4H7EA

Crystal structure of haloalkane dehalogenase linb v112a mutant from sphingobium sp. mi1205
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
total genus 112
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7eA00
1KEZA 1P0QA 3DQZA 1J1IA 4M0FA 1CLEA 3WWEA 4BVLA 3WYNA 5JAOA 4UHFA 2XB6A 3WL7A 1AC5A 2DSNA 2YXPX 1UK6A 1ZD4A 1YB6A 5AK5A 1TCAA 4IH1A 1AKNA 3OURA 3DYVA 5HZGA 3MGAA 4WFKA 3R3YA 3D2CA 3L1JA 1BE0A 4XVCA 3LP5A 4INZA 3WWPA 5JAUA 3WZLA 4BC1A 1WPXA 5FKJA 5A62A 3FYUC 3AILA 4DSAA 1QO9A 1R50A 4KAFA 1CUDA 2DHCA 2RAUA 3B3QA 2QJWA 3ICVA 5IVKA 4OB7A 1SCKA 3JWEA 4LKOA 1MAAA 1QIHA 1MJ5A 3AFIA 5AP9A 5AKXA 1TRHA 1XLUA 1R3DA 2HU7A 1ZGCA 1RP1A 1FJ2A 2WTNA 5FV4A 3W04A 4FNGA 3WKDA 4GEGA 1ACLA 1TK3A 4NZZA 1GZ7A 3WZMA 1F0NA 1AZWA 5K3CA 5SYMA 1VZ2A 1DX6A 2XMCA 2ES4A 4OCZA 4A5SA 4FHZA 5H3HA 3I6YA 3IUJA 1Y37A 3BXPA 4KE6A 5AKZA 4U2DA 2QJRA 3G9TA 1QO7A 1QIJA 4NMWA 4YPVA 4Q3OA 2I78A 4OD0A 4C4XA 3GA7A 4UFNA 5YASA 1EDDA 1L7QA 1DT5A 3PUIA 4CG3A 5LZ2A 3QMWA 1MX5A 1DTEA 4B85A 4V2IA 4C87A 1CUBA 3BJRA 1DX4A 4ZGBA 1ODTC 5A7FA 2GBCA 3KSRA 3O4GA 2WFLA 2XMSA 4C4ZA 2PSHA 3RK4A 4BVKA 6YASA 4X00A 4FWBA 4BZZA 2B9VA 3E4DA 5JYCA 5KWIA 3OC0A 1UFOA 1YAHA 2C5FA 3I2JA 3IDAA 4Y7DA 2O2GA 4J0GA 5AKKA 2PUHA 3G0GA 4B83A 4J0JA 1K8QA 3DOHA 4P08A 1NX9A 3DYIA 3DL7A 4Y2SA 2DQYA 1AX9A 3QBJA 5C8VA 1X2EA 4X71A 4AN1A 3VKFA 3QVMA 1F8UA 2PUJA 5CT9A 3WK4A 2OCLA 2IIVA 1R9NA 1TQHA 1FFCA 2JIDA 2Y1KA 2RI6A 5FRDA 3H0CA 1OCEA 5CURA 5K3AA 1IVYA 2H7XA 5LKAA 2PSJA 3IIIA 3AZOA 2XUFA 5ALWA 4MEAA 1CRLA 3WK5A 2VT6A 2R8BA 3R0VA 4K6HA 1JU3A 3IUMA 1XROA 1WB5A 2XUPA 2XQKA 5JZ9A 3I1YA 3WA7A 5K3FB 1DU4A 1TKRA 3I2HA 2B20A 2C4HA 4X6YA 2HFJA 1IUOA 3WL6A 2QRUA 1FFAA 1XZCA 1EVQA 4HTAA 1CV2A 2PX6A 1LPBB 4GW3A 3FYUA 3SC2A 1UK8A 3K9BA 1XKLA 5AKIA 4S0XA 4GBGA 4GXNA 3H18A 3C6BA 1DINA 3LIPA 1PV1A 3BF7A 4AO6A 5AI4A 3G9ZA 2PSFA 2QM0A 4Q3LA 3CXUA 3U1TA 2FUKA 5DNWA 2XMRA 4H7FA 4PQEA 1Y7HA 1B41A 1HL7A 3A6ZA 5BV7A 3PDCA 4TVKA 4N8SA 4AZ3A 4K6GA 1DQYA 2CMFA 3JW8A 4HVTA 5JASA 4KE7A 5CTAA 2JGKA 3IURA 5D3ZA 2WJ3A 3C6YA 2XE4A 1ODCA 1XQVA 4HAIA 1KU6A 1QGED 2B4KA 4IH4A 3OG9A 5DYYA 4B80A 3DEAA 3WMRA 3DS8A 4BB0A 3D0KA 1X70A 4UBJA 2OG1A 1UOOA 1VOTA 3F97A 4FLEA 1XZBA 4EUSA 4D9JA 1JJBA 4KRYA 1W52X 1XZFA 1IMJA 5E4YA 4FDMA 4GI1A 1W1IA 2EEPA 3TRDA 3BF8A 4CIBA 3GUUA 3D5EA 1EVEA 4LXIA 3V9AA 4DNPA 2HL6A 4JYMA 5FXMA 3HXKA 4WDQA 2HIHA 4MYDA 5KBYA 5ALUA 1KU0A 1GGVA 1BROA 3F96A 1JMYA 4W63A 1TAHA 2GYWA 1SFRA 4G8CA 3ED1A 1VLQA 1QOZA 3DOIA 3BL8A 5KWJA 2WIJA 4W9RA 1XKTA 2BUAA 4B84A 5CW2A 3UUFA 5CBKA 5JZBA 3FLBA 2WJ4A 1DQZA 1H22A 5AI0A 4CI9A 4LHEA 1A88A 4QWMA 1XRNA 3TEJA 1LBTA 1ORWA 4HRXA 3A2MA 3DDUA 3QMMA 3FLEA 3F67A 1N5MA 5HF6A 2W22A 4UFPA 4OPMA 3GELA 4AX4A 3D4LA 2BCEA 5T4FA 4X93A 1EK1A 3W2TA 5AI8A 4AO8A 2ROQA 4UHCA 3WK9A 5J3JA 3M3DA 1R88A 3KWJA 3N2ZB 2LIPA 1Q0RA 3CN7A 1XZKA 4HRYA 3R3VA 2ZSIA 4N5HX 3YASA 2VJAA 4F21A 2VTVA 2AJ8A 4BAGA 1EHYA 1T4MA 4WY8A 5BWBA 2ZVDA 1UT6A 1LGYA 4RNCA 1JKMA 1YS1X 1LZLA 4ROTA 1NU6A 4W1QA 4RGYA 5ALYA 3HYSA 1LPOA 3B12A 2B61A 3LIIA 4EY5A 2GZSA 4GWLA 3I2GA 4ZRDA 2QKYA 4H35A 3VVLA 3WWOA 4FLMA 2CBGA 3O95A 4UBNA 4KE9A 1CUJA 2BJHA 1CUUA 1OILA 2JF0A 4QLOA 5K3DA 3VISA 1OXMA 1ZGBA 4UHHA 3QH4A 3FLAA 4LYDA 5K3BA 5HFAA 1MNQA 1TCCA 3I28A 2BUBA 4E11A 1C4XA 4PF1A 4H18A 5AOCA 2FJ0A 5EIHA 3DKKA 4B9EA 1EK2A 2I3ZA 2G5PA 3LCRA 4BDSA 2DQZA 3M83A 5I7UA 1JJIA 3GZJA 3PF8A 2AJBA 2G4LA 4LIPD 5E4JA 5HQ3A 2WHQA 3ANSA 4ETWA 2XUKA 3PICA 4JH0A 1ODSA 4GDMA 3DLTA 4G4JA 3IA2A 5IVHA 5DNUA 3C8HA 2XUHA 2PVSA 3G0BA 4KEAA 4QNNA 3HC7A 1CUHA 3BWXA 3HACA 3R3ZA 4BDTA 1GPKA 5CRIA 2XMGA 1F6WA 5CXUA 1XZMA 4UUQA 1XRRA 4KYVA 4J3JA 3E1GA 1DWQA 4FTWA 5JAPA 3GFFA 3OOSA 5AIBA 1CUZA 4MWTA 3WL5A 1PFQA 5ALSA 4EY6A 2HU8A 2WHPA 3BJMA 4MXDA 5AM0A 1VE7A 2OGZA 4BYMA 2V96A 4BCDA 1MNAA 5AI9A 1USWA 2JGJA 2XQGA 4EY7A 1H2YA 3PI6A 1QIIA 3V48A 3FWHA 5AKLA 3QPCA 2OGSA 1UKBA 2C0QA 2HA6A 3VJLA 1ZI6A 3AUKA 3D59A 1YCDA 2HA0A 1O6FA 5ALFA 1RYYA 1AURA 4C4YA 4AN0A 3I2KA 4EZIA 2RONA 2E3JA 4B6GA 1XZIA 1K6EA 3VJMA 4H7DA 2CUTA 2JGFA 2WIKA 2XMQA 1E8NA 4ZV9A 5IKXA 4K2AA 4NS4A 4Q34A 3G8YA 2OPHA 2XLBA 4J0KA 4FFWA 3BIWA 1BCRA 1UKAA 1L7RA 2JGLA 2OCIA 3V1NA 3RARA 1EINA 1G66A 3TJMA 5AKEA 1EDEA 3HRHA 1UK9A 1AMNA 2H7CA 3EIOA 4DM7A 4DNOA 4CCWA 3PE6A 2WUDA 1WHTA 1XLVA 4M0EA 4PV7A 2AJDA 2QUAA 5AOBA 3DD5A 4JUIA 1AQLA 1QIEA 2WG0A 1CPYA 5AIAA 2XI4A 5F4ZA 5BOVA 4Y2XA 5AH0A 3SK0A 3STWA 4B9AA 4UBKA 5HKBA 4CIAA 3C87A 1BRTA 3WI7A 2FJPA 3I6MA 2XQIA 5AM1A 2O2HA 3O4JA 4PSUA 4MWSA 1P0MA 2RHWA 1QFMA 2PU5A 3N0TA 5T4BA 4IH9A 4QDXA 3FAKA 4RPCA 4BE4A 1XZGA 2JGEA 5AK4A 2WU3A 4KACA 1J07A 2ECFA 5FP0A 1CUWA 1IZ7A 5EIEA 4QE3A 4PSCA 5E2IA 4H77A 1FFBA 1QIKA 1UK7A 5BWCA 1J06A 4F0JA 4G8BA 3R3UA 4ARBA 2ZYHA 1MX9A 3SX4A 3S8YA 1Q84A 2HA4A 4X85A 1SCIA 3KDAA 4UBOA 4P9NA 4MQLA 1YAJA 4LYEA 3H04A 3X3HA 2GYVA 3MUNA 5ALJA 4CG1A 3H2JA 4I4CA 5CH5A 3G0DA 4Y2PA 2Z3ZA 1U65A 2HFKA 1CVLA 3FOBA 3ESAA 2YASA 1XZLA 2GYUA 4EHBA 1BN7A 4PW0A 2V9ZA 3HEAA 3L1IA 2ZJ6A 5EI5A 1MU0A 3VXKA 2GBGA 3GROA 1GQRA 2IITA 1WB6A 4QEKA 5JAHA 2Y2UA 2CZQA 1JJFA 1QFSA 1QTIA 3H2GA 2PSEA 4X97A 4FKBA 1Q83A 5ALDA 3W06A 3D7RA 5JADA 4MJ3A 3C6ZA 2EDAA 4GHWA 1GQSA 2Y6UA 5DYWA 1VE6A 4KE8A 5LZ7A 1CUIA 3OPMA 2BGNA 1L7AA 2X76A 4PSDA 3W05A 2WQZA 5EGNA 4UHBA 4E14A 5LLSA 2GBIA 1Q0ZA 2QS9A 5ALOA 1QTRA 2OAGA 4C01A 3ZI7A 4UBMA 3ZWQA 1WOMA 3FSGD 1A7UA 3NGMA 1FSSA 5FOQA 4AZ0A 2DR0A 1QLWA 4BTLA 3DNMA 1VA4A 1H2XA 1LNSA 1X2BA 4AO7A 4G9EA 5HF5A 4JNCA 3I2IA 1CQWA 2C0PA 5ISMA 1LLFA 2ZJFA 5HF8A 3I1IA 5AI6A 4RE6A 3SWWA 4H0CA 3CCCA 1DWPA 4X6UA 3H2KA 2HDWA 4QDZA 1MTZA 1T2NA 5ALVA 5ALLA 3V1LA 1LBSA 5CT4A 2WUEA 2QT9A 3QPAA 4DNQA 2WTMA 4WFIA 4QDUA 2EDCA 2GBFA 1K63A 2Y2VA 5C81A 2RGUA 4A23A 1YB7A 3KOOA 3ESBA 4BCBA 2PU7A 4DNFA 4QWWA 5HFNA 4Y2YA 2XUDA 1ORVA 1THTA 4MYSA 1ZIYA 4OYYA 4B82A 1ZD5A 4DGQA 1XQXA 3FBWA 3WJ2A 1MT3A 3F8SA 1C7JA 1EB8A 3IVMA 1E5TA 1U8EA 4UPDA 3V1MA 1LPAB 3W9BA 3WWDA 2JBWA 1MN6A 3A2NA 3AINA 4QZVA 4X91A 3S2ZA 5EHXA 4HXEB 3WK8A 3K6KA 3STXA 3H1BA 4DMHA 5A71A 1BS9A 1CUCA 2HA7A 1JI3A 3K2IA 1XZDA 2HU5A 4OSEA 4HXGA 4B7ZA 5KREA 4WCVA 4B0OA 4U2GA 5JARA 1E8DA 4MEBA 1N1MA 1AUOA 1E8MA 1BCSA 5K5EA 4J03A 3IULA 3WA6A 3VJKA 4FBLA 2PSDA 2XT0A 4JYPA 1HLGA 1YSCA 4OYLA 3DKRA 2WIDA 3LS2A 4H7IA 1TCBA 2VT7A 4DMFA 5JD5A 1DT3A 5ALQA 5K3EA 1CR6A 5A2GA 3WKEA 2BAGA 2WILA 3AIKA 4UHDA 4FMPA 4B0PA 3AZPA 1CUAA 1R1DA 1G5FA 3WK7A 1E3QA 3WKCA 1XRMA 4W1RA 5AKHA 5LKRA 1ZI9A 2Z8XA 4FBMA 4EB0A 4ARAA 2ACKA 3FNBA 3R40A 5IH7A 5DYTA 3D3NA 2DHDA 3C5WP 1J2EA 5HF9A 5AK3A 4Y2TA 3DJYA 1CQZA 2RHTA 1EA5A 2Z3WA 2ACEA 4XX1A 5ALPA 1ZOIA 4DSZA 3C6XA 4ITVA 2WG1A 5ALEA 3E3AA 4BRSA 1GPNA 5ALTA 5CH8A 3UUEA 5ALIA 4AMZA 3D2AA 1ZD2P 4Q1VA 3VDXA 4G9GA 5IVDA 1BU8A 1P0IA 4L0CA 3U0VA 2WKWA 3ZPXA 1THGA 4DMCA 3QPDA 4KJXA 5ESRA 3CCBA 1N5RA 3STYA 1H23A 2YYSA 3CN9A 3FVRA 4WY5A 5T4HA 5CH3A 1ZICA 4DLNA 2JGIA 1WPRA 2XUGA 3DL4A 4OU5A 3EF3A 1WCYA 3ILSA 2PBLA 1E89A 2BFNA 2BKLA 5A7GA 4U2BA 4HS9A 3F98A 1ZD3A 4E46A 5CXXA 4BBZA 3R3WA 2XUIA 4KRXA 3NOXA 2OCGA 4IHAA 1UOQA 2BGRA 3IBTA 4Q05A 2QUBA 4G1FA 2OAEA 3AIOA 1VKHA 4O08A 2XUOA 3PFCA 2O2IA 4G5XA 4Y2UA 2V98A 4J0DA 5HQ3B 3ESCA 4U2CA 5AM3A 4CCYA 1Y7IA 7YASA 5A6VA 1CUFA 1W75A 4GECA 1W76A 2ZSHA 2CJPA 2VF2A 5CMLA 2XMZA 2QXUA 2WSLA 3T52A 3D2BA 2I3DA 4FNMA 4AXBA 4U2EA 5LYYA 4L9AA 1S8OA 3R41A 4OUKX 1YA8A 4K6KA 3IUNA 4HZGA 5DNVA 2XDWA 1R9MA 1CUXA 1R4ZA 3KXPA 5FPQA 4BRZA 3IUQA 3HZOA 4N8DA 5AKJA 4A16A 4X7BA 3H17A 1ETHA 3P2MA 5E4TA 2WHPB 3ZLTA 3IB3A 3B5EA 2WM2A 4U2FA 4ZWNA 3M81A 4YK7A 4X6XA 1LPNA 4AB1A 4UFOA 2J3DA 4BAZA 1JMKC 1K5PA 1SC9A 1YASA 4K5QA 4FOLA 5HK8A 5EHZA 3FSGA 2IX9A 5I8PA 1CIJA 1A8UA 1WB4A 1EB9A 2QVBA 1C7IA 5ALRA 1G42A 4CFSA 1NU8A 1N8SA 4Y2QA 5DLPA 5AJHA 3HABA 5DWDA 3G9XA 2QR5A 3C70A 1XZJA 5ALKA 1BN6A 1BEEA 1CEXA 2DFPA 1B6GA 5DJ5A 4Y2VA 4X92A 1HPLA 2H1IA 1HDEA 2H9YA 1WHSA 4PO3X 1D07A 1GXSA 1XRPA 3L1HA 5AKYA 4AMYA 5FUMA 4J0CA 1ACJA 3O0DA 3H1AA 5HCUA 4B81A 3KD2A 4F5ZA 3FCYA 5ALGA 3WJ1A 3WL8A 2XMBA 3STVA 4Z49A 3OM8A 3H2HA 2HHAA 3ZLVA 3ZV7A 5LIPA 4FLFA 3QITA 2VAXA 1LPMA 5LP1A 2XUJA 1UOPA 4L3WA 1XZEA 1QONA 1VXRA 1GPLA 3BDIA 2I03A 2D0DA 3AIMA 1MPXA 5CT8A 5IVIA 1JT2A 2VJDA 3WYDA 4UBLA 3NUZA 1UKCA 2H7YA 2O7VA 4JEIA 2XMDA 3I2FA 1XLWA 1BEZA 2OGTA 3O9VA 1MAHA 5AM2A 3WIOA 4OB8A 1LZKA 1VXOA 5AM4A 1ISPA 4I19A 5D6OA 1U4NA 3HI4A 4BATA 3BDVA 2C7BA 5FPPA 4Y9SA 3GBSA 1CUSA 2DCMA 3HJUA 4EBBA 2AJLI 2WFLB 2AXEA 3ANTA 5EHQA 1XQYA 5A7HA 3QMVA 4YASA 1QJ4A 5DTIA 4QA9A 4C89A 5C8ZA 2VEOA 2R11A 3PF9A 1O6GA 2WIFA 2VA9A 3OTQA 3O9MA 2WHRA 1Z68A 2FX5A 5DTJA 1F0PA 1CFJA 3WWCA 4N8EA 3JYHA 4ZXFA 3HSSA 3WIBA 4C88A 2VAVA 4BTVA 5LZ4A 1CUGA 4I3FA 3G0CA 2Y6VA 4ZREA 1SCQA 1TIBA 5JANA 1RWQA 5K3FA 4G8DA 5EHNA 1FFEA 1EDBA 1XRLA 4MQMA 1QIFA 3DCNA 3WK6A 1H2WA 4LXGA 3G9UA 2WIGA 3NWOA 3T4UA 4FFVA 5T4EA 2J4CA 2XUQA 2XQJA 2JEYA 2ZYSA 3KWFA 1LPSA 4LXHA 4DTCA 4PNZA 5D7BA 3EQ9A 4BP8A 3BE8A 4X3CA 2QXTA 2ORYA 1VJ5A 1IUPA 4GLBA 4BC0A 1LPPA 2WU4A 5AICA 4E15A 3C45A 2C5GA 3A2LA 1EXWA 1XZAA 4H7EA 2AJCA 2P8SA 1YS2X 3EBLA 3WQHA 2WUFA 1AGYA 4ZI5A 2CEKA 5AM5A 5AHXA 3FYUB 2J3QA 5SYNA 4DYHA 3G7NA 4BVJA 2WUGA 3E0XA 4H7JA 3EQ8A 1XZHA 2ONCA 1DWOA 3F9CA 4NVRA 5ALZA 1U2EA 4X90A 3WLAA 2WFZA 3BIXA 1QIDA 2G5TA 2W6CX 2DHEA 1K4YA 4TGLA 1QIGA 2OQIA 4KAAA 4W1PA 4CG2A 4KR0A 3Q8WA 2CKMA 4C6HA 2YH2A 4N5IX 1QIMA 4XWGA 5FLKA 1MO2A 5JD4A 5HK9A 4EY4A 3MUOA 3HLKA 4H7KA 4BAUA 3RKSA 5JALA 1M33A 1UXOA 2WLSA 4G4GA 3C43A 1UWCA 2HRRA 3TGLA 3VVMA 1VA5A 1GKLA 2QMQA 3QYJA 5AK6A 3C5VA 5EIAA 4AQDA 4QLAA 2OCKA 4G4IA 3STTA 1ZJ4A 1IUNA 2OLEA 1HKHA 1GT6A 3QZUA 2OXEA 4L72A 2O7RA 3H19A 4BP9A 3ICWA 1YA4A 5HKAA 4X94A 1GKKA 3FCXA 3I6ZA 2K2QB 2XQFA 3LLCA 2CB9A 5AO9A 4YX9A 3W9UA 1XRQA 5I9IA 1A8SA 1QE3A 3WKAA 1PJAA 5LZ8A 1EI9A 3ESDA 4RE5A 4IO0A 5AKGA 4DIUA 2XUAA 3O4IA 1A8QA 2C58A 5C7YA 2QZPA 2RIPA 4J0IA 1ZI8A 2XLCA 4UHEA 4P92A 4Y2JA 2NW6A 4XIIA 1WM1A 4W1SA 3MVEA 3STUA 1H2ZA 4J7AA 2PPLA 3UMJA 4EA6A 1W4LA 4BE9A 2WG2A 2VATA 2Z8ZA 2Z5GA 3C8DA 4F60A 2VJBA 5LZ5A 4XJVA 1JU4A 2ZYIA 2OQVA 4M0MA 2QTBA 1UZAA 2WJ6A 4IQ4A 4WDRA 1I6WA 2JGMA 3AJAA 5C8XA 3QM1A 2HA3A 5JZSA 1CUEA 1QZ3A 2ZJ7A 4OB6A 2X5XA 3O4HA 2Q0XA 4BCCA 3FVTA 1ZJ5A 2V97A 2VSQA 1W6RA 2G63A 4KAJA 1HQDA 5JIBA 1ZIXA 5CT5A 3ZLUA 2HM7A 5ALMA 1HBJA 2UZ0A 3G0IA 2GZRA 5AOAA 3PUHA 1MX1A 4Q3KA 1EX9A 1FFDA 3Q0TA 4QDTA 1VZ3A 4EY8A 1CUVA 1IZ8A 3FYTA 3V1KA 4ZV7A 2PKYX 4WFJA 5FDFA 2ZYRA 3M82A 5ALXA 2VJCA 4OU4A 5LZ9A 5ALNA 5D3KA 1E66A 4P93A 2X8BA 1XFDA 2HA2A 2HA5A 4QDOA 4HXFB 2VQ6A 2WFMA 4BZWA 5ALHA 4UBIA 3EQ7A 3H2IA 4Q82A 3R3XA 1G4HA 4J0HA 2JEZA 2J4FA 1CUYA 2HADA 2D5LA 2QOEA 5EFZA 4WJLA 3RLIA 2HRQA 3WKBA 1EH5A 5JD6A 1SOMA 1YR2A 2PM8A 5AI5A 4X95A 4Y2RA 4H7HA 3G02A 1P0PA 1JFRA 5CT6A 4CCYB 5JATA 2BUCA 2PL5A 3PFBA 3RM3A 4DMKA 1XQWA 3A70A 4TPKA 3AZQA
chains in the Genus database with same CATH superfamily
4D45A 2CNKA 2J0VA 5BNZA 4D8TA 1Y4AE 3DQZA 2J4DA 4NNJA 4M0FA 1CLEA 4CM9A 2ZBFA 3AF0A 4Q1AA 1T36A 1XKQA 3UAVA 1OR8A 4G09A 2AF3C 2D3TA 4HZIA 1BJRE 2QD1A 1L5YA 1F20A 2ZYUX 1BWPA 2OV4A 1W6UA 2AX3A 3CKYA 3FCSB 2CXHA 3MWLA 4PC7A 2YCLA 3DDHA 3HKDA 4DSUA 3KQHA 2Q9UA 1M6VA 4DA4A 1Y8RA 5EJ7A 2WSMA 4GUAA 2HHHB 1VL6A 2H00A 1XZQA 3JRWA 3O4VA 2WTUA 2X3FA 2QLTA 3N2YA 1NT4A 1QH0A 1SZPA 4W99A 1T4CB 1KVSA 2P2LA 1DC6A 1DX9A 1FX0A 3G5TA 3JQBC 4Z4QA 4H0FA 4RMGA 3N8HA 4N0PA 4ALMA 4ZYUA 4JUDX 4F9FA 1RIIA 5C9ZA 5KAPA 1LKZA 4ZT5A 2IZ7A 2JJ1A 3OURA 2GPYA 1A98A 3DYVA 3QF4A 4XH9B 1D2CA 1KKUA 1PKXA 2GILA 3TZQA 5K05A 3EDMA 2OORC 3GLKA 3LQ4A 3VR4H 1G8PA 1ISJA 4Z86A 3A7DA 4WFKA 4F6RB 1OXBB 2IPOA 3OTGA 3GCWA 1Z2PX 3HKEB 4N03A 3MYRA 4DANA 1RLUA 1U0OC 1U0TA 1UWLA 3KUXA 1KWGA 3TZCA 5C7IO 3DLCA 4OJMX 2C9BA 4WLVA 2WE8A 4BVHA 2FDCA 3LP5A 5ELXA 4V1CI 4M46A 4DKJA 4IMJB 4LC1A 3Q98A 1KO4A 3MK31 1Z2OX 4CLRA 4IFIA 3HCPA 2SCUA 3O90A 1PZMA 3AR9A 4NOJA 4LSZA 2GLXA 3CJTA 4TMTA 3IMEA 4ZANA 2VTBB 1W8IA 3A0UA 4WESB 3KPVA 5JAUA 1VSQA 2ZUTA 1J99A 1ULHA 4YJ3B 1HG1A 3ZU2A 1CZUA 2G08A 3PEYA 1Z2NX 2IOFK 4GOND 4P4UA 4OLBA 2CV1A 2C95A 3RUPA 3L7IA 4MJ7A 1TIKA 3AILA 3EZYA 4J16C 4DSAA 1DCKA 4D80A 5FI0B 3ZU4A 5ICMA 1DRKA 1CRPA 4FOPA 1D1TA 1VBFA 2GN6A 4AS3A 4MK4A 2AZXA 3JPWA 2LRHA 4LV5B 4DCMA 3ILXA 2CT8A 1NLYA 3B5IA 3DWGA 3ICVA 1TK9A 1KEEA 2AD1A 2G04A 3PD7A 5CLQA 3M1YA 2RKWA 3MWEA 1MAAA 3HA3A 4FYMA 4EFNA 4H59A 1S3SA 4B74A 3KUDA 3KQVA 3EXHA 3AFIA 2H5JA 3O92A 4HWTA 2Q3FA 2PL9A 1ADBA 4LXTA 1R3DA 4K88A 3K1AB 3U3DA 5DNDA 5EA2A 5A4JA 4MQ5A 1DO2A 4MUGA 4IV0A 2HPVA 1AT1A 4AP9A 1IN1A 1KDRA 1PR6A 4E70A 1P45A 4YALA 5DB4A 2Y1GA 1GEEA 3E1KA 4MKFA 4P4GA 5B58C 3RCBA 1ACLA 3VR0A 1TK3A 4IGEA 2ZUVA 3QBEA 1GZ7A 1DIHA 1NP7A 2QSYA 3SZ3A 1AKWA 1Q74A 4MHSA 3ZWXA 5DGTA 5K3CA 1G21B 1GXSB 4DMMA 3ROPA 4MGIR 3IAFA 1NIJA 3AXTA 1JYSA 4D8YA 1JHYA 1H9AA 1Y4SA 1DKPA 2OESA 4LDRA 1OAKA 2CVPA 4QXPA 1DX6A 2XMCA 1GG8A 4OCZA 4A5SA 1NX6A 1HGXA 1SHLA 5KCZA 5LQDA 2D2EA 2FUG6 3CKKA 2NU6B 1ZVMA 3EIHA 1H1DA 4F9GA 3IUJA 4F2WA 4Q4HB 5DSZA 4ZARA 2GPTA 3KU4A 1SHTX 1Y6GA 2ZE8A 2C8JA 4RZHA 3C48A 4U2DA 2O1XA 2QJRA 3M49A 1TTQB 1G8HA 3G9TA 4QODA 3UM9A 5JMTA 4Q15A 4EEZA 5JYBA 2IPNA 2ZYVX 3DF9A 1RS0A 1TXGA 2ZPUA 3K5IA 1M8JA 4C4XA 1EDDA 1FFXB 3ONFA 5KQPA 4NEHB 2QBYA 3BRCA 3DB2A 3UWSA 2AQIA 3J80A 5C7OO 3MT8A 2LV8A 3LRPA 3GLUA 2KQUA 1MX5A 1PD1A 5L4SA 3A4VA 1TKAA 1F48A 4EFMA 1D2MA 2B35A 4Y6SA 3U4CA 5T6BA 3VYRB 4V2IA 3ESQA 1H5UA 1LI5A 1G8AA 1XDUA 1ZPDA 3AUSA 5FO0A 3R7NA 3ULKA 4ZGBA 1AMUA 2JLYA 2GBCA 3NJ8A 1C30A 3ZBPA 3CINA 5BR7A 5MGBA 3NEYA 3M3HA 4KYUA 2NO4A 3BRWD 1SBNE 3RK4A 4G26A 4ZVTA 1W7AA 5EVCA 1PJ4A 4YMIA 4A3SA 1OH8A 4GXRA 4PSVA 2I3BA 4JEMA 4A92A 4C7OA 3K1TA 5DM4A 2ZRIA 3ZJTA 1EIWA 1NT2A 2B9VA 2BFWA 2R2GA 4EENA 1STOA 4F6CA 3M2TA 1UMCA 3URKA 3V7FA 3OFNA 1M0SA 2A1TR 2WJZB 3OJOA 3NIWA 2I6SA 4J1TA 1D6MA 4LQ4A 4EYGA 4A8JC 5AUNB 4OI0A 2H8KA 3AY3A 4X44A 2C5FA 2VJYA 4A27A 2NTEA 3QVTA 1Y8QB 4NX2A 1YOBA 1FFHA 3HBAA 4C29A 4AP5A 4FBGA 4Z8XA 1SZDA 3PR3A 2ID4A 4X0EA 1U0NA 1LVGA 4DUYB 3JQAB 3NYWA 5AQEA 3G1UA 3UKJA 5AK0A 4IXNA 2F00A 1NX9A 1P75A 1NUPA 1X14A 1ZU4A 2ZI7A 3DL7A 4PIPA 5KOIA 1GEGA 1Z6TA 1WUIS 1UODA 4FFRA 1DLIA 2LR0A 3W5BA 2JAWA 4YJHB 4WOJA 3VV2A 2C3OA 4D5EA 1FUYB 3T4PA 5HTOA 1T1JA 4C2UA 4Y1GA 3VKWA 4F85A 5JXHA 4M1WA 3N3BC 3NM6B 1NSTA 3QVMA 3VKVA 2PUJA 3WK4A 5I48A 2B98A 3FNRA 4RELA 4NYJR 1ECJA 4ARZA 3ABZA 4JOCA 1EK5A 1UH5A 2A5JA 4L0QA 3LGXA 1XBTA 2JIDA 4TYPA 4LN1A 4KN8A 2JI9A 3CLVA 1V8DA 2RI6A 4IPTA 3DW1X 1QVAA 4N3AA 5JNUA 3R8FA 2QYOA 3EY9A 4US1R 5FRDA 5EJFA 3KE9A 1C1HA 3QFSA 1E2UA 1FPQA 3BHNA 1KZ9A 1OCEA 2FKNA 3ONWA 4O4LF 2FWIA 4UU7A 4ZQBA 2H4WA 3ROXA 4K40A 4ND8B 1V4BA 3UF0A 1TZCA 1XQ9A 4AUEA 2PSJA 2VRWA 3IIIA 3NNNA 2P9CA 4C78A 2QUKA 1AGNA 1B6RA 1T1IA 1T34A 1I6KA 3ECSA 1PG0A 2RHJA 3BDAA 4TN5A 1PWHA 3RRJA 3WK5A 2GNAA 1IPFA 1Q0LA 1J0BA 1GFSA 3MRXA 3BULA 3DM5A 4GPTA 4ZHQB 2NVUA 1T8TA 4GH5A 3EOBI 4W8HA 1P1JA 2VEDA 1EM6A 2Q1YA 3VPSA 3HVIA 5BN3A 2J6HA 3KALA 2NU9B 3THWA 1E3LA 1WSDA 2OORA 3IUMA 4GGOA 5B36A 4ZYWA 2Q8PA 1UDXA 3B20A 3ET4A 2XZLA 1WB5A 1GFIA 1A9OA 3BMCB 1L8XA 1V48A 2R6FA 3BREA 3TECE 1PDVA 1NQUA 2I62A 1DU4A 2LCQA 3R6LA 2C78A 3UV7A 4DPMA 5KTNA 1GAXA 4TL7A 1F38A 1MB4A 1E6CA 1M7BA 5EZQA 2BIFA 5EYPB 3I2HA 2GN1A 3SHTA 5HUHA 5JFTA 3W2GA 2QSJA 3ZZUA 1NVVQ 3HXPA 4D6YA 2C2KA 1EP3B 2PHZA 4KLZA 4M98A 3KSBC 4V1CB 2BSAA 5D1HA 2BI4A 3CRW1 2QRUA 3GPDG 3B8EA 1QTNA 4MUHA 3F78A 4NCJA 1QU3A 1X1TA 1PNQA 4AKSA 1ICIA 3M0EA 1DEKA 3O7WA 4K2HA 4IS3A 1A5SB 1CV2A 1WCXA 3O47A 2XAUA 3KV1A 3GO4A 3H5IA 2BMFA 3SKVA 3BCUA 3OFVA 1CSEE 1U9CA 5LOVB 2EBHX 3S8MA 5GONA 4NWIA 2RDMA 1MV8A 3KHKA 4HYQA 2QUHA 3K9BA 2H3EA 1S2IA 3V9PA 1P0CA 1PHRA 1G8SA 1AS0A 1V7CA 1GARA 2X7JA 4GX1A 5JISA 1KOGA 4GP9A 3ICOA 1Z7YA 2XB4A 3PHIA 2CL6X 1LVHA 4G37A 1HE4A 1WDKA 2XW6A 3K4QA 4D3XA 1MZVA 1YIOA 2RK6A 1WEHA 3INTA 2I71A 2HT6A 4H6PA 4LJ4A 4R9RA 3TSZA 4LNUA 1RQ2A 3I0ZA 1PKEA 3AFGA 2Q7DA 2YTZA 3GLFA 4Q3LA 1XDDA 3FPCA 3CXUA 4XPIB 3GLHA 3USZA 4XJTA 1Q14A 3R6TA 4ZDWA 5BSMA 5DNWA 3NC0C 1WP4A 1YK1A 4Y9DA 1KIFA 4H7FA 5IPFA 4KO2S 1LQ2A 1Y7HA 3RYHB 2RJOA 3L41A 2FE4A 1N2ZA 5BV7A 3HDQA 2VUTA 4MHOA 5BQFA 2X58A 1WKCA 3EMVA 3HV2A 4TMXA 1KGDA 2CMFA 5JASA 2FWBA 3VYSB 2FPKA 2JIBA 2YRXA 5CTAA 3WLTA 2H4ZA 4KOAA 1JEYB 4RF4A 2AXPA 1YIAA 3C6YA 1RAGA 3BTOA 4AULA 4DYVA 1E18A 2ZIWB 1DFHA 3H1FA 2JFVA 2Q5JA 1Y3CE 1ODCA 1XQVA 2AOTB 1CTQA 1Z4PX 2O2SA 3EUAA 3C4QA 4BO2A 5BQPA 1T2FA 1KU6A 2CLCX 3CX7A 3DBHA 1H2FA 1T9DA 1VE1A 1KVTA 1XCOA 2JJ2A 5L3QB 3AI3A 1LSJA 2EFEB 2EX0A 3DTTA 1FCJA 2YHSA 2YUTA 3L5OA 3S2GA 5DFAA 3MOIA 4FXOA 2A86A 2QNIA 5DYYA 3WMRA 5CDFE 1OU4A 2Y66A 1RLMA 4FE4A 3D0KA 1MQ9A 1S0UA 5JLJA 2QU8A 4LK3A 1PZGA 4ZAFA 5FAKA 1TC2A 2G36A 1IE3A 2WKSA 4PZDA 2H8GA 1L8AA 2AG6A 3UJ8A 1E2DA 2DPYA 2F3RA 2IOFA 2X2FA 1Q0QA 4TQUS 2OV6A 4NZOA 3GNLA 4R1MA 4JVMA 1YQDA 3FTDA 1N2CE 3GXOA 2DT8A 2D13A 1H5QA 1HA3A 1VL8A 1W52X 1ESCA 1XZFA 2WP0A 1TYBE 2G88A 1JG2A 4ANFA 4IDAA 5E4YA 3CWCA 5IABA 1F0YA 2R97A 4OKIA 2XY4A 3EXFB 4GI1A 2RHOA 1N6IA 2J46A 3OEEA 4D0RA 4JT8A 1J25A 1YJBA 3B6EA 3GUUA 5FUWA 3RABA 3CG4A 2RGRA 3EZNA 3HKBA 2WTEA 4LXIA 1I5OA 4PAMA 2HL6A 2AN4A 2MYNA 1G16A 3NHSA 3TKYA 3HJRA 3R0IA 2ZIXB 2GXUA 1NQTA 3RC1A 3IL2A 3NOQA 4EX7A 4HH4A 1FDTA 1FFGA 3Q7SA 3VVCA 2VDKB 3OJLA 1QQ6A 4QG3A 3AESA 2HLDA 2ONZA 4UTNA 1FMTA 2LPMA 1E4EA 3GNQA 4ND6A 1G6OA 1DOHA 5JQWA 5IWAB 2WABA 3F96A 3RSOA 2O9JA 4ZOBA 1DCMA 2GYWA 2HWXA 2FW8A 2FZKA 2PH5A 3MHPA 1FYFA 2VHVA 3A6EA 4D44A 4TTJA 3HO6A 3KWLA 4A15A 2YYAA 1R6XA 3A6HA 3CH5A 3H4MA 4M55A 4C05A 1Q7TA 3AP1A 4RPLA 3JALA 5GV7A 1XPUA 3EZLA 4DWVA 4YRAA 1ZUNB 1DKLA 5T3UA 3FSEA 1FJGB 2VKTA 3BWVA 5FYQA 3PUKA 4CWAA 3UAWA 1SRQA 4CM3A 3MS7A 4R1UA 3AM1A 1ULTA 2KYRA 2WJ4A 1VKRA 1YFZA 1GQOA 2YXNA 3I12A 3BSFA 1IJFA 4DC0A 2I6FA 3BBPA 3BERA 3WL4A 1O87A 1H22A 2NNLD 3NHYA 3M6AA 4TXJA 3C16C 2PZFA 2BTQA 1ZGHA 4CI9A 5ITSA 4AKGA 3KKEA 4M60A 4B73A 2DB3A 1IHOA 4DWOA 4HRXA 4LZZA 4KPFC 1ZVQA 4GPZA 2HSEA 1KAGA 2V8OA 2Y93A 1KZ4A 2ZQ5A 3P19A 3QMMA 1EWKA 2DFKB 3OIYA 4N0EA 3WMWA 2CF5A 3FLEA 3V7WA 4NFLA 2VTKA 2IPMA 2VDMB 3PXCX 2JH9A 5ILGA 5HF6A 1BWSA 5FI3A 3SJUA 4IJKA 4RD1A 1PNVA 1SM4A 3HWWA 2X0IA 4Q1FA 3E22A 4OPMA 2JVIA 1I01A 5AHKA 4AX4A 1QRRA 2EQBA 2BCEA 4YI5A 2ZE7A 1GQQA 4M8SA 4EKIA 4A4DA 1SC4A 4X93A 1H42A 1XYYA 5DSTA 1N7HA 1UL1X 1XDZA 2BW0A 2VLIA 1V11A 4AO8A 1IWBB 2UAGA 2OGWA 1YULA 2PV7A 1RJWA 1WCIB 3OAAA 4DBZA 1BXZA 3LBHA 3N2ZB 5SYAA 2IYPA 1XJQA 5E1OA 3ZLBA 5H9WA 3TGPA 1AKVA 1L1RA 1NVDA 1Q0RA 1SBTA 2LIPA 3BHJA 1XZKA 4AU1A 3KTDA 3QW4B 1E1CB 1OX5A 4PSKA 4M9QA 3R3VA 3SIXA 2LP4Y 3OHPA 4YRFA 2P40A 3SM3A 4ETIA 4F21A 2AFHE 2VTVA 4YV0A 3KAQA 4BAGA 4WSOA 1Z08A 4R8RA 5H3CA 1KI4A 3ZNNA 4A0RA 2RAFA 2AQ8A 1A5BB 1HSZA 1U1CA 1UT6A 3B7WA 4UQOA 4YJDA 3OOYA 4QQKA 4RNCA 5AYVA 4KNVA 1RW4A 1SQ5A 2HPHA 1K66A 4G5RA 1THZA 1MVNA 2P3QA 1YS1X 4G5OA 4KQ1A 5J59A 3ZUGA 3U44A 3VNVA 1NU6A 2F1HA 2FAXA 4RGYA 2CJXA 2WU0A 4NJMA 4OIMA 3GGJA 4ROSA 3LDAA 3HYSA 4H60A 4ND4A 1SB8A 1F4PA 4R1PA 2ZUWA 4PYJA 2B61A 4ND5A 4NY1A 3WX0A 4BXOB 2E4UA 3LIIA 2J7KA 3HDYA 1XTVA 2WU1A 3VPXA 1TE2A 3LT4A 3GRVA 4IUYA 5BMVF 1OBOA 3N8DA 4PG6A 3UBTA 3OJWA 1JIJA 4ZRDA 2Y1XA 2QTCA 3I73A 3R5HA 2TRSB 3VH1A 1EHCA 4OQ4A 3VSAA 1LTHR 3WMFA 1X9IA 3MNFA 2V6GA 3HADA 4KE9A 1BH2A 3MQ4A 2DLCX 1KJWA 5EXTA 1IY2A 2IUSA 1BW9A 3EVBA 5LBTA 3RH0A 2I7XA 3E3OA 3LLSA 4AG5A 1E77A 3AY7A 2Q5EA 3N8NA 4ZU3A 4QLOA 1DEAA 3AI2A 4URWR 1CP2A 3MD9A 3OZFA 3SD7A 3BXEA 1T5DX 4DM3A 3GXBA 3CUKA 3FLAA 4WVFA 5TQ0A 3AHHA 2P4UA 4UCWA 5KX5F 4ZD6A 1GVHA 3I28A 3FDZB 1F9EA 1C4XA 2C61A 1PGNA 2DBYA 3AUAA 2VXYA 4PF1A 4UM7A 4TS4A 2E21A 4RVDA 2FPRA 5FTJA 1QFYA 3HBNA 2H4JA 4CL3A 3VX4A 2NOAA 1SXJA 1USGA 3DKKA 3RT9A 4B9EA 2I3ZA 4EP1A 1PF7E 2YJZA 2AA3A 5BW6B 3UFXB 4RH0A 2G5PA 1NDQA 3W6NA 1PR9A 1Y3BE 3BXFA 3CLUD 2PXAA 3D8HA 4N12A 1YRLA 4LHVA 1N6RA 3PF8A 3TB6A 2AJBA 1GPYA 2VDLB 3FFXA 4A5OA 2O8FA 1YIDA 3CVXA 3LCJA 4X60A 1NMEA 4B3SB 1NVUQ 4MVXA 1UZLA 5FWNA 4D4JA 4KO1S 2IDZA 4U6SA 3ZE0B 5LQMA 3RSGA 5FR2A 3D6JA 3HXMA 2FFQA 3GCGA 3L0SA 2H5LA 3SF8B 3LX8A 3T38A 5C3MA 2V4MA 4GYKA 3NAZA 4WT7A 2FFJA 4UU0A 5JV5A 4XYLA 4LK2A 3PICA 4IQ8A 1Q17A 3USCS 2BR5A 1FBNA 3MTJA 4WGFA 4I5FA 1BKYA 3P9QA 2P69A 4GLLA 1K4MA 4E7OA 1G3QA 1DAHA 1Z4IA 3E58A 3ZWKA 4DBLE 5IVHA 3UMYA 1K6IA 4TSFA 1DAIA 4I3GA 2XKJE 1GADO 3KKNA 1EFUA 2PX4A 4MQEA 4UEQA 4WUTA 1P4RA 1SIUA 4HZUA 2PWPA 3KC2A 2XUHA 3ZE7A 2LDBA 1CY0A 5J2TF 3KZKA 3ZGNA 2IU6A 1NBOA 4DSTA 2R96A 1Z9BA 4RIFA 5DHFA 2LUOA 3HB5X 1PFYA 2HEGA 4RVSA 2I1QA 1W1UA 2CK3D 2R44A 3HC7A 3TLBA 4BRWA 2CVQA 1SUEA 3T9CA 3HCWA 3EFEA 2CJFA 2V7WA 3BWXA 3JQ8A 3VAZA 3Q9UA 2ZCVA 2A58A 3R3ZA 4G1MB 4ZCTA 1JFFB 1GPKA 1V8PA 1XXLA 2DFVA 4F4DA 1D4AA 1F6WA 1Z5UA 1CR0A 3UHOA 4PZLA 1RBMA 1AXRA 1HDRA 1XRRA 1Z75A 4XASA 2XGGA 3HU1A 3C41J 4QBFA 1CY7A 4UQLA 1M1NA 3GZNA 3LWZA 1P4JA 4QU9A 3L84A 3ENNA 5IK2A 3K0BA 3OOSA 3K94A 1AUQA 5B57C 3RAEC 1EGQA 3OZCA 4ZT6A 3PJDA 2FPMA 4XVHA 3VBEA 1A71A 3PWTA 3WL5A 3T7DA 2QX6A 1RRGA 2F8MA 2XKAA 3WTCA 3O2NA 3V8VA 4NU0A 4CV0A 1Q7BA 2ZIUB 1URPA 3ENKA 3DE4X 1X8KA 5FWDA 2WJPA 5DMXA 5F7JA 2QZZA 4TVSA 1AZSC 3BJMA 4JU9A 3D3EA 2FCAA 5EFOA 1XPRA 5JSZA 1VE7A 3F6EX 4BYMA 3OICA 4PAOA 1S8AA 1T4CA 3A26A 4Q4DA 2EARA 3ELWA 4RXMA 2YC4C 4FEAA 1A9QA 4RQAA 1Y63A 1A5AB 2A88A 2IJGX 1VHJA 3ITNA 1IBSA 3JVEA 2Q3MA 3RAGA 5ILOA 2X0EA 4RDIA 4Y2HA 1C80A 1X9HA 3T7KA 2C0QA 2YWBA 2Z2YA 5TVGA 3SOPA 3W6UA 1Q1NA 1Z0FA 2H08A 3HKEA 3LUFA 5K0CA 3ELUA 3MJDA 2HA0A 2C9ZA 2W2KB 5D5PA 4QSMA 5ALFA 5C3UA 3P2JA 4E09A 4FGUA 5A0VA 4AN0A 1KKMA 3Q6NA 4E5SA 1XYVA 4P4TA 2RKOA 1TT5B 2DULA 4EZIA 1H94A 5HS6A 4HJXA 3SSAA 2AW3A 2E3JA 2GHQA 1K9VF 3TPZA 2FUEA 4B6GA 1V8BA 4C2TA 4WESA 4UD6A 2CXRA 1JSXA 5DU2A 4YUVA 1S3IA 2QPLA 4UMFA 5THKA 1ECPA 2H5EA 4H7DA 2CUTA 3KYBA 1XVVA 3URMA 5FOXA 4CT4B 2X9VA 2NU8B 1CEYA 4UATA 5DHQA 2RC6A 1IRXA 1PZXA 2WWRA 3HZHA 1V9SA 2P9TA 3AEKB 1MAUA 3CF0A 3I01M 4Q3EA 1A7JA 5AJTA 2OV3A 3CZRA 3O8QA 3AK4A 1SRRA 3A1TA 2CSXA 1EQAA 3PGA1 3CNEA 4DA7A 1O0SA 4IRMA 4UM9B 4JODA 1UBNA 2FMIA 4N6NA 2XLBA 1K7YA 3KT3A 1QS0B 4KFCA 1EXDA 1GZUA 3BIWA 3EWIA 4J8PA 4QUGA 4RIGA 4K6CA 5K0FA 2RHMA 3QYPA 2YWRA 4B2IA 1XVTA 3C6QA 5JH7F 2EWMA 2JGLA 2QENA 4LNHA 1VJRA 2VAPA 1G66A 3BBLA 3BIFA 4PC1A 1UBRS 2FP3A 3AW8A 3HLTA 5JVDB 1K98A 5DBGA 4RETA 1YBVA 8OHMA 4ZALA 3A4YA 4PCUA 1J33A 1NUAA 3TK1A 2KM1A 1I4EB 5TPZD 2QN7A 2FFAA 4N76A 3PQCA 1JTVA 1ZCZA 3TLKA 3GFTA 3PWZA 2WNSA 1XR3A 1YUBA 2JIPA 2PGXA 2QROA 3HJCA 4DM7A 3IAAA 3JWGA 5HHTA 3W8NA 1N2HA 5KNCA 3KQTA 1O0CA 1JAXA 4HQFA 1IULA 3RVLA 3FI9A 1VYUA 4B3HA 1WHTA 2LDXA 3QOFA 1I7QB 1F8YA 2XDYA 3M5WA 3MMNA 3QENA 1FW8A 1ZA1A 1TVCA 4NZ9A 4RHUA 3SEFA 5KNBD 4NMLA 1ECLA 3I61A 2CBZA 2VRBA 2XODA 3W5IA 3DD5A 1EGMB 3QA3E 2GEVA 4W6QA 1GUYA 4Q7QA 2PBFA 3O1IC 3FG9A 1OA0A 3FSJX 3OLQA 1DDGA 3AUXA 3OJFA 1QIEA 2IIQA 4O2BB 4Q4HA 3LG2A 2B1QA 3DKVA 2XI4A 1GU0A 3IXLA 3NDIA 1X7DA 5BOVA 1RHRA 3TMKA 3G5LA 4XGQA 2H2AA 3E7PA 3IILA 1J9EA 4C5CA 3VU9B 1E9BA 5AH0A 1T8WA 1EQUA 1GQYA 2X19A 3G68A 3Q3VA 2X8AA 4PZ0A 3B1VA 2QZJA 4HO1X 4RVCA 5ESXA 3RHSA 1SVOA 3SK0A 4XQEA 4D96A 3STWA 1T8SA 2EFHB 2ST1A 3DZHA 4L4ZA 4ZQIA 3ZZ0A 5EIXA 3IQXA 3U3XA 4IF6A 1BX0A 1BRTA 2BF7A 3PDJA 1JWLA 4DXDA 1U5BB 1PZHA 3I6MA 3PEVA 2L42A 3TIVA 2JG3A 4KV9A 4RKRA 5A5FA 1E79A 2O2HA 3V2UA 5DOVA 3O75A 2H57A 4GZ5A 2QG6A 3IT2A 5LXTB 1U8CB 2C00A 4PFJA 1L4GA 4YJKA 1AMOA 3SY8A 1RBQA 1IONA 2H0AA 3ZJVA 3NOOA 4YQZA 3U7JA 1TMKA 5JRJA 1IK6A 1NM5C 4CMBA 5K4GA 1WNTA 2XDQA 1CERA 4DKXA 1HNXB 1LW6E 1A95A 3AVTA 4QUAA 1UQUA 2COKA 3IUSA 2OFPA 1SU7A 1MOZA 1NZFA 3DFMA 4QBIA 3EHDA 2IWRA 3TRIA 3UMMA 5T4BA 4UTOA 2WWVD 1D6JA 1QR2A 3CHYA 5AOVA 2ZM5A 4GSLA 4PRZA 2OO5A 3TWOA 2AOXA 2BBWA 4I9HA 1XZGA 4AF6A 1SUPA 2JGEA 4YP0A 4B7AA 4KACA 1J07A 3FOWA 1YJ8A 3L4BC 4MPPA 5FP0A 2MCFA 3CVVA 1EJ0A 4OMUA 1H6CA 1O7JA 1WVMA 4QUIA 4S1PA 3OM0A 4ND2A 621PA 5E2IA 4Y9RA 3TNDA 1AQYA 4X62B 4GI2A 3E8XA 1FFBA 4Y0AA 5JROA 2JHGA 1U0LA 4F5YA 4YDSA 5BWCA 4G8BA 1Q44A 1UWVA 4JUCA 2YNMD 4ARBA 3B51X 2J08A 2IUEA 2QXYA 3TLMA 3CMCO 1XA0A 2XRFA 3C4JA 1RZRD 2HBQA 3JD2A 3USES 1IY8A 1Q84A 1I7PA 4EJ0A 3E03A 3PFGA 2G17A 1Y1KE 4QGAA 4LYGA 3S99A 4XQ9A 4MQLA 4YT5A 3G5MA 3DHEA 1U7DA 3U26A 1JR6A 5LPNA 1NV8A 1O95C 2PG3A 3I6IA 3NDRA 3QWBA 2EC5A 4JI1B 3X3HA 2NQ2C 2D74A 3ETNA 4EGAA 1NKTA 1MRNA 2P3SA 5TMPA 4DV6B 2YUIA 1OIXA 5EIWA 5G1NA 5ICCA 1VPEA 2RC5A 5JFGA 1G7SA 3ZDDA 2VDWB 3EARA 4WASA 1XD9A 3RNOA 1FW6A 4Q9NA 3ZIAD 4L7QA 1QC5A 1U65A 5K2MA 1CVLA 1EE9A 1EA7A 3DTVD 4L16A 1M1UA 4DR5B 3DONA 1VLHA 2Q21A 4MRNA 3P45A 2G72A 1XZLA 1O94C 4KO4S 1YBHA 2FN8A 4EHBA 2GA8A 5E7JA 1EKXA 2CFRA 3ILHA 5C53B 5LA6A 5HDBB 4HWPA 4OLFA 4X64B 3VXKA 2K6GA 4IVNA 4DV1B 2ONKA 3R8CA 1S1MA 4LBVA 2IITA 3TLAA 5COAA 2UUCB 1XWWA 2O8BB 5AJUA 1J9ZA 1HT3A 5AMXA 1P2UA 1JJFA 3A1WA 4NDZA 4WOBA 1QTIA 2QTLA 2Y0PA 3ZH9B 4ZHQA 1BFDA 3ZHBA 3AI7A 2ZM6B 1PT7A 2Q2OA 2WJHA 4GQAA 4R8LA 5C18A 1C5KA 2XNDD 3ZIDA 2NU9A 2DWUA 1OFVA 5GMOA 1OU0A 2GAFA 1B3RA 4FKBA 1U2SA 4H31A 1XMXA 3D7RA 5G1PA 2YHIA 4TQAA 1T2DA 1TECE 1DRJA 5F9MA 1SN7A 3ZNOA 3GRUA 2PH7A 3RFFA 2Y6UA 2A57A 5DYWA 4US2R 2CYAA 1DOAA 1Y4UA 1CUIA 1IRIA 3IR7A 5LZ7A 1WL8A 2WDZA 4X66B 1BMDA 2O3JA 1MORA 3QEMB 2VLBA 3AFNA 3DGEC 4PSDA 3RVMA 3VGJA 4J1SA 3IAM1 2QSZA 4UHBA 2WHXA 4BFVA 4BQEA 1M67A 1PJSA 1L5MA 1Q0ZA 1XTRA 5I9MA 4GU5A 1RJFA 1NYQA 3H16A 4MYUA 1WMDA 3WB2A 4DV7B 5ALOA 1KSJA 2B25A 4LGYA 5JS2A 5JMPA 2FWAA 5M5BA 1J8MF 3CBQA 4BLRA 1DXOA 3DVAB 4I55F 2ZSUA 3ZGLA 4CL8A 1TTPB 3VR6A 2AYYA 3GOHA 2E6KA 3PRKE 1QF6A 4HCJA 2Q2VA 4UBMA 5J2TB 4DEYA 5IG2A 4RY8A 1JLRA 5AXBA 1Y3IA 1Y3AA 4EIWA 2UZAA 3GBPA 3OPQA 4Q4JA 3FSGD 2XWSA 5CA0A 5KNBH 3UHFA 1XXHA 3NGMA 2IDJA 1FSSA 4MV7A 5KAMA 3WG9A 4AZ0A 4DUGA 2H06A 5A02A 3IT0A 1QLWA 1LF0A 1NRWA 3QW2A 1Y7PA 3DNMA 1KK3A 3HN2A 4I4TB 3UN1A 5JTTA 2E6UX 5A04A 4F3TA 3SLRA 1CKEA 3CH7A 2ZREA 3RJ9A 4HAZA 1N5JA 2A4KA 1ZG3A 2GZDA 2I6XA 3H4IA 4K0RA 2PH1A 4AO7A 3FJYA 1N9ZA 3TNLA 4XX0A 4B3RB 2RSLA 4ID9A 1MABB 2Q62A 4CYMA 1CQWA 2BHSA 2O1WA 1A04A 4XPIA 4CI0B 1JFSA 2GCOB 2YWEA 4D9BA 1XTQA 2QD3A 3ZCXA 2PO7A 5AI6A 4RE6A 3RYHA 3SWWA 1ZNYA 5DDIP 3OE7D 1VLVA 5IN5A 5ALVA 4Q9IA 4IHJB 3ZX5A 1YNOA 3QVUA 4O5AA 3V1LA 5CT4A 2QT9A 1HTTA 5HFJA 1E2FA 1RABA 2XYHA 1US8B 2O5RA 2R3SA 3ASUA 1IJEA 2P2NA 4LSWA 5CLGA 1EX7A 3HB1A 2EDCA 4PG4A 1K63A 1HT1E 3OCWA 4B31A 3OY2A 4R8SA 2NSLA 3SC2B 4A23A 1HL3A 1NE2A 4RD0A 2AOTA 3O3MB 4AICA 4QEDA 1X1BA 1U3TA 3KOOA 3F5QA 1N4AA 3WIUA 3TQSA 1JZSA 1KMNA 3T1OA 3IX7A 2WICA 2ZE5A 3H5TA 2XGOA 1AZLA 4EX6A 5HFNA 2I8CA 1Y6QA 2J6IA 2XUDA 1ORVA 1THTA 1YXMA 2IRWA 3ZCPA 1DO8A 1D4OA 1RYMA 1NXPA 3BAFA 1ZY2A 2NZXA 4XLZA 4TWBA 2I33A 3DB1A 1VQ1A 2JAUA 4CU5A 1DZIA 1M2NA 1CF2O 3KLBA 5BYAA 1HTBA 1RKQA 5CLFA 3EQ2A 1ZD5A 3H11B 1XQXA 4EJFA 3SZRA 2O50A 4XSHA 1FSZA 1MT3A 1W34A 1D7OA 1U2QA 4RZSA 2YJ6A 2Q8NA 5HXAA 4BKRA 1EB8A 2P62A 2YXEA 3GFGA 1LI4A 4MARA 1E5TA 1JRLA 2VA8A 3IPAA 4OYRA 2FSVC 1LPAB 1GV0A 2P1DA 3AWIA 4ZXPA 3AF4A 1E2BA 1TZMA 3AR2A 2JBWA 1PSDA 1T9ZA 2W93A 3COZA 4EABA 4BQNA 3HDGA 3QELB 3WC4A 4CU2A 2X3YA 2JBAB 4FX2A 4LZLA 3M6UA 4IGKA 4P82A 3S2ZA 2F9LA 5FUYA 5EHXA 2FMTA 3EVCA 3NC1C 5LJIA 4LJ7A 2BGTA 4OAPA 2ISSD 3QKWA 1X1SA 3DEHA 2LGJA 2W6PA 2AN9A 1LV8A 3DOJA 3UMRA 3VI4B 4B4VA 2O8CB 2Z6UA 1OPXA 4EJ2A 1CUCA 1V3TA 2NTNA 3CGGA 2HA7A 4GD3Q 3E7XA 1RYEA 4OYHA 5KDLA 1QZZA 3OWOA 1EE1A 3L4BA 3T7EA 1C29B 3VSDA 4YYEA 1ZXBA 5G3ZA 4QX6A 1DTSA 1L7PA 2HF9A 3S29A 5JH7B 2DJIA 1ZFNA 3UG7A 3E9DA 3K9LA 2O3TA 5JARA 3MWGA 5L3VA 1H9BA 2PUCA 4MTLA 1KI8A 5MDHA 1QHGA 3PLRA 4W7SA 3GIDA 5GVSA 2OMKA 3CPSA 1OC2A 3T0GA 4EI7A 4P4NA 4GDFA 4IIXA 2G06A 1R4NB 4ZVRA 1C0IA 2XRZA 4AMVA 5K5EA 5ERXA 4J03A 1U0SY 3IULA 521PA 3OZIA 5C0OE 3NATA 1CS0A 2VS1A 3IMCA 4DLPA 1HLGA 1NVEA 4ME6A 1EFVA 4LDJA 3RI3A 1MEOA 3GGGA 2NP7A 4DLUA 4K7JA 2OHFA 1FF9A 1N3IA 1QVWA 1Z33A 3FWZA 4H7IA 4LTNA 5D01A 3IQIX 3GEEA 4LBYA 4YIKA 3UMCA 4L9RA 2VT7A 4R9UC 3HRKA 4REQB 3V4SA 1NSFA 3RKUA 3L7KA 3WGOA 5JD5A 4DDMA 4EQZA 5JXWA 3THOA 2RHLA 2C03A 1SIBE 5EQFA 5REQB 2VDPB 2AK2A 3ZKWB 4KK4A 1OFUX 1Q1BA 1E4OA 5ETJA 4ALNA 2ZJ5A 4EYKA 2FZEA 4KIUA 2QTVA 4ALIA 3Q1LA 4URFA 4IWYA 1CF4A 2WILA 4DIKA 3EDRA 4DRXB 1QKKA 4UHDA 1JXOA 2JGDA 4FMPA 4QXRA 2Y1OA 3DKPA 4EG0A 3UXMA 2NZ8A 1O9HA 1WCIA 3PVZA 4CQLB 1CUAA 1R1DA 4B6PA 1QUFA 3G6WA 4DDVA 1E3QA 5BN4A 3OQMA 1FNBA 2B8NA 4Q7JB 5LKRA 2VIIA 1BHJA 1OJLA 3C7TA 1PK8A 3TW4A 4FM9A 1ZI9A 4NONA 5HOEA 1O97D 3I4LA 1MO3A 4Y6GB 3VHXB 3SNKA 1HNNA 3O7MA 4BNZA 5K99A 3ZI4A 2HWWA 3LOQA 3VH3A 3RSSA 1N2SA 2XKBA 2XWPA 4OI4A 3GK3A 2PLNA 5T8KA 3UWMA 5IH7A 4JKIA 3GEIA 3PIIA 2ANBA 2O05A 2IY9A 4WA8A 4ZYVA 5C5CA 2P7IA 2R8ZA 3C5WP 3CR8A 2XECA 3ZHRA 3H5LA 1J2EA 3B6MA 4IDCA 4RV5A 1IC6A 5C2JB 2MOKA 2DBVO 2ZCUA 3R0JA 4IR7A 3KKZA 1T9KA 1GG9A 4OKNA 5ALPA 4DSZA 1ZOIA 1OTHA 3C6XA 4L4RA 1V35A 2WYOA 1K27A 3RU7A 4BXOA 3JD1A 4JL5A 3ZE2B 2WG1A 1GRVA 1RRMA 1S96A 3HR4A 2X6RA 1VDZA 1I6MA 2DY0A 3BXZA 4OI1A 2A1UA 1N0IA 3QBDA 2E89A 2IIBA 1TCVA 1WDTA 2OPBA 2VCYA 4FS8A 4IRUB 1FQOA 3PYMA 4N5MA 5D7NA 2PD4A 3A32A 2ZW9A 4BMPB 5H7XA 1LLCA 2PLWA 3MQFA 5CH8A 1M6YA 2G1JA 3OFJA 1NUSA 3V1YA 5TQ2A 8ADHA 4B8ZA 4MIKA 4EB6B 1YGYA 4ZU1X 4JX8A 4KUHA 4E94A 1ZD2P 1U8XX 3LUPA 2RGAA 4JQCA 2JLRA 5IVDA 3VNBA 4DMGA 1GTRA 1P0IA 4L0CA 3TDKA 4LA4A 2FOLA 4L73A 3ZPXA 1MJFA 1RADA 3JATB 1IU9A 1H6BA 3MTQA 1WY5A 4FINA 2O3RA 3OPYI 4JBWA 3RS8A 3W6OA 2BFEB 4LOHA 4DMCA 3GL9A 3P9IA 3QF7A 3T5BA 3AJEA 4K86A 1GPMA 4KDCA 3CEAA 4TS9A 1N5RA 4XYEA 4W5QA 1NW4A 3STYA 2NVOA 1YE8A 4JB0A 2FSIA 2GARA 3CN9A 4WKOA 5T4HA 5FF9A 3WLJA 1UMBA 2CLDX 3FUCA 3UFXA 3FCEA 4US0R 3FMGA 5B2FA 1PWEA 1DSSG 1KBOA 1XP5A 1K3TA 2XYVA 1K6XA 5H9VA 1GU1A 1TZJA 4BJ5A 2GF2A 2R8PA 3KOZA 2VWGA 1N34B 1OWMA 4FEGA 3DL4A 3D2LA 3OLYA 3EA5A 3IRVA 5FHQA 3WGJA 2I6GA 4R71A 5K4AA 1I0IA 1NR5A 2R4UA 3FDXA 1EXMA 5TGDA 3UXYA 3CPHA 4CLDA 4YQEA 3TL6A 5BVHB 2W6QA 1KPIA 2EYUA 3O8DA 4IJVA 4JJZA 1NAHA 5DT2A 3FX2A 4NR0A 4BNUA 3GVPA 4N18A 3SJZA 1WCV1 1GRCA 5GWXA 3RIMA 4ALJA 4CKXA 4IOJA 1Z0IA 3TOCA 3BD6A 3VTAA 3PQEA 3O3OB 4FI3C 5FWYB 2TECE 2DRIA 4TYYA 2LKDA 3U81A 1P31A 5B1SA 4GI7A 4U2BA 2V7TA 4FZJA 4HS9A 4RJLA 3FYCA 4MUKA 4JVNA 1T2VA 2C5HA 2O2CA 3FCOA 4PGGA 3QLUC 3T9DA 2OYSA 5KJCA 3L49A 3MFYA 3IJ5A 1G5HA 1K89A 1RWPA 4I46A 4QUDA 4P33A 1QUEA 3SXPA 4BWYA 5A3QA 1LI7A 2XD9A 5LLDA 4FB5A 1BYUA 1KFCB 5H59A 3NOXA 3QLTA 3ROQA 1DBIA 1W9MA 4U39A 1BE8A 3Q5EA 2D7DA 3F1LA 2PQ6A 2Q8QA 3PRHA 4ZDJA 5BPHA 4G5YA 3VDMA 1JFFA 3ESZA 3SYKA 1PQ4A 4JJKA 2VXBA 2Z08A 3DV0B 4EJSA 1N6PA 2W8BB 4JASB 2EJVA 1CJBA 3DR5A 4J0FA 4Y2UA 2ASVA 1SCAA 4CHGA 4HATA 1ZXLA 4EUKA 3IFSA 3AT1A 3C15C 2IYEA 3LX4A 4LF4B 1V37A 1SUAA 3ESCA 1MC5A 2R7MA 3P9ZA 3A4MA 3COWA 4HFJA 3TQCA 5EJ4A 3C7KA 4QTXA 3BMQB 4MQUA 3I4CA 4CCYA 3O21A 1Z37A 1O0BA 3QWAA 2PV0A 4REMA 1Y7IA 2IHVA 4PYOA 4J76A 4HS4A 1KDOA 3ZKAA 4YEDA 1ST2A 4WGGA 3AVWA 1U1EA 4OQNA 3GCDA 2DJ5A 3DP7A 1X80A 2FETA 4HNRA 4R1LA 4ARVA 1SOAA 4E3WA 3TFWA 2IU0A 1H65A 4V0SA 4NBTA 3L0DA 1OIWA 4JI5B 5CMLA 4RTPA 2VPIA 4LF8B 2XMZA 5IZCA 4WNYA 3K35A 3D2BA 3I0MA 4R1QA 2YS7A 3OE5A 5I7VA 1ENZA 4JQSA 2HCRA 3JVVA 4RULA 4LX0A 2C4VA 3MAAC 1K7SN 3EEYA 3GLRA 1P2VA 2FRDC 1SOWA 3R41A 2BEJA 1UXIA 3KFXA 1G18A 4DR7B 3AVPA 3CZMA 3F6PA 2VWHA 1O77A 2MSWA 3CZAA 5ECDA 3TIXB 3ELYA 1IH8A 2PS1A 3K1YA 2G9NA 1GPWB 3S1LA 2A35A 4R0VA 3G2OA 3KAKA 5BSRA 3R7BA 2VDUE 1PTJC 2GTIA 2XRMA 2CFCA 4FJ0A 1JLLB 4YP7A 5FNVB 4M6WA 3DNPA 1O95D 1C9YA 2OBNA 2SKDA 2XDAA 1QE5A 3F5MA 4FX5A 2DPHA 4TLEA 3MELA 4HZGA 3OOHA 2WUWE 3L0CA 3H5WA 2IXFA 1SIWA 1TT5A 1PS9A 2PGDA 3BGWA 4DSOA 1G6KA 1EVKA 1R4AA 4ZVVA 1X3SA 2QWXA 3A9RA 2Z0MA 3R9XB 3IUQA 4X3PA 3DOFA 1CC1S 5AVOA 1RHKA 3CRZA 4NU5A 3T35A 5CFZA 2C2BA 4KXLA 1OFHA 4YV1A 4WLOA 1G7CA 1EAYA 2YY5A 3ZC3A 5AVWA 3GAZA 1N7GA 1JG3A 1V71A 2WU8A 5TT1A 5ELMA 2WHPB 5DNEA 2OCBA 4RSRA 5D3MA 3ZLTA 1QNFA 3IB3A 3B5EA 3O8OA 3ZZTA 2BWJA 1QCCA 2O0JA 4KDEA 3OZVA 4QXAA 4YK7A 1X38A 1LPNA 2IKQA 4JQYA 3VR1A 3PITA 3W4JA 4PHFA 1V1RB 1P3DA 4MCHA 4IXMA 2Q07A 3CZ9A 3N2KB 1K5PA 2A7XA 3CISA 1MDFA 1YASA 2UZIR 4R7ZA 1N2XA 5ES3A 1A2QA 4F38A 1HOXA 1QS0A 7REQB 1IK4A 5L3ZA 4H6WA 2CWDA 1J49A 1YTLA 1NQVA 5I8PA 2PRJA 2YV1A 2VZ9A 1QAOA 4RMHA 4YJ2B 3NCTA 3FTEA 4FFPA 1EP2B 4Z7NB 2OOSA 2WINI 2AOWA 4U5XA 1C3OA 2GD2A 3WDKA 3PP8A 3E18A 1L4NA 4JBYA 3EZGA 4RYDA 1JJ7A 1JE0A 1PR0A 2F6RA 5AJHA 1ZESA 2A5LA 4IZIA 3D4PA 3TW6A 5DWDA 5CEFA 2VVTA 2PKRA 4GVPA 4KK3A 2XITA 1ZEMA 1BOFA 4OG2A 4N65A 1XZJA 1CQIA 1ZZEA 3GMDA 3H8SA 1O9GA 2RGYA 4IQFA 3AF3A 4GM4A 3L6OO 1N6NA 2JH8A 2DFPA 2ZITA 3RUCA 1U9ZA 4RHYA 4WRRA 1T1GA 5DNAA 4NDAA 4KMMA 1RLJA 3NDJA 4FYIA 1OI7A 1ZD8A 3ZDQA 4C2BA 2H1IA 1YGPA 3MC1A 2L2QA 1GRQA 1VMAA 3LA6A 4FDUA 3ROEA 4ZYLA 2G7ZA 1TQ6A 1WHSA 5MN5A 3GEPA 3AB8A 1D07A 1DQPA 1JQLB 2ARKA 3SZGA 2HX1A 2VPXA 2QUIA 3L7CA 2ATEA 9LDBA 3E35A 3HHPA 5LWQA 1MAVA 1J8VA 4QT4A 2GEJA 2I2DA 3RU9A 3JSAA 5FUMA 3RVJA 1I3NA 2H63A 4CIXA 3RYCB 1JA1A 3O0DA 3H1AA 4EYOA 1OREA 4B81A 4MKIA 3ZDXB 4TL6A 2BKAA 2X0JA 3VU9A 4JI4B 2H07A 1HZZC 4OGFA 4TUYB 2PXCA 3DUFA 3K9HA 5ALGA 4TTPA 3OPYB 3D7KA 4ZC1A 1L1QA 4DIEA 1DPGA 3QG5A 1ZR4A 2PD6A 3OM8A 3WLLA 1M66A 3PEUA 4TRNA 1P5JA 2VDRB 3A6GA 3ZLVA 3DTNA 2FWPA 1U5BA 2IK8A 2W6JD 2A0UA 2Y92A 5I9NA 1E3IA 1L5QA 2PA0A 2VAXA 1PNTA 1MOPA 1LPMA 1KR5A 1YQQA 2BM8A 4JLNA 3TQTA 3LHDA 4RKFA 2XUJA 3UYLA 2J1LA 1B43A 1JYFA 1UOPA 3N5KA 4DDHA 1HE1C 5IKEA 5LXTA 5IT0A 1MJNA 1V9LA 1LV7A 3P26A 2Q6KA 3KETA 1VXRA 2X1LA 4NZMA 1X7XB 1C7ZA 4ON9A 5TNXA 5CGQB 2E4AA 4U7TB 5EG5A 4X9XA 3GP5A 4PPYA 3BDIA 2BYTA 1NNI1 2ADMA 1Q1GA 1V1JA 1HE8B 4RORA 4YASA 2I03A 2OCYC 5LMZA 3PX7A 2CCKA 1SK8A 2C5BA 4BQRA 5I8ZA 1SC1A 3OEWA 3EFBA 5AHRA 4D79A 2E1RA 3ESYA 4Z6KA 3THYB 1QM5A 1QR6A 1MX3A 4E5DA 2DWPA 2X1VA 2CDAA 1GQ2A 4N5LA 1XE3A 4JA0A 3FVVA 3PUXA 4L1KA 4UBLA 3TE6A 1HKUA 2ODAA 4MYCA 5BV8A 1I10A 2H7YA 3QLUA 3HGQA 2O7VA 1Y8AA 3FUXA 2XMDA 3EGXB 4AC9A 1C9NA 4I50B 4G25A 4YR9A 1I7SB 2W48A 3MJCA 1E69A 2YY7A 5FL7D 5LYJF 3EXG1 3D0OA 4ETNA 1YI1A 1Z3IX 2HXSA 1Z4NA 2ZRHA 5FWAA 2Z8YA 3FUUA 4L22A 2OLKA 2Q29A 3HBMA 3S7ZA 5CG2A 4AJOA 1FA9A 4OB8A 3CUUA 3JQPA 5JC1A 5HUJA 1LZKA 3F73A 3T9FA 4FFOA 4I19A 4LHXA 4MUEA 3GVXA 4O0MA 1U4NA 4Z4IA 4YS6A 3L7OA 1Y9AA 3C74A 4OXRA 3VH2A 3NHMA 4LZAA 3LK6A 4NG4A 2FEKA 1PZNA 4N01A 5BMVA 1ID8A 2WWYA 1I30A 4DE5A 1QGZA 4N4AA 1K92A 5FPPA 1Z5VA 2GFQA 3GBSA 1ONPA 2YDXA 3BUSA 4L8GA 4TKUA 4M1EA 3EGOA 5IAAA 3L79A 1BU5A 2EKPA 4O0LA 1FBTA 4A2CA 4KC0A 1RXEA 4RHTA 3RYTC 4Z2AA 3VO9A 1BH6A 1ATZA 5JWOA 3ZU6A 2HSJA 3MILA 3QXXA 1GYRA 3QUBA 3FPBA 5THQA 4ESVA 4WKBA 2ZBVA 3W6PA 1Z7GA 2X4GA 4JQOA 5F9FA 3IEMA 4COKA 1NKVA 1Y4DE 2BFAA 3OBIA 3QI2A 1GNLA 1RXUA 1U0JA 2A9FA 2FZWA 2IYQA 1XMJA 1Z73A 2RCNA 3LECA 4JR1A 5C8ZA 5KX5A 5LNK1 4ZOAA 4UCQA 1SVNA 3ZD6A 4BJ3A 2V3VA 3K7EA 3O5AA 4K3UA 4NZYA 2QP4A 3I9FA 2F67A 1D2NA 2VA9A 3Q7EA 4H6XA 2JL1A 3O9MA 3X1MA 1CU1A 5LSAA 2VYQA 2O8BA 1E7MA 2FX5A 4CMJA 2HMUA 2JFPA 4HXYA 4YH1A 5J1TB 3D4OA 4BV9A 3T15A 2RB4A 1NUQA 5FOWA 2YL2A 1NONA 2JRCA 1YZYA 1I4TD 3INNA 4YCNA 1Z2CA 4U0KA 4DLTA 1K97A 1KFKB 1T6XA 4RTQA 1K4KA 1TTTA 1BQEA 1IY9A 4Q3CA 4NCIA 3FWYA 1AK1A 2YVKA 1PTJA 4OOFA 3RG8A 1AO3A 1AKYA 1P7YA 1T5HX 3ESXA 3SJCA 4OHOA 5J40A 2GN9A 2OV2A 4RIIA 5F2EA 2P91A 1Z6AA 4BKMA 1XEWX 1JR3D 4DCTA 2H1FA 2WB4A 3LUJA 1ABEA 4BIIA 4DPLA 1OWOA 2B2XA 1RPZA 2H1CA 3FYHA 4YFVA 2VYND 4JT4A 3BGIA 5TVKA 3T1HB 5DISB 1XFAA 3OP1A 5TR9A 1H93A 4GZ6A 4MQMA 5FBQB 1Y1SA 2G9ZA 1FSGA 3DOEA 4AJ9A 3U16A 4Z1OA 4DJEC 4OQZA 2UZ1B 3NTQA 4MQ4A 3WK6A 4CF5A 2FFRA 3PNLA 5K45A 3VR5A 2WF6A 3KYJB 2WIGA 3NWOA 2FPGB 5E95A 3T4UA 5J2TA 1G291 4FFVA 1L4KA 3KJEA 5T4EA 3KJHA 1C0PA 1BE6A 3KOYA 3ZY5A 1ZN2A 4DYDA 1E0DA 3MCAA 3TQQA 2PTHA 3L0YA 3EPJA 3OTWA 3NI2A 2GK6A 2OFOA 2V03A 2M1XA 4HVAA 4WZBB 5KSPA 2DX7A 3KWFA 4LXHA 2PBZA 5K51A 4KFUA 3B1FA 1NXTA 2JCBA 4Q9AA 4XQ0A 5BNTA 1Q92A 3WB0A 4I99A 4OQDA 2Q1UA 1UCFA 2E4XA 3JQFA 2RHRA 4PC2A 5ULLA 1WLSA 1ZW1A 1U9JA 3QBTA 2ORYA 1VE3A 4DB2A 3HV0A 1ZN8A 5DBIA 2GAJA 1XJ5A 1KMHB 1VDMA 2IF0A 4BBJA 1ILEA 5BOSB 7MDHA 3IVGA 2EKQA 2GCOA 2GNOA 4FHFA 5FI5A 1LPPA 2AFIA 2P2DA 2QG9A 4BC0A 3AVYA 2AH5A 2ZJZA 2I4TA 2CDCA 3C45A 3NETA 4WJKB 1HQKA 3EWNA 5EGSA 4X1YB 4EOGA 2X40A 3WQQA 2OBBA 1QCZA 4FOTA 4ZHSA 3A2LA 4HOYA 1EXWA 2ZWMA 5JPDA 4YAWA 1NMSA 3IP5A 3DTYA 4EMUA 3DE3X 1E1KA 3IS3A 5TMDA 1YS2X 3O1HB 1YS7A 1J8DA 2W2LD 2OVBA 3JY6A 2PZ8A 2D0OB 2PA3A 3DPUA 4HDAA 2HPZA 4A73A 3C0KA 2P11A 1NNLA 3PT9A 3OKCA 2I22A 4X8HA 3V4LA 1UOEA 4HMPA 3ZY2A 4GUDA 5HX7A 1AGYA 1EQ2A 3AOEC 2R4QA 4ETMA 5F23A 5ECGC 3R7LA 4H1UA 3FYUB 5TDHA 2HJGA 1VYVA 4X5OA 1JJAA 1TO2E 4F11A 3G7NA 4BMCA 4FVTA 2ADOA 1LC3A 1HZZA 3U3OA 5CD1A 2O3QA 3C3PA 1ISHA 1N8TA 4JNKA 1WZUA 4L76A 4MULA 1ZRMA 3FCUB 2DCUA 2F43B 5E6UB 1T1SA 4Q1EA 3EEFA 5BQOA 5C1OA 1X19A 4HWRA 3AV3A 3KSMA 4KWIA 2O7NA 2ONCA 5BT9A 4B3BA 4DT1B 3CA8A 1W25A 1KVUA 3EXIB 3F9CA 4ENWA 3U6KA 2MMCA 1XC7A 2V6IA 4IJUA 1NG9A 2Q6VA 2CXPA 3LUDA 3E3NA 1FVHA 3P71T 3LT5A 2W6CX 4I5EA 5CVCA 1KBQA 2X7HA 1SG6A 1K4YA 3KL4A 3EOZA 1JEAA 5ED4A 3AVXA 4W1PA 1IOVA 4X1IB 4KR0A 4C6HA 1ZP6A 2YH2A 5F1OA 3PLAE 1FFSA 4EMTA 4DOMA 2FEWB 4NESA 4CM8B 5JXGA 2CK3A 4IUBS 1XD2B 3A6JA 2I55A 2O8NA 4GOKA 4MDHA 1PNOA 2MSKA 3HCDA 4K9DA 5EL0A 1KDPA 1MO2A 4C07A 4CLOA 2FOXA 4J9UE 4RLHA 4TWJA 5DWVA 4EHNA 4EI9A 3E6AA 5JD4A 1GZ3A 2QRVA 3GLGE 1P9RA 4LRSB 3BS4A 3Q85A 2PUBA 1E6EA 3VPGA 1FYVA 1UZMA 5HR5A 1A2OA 1JKJB 2GD6A 2WJYA 3AUFA 1JHQA 4BAUA 3N2IA 2WLSA 1KOFA 4V24A 2WWXA 5J4VA 5JH7A 3AR7A 3PXUA 4F5EA 4G4GA 2Q4RA 4F04A 2RD2A 5JJ5A 1RKXA 1TYEB 5EZ6B 5JXJA 1HURA 1SXGA 4EKGA 3U1BA 2CLSA 3ER8A 4EH1A 1Q1EA 2Q9BA 3H86A 4I2NA 4PLPA 3N0RA 4RQUA 2O1EA 4WLNA 5EIAA 3WYFA 3CIFA 1Q0UA 5H70A 1L3IA 5MN4A 3RB8A 2P2GA 3VA7A 1FL9A 1R8QA 2FMHA 3II6X 5L4LA 3IDZA 3N2GB 4FNOA 4D8VA 1VPDA 3QFFA 2EHDA 4HF7A 4O4IF 1FLDA 4M0DA 3KELA 4UM5A 5JDCC 3TM5A 1YVDA 5C7LO 5L51A 3DLAA 4MKGA 5CP8A 5CX1B 5A0FA 2FW7A 2I9PA 1D9XA 3QE4A 3DEJA 3OQ6A 2XZPA 3GJSA 3AP2A 2GDZA 3DVRX 3GDFA 4TSKA 3QEBZ 2RHGB 1KK0A 3R5XA 3ZGVA 2VNIA 3TW8B 1HQCA 1KMMA 1RPAA 4IG9A 1VCIA 3ICWA 3RG2A 3W8RA 2WYWA 3PXAA 5IBPA 4R5MA 4MI1A 1YA4A 3UPTA 3GEDA 3PIRA 1J09A 2JLCA 2PAAA 5HKAA 1D6SA 4JYZA 4G0VA 3O0TA 3ZXXA 4AURA 1I80A 4TYMA 4R98A 3ZE9A 4DRXA 1SCJA 2HQBA 2XNCA 3OZUA 4IF4A 3P8ZA 2B2CA 3S27A 4B3TB 3D43A 1SKBA 3GN1A 4YX9A 3SDSA 1H2HA 2QN2A 4N0QA 1ZN9A 1WMAA 4WNCA 5AVSA 5I9IA 3OEYA 2XA2A 1MFZA 1UR5A 1PFWA 2CB0A 4EFLA 4BTEA 4NXNB 1PJAA 2IA5A 3NONA 1EI9A 2PEZA 2A94A 2Q2WA 4HDRB 1SBQA 2CL5A 2FPLA 2LD4A 2Q9AA 1VKJA 5A9SA 3VHXA 3TOZA 1GNQA 4FFBB 4K9MA 2EERA 4UNQA 4PLHA 2P67A 5FTLA 2QV0A 3ZE8A 1E2PA 1BFKA 1KP3A 4G1EB 2HREA 3MGBA 1G3IA 2C96A 2R4TA 4J0IA 4LYJA 4MS3B 3WE7A 4AWBA 1B23P 1ZI8A 1BXKA 1CW2B 1KQ3A 1WZCA 3K73O 5IAJA 2PUGA 1CT9A 5TX7A 1DNPA 2BM0A 9ABPA 2ZB2A 4P92A 4Y2JA 3PUYA 4F5DA 5GJWC 1ULAA 4FD2A 2SICE 4B3CA 3MVEA 1TCUA 4GM0A 5I9TA 4OJTA 2WLTA 5G0UA 5LQAA 3UMJA 1CQXA 3PKJA 4UVEA 5KPDA 3PC6A 4J6EA 3EUFA 3SC3A 3L0PA 2ATCA 1NP3A 1ZMTA 5CAEB 3TW0A 4E5PA 1AF7A 4D0NA 2WG2A 1L7MA 2BGWA 2QVGA 3GLIB 2VATA 4EPXA 4C1BA 5AFSA 1KYWA 2CMKA 1CRQA 1GY8A 3B6KA 3JQQA 3OZEA 4CCAA 1ZM4A 3LVQE 1KPHA 1GM5A 4AUMA 5TPZA 3PIDA 3GVIA 3R24A 3PFNA 1NW8A 3F9RA 1VBNA 3U2QA 4LRQA 1DFIA 3S5UA 1V7QA 4YWJA 4TRRA 1HDIA 4MMYB 2EBUA 5CLHA 1F51E 3SPXA 2ZJ3A 4M0MA 1J0DA 2QTBA 2BFEA 2GD0A 2P0AA 4CMCA 5AJWA 3VNRA 2WJ6A 5LP6B 3R6WA 4KHZA 3VOBA 3ZI0A 2HLHA 3ZQ6A 3P9PA 3N39C 2YRWA 4OLJA 4QOHA 1DB3A 3AJAA 3CF4A 4BPRA 2HPAA 5EWJB 2HA3A 1M2GA 2ZUFA 4C30A 1QDEA 1GV1A 4X7MA 1XT6A 3ZCVA 4HQNA 3TOXA 3UA3A 3RAJA 1KRHA 1P60A 1ZA2A 2X5XA 3JARB 3O4HA 4KH1A 5DOZA 4D8UA 5C4IA 1R8XA 1IG0A 2CMHA 1QYCA 2W37A 4PLCA 3RRNA 1J8YF 1EPUA 1ZJ5A 1E5DA 3FVTA 3HA7A 1T91A 1W6RA 1PBTA 2PRKA 4EYQA 1V2HE 3VZQA 1XEWY 1XCLA 4WLEA 5CBPA 5JIBA 4ENRA 2P0YA 3ME5A 5CT5A 4PZUA 2YN2A 3FOAA 1OSNA 3NIFB 4YLYA 3UJ9A 2V59A 5HIJA 1CJSA 1Y9EA 3D6VA 1ZBDA 3PJFA 1QYXA 5IDWA 2CC2A 5CM9C 3BD8A 4D0SA 2C2GA 4AKEA 3AOEA 1OX6A 2UVPB 4QDKA 2IV7A 2IH4A 4F92B 1EZ1A 5JDIA 1A76A 1R6BX 1FFDA 2YJNA 3Q0TA 3SJBA 3OMLA 2H0RA 3WYBA 5EXPA 2J9FB 3DT8A 4MVJP 4C0AC 1XCPA 1Z5GA 1BDIA 2I76A 2P3OA 1RYZA 2FUG1 1HZJA 1RWWA 2W2PA 2Z4SA 1FB5A 1VZ3A 3LTEA 4U3JA 1T9HA 1PEDA 3FF1A 4DA8A 3IUPA 3W7AA 2GT1A 1CUVA 4DLBA 3F74A 2R1TB 1TD1A 1UINA 3GRFA 4IOKA 3AKDA 3OQVA 4HMQA 4NOMA 4JGIA 3ROKA 3SFVA 2PKYX 3V1KA 3OX3A 4OJQA 4F0JA 2IX3A 1K2WA 4G0XA 3PSHA 4NH0A 4E4RA 4F2HA 3WOVA 3CVUA 5L45A 5ALXA 4Q48A 3JQCA 3OX4A 1GTSA 2VJCA 4OU4A 3M33A 2VDVE 4LOLA 1E66A 2OHHA 3C1AA 3L8CA 4WINA 1ZSYA 2IHZA 2WC1A 3FFBA 1BX3A 1SY7A 3IGFA 3TEFA 2NP6A 3W1WA 1S2GA 3DV0A 4NV1A 1UFQA 3FBTA 3RF7A 3P2EA 4I55A 4O3MA 5KJFA 1CVRA 2FUNB 1G20E 1KJZA 4HDKB 3EULA 4KU4A 2X13A 1IB0A 3CX4A 5CEJA 1Z29A 3BMQA 3FROA 4FDAA 2EF0A 2V5UA 3KJIA 3WQRA 3L06A 5ITZB 3KCQA 3RSQA 3RUDA 4N5DA 3NYIA 5ALHA 1VJ1A 3JYPA 3D31A 1NVMB 1WWKA 1XX6A 5ESDA 3HDJA 1RZRA 3LHIA 4INPA 5LBIA