4H7EA

Crystal structure of haloalkane dehalogenase linb v112a mutant from sphingobium sp. mi1205
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
b'SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
total genus 112
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7eA00
3JWEA 1IZ8A 1YS1X 1C7JA 4WFJA 2JBWA 2WU3A 4AQDA 3PF9A 5KBYA 2PSDA 2Z8XA 3Q0TA 5AM3A 4C87A 1WB6A 4TVKA 5ALXA 2B4KA 5HQ3B 4LXGA 4DMCA 1QJ4A 3BF7A 4Y2JA 1LPNA 3I1IA 1HKHA 4AO8A 1VLQA 2ORYA 1R4ZA 2W6CX 3EQ7A 3G9TA 1RP1A 2W22A 2JGJA 5CH3A 5ESRA 1DWQA 4JNCA 2FUKA 3H0CA 3TJMA 4C4XA 2VTVA 5A7GA 1U65A 4RNCA 5AHXA 1XLVA 2XB6A 3V1LA 5K3DA 4KACA 5T4FA 1R1DA 4UBNA 1G66A 4WFIA 1XLWA 1WPXA 2VA9A 5CH8A 1B6GA 1FFAA 4J03A 5CMLA 1L7RA 1H23A 1QTIA 3R3XA 1XZGA 4U2DA 4OUKX 3VVLA 2RHWA 5AKIA 1PJAA 2QVBA 3HJUA 1JT2A 4BC0A 1XZCA 4M0FA 1CUSA 5FRDA 2HADA 2WFLA 2WTNA 2V97A 4Y9SA 4X85A 3GELA 4X94A 3BE8A 5C8VA 4DNFA 4BRSA 4G8BA 5FOQA 1MX9A 3WQHA 1Y37A 3BWXA 5HKBA 1MN6A 4AMZA 3F96A 5AM4A 4FKBA 2DFPA 5C7YA 2QXTA 2Z3ZA 1FFDA 3BL8A 3PE6A 2OGTA 3P2MA 2ROQA 4PSDA 3I2KA 3Q8WA 4G8CA 2ZSHA 1L7AA 4GECA 4GI1A 2JF0A 1SOMA 1B41A 3G02A 4F0JA 4H7JA 3R3ZA 2XDWA 4UBOA 1LZKA 3CCCA 1THGA 1GPLA 2K2QB 3ANSA 1QONA 3H2IA 1LPBB 4MXDA 5CBKA 4HRXA 3C6YA 3ZWQA 2OCLA 4KE8A 2AJ8A 2G4LA 1E8NA 4H35A 5JZSA 4CFSA 4IO0A 3MVEA 4XWGA 5IVDA 4QDXA 1VXOA 4OB6A 4MQMA 1ZOIA 4W9RA 2PSEA 2JGKA 2PU7A 1WM1A 3CN9A 1CUGA 4PSCA 4J3JA 2HL6A 4BVLA 3GZJA 5ALQA 1QIMA 2WUGA 3PFCA 3FNBA 3KD2A 5AI8A 4H7DA 3B5EA 1CUWA 1IVYA 3H17A 1QO9A 1TK3A 2HU7A 3KSRA 3WKAA 4CIAA 2VT7A 1DT3A 2YYSA 2PBLA 4DNOA 4QLAA 4BAGA 2ECFA 1X2BA 2HA6A 4Q82A 1A7UA 1VOTA 4ZV7A 1XZAA 4BP8A 4B85A 4U2EA 4KEAA 1C7IA 4U2CA 5ALVA 4DYHA 2HA3A 2PPLA 5BWBA 4GBGA 1H2ZA 4GXNA 2CZQA 3W2TA 4AZ3A 4RE5A 5AKEA 3EQ8A 2RI6A 2O2IA 3KOOA 2J4FA 3GA7A 2PSHA 2J3QA 4BZZA 1Q0ZA 5DYYA 4OSEA 1TRHA 3NUZA 4GLBA 4FWBA 1YCDA 5DNVA 2CUTA 3U1TA 1VKHA 5FLKA 5DTIA 1N8SA 2BJHA 3F9CA 4ITVA 1GXSA 4XVCA 2ZYHA 1QIFA 1QIDA 2XT0A 2OLEA 3DD5A 4N5IX 1DINA 4AB1A 2YH2A 4H7KA 3G7NA 2HM7A 3DJYA 3R3VA 1X2EA 4BAUA 3GFFA 3PUIA 5JALA 2V98A 3WLAA 5E4JA 4EHBA 1LPPA 4MWSA 1CQWA 2WUEA 3CXUA 2BAGA 4YASA 3AZQA 5FDFA 1LPOA 4L0CA 1JMKC 1N5MA 1EX9A 4K6GA 4W1PA 2C7BA 2BKLA 4GWLA 4G1FA 5CTAA 5ALNA 3O4IA 1UKAA 4DSZA 2DQYA 2HA7A 1CEXA 3I2JA 2WIGA 3WWPA 3WK6A 1QIEA 2QJWA 3DL7A 4W1QA 4X71A 2AJDA 4MYDA 3VVMA 4K6HA 2HU5A 5D3ZA 1EDBA 1WHSA 3WKEA 3WL5A 2VJBA 3LLCA 2XUKA 4B6GA 3TEJA 1AUOA 2WG2A 5I8PA 1YS2X 4CCWA 4Q05A 5ALLA 5HK9A 3VJLA 5ALIA 2O2HA 3O9MA 4N8SA 3V1NA 4FTWA 1HDEA 4OPMA 3UUFA 2OCKA 4A16A 4FFWA 3AIOA 3STUA 1MX5A 4I4CA 4TPKA 5AKKA 3WYNA 5CW2A 2XMDA 3FWHA 1XZIA 5EGNA 3O4JA 4X6UA 3IDAA 1XRMA 5AI9A 5AKXA 2DQZA 4J0HA 1K63A 4N8EA 3NWOA 3WYDA 3HI4A 1UK9A 1EK1A 3PFBA 3OPMA 4BYMA 3FYTA 1EH5A 4BAZA 5JD6A 1AX9A 3C6BA 1AKNA 3WL6A 1XKTA 3IUNA 2XMBA 4LXHA 4AXBA 3G8YA 3IUJA 3PUHA 4G4JA 3IULA 4EY4A 1SCKA 3RLIA 4A5SA 1EVQA 5ALPA 1DTEA 4NMWA 3LIIA 4KAAA 4BP9A 4X93A 1W6RA 4EY8A 3F8SA 3QPAA 2HRQA 3S2ZA 5BOVA 1YAJA 3OG9A 4HAIA 1I6WA 1ZD4A 2CBGA 4ZGBA 1AZWA 2HFJA 3E4DA 3HLKA 1ODTC 3AIMA 1BCRA 3D4LA 2BFNA 3K9BA 3OM8A 3FCXA 3LIPA 1VA4A 1XZKA 3AINA 2XQJA 1T2NA 2Z5GA 4OYYA 1YAHA 3I2IA 2XUFA 5CRIA 3FBWA 3HSSA 5FKJA 3WK4A 2D5LA 4J0CA 1IUNA 4HTAA 1G42A 7YASA 1K4YA 1MNAA 2WIJA 1G5FA 4PNZA 3ICWA 1VE7A 3QVMA 5AK3A 5AKGA 5K3BA 1Z68A 2ACEA 3C87A 3E3AA 4RPCA 4H7EA 3WWCA 3EIOA 3FLAA 4KRYA 1TCCA 2QRUA 5C81A 4FLEA 2O2GA 3UUEA 2Z3WA 2OQVA 1P0IA 1CUDA 2WKWA 1XRNA 1VE6A 5BV7A 2RAUA 2GZRA 3GUUA 1TCBA 1Y7IA 2Q0XA 3A2NA 1A8QA 5D7BA 1XQYA 2J3DA 1CUZA 3M81A 2BGRA 3IIIA 2XUGA 5AIBA 1GKLA 5EI5A 2ZYIA 5A6VA 2AJCA 4X92A 3ZLVA 4XIIA 1USWA 1CUUA 3O0DA 2ZJ7A 1WCYA 1GQSA 2V9ZA 1UZAA 1LZLA 5LYYA 4I19A 1XRQA 2OCIA 1HPLA 3TRDA 3F67A 5CXUA 3LS2A 3WIOA 1AMNA 3STWA 3ANTA 1X70A 1WHTA 5LZ7A 1Y7HA 4BCDA 5EHNA 3SC2A 2AJLI 3QMMA 5FPQA 1UT6A 1DQZA 3OC0A 1QFSA 4B80A 1UFOA 4KE7A 3RARA 4PO3X 3I2HA 4QZVA 1A88A 2GYVA 3V1KA 3BDVA 1TAHA 1ZGBA 1SFRA 4HZGA 2Y2VA 4D9JA 5JASA 4J0JA 5T4BA 1K8QA 2QTBA 1ZI6A 4Z49A 1XRLA 1UWCA 2C5FA 4UHFA 1J1IA 4DMKA 1YA4A 5HK8A 1EB8A 5ALTA 4CG1A 3BIWA 1J06A 3C5VA 4OU5A 5CT8A 4QA9A 2X76A 2WM2A 2DHDA 1UOPA 4RE6A 1N5RA 2PM8A 2HRRA 5AOAA 4DNQA 1VZ3A 3D0KA 1FFBA 5CT5A 4G9GA 1NU8A 2FJ0A 3BJRA 3QPCA 4BDTA 1AGYA 3OTQA 3JYHA 1JJFA 2VAVA 5HCUA 4B0PA 1E8DA 4EBBA 2QUAA 4JEIA 4C4YA 4JYMA 2XMCA 1YSCA 4NVRA 5CT6A 4LYDA 3HC7A 3WL8A 4Y2XA 3HRHA 2EDCA 1W75A 3E1GA 3T4UA 1QIKA 1HL7A 1AQLA 2XUQA 2PUJA 2DHEA 4X95A 4U2FA 3A2MA 4BTVA 3QYJA 2HA0A 2WILA 3C70A 5HF8A 2OCGA 2WUDA 3O9VA 1SC9A 4Q3KA 1WB5A 1O6FA 4GDMA 5C8XA 3R3UA 1CUBA 4FBMA 4YX9A 1NX9A 1ODCA 1CUEA 3DCNA 5DYTA 1SCQA 4QNNA 2I3DA 1XQXA 2VJDA 3UMJA 2OG1A 3NOXA 4CG2A 5EFZA 5IVKA 2H7YA 4BE9A 1VXRA 1UK8A 1CUAA 1GGVA 3C8HA 1GZ7A 5YASA 1XZJA 4B82A 2XUDA 2WTMA 1UOQA 2XUJA 1ODSA 3GROA 4X6YA 4M0MA 4FNMA 4LYEA 3VDXA 2XMQA 1TKRA 3C6XA 4CCYB 4PW0A 2H1IA 5AI6A 2Y6VA 5D3KA 2C0PA 4OB8A 4P93A 2IX9A 1C4XA 1SCIA 1QIGA 2BUCA 1TIBA 3KWFA 5SYNA 4Y2SA 1QE3A 5K3CA 1BU8A 1IMJA 2FJPA 3DEAA 2C4HA 3I2GA 1DX4A 1F6WA 5JZ9A 1CVLA 3IA2A 1E5TA 4E15A 1E3QA 2OQIA 3IURA 4KAFA 2LIPA 5LKAA 1BEZA 4BC1A 5EHXA 1MX1A 1L7QA 5A2GA 3I6ZA 4IH4A 2XQIA 2HFKA 3IUQA 1CR6A 4UBKA 1CUVA 3K6KA 3PI6A 1ISPA 1LLFA 2VF2A 5EHQA 2PVSA 1TCAA 1H22A 5AKZA 4W1SA 3YASA 1JU4A 1JMYA 1LNSA 4BATA 1MO2A 1M33A 1RYYA 4UFNA 1XQVA 3ZLTA 2JEZA 2JEYA 4OCZA 5KWIA 2FX5A 4WCVA 2J4CA 1BRTA 2VAXA 4G5XA 4EB0A 4CCYA 4KE9A 3W05A 3R3YA 1QGED 1MT3A 5DNWA 3FOBA 5FXMA 4B7ZA 4AMYA 4EY7A 2UZ0A 2PU5A 3STTA 5ALKA 4G4IA 3VJKA 1BEEA 3SWWA 4S0XA 2WHPB 3LP5A 3N0TA 2XE4A 3X3HA 2WFMA 3O95A 4KJXA 1MU0A 2QUBA 1EB9A 4O08A 5AOBA 3WKCA 1DQYA 2XUAA 1MAHA 1VJ5A 1U4NA 2R11A 1CFJA 1THTA 3FYUB 1JFRA 1CUJA 3PICA 2BGNA 2O7RA 4OB7A 3WL7A 3WWOA 2YXPX 5AP9A 1K6EA 4Y2UA 3I6YA 4YPVA 5I7UA 2CEKA 3S8YA 3ESDA 1PV1A 4G9EA 4BVJA 1OXMA 2HDWA 3AILA 4J0IA 5T4EA 4X3CA 5BWCA 3WK5A 3IVMA 2RIPA 4Y2RA 5ALWA 1QIJA 5AI0A 1BN6A 2C58A 5FP0A 1MTZA 1ZI8A 4ZRDA 2ZJ6A 1MJ5A 2VSQA 2NW6A 5EIAA 3DS8A 4X00A 3HEAA 4A23A 1UXOA 4BCBA 2H7XA 4KRXA 1UOOA 3GBSA 5HFNA 5JD4A 2QM0A 3VKFA 1ACJA 4QEKA 1Q83A 3KWJA 3D2BA 5JIBA 3ZI7A 2X5XA 3WJ2A 4FFVA 2ES4A 5LLSA 4IQ4A 4BTLA 1CUHA 2XMGA 2WHPA 4DGQA 4EY5A 4UHCA 3C45A 4MEAA 3C6ZA 1U8EA 2H7CA 2P8SA 1XRRA 3DYVA 4B9EA 1JU3A 2XMRA 5AJHA 1LPAB 3AFIA 3WWEA 1JI3A 3STVA 4FDMA 5AH0A 1WPRA 3HACA 2IITA 4F5ZA 4BBZA 3FYUA 5FV4A 1DWOA 1Q84A 3RM3A 3FCYA 3DL4A 4QDOA 4AO7A 1BS9A 1GKKA 5DWDA 2WLSA 2CKMA 2WG0A 4OU4A 5AO9A 2ZYSA 3O4HA 2XMZA 3IB3A 4PSUA 4H18A 5JAOA 3ESCA 2OGSA 5LP1A 3H2GA 1XZFA 5K5EA 5SYMA 3WMRA 5CURA 2ACKA 2GYUA 3E0XA 4QLOA 1KU0A 3L1HA 1XZBA 5AK5A 5JANA 2OXEA 2B61A 4L3WA 2JGEA 4J0KA 5A62A 1VA5A 2HA4A 3G9UA 4KE6A 2VEOA 5AIAA 1ORWA 3PDCA 1T4MA 3WZMA 5ALMA 4L9AA 3ILSA 2CMFA 3EQ9A 5D6OA 5HF6A 3AZOA 4XX1A 3IUMA 2VATA 2G5TA 4X6XA 4EY6A 4EA6A 4M0EA 1R88A 4C89A 2DSNA 1NU6A 4X97A 1EINA 2PSJA 2OAEA 3DKRA 1GQRA 1EK2A 3QH4A 3G0IA 4Q1VA 3OOSA 3U0VA 5ALFA 3H2JA 2ZYRA 2XUPA 5AKJA 3D7RA 2VT6A 1ACLA 5A71A 4DIUA 1QOZA 5EIHA 3QPDA 1R9NA 4DMFA 4PF1A 2GBFA 2B20A 5AOCA 4ARAA 4QWMA 5FUMA 1RWQA 1XZDA 5FPPA 4WY8A 5ALJA 5AM0A 1FFEA 3EF3A 3WJ1A 2B9VA 4W1RA 3WI7A 3ZV7A 1VZ2A 4AN0A 1XQWA 1W1IA 3O4GA 4TGLA 5AK6A 1R3DA 3VXKA 3WKDA 1IZ7A 1BCSA 3CN7A 2QR5A 4UFOA 5ALUA 4L72A 4E46A 2XLBA 1O6GA 1DWPA 5HF9A 4QWWA 1JJBA 4PQEA 3QMWA 2WIFA 1F0PA 4J0DA 1XRPA 3V1MA 3WWDA 3WIBA 3SK0A 5HZGA 3D59A 2QJRA 1J07A 4P9NA 4ZV9A 2WSLA 2WJ3A 2G5PA 5CXXA 5J3JA 1GPNA 3I28A 3F98A 3VISA 5JAUA 5LIPA 4FOLA 4WFKA 2JIDA 4BRZA 2I03A 3WA6A 1DT5A 5IVIA 5IKXA 4MWTA 4QE3A 4Y2PA 1CV2A 4V2IA 2PSFA 4B81A 4Y7DA 4W63A 4C01A 1P0PA 2WIKA 2RGUA 1EDDA 5ALDA 4FNGA 2GYWA 2WU4A 1TQHA 1YA8A 4P08A 3D2CA 5AICA 1ZIYA 4G4GA 5JZBA 1XZEA 3D5EA 1AC5A 2BUAA 1UKCA 1XFDA 3BF8A 2QT9A 4K5QA 2Y6UA 4MYSA 4Y2TA 5IH7A 4H0CA 2HA2A 5K3EA 1BROA 4P92A 2BCEA 4GHWA 2PL5A 3AZPA 4WY5A 1OILA 3ED1A 4ZXFA 1KEZA 2JGLA 1EXWA 1BE0A 2DCMA 2QZPA 4LKOA 2O7VA 2HIHA 5JYCA 5KREA 4ARBA 5LZ4A 1CLEA 4OD0A 4UBIA 5AM1A 5DNUA 5JAHA 1CUIA 1QZ3A 1ZICA 3G9ZA 4BDSA 2XUOA 1JJIA 1A8UA 4B9AA 4DSAA 2XQKA 5HKAA 2XLCA 2GBIA 1H2XA 1QO7A 4ZI5A 4AZ0A 4DM7A 1YB7A 5F4ZA 4HRYA 5IVHA 1ZGCA 2C0QA 4DTCA 1YB6A 2WJ6A 3W06A 5HQ3A 4FLMA 5AKHA 3H2KA 4B83A 5LZ2A 1HBJA 3FLBA 1BN7A 2JGIA 3T52A 4H7HA 4EZIA 4HS9A 1MAAA 3B12A 4J0GA 3B3QA 4QDZA 1HQDA 4FMPA 4H7FA 2ONCA 2WJ4A 5ALYA 2CB9A 1KU6A 6YASA 5K3AA 3G9XA 4MQLA 1UKBA 2E3JA 4NS4A 1XLUA 2QMQA 1GT6A 5CT4A 2H9YA 1ZJ4A 4U2GA 4B84A 4UFPA 1XZLA 4YK7A 1YASA 3MUNA 5DTJA 3D2AA 1P0MA 2WIDA 2RHTA 1U2EA 3FAKA 3AUKA 4X90A 3TGLA 3HYSA 3QZUA 2WUFA 4C4ZA 4HXEB 2YASA 5E4TA 4PV7A 4WDQA 3DKKA 4FHZA 1XKLA 1G4HA 2I3ZA 1FFCA 3WKBA 3D3NA 1CIJA 1H2WA 3WZLA 4QDUA 5ISMA 1ZJ5A 2EEPA 1WOMA 4KYVA 4ZREA 3L1IA 4FBLA 3C5WP 4G8DA 3G0GA 4K6KA 3I2FA 4BE4A 5EIEA 2ZJFA 2AJBA 4HVTA 5K3FB 1EA5A 3NGMA 3W9BA 2OAGA 1ZD3A 5ALEA 2WFZA 2DHCA 1LPSA 3STXA 2CJPA 2GBCA 1ETHA 4X7BA 3ESBA 4Y2QA 2XQFA 5HF5A 2OGZA 4LXIA 1IUPA 4X91A 4QDTA 4IH9A 4Q3LA 3MGAA 3DOHA 1QIHA 1W76A 4LIPD 5JAPA 3H1AA 3G0DA 4I3FA 5LZ5A 3A6ZA 3H18A 5DYWA 4GEGA 2G63A 3DLTA 3RKSA 3L1JA 4UHBA 4UPDA 5E4YA 2WQZA 3ZLUA 1CRLA 4JUIA 3BXPA 3QITA 3AIKA 4KR0A 2QOEA 1LPMA 3FLEA 2V96A 1CUXA 1XZHA 2JGFA 5JADA 2DR0A 4UBLA 1CUYA 3N2ZB 3RK4A 1H2YA 5ALRA 3DDUA 2QXUA 2OPHA 2D0DA 3SX4A 1LBSA 2WG1A 1S8OA 2HHAA 3V48A 4DNPA 4MJ3A 4AN1A 3C43A 3M3DA 3A70A 4H7IA 5JARA 1OCEA 1IUOA 4JH0A 1F0NA 1EDEA 2XI4A 3H19A 3ICVA 1UK6A 5K3FA 1QTRA 4AO6A 5ALHA 4E11A 5ALOA 2JGMA 1D07A 1MPXA 3CCBA 4F21A 5AI5A 5A7FA 4ETWA 4HXGA 3QBJA 5CH5A 4IH1A 2HU8A 1E89A 3KDAA 4CIBA 1E66A 5EHZA 1CUFA 2I78A 4BCCA 4WDRA 5T4HA 3WK8A 3HXKA 4Q34A 2VJCA 3MUOA 3DQZA 4H77A 1DX6A 4GW3A 1FJ2A 4XJVA 3K2IA 5DJ5A 3KXPA 1QIIA 3H1BA 2C5GA 1XROA 1WB4A 3M82A 2ZVDA 5CT9A 3M83A 3HABA 3W9UA 2Y2UA 2GZSA 1P0QA 1ZD2P 3F97A 5LZ9A 1R50A 1XZMA 3ZPXA 1Q0RA 2ZSIA 2IIVA 1EHYA 3FSGD 2BUBA 1FSSA 2PUHA 2VJAA 1W4LA 3R0VA 5AI4A 5JD5A 3FVTA 4JYPA 4C88A 3DOIA 4K2AA 5KWJA 3R41A 4KAJA 2HA5A 2WHRA 4CI9A 1LGYA 2XQGA 4Y2VA 3H04A 5ALGA 1EI9A 1HLGA 5ALSA 1YR2A 4B0OA 2X8BA 3JW8A 5H3HA 1W52X 3G0CA 5AK4A 2Y1KA 3BJMA 4IHAA 3EBLA 2RONA 1N1MA 3DYIA 3I6MA 5DLPA 4UHHA 5AM2A 4N5HX 4ZWNA 1GPKA 3R40A 1ZIXA 5AKLA 3QMVA 2WHQA 5A7HA 2QS9A 4FLFA 3WK9A 4U2BA 3H2HA 4Y2YA 2XUIA 3W04A 1QFMA 3LCRA 4ROTA 4WJLA 5ALZA 5LZ8A 4BZWA 2XMSA 2Z8ZA 1EVEA 4BB0A 4HXFB 3WA7A 3VJMA 4LHEA 3HZOA 3QM1A 3V9AA 3STYA 1CUCA 1DU4A 1ORVA 2XUHA 4OYLA 1UK7A 3C8DA 1CQZA 3ESAA 3A2LA 5AM5A 4DMHA 5I9IA 3IBTA 1ZD5A 3I1YA 4UUQA 4BVKA 4MEBA 1R9MA 1PFQA 3DNMA 4DLNA 3PF8A 2R8BA 3FSGA 2GBGA 1AURA 1CPYA 4C6HA 4UHEA 1J2EA 2QKYA 4NZZA 4J7AA 4EUSA 1LBTA 4UBJA 1A8SA 1F8UA 3R3WA 5C8ZA 4INZA 3OURA 5E2IA 2PKYX 1JKMA 3BDIA 2AXEA 4N8DA 1MNQA 4UHDA 4F60A 5JATA 5LKRA 3FVRA 5HFAA 4AX4A 1E8MA 2EDAA 3BIXA 3FYUC 1K5PA 4CG3A 4Q3OA 3AJAA 2PX6A 2WFLB 4RGYA 3WK7A 1QLWA 2VQ6A 3G0BA 5AKYA 4UBMA 4E14A 1ZI9A
chains in the Genus database with same CATH superfamily
4R1LA 4H16A 3JWEA 1GAQA 4M83A 2OBFA 4R54A 4C78A 4J8PA 4EQ6B 2WV9A 2YY5A 3QKUA 1YRLA 2IJGX 2F59A 4V1CB 1D0VA 4ZT5A 2XBLA 1D2MA 1G2OA 1E2UA 2DFLA 5JISA 2G8NA 4EPXA 4TN1A 2B2NA 2WU3A 4RH0A 4R98A 2P62A 3PF9A 4JX9A 1QR6A 1KJWA 5CK5A 5CVDA 3T7DA 2Z8XA 2QVYX 3VU3A 4PZDA 3UEOA 4EPVA 5AM3A 4C87A 2XNDA 1JQDA 3G49A 4RSRA 3N05A 4CMGA 3F4KA 4WKBA 1YKFA 1WB6A 1ODFA 3NHUA 1JHXA 4TVKA 3TPFA 4GI5A 3QKTA 4LXGA 5AW8A 1HQCA 1I30A 3H8SA 5JQGA 1EIWA 4FYPA 5SZJA 1EFRA 3D6MA 3TKYA 5BN4A 2CLIB 3TQCA 1IDN1 1JHMA 4Y2JA 5D3QA 1P6QA 4JGIA 2CXTA 1G21E 4HC4A 4JT4A 1CXZA 2JANA 4NU6A 4AO8A 2WA2A 3VYWA 3SSOA 3EASA 2GM3A 2H1OA 3M6MD 3HXQA 3VKUA 2H1SA 4K9PA 3I9V6 3AR4A 3L8GA 4JODA 1XP8A 3G9TA 1RP1A 1YCGA 1NBIA 2DOKA 2QN6A 1HYQA 2V7XA 3BFPA 3CU5A 3FKQA 2IF2A 4MO9A 4MVYA 4UZFA 5ESRA 4EB6A 2ZIWB 1Z82A 3CVOA 2BH2A 2GZ1A 3N86A 4JL8A 3W6UA 1XT6A 2FUKA 4DUZB 1M2VA 1R8SA 2FSUA 3TJMA 5BUZA 3QEMA 3RK1A 1U65A 2FF7A 1QF6A 1QYCA 1NDUA 2OHGA 3A6HA 1J70A 2X3FA 16PKA 1LDNA 4A2WA 2Z1MA 3CZQA 3RS5A 5DI9A 3WJ7A 5K3DA 2W8BA 2WKSA 3I01A 2OCAA 4KACA 4D4KA 1K9SA 4QEZA 4JLWA 3PNLA 4D3SA 3RUHA 1UBUS 4GZ3A 1G66A 1LI4A 3V3TA 1WSWA 4KDEA 5A2QA 1BDMA 3LXUX 5I7WA 1U0TA 1XLWA 1TKCA 1Z6GA 4ENWA 2VH1A 3T5GA 1WPXA 2VA9A 1M2NA 3CX6A 5IMBA 2LCFA 1YFZA 1KO5A 5LLDA 4CT5A 3IRVA 1TMOA 2AD1A 2RC5A 4OLJA 4KREA 2R1UA 1CNMA 1E4VA 3OHMA 3OPYI 3QFCA 3VBCA 3RC8A 3IP8A 4OV6B 2GJ8A 5CHEA 3HY4A 4IWNA 4XVUA 2ZT6A 1UC5B 3HQ4O 1EP2B 3IMCA 3CUSA 5CCEA 1QTIA 2VL7A 1G7TA 3SLKA 2VDPB 2QRNA 4DAOA 5HILA 2LWIA 2OOSA 5GINE 2ID4A 4XYEA 4OUKX 1RRPA 3V32A 3BCRA 4YRIA 2C31A 2QRVA 3D54D 3G68A 4NV0A 4X1IA 3DTTA 1C5KA 4EJSC 1WLYA 4G41A 4XWYA 3ZE9A 1PJAA 2HUNA 2QVBA 4BC0A 2HSZA 1XZCA 3ANMA 2QD3A 3LHSA 3A9WA 1QLHA 4FHEA 1XEFA 1FLDA 2CJYA 2XF8A 2AZXA 4J7CA 2C1ZA 4JP2A 2WTNA 3HYTA 3KB8A 2ATCA 3MGGA 4G5QA 2D4AA 2FUCA 1EIZA 4R84A 1CY6A 4ZA2A 4IVQA 3LXXA 2NIPA 4EYEA 1GRQA 4TT3A 1DHRA 1QWSA 1T9BA 5JCOA 4ARUA 4BMXA 5HM8A 5JSFA 1V5FA 3WLMA 2O2SA 5IT4A 5C31A 2GJ9A 5B4VA 3RSLA 3I0MA 4ZTUB 5C8VA 2AUNA 3ONNA 3TLGB 3LHKA 3IT2A 4J1SA 3OOHA 4F6CA 1MGOA 5LMCA 1XD2B 4O4HF 3WQHA 2ATIA 4HH3C 3EG5A 4CR7A 1EFUA 1HEUA 1N5OX 4HADA 5FWAA 1UBGA 3EGOA 2O8DB 4DHEA 3PGVA 3W4IA 1HWYA 1MN6A 3RQIA 3F8TA 5T6BA 3NORA 1ZRNA 4YP0A 1UXGA 2HEGA 2RH8A 4MQ6A 1NM5A 1Z8NA 1PHRA 3B9BA 1TU3A 4UU0A 5P8WA 3SSMA 3THOA 5B3LA 2OGTA 2X4IA 3TLXA 2JHCA 2YMMA 3D3JA 2JCGA 5AVUA 3O2SB 4PSDA 4ZI7F 5EE5B 5I4CA 3UJNA 1Y6FA 4GPAA 2C9CA 4A8JC 3I2KA 1ZEMA 4YRZA 1PJQA 1N0WA 4REOA 2HLDD 1DKUA 2BCJQ 1N78A 5D7NA 5HKKD 5I9TA 5HXAA 2QAGC 4CMIB 4GI1A 4JEUA 5SZKB 3NTOA 1JDBB 2NSLA 4OGGA 4OL9A 1SKYB 2EWVA 4G86A 3I01M 3R3ZA 4KXQA 3SDSA 3ODPA 3DPSA 4YJHB 3ZHTA 2CXUA 3GA5A 1TPYA 2O2XA 3GRYA 2GPAA 4W82A 5LOVB 1UJNA 2V55B 1THGA 1MLDA 2X0RA 1GPLA 3IMFA 3TD2A 2C7VA 1LTHR 1QONA 3ANSA 4WKGA 3PUXA 4ID9A 1V6AA 3EIFA 3RG8A 3S7ZA 3ZDYB 5CFPA 3E58A 1PGOA 1HUQA 3WGOA 1GRNA 2XCTB 1K7EB 1VSVA 3ZWQA 2OCLA 5KC9A 3EFEA 5IARA 1VBKA 1NI4B 2ZXFA 2GPSA 2Q9CA 4H35A 1PGNA 5JZSA 4CFSA 4C0JA 5H9VA 5HNKA 1USUA 4JXZA 5F7OA 3Q0EA 2V45A 1YB2A 3RRXA 1B2LA 1PE0A 5EJAA 3ZCVA 4QDXA 1JB9A 3C3XA 4KIGA 4TYQA 4ZMSA 3FNEA 1CEYA 4Q4DA 4RL6A 2XBUA 4MQMA 4HNRA 3SS7X 1LV7A 1M8FA 3AI2A 4W9RA 5K8LA 4XVQA 2YHAA 3RHSA 2PUDA 1MOSA 1WM1A 5J63A 1JFFA 2WB4A 2IV2X 3A1CA 4E5YA 2QL9A 1UJCA 4DG8A 4PSCA 2V1UA 2CLDX 1K7YA 2HCJB 3WADA 4DR7B 4H3VA 2D8AA 3EGIA 1WCXA 4OXXA 5AVWA 5I7AA 3IBFA 1ZG3A 2B4TO 2A0YA 3GZJA 3E5RA 3MOGA 4TTTS 4YJ3A 5HA5A 1QBKC 1UFKA 1YDEA 2QRMA 3GLQA 4XJTA 1JS1X 1QIMA 3VAZA 3ZKWA 4C3OB 1E1LA 1KI1A 3KB6A 1BE8A 2WUGA 4WKPA 4JT2A 4KBFA 1IB0A 5BQ3A 3K32A 3NPAA 4PHTA 1DKRA 1OFTA 2PYDA 1RNLA 2VDQB 2Y1GA 4JHXA 4TWBA 3F5FA 1SC1A 2AOTA 2PJUA 2W48A 4J0FA 4BO6A 2BKUA 4AJIA 2JJQA 3H17A 4N82A 2HU7A 5BW5A 5MFZA 1Z25A 3CZ5A 3ISVA 3R5FA 2PFSA 4L75A 2CD7A 4CIAA 3PPYA 5ITZB 2O3TA 3O6VA 2F9LA 4D5EA 2GXAA 1O6BA 2AN9A 2B92A 2FFRA 3ZDFA 3L46A 2I3AA 3AOEC 2HA6A 1M7BA 2BKEA 2X4GA 4Q82A 4ZV7A 1LSOA 4GS5A 3VO2A 4WOKA 4BBAA 4B85A 2DG2A 4BWVA 2H85A 1VJ0A 3TDMA 5EZYB 4BMVA 2VQ3A 1GGHA 1HE2A 1V1MA 3EW9A 4DCCA 4HNUA 1W5BA 2FP4A 2PRJA 1TZKA 5CG1A 3EXG2 5EXTA 2BGIA 3RYHA 4YHHB 2H31A 3SQNA 3K0FA 3V8MA 1E7MA 1WHSB 5JJ5A 3CUWA 2BTQA 2FEKA 3GZTB 2CYBA 3OQIB 2HPHA 3WGJA 5CEFA 3KAQA 4AICA 4IDDA 1H2ZA 2IPAB 3I9V1 3MJVA 1L5FA 2GBPA 1Z6TA 1RHQA 3L8YA 4LX8A 2ZB4A 4QGGA 1G5HA 3CFYA 2P9ZA 4LF6B 1OKKD 1L1QA 2IUYA 3KOOA 2W70A 1RJGA 2MTBA 2J4FA 1YGYA 4NG5A 1JBEA 4ZOCA 3L8DA 5LP6B 3IP1A 2W5UA 4G0PA 4QTZA 4I1YA 1AGPA 3EYWA 3OIFA 2QYOA 4IKOA 4OQNA 3DXZA 3U62A 2YXDA 2A5FA 4UE6A 2XXBA 1JU9A 3C8MA 4KRGA 4U6QA 1UL1X 4HVLA 4BMCA 2ZK7A 2RGYA 2DXIA 1M1ZA 3B3AA 1TRHA 4GLBA 5EKTA 5FR1A 1U94A 3M34A 3JAMA 1NULA 4KPUA 4L8YA 1JAHA 2X8AA 4EG5A 2P3OA 1Z4MA 3L1KA 1NFFA 3GLHB 1KXJA 3LWBA 4N4AA 4N47A 5MF6A 1YCDA 4R9VA 1P33A 3OX3A 1F6DA 4XR9A 2MU1A 3LP8A 3MWEB 4MAMA 5DZSA 1RJWA 3GH1A 4KHZA 4PGAA 4YAJA 3TIFA 3UWOA 2CVZA 3EARA 2P2YA 3QE0A 2CY0A 2PD6A 4DBZA 7ABPA 3F9CA 3ROGA 1PI3A 4RIFA 1L4GA 3NTQA 5CFOA 1ENPA 1HE3A 2JB9A 2PVCA 3AONB 4HDKB 5I6DA 1DLIA 1OTXA 2JAUA 4OLHA 2HLPA 2OLEA 3E1KA 1EVLA 1Z5WA 5AJZA 3OZWA 3EG9A 1Y3CE 4Z1MD 1D6SA 1U02A 3MWFA 2YH2A 1AHIA 2ZJ5A 5UKDA 2ECPA 3H7IA 4WXRA 5CAEA 3C7AA 1F51E 2HM7A 3DJYA 3X0DA 2BEWB 1KARA 3WNVA 1DC5A 2VDLB 1W94A 4D57A 3IQXA 1T13A 3KSZO 3M2PA 1XZPA 3PXGA 2AQIA 1WMEA 3I73A 4J91A 3CF4G 3Q1LA 1EP1B 4MW0A 1AXRA 4RFVA 5E4JA 4EHBA 1OAAA 1LPPA 5GZ1A 1CQWA 1ZCBA 4HYTA 3CXUA 2CL6X 3RRJA 1P4HA 4IR7A 1LWNA 2BAGA 1UBOS 3LCMA 4QUEA 3EEOA 3AZQA 4D26A 1WUIS 2C61A 2FW8A 4US0R 1LPOA 1XAIA 3M4XA 4HTFA 1JMKC 1PR5A 1PAUA 1N5MA 3IOCA 3S27A 2R47A 3ZWMA 1XLTA 4HDSA 2BKLA 4GWLA 4LGVA 4Y0AA 3R6GA 5CTAA 1JEYB 3FGOA 1I4OA 3K53A 3M70A 3O4IA 4AJ1A 1UKAA 3TJRA 1JHAA 1ZGHA 1VP3A 3WLPA 4DSZA 5IBPA 3DF9A 4C6RA 1E3IA 2H9AA 2I4MA 4I9GA 3WWPA 2L0XA 1XTQA 3RIMA 1A98A 3IBSA 2PANA 4GYWA 1QIEA 1U80A 2QJWA 3BGVA 1ECLA 5K0LA 4W1QA 2JJ1A 3FMVA 4QXPA 3QSYA 2XAUA 3IT1A 5KPDA 4ZHQF 2J4DA 4YUWA 1RE1A 2AJDA 3FUUA 4MUAA 4G81A 1SULA 1UZUA 1T5DX 3NM5A 1L9XA 3OZIA 1ULTA 4U7WA 3ROZA 3WKEA 1A1VA 4JLPA 4ZOLF 4MMZB 2ZDGA 4B6GA 1ZL0A 1Z9BA 2QWXA 3SIWA 3ZJVA 3AJ9A 1EX6A 1AUOA 2PT7A 4EO9A 1T0BA 3RSGA 1DKMA 5I8PA 1EX7A 1W4AA 2EHDA 2N46A 3IAAA 4AN4A 1Y9JA 3UJ3X 5D5QA 2LW7A 3NC0C 2C03A 5TV2A 1E4EA 3QPVA 4RSMA 4B6EA 5KVAA 1BS2A 3T35A 2O0HA 3VJLA 2DJ5A 3QI2A 4PVCA 3CSSA 2IF0A 3O9MA 4OATA 4RENA 4EJ0A 2UYQA 4PS1A 1BKYA 1HDEA 1SD1A 2RGNC 5EJIA 4OPMA 3RT7A 4UJ3A 3O47A 1GSOA 4A16A 4DW8A 2XCUA 3O2QB 2A4MA 2IPMA 1JHZA 1HFWA 3JVUA 3Q6NA 1Z47A 3EFOB 3STUA 5ICGA 4YJDA 4I4CA 3UPUA 4TPKA 2VZ9A 3AESB 4L85A 4PYKA 1WXEA 1AT1A 4NPAA 1T26A 3FWHA 3KK0A 3OOJA 4Y9DA 4HUQB 3LL7A 3LCCA 3WRXC 2O3RA 4OMDA 1JVSA 2IK8A 2NVUB 4EMUA 4LAFA 1NZJA 3FZNA 3EFBA 5GZ3A 4BP3A 2WSYB 1WNFA 1XDBA 3O4JA 2Z5VA 4X6UA 4D92A 4Y6GB 3IDAA 8LDHA 4ND5A 5M7EA 2A84A 2Q1SA 2C42A 4URHA 3KVNA 3FTNA 2RAVA 2VXCA 1Z5UA 2RHHA 4L0MA 5CB4A 4G1EB 1U0JA 2D5IA 1PD1A 5CJJA 1L7EA 1TJ3A 4BNJA 1EFTA 1V2GA 4BOYA 2P35A 4KUHA 1EK1A 3W8RA 3IS3A 2NUBA 4BYMA 4IFBA 5B1YA 4YC7A 1EH5A 4FFBA 3CUYA 4WNIA 4BAZA 3BORA 1KMIY 1AX9A 1Z5OA 2IP4A 1AKNA 2OKCA 3C6BA 3ESXA 2R1VB 5TVGA 3WL6A 5TIIA 1LC0A 3B52X 3HJCA 2XVZA 1RD4A 4MIYA 2JLVA 3BX1A 1HDIA 3G8YA 3HUDA 1JGTA 2QVCA 3IUJA 5CGQB 3RRFA 2B25A 2R97A 4ZYZA 1G0NA 3K09C 1ICIA 5IABA 5KJ1A 3RLIA 3EN0A 2A5JA 2NXWA 3EAQA 1U63A 1TM1E 1KAQA 2E49A 1X14A 2E55A 5GONA 1QV9A 2OUIA 2OO3A 3OFSA 1W6RA 2ZG6A 4CM8B 1B76A 3FFXA 3QPAA 4B33A 6Q21A 4M9CA 3ZZMA 1DMSA 4E12A 1MGPA 3CLTD 1RRGA 2EBUA 5CDTA 3GFRA 4CEHB 4JR0A 4RANA 3NI2A 3RVLA 1EFPB 3RVNA 2QTRA 4X20B 3TZCA 2B2XA 1ZD4A 3AJEA 1Z35A 3FGPA 4RC9A 5FUVA 3ASYA 3BEDA 4KAXA 3UCXA 2ZANA 3WLFA 3GUYA 3DAYA 3L8CA 4PSAA 4F5DA 3EPKA 5F9FA 1DAKA 2HFJA 2XTAA 3CKKA 5LUAA 3QHQA 4MUHA 1TKBA 1ECCA 3QP9A 2GWHA 3S99A 3D4LA 3EAGA 3IXMA 1KNQA 3PHGA 1VLHA 4CV2A 1T5OA 2HNBA 2ZETA 5H16A 5B6IA 1DFGA 3LIPA 1QPBA 2XT6A 3NJ8A 4WXYB 1XMQB 3T5MA 1WHTB 1XVIA 3T5AA 2BFCB 1T2NA 1PZEA 1U3TA 1KZ6A 2Z5GA 3DNPA 4U00A 5ECYA 1LI7A 3PXDA 4F3YA 1YAHA 1ZK2A 2XUFA 1S96A 3HKEB 3ETCA 2UYCA 3W5AA 2NSJA 3R6DA 5FKJA 3T15A 3TZEA 1U1FA 5A3SA 4Q3DA 3FKSA 2I1VB 5NLLA 3UYLA 1V9SA 4U4AA 5F3WB 2EFGA 2REQB 2WAOA 4J0CA 1IUNA 2B94A 4CMEA 1PGQA 4I5FA 1G42A 5FAKA 4LVNA 2PIAA 3C1OA 3LDHA 1MVLA 2I33A 3CPHA 4MQEB 4NU8X 3PRKE 3BJEA 3OZXA 1RMQA 4KC0A 4BEVA 3IMKA 1AH2A 3ICWA 2PBRA 4FE3A 4DEYA 2QP3A 4PLWA 5I9SA 3AKYA 3ZV3A 1QHNA 1Z17A 4PGHA 1JLSA 1QDLB 3L0BA 3F7TA 4MGEA 4N1AA 2A3NA 3GBVA 2GPNA 1BKSB 1LFAA 2PT6A 1W35A 1Z68A 1UFRA 2VSFA 3DR3A 4BKUA 3RAGA 4G3XA 3NYRA 5FCDA 1RRCA 2EQ5A 2F1KA 3PFCA 1JHPA 4FW9A 5BQOA 1LXCA 1OXBB 2C8JA 2O06A 2QTWB 1ZH4A 3KKEA 4XYBA 1CEEA 3F6YA 1DRJA 3ZBPA 3MS4A 1HE4A 1IK4A 1N7JA 1K7SN 4RXUA 7MDHA 1EMDA 2QTFA 4LVOA 4B7XA 4CU5A 2EEZA 3BWBA 1OHHA 3NTVA 1NRJB 2BWJA 3E70C 4M36A 2C2BA 5DK6A 1TCCA 1JYFA 3C3AA 3P5BA 4B7AA 4C3ZA 2R7AA 2R7NA 4BVBA 2NO5A 3A1WA 3RSSA 4YRQA 1COWA 1BDJA 2I7TA 3JQFA 2XJ4A 5LSAA 3K8OE 2WKWA 1AUXA 2EWWA 1XRNA 3GJRA 3D3WB 3NYWA 4NBUA 4D97A 4MCIA 4OM7A 4MLDA 1L5GB 2I8LA 3VKWA 2C2YA 2P3LA 421PA 1MO3A 5SY4A 1UDCA 3N07A 2IYSA 4MMYB 3KOXA 1KYQA 1B16A 4HFNA 4IS2A 1Y7IA 4RD4A 4JB2A 4YN3A 4EX7A 3K6SA 5KOIA 3BMQA 2Q5OA 4DLRA 1N9GA 2IT1A 2KPOA 1W0JA 3D02A 5D7BA 3SVZA 1Q91A 3PEUA 1W0KA 4KPGA 2DF8A 3QFRA 1MZVA 1E9SA 3HY6A 1ZS9A 2RFLA 4DQLA 3VGPA 2PA0A 3IIIA 4UVDA 1JQ5A 2XUGA 5ITSA 4LPKA 3VNSA 5AIBA 4LUCA 4TTRA 1M66A 3MCAA 5A9SA 3GLSA 3FB4A 3LKZA 4QPNA 4TZKA 2ZYIA 3VR2A 4DR6B 1D1SA 2VNKA 4JOBA 4M1EA 1JF8A 3JZAA 4X92A 5EE9A 4ZI3A 3ZLVA 3DHYA 1XMOB 1USWA 4MGZR 2OZVA 4D8VA 3EVTA 1Y6ZA 4XGNA 1UODA 1A9OA 3PNMA 4ARZA 4HWTA 3O03A 4HDNB 2V9ZA 4MI3A 1PEYA 1QCZA 1DRVA 3NC1C 4TKUB 2V65A 3IP5A 4HFRA 5LYYA 2WYIA 3THYA 4MO2A 3T99A 1V25A 1XRQA 3IDZA 5E9AA 3STHA 1KH2A 1PSWA 1SK8A 3C6KA 3KTOA 3SYNA 1WMBA 3WISA 3LS2A 2A7XA 1NVDA 1Q50A 2VF8A 3PEFA 2FMIA 4FUQA 4L9WA 1U8ZA 5EQJB 1GITA 3ANTA 4U3JB 3ZHRA 1ZK1A 1JV2B 5BNTA 1OT3A 2J08A 4YY3B 1NE7A 3F90A 3BD6A 4GPZA 4BCDA 4MARA 3ASVA 1DAEA 3QMMA 4LE1A 3E7PA 4G09A 4OXRA 2C1XA 1XKQA 4KW7A 1SKYE 3OQBA 4BMZA 2IY7A 1UKEA 2IH5A 2ODBA 2I9KA 2O2CA 4KE7A 1FNMA 1JNYA 3OWHA 5DXAA 1QRDA 1RXYA 1C30B 5K2MA 4ZJYA 4QZVA 3N2IA 3BDVA 2YNMD 2IXGA 1ZGBA 3M4ZA 5B57C 4HZGA 2J9GA 3D4BA 3G89A 4K26A 3P2EA 4J0JA 3HSYA 1K8QA 4WCFC 5INTA 1ZESA 2FV8A 1LSSA 4RVHA 3VU0A 3A10A 1UMDA 2BFOA 2EVWX 3ZE0B 1PT8A 1XC7A 4R1OA 4FM9A 1KSHA 1DRUA 2LXNA 4F84A 4MQUA 2R6CA 1POWA 4UAUA 2NU7A 4YO7A 5JAMA 2FFAA 1D8TA 1XRLA 3KB1A 1NT4A 4PO8A 4FB4A 1MO5A 1LC3A 2AE2A 4UHFA 4C7KA 3GLIE 4CBVA 4AQYB 3GCWA 3OPYA 4WKOA 4EKGA 3K9FC 1P17A 1VKZA 1Q3KA 4AUMA 4J1TC 2F6RA 2H63A 4CG1A 3BIWA 3KNZA 3GGJA 2YJ3A 4NFLA 3LBNA 2TMDA 1NLYA 1A4XA 2E87A 4IIJB 4OU5A 4US1R 3V97A 1SUSA 2JLCA 3ODGA 5LQAA 4QJBA 1KH3A 2DHDA 4GZMA 3W7VA 1US8A 2CMHA 3MMNA 4LDJA 2PM8A 4TYNA 3TMKA 1VPWA 3R7NA 1L5VA 3IEPA 5C46F 1N1GA 1XL0A 1FSGA 2OBYA 2ZUTA 3D0KA 2E0IA 3MTAA 3DBVO 1FFBA 2YV4A 4MOWA 3RT1A 4G9GA 2FGKA 1LDMA 3OQMA 3S3TA 3KJZA 4TS9A 1M8PA 2FJ0A 4KU4A 4D0GA 1M6YA 3FPHA 4IQ8A 3OZSA 4BWFB 4WA7A 2O8FA 3D6VA 3KYCA 4O4JF 4P4UA 1YUNA 1AGYA 3ZHSA 3EIQA 1IM5A 1RFGE 1V96A 1J8MF 3EDQA 1ZH2A 2HREA 2VJOA 2ZIFA 4LZNA 4YMGA 1ZJJA 3I37X 2FZKA 1M5TA 4KWCA 1XJWA 5GWXA 4JY7A 2WOJA 3GZNA 3JVIA 3U4AA 4B0PA 4I4TA 4HS4A 1M1YE 3CB4A 4CTOA 1MRNA 3GLUA 2BBWA 1NVAA 3OE4A 4JVMA 3ZHXA 1E2EA 3V1UA 1P73A 1C7RA 4PGGA 3AU8A 1M54A 4R2XA 3SBOA 2BMEA 4DWVA 4Z3OA 1YSCA 5KO2A 1R6AA 3O2JA 4JC8A 1EP3B 5JVDF 4NU0A 3OLWA 1STOA 2FMFA 1U6KA 2WTEA 2ZRBA 1ZFNA 3HB4X 3OZ7A 2H07A 4MWEA 5D1HA 3NP9A 2FE1A 4ZVRA 4ZVVA 5A6SB 4DLBA 4DGSA 2O4CA 2I8AA 5ADWA 1OREA 1SOWA 3ORYA 3I39X 5BYBA 1GPYA 3OI7A 5IFLA 3KQWA 1PX2A 2W4IA 3IBGA 1OXVA 3N58A 2Y1XA 3JYNA 2QD1A 3QKIA 4LE0A 4UOEA 2ALJA 4JOSA 3AFNA 4Q4AB 1AQLA 4CNQA 2XUQA 4MW5A 4LYYA 4P2GA 2NZ8A 3ORHA 4H6VA 1FXWA 1EPUA 4XCXA 2VDOB 2ZQYA 1VYVA 2WF7A 2WPDD 3DCJA 4U2FA 2ZUEA 3RBXA 1A1SA 1GTJ1 3U7QA 5KNBH 5JT1A 1P1BA 4BRWA 4HKTA 3HN2A 4K9OA 2XD9A 5TQ2A 3ZK9A 2WILA 2P1DA 4YPFA 3NP7A 4MUXA 4DDKA 2BR3A 3QBVA 3R5KA 4ZU3A 5FWXB 1F17A 2PG3A 3DXYA 1SC9A 3O9VA 4LJ7A 4FC6A 1MB4A 2O6HA 1GFSA 2VC2B 2EKBA 5C8XA 1CUBA 5DKFA 1UJ4A 5IDXA 1M2GA 4XRRA 3IQZA 2QBYA 2PUGA 1KYZA 3TLCA 4ND8A 1WZEA 2QLMA 4RHFA 4TLLB 5LA6F 2C3YA 1Y4ZA 3VV2A 1BJTA 3W5DA 1BX3A 3PPIA 5KCMA 1G41A 3W3AA 5ADHA 3CZ4A 3CHYA 4CKBA 3HB1A 3KJHA 3FFWA 1K89A 4Z0HO 3AERA 4XEHA 4YRSA 3WMXA 2PZJA 3HM2A 5HOQA 4D25A 3MMXA 2I3DA 5BV1A 3EPJA 4M6WA 2IDJA 2VJDA 2Z2YA 3RBVA 2OG1A 2ZUCA 5DASA 3UMJA 1JZSA 4RY0A 4WLEA 1NPTO 1X87A 1PV4A 3UWKA 5KVSA 621PA 1QP7A 5M04A 4BE9A 1T4DA 1B0PA 1CCWA 1Y7PA 3CGWA 2OYRA 1KNXA 5EJ2A 3PQ8A 3AF0A 1KAOA 1RYBA 3JCZA 4R16A 3TM5A 1ISGA 5BURA 3DCYA 5CEEA 5JJBA 1KYVA 3COWA 1GZ7A 1E0SA 3EVCA 5YASA 3F7NA 1WEHA 4OA8A 4B3JA 1XZJA 4ZO9A 1N36B 5HS4A 9MHTA 2GUWA 2XUDA 3JQGA 1RLOA 1WSDA 2HWKA 4MVJF 4FGSA 1HDYA 3A27A 1ZKDA 1UOQA 4YV1A 4J16C 4RCYA 5CIWA 2XUJA 5J59A 3LY5A 1FBTA 1T1IA 3MJEA 1PWEA 2EW1A 3BUSA 4HVAA 4WW0A 3G0OA 5CDFA 2HAEA 4EELA 1ODSA 2NSDA 1DBWA 2X2PA 1VB3A 4YDSA 5B7PA 4X6YA 1HSOA 4O63O 1ZWLA 1RBZA 1QYRA 1NVTA 2VUIB 1J0XO 4JB3A 2H54A 1CQIA 5EXPA 2XGGA 1QO0A 4Y98A 1T9ZA 4ACBA 4AUKA 2RH4A 3MWDB 4L0QA 1UWVA 4MGHA 5KAMA 5CFRA 4WY2A 3SQOA 1JIVA 2D8MA 1M1NB 4ESOA 3SQMA 5HPYB 4D9HA 1P9OA 5K20A 3QVTA 5IDYA 3RJ9A 2B4QA 2X7XA 3C6XA 1E6KA 5HJ2A 3TMYA 4BVGA 1O94D 3K0BA 1QRTA 5DHQA 1PO7A 2FMUA 2JI6A 2FQXA 1OYOA 2I1QA 3ZU5A 1FX1A 1ZRHA 5F1OA 1CJBA 2Y6VA 1FDVA 2MIIA 2PQ6A 3QKWA 4OYHA 1FE8A 2FPGA 2JDIA 4OB8A 4P93A 3R7BA 3RG2A 1KEWA 3W90A 2HT6A 4DLWA 4FK8A 1IBRA 4QTYA 2IX9A 5ABPA 2YHIB 2BUCA 1TIBA 1IQUA 3C3YA 4UVEA 1P3DA 4LDPA 2FOIA 3B7GA 1QORA 3KT6A 1NC3A 2DFDA 3ZDEA 3SS8A 1G7CA 3PC2A 3LDGA 1BX0A 5SYNA 2VWQA 2ZVPX 3BK7A 3PNQA 3OU2A 3SYLA 3U4MA 3W2HA 2DCUA 3ROMA 2FJPA 5CYFA 4IDNA 5JV5A 1DZ3A 5J2UF 4ENQA 4IBOA 2FR0A 5G4KA 5DYNA 1RJEA 1EKXA 1SCNE 4FFPA 5G1PA 4JJGA 3IA2A 4E32A 4A0SA 1YBHA 1KZ9A 5BORA 4IDGA 3U7RA 3C1AA 4FHDA 2ZIVB 4EQ6A 2HYIC 3CLHA 3E2IA 2A35A 3P9ZA 1EWQA 3OJEA 2VNSA 2EJCA 4G9BA 3GIDA 1UPFA 3IURA 3K2EA 1ISJA 2UU9B 4YWJA 2GFIA 2Q1WA 3WRVA 4KQWA 4BC1A 4CT4B 4EFMA 1XX6A 4B5LA 1K4KA 1WUKS 5A4IS 3GRFA 1JYSA 3HVIA 1E63A 2B5OA 5DNDA 4F45A 4ZDKA 1SUPA 1HDOA 2DHRA 3I52A 2UKDA 2WTUA 4E33A 3UJHA 4KQ6A 2BD0A 4TMXA 3E22B 5ENVA 3F0TA 5A2GA 1KH1A 2ZE6A 3E9MA 4TWRA 2ZXUA 2XCQA 1HDZA 2VPIA 3IHLA 1J33A 2BC9A 2QE7D 3C3JA 2ZU6A 1O7JA 1SD5A 3IUQA 1CR6A 3PVSA 1EU1A 4K81B 4MV5A 4AXXA 5EZQA 4D82A 4YRRA 3KJNA 2OFFA 2MINA 1YQTA 1OYYA 1JLLA 1VMKA 4HL6A 1PQUA 4JP3A 3TF5A 3IDFA 4MDHA 4BGVA 2K5UA 4X3OA 2D7JA 2QJOA 3ZU2A 5U9CA 4HMQA 2Z1NA 4MYCA 2PVSA 2BVNA 3RSZA 2ZIXB 2ZBQA 4UREA 3IOYA 1TCAA 5FI1B 1H22A 2WF9A 3MFQA 4I5GA 3CY6A 1JMYA 2X0JA 4FD2A 5HYVA 4KYUA 3K9LA 1P91A 4C7OA 1J6UA 4IJKA 4ND4A 4LYFA 1GHTA 4CEIA 4KIFA 1MRSA 3DO6A 5DEOA 4AROA 3FHOA 3E9CA 2Y8EA 1U2DC 1XQVA 2JEZA 5J2TF 5C7LO 1FTGA 5COAA 1DAFA 4HN2A 2ATVA 2FDRA 2JEYA 2QTGA 4OCZA 5KWIA 3BMNB 2YHBA 3CZPA 4RK6A 1U7HA 1DXYA 5IDQA 3O91A 2W98A 2Y4NA 3DMDA 4L6AA 2FFHA 4G85A 4OQFA 1ILWA 3D5QA 2Z1DA 4UOQA 1L4HA 4DLYA 3E3NA 2QW8A 4KB5A 3QXGA 1BRTA 3FI9A 4K6CA 4TWAA 3FTEA 1ESMA 2VAXA 2HBZA 3JQPA 4G5XA 1X3SA 4PLPA 3FCAA 4RKQA 3NBQA 4EB0A 1YOVA 4KITB 5KHLB 5ERXA 4CCYA 3BE4A 3SF0A 3F5QA 3LA8A 3Q15C 2LKDA 3S1AA 1QGED 3H5AA 2O2DA 1WD5A 2WW8A 3L8EA 3CJTA 3K9QO 5CX1A 5DNWA 1R64A 2WSSA 2O9JA 3C0KA 4B7ZA 2K87A 2BGWA 3WBFA 2FZEA 4FSXA 4DLPA 4P4SB 4ZALA 4GKAA 1NP6A 3RASA 4TTSA 4J6FA 2UZ0A 4JOCA 3RUDA 2BMFA 1HDGO 1GEEA 5CA0F 4KVAA 3UXMA 1BEEA 4J3NA 4Y6QA 4S0XA 3E9DA 4O5OA 4AY6A 2AQHA 3KYBA 3TW6A 4O59O 2SKCA 4DLVA 5EY5B 1GSHA 3OKFA 3RFVA 1WP4A 3T4EA 1A69A 4BLRA 4CVNA 1SUEA 4EBFA 4TXLA 5F7JA 4KUGA 3AR2A 3O95A 4KJXA 1TJ5A 2QUBA 1O0SA 3SJAA 2GA9A 2XDQB 3KHUA 1P1CA 3Q4GA 4BU0A 5I48A 1NLMA 1YHZA 2XUAA 2Z5FA 1V35A 1HSZA 4NCAA 2NUPB 3TSYA 1VJ5A 2APJA 2QQFA 5EIFA 2CNLA 4ZT2A 3RUIA 5EWMB 3DBHB 3R4CA 5FBRB 3SFZA 1G21A 4UAGA 4UJ5A 3VKVA 5GP1A 5IKMA 3RVMA 2Y0CA 1GGFA 3V8QA 3OJLA 5C8DA 4KN5A 3WLSA 5B6PA 1ZHFA 4YAOA 3RFTA 3GDWA 1R9GA 4FBGA 4V02A 4YRNA 4OHWA 3M6WA 4R40A 4JL5A 3VZSA 2GXQA 2I2AA 1S3IA 1A4UA 4G0NA 2O7RA 1RHMA 2W00A 4BJ1A 4TS1A 3I72A 4JBLA 2JBHA 3COVA 2QL5A 2XNCA 3ZI0A 3ZWBA 1Z6AA 4NNJA 4YPVA 1JEQA 2OM2A 2QN2A 2H2WA 2UUOA 4I8IA 4RL4A 1V3UA 4HLNA 5E95A 3ESDA 1CNFA 2GETA 1KIAA 2JFZA 2PZ8A 1DCTA 3IDQA 4G9EA 3EVDA 4CQLB 3OQ6A 5IDVA 1F20A 3GMIA 1RQ2A 2O3SA 3FMGA 4BFZA 5BXYA 3BE6A 2QN3A 1Z6XA 1BW9A 4K9LA 3QUTA 2G9NA 4WKCA 3VV3A 1O97C 3WRWA 6REQA 8GPBA 3T8YA 1FF9A 2WI8A 4P3YA 1MIOB 5BWCA 4JS0A 4EP1A 4RIHA 3VYUB 1CK4A 5F73A 1ORIA 2OORA 1HNWB 3L8FA 2DBYA 1SC6A 1Y6RA 3I05A 4FN4A 1BN6A 2VG8A 3F46A 3G7UA 3MJHA 2EJUA 5FP0A 2ZJYA 5AVTA 1GPAA 1YIAA 1MRZA 1A9XA 3BBLA 3VKHA 2OAQ1 2QQ5A 3OIDA 4C0WA 4YR9A 1U7XA 1QYDA 4HAZA 4DEVA 1SMKA 2L42A 2FMHA 3IJPA 1PX0A 1KO4A 2ZJ6A 3W9YA 2EIHA 2NNLD 2VSQA 3JAWB 3P2OA 4WA8A 4YRGA 1C1XA 1Y1RA 4GVPA 1LF5A 1ACMA 1RWVA 2NW6A 2PLWA 3AY3A 4HCJA 3UK0A 5BR4A 1X38A 1R0LA 1WCWA 3PJDA 1J20A 3PKJA 3RVPA 3A04A 1F14A 3WO0A 4A23A 2H7XA 5AESA 4R69A 1DC4A 2BI4A 4KRXA 5HBGA 3ZVRA 4EKNB 1QS0B 5JEDA 3BIFA 3A6LA 3IX7A 5SY9A 3L7KA 2IYQA 3DC7A 521PA 4AP5A 4ALMA 3HL4A 5IWAB 1T0UA 4I50B 3CVJA 2IELA 3HBAA 1GA4A 2W37A 1VLMA 3CWZA 5HFNA 4O2AB 4YWHA 2R6JA 2ON6A 3TJZA 1ZISA 1C1YA 2QM0A 2XTJA 4QRHA 1QGYA 1Q83A 3CLRD 3WQSB 4AP9A 4YXFA 1A8IA 4ZT6A 4ZCRA 3C7KA 3D2BA 3TVDA 3E23A 2G0NA 2I1WA 2HMTA 3I4LA 1IHXA 1JAZA 3FYSA 4IG4A 3AI1A 3O8OA 2Q5JA 4R1SA 4RVOA 4B4WA 1KP3A 1XMIA 4BZPA 5BQFA 1EXDA 2UVDA 1X7GA 2ES4A 2V9PA 4AMBA 4BMPB 5JWOA 2EHJA 1Z45A 1QHGA 1BXGB 1P0CA 3L05A 5LLSA 1FTYA 1NMXA 3HHPA 5G3ZA 2XMGA 4EY5A 4D2IA 4E07A 1N6KA 3TAXA 5EQDA 4GI3A 3HR7A 2D5BA 4UHCA 1FQKA 3HWSA 1EE1A 1DQNA 5TT1A 6NULA 4YMWA 4CLRA 5IUJC 1LNZA 1YD7A 3GGSA 4WZBA 4D44A 2AKEA 1EGVB 4UUNA 1C29B 3O8QA 1E7QA 5AJHA 4AG3A 4B4KA 2JH9A 5TY0A 4PFQA 2V7GA 2AV6A 1R4MB 4AX8A 3WWEA 4WMLA 4JSRA 5IZ4A 1TMKA 3OZRA 4P33A 3V3KA 1CC1S 4RF5A 1G8AA 5EPUA 3ROXA 1IRIA 3BERA 4UNSA 5AH0A 2RIRA 1B00A 2REOA 2AE1A 1WPRA 3QKRA 4HX9A 1Y9DA 1PKEA 2RHMA 4MVJH 4WOCA 3H1PA 3FYUA 4FGZA 2PKRA 2MYUA 2GLTA 2ODNA 4Y6RA 1G6KA 4JJ6A 3RM3A 1R6BX 1QG4A 4M7PA 1UDXA 2JAPA 3AUYA 1ZN9A 4QDOA 4BYGA 1BS9A 1XNQB 1F8FA 2CKMA 2GERA 1VPEA 2YRFA 4RV4A 1V5GA 3MTGA 3DDNA 2GK3A 3PQEA 3O4HA 4K9SA 3SKYA 1JSXA 3IB3A 2DEUA 4D9FA 2L19A 3DH0A 5JAOA 2X14A 1N6HA 1X74A 4CKWA 3H2GA 2H2HA 3KJEA 3SJ7A 1FDUA 4NICA 2DT5A 3SOZA 2GO1A 2EBWA 1NBHA 1E3TA 1G1MA 3NV7A 4ZEOA 1D04A 4JJ7A 4RJTA 2CUZA 2GYUA 3ZVNA 3NH9A 4IP0A 3NGLA 1FNBA 1XCLA 1M0TA 3ADPA 4OH7A 4B3XA 2FPPA 3CH5A 4N49A 4FHGA 1ORDA 5KOHA 4YV0A 3Q8LA 4NJOA 5LWQA 2X2EA 1L4LA 1IOLA 2J7KA 4MWGA 4WBNB 3JQAD 4E5NA 1A2KC 2IU3A 4B3GA 1EBUA 4L3WA 2C2GA 3B6JA 1NVMB 5A5VA 3WGMA 4UVGA 4NBVA 1UBHS 1VA5A 4FIDA 3NH6A 1Y5IA 2HA4A 3U7GA 5D51S 4Q47A 4E2ZA 1NHGA 2BM0A 4KE6A 1C8KA 2H4ZA 1ZR2A 5BUCA 1OV4A 1TO2E 1JTEA 1X0VA 4IUDS 2I3BA 5C7OO 3RWMB 4NCBA 1ZSVA 1EVKA 5L40A 3RS0A 4BLQA 1ORWA 4C1BA 4KXVA 3FYHA 3O26A 3DZJA 4RA6B 3K0HA 3SZRA 4L9AA 2CMFA 2OB2A 4MR9A 1VHTA 4JYAB 1IXKA 1RLIA 2A94A 3H5IA 4MCJA 5COBA 1UINA 4RDHA 1YHYA 2QSZA 2ZQ5A 2IFTA 5D6OA 2E21A 5HF6A 2IODA 4DADA 4F2PA 1RI5A 3OQVA 4NFSA 3A4VA 5AOVA 1OROA 2VATA 1JYEA 1Q1NA 3LKBA 3QLUC 4X6XA 4YAIA 4ES6A 1UBMS 4I1UA 1IM8A 4RS4A 4NARA 1TUEA 4MV7A 3VFDA 3GX1A 4KTVE 4I55A 3M33A 1KPIA 1TVKB 1MDBA 3ZHCA 1FLAA 4M0EA 2E4WA 4BEBA 3KVYA 4TLBA 1R88A 1ZMTA 1M74A 1GDTA 4ZT4A 4DCNA 4BQQA 2DSNA 1XSEA 1EINA 5TS2A 4NE9A 3CISA 2RGRA 1AV6A 3T9AA 5HCIA 4EUKA 4O4LF 2OFPA 3QENA 2AOUB 3RYFA 4ZICA 2QVLA 1GQRA 2VR1A 4DCOA 2DMRA 3AI3A 1ESNA 2R8EA 3PT5A 2C5HA 3OPQA 4M1KA 4NMXB 3RJ5A 5JDCA 1P80A 1GL7A 3II6X 4OAOA 5FUWA 1GV1A 3Q2IA 1KPHA 2ZYRA 3OZBA 4JLJA 2WM8A 1X8KA 1AG9A 3EEFA 3IHTA 2W2TA 3K5PA 3OF2A 3OU6A 3PNOA 4A26A 4F4DA 1FXUA 1I1QB 3O21A 4G37A 3HZRA 5REQB 3DFZA 5IM5A 2RAFA 5JH7B 4KGDA 3AY7A 5TPWB 1XELA 2H8KA 1JVNA 2WWIA 1U1GA 3WNZA 3HU1A 2MWMA 1XEWY 1GDDA 2Q2OA 3IEKA 1PR9A 2DWUA 3Q7SA 4IIEA 3A4NA 4KPFC 2J6HA 2XAAA 1DFHA 5DN6A 5JSKA 1B15A 1J22A 1DAPA 3GJ4A 3PA8A 4ARAA 4EGFA 4YCSA 5M3BA 5FUMA 2FZVA 4L15A 1YV9A 5A4AA 4HLQB 3OC6A 2IBMA 3IPRA 2J6IA 1GNTA 1P72A 4HEQA 3U9LA 3FBTA 3TUJC 2BHLA 4CKXA 1GJRA 4I5IA 2CNWA 1G3UA 5SICE 2AI1A 2WJIA 4EFNA 2Q4BA 1IWPB 1E79D 1ZJYA 3MWLA 3M7IA 4A7PA 2VTBB 2R66A 2ZJ0A 5F64A 3KETA 3RWBA 1DRWA 2EZTA 3OZCA 3P9YA 1ZVKA 1PFUA 1OFIA 3QLTA 3MBKA 1W1IA 1LSUA 3IPYA 4NHEA 2ZI5A 4TGLA 2XW6A 4B3IA 3VXKA 5KNDH 2I65A 3SEAA 3WKDA 2QG4A 3PZBA 3CQ9A 4EPYA 1IZ7A 2O48X 1WABA 4DJTA 1WZNA 3D7NA 3H9UA 4GR9A 4KUEA 3V8VA 1O3YA 1X7HA 1QZXA 4IG9A 3K9CA 4L72A 2QTMA 1SZPA 5AK0A 4E46A 1O95A 1IDOA 1EJ0A 1KHHA 5JWHA 4XGKA 4DJFC 1AXEA 1A7AA 3MT9A 4I2NA 5HTOA 1Y8RA 4C4AA 1OBHA 4OHFA 5FH9A 3Q88A 1WBJB 2W2LA 3TLBA 4AIIA 5C1BA 4H1HA 2CMDA 1F0PA 1E77A 4XQGA 1YJCA 3GFVA 1YU9A 3I76A 3MXTA 4LHWA 1QQTA 2Q3JA 5DGDA 3BSWA 4EHJA 1R15A 5K6RA 1U5BB 5KOJB 1H05A 3WWDA 2P1RA 1KETA 2GPYA 4W5HA 5LJIA 2BRUC 3D59A 3WGKA 2R5WA 1D6MA 2CVPA 3JATB 1ISSA 1T6YA 3T1NA 3HG7A 1I94B 3QEOA 3UIEA 1GRCA 2Q5QA 2BE7A 1T4CA 5J3JA 1FDSA 4RPKA 2JFQA 3LXMA 4JR1A 4KDCA 4AZ0B 4G0WA 3K73O 1GYRA 3MTBA 1GFIA 3VR5D 4KZKA 1U31A 2RGCA 4KMSA 1EZ1A 3PGJA 4XB1A 2WUWE 2ZWMA 3PUWA 1GCOA 5CU7A 5HVNA 4PYQA 3FN4A 1RKBA 1S3SA 1WG8A 2W2OA 4WEQA 5DLDA 5HOEA 3T12A 5B12A 2GM9A 3T3NA 3L6DA 1MEEA 4XCVA 1GVNB 1Y98A 4Z99A 4GL4A 3FTQA 3WA6A 5C8YA 5C7IO 3GVCA 2ZM5A 4O4JB 2W43A 3PCRB 4PHCA 1AN0A 4KWHA 4DOMA 1G19A 2J48A 2Q3DA 4KDFA 3HP1A 2EBHX 3QFTA 4RPIA 4A8TA 4EGSA 1ILEA 4RVGA 1OT5A 2HLNA 4W63A 4UNQA 3VDMA 3VA7A 1VE9A 2FKNA 4EAAA 1FZTA 2WIKA 2QROA 2RJNA 3FRJA 5ALDA 4JBYA 2YVUA 3HA7A 2OMEA 5JPCA 4N0DA 4B7CA 3U44A 2AI2A 4RVNA 2QPTA 4QGFA 2AN3A 3PIRA 4QKQA 5JLJA 5LN1A 2X9NA 3BA6A 3NAGA 1YVPA 4KIUA 5ADUS 2DR2A 4G4GA 5KMGB 1U99A 4R1NA 5DLQC 1XZEA 2R8YA 3D5EA 4HDRA 1QVVA 4M0PA 3LQ2A 1AC5A 4E4TA 2WWWA 1YACA 3DLIA 1P1KA 2E4AA 1E2LA 4I3HA 1UKCA 2G9RA 4FOSA 2GTIA 1SO8A 4P5EA 4LK2A 3HRIA 1ZK0A 1JLRA 3U39A 1IC6A 2QSJA 2YHSA 4Q0MA 3L01A 3Q9SA 1K06A 3RS3A 2P9YA 5DSTA 3V2UA 1PTJA 2IYPA 3C7TA 3KJIA 4KSCA 4YB8A 3EEQA 4PG8A 5C51B 5LMNB 4JLBA 1J0DA 4UMFA 3M4YA 2HQRA 1MEJA 5BMVF 4DV0B 1YVRA 3GPDG 4QFMA 1QGUA 1PZFA 4KR2A 4RVDA 5F2OA 3D1LA 4K8OA 3ES9A 4E2FA 4D8UA 1ZX1A 1OILA 2H4FA 3HKBA 4HGRA 1SXJE 4RPGA 3GRCA 4ER7A 1NF9A 2WNIA 3DOUA 4W8GA 3DYBA 5FX2A 2FSVA 1E5QA 2JFNA 4U8HA 1YL7A 2X77A 2SECE 4P1ZA 5KX5A 3AJRA 4HSGA 3GJSA 1OWPA 3F71A 5E8RA 5F1PA 5K09A 1EXVA 4V39A 4JJ8A 4AC9A 1NW3A 5DM70 5LA6B 4CI0B 4YBRA 2DCMA 4Z9FA 1NDQA 2GNOA 2F4VB 2O7VA 2HK8A 1YZ3A 3TQSA 1RBQA 4BJHB 1V5IA 1YBFA 4JP1A 4L8WB 1J9ZA 2SBTA 1GQQA 1QB7A 1KJ9A 1UP7A 2LP4Y 4FYJA 1ICEA 2PS3A 2YWRA 4KLCA 6ABPA 3WNDA 4KQKA 1QUEA 4OD0A 5AM1A 1H3NA 1P6XA 2ICAA 3K9HA 2XSZD 2HMAA 4KQXA 1IATA 4UNIA 2JZOA 2X5KO 4OHPA 1TOAA 4A1FA 1XEXB 4MVJD 2BFAA 3QPBA 1W85A 4YACA 1A8UA 3EXG1 1RRFA 4RMIA 4DSAA 1KOFA 2G0AA 1Z37A 2XQKA 1NVVQ 5TVKA 2XLCA 4QVGA 3ZWOA 3S1SA 1E3MA 4JBXA 3TSWA 3L41A 5F4ZA 1HMYA 2BFBB 1VBNA 5ADVA 2PBFA 1TQ8A 1UBCA 3VPSA 4EB3A 1U4OA 2EU8A 3BGDA 1ZGCA 3C3PA 4M37A 1FRVA 2QT1A 1RP7A 2P9GA 5JW6A 1D0IA 2WJ6A 3T1HB 3ZE2B 3DL2A 3W06A 1RYHA 1BFKA 4ESVA 1O57A 3Q0IA 1JJ7A 1REQA 4PC2A 5DCWA 4FDLA 5J4YA 2IOQA 4IDCA 2J9XB 1HTWA 3W8NA 2ZYDA 2P40A 2QNBA 3LM8A 1U8TA 5LZ2A 2QY6A 2VBIA 2ZSAA 4IV8A 5IYZB 2N42A 3AETA 3O75A 3N2GA 4KWEA 4B45A 2BJWA 3A6DA 4EZIA 2G04A 4KDRA 4GDFA 1MAAA 4ALIA 4BNZA 1SVLA 2Y66A 4QOEA 5JS2A 2C97A 3ILXA 4KP7A 1PG2A 4R71A 2IXTA 3PE4A 4TYMA 4JGBA 5JSYA 3ILYA 1N0VC 5EMHA 1OU4A 2YFKA 3B3QA 4JGGA 4N0EA 3QUCA 4QDZA 2BJVA 3AYZB 3QVUA 2Q4TA 2QG6A 3GC6A 3UHAA 1NKVA 4FMPA 4GM4A 4J1QA 5I4KA 1O5IA 4H7FA 2ONCA 4NYJQ 4AKHA 1MF7A 1CU1A 4IO1A 4OAQA 5KYUB 3QKSA 5F2KA 5A5GA 3UGKA 3FH0A 4YMSA 4D9GA 5B2FA 5IZCC 4MQLA 4PPGA 2E3JA 3FUVA 4MKZA 4PBSA 5T8KA 4EOGA 4TZ6A 1DCKA 4JYZA 3A6PC 1V3TA 1W96A 2LCIA 1UC9A 3B36A 2H9YA 2H8GA 3G2HA 4YP5A 1L4YA 3DLBA 5LXTA 4QGSA 1OZFA 1QOQB 2PT9A 2J0UA 2DLCX 4N76A 1XZLA 4O2BA 1GFZA 2HF7A 4KFSA 4QXRA 5TDHA 4ZVNA 1DXQA 2ZJ3A 2FW7A 3NVDA 1YASA 3OEHD 2FOLA 1E3WA 3HJBA 4GAEA 2ZPUA 3EPHA 1H2HA 1IM2A 4MRVA 1WKCA 2JFBA 2DERA 6GPBA 1TE2A 1E60A 2LKCA 2AHRA 3A05A 1YR1A 2I3GA 4U39A 5F35A 1F4PA 3QXCA 4AWXA 4DY6A 2AFVA 3CBGA 3D4NA 5K1ZA 3AVYA 1FYDA 3FAKA 3D43A 4TLDA 4X90A 3KJQA 1W9MA 3DONA 3N8KA 2OVBA 5I5GA 3R5HA 2J5XA 1UP6A 4X1YA 3E5HA 2FETA 3FF1A 4B6JA 1I14A 2RHGB 4RD3A 4HDQB 5E4TA 3K70D 3QYFA 4WESA 2O0LA 5IAGA 2BDTA 4Y1EA 3TL6A 3DKKA 4K2HA 4FHZA 2O7SA 1RXUA 4YTEA 1BJKA 2J45A 4CW7A 4LJ9A 2J41A 3T7AA 3T3DA 1DDGA 2Z08A 5EE0A 1SIBE 1FMLA 2RGNA 3K70B 1WV1A 4N01A 4HAWA 4N5LA 3D3NA 3PRYA 1CIJA 1L7BA 1Q0PA 1VE5A 3JQ9A 3JASA 4RTRA 3MJSA 3WXMA 1GN8A 2GCOB 2VRCD 3H2BA 4FOTA 4QDUA 5EQTA 2X8JB 5ISMA 1ZVVA 2XGJA 4B46A 1DQRA 1WOMA 5BR1A 2VUUA 4B2YA 3UB3A 2PGLA 4RX1A 3G79A 1TTTA 1G17A 1HMPA 1CDDA 2ZYUX 4W9NA 4OHVA 3WRXA 3HCRA 1JN0A 1EWYA 2AFHB 4HY3A 4AFNA 1HKUA 2WTBA 4F3RA 3O4VA 1YE8A 1EA7A 1G8GA 4R9RA 3TMAA 2H5IA 2PSSA 3DKPA 1J09A 1PK8A 4R05A 4WTOA 1NNEA 3DMYA 1GNQA 1POXA 1SGWA 2IHJA 4GOXA 4C03A 4XCQA 3INNA 3TTYA 5DGIA 3NGMA 3WFIA 5AW2A 3TZBA 1JFTA 1N1EA 3FWNA 1ZJWA 4B4UA 2QLJA 1OH8A 3QWAA 4DLXA 1KDVA 4C1NA 1RWNA 1GR1A 1ETHA 3KEOA 3PXUA 3OQ1A 5DI3A 3RS2A 1U8XX 2HT1A 4GKVA 1HQYE 1O2DA 3ZY5A 1NYQA 3TR0A 3LL4A 1NNLA 3H1EA 2XQFA 2OGZA 4GI2A 4LXIA 3RIGA 2OO7A 4OHKA 1GG2A 3UC5A 2Q8PA 2Q7XA 5AVZA 4CLHA 5BVHA 4YJHA 2V5AA 3OLZA 2TMGA 4QDTA 4AKEA 4EG4A 2A3RA 1E1QA 5K0BA 1E20A 4F1JA 1GARA 5JAZA 1PJ2A 3G3EA 4IH9A 4Q3LA 1YI0A 3DOHA 1Z36A 3K5HA 1JQKA 3WYFA 3MCVA 3AW9A 1AD2A 4G23A 3SC4A 4N5NA 1CR1A 4ISBA 1ATIA 2QDXA 2AVDA 3EHDA 4LZJA 4S24A 4S1WA 3UHOA 3D3KA 5JFTA 1T29A 2IDZA 1GTZA 1C3LA 1NRXA 3DEHA 3EC2A 1TEZA 4I3FA 4RVSA 4L8VA 3ANXA 2G63A 2MSDB 4G1MB 3L1JA 4P36A 4PXAA 4NBRA 3T5CA 1TEXA 4CIVA 2WQ7A 4OUDB 4C06A 3GLIA 4UPDA 1XXLA 5E4YA 1WDTA 2WQZA 3IKLA 2XE8A 3KTAB 4EDFA 1E2MA 2PH3A 3EGCA 2JFUA 1RJ9B 5BW4A 1GAJA 1QH1B 1U11A 1UJ6A 5TMBA 1K8RA 2BFEB 2QOEA 1W5TA 2Y1DA 3N76A 4DUGD 1PBNA 4DV2B 1LPMA 1A95A 1UMKA 2FK8A 3FLEA 5E4FA 4OX9B 2ZI7A 4TTAA 121PA 3EGXB 4N7RA 2JGFA 1VFPA 2P9FA 5IG2A 4OFXA 5KYXA 1Z6PA 2JEOA 4V0QA 2J9YB 4J4BA 3OEWA 2QV7A 3AVOA 2W6PA 1H2YA 3WXBA 1JXAA 4QUHA 1T9AA 2A57A 1W48A 3TLZA 1YJBA 3N8GA 4TV8F 5CLIA 4R1UA 2ZZMA 2D0DA 4YAWA 2I34A 2A33A 3DDWA 1U2RA 3ELDA 4GXQA 3NALA 1Q19A 2R751 2FXIA 2GN9A 3FDZB 2RDMA 4X8OA 5EESA 1XMSA 1V7PC 1VPTA 2VDWB 4FFLA 4D41A 1JDUA 3IMGA 2D74A 2KBFA 4I1VA 3LUGA 4MJ3A 4OF4A 3N8NA 1ZN8A 3C43A 4CEJA 1M1YA 3ZY3A 1D6NA 1G60A 1W5EA 2JFPA 5JARA 4OGFA 1WW3A 4MQFA 3H11B 4GF5A 1J8FA 1UQUA 3H19A 3ICVA 1Q17A 3ER8A 3IVGA 5SYAA 2AB0A 1H6AA 1UK6A 1E9CA 1Z0AA 4HQ6A 4F6LA 1RPAA 5A4FS 3SYMA 5FTKA 3LPCA 1G38A 1WV0A 2XVXA 4KI0A 1GL9B 3EH1A 4LRWA 1FFSA 1VL5A 2HN9A 3RHTA 2RAPA 3OM0A 3NHAA 3U37A 3E4CA 2DUMA 5DTRA 4D5GA 1W4BA 2ZRMA 2DETA 2X0EA 4V0NA 4F21A 2HHJA 3R5JA 3BL6A 4ZN6A 3JVVA 3JPWA 4CMBA 4N41A 2HSWA 4MHOA 3VI4B 2BEVB 4KQIA 3AVVA 4FI3F 3S70A 1Q1EA 1OGJA 2X7JA 4MLZA 3MTEA 1ADFA 1VLVA 3VPFA 2GAJA 4IH1A 1A2QA 5AW1A 1T4GA 1ZWKA 3NYIA 2RHBA 2GDZA 5JROA 1FFXA 3IV9A 1G8SA 4Q6WA 3KZNA 3Q11A 2M6SA 4DA7A 1S2OA 3U5TA 1DE0A 1DG3A 1Q74A 2NQ2C 4F86A 3EA4A 2VF5X 3LP6A 1OKKA 4FMBB 3EXEB 1PVDA 4DJEC 2OV8A 3CR3C 2WJAA 2PK3A 2GASA 2DYKA 4RLHA 3HXKA 3RT9A 4BO3A 3ZVKA 3BZWA 3DG9A 2GEDA 3MUOA 2J3HA 3DHVA 3Q72A 2O8BB 1JDVA 1P61B 2OXCA 3DHWC 2O1EA 5FBZA 4LHYA 3KQVA 3BWVA 3PNSA 2VAPA 3WSTA 3K2IA 4FIZA 2QTCA 3DBLA 2YIVX 5G0VA 2ZSDA 4GX2A 3D3EA 1AQ6A 1M2WA 1NSTA 4WPGA 3KDSE 4KXLA 4G84A 1EJ2A 4KO1S 4WNYA 1JDBC 2C5GA 3H1BA 3LHDA 1UBJS 3M82A 5KSWB 3GUVA 1XRJA 1SR8A 2EZ9A 3K9WA 1ISHA 4DZTA 3HABA 4Q93A 3TNDA 2OZEA 3KM0A 3JRXA 3FPAA 1ZD2P 1KI7A 4K88A 4W5RA 3NDIA 3CRNA 3BIOA 1NJ5A 3IO3A 1WDMA 3PC7A 4ETMA 3EXHB 3ZCUA 821PA 4OFBA 1E2PA 2AOXA 3I8SA 4KQGA 4AG5A 1TZMA 2XRFA 5H9WA 2NSHA 1C0KA 4GU5A 2Y67A 4KPYA 4UM8B 1YNOA 2WWHA 4O6VA 2BUBA 3KELA 3NX4A 2QG9A 1FQJA 4OJTA 3BM5A 1EG7A 3LECA 2Y1LA 5JO0A 2VP0A 3RLFA 3IR6A 3ACDA 5AI4A 5HX7A 1NKTA 3I04A 4BB5A 1Y8ZA 1QHYA 3DL0A 4JYPA 5FBQB 4H7PA 4C88A 1HURA 2I4OA 4OHCA 3X1WA 3R8XA 3IPXA 3R41A 4B3RB 2PDAA 4QPPA 3PQCA 2JBAB 2B35A 2V3WA 1MO6A 4PY2A 3RUEA 4E4YA 1MB0A 2AX3A 3NB0A 1FX0B 3MUFA 3PA6A 4P38A 4ESHA 2FFJA 5FULA 2YXLA 4JZYA 1ZUWA 5ALGA 2ZDHA 3IJ5A 4ECAA 1N0UA 1NV9A 3PHBE 5DXFA 3NHFA 3KEFA 2Q62A 1WX1A 3HVUA 1A5TA 3ID6C 4WZAE 5DMHA 3TAHA 5HR5A 3DE1X 2X8BA 3OFVA 2R2AA 1JP7A 2VYVA 2XCLA 1X8JA 3IT3A 1QH8B 3R0JA 1PZMA 1RZVA 1EQAA 4J1NA 1W52X 1DJPA 3VR4D 1Z34A 3TXAA 1E3SA 4QXOA 3FUCA 2DBQA 2O5VA 3A6JA 1M1UA 4QJ5A 4NCXA 4AZWA 4OBEA 1M10A 3L4BC 3I09A 4X41A 4HN4B 2Y77A 2BSAA 1E5VA 4R31A 1CRZA 4HOYA 1SCDA 4DWOA 1F7VA 5JXJA 4LECA 2BHTA 5MFPA 3HYLA 5IEBA 5AM2A 3KQTA 3N39C 5B4UA 2QUZA 4DABA 2PQ2A 1XJ5A 1YL5A 1CR2A 1NT2A 4B75A 1G3MA 4F92B 1ZIXA 4TMWA 1YDGA 2FG5A 2HV9A 3FPGA 2E48A 5DW3A 4BNWA 5IBCA 5AKLA 4EHHA 4L57A 2WHQA 2XNDD 1SXQA 3OESA 3ZBTA 1GP2A 3AP2A 4RV5A 1PNTA 4U2BA 1M3SA 3WIDA 1DV2A 3TRIA 2WM9B 3T0IA 2PD4A 1TQ2A 3W04A 1EFRD 1U9IA 3ZGLA 3EVAA 4ROTA 4WJLA 2B7BA 3W7AA 3AMVA 4NNPA 1NUHA 4BZWA 1J0EA 2ONJA 2FKAA 4DS3A 1EDOA 2PKQO 2RCNA 1X1TA 2Y0BA 4QO8A 1Z4LA 1QKIA 3OUZA 3D6HA 1M8KA 1JI0A 1S2NA 4II2A 2UXCB 1WKVA 4LHEA 5F1KA 4TLAA 3VR6D 3WLNA 3OPNA 5JQGB 1VSUA 3OTGA 3S29A 2QVZX 5LP6C 5BN4B 2H2FA 3TWOA 2FR8C 1WXDA 4AUEA 2WKRA 2P2DA 1ONNA 2UVPA 3SIRA 2Q4RA 2ST1A 4OYLA 3A14A 2V6GA 3N0VA 3QLVC 4REMA 1KS2A 3ISTA 4TSRA 3KZCA 3NM6B 5T64A 2JASA 2C94A 4DFDA 3WLLA 2NPOA 3JZIA 2ZJOA 5FWDA 2YOFA 3I04M 3JPYA 1ZD5A 2H9IA 3JALA 3GJ7A 4GX5A 4DV7B 1C9DB 2IZ1A 3DZGA 4PZLA 2A1UB 2D5AA 4UUQA 2RJOA 1BSVA 4Z4GA 3ROPA 1RABA 1FPQA 1M2VB 4R0NA 3G5TA 3QEMB 1NIPA 3SC3A 3V4LA 3AEKB 4CF5A 3C15C 5IF3A 1R8JA 4N7JA 4Z8XA 5FIUA 3B38A 2R8BA 3HXLA 3N5CA 4TL9A 2GBGA 1AURA 4TYYA 3CWQA 4S2EA 3QIAA 4IXNA 3BSSA 4C6HA 5JTUA 1KBZA