3OPXA 1NI4B 3RUFA 2BCEA 3MB8A 4QULA 3VAYA 4BGVA 1AKMA 3EIQA 4MO2A 3UJ6A 3R3HA 3PUJA 5TF4A 2ZYVX 4CG2A 5TE9A 4AMYA 1ZG3A 1YS1X 3QVKA 4TKUB 4UU1A 3VZRA 1BH6A 4LHVA 3NUZA 3AR2A 2XUDA 4C0AC 1HNZB 1U2DC 1EFPB 1KI4A 2QLFA 3O90A 3IS3A 4DDTA 4DA0A 5I4BA 5E7MA 1XZLA 2FLWA 4MARA 2FR0A 1K9VF 3BL8A 4YJHB 3IPLA 4NEQA 5HMLA 3FIUA 1EVEA 1W5AA 4EHBA 1BS1A 4NL4H 3WK9A 4C4YA 1XXLA 5CCXA 2OBXA 5JWHA 1Z5WA 5EJIA 2AUNA 3EXHA 1E6MA 5HIMA 4AKTA 1TM7E 3NIWA 4LYFA 1ZLYA 3WOVA 4H7IA 4TV8F 4B80A 3TUIC 5IXYA 3TD2A 3RRNA 3VZBA 1UBJS 3JQPA 4LDZA 3ZI4A 3TLAA 3ERCA 3HEAA 5DLPA 1KEPA 1AHPA 2F9MA 1E3SA 3W7AA 2OCDA 2E18A 3CH6A 4JBHA 3IP1A 4YBZA 5BXYA 4RA6B 3QX9A 2AN3A 1WZEA 3G9ZA 3GCZA 2B4TO 3LXXA 3TI7A 1BTOA 2EKDA 5FJJA 3ROMA 3F71A 1D1QA 1B0AA 4MKHA 1G9SA 1G7SA 1SBNE 3ZDRA 4CODB 5HQ3B 1VKOA 3SIWA 1U1DA 4PO1A 1X80A 2FB9A 1EGHA 4N18A 1SCQA 2C5AA 1J06A 1U5CA 1VE6A 1D2NA 1WUIS 3A14A 1ZMXA 3PG5A 1OX4B 3JWIA 2VHXA 4JZKA 3KOUA 4KQHA 4RVGA 1EDDA 3HPQA 1E4OA 4J1QA 5CT6A 5AKKA 1LK5A 4HGYA 3EMDA 5JZOA 3OEHA 1JKJB 5GGXA 3WIBA 5LR6A 3EGEA 3UJCA 1H6DA 4Z3OA 3WL7A 2QGNA 3D4IA 1KWKA 4HDKA 5TMEA 1F0KA 2VTKA 4PGHA 1KBOA 3T7CA 3O1HB 5SY9A 3PPWA 3T9FA 3T1OA 4D4KA 3DZIA 1KZYC 2WHRA 4MXDA 1P7CA 3ASVA 3MBIA 3T7IA 4LZAA 3X2FA 1FTGA 2MTBA 3Q11A 3PKJA 2GPAA 1WXHA 2UYYA 4C22A 4CTJA 1ZGCA 3X1JA 4F96A 1F8FA 4FX5A 2A33A 3G8BA 4K6OA 4NVRA 3KZVA 2DQZA 4MTLA 5COAA 1GA6A 1R6DA 5FUMA 2HA3A 2ESRA 1ADJA 2G8NA 5CEJA 3ZQ4A 4JP3A 4EVRA 2ZBQA 3QVGA 2JB9A 1AC5A 3OKAA 3ZBTA 4GIBA 4AI6A 2FSUA 4W1PA 3G1WA 4ZEOA 4Z49A 2P79A 2WFAA 5SYNA 3KUXA 2H1SA 1JVNA 3D7RA 4YQEA 1SNYA 3KYJB 4PLPA 3T5DA 1COWA 4B2PA 2WSYB 5ER9A 4H1VA 2P7IA 3ABQB 3IOBA 1VJTA 3D6UA 3ZWAA 4HQ0A 1JX6A 1SWWA 1UT8A 4OAPA 3UT5B 4QSHA 3AKZA 2QGZA 3BSFA 2SCUB 2A9KA 4YROA 4ITUA 2PK3A 2WVHA 4QFMA 2IHBA 1ZH0A 2X4GA 2OXTA 4OHBA 2VDNB 4ZEVA 3LP5A 1QZ3A 2VF2A 2FMIA 3QWFA 4ME6A 4TRRA 5AJWA 1KOLA 4GKKB 2IYSA 3WP0A 2OV4A 2WABA 5CDSA 2FPIB 1PWEA 1DLJA 2XWPA 4M1QA 1NURA 2LV8A 3B6MA 3TW8B 1KJYA 1MAWA 1R18A 2AG5A 4W5JA 1YCDA 3IE2A 4ZI7A 4ZVTA 2VAMA 3AM4A 1L4NA 4WZAB 3U7FB 3PGKA 4JUIA 3PHHA 2NNLD 2R00C 3KYCB 4GOLD 1CF9A 3H17A 4DSTA 4DNQA 2Q4RA 3K1ZA 3N39C 4GP6A 1PFVA 2DB3A 3HHPA 4EX7A 3U3DA 1T4BA 1XEXB 2RGCA 3QVLA 1WEHA 1GO2A 4MQFA 3CLSC 4DCNA 4RADA 5SV2A 1OXTA 3CW2A 3NBZC 1CQJA 4KWHA 1JI3A 5BQXA 5DNYB 1PT6A 4I50B 3K4PA 1KC1A 2WMYA 1EFHA 2R11A 2F00A 3ESRA 3CINA 3PHGA 1RTTA 4P34A 4BKPA 2PLNA 5E38A 5H4GA 1T24A 4TLEA 4TKMA 3CF2A 1DTWB 3QOFA 2ONJA 5DSZA 2Y1WA 1Z5UA 1AU9A 4AWAA 3IERA 3CVWA 3HCCA 3UTCA 3ONEA 4HUQA 1GPUA 2LDXA 2JGJA 5EJ4A 1XDUA 4N40A 4NWIA 1B8NA 2VS1A 2HWYA 5J4HA 1BGXT 1ZITA 5LP6F 1U3FA 2FY8A 5EEGA 1DIAA 2JD2A 4G5SA 5LFAA 4TRMA 4FZVA 2ORED 2QLLA 4UHKA 1NJ6A 4BKQA 5B2EA 1PAUA 2ZUBA 5CYOA 3H19A 3KTFA 4PEVA 1SZPA 4YFYA 5JWRA 3ELUA 5BSFA 5KTTA 4YWJA 4PWYA 3U62A 3G7NA 2J3MA 4BNYA 3WJAA 4V2UA 4Z8XA 1NKVA 2GLTA 2RHJA 4HLCA 3TNYA 2GZSA 3DMPA 1XZGA 3QA3E 1DKRA 1GAEO 2B35A 1V5IA 1ZD1A 3ESBA 1EDZA 3JQRA 4YO7A 3ZI0A 4ALLA 5C8YF 3KDAA 3ZU5A 4R1TA 2C0QA 3JARB 1KO8A 2WD9A 1L7AA 3IBYA 3UAVA 3QYAA 3C5EA 1CNEA 1V6SA 2QL7A 3I1YA 3TIIA 3ZN2A 3EWIA 2N3ZA 1T8SA 2B94A 5CK4A 1E9FA 2Q3HA 2J5BA 1GSIA 1LLCA 3TZKA 1KJNA 3KPWA 4CKCA 2BRUA 2W8BB 3EYWA 3M9WA 3N8GA 4INPA 3TPFA 1M0TA 2I34A 1JIJA 4G5OA 4WXMA 2CUZA 2O8EA 4E03A 3OURA 1IE3A 2AQ8A 1JLLB 4IIDA 5J1TB 1OSNA 4DIOA 2QTMA 4DR6B 5DYTA 2PH7A 4DV6B 2V4UA 4MICA 5ENVA 4XUEA 5LQNA 3AR5A 4DZZA 1YBAA 1ACJA 1QG6A 4GD3Q 4C89A 4B8YA 1NONA 1ABBA 2CL6X 3PXXA 4FFNA 5LBTA 4FMCB 4A0QA 3D4BA 4FJ2A 3UEOA 4F3CA 4N6GA 4IQ8A 1YFLA 2DVMA 5IF9A 5KNBA 1WS6A 1YL5A 4DLYA 4OMFG 3X1MA 1XWFA 4XGRA 1K4MA 2GNAA 3TLGB 5FWYA 3R0IA 4CMIB 1CQPA 4N7BA 3BGSA 1KYVA 1DIHA 4NBUA 4GR4A 2OFPA 4Q1CA 2BFNA 4LCJA 3MWEA 5BV1A 1IBRA 2BT4A 4NU0A 5EWMA 4BX2A 2NO4A 2X6RA 3Q15C 4XB2A 3LKBA 4AM8A 4BZXA 1WP9A 2BJWA 4KR6A 3ZDXB 4YCMA 3IEVA 4IXMA 2OCGA 4Z99A 4GEGA 2Z4RA 2GASA 1MHPA 2WTBA 2WTXA 3IE1A 1XEAA 4BASA 1D3AA 1KI6A 1UDRA 1XCLA 4GI1A 2D1RA 1S8NA 3NBFA 4RH0A 3ZKAA 2C9DA 3CE9A 5LMZA 1YRLA 2PR7A 2YVAA 1N6IA 1VMEA 1TJPB 3I01M 2PGJA 5BORA 5BUCA 5E6UB 4YUAA 2RKOA 4J16A 2M9MA 5FYDA 2PWZA 3GNLA 1PR2A 2WWRA 3V4SA 1LDYA 3JQ8A 3DUWA 1JQDA 2IDKA 3R6LA 4JT2A 1DG1G 4R0NA 4MPRA 3EFBA 1W2WB 1EB8A 1B73A 1K98A 1T9DA 4G0MA 3UMFA 2C2BA 2AZDA 2VDJA 4FYMA 1XVIA 3UMYA 2A58A 3C3AA 4XAQA 1JHPA 1K06A 5HK8A 1KZ4A 3IT3A 3B3FA 2PUGA 4V1CA 1X6VA 3ET5A 4P7BA 5K3BA 3SS9X 1P0MA 2F67A 3OIFA 1QP4A 4B31A 5H59A 3V4VB 2W6QA 5TSDA 1W48A 3Q41A 2GEKA 4F4IA 3EWNA 3RH0A 3O26A 5D3QA 1JFFB 1HNXB 3GEHA 5TPWA 1H3EA 4LYHA 5C8XA 2JJ2D 1KERA 1E7QA 2V7VA 1ECJA 2B61A 1SR8A 1I13A 2XTAA 3PHJA 2ZIWB 3H2YA 4V3BA 3TF5A 3VKFA 1JHYA 2QVYX 3R0ZA 3MWYW 5GONF 1MIHA 1M8KA 1T3SA 3RC7A 2GHTA 1Y4UA 4L2IB 3SI7A 3N0XA 5FL7A 1E3TA 2CKMA 2DUJA 1K5DA 3HN7A 1BNCA 4YAOA 2FJUA 2P11A 1SFRA 4Y9UA 1MX3A 3V46A 2P67A 3WKCA 5DGXA 3AQIA 3M4JA 1H2AS 2BFCA 2HJHA 1STOA 4MRAA 5G1NA 3ZDEA 1YDMA 1ZESA 4DTCA 4EFKA 2UUPA 1RJFA 3OOWA 1KYYA 2VT6A 4FS3A 5G40A 3UJ3X 3ZY4A 3D64A 2AH5A 2VYFA 1YQDA 1G7TA 1FU8A 2WSIA 3H4TA 3RSZA 3FZEA 4YRCA 1Z0DA 4COKA 2XE4A 4AL4A 1GNQA 1KGDA 1YRHA 2ZIUB 3AHCA 3MOIA 4DS3A 3DDHA 2CXHA 3ZHTA 4RNCA 1R5OA 1JUDA 1VKZA 2WF6A 4Q7QA 1QSGA 2DGDA 2Y4OA 3CLUD 2WYOA 1A8HA 1GUDA 2BBOA 1AQYA 2GRAA 4IOJA 3WFJA 1BYUA 1KI1A 1G5QA 3NTVA 1R8QA 3KQHA 2B9EA 5T6MA 3ROGA 5FH9A 5JROA 4PPGA 1UM9B 1SKYB 1HK7A 1A04A 1BCSB 1K7FB 3A1UA 3VPFA 1MC8A 2C54A 5A4IS 4KL8S 4BQIA 2PZEA 3OIWA 4N01A 4S12A 4HDNB 4I81A 3LT1A 1VYUA 2HI0A 1JKIA 3OP1A 5KYYA 3L46A 4RNDB 2NQ8A 4ENRA 3GLFA 4E11A 2BE9A 1XSEA 4ZD6A 4N65A 1BROA 2Q9AA 2NVUB 3ORSA 5IBQA 3M4ZA 1UOEA 2MSKA 4MQ6A 2GKSA 3OETA 3R6TA 2AG8A 1VPLA 1U1FA 2ZYGA 4PTYA 3VNBA 1IQRA 5SY6A 4E22A 2M1XA 3T7AA 2WKSA 1NBAA 2OAGA 2VTDA 2ZE7A 3K8ZA 2NACA 2YRWA 4R5MA 4ZV7A 2OYCA 3ICOA 4EPVA 1H0KA 5A0VA 5I7OA 1X3LA 4YMGA 2LIVA 4Q3KA 4LOJA 2BI4A 4P9NA 1J21A 1FUIA 2JGEA 3WS7A 1K08A 5KWVA 2JZNA 4LAFA 3ZK9A 4BIIA 3KKPA 1G3UA 3HJGA 3REFA 4JT4A 4OHPA 3HXOA 3FUVA 2EGHA 3MTAA 3TRDA 4ABTA 3ZLBA 1GTSA 4R8KA 2G9QA 5KTSA 4OXNA 2P7HA 4JGIA 3T15A 1Z0AA 4FYWA 1QF6A 3RBVA 4Z51A 2I87A 3DE1X 3FYDA 3VSDA 1YI0A 1KK0A 1BXGA 2H4HA 4ZOEA 3KQVA 3S8EA 3TPZA 3U3RA 3AETA 4DSZA 5IHXA 4O0MA 2ZU0C 4A2PA 1S01A 2BGJA 1R74A 3GLIB 3CF4A 4HWTA 4EI7A 5ALOA 4N03A 1JR3D 5F1YA 5K4HA 4W1RA 1GAQA 3CR7A 1H6BA 3W3AD 3F1KA 3QE3A 1KRHA 1U9ZA 3TUJC 2HK9A 2PN1A 1IH8A 3RC1A 3WL6A 1AKRA 3RARA 3R4VA 1QV9A 1ZSVA 4DR3B 1O96A 1P4SA 4U39A 3F98A 3MJ4A 1UMBA 5EIBC 1R5BA 1II8B 4ZYTA 5TMPA 1Q0UA 3OTOB 3A58B 2IY9A 5DFAA 1M3SA 4MZXA 4IRUB 3W5SA 4E94A 3HDVA 1ISJA 3BWMA 3HA2A 2VJNA 1FFHA 1OWPA 3JD4A 4HGQA 4DG8A 2G17A 4FHGA 1CY4A 1ORRA 2PSDA 3MWLA 5JNUA 3FPSA 4Q3DA 4DSAA 3QFHA 5BSUA 1KMHB 4GWLA 5JWOA 4JFAA 1P19A 3FMPB 5ALQA 3OUTA 4XUDA 4BE7B 5BR1A 4RVCA 2PGNA 1FDOA 1MDFA 6ABPA 1DC3A 4ZDKA 1CERA 4II7A 5TPZA 4BO6A 3L7DA 4PYNA 2DR2A 5A3JA 1K6MA 1U28C 4HI0E 2FZWA 2P9HA 3KOWA 1NN3A 4QTXA 3I2IA 5FADA 1BZYA 5HHTA 5FUWA 1NJ5A 5AW3A 3PNKA 4ETWA 2WWWA 2C9CA 2D0DA 2ZUVA 3DZGA 2P9BA 1M83A 2R6R1 3GRAA 1QNFA 1VM6A 1XNJA 2ECPA 2PZMA 3K0AA 4J03A 4XIIA 4OLBA 4EGCB 2APJA 4JYCA 3ZOZA 1SG0A 6YASA 4HNGA 4XQCA 4R2IA 3GPDG 5JS6A 1U8AA 1YI8A 5TR9A 3P4XA 3ANXA 4Y6RA 2CHGA 3UXYA 1X1RA 4NCAA 3ILHA 3KZCA 1Q11A 5G53C 3RU2A 4Q24A 1RC0A 2XHEA 3WDSA 3IJ5A 4HRAA 3LW7A 3I3OA 4E5SA 2J87A 4FC6A 4DNXA 5DNDA 2Q0XA 4Z9BA 4HH3C 3AVTA 1HC7A 4JENA 5BSTA 1FJXA 2NSHA 1QRTA 3KEMA 1EM6A 1G3QA 1UBNA 3M5CA 5GJVC 5AK0A 5EMNA 2Q3EA 4LXHA 1L8LA 4DC9A 5I8ZA 4CXMA 4RKEA 4XD2A 3K09A 2PVSA 5DM1A 3D7KA 4LSGA 3KKQA 1NV8A 2Q4OA 4Q03A 4QUGA 4PGAA 2H1FA 5AVRA 2IS1A 2C59A 4KPUA 2P1RA 1WHSB 2HIGA 2QG6A 4EW2A 2EHDA 1ONPA 4MGIR 3IAS1 3Q6NA 4YH1A 4HQFA 1PX0A 4EGQA 2R6GA 1Q1ZA 1ULBA 2F3UA 3MVEA 3K0CC 3OZSA 3S2ZA 3JZFA 2EYUA 5D3KA 5IMSA 2JBHA 1GZ7A 1DLIA 1W4BA 2Y0BA 2FOLA 4EMTA 3CYFA 1XYGA 1Z6TA 2CBGA 4Y6SA 621PA 3ITDA 1LY1A 2QENA 3MTGA 2K6GA 2V7TA 4AO7A 1W8IA 2O0LA 2OCLA 1SHKA 1E89A 1GKIA 4NYMR 4QFDA 5FI1B 1U6IA 3V1LA 3TB4A 5JNVA 1ZIDA 1IN5A 4H3VA 2Y77A 5FO1A 3UT6A 3VR5H 3E5RA 1CUBA 1TJYA 1CU1A 2RGBA 4HKTA 4NTZA 5ERGB 1VGVA 3ETDA 3BHNA 3TIXB 1C0EA 1JB1A 1XD2A 1PQPA 1A71A 1V9CA 1Q6YA 3LLCA 3E6AA 3F1LA 1L5HA 3RREA 2F1KA 3L0ZA 4C4ZA 4Y9RA 2O23A 1EXWA 2RGNA 1RLIA 1A72A 3COYA 4X90A 4CIAA 1DQPA 1U3TA 4DUGA 4ZVKA 1CEEA 1YGPA 3WLNA 5HJ5A 1ZISA 3PTLA 5FEMA 4BNDB 5BUQA 4QATA 5B7NA 1XUOA 2FZVA 4BNUA 4AZVA 4L76A 2C99A 2FCAA 3LCVB 2BKAA 2VT3A 2W48A 3IQZA 3MPUA 3TIGA 4D9FA 5AKEA 5E6RA 3PPXA 3PQ5A 5ICMA 3NOXA 1M1NA 2I29A 4NCIA 4F1WA 4EY3A 4QPCA 1L4YA 4RS3A 2NP6A 2CGEA 1YK1A 4HDMB 5CK5A 5EGSA 2VF5X 5GJBA 4MW4A 4Q47A 2AJLI 2VHVA 1XAIA 1TMKA 1EJ2A 2EGUA 3EDRA 3QK7A 1ZGGA 4OUDB 1RXIA 2HMSA 5A03A 1ZW1A 2CLIB 1JHZA 4QLAA 1OWLA 2XWJI 1NN1A 4N8DA 5FPQA 3RE1A 5DP2A 1SQ0A 2LUOA 1X1QA 3NTRA 4ZGWA 4G65A 4AZWA 2X4IA 4TMKA 2XF2A 3GAAA 1QBGA 2I2DA 4LX0A 4WKOA 4ZT3A 3SDBA 1GNSA 2FFBA 2BIFA 3EEIA 3BEDA 3EEQA 4AZSA 4J7UA 4IVQA 2FQXA 3FRJA 1PR4A 1RHQA 3A6EA 5TEVA 1RS0A 2PUBA 3J81A 4D44A 3CS3A 1D0SA 2O05A 4NH0A 3LGSA 3UB2A 2EHJA 3WGQA 3T1HB 1OLSA 2EZTA 3F49S 2HF8A 3WGNA 2PH5A 5EQJB 4BQNA 3OIYA 1DCMA 4EQ6B 4TTRA 2Z4SA 4AZTA 5EE3A 1UZNA 2XB6A 4F8JA 1RPAA 1X7GA 1N5OX 1JDBC 3Q5GA 3SHWA 3EZGA 1XKTA 1SO8A 1DGQA 5DASA 4HTFB 1H1DA 3AUTA 3NWJA 1WCYA 5DCYA 4RENA 5B2ZA 4C3VA 1JBQA 4M7RA 4PXYA 3QYFA 5CB4A 1FL9A 4BX8A 5ETJA 3ETNA 1D03A 4HG2A 1KFKB 2AMFA 1JEEA 3AHGA 2JGNA 2PU5A 4EYSA 2CKDA 1SZDA 3RUCA 4BQEA 5HGXA 5AVOA 4YMHA 3VGPA 4TTAA 2EU8A 3EC2A 5P8WA 4MDYA 1XK6A 4AZ0B 4PZEA 3AUSA 1ZRSA 2J4DA 2ZRPA 3RNOA 3ZWQA 2N46A 1AQUA 1LNQA 5JTUA 4CG0A 1NIPA 4NBTA 3U4MA 3OCYA 4Z2YA 1CY0A 5LQKA 1F2UB 5F35A 4EKNB 3V2GA 2Q2QA 1YZHA 1FPQA 2ZW9A 3VRHA 4XOUA 3SJBA 1Z22A 4G23A 1PL8A 3X1ZA 4N7MA 1KL7A 3DVQX 1NDHA 3E9YA 5T3YA 2DETA 1XZFA 1ZC4A 2XEXA 4NFYA 3RRYA 4H15A 1OFIA 4TLBA 4WECA 2OZEA 4LCBA 1FP7A 2PPVA 5HKAA 1Z17A 4HRXA 1FSSA 1XDSA 2GNOA 1J23A 2DYKA 3B7GA 3PRKE 5K01A 5K6TA 3QU9A 3UPTA 3Q3VA 4MZDA 4HAWA 1WDLA 4WCFB 3T38A 4CIBA 3DQPA 3KQPA 4KAXA 2OL4A 2OUIA 1MD9A 4O2LA 4RHCA 1PHPA 1O8CA 1OOEA 2Y1EA 2FF5A 4CZ2A 4DBLE 2D4AA 3GDOA 4MROA 3TAHA 4BNNA 1LDBA 1YR3A 1XEFA 2XI4A 3K15A 4JP1A 1C3OA 4TL9A 2H9AA 2VZ0A 5DSXA 3UCEA 4P7FA 3EZXA 3UZUA 4NOLA 3GQBA 2X2FA 2CCGA 3TLCA 5LSAA 4K8OA 4TSKA 1TGVA 4NMLA 5HZHA 3JD2A 2BN4A 5C0OE 2IPXA 2PA3A 3QIAA 3QEMA 4M98A 3LKZA 1V48A 4PG4A 2VPQA 3P71T 3HJTA 4HAZA 3B3GA 2X0EA 3RBAA 5D8DA 4ZYYA 1Z74A 4MW5A 1FRZA 2CLCX 4N76A 5B3JC 5BYKA 2YWJA 5E2AA 3PEYA 3BDVA 1HX7A 1AO0A 1LSSA 4P3NA 2AFVA 4H27A 2XXAA 3KWLA 3CKYA 2XUZA 2PGOA 3SYMA 1KI6B 3Q5DA 4DL9A 2F9LA 2DBQA 2QMOA 3HVUA 4HGZA 4MULA 4Y2XA 1SXJB 3RRZA 4IZ6A 5LKAA 2GEUA 4BXOA 4B3DA 1PJQA 2NXCA 2PTHA 2XJ4A 4OHXA 2D74A 1Z2OX 3LC2O 4W1QA 3TLEA 3DKIA 4G84A 5F7ZA 3ZGLA 3ZY3A 5K8TA 3TFWA 2VCYA 3G17A 4C76A 3FKQA 4UBJA 3BA1A 1SXIA 1NOKA 2C9ZA 2RH4A 1CDDA 2JCXA 4ND1A 1IUPA 1O9HA 3KR2A 4NK5A 2R6DA 2VP6A 1FX1A 2HMUA 2QGFA 4M7WA 3TXAA 2CEKA 3UMBA 3V7NA 1GCAA 4JS0A 3RFCA 1K1EA 5EOVA 3M70A 3H1FA 5ADWA 5EVJA 5BVGB 4ZT4A 3K32A 4Q9NA 3FHCB 3UK7A 4ROSA 3HO6A 2GEFA 4EAQA 1QK4A 5LOVA 3JD1A 3EWSA 1A9ZA 1BWSA 2GHRA 2PJDA 3LGXA 4KLRA 5C51B 2CXPA 4RK1A 1WZNA 4OHRA 1AV7A 4GC5A 4KSBA 4P4UA 4EJ0A 4U1RA 5SYAA 1SKQA 4ZCMA 3LBAA 2BHNA 2I76A 3PR3A 3IB3A 2G3YA 2XNCA 5FLYA 2QY6A 1BOOA 1GL3A 3CW8X 1VDZA 1OGIA 2HL6A 4LFAB 1CJVC 2PSHA 2Z57A 3A37A 4K6MA 1L7XA 1LFDB 4Z4HA 2JAOA 2KMLA 2W2MA 1IZ7A 3OOJA 4R9SA 4W7SA 5DWVA 4EYQA 1WG8A 1YKGA 3CF4G 1YF3A 1FFCA 1ICIA 1YB4A 1J07A 2VTEA 2ZUUA 3B6KA 4ND8A 4FBLA 1Y4SA 3RRXA 3AXTA 4CHTA 1Q2UA 4W9RA 3E05A 3PTZA 1JIKA 2JGDB 3CEAA 2AQHA 2VBFA 1YZTA 1ZY2A 3DOJA 4DDHA 3GUYA 1HNWB 2GM9A 3FWKA 4COOA 4DQDA 3IDSA 4QM6A 1DDIA 3JVIA 2B8NA 4Y1GA 1E2HA 3NTQA 4DEVA 4XYBA 1MOQA 3FSJX 2YUTA 2P2LA 3ZHYA 4U2BA 3A4MA 4R8VA 3AM3A 1GEGA 2D5BA 3LY9A 4F06A 2WWFA 1LA2A 1R8YA 2E7ZA 4MYTA 1XJWA 3LBNA 4UMVA 4HQNA 3K7EA 4R1UA 1HSZA 2NZJA 5I5EA 3Q8KA 1G16A 3UFXA 4CM1A 2GERA 3E03A 2QZ4A 4AQYB 1GZDA 1RJEA 2W37A 3DMGA 1FFXA 4DV1B 1T0HB 3V8RA 4J0KA 4F6RB 3L2OB 1ZD4A 4HDOB 5CA1F 1MEOA 2MSWA 4HLQB 3LBHA 4TKVA 4OA5A 3I32A 2O2YA 2DXIA 3FJYA 2EKQA 1LV7A 3E3LA 3HHEA 4G2TA 2HYIC 3PDWA 2Q4DA 4MS1A 3LBIA 4R1SA 2VA9A 4MLCA 1UJ5A 1N5MA 1AK9A 3UHOA 3E7FA 3CXRA 3E9NA 5LU9A 1WLSA 2R44A 4FW9A 3DCIA 3F6BX 3PI6A 4K46A 4X6UA 5TVGA 3ZZ0A 5MN5A 1FNBA 5LZ2A 3P0JA 3ON5A 5DMXA 3QENA 2BSXA 2VRNA 1WSDA 1B8VA 2NZUG 5KYTA 1GKLA 2JH3A 2BH2A 3ESDA 1AZWA 2ZQZA 4FGLA 3C74A 4I46A 2GSWA 4ZI2A 1DO8A 4PSDA 2FOXA 1P3DA 1UADA 2BGUA 2V7WA 1KMNA 1Q77A 2F9FA 2R5WA 2YNMC 3H2HA 4MK4A 4C87A 2QR2A 4YAWA 4UDNA 4HVAA 1O94D 2WIAA 2Y68A 3JTEA 3KZKA 4TWAA 2XPCA 4BY9E 4ILEA 1PE0A 1QORA 3E7PA 3IUEA 3QQPA 4PFJA 4TTTS 3VMFA 2G88A 2HXYA 3DLCA 3DFIA 1UBUS 2DWCA 2HJSA 1ES9A 4CKZA 3Q9SA 4C7KA 3VKHA 1NX9A 3AFIA 1E4VA 2PJZA 3G5LA 3H4IA 4G6ZA 4DLPA 1Q44A 5F9MA 3H7IA 1EUCA 1IOZA 3K8YA 4MS4B 3CNEA 3TCXB 5KYWA 3TQFA 1YUBA 2FH5B 2XT0A 5CJ2A 4KXXA 1DRKA 3QV1A 1NN5A 4Z1MD 3F8SA 1COZA 4M8NE 2JJ1D 3DE3X 3PNMA 4MW6A 1DV1A 2FEAA 4KCGA 4L0MA 5JISA 1RAGA 1B3RA 1C1DB 2F3TA 2Y2UA 5IH3A 2D1FA 5G3ZA 5K3AA 3AVXA 1AH2A 4C6RA 4F38A 3JY6A 1DKPA 2RHCA 3WLKX 1SUEA 2J3LA 3D8TA 1GPDG 3HJAA 3P2JA 2EIHA 2W0SA 3Q0EA 2X5JO 4HHEA 4BRWA 5EJFA 1MX9A 4AJNA 3R76A 1SBTA 1JHOA 4PS0A 1VPWA 3K6KA 3ZWPA 4QPNA 1S2IA 2CUNA 3VTKA 2TMDA 2A30A 4F8EA 3NX4A 1VKJA 3MFQA 1HLFA 3QPUA 4D99A 2R6ZA 3IALA 4U7PB 3TKYA 5M2QA 4LQDA 3KXDA 2OGUA 1CJSA 2A9JA 1T2DA 1HQYE 2QP9X 3OLVA 4RVOA 3BXZA 2NZXA 4P80A 3X1XA 2C8JA 3AUUA 1AQLA 3WOHA 1WPXA 4EG3A 3IOCA 3I5AA 4EY6A 1SXJE 4H3KB 1IJFA 1NVUQ 1PDOA 1TYEB 2DULA 3AHHA 4OGKA 2QI9F 4ZQGA 3WTCA 4EI9A 3V5NA 1J8YF 3VPAA 4NXMB 3MS2A 2WPNA 4BUZA 4BYGA 1YR2A 3KL2A 4BAUA 3PGA1 1KEWA 1NXOA 4CYMA 1RWKA 2V54A 2G1KA 5HR5A 3VJMA 3PD0A 3N28A 4MA5A 1W581 1QZZA 5JD6A 4KIJA 4K5QA 4YJGB 3O2JA 3WGUA 5AM2A 2WMDA 3VAAA 2PRSA 4LJ7A 4INOA 3RU3A 1N57A 4X65B 3HZRA 4RJLA 4XFKA 4HX9A 3U2QA 3NWPA 3ONNA 2R62A 4MWZA 3B9QA 4NPHA 4ZOLA 1HV8A 2EWMA 4KWIA 2IYRA 5AOCA 5EMJA 2FJPA 2WE8A 4DQVA 1IIRA 1BJRE 2FSFA 3B1ZA 4EG8A 1KZ9A 2QM3A 2XE8A 4FINA 5BOVA 4JHXA 1YQUA 1YJXA 4M9RA 1KJJA 1NY6A 2VYVA 1AXRA 4MVJA 13PKA 1IBKB 4YLYA 3QZUA 1C2YA 1X0VA 1WD7A 1OWNA 1TA9A 3GLGA 2ZJ1A 3EA5A 1NFQA 3H8JA 3V8BA 4LY3A 3F7MA 2XUKA 4M86A 4WLUA 2ZU6A 1Y7LA 3LLUA 1XPUA 1UDXA 2CDBA 2PO5A 3HP7A 1GCGA 1YR6A 1S9HA 2X9VA 1B41A 1XQYA 1NKSA 2HO4A 3CR3C 4KR0A 1CF2O 5K0TA 4G1CA 1NJGA 2ZATA 3MM4A 2IL1A 2JCYA 4I1RA 5DW3A 3TS1A 4A7PA 3AMVA 1IRXA 4Q1BA 4U7HA 1T15A 1E77A 4TL8A 3TZHA 1I1OA 3EIEA 4Y18A 3SN6A 1BXZA 1J56A 4KVGA 4OFBA 5TX7A 2VP9A 1RLJA 1Q3TA 2FPGA 3ACBA 3RF6A 3TRKA 4FU0A 3BX1A 2J0UB 1RZRA 1C9EA 4DLWA 3Q6MA 1ZRHA 1DG3A 4JDPA 5C4GB 1ULZA 2BZGA 1L4MA 1QH1B 2QD5A 2QRVB 3CLKA 5BW5A 1ULUA 1Y1RA 2RI0A 4IVPA 4J1TA 3SJ7A 4JVNA 5FNVB 4HQ6A 4LGMA 4M9CA 4YAJA 5IEBA 1DINA 4Q0MA 4HDCA 5B1YA 4PAGA 5L51A 4LPSA 4PBSA 4HFMA 1GOTA 3U09A 3QKSA 3Q6IA 5KPJA 1U7WA 3NJ4A 1E9AA 1SAYA 2C2XA 2X58A 3TEMA 1RQNA 4YJFB 4XH9B 4UVIA 5EIOA 1I94B 2KE5A 3UMGA 2QIPA 5EJGA 4MDEA 3FIJA 1KQOA 3SJZA 3FLBA 1DELA 4CG1A 4NPAA 1VE3A 2WHYA 3H3JA 3LQ2A 3PKIA 3ZH9B 4QXQA 4RDCA 5B1HA 1IB0A 1E2NA 2W00A 3EDCA 2FUCA 3JQGA 5AIAA 1EGAA 3IXLA 4M54A 1BO6A 1BCSA 4ZYLA 2QSUA 2PHZA 4X00A 2BFMA 3GAFA 1OD6A 2V5AA 1QIIA 1MZVA 3ZDDA 2DLDA 2O7VA 5IM4A 3A0UA 1HYHA 3MHPA 1ABEA 4K3UA 3EEYA 2A3RA 5LA6A 4QOJA 2JD0A 3QBJA 4ZCIA 2A5LA 3DV0B 5FL3A 3RYCB 5B57C 4TN1A 2XYGA 4GLBA 3W90A 2FPMA 3G7SA 2HJVA 3HWSA 4CTNA 1NASA 1YCGA 1Y5LA 1OAKA 2LKCA 4XQ0A 2B1QA 4Q7KA 4RZIA 1VJ0A 2JF0A 5H70A 4F9EA 5JZ9A 3H9CA 5ALHA 1Q2XA 1EA5A 3ZD8A 4F3RA 1UJBA 1XTTA 1CUAA 2VDWA 2MDTA 4ZHQB 5C35A 1RMQA 4LF9B 4E08A 4KU4A 3FCOA 4MJ7A 5CLGA 3VR5A 3KQSA 3N2GB 1S3FA 5ALKA 4O3MA 1VMDA 1E79A 2GAIA 1XRJA 4JKOA 3RODA 2O2ZA 3C87A 4K9LA 2I8LA 2IOYA 1ABFA 2CB9A 3PQ6A 4PV7A 4CW7A 4KHPB 2W6MA 1XKLA 2Q2OA 1COWD 2VG8A 3FVTA 2FR1A 5DTQA 3O91A 4ZFNA 3QE4A 4I4IA 3NDPA 3PQCA 1BMQA 2XX3A 5LB2A 5I5GA 4KPYA 3EVTA 4KRGA 3W8NA 4CM9D 3SICE 2NGRA 4QOHA 1UR5A 3T9AA 1I0ZA 5JSZA 2DLNA 4UTOA 3E22B 3MBKA 3UAOA 4QDZA 2R2AA 3SX0A 1XQ1A 1V16B 4ALMA 3JYPA 4IG9A 1NPDA 1P17A 3WB1A 1U3WA 3IPCA 4KGDA 3GL9A 4AFNA 1ADGA 1S4QA 4DRXB 4WBNB 5I4CA 1MNAA 3U16A 1Z13A 2FZKA 3DMNA 3SEAA 4AP5A 4YCSA 1EWTA 1FDTA 4FZJA 1CY6A 1TQDA 2NPIA 3U7GA 4AMBA 2H0AA 3I9NA 4OG2A 2OC9A 4UJ3A 4OL0A 1CYDA 3D1JA 4QDXA 2JBWA 3M6UA 1EM8A 3M2TA 3M6AA 4R9UC 1YD7A 4DYVA 3CLUC 1HG1A 3QLVC 2AE1A 6AT1A 1T1RA 1ZM9A 3HDHA 4L7VA 4P32A 3V8VA 3ZTYA 1VKRA 3RV4A 2R8OA 4O1MA 1WW3A 3H1GA 4A82A 4UE6A 4BS9A 1PDWA 1TUIA 4E3ZA 1J70A 5BW8A 5EHXA 1KRWA 4TTIA 3ZS9A 3RS4A 2XCQA 1EK0A 3IH5A 4DXDA 4RQBA 3G68A 4N0QA 1YVEI 4KPFC 1J39A 3GI1A 1CSEE 1PZMA 3UOWA 1C4OA 1AGYA 2Z08A 3CVJA 4WKCA 2BR5A 1ML3A 3EDQA 1U3GA 5JD5A 1Z0UA 1N3IA 2AFHE 2J32A 3AJ8A 4R7TA 3CRZA 1CY2A 1KXJA 3EAQA 3EY9A 3HKBA 1U1CA 4B6OA 3JWGA 1PBTA 3KAJA 1JRLA 2ZRQA 4EI8A 4EHJA 5JAIA 2O07A 4MV8A 1E6KA 1I8TA 2DTEA 2EZ8A 2JIBA 3SEFA 4MUJA 1IUOA 5KHAA 1VXOA 4YRZA 2FWRA 1GQFA 1A2KC 1QGED 1NM5A 4HYTA 2WSSA 4HEQA 1D5CA 1QH1A 1T29A 3HA7A 4KO4S 3KXPA 2BZ1A 3RHSA 3MERA 1FXSA 4BFLA 4CMAA 1W30A 1JEAA 2J3KA 3GUUA 4L1KA 2AK3A 4NECA 4EECA 1DKQA 2PZFA 2YN4A 1TZ2A 2Q49A 1JYEA 3ONDA 4R1NA 2ODWA 3IRVA 3QRWA 3WBBA 2KS6A 4CMIA 5KTYA 5FWYB 2CK3A 1UMDB 2H16A 1BDJA 1LJ8A 2XCIA 3UMRA 2AJBA 3I58A 4IDBA 2XTNA 3BOSA 1VRVA 4L95C 4Q9HA 3RUIA 3WGZA 1NGSA 4IGKA 4X71A 4CBVA 2K87A 1IEWA 1RZUA 2YCLA 2VSXA 3OFNA 1UOPA 3RC2A 4K26A 4PPQA 1T26A 5D3MB 3FDFA 4GVXA 3WWYA 3X43A 4L8VA 4EMSA 5IFKA 5EIEA 5BSGA 2BEWA 3CCBA 3DG9A 4K9PA 3OT4A 1YT5A 1V11B 3DA8A 4K40A 4Y9SA 3TQQA 4XX0B 1KH3A 1JG4A 2YWFA 1V3UA 4L8GA 3ZK8A 2Q0QA 4R98A 2AKEA 1TT7A 1HDYA 1BEEA 3I5MA 4IRMA 2X2EA 1RWOA 2HU5A 4BV2A 5A9SA 3ROKA 2RHOA 4EJMA 3I4FA 3R8FA 1ZUIA 1R0LA 3H5VA 3RVQA 2GN2A 2XUFA 4E21A 3ZDQA 3F8TA 4XUGB 1OFVA 5AM0A 4EA6A 4WNCA 1JLHA 1KDPA 5JECA 5A0TA 1T6XA 1UC5B 2B6NA 2C5FA 1E0SA 5KREA 1IN8A 2BGMA 1M7HA 3QHQA 4MWDA 2JLXA 4X63A 1W36D 4M83A 5KJCA 1YQQA 4GVLA 1KVUA 2JJ8A 4L5AA 1NXTA 2PAAA 3PNVA 3L1UA 5LZ9A 3MJTA 4MGKR 5L53A 1HE2A 1EX6A 1T25A 5HE9A 1OHHA 3O9VA 5KIAA 4M1OA 4ETNA 1BKDR 6PFKA 1RXWA 3PLAE 2AR0A 1E3DA 3SZGA 1I3KA 4HUQB 3RAGA 1E92A 1Q1BA 2O3TA 3DWEX 4MR7B 4YNBA 3TTSA 1W29A 4CV2A 2CF6A 1EPUA 1E1LA 3HJCA 4FGSA 4O2BA 3R7FA 3U5TA 1DZ3A 1Z45A 2HZBA 4GMGA 1WB4A 4BFTA 3Q1KA 1CZHA 3VR6D 4FIZA 5TGTA 3Q7TA 1K4KA 1NBOA 2R8RA 1A9SA 3RPEA 2G7ZA 1GPLA 2I1LA 4QT4A 2QLMA 3BERA 1KK3A 4YI5A 5K09A 3UJAA 4QOFA 2ZRHA 4M46A 1XEXA 1XKQA 1ZNZA 3IT1A 5EP1A 5DULA 1G2OA 1Z68A 2ODNA 3KB2A 1P2FA 1FNDA 3BGDA 3JVUA 3ENVA 1P7PA 2EFJA 2X8BA 3CX3A 2JLAA 4KDRA 2FR8C 2HJWA 3I2FA 1LLFA 1JMYA 1V4NA 1WO8A 2D2XA 2HM7A 2XDQA 3ANLA 1HLDA 3EZ9A 3GFPA 1W76A 3JQ6A 1P5HA 2F1OA 5I47A 4BVFA 1TQ2A 2P78A 2P9FA 2RHRA 4QSMA 3BD9A 5BQ3A 2O19A 1KY5A 2QPOA 5KQLA 3GIDA 5CNIA 1YK0A 3QE0A 1YVDA 3OKPA 2P4EA 1RMYA 2PZKA 4B74A 3SMQA 4PQRA 4C6HA 4ZKDA 5HEKA 1G8KA 4KE8A 5H3CA 1XTRA 3AVQA 3BF8A 3CO5A 3A05A 3LIIA 4HDSA 3I61A 3FOZA 1RXVA 3HCFA 3KJXA 1HOXA 2BRUC 2EEPA 2HHLA 3R6DA 1G20A 3H83A 1SK9A 4YRGA 3OZEA 3AF2A 4L7QA 2DQSA 3P9CA 4HMQA 5IVDA 2Q3LA 2R6FA 4MIOA 1DDGA 2QMZA 1XI2A 2QX9A 3HBLA 2F6RA 4FR2A 4GX2A 4B46A 4C6TB 4OUKX 5BN4A 3COVA 1DJOA 3PX2A 4PICA 3WISA 4WFKA 1USUA 2J7PD 1KI2A 1UMCA 3FG9A 3IBGA 4P4SB 3SIRA 1VJRA 2BF4A 1BHQ1 4KK3A 3TSZA 4B7AA 1QX4A 5FQOA 5K51A 5LD2C 4OPMA 3SY8A 2OGWA 1GPKA 2O50A 4TLMB 1JG1A 3NV7A 5CRIA 3QOXA 4MP8A 1ZCZA 4AO8A 1QYDA 3P9ZA 1L5ZA 2HN9A 2D59A 3PEUA 2HA6A 2P2ZA 4KFCA 4B35A 3QUTA 2MMGA 2Z8YM 1E5DA 1ECPA 1E5LA 4HSGA 2IRWA 3CZ9A 5F77A 4UHCA 4U6SA 3WGJA 2YX1A 5JS8A 2D7DA 2AWOA 3HA5A 4ZCLA 1IEQA 4TYYA 2OYSA 4RTJA 1Z8NA 2EFGA 4WACA 2Q5OA 4G36A 4IDPA 3WWZA 4B4UA 3BGIA 1MO4A 4YV0A 4KDFA 2ZSDA 3L0SA 4J4TA 2G7MC 3M3PA 1BDMA 1ZD3A 2BFBB 3GLHA 4Q7EA 3U0BA 5LLTA 3MIZA 1DWOA 1PCXA 2WWIA 4MWEA 4B0PA 4P5PA 5K3DA 4B09A 1PL0A 5JC1A 2BGKA 4UVGA 1T9ZA 3K1TA 1VDMA 5I9MA 1WF6A 1WCXA 2X5NA 2O14A 5G0TA 3B53X 1Y9JA 4W5WA 3TRHA 3K05A 5FNVF 3U1TA 5CA0B 4EZEA 1DJLA 2HBZA 4XQGA 4BJ5A 3IHWA 4ZO4A 4EHLA 1JHRA 1D04A 3A6KA 2DQKA 4IR7A 2Y1DA 1TUBA 1VJ5A 1ULHA 4L3OA 3DONA 5SZKB 5K0JA 4PZ0A 1U2TA 1ODFA 1Z0JA 3UVEA 1TPZA 2VKQA 3A1FA 2EWVA 3B5JA 4WLOA 5MFZA 3SC6A 3OF5A 1QFMA 2IS4A 1NVFA 1VB3A 3GLQA 4WX2B 4X54A 4Z9XA 5FNZA 1Y6GA 2FWIA 3AJ9A 3ETEA 4KQGA 2IPLA 1WBBA 4UFPA 3I2GA 1OREA 2H1RA 4ZJPA 1GWNA 5JCJD 2D8MA 1CHDA 2AOWA 1E66A 2R6HA 1NJ1A 1WUJS 1NDUA 1PTKA 2V7GA 3K9GA 5KYUA 3IEMA 1IHDA 1RE0A 4I6JA 5D84A 4A2QA 5AO9A 2H0RA 4IEIA 4KX3A 5C4IA 1IN1A 3CX7A 2RK4A 1HG0A 3IC5A 4WEOA 2RGEA 4PNPA 4TMWA 3JV7A 3N75A 2ADMA 4FXPA 2N1MA 1H5UA 1Q20A 3QU5A 4CV1A 3HXLA 1J1ZA 3AFGA 5IYZB 1OJLA 3P0IA 1NVVR 1FTNA 2KX7A 3OZXA 2BL4A 4OK5A 3PZBA 3O75A 4Q37A 3AERB 4REQA 1X7XA 4CTMA 3ZVNA 1HY3A 1W1WA 4XGNA 1FF9A 1C3JA 5T67A 3WE7A 1J7JA 1KP9A 4GICA 1TVEA 2EFEB 4FR5A 4F93B 1M6VA 1C9NA 3L93A 4W5QA 3VDNB 3DC7A 4EDHA 4KHZA 1G41A 4KFRA 4EOGA 2O8BB 3LUKA 2I7VA 3N0VA 4GX5A 3W77A 4EMUA 1VZ2A 1BHO1 1PR1A 1VHDA 3LUJA 1Q92A 4XPIA 1BD4A 1VOTA 1KSHA 3ZW7A 4AG3A 1JU9A 1P91A 1R8XA 4A6XA 3LHFA 4YRTA 4JCOA 4CUKA 4D3FA 3P9QA 3BN3A 2EP5A 4QUIA 1U0GA 4FMPA 4CEJA 1D4FA 5BWBA 3ZLJA 1EESA 2YWEA 3LZ6A 1U6JA 1TO2E 2XUQA 2XB8A 4EG5A 4O6VA 3C1UA 3WGHA 5JH7A 2V9CA 4LV5B 4ETMA 3OAAD 2PEZA 1IWPB 4JD5A 4XTRA 4N5DA 3WKAA 3R24A 1O58A 4KB5A 4FKMA 4U3JB 2EZ4A 4XRGA 3U6BA 1S3SA 2ZLBA 3QF4A 1FVOA 3FNHA 4H3SA 3NQ41 5I7RA 5CXSA 5KS2A 4AX8A 1N32B 2GK3A 4OLHA 1SXJA 2MIIA 3V00A 1FFBA 3ZWKA 3WRVA 2GCGA 2CC2A 2X41A 4Z7NB 3LDFA 1M6VB 1UJNA 1ELOA 3E1KA 2IYOA 2X40A 4GYKA 5I8PA 4AC9A 4MA0A 2PANA 4JASB 3DGEC 5C5IA 2H8KA 5FKJA 1X7YB 4RJ2A 5ILQA 1NP3A 3BWYA 4YX9A 4Y2GA 2NU7A 2R1VA 3X3HA 5MN6A 2Z6QA 1EHYA 1G6KA 3A32A 1BCRA 3QFSA 1DQYA 4NYMQ 2BOVA 3RUHA 1YIAA 4IVNA 1UKVY 3JZIA 5JEDA 2IIBA 3AUXA 1Q1GA 1CS0B 2D62A 4NMMA 1THTA 3P8ZA 2JGFA 4FMDB 3T3DA 5B3KA 2O8DA 1OF1A 3KB1A 1GGHA 4XVRA 3GJQA 4TXHA 3DEKA 3MTBA 4R0VA 4QEDA 3VAZA 5BSVA 2C9YA 2QMYA 4X1KB 2RH8A 9ABPA 3CUSA 3CVYA 3UJ7A 4M36A 421PA 1L9XA 2PQMA 2AOTB 3D2BA 1VE9A 4DKXA 1XNHA 3I34X 1UT6A 2ZRDA 4MUGA 1OI4A 2L0XA 3ZU2A 2QRNA 3BILA 3PJRA 4B9AA 1M33A 4QBFA 1ZONA 1A3CA 3JSAA 1SUCA 4BO8A 3HFSA 2GD1O 1YJ8A 4LZNA 3R7WB 1KA9H 3DVLA 4WXPA 1VLJA 3L82B 3PVSA 1KQPA 2B6HA 4UUNA 1YQXA 5FTLA 4ZPXA 5JJ5A 3N8NA 2H00A 1WWKA 1DWQA 4BTVA 2AX4A 1FS5A 4V2IA 1RRPA 2YW9A 2DUUA 1ECFA 1Q17A 4MRRA 3ZEIA 3ZNNA 2JG3A 1JLRA 1LXCA 1ZVVA 4CGYA 4LHZA 1G5IA 5FBLB 2NU8B 3BHIA 3UOAB 5A5DA 3I1JA 4JYPA 2IHYA 5KB3A 2HEGA 4Z7OB 2GESA 3ETJA 1ZCAA 3V9PA 1GCOA 2TRSB 3FA2A 5DPMA 2IEZA 3T3NA 5EUMA 3JZMA 4GBED 4F97A 1YQGA 1AX9A 1OPXA 2HA7A 2E9SA 2HSZA 2UXBB 2W6PA 4KRXA 4Q34A 3ZYZA 4QFCA 2H5IA 2XNKA 3AP3A 3Q9LA 4MGHA 5DEOA 3RTDA 5KSZA 4KQ6A 1NVGA 4YGXB 4DWVA 2I4OA 3ABRB 1KK2A 1CJUC 5IKPA 4PRKA 4B6SA 4UTRA 1T1GA 3RJTA 4XJXA 1E18A 4LVCA 5DN6A 2ZXUA 1SEPA 3FN4A 2TSYB 5CITA 1DEKA 2W7TA 1E6UA 3TAXA 3EJ6A 1X8KA 2N0SA 5I7UA 4BLSA 3AONB 3LLVA 4N48A 1GDDA 4QTUB 2VDVE 3TUZC 4QBIA 3CRRA 4N0DA 4AECA 4Z4EA 1U3VA 1HT2E 2I4NA 3LQQA 4R01A 4TMYA 3E4CA 2ECOA 2BGIA 2HBQA 2AFHA 3AFOA 3STHA 1EX1A 3H1PA 3HI6A 2ZVJA 1N1DA 1PK8A 2NVOA 4H59A 4Q4JA 3DL7A 2ZJZA 4P4NA 3SNKA 3T0IA 5BVHB 2QVZX 2AMJA 3HM2A 5KKCA 1V2HE 3SHQA 3QMWA 1F0PA 4KFSA 4N47A 1PVOA 3UCXA 5EXEA 3OY2A 5FPPA 3VR3A 4HN2A 4UM9D 3K0FB 4K9SA 5EI5A 5AW6A 1MO5A 3HB7A 1SQSA 3OIDA 2IELA 2IYEA 4WBNF 5KYGA 1NI5A 4XOIA 1E2BA 3ILVA 3AJAA 1I4TD 1B14A 1OC4A 1JLSA 1NWCA 2W2TA 4JJ6A 4NE2A 4M8KA 3MAAC 4U7GA 5GM2A 1JIXA 4DNOA 3NAQA 3VZCA 1R0KA 1Z16A 3SHOA 3LVFO 1X1DA 1GQRA 3H5TA 1CCWA 4YR9A 2EVWX 4TUYF 2O7QA 3QBEA 3GWGA 1M2NA 4DDVA 4PHHA 4FQ5A 5H02A 4X1IB 3U7EB 1K8YB 1ZXBA 2JGRA 5A4JA 3GPLA 1L7MA 1LU9A 2ZIGA 3IR6A 1QUFA 2ID7A 4MQLA 4MR9A 4BVKA 2YY5A 3DVAA 3OVMA 3DXZA 4GOOD 3AG5A 4QU0A 4XWYA 4C7XA 4D0RA 5KKNB 2D5CA 5CFQA 2DY1A 1F2TA 1H2EA 1G0NA 2DHEA 4AY5A 3DW3X 2Y4NA 4M6WB 4OQXA 1U0LA 5EIXA 3T3PB 2WC1A 2O2CA 1SBZA 3A26A 4NCNA 1K63A 5I9TA 3DL4A 4E6EA 2ZI9A 4OIMA 1WW8A 3IIIA 4ZHQF 2X9GA 3B1FA 3LXRA 1LW7A 3M1LA 4FCWA 4BMPB 5EHQA 1FRFS 1NOJA 2ZGVA 2NMVA 1O08A 2JC3A 3EVDA 3PGVA 1WETA 3LVQE 3DDNA 2EC5A 3F96A 1ZUNA 3HSYA 3KSUA 2PUCA 1DCKA 2RHHA 3SKYA 1OXMA 3R9XB 1U0EA 1DAGA 1VRWA 1X70A 3KS9A 3HC7A 2RJ3A 6CHYA 1GYQA 1PTJA 1SQGA 1NXPA 1JLKA 1GFSA 3ZZTA 3K6SA 5JRZA 2HWXA 3T1QA 9LDBA 1JDZA 1FNNA 4E31A 4OMUA 1EEXB 3M6XA 4UQLA 1XZCA 4TMXA 2O6HA 3S2GA 1II8A 3QQ5A 3HKDB 2OUKA 3QEAZ 4LGCA 1E9BA 2COEA 5TMBA 3R7NA 1L5QA 3USCS 3VNUA 2JA1A 2H92A 5GP1A 3WA6A 4DCMA 1KQFA 3FVRA 1V1JA 1PKXA 4KPUB 5CLJA 3E7XA 4GDFA 2CVOA 1DAFA 1NPTO 4MR8B 3SHVA 1Z07A 4HZGA 4QOSA 1Y6JA 2DHDA 3T3MB 2ODBA 4MTCA 3K9CA 3D43A 4Q39A 2P2GA 5KBYA 1SJ9A 4IQ4A 2BEVB 3ZU3A 4P7JA 1GNPA 1JJBA 2JFWA 3ETCA 3QVVA 3OCCA 2AMYA 1DBQA 2C42A 1X92A 3IEKA 4GPIB 4P92A 4EJSC 1Y8QA 2QLNA 3DULA 3Q4GA 3D4OA 3ILYA 5A4KA 3NBMA 1XNRB 3MLEA 2RGRA 3HN2A 2AC2A 4NYIQ 3C2QA 4MPJA 5F12A 4S04A 1TJ4A 2NVWA 1AB6A 5JDCA 3WYNA 4WZAE 4HN9A 1GARA 3ZNPA 4M60A 1APBA 2FMXA 1CWUA 3TB6A 5C46F 1LJUA 4YRSA 2QKYA 4E46A 5B58T 2XMBA 3KEQA 5HFJA 4O5OA 3R7BA 1JKXA 1X8JA 1U7HA 4XD7D 2CHVA 4XFJA 4JOCA 3FPFA 3G3EA 1DXHA 2XODA 4Q4HB 1QYXA 5HS6A 4P82A 2FETA 4MMXB 3J7AC 4Q3AA 2E4ZA 4H17A 4S0ZA 4QJ3A 5F33A 4G8CA 1FA9A 1RW4A 2GXUA 1NSTA 3FYSA 5D5PA 4A1OA 4I9HA 5KC9A 1ISIA 5IN5A 4F3KA 5JAUA 2B4KA 2D0IA 2YWRA 3BULA 3HKBB 5TC4A 2W98A 3QEJA 1QGUA 3OHPA 2PYZA 5L7WA 5ES4B 1DIBA 5IVIA 4Z7QB 1XPJA 4BZWA 1QVWA 2NX2A 4FGZA 3UV3A 5ER6A 2Q5CA 3H8SA 3P0EA 1T9AA 2NAPA 1AY0A 1RWPA 4QQNA 4JXZA 3WHKA 5ITZA 5TF0A 4PM4A 2UZ1B 3AJEA 4YCJA 1E2PA 3QF7A 1RJ9A 4EY7A 1K3UB 1I4DD 2GN8A 1GIAA 3N1UA 1K7SN 4TPKA 5IK2D 4JLUA 3V32A 1ETUA 2R4TA 1D0VA 4R8RA 2Z30A 1CLUA 4GPEA 4AK9A 1M54A 1NP6A 4IJMA 4CKBB 5C1BA 3CVXA 2D5LA 4QDJA 3CUWA 3V4LA 2YTZA 2QTWB 3KAPA 4RK4A 3WLAA 1UDCA 1HBJA