4H7EA

Crystal structure of haloalkane dehalogenase linb v112a mutant from sphingobium sp. mi1205
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
total genus 112
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7eA00
1B41A 3S8YA 3FYTA 3DYVA 1WB4A 3G0IA 5HF5A 1WOMA 2Y2UA 2HDWA 1LPMA 1MX1A 3YASA 5FPPA 4G1FA 4G4GA 4UFNA 1KU6A 5EHNA 2XUPA 3IIIA 3R3UA 5D3ZA 1UK7A 5F4ZA 2QJRA 5C8ZA 1UOPA 2RHWA 3I2GA 3HXKA 2BUBA 3IULA 5IKXA 4L3WA 2CB9A 3I1YA 3H0CA 4UBMA 4H7DA 3DQZA 1QGED 1IUOA 5T4EA 1H2ZA 2NW6A 4Q1VA 4P93A 5JANA 1XRMA 1YR2A 4C4ZA 5EGNA 5E2IA 3WIOA 2GBGA 1R9MA 5EIAA 1TIBA 5HF8A 1EB9A 4FFWA 3E0XA 5JALA 4ZREA 2XLCA 5CT8A 4H77A 1QTRA 3WI7A 2HA2A 1LGYA 3MGAA 2VJAA 4EY6A 4DNFA 4C88A 3FAKA 1UK9A 4PW0A 2Z3ZA 2C4HA 2WHQA 3DD5A 4UFOA 4B9EA 2XT0A 2HA5A 3VJKA 2I03A 2GBCA 5CRIA 2ES4A 2OCGA 3H2IA 3HJUA 1W6RA 4KEAA 1IUNA 1QTIA 1ACJA 1EK2A 2JGJA 3QVMA 1SFRA 3FVTA 3DYIA 2CBGA 3O9MA 2H7XA 3UMJA 1YAJA 1GZ7A 1YS2X 4UBNA 4Q82A 1Y7HA 3K6KA 3BE8A 1UT6A 4IHAA 1ACLA 4Y2PA 5DLPA 3EF3A 4QDZA 3KWJA 2QUBA 4XWGA 1CR6A 1ZJ5A 3G9UA 4UHCA 3DCNA 2RI6A 3F98A 5EI5A 3EQ8A 1WPXA 3G8YA 1YAHA 2LIPA 4BZZA 5K3CA 4ZRDA 1L7QA 3O4IA 1XQVA 1W1IA 2E3JA 4J0GA 4A5SA 1N8SA 1UKBA 5K3EA 3IUNA 5DNUA 3WL8A 2VSQA 2PSDA 1XZFA 1DWOA 2GZSA 2VJBA 1AKNA 5AI4A 2XUQA 4MYDA 5A7FA 4UBJA 4UUQA 4DNPA 4Y2YA 4Y2JA 4AN0A 1DINA 1H23A 2WLSA 5K5EA 4GECA 1U8EA 1Y37A 5JZSA 5AI0A 3AZOA 4I3FA 2BKLA 2PM8A 4KJXA 4K6HA 1QO9A 3HACA 2PU5A 4MYSA 4Q3LA 4G4IA 3C8HA 1G42A 5C8VA 2QJWA 4OB6A 4OB7A 1GXSA 5IVKA 4DTCA 3VKFA 5CXUA 4FBMA 1EDDA 4GLBA 1GKKA 1VXRA 4UHHA 3I6MA 2HA6A 5ALEA 4F0JA 1F6WA 4J3JA 2WFLA 3D5EA 4QZVA 3MUNA 5ESRA 4HZGA 1F8UA 1XKTA 3KXPA 1AQLA 1R9NA 3OC0A 2C0QA 3HZOA 2XMZA 2V9ZA 4CIBA 3Q8WA 5K3AA 3ZPXA 3DLTA 4G9GA 2DR0A 1LLFA 3AFIA 3I2HA 2HA4A 4BVKA 4BCCA 1OCEA 2OXEA 4FTWA 3Q0TA 3SWWA 5A7HA 1ZICA 1R50A 3D3NA 1MJ5A 3DKRA 1JJBA 3EIOA 4FNGA 2EDAA 3WWOA 2QT9A 3BF7A 1XZLA 2G4LA 1ZIYA 2YH2A 2JEZA 3D2CA 4X3CA 2XQKA 1ZD4A 3G9ZA 5JZ9A 3HLKA 3PF8A 4J03A 3KDAA 4BP9A 2CJPA 1UOQA 4EB0A 2Z3WA 4Q3OA 4I19A 2B4KA 4MWTA 3N2ZB 5K3FB 3H2JA 1IZ7A 2JF0A 3WWPA 1ZD3A 3ANSA 4H7JA 1EH5A 1UWCA 1XRLA 4V2IA 2G5TA 1MX5A 2QMQA 4UHEA 3CN7A 2FJPA 2Y2VA 5AKJA 2O2HA 4UFPA 4B0OA 1MO2A 1AGYA 4KE7A 1P0IA 3O95A 3FCXA 5ALRA 1T2NA 1TCAA 3FLBA 3GFFA 4W63A 5CT6A 2ZSIA 2HRQA 4CI9A 3V9AA 1XRRA 2O7RA 4BVJA 3M81A 3WKAA 5DTJA 1K8QA 2WTMA 1UKAA 3MUOA 3IA2A 4H35A 4J0CA 3DEAA 4Y2XA 1O6FA 1EINA 1UFOA 4B85A 1J07A 2QM0A 5DYTA 1DX6A 5T4FA 4RE5A 1K63A 2V96A 4OSEA 2IITA 5KREA 4B81A 4NVRA 1AUOA 1EDEA 4Y9SA 3HRHA 1CEXA 3VJLA 3H1BA 3OG9A 5DYYA 2ACEA 3BIXA 4CIAA 4BAUA 1QIJA 4DSAA 3R41A 4H18A 5ALYA 1ODSA 2C58A 1CUFA 1P0PA 1YSCA 5I9IA 2DHCA 3SK0A 1E66A 2OAEA 1QFSA 2WFZA 5FLKA 3SX4A 2JGLA 3VXKA 5ALWA 3ZV7A 4BE9A 3T52A 1C7IA 5ALOA 2ZYSA 1E8DA 2ONCA 5FUMA 4OUKX 1MAHA 3PICA 3DL7A 3H18A 1EB8A 4HAIA 2ZJFA 2ROQA 3BL8A 4U2GA 2WUEA 5CXXA 1I6WA 4Q3KA 3M82A 3E1GA 5AP9A 1TCCA 1ZIXA 4NMWA 1DQYA 3GROA 2WTNA 4TVKA 1E89A 1SCQA 4XIIA 5C8XA 4EA6A 1CUVA 1HPLA 2VF2A 3VDXA 4BC0A 1CUHA 2QS9A 1XZMA 4K2AA 4DMKA 2I3DA 2WJ4A 4FKBA 4CG2A 2X8BA 5BWBA 1FJ2A 1LBTA 1CPYA 5LZ4A 5ALSA 2XQGA 3QITA 5AM0A 2JBWA 4W1SA 5AM1A 5AKIA 3TJMA 3A2NA 2HA7A 3H2GA 2XMBA 3BXPA 2PSHA 3WKCA 4RPCA 4X90A 5CTAA 1WHTA 5AIAA 1XRQA 1KU0A 1XQWA 4QLOA 4TGLA 2CEKA 4JYPA 3D7RA 5C81A 4WFIA 4Y7DA 3IUMA 5AM4A 5AKXA 1YS1X 2V98A 3TEJA 1FFEA 3U1TA 1GQSA 5CMLA 2Y6VA 4K6GA 3BDIA 2IIVA 1CVLA 5AKYA 1ZJ4A 2ZYIA 4XJVA 4GWLA 5A6VA 3L1JA 4QDUA 3DNMA 4J7AA 5AI5A 4F21A 5LIPA 4QLAA 4FLMA 5H3HA 3HI4A 2HRRA 2V97A 4G4JA 3D59A 5FOQA 1YA4A 2H7CA 5LZ8A 3LP5A 3FSGD 3A70A 1LPPA 3G0DA 5CT9A 1PV1A 2JIDA 2VT6A 3ESAA 1ISPA 1TK3A 2HA3A 4Y2TA 5JASA 5A62A 3R0VA 4M0FA 3FYUC 1YB6A 3KSRA 4IH4A 5LZ7A 3W06A 3ICVA 3X3HA 3ZLVA 4GDMA 4HXGA 1TCBA 1CUJA 3LS2A 1GKLA 3AINA 3DOIA 5K3BA 1ZGCA 4J0IA 3HSSA 5D7BA 3RLIA 2JGMA 5AKLA 4HRXA 3AZPA 4G9EA 5K3DA 2AJBA 2XMQA 1ETHA 3K9BA 5ALTA 5LP1A 4F60A 1XLVA 1CLEA 5AOBA 3C5VA 4OB8A 3WWEA 4DM7A 3ESCA 2Z5GA 4WFKA 2GBIA 3F8SA 1JT2A 1FSSA 3VVMA 1WCYA 2BGRA 5EHXA 5ALHA 3HEAA 2XUGA 1W52X 3QPCA 4FNMA 3QPAA 4DMCA 2VJCA 1VZ3A 3WK9A 1ORVA 4H0CA 5AKZA 4L9AA 3FLEA 3RARA 4ZV9A 1Q0ZA 3OOSA 5A2GA 1A8QA 2GZRA 4HXFB 2GYVA 4HRYA 1JI3A 2XUAA 3DDUA 4BE4A 1CUXA 1QLWA 4LIPD 4OU5A 1XZIA 1U4NA 3PFCA 3A2LA 2WFMA 1G4HA 1SC9A 3HYSA 2K2QB 1E8NA 1LPSA 1BCSA 2XMRA 5EFZA 4W1RA 3T4UA 4OU4A 2Y6UA 2PSJA 2AJLI 4IO0A 2PKYX 1H22A 4E15A 3QPDA 1Y7IA 2B20A 1O6GA 4AB1A 1JKMA 2CUTA 4LYDA 2WUGA 3A2MA 2XQIA 3DS8A 2FJ0A 4UHFA 3ZWQA 4BB0A 2QRUA 4KRXA 4X91A 3WL6A 2PVSA 4C6HA 2CMFA 5CH3A 3RM3A 3AUKA 4CG3A 1HKHA 2EEPA 5HQ3A 2QUAA 3WA7A 4BTLA 5HQ3B 3G02A 4WDRA 4J0HA 4I4CA 2PL5A 1LPAB 1DTEA 1JJIA 3B12A 1K4YA 4PSDA 3L1HA 4NS4A 5IVIA 5DWDA 4BP8A 1FFAA 5AKEA 1WHSA 1JU3A 4JEIA 1IVYA 3I2JA 3ZI7A 2OCLA 1CUEA 1CIJA 4P9NA 2XUOA 1TKRA 4G5XA 3IURA 4N5HX 2XMGA 3LCRA 1K5PA 1B6GA 5HFNA 2JGFA 2WIGA 2ECFA 3WL7A 3CCCA 5ALQA 3OPMA 4X95A 5ALKA 1VXOA 2XMDA 4DNOA 1SCKA 4BDTA 5KBYA 2G63A 3PF9A 4XVCA 1QIMA 5CBKA 4G8CA 1C4XA 4JH0A 1QIFA 2H1IA 5IH7A 2JEYA 3R3VA 4MQMA 5AM5A 5DNVA 1CUUA 3H1AA 2C5GA 4AMZA 3BJMA 3LIPA 5JD5A 4KAAA 1VKHA 3E4DA 5AK4A 2VATA 2HIHA 4ZV7A 4X94A 5J3JA 1RYYA 4Z49A 1CUCA 2XQFA 5HCUA 1LPOA 2QZPA 4A16A 4KYVA 3EQ7A 1RWQA 1CQWA 4U2DA 5AOAA 1ZI6A 1LNSA 1XRNA 2DSNA 4OD0A 1M33A 2JGIA 4DMHA 4EHBA 3ANTA 1Z68A 1TQHA 3D2BA 4RGYA 5EHQA 4ZI5A 1U65A 1YA8A 5AK5A 1A8UA 4LXHA 1XZCA 2AJDA 4P92A 4H7HA 4OYLA 2HU7A 4H7FA 5IVHA 1N5MA 1EX9A 4HTAA 5BV7A 1UOOA 1FFBA 3GUUA 5AK6A 5K3FA 1LPBB 4DSZA 2WHRA 3C5WP 3LLCA 1XZEA 5LZ5A 2QKYA 3W9BA 4B83A 2I3ZA 5C7YA 4TPKA 3WK6A 1BN7A 1EA5A 1NX9A 3EBLA 4Q05A 1A88A 4AO6A 1HDEA 3LIIA 4UBKA 5FDFA 1H2YA 3A6ZA 1EI9A 1F0NA 1TAHA 4YASA 3STUA 2O2GA 4MEAA 2PSEA 3WK7A 4ARAA 5ALJA 5ALPA 2OQIA 4QWWA 4U2BA 3STVA 3BF8A 2RHTA 3ICWA 2QR5A 1Q83A 5JD4A 2WG0A 4INZA 2WIDA 4BBZA 4EUSA 4BC1A 4N8SA 2WIJA 3FCYA 1QE3A 4QDXA 4AO7A 4ARBA 3BDVA 1USWA 2C0PA 3FOBA 1BRTA 2OLEA 2ZYHA 1EHYA 3I2KA 2RGUA 2HU8A 1QONA 4KR0A 3O4GA 3CXUA 1MU0A 1H2WA 4IH1A 5LLSA 5ALXA 1KEZA 2WU4A 1XKLA 3GELA 3R3WA 1GGVA 2XQJA 2H9YA 1IUPA 2X5XA 2C5FA 4W9RA 1NU6A 2BJHA 2DQYA 1QIDA 1PJAA 4U2EA 3PE6A 3O4JA 4EY4A 4BVLA 2AXEA 3E3AA 4MXDA 4BTVA 5ISMA 5DTIA 3WWCA 4QDOA 5JAUA 1CUZA 2BUAA 2H7YA 3GA7A 4E11A 5AM3A 1X2BA 5HF6A 1UK8A 4P08A 3AZQA 4EZIA 1CUDA 3STYA 5CT5A 3WKEA 1VZ2A 5YASA 1JFRA 2RAUA 4EBBA 1JU4A 2VAVA 4GW3A 3N0TA 4UHBA 1A7UA 1K6EA 2YYSA 1WM1A 4XX1A 1DQZA 1F0PA 1XZDA 4LHEA 3WLAA 5ALIA 1R1DA 1L7RA 3P2MA 3S2ZA 3O9VA 4BRZA 4B84A 1J1IA 1XZKA 2PUHA 5DNWA 2OCKA 3IB3A 1MX9A 4QEKA 1W76A 1GPNA 1BEEA 1NU8A 1DT5A 4WJLA 4DNQA 2J3QA 5ALGA 5ALFA 3FBWA 4BAGA 3PFBA 4L72A 1ODTC 4AZ0A 3TGLA 1AURA 4G8BA 2OGZA 5AH0A 2WIKA 1MN6A 1J2EA 1PFQA 1WB5A 4WY5A 4WFJA 3JYHA 4N8DA 4NZZA 3MVEA 5FKJA 4PQEA 1CRLA 2WJ3A 2XDWA 5AI9A 2Z8XA 3D4LA 3F96A 5LKRA 3G9XA 3C87A 2WG1A 1MPXA 4CCYA 2G5PA 5JZBA 4CCYB 3STTA 4Y2RA 3QMWA 2CKMA 2XE4A 1SCIA 3H2HA 5BWCA 2O2IA 1MNQA 3RKSA 3STXA 4B9AA 1P0QA 2DHDA 1IZ8A 4BAZA 3O4HA 3HABA 2PPLA 5LZ2A 4GXNA 1DU4A 1CUGA 3B5EA 3ESDA 3PUIA 2PSFA 3G9TA 4QA9A 2DFPA 3VVLA 3W9UA 4E46A 4B80A 3F67A 3QMVA 1U2EA 3WYDA 3AJAA 4FDMA 3AILA 1XRPA 6YASA 3DKKA 5LZ9A 3NWOA 4X71A 4ITVA 1GT6A 3V1NA 5JIBA 1WPRA 4UBOA 3V1MA 1R3DA 2ZJ6A 2QTBA 4PSUA 1QZ3A 3U0VA 4FHZA 5AI6A 1XZJA 1CUYA 2VJDA 4YPVA 2BGNA 5LKAA 1ZD5A 2I78A 4FLFA 3EQ9A 3M83A 2EDCA 2YASA 3V1KA 4BRSA 1EK1A 2VA9A 3QM1A 5LYYA 1XZHA 1ZI9A 1XFDA 1AMNA 3VISA 3IUJA 4GBGA 4MWSA 3KWFA 4CCWA 3I28A 4WDQA 2Z8ZA 4AN1A 3WKDA 1X70A 3G0BA 3ED1A 1ZD2P 1EDBA 2VTVA 3BIWA 2W22A 2PUJA 2OGSA 4LXIA 4LYEA 4G8DA 4A23A 3H2KA 4WCVA 2WUFA 1JMYA 5AOCA 5HK8A 2BCEA 1QO7A 3WL5A 4AXBA 3FLAA 4KAJA 3V48A 1VLQA 4GEGA 4QDTA 5ALVA 4BYMA 5HKBA 3HC7A 3C6BA 3WA6A 1OILA 2GYUA 1QJ4A 1GPLA 3KOOA 4O08A 4HXEB 2QXUA 4PV7A 3BJRA 3NUZA 4WY8A 4X6XA 2XB6A 2HHAA 4FFVA 1BROA 4B6GA 5EHZA 2VEOA 4S0XA 4JYMA 1BE0A 4EY7A 3QBJA 2VAXA 1AC5A 1R4ZA 1CV2A 1MT3A 3JWEA 4H7IA 3WZLA 4KRYA 5I8PA 2XUJA 4X6UA 1THGA 1YASA 4W1PA 4DYHA 1GPKA 2FX5A 1TRHA 4D9JA 1L7AA 1RP1A 4DIUA 1CUSA 2BFNA 2J4CA 2PX6A 3W2TA 1CUAA 2WHPA 4L0CA 2WHPB 2QVBA 4F5ZA 3PDCA 1BN6A 3KD2A 1UZAA 5JAPA 2DQZA 2RONA 3NGMA 3G0CA 2JGKA 4N5IX 3WQHA 4GHWA 2BAGA 2WJ6A 1VA4A 4E14A 2WUDA 1ORWA 2QXTA 5AKGA 1FFDA 4OCZA 5FP0A 4X00A 2XLBA 4N8EA 3FYUA 3CN9A 1BEZA 3WWDA 3FYUB 3BWXA 5AKHA 1GQRA 4Q34A 2XI4A 2VQ6A 4M0MA 3FWHA 4UHDA 2B9VA 2ZSHA 4Y2SA 3DL4A 5ALNA 3ESBA 1HBJA 4DLNA 3DOHA 5AO9A 4C4YA 1W75A 3WJ2A 3C6YA 3R3YA 5FPQA 5JAOA 2UZ0A 1CUIA 4KE8A 4X92A 1BU8A 5HF9A 2QOEA 3FNBA 4FMPA 3H04A 5EIHA 5DJ5A 4BZWA 4IH9A 4JUIA 1LBSA 4C01A 3QZUA 2R11A 4AO8A 4PO3X 1DWQA 1ZGBA 2D0DA 3WK5A 4AX4A 4M0EA 1EXWA 1THTA 4HVTA 5CURA 3WYNA 2J4FA 2Y1KA 3C43A 1CQZA 5AI8A 4H7EA 2XUHA 5AIBA 2WFLB 1OXMA 2C7BA 4DGQA 4PSCA 1E8MA 3JW8A 3QH4A 2JGEA 5JAHA 4RE6A 3FSGA 4H7KA 1DT3A 2CZQA 1T4MA 3ZLTA 2HM7A 3QMMA 5CW2A 1HLGA 1VE7A 2WQZA 3NOXA 4BDSA 4LKOA 5JYCA 5SYNA 5D6OA 2P8SA 5AM2A 3WK8A 3TRDA 1FFCA 1HL7A 2WU3A 1N5RA 4X6YA 4B0PA 2X76A 5FRDA 2DCMA 1WB6A 4J0JA 5IVDA 5KWIA 4AZ3A 5HFAA 2XUKA 3SC2A 2PBLA 5SYMA 2AJ8A 4ZXFA 3H17A 4B82A 4J0DA 1DX4A 2J3DA 2HU5A 4Y2QA 3V1LA 2OGTA 5A71A 1QIEA 4AQDA 5JD6A 5ALDA 1DWPA 5CH8A 5T4HA 4EY8A 2W6CX 5KWJA 3OURA 4KAFA 4EY5A 3G0GA 3C70A 3H19A 5E4JA 4ROTA 3G7NA 2ORYA 3STWA 1VJ5A 2AJCA 4OYYA 3C6ZA 3PI6A 3K2IA 3VJMA 2R8BA 3D2AA 5A7GA 5HKAA 1XQYA 5T4BA 1XZBA 4FBLA 1VOTA 4C87A 1W4LA 3CCBA 4JNCA 3I2FA 1X2EA 3GBSA 3L1IA 1UKCA 5ALUA 1MNAA 2DHEA 2GYWA 2XMCA 4MQLA 1EVEA 4MEBA 1G66A 1XLWA 5BOVA 5ALLA 3W05A 4C4XA 1E5TA 1Q84A 3WK4A 3IBTA 1XLUA 1VA5A 1IMJA 3R40A 3WZMA 2XUDA 3W04A 3UUFA 5JATA 1UXOA 3RK4A 2WIFA 2ZYRA 3AIKA 3UUEA 4K5QA 5JARA 1G5FA 4K6KA 1ZI8A 2GBFA 3O0DA 5I7UA 3IUQA 5ALMA 2WILA 1AZWA 2IX9A 3IDAA 3R3ZA 1E3QA 3C45A 3ILSA 1QIIA 1N1MA 5DYWA 5D3KA 2BUCA 4QNNA 2HA0A 2B61A 1BCRA 2HFKA 3R3XA 3I6ZA 4C89A 2O7VA 2RIPA 2WG2A 2YXPX 4HS9A 4BATA 2ZVDA 4LXGA 4UBIA 1AX9A 3C8DA 1QOZA 4UPDA 5AHXA 4PNZA 1A8SA 5EIEA 3PUHA 5AJHA 4KE6A 1MAAA 5CT4A 1R88A 1JJFA 3WKBA 1S8OA 5AICA 1D07A 1XZAA 5AK3A 2XUFA 3D0KA 4Y2VA 1QFMA 4U2FA 1LPNA 2HADA 2HFJA 3AIMA 3OTQA 1JMKC 2FUKA 4FWBA 3WMRA 1CUWA 2OAGA 2PU7A 1J06A 4QWMA 4UBLA 3GZJA 2VT7A 5HK9A 4YX9A 5FXMA 2XMSA 4RNCA 5FV4A 2OPHA 2OQVA 4IQ4A 2ACKA 4ZGBA 4QE3A 4AMYA 1YCDA 2WM2A 2WKWA 2XUIA 3M3DA 4CFSA 1XZGA 1P0MA 1ODCA 1LZLA 3AIOA 3B3QA 1QIKA 3F97A 7YASA 3I1IA 4X7BA 3WIBA 2ZJ7A 4CG1A 3IVMA 3I2IA 4DMFA 1QIGA 3WJ1A 4BCDA 1EVQA 4W1QA 2Q0XA 4ETWA 4BCBA 2OCIA 1MTZA 4X93A 1SOMA 1H2XA 5HZGA 1BS9A 5AKKA 5CH5A 3QYJA 2HL6A 4OPMA 2OG1A 2D5LA 1YB7A 5ALZA 4MJ3A 1HQDA 1XQXA 3I6YA 1UK6A 4YK7A 1ZOIA 3C6XA 5JADA 4FOLA 1Q0RA 3OM8A 4GI1A 1XROA 4Y2UA 4KE9A 4J0KA 2WSLA 1QIHA 4PF1A 4FLEA 3FVRA 4U2CA 3ZLUA 1CFJA 4X97A 3DJYA 5E4YA 4ZWNA 5E4TA 4B7ZA 3F9CA 1VE6A 1C7JA 1LZKA 4KACA 1CUBA 4X85A
chains in the Genus database with same CATH superfamily
5CLFA 5CDTA 4US0R 3JQEA 4HDMA 3KQLA 4U0JA 2GLUA 5MDHA 1W88B 3R5HA 5AJVB 2PBZA 1REQB 1PJ3A 3AR5A 4PZZA 1J9EA 5EZ5A 1BGVA 1WOMA 2RI1A 3H5IA 3IQEA 2RE8A 1XJ5A 2G6TA 4Y9TA 1FSFA 5IJ0A 4TV8F 3GFTA 2YJ6A 5ILOA 3L6OO 4FB4A 4OL0A 5SZJA 3TSYA 3SKXA 1NF9A 2JI6A 3DZJA 1M0TA 3JTMA 4LDNA 4ODIA 4MI6A 4EHHA 3DBLA 1MX1A 1LDNA 2XADA 4G1FA 1H3FA 1BKDR 2X7HA 4QJ4A 4KI7A 5IMBA 1G55A 3HHPA 1R66A 3WLTA 5JSHA 3BFJA 5D3ZA 2XJ4A 2D1RA 3OKPA 2OK8A 4GQAA 3B6ZA 1FW8A 4ZMRA 3FB4A 2FW8A 1W96A 4JL6A 3F1LA 2WEKA 3AR6A 4AY4A 1UOPA 5FPTA 2JFVA 1XWIA 4FR2A 2OXIA 2PDAA 1RQPA 1KJZA 2WRZA 2UXDB 4BNKA 3RCBA 2ID7A 3T9EA 2BUBA 3IULA 5IKXA 2I7CA 3EVZA 3E8SA 1EK0A 1XEXA 3FNGA 3JARB 5CLQA 3RAGA 4RK1A 4JV5B 4NBTA 2Z6QA 3HCBA 1VJCA 2I29A 3BAFA 5T4EA 1IUOA 3C16C 3HXQA 3C6MA 1ZO8A 2E9SA 2OV3A 4MB0A 3E53A 2IV3A 2VHXA 2UYQA 2ZI6A 4EG3A 4LJ8A 4L8GA 4R40A 3WLKX 4C4ZA 1B15A 1W93A 1T6NA 4QTZA 3OSUA 5CFPA 1C3OA 1R9MA 3ES9A 1DJLA 2DPHA 2HXSA 4I9FA 1FL9A 2RHRA 4ILKA 1KI2A 2IW3A 2YRXA 3Q11A 1YACA 5P8WA 2FDXA 1TIBA 2G76A 1VHJA 4D4KA 1K86A 1SQFA 2ZSBA 3GZ4A 4FFWA 5JALA 1GRNA 2G17A 4ZREA 3WYEA 4BNTA 4ZCSA 2ZSFA 1DL5A 4PHTA 4ZTBA 4D4LA 1TM3E 2YZGA 2C7PA 3GVCA 2A5LA 2GCNA 2C31A 1OWMA 4R1OA 3I58A 3AV3A 4PLWA 3ZV3A 1C1DB 2VJAA 4EY6A 4DNFA 2QD1A 4C88A 2D74A 4BECA 3DVRX 2ERYA 3GD5A 4R3WA 3ADBA 4JY7A 4C0WA 3CX6A 5K0GA 4PW0A 4P54A 3F74A 4TUYB 1JSLA 2Z3ZA 2ZBEA 2WHQA 4N0QA 3VR5H 3NTUA 4K86A 2UYHA 2E2WA 4IYJA 1D2RA 2XT0A 2Q9UA 2Z2KA 3GPLA 3DC7A 1UKZA 1XVIA 2Q5QA 1KDPA 4IFTA 4GM1A 2I03A 2IXBA 1XEWX 2IXGA 5J2UB 2JFZA 3DMRA 4X20A 4JFAA 4MUIA 2OCGA 4HPWA 3DEZA 4WWHA 2C03A 2XRFA 5DTEA 1GVNB 1NDHA 1W6RA 4KEAA 4ROSA 2CGEA 2O06A 3T8YA 1VE3A 1V2GA 4QO8A 5KTNA 2R7NA 1UBGA 4IKOA 5JNUA 5K05A 3MT8A 5AESA 4OP2A 2Q46A 4Z4IA 2IL1A 1GGKA 4YQEA 2W2TA 4FUQA 2PMBA 2YN0A 1CVIA 1G2OA 2QY9A 3OPQA 3QUQA 4JKYA 1TKBA 1LBHA 4RGVA 1JA1A 5BW4A 1ZL0A 1LC0A 3OJLA 5LD2C 3FVTA 1GOTA 4ER6A 4JGBA 4IHJB 3O9MA 3PK0A 3S7TA 2C04A 1SJ9A 3FJYA 1U5AA 1IK6A 4UOEA 4REQB 8LDHA 2IY8A 4Q82A 2J3IA 1RBZA 3TX6A 1Y7HA 1UBEA 3LC2O 4K9QA 5FOTA 3SX0A 1NBAA 1UT6A 3OY7A 4K9RA 3RANA 1SKAA 1E0SA 2QSZA 4KL8S 4KMOA 1FTNA 3EF3A 3SEAA 4O2LA 3CX3A 2E4WA 1RJGA 2O0JA 1NG1A 2E4ZA 3KWJA 3VHQA 5JNVA 1MIOB 2QR2A 1Z6GA 4JI4B 5K0SA 1ZD8A 3NRBA 1EFHA 3RS0A 1PVVA 1SIBE 2OZVA 3K32A 1PLLA 1IM5A 3OCVA 4U0KA 5B7GA 3EIFA 4D5GA 3LU1A 3OLZA 1V3QE 3DCNA 4Q39A 1KI6A 2CFOA 1KWGA 5EI5A 3HH8A 1ZD1A 4CM4B 1KO4A 3JVEA 2C54A 3EIQA 2AE1A 1CIPA 3G8YA 5EWLB 4HMPA 4KK3A 5JSFA 2QMHA 4QNRA 1C2TA 3K0FA 1KJIA 1V6AA 4EHFA 5FFNA 3ERCA 10MHA 4EHDA 4LRYA 4M21A 4PCVA 3JX9A 2F8MA 4XYMA 1W85B 4LJ4A 1X1QA 3UMFA 2PBRA 1E2HA 2E3JA 4LHWA 4RKWA 4O0MA 1PJ2A 2Y71A 3IUNA 4YCMA 3ZW9A 4O63O 3U3XA 1SQGA 3LZDA 2UUCB 1EESA 5EE3A 2R6DA 1DWOA 3KKOA 4MRMA 1KJWA 3N3BC 2VJBA 1GU7A 4RYDA 5CPFA 5AI4A 5HIAA 2AGVA 1FUEA 2R3SA 3D8TA 3IXMA 4GKBA 4L0QA 2X2FA 5EXEA 3HN2A 5JCZA 5A7FA 1T15A 2OOSA 4I1PA 2R85A 5C4GB 2OVBA 5HMLA 5J2TA 4Y2JA 3HR7A 4BP3A 4KLZA 3PFNA 4WEOA 3ZBPA 4OVKA 1YOVB 2P27A 2NZWA 4UATA 1H23A 3LPNA 4PPFA 2WYOA 2ZPAA 3TB4A 4HNHA 1MX3A 1BRMA 4GECA 2Q1TA 1Y37A 3ER9A 1ODJA 3TJZA 1UJBA 1GGNA 3PXEA 5A6SB 3LBIA 6ABPA 4TYYA 4W5TA 1GPJA 2H7VA 4HEQA 4B7XA 4F06A 4B3RB 5BQ3A 4J4HA 1L4UA 5CIQA 1CLUA 1T3ZA 4GM4A 2RH8A 4LZZA 4MYSA 5GJCA 3F71A 2XWQA 3QEAZ 1Z2PX 1G42A 2VSNA 3NOQA 2QJWA 3O26A 4OB7A 4K9OA 1GEEA 3IV9A 3LO8A 4OB6A 1GKUB 4ZODA 1V26A 2KW5A 1JL3A 1EJBA 1K0UA 2Z56A 4UUMA 4UUAA 5HJ2A 3GLGB 2CNDA 3QA9A 3VKFA 4A2CA 2WTAA 4H1VA 2V1UA 3H2BA 3HJTA 3IQDB 4FBMA 1WDLA 1L4YA 3EDMA 5ITZB 3WLMA 3I53A 1DBRA 4AJ2A 1NC1A 4Z54A 3IAAA 3FVWA 4K9KA 3H8SA 2ZR7A 4NDAA 4X0EA 1ZHFA 3QELA 3UXYA 2NO0A 1JHDA 4J3JA 2B4YA 5EP2A 3HV2A 4HGYA 4F11A 3WS7A 1W59A 4F2PA 2BRUC 1FMTA 1ZVJA 4QZVA 3AESA 3MUNA 4Q3AA 1R6TA 1XD9A 2ZLBA 4QPJC 5ESRA 1JFSA 3VR2D 5K0JA 1JQEA 2HTEA 2V6FA 3OT1A 1X0XA 3DCIA 3EGIA 3HCWA 2Q5IA 1R9NA 4OH7A 3R74A 4OY3A 2BDEA 3OC0A 4BLSA 5LQMA 2C0QA 4JLMA 5DH9A 3RTAA 4UW9A 3T1TA 2NVWA 2VYCA 2IZ7A 2V9ZA 4G26A 1N6KA 1Z0AA 5A0TA 3C7CB 1H1LB 4J1TA 2AHRA 4TQ9A 4G9GA 1LLFA 3AFIA 3I2HA 4WKCA 3RJ9A 3T4XA 1S1CA 1AS3A 1CY2A 1GZSA 4FJ1A 3DE6X 4P84A 4RLQA 4ESOA 3PT9A 1RBMA 3BZBA 1Q1BA 2C4UA 3I1FA 4X84A 1P75A 5DI9A 4XDZA 3BS4A 2VQSA 4PYIA 3RFUA 3W8FA 4QOGA 4FHCA 4CQMA 2CNLA 1GPAA 3BQMB 3NV7A 3MMZA 2JZCA 3DTVA 3GOQA 3IUPA 4MS4A 4UXJA 3V4OA 3CVYA 1B8NA 1MPTA 5CJJA 1D0SA 3EOBI 4FTWA 3EARA 3VU9B 1P4AA 1FUUA 3RT9A 2R9VA 1ZICA 1JIVA 3PVCA 1R50A 2J6IA 1UC8A 5CR9A 3LK6A 5THKA 3DKRA 3M4XA 4R8MA 3A1CA 3EIOA 3TAXA 2XKJE 2R6AA 5FWAA 1UWVA 4NAVA 4FNGA 3P96A 4V24A 2JIMA 2BHLA 2RB4A 2ZWVA 3H13A 5TB5A 1MB0A 1COWD 1HWYA 1Z75A 2JFBA 3FJOA 3KQSA 5DU2A 4MIEA 4N48A 1U8ZA 1U1CA 3BF7A 2H4YA 2VK8A 3ZHSA 1HDCA 2M6RA 3R5FA 121PA 1CNMA 1CIVA 1UIMA 2DWPA 2OBNA 1Z34A 3JD4A 3QU4A 4MQFB 4N3CA 5JECA 3FOCA 4X3CA 5HS6A 4C20A 2XQKA 4L5IA 3WG9A 5JZ9A 3HLKA 3MWFA 3NKLA 4PNHA 5ECYA 2DBYA 4O4IB 4X60A 2O0MA 1FRFS 2EHJA 1O6CA 1UOQA 3PCTA 5K0BA 4CEJB 1RPTA 3F7MA 2ZB3A 3K9QO 2BEKA 4Q3OA 3VTZA 1YGYA 4O2AF 1QQTA 4PTLA 2QN1A 4LG1A 1P3DA 1KAOA 3H2JA 2JF0A 3T7AA 3U17A 1ZD3A 2XVZA 3BPSA 5DBOA 1EH5A 1UWCA 3CNHA 1GPYA 1XA3A 3H75A 4IX9A 2QVLA 3DZFA 1VP9A 4RMHA 2CVPA 3AR9A 2QMQA 4RW0A 2IDMA 5C31A 2LCQA 5L9AA 1ZUD1 4HQ6A 1RYEA 1EXMA 3L7AA 4XVUA 2BC9A 2Y2VA 1JGTA 3HUDA 2ZUSA 3PHLA 2Y99A 4NK4A 2P9QA 3IBCA 2P3OA 4ICIA 2VDJA 4MKRA 4UFPA 4EY3A 4K6OA 5FTJA 2CBZA 5IFLA 2ZRLA 4WI1A 2VZEA 3WNVA 3Q7RA 5IXSA 3AVYA 1P2UA 3HHEA 4O4JB 3GYBA 2BISA 1PG5A 1T3TA 2B3TA 1ISJA 3ZGZA 1T2NA 2D5IA 2R79A 1U28C 1HT3A 4CKWA 1PFWA 1XF9A 2A8YA 2LDBA 4W63A 2Q7XA 1GN8A 2A1IA 3PQDA 3K9NA 2KM1A 3MOIA 1NVAA 5JYBA 4NFHA 4EKIA 2BD0A 3H4MA 3AVOA 1CRWG 3ACDA 3V9AA 3TI9A 1XRRA 1VPTA 1D2NA 2O7RA 4M4SA 4N3NA 4R7TA 1P8AA 4B2YA 7MHTA 4ZI7F 5F77A 3GUVA 1JFFA 3M81A 3AERA 1BIFA 5DTJA 4FCTA 2LV8A 5FBHA 3GEBA 3OQIA 1ZW6A 1E7MA 1P4GA 2P0AA 4HDNA 4HX5A 2WJZB 3SF0A 4J0CA 4YMIA 4ALKA 3WGVA 4FKZA 1O6FA 4KK4A 1XEAA 3VVCA 3D6TB 4HDRB 5A4AA 3A9RA 3HKBB 3L7LA 3S2SA 1SXJE 4I5FA 4IIEA 1UFOA 3T1HB 2AQIA 4ENQA 1ZC4A 3FW1A 5K8IA 5LOVB 1PL0A 2GVZC 3JZDA 4JB2A 4URWR 4Z0PA 3N2KA 3ZHYA 2ZCVA 4Q3CA 4HPXB 3QVOA 1ZJWA 1UBTS 2BFDB 1QKKA 2HO4A 2KLBA 2W2LD 4PRYA 2P6PA 1N2XA 1TVCA 1GG2A 2BWJA 2C5AA 2GCEA 1TX4B 2RJNA 4M1ZA 4L85A 3TSOA 3R75A 4B5LA 5KREA 1N5JA 4R41A 4NVRA 1PR3A 4O4LF 4Y6RA 2XCQA 2VSYA 2JJQA 3FRHA 4EA7A 1HTWA 1IXRC 1SR8A 1V8BA 4TQGA 1Y1SA 2IFTA 3UATA 3H65A 3AVQA 5C7LO 2XOEA 5IT4A 4UTPA 3NC1C 4E5VA 4KBGA 1QQBA 3H1BA 1BHSA 2BMWA 3BB4A 3AYZB 5FI1B 4HK4A 2O50A 4QXMA 3BIXA 5JCJD 2PH1A 2SECE 3A6HA 4HQFA 4DSUA 2V0GA 1ZIDA 4CIAA 5LYJB 1XDDA 1JQAA 1NE2A 2ZT6A 1QIJA 2CXXA 3R41A 2NPFA 3KYCB 3F73A 4FVTA 2AFHE 4IOJA 3TQCA 1ZM9A 3F7TA 2JC3A 5E4FA 1KE2A 4MUJA 3JSAA 3E7DA 5JCOA 2WSSD 5A9SA 2C58A 3WJ7A 5IAKA 1I8TA 4GC9A 2HJSA 3CWZA 4DR3B 4EUKA 1O94D 4CIWA 4N6GA 4O59O 3PWSA 3UT6A 4P53A 5ICFA 4UOZA 5EPEA 1VLLA 2PT5A 2XF8A 5HOQA 4V0SA 1P0PA 4LXUA 3D8BA 3AJDA 5I9IA 1K88A 1JA0A 1NM5A 2GHIA 3HDTA 2QRMA 5CA0B 1T4CA 2DHCA 2XITA 5CJPA 1GQ2A 4G24A 2IP1A 5LMUB 2GJ4A 2AQKA 5C52B 3FN4A 4L76A 4QSHA 5DX0A 3T61A 1QFSA 1NQXA 1LV7A 2GKSA 1A2OA 1S2MA 4N3AA 1USKA 3GJ5A 3FTQA 2R5FA 1GRVA 2QTMA 3VXKA 1I3LA 3QKRA 3T52A 4BE9A 1UR5A 1Z0IA 4CVNA 5ALOA 2VNIA 2GHRA 2J9YB 3A6DA 1T9GS 1KKLA 4AJ4A 3ZVKA 5EKTA 3ASVA 4ZQBA 5FUMA 1FQJA 3PICA 5TX7A 2PUBA 4OHFA 4FFMA 3WSVA 4D26A 4BUZA 4BMSA 4HB4A 2R1UA 3TPZA 3NJRA 3SS7X 2C95A 1E5QA 3JQPA 2W90A 2MINB 5CNIA 5EQFA 1RMTA 4AZSA 1N9GA 4U3JA 2WUEA 2MCFA 3SI7A 3ZGOA 3MRTA 4QU9A 4OXKA 1VFNA 1MO5A 4WY2A 1H8HA 3GXBA 4TTSA 2R8EA 2JK0A 3TL3A 4XLTA 1MW8X 3DFUA 5AD1A 3E1GA 1TCCA 1ZCBA 3ETEA 3EZGA 3H2YA 2O8BB 3A26A 3L8HA 5JAZA 1E4EA 4GI5A 2HSJA 2FN3A 4H6PA 4QDKA 5KMGA 3QXHA 3H5OA 5HE9A 5KWEA 4INOA 3GLVA 3N8HA 3ZS8A 3RYTC 4MS3B 1JEYB 2WLTA 3MINB 3BWDD 1E89A 2BZSA 4EGAA 1SCQA 3OLWA 3OOHA 1Z7EA 4M60A 4U5QA 5KOJA 4M54A 1NVKA 2CKDA 3KUCA 1V35A 4G0ZA 4JBXA 4XOIA 1XZMA 4K2AA 1ZGAA 3VNRA 2I3DA 2WJ4A 4BX9A 4DA4A 1XK6A 2EKQA 3OE5A 3W4JA 5AVZA 1EP9A 2W6ZA 1JHQA 2QN7A 3G1UA 5LZ4A 4RTPA 4D4MA 3AHJA 2GEJA 1QPBA 5F2OA 4RF4A 4ZAVA 4KXMA 2PL3A 4EX7A 2ZT8A 3HBJA 4ERXA 2QRZA 4WASA 2FPWA 1HXHA 2C5SA 4ADSG 3FDIA 3IEUA 4BO1A 2VYQA 1RJ9B 5AKIA 3TJMA 4C5CA 4F1JA 2HA7A 3H2GA 1SIOA 2X8WA 3MMSA 1NYTA 4RPCA 1WHTA 1Z3CA 1XNRB 1MBZA 1AQUA 4RXUA 5FA6A 3SS8A 1FNNA 1L1QA 1Z4MA 4R2MA 2ISSD 5ADUS 3PQ2A 2ZE5A 5TDHA 2A88A 4QLOA 5K3OA 4OBEA 2VTKA 4L4RA 3T3PB 3D7RA 1XN1A 1E3EA 4A27A 3JVDA 3CR7A 5C81A 3VHLB 2JFQA 4AKHA 4PFJA 1NWCA 1NXVA 4F6RB 4Y7DA 2PUDA 1M8PA 4OMCA 5AKXA 3VOTA 4CKZA 4MWOA 1FFEA 2OVFA 4N01A 5DBHX 4HSGA 1MC8A 5CMLA 2FZGA 4ZARA 1PUIA 3SQDA 3E2MA 5A05A 4TVOA 2V7WA 1L4HA 2RBGA 5IF3A 4LZPA 1H0HA 4IMIB 3V8VA 4A15A 5BMVA 2Y6VA 2EJWA 4BVBA 3NHAA 1O94C 2O1WA 2Z1NA 3GUCA 5TVGA 1OQAA 1PK9A 4B6FA 2ZBVA 1HE8B 3JQ9C 4FQ7A 3RW9A 1AKYA 3ITEA 4OV6B 4PANA 2QSUA 4I0WB 2B2NA 1OBOA 2QQEA 3UAXA 3BRWD 4TLDA 1STOA 1Z36A 3ISTA 2QM7A 1ISHA 2C77A 3FROA 4N0MA 2XNJA 3L1JA 4L1KA 1DKMA 4X8HA 5EAIA 1E9FA 1KK0A 2PCJA 1Q5PA 1C8VB 3OE7A 4QDUA 3UAGA 1HDZA 1VSBA 3FCOA 4QLAA 1G8AA 3K70D 4FLMA 2QMOA 1PFKA 2W48A 5IEBA 1RWKA 1JJ7A 2V97A 3D59A 4I5IA 5JSYA 3UMVA 4P31A 4EF5A 5FOQA 2IEDA 1XMSA 1YA4A 4PIVA 2BOVA 3IQXA 4KDEA 4EPXA 4PFQA 5LWQA 1GAEO 1EAYA 1EBFA 1BKSB 1JLMA 4BFTA 1O97D 2X1LA 4IWYA 3FSGD 4MR8B 1GG9A 4D4GA 4E1AA 1GTSA 2V9CA 4QHYA 2ZJ0A 2C83A 1LPPA 1T1GA 3MBOA 4HAZA 3ZV4A 4DARA 3A2KA 4OBBA 2BIFA 1ZM4A 5CT9A 5GGXA 1N4AA 3SXJA 3CT6A 1L8XA 4J3FA 1EG2A 2VT6A 3F5SA 3ESAA 4IJWA 3ABOB 3QTTA 1G8HA 5C46F 2V7EA 1DZ3A 1U9IC 1FE8A 4OEHA 1SKYB 2HA3A 3R3SA 5IC5A 3A4YA 4XPZA 5E8RA 2DKFA 5JASA 2E4AA 4D8TA 2JLWA 4EI8A 3Q98A 2OGUA 4KP7A 2NGRA 2P65A 2B1GA 3FYDA 3AEQA 3FYUC 4RSGA 3MCZA 2B6NA 3KSRA 5TJ9A 1NW6A 4IH4A 1L7VC 5E1BA 4K7JA 5LZ7A 4Z7QB 4UU8A 2LIVA 2WK1A 2M6SA 3UOGA 1K4MA 4CIYA 4ZICA 3RIGA 1CUJA 2C9MA 4EUNA 1GKLA 1W88A 3AINA 1FQOA 3V7WA 2FFBA 4FWTA 1REQA 2YWJA 3L3BA 3S1LA 1U0HC 3X1ZA 2JCXA 1ZGCA 2GTIA 5BN5B 2HJRA 4KQFA 1AK1A 3KWLA 4CDMA 4EF6A 2YZNA 5BWLA 2X3FA 2ZAIA 3Q87B 4Q4DA 5AKLA 2FWBA 3AF5A 3SZRA 3AZPA 1YZGA 1TJ3A 2XE8A 3CLUD 3QK7A 2J41A 3KQKA 2ZRQA 1WTAA 1L4NA 3A7EA 1PLKA 4HAXA 4QXAA 1GZ4A 3ND7A 4JT4A 2AJBA 2XMQA 4PZDA 4MGKR 4C3UA 4QG3A 1RZUA 3QBEA 1I0IA 3VYRB 1HO3A 1E2NA 5FL7A 4ENWA 2AR9A 1AQ6A 1QH0A 1RHUA 5K8VA 1DRKA 1H9AA 2V4ZA 2VPIA 3CFYA 4KVAA 2RKWA 3IT3A 4R9NA 5EQTA 2ZYWX 2ZANA 4FGWA 3RFFA 5IUKC 1DVRA 4W5RA 2OCDA 4ZEOA 3GBPA 4A03A 4FYWA 5JZOA 1FEZA 3WWEA 3DZ8A 2WT4A 3EISA 1R3UA 4DM7A 2JFHA 4E5YA 1I5EA 2YICA 4JL8A 1WE2A 2Z5GA 3DMGA 1M34B 2X4IA 2DECA 3E9MA 5JI2E 2X9NA 3JARA 1V3TA 1WCYA 1U0LA 2ZTHA 2BGRA 4NL4H 1T3GA 3TN7A 1X9IA 2VP9A 4WXPA 1PR1A 1ISIA 1VIYA 3ZQKA 2IYOA 1W52X 3CB4A 4IDEA 3ROPA 5KNDD 1UKYA 2BH2A 2GJ9A 2GZDA 3OIWA 5THQA 2NVUA 5HZKA 3BTUA 5L3QA 3KL2A 4HSEA 4UOQA 1UPTA 3DE4X 5LQSA 1N6RA 4DSTA 1MENA 1HORA 2ZRAA 2IEIA 4PINA 2ACVA 2NT3A 1VG1A 4B8YA 3HYLA 3KOZA 3LRPA 4PO1A 4XSHA 4CM5A 2F9LA 1RLTA 2VTEA 3NNNA 2PKCA 5F7XA 3C15C 4UHJA 3DW3X 2JAPA 1C7RA 1QH9A 4BU0A 5CDGA 5C4MA 5KYWA 1HZJA 5A2GA 4IIXA 3L6RA 2IF0A 3KBBA 1Q21A 2Q99A 5F9MA 2HH9A 5D2CA 3K70C 3I01M 4NQZA 4C29A 4XWAA 1UBUS 2BJVA 2Z2ZA 2OK7A 2Y68A 4N5DA 2AC7A 1L4EA 2KBEA 1S1MA 1OVGA 2PRYA 2WAYA 1VL8A 3GA0A 3QU7A 2OC9A 4WT7A 3V4VB 2XIQA 3VSDA 3ZNOA 1HETA 1M2VB 3CHYA 1C1DA 1CUXA 1OXUA 2GZ3A 4YS6A 1M76A 4YMGA 3LP6A 2FN4A 3B82A 1O97C 5JNRA 2WPDD 4KZKA 4NMHA 2RAPA 1VJRA 3CRW1 4KH0A 2WFMA 4TUYA 3PC8A 1JIQA 4MPPA 2J8ZA 4H1TA 3SU8A 4G97A 5KTYA 1WNTA 1BAPA 2ODAA 4GRAA 5AHRA 1YKGA 1GCUA 4B76A 4D0NA 4ZYXA 4FYKA 2QGFA 3DZIA 3E5RA 3DKPA 3CE6A 1E8NA 4GS5A 4A26A 2ZUUA 4M1KA 5J1TB 1SKQA 1NVDA 1QAMA 3GEDA 3QYPA 3O84A 5J2UA 4IXMA 1H2FA 4ZHSA 1DDIA 4XJXA 1R18A 2DPGA 5KYVA 2VT3A 5EC8A 2IU3A 5HP4A 4W8HA 3RNOA 3DXZA 2IODA 3GQBA 3NZEA 2C20A 4TKZA 4EVQA 3LQQA 4P4TA 4W1RA 3T4UA 1U0EA 3E9RA 3TNDA 2UYGA 3VR5D 4BMZA 2A1TS 1UM9B 2YY7A 2YYAA 1V9LA 4IO0A 2Q21A 1Y7IA 5LU9A 4BY9E 3H6HA 4BQRA 4IHJA 3X1JA 4RY8A 2CUTA 2ZIWB 1P19A 3QVTA 3TDMA 1L9XA 2MT9A 4OLJA 4LRQA 1ZN2A 1Q3KA 4G0QA 4PHGA 4REQA 2QJFA 4XJSA 5FPSA 5HIKA 2BLNA 2XQIA 2PY6A 4X44A 2BMJA 2P5TB 2XB9A 2AN3A 2FJ0A 4DMRA 4E30A 4ZQGA 2O59A 5DN6D 1U0OC 3CLUC 4ER3A 1U7XA 5FWDA 3DBHA 3GDWA 2J67A 3VKGA 2Q3FA 4C6HA 1JTFA 1EGMB 2AX4A 5CH3A 3JV7A 1MIHA 4FQ5A 4IRMA 3IBFA 1HKHA 1SUSA 3D54D 3R23A 1YIDA 2OPBA 2EEPA 1UM8A 2QUAA 5E9JA 5HQ3A 2ZZMA 2OBYA 5DGXA 3F7OA 1A96A 1Z62A 2RHHA 3GGCA 3AEKB 5BYJA 3O73A 4UM9B 3P7MA 3CVUA 1N6IA 1RI1A 4WDRA 5EWLA 1LBIA 1V9CA 4I4CA 1SPBS 1ZN8A 3DA8A 1WF3A 1KHTA 2P9JA 2HPVA 1PR2A 1J0EA 1TU4A 4EG1A 1DTEA 1W85A 3JD2A 4MKGA 3TTWA 1KQNA 1VDZA 4LQLA 5IM5A 4E0BA 1DSSG 5FOVA 1E77A 1Z5GA 4Y6SA 3CIOA 5IAEA 5BT9A 5G0UA 3K8YA 4YT2A 3KOMA 2RJ3A 5IVIA 1SD2A 1H1DA 2Y0DA 3GCGA 3PYXA 1FFAA 2XCLA 1GR0A 5AKEA 3CNNA 1F60A 1F20A 1JU3A 2XNHA 3CEJA 3FVQA 3G0OA 1N6OA 1IVYA 2AMLA 2ATXA 4UD6A 3IBGA 2IYQA 1CUEA 3Q1KA 1I01A 4BLQA 4DQXA 3OY2A 5BWNA 4MW9A 1N1EA 5GOTA 4P9NA 2XUOA 1LUAA 2JJ2A 3O8CA 2G07A 1RM5A 2A4KA 3HJGA 3MMXA 1DB3A 1G6HA 1PUXA 3LCRA 4WFQA 4TYQA 2A78A 3V7YA 2GAAA 5KYGA 3EWNA 4BQFA 1HM5A 4PWYA 2H07A 3AP2A 3AEUB 1GPDG 4YY3B 1XF1A 5AUQA 5HFJA 3AETB 3W6ZA 4B4UA 1TT5B 4PYNA 1A4RA 2ZS7A 4RACA 5A6SA 2YJGA 5CVTA 3HZHA 4OI0A 3S2YA 2HDOA 4RF2A 3VPCA 2QJTA 4KLAA 1C0KA 2HN9A 1FJGB 1VXOA 2CUZA 2W2VA 4R9SA 5EERA 2RIRA 1KH1A 3EXIB 1OLXB 1CT9A 1WOYA 4HFJA 4EFMA 3ZNQA 4H6WA 4XVCA 2M98A 3BOSA 2VDMB 5IC6A 5D84A 1G8PA 4G8CA 4I1VA 2ZVQX 2R5NA 4C7XA 2FG5A 4JH0A 3I3OA 1CU1A 3ABQB 1ESDA 4ZU1X 1KDTA 3GLGA 2H1IA 5IH7A 1T4BA 4Z3KA 1L4KA 1NG9A 3DOFA 2JEYA 4ZVSA 4IQFA 5DZSA 4N7BA 4BIIA 2XVYA 4L4UA 4R84A 3SG0A 1MD9A 2DOKA 3AU8A 1JIXA 1XD2B 4DJDC 4RZ3A 2VJMB 1M54A 4LJYA 3ZLJA 1U94A 3ER8A 3HTXA 3BGIA 1AZLA 2FEWB 4HBZA 4JBGA 3U7QB 4ACAA 4ZCIA 3BGDA 1VCNA 1MVOA 1Y5RA 3K16A 2C5GA 5EUBA 3VU1A 5IT0A 1RAAA 1GTMA 3BJMA 5I4BA 5JU6A 4IKPA 2LNDA 1LQ2A 1SCUB 1VKHA 5AK4A 5B1HA 3HB4X 3DAPA 3LC1O 2VATA 5IDVA 3ITDA 4DEYA 2RGNC 1Y6RA 5CEFA 1RRMA 1RYYA 1MH1A 1WETA 2B7LA 2HNBA 1XTIA 1H1LA 1JALA 1IG0A 2VH5R 4IDGA 3LQRA 4PY2A 5HCUA 2QZPA 2DBVO 2J3JA 2V5UA 2MYUA 2QL7A 4A16A 1ETUA 3BGSA 3U4CA 4BNNA 3COSA 1RWQA 1VE5A 4OXQA 4EJSC 1F38A 1CQWA 2VHCA 4JC0A 3ZY4A 5JAMA 2VAPA 5AOAA 1Z47A 1ZK4A 6REQB 1CY8A 5DKFA 5IK2A 2RGYA 5AVRA 1W6UA 3UB3A 1JZQA 1W0KA 2GPJA 1XYGA 1USVA 1XRNA 2DSNA 1SU8A 3AGQA 4G6ZA 3UTCA 1U8YA 3QEMB 4NAUA 2OYRA 5JSUA 1YDWA 4MCJA 1UAYA 1OROA 1OPXA 3S1AB 4Q21A 4YYEA 3HCAA 1L8QA 2DT8A 1Q6ZA 5J4LA 3NTOA 1YFKA 1L3BA 2C2GA 3EEFA 3J7AC 3FOZA 3S8EA 4R69A 2Y66A 2FLVA 2FQWA 5EHQA 3RFCA 2IJGX 4ZI5A 2GKOA 1OKKA 1YR9A 4G1CA 1YA8A 3IUSA 4QFBA 2CWDA 3LBAA 5EMKA 1X7ZB 1MOQA 3DULA 1NHGA 3IKLA 2Q6KA 2DXIA 5C37A 2FSSA 1B6TA 1C41A 1Q19A 4AC9A 2ORVA 4MQFA 5IJZA 2R1VA 1C9JA 2B5OA 3S29A 4OHVA 1SVSA 2B83A 2I1VB 2HU7A 4DIEA 3JWHA 2DFNA 3GCXA 1AA6A 4TQAA 1UPUA 2XWBF 1I4EB 4CEJA 1YO6A 2FU5C 4XPIA 3GAAA 1RI2A 3NHUA 4HTAA 1G60A 2B8EA 1P8JA 1RM0A 4EMSA 3U44B 1Y4DE 5AK6A 3C8UA 3GJZA 3MFQA 1LPBB 1ZHHA 5GWXA 2WHRA 5LUBA 1GYPA 4AF6A 1E6MA 1Y1KE 1VMKA 1XZEA 1TADA 3D4PA 1E5XA 2BTOA 1KY5A 1PJZA 2FPGB 3LPDA 4O1IA 5CYPA 1B0PA 1YC5A 2BEVB 2RHDA 1ESMA 4MROA 1RHMA 5C7YA 2AMVA 2F7SA 4BNXA 3G13A 4K8OA 3VI3B 1JKJB 5BVHB 2C7OA 2OV6A 2O8CA 4K0RA 2R5WA 6AT1A 1PG0A 1G7TA 4Q05A 4NS1A 1NJFA 3T34A 3TZ6A 2XIJA 3GGSA 3AW8A 4UBKA 3IE0A 2QB5A 3RTEA 3SXUB 1C7FA 1YT5A 5FUXA 2J0QA 3S0JA 3N59A 1JIUA 4RVGA 4UVGA 5ICMA 1U1EA 4KRFA 2J9RA 2FVXA 4HNUA 1SUIA 2Q07A 2V3CC 1QP0A 3ZCQA 1KE1A 5CB6A 4ZVKA 4BTEA 1NMXA 5A04A 1IQ0A 2OQIA 1RIFA 2GXUA 4JQYA 3FR7A 4U2BA 4U63A 2VDLB 1OXKB 4E32A 3CG0A 3D0RA 4MLPA 3OOEA 1IC6A 1GFSA 1S01A 1Q83A 1UIRA 2HGSA 3KK0A 5SY9A 5BWMA 4H4DA 1DXHA 1V5WA 3EG9B 1WO8A 3D7NA 4BBZA 4DUPA 4EUSA 3DBIA 4MWEA 1ZOOA 3BFXA 3ROTA 3DO5A 2WIJA 5AYVA 5ANRB 1MA3A 5LXTB 5AVQA 3P9SA 3FCYA 1QE3A 3D6FA 3H0KA 4AO7A 5JS7A 3BTSA 3U7IA 5IN4A 3BDVA 4HDRA 2PCLA 2A59A 1RVDA 2FCAA 1BRTA 3BBLA 3H6GA 3HPQA 3HRKA 4JXJA 2IVZA 2YZKA 4KV7A 4MWCA 5EXTA 3I2KA 3QIVA 6Q21A 2PSSA 1NT2A 5TF4A 1U3UA 4INAA 1CYEA 1Q14A 3W7VA 3A05A 2QMEA 5G1OA 1HMYA 1J90A 1WCV1 1EFPA 2O2YA 3I6BA 1MU0A 1K3FA 4GYKA 4CHGA 2R48A 3JWPA 3CINA 5C35A 2RCNA 1FFGA 1NXPA 3B13B 5ITWA 1GKIA 1ZLYA 3ZWVA 1RPJA 1T36B 3L5KA 1KEZA 5BPFA 2PH7A 3TLMA 1KQOA 2WU4A 3LYUA 2FEPA 3IT1A 4GEKA 2PGXA 1C0EA 3R3WA 4EKYA 1GGVA 2H5EA 2EERA 2JIZD 1GP2A 5IAOA 2H9YA 4GPIB 1Z2OX 3UJCA 4BZPA 1HT0A 3O21A 2C5FA 3OZEA 5LYJA 3DHVA 1FTWA 3ML1A 1RKBA 3PX2A 3H9GA 1QIDA 1PJAA 3KYCA 3OWOA 1NW5A 3ZCPA 1NUSA 5IBPA 3PQCA 4IMPA 4J6FA 4U2EA 4DMMA 5F2NA 4LVCA 4QJIA 4DR2B 4H3HB 5IKMA 1WW2A 3FIUA 1TECE 4BVLA 3WMXA 2PV7A 3TTUA 3UW3A 1Y7TA 1OXXK 4KVGA 4L6IA 2GZHA 3SYNA 5DTIA 4AS2A 4B3BA 1ZXBA 2EOAA 2VJNA 3C85A 3PYLA 3ZCSA 1BS1A 1U9CA 2GF2A 3GRVA 2K5UA 3AUFA 5CA0A 1DC5A 1PU2A 1CZUA 2H7YA 1K6MA 2JAOA 4I55A 4URYR 2CYAA 3ZWBA 3F4KA 3F7NA 2GCOB 3R6GA 3QBTA 4NMMA 1EE2A 4RDHA 3A37A 4BMYA 1JE0A 3M3HA 1PT8A 2OOKA 3Q2OA 4RZHA 4QOJA 4R2HA 1KO5A 5HF6A 3DOJA 2WYHA 1FC0A 2BFCB 3MTAA 4ZCMA 1T9BA 3PL1A 4NYIR 4L8VA 4A0FA 3GB9A 3QFHA 5FYDA 3SSAA 3NOVA 3QVKA 1MRZA 2Y1XA 2ZQZA 9LDTA 1IEQA 1TDJA 3STYA 2BEJA 3FWPA 4M9RA 1H5QA 4TMWA 3QJ5A 3WKEA 3JASB 1NXXA 1VZ2A 2G0TA 3PXUA 5HKOA 1EGVB 4EBBA 3KV3O 4DQ0A 4G4SO 5EYPB 4YECA 2BP7B 3I4CA 4KKXB 1R0XA 2MINA 1ZCFA 1ZWKA 4B17A 4UHBA 1ULSA 5DHTA 4C5AA 2XTMA 4UAUA 4RLSA 4UDNA 2Z0MA 1WM1A 2EJUA 2ACWA 3N2YA 1R37A 1WY5A 1GG5A 3LMKA 1TAGA 4E2WA 4AP6A 2HSEA 4PX3A 2Q5FA 4MW6A 3TQTA 1AUPA 2E55A 4EPYA 4LHEA 3WLAA 2ZSDA 3GJTA 3USES 5IASA 2Q1YA 2ZB7A 4GH5A 5EE5B 4YIHA 1NDUA 2CMHA 1DAOA 1YJQA 4KNVA 4RSRA 1QKJA 1L7RA 1T1JA 1T8YA 2VWQA 1P4HA 4MS3A 3ZZTA 1H4SA 1D6MA 1J1IA 1XZKA 3GRPA 4PAQA 4CV3A 1JZTA 4FN4A 3CZRA 3IB3A 4WZBE 2JGDB 3OLCX 2ZI5A 1O5IA 3V7UA 1TM4E 1GPNA 1XWFA 4UCXA 1NU8A 2COKA 1FMLA 4S24A 5EESA 4CTMA 3Q9LA 1QCDA 1DT5A 5CHEA 2A7XA 2FP4A 5ALGA 2YCBA 4YYZA 3IXQA 1ZG3A 3FUTA 3W8DA 4ZIRB 1E3WB 4MGHA 4Z0TA 5CA0F 1E5DA 5FNVA 1RJ9A 4B33A 4LS3A 3TGLA 4WBXC 1QOQB 1T29A 1PHPA 1PUJA 1Y48E 4LY3A 5A5DA 2ZJBA 4EM6A 1LJ8A 2IYEA 2DUMA 1PJTA 1D3AA 3V9PA 1PNTA 4JP2A 2WIKA 1WQ3A 2R6ZA 1A8PA 4XB1A 3EEQA 1D6SA 1ZP6A 5ETJA 2DETA 4UC0A 4WY5A 1FFWA 1N2CE 1QNFA 4N5NA 1Z4KA 1NJ2A 3M49A 5I9MA 3UVEA 2BGWA 3TEMA 1IZ0A 1Y3FE 5BSFA 4B3IA 4PQEA 1V48A 2ECKA 2QP9X 2WJ3A 1NUTA 3SX2A 3DW1X 3HKCB 4EENA 1W47A 3L7BA 4JJEA 3U7FB 1Y3IA 2G1KA 1YS6A 3D4LA 1G0NA 3UQYS 3FMPB 7AT1A 5T67A 3HVHA 4R1NA 3SFZA 1RQGA 1DLJA 3AEYA 2WG1A 2AF4C 1MPXA 1P62B 3BZWA 1N7HA 2L18A 3EXG1 1HSOA 4KO3S 4MV5A 4ZDJA 2V7UA 3HXTA 5CDUA 5H4GA 4WIAA 1TW2A 4XGRA 4KPFC 2JLSA 3T1YB 1YKFA 3IOMA 3MWJA 4WVFA 4OGFA 1MJFA 2NTNA 4LXYA 4WESA 1Y1PA 1Z56C 3STTA 3GRFA 3P0EA 4FS3A 3L93A 1D1SA 1QGOA 3PTLA 4LYHA 4R1TA 2QAGB 4YLEA 1G2IA 2CKMA 1SCIA 2QORA 3CUYA 5MF6A 4DRZA 4IIUA 1BHO1 5JPCA 5KHLB 1KMMA 5GJBA 2O2IA 1P9OA 2QIOA 2VHTA 2XYHA 1Q22A 2XEXA 3IT2A 3RKSA 5FPHA 4ENSA 5HS4A 3VR2A 4B9AA 3TSWA 1P0QA 5H9VA 1IZ8A 1P9NA 4Q4LA 5IX8A 1AKRA 4BAZA 1DQSA 2J30A 5IW8A 3O4HA 4QQFA 4WUVA 3BD7A 1SELA 3ZU2A 5CEEA 4BL5A 4RIHA 3HDGA 3W3AH 1Q7GA 4II2A 4LOJA 3HABA 3M6AA 1V45E 5ESDA 3PP8A 2YWDA 1PJBA 3CONA 4KN5A 4Y8VA 3H3XA 4R2XA 4RFSB 3O1HB 3P4YA 5JLJA 1RLIA 3B5EA 1DIHA 2PSFA 3ESDA 4EZEA 3HA3A 2UDPA 4QA9A 5THXA 3L0BA 2BR3A 3TW0A 3C4VA 1J8YF 5DIZA 3U60B 3DWGA 4MR8A 4M88A 3UHFA 1PGJA 4HKTA 4FB5A 5L45A 3AILA 2H18A 3FBTA 3O6VA 1GPH1 4J7XA 1TM1E 3DMYA 2JD1A 1QP4A 4F4JA 3GVIA 3R8FA 3EZYA 1K75A 2F67A 3ZX4A 3KSZO 4W9NA 4X71A 4Q1EA 1QTNA 5EOVA 3X2FA 1H5NA 1W5SA 3RU7A 5K0TA 1PS8A 1WPRA 3NEYA 4KLCA 1DX9A 1Q0UA 1TRKA 5BMVF 1EEXB 2LD4A 4LI3X 2DPYA 2OZKA 2HQBA 3WHIA 3PGJA 4DANA 4B3GA 1BA3A 3O3CA 4Q4HB 1XZJA 4DKJA 1CUYA 1KP3A 1TLFA 2VJDA 5EWJA 3D0QA 4TOIA 1ONBA 4YPVA 4ZANA 4TN1A 2Q6IA 4IHQA 3K05A 5LKAA 1Z6YA 1ZOPA 2GF0A 5AR1A 2VJPA 3I37X 3KKPA 1FP1D 1IE3A 3U4QB 2B2XA 2CNWD 2WB4A 2A5FA 5AW3A 4XX0A 2I6UA 1VSUA 2EDCA 1JDUA 1PJ4A 2X7XA 4PZLA 3V1KA 1IJFA 3I09A 3LKVA 4HB2A 1EK1A 1GGMA 1ZMBA 3RS5A 4BRSA 1AQJA 4L9WA 3FBGA 3QM1A 4RWEA 5CDFA 1IY9A 3WGTA 2J48A 3FCUB 1IVNA 1ZI9A 3LX8A 5L7YA 3ZK9A 2ZYDA 1XELA 3KKKA 5L4NA 3OQOA 4KV9A 5AW8A 4FZ3A 1PEKE 1XVAA 2ZJ5A 3LO5A 4CCWA 5LR6A 4MYUA 2I4RA 1A1VA 1P6XA 3H7AA 3I28A 4R1LA 2Z8ZA 4DRXA 4AN1A 4AICA 4OQEA 1W94A 2J7PD 3KB8A 1LQUA 1OXSC 2QTNA 3KYDB 2NSHA 2YWCA 4K05A 5FWYB 5IVPA 3U80A 3Q6NA 3WLFA 4KREA 2QAJA 1Z4OA 3TQFA 4DSNA 1ZD2P 4KAXA 3GEEA 4N4AA 2A5DA 4JFRA 2JCVA 3EA0A 3LPCA 4YUVA 2PE5A 4E88A 3PEVA 1M34A 4XYBA 2VTVA 2FOLA 4Z3OA 2LR0A 3SJZA 3SQWA 3B9BA 1CQIB 1T91A 2IF2A 2PUJA 4EGCB 3FNHA 5CM2Z 4AJKA 3D7SA 3BT7A 5FQNA 4MJLA 1T5TA 3KLNA 4LYEA 5LM3A 2WWIA 4CFZA 1FYVA 1NUPA 3EW7A 1LA2A 1CRQA 5D85A 3A4IA 1TGYA 2P2NA 1BWPA 3UMSA 5JJBA 3H2KA 3JRWA 2F1RA 3C3XA 1VB3A 2WUFA 3GMDA 4WCVA 4WLVA 1H4VB 2JI8A 5J40A 2AWOA 3RJMA 5HK8A 1YA6A 4TRMA 3FKJA 5BT8A 2D62A 1QO7A 3H11A 3RHFA 1BX1A 1N3YA 1E99A 4KAJA 1VRVA 2B4QA 4TVBA 3WIDA 4ENTA 1L3IA 3WDSA 4DCCA 4UDXX 4WPGA 4QDTA 1Y42X 2OBBA 3TEFA 1NW8A 4BYMA 5HKBA 3ZWDA 1MR3F 1SU4A 1IN4A 2O2EA 3I9OA 3IP6A 4IVQA 1M2VA 4NZOA 1ZH2A 5DK4A 3X0DA 1QV7A 4G2TA 3ZJTA 2HMWA 3RU2A 4AXXA 3AQIA 3JQ8B 3LRTA 3QTBA 1GAQA 2A14A 1SCAA 2GYUA 3PSAA 3QJGA 3RS2A 1NN3A 1M75A 4E4RA 2WMNB 3L0SA 3QXSA 1VPEA 4DTIA 5LQKA 1K3UB 3JD0A 2VUIB 1TKCA 2OHFA 3DXYA 3LUGA 1A9XB 3AMVA 4IG4A 5KQSA 2QXUA 4K9NA 1XCJA 1M67A 2XB4A 1V37A 4RNDB 5C7IO 3VOSA 2VRWA 3GL9A 3BJRA 5MGBA 1ZVVA 5EMNA 4WY8A 3O75A 1P2TA 3GJQA 1T8TA 4M0CA 4NHEA 2AFVA 1JVSA 3GP3A 3Q5DA 3RBAA 1KXJA 4E6PA 2XB6A 4QOSA 1SXIA 3GGDA 4Q1FA 3I6IA 5JCJA 5FWNA 3LQ4A 1N6HA 4FFVA 3ADCA 1CKEA 1BROA 1PVDA 5BQOA 4Z3DA 4B6GA 1JECA 4V1CI 1JPUA 1GUDA 2HK7A 2PT6A 4EG8A 2P6RA 1DC8A 4LF5B 1V4VA 3A6JA 1UBCA 3LW7A 1BE0A 4EY7A 3FKQA 3ZGLA 4AS1A 4PR3A 1AC5A 4R1UA 1R4ZA 2ZI4A 1S4QA 5B64A 3FCAA 1WD5A 3M6LA 3RUAA 5TLSA 1S7CA 1QH1B 2GZ1A 4V3BA 5TMEA 3VC2A 3WZLA 4YUXA 4JXXA 5ER6A 2GPSA 3C8MA 4S1TA 2GWRA 4JR0A 1JSCA 4OHZA 2FEMA 1A50B 2FX5A 4XZ3A 1V1MB 2F90A 1L5YA 2YXDA 3B1FA 2VQEB 1N7IA 3IAEA 2Z4SA 4D9JA 1JG2A 1XKXA 5LB4A 2JIQA 3OJWA 4UTNA 1Z6TA 1PK8A 2Q0HA 4F12A 2VJQA 1PWXA 4DEXA 5G3YA 1YR6A 3V1YA 2LP4Y 1AKEA 1ZGJA 4HB0A 3QXXA 5TJHA 4OIMA 4MYCA 4RD3A 4DIUA 2V7QA 1WMFA 1G7RA 4H6XA 4JSYA 3V00A 4WERA 3G89A 3OQJA 2KPOA 4UEJA 2H1LA 3IOCA 2W93A 2P5SA 4WCFC 1B74A 4TUYF 4YRSA 4J4BA 3G7UA 5H82A 3QFCA 2ZRBA 1FMFA 1VHDA 1CUAA 2CBXA 3KZMA 3P8ZA 2WHPA 3A25A 2JAWA 3AEKA 3IQZA 4BKPA 4OX9B 4L0CA 2IHTA 2OFWA 2TMGA 2BSQA 3O8DA 5AHWA 1GV0A 1VECA 3C5EA 2Z6AA 4Q1CA 4URVR 4NZMA 5J2UF 1T5LA 2QVBA 5CX1B 4ERNA 1TA9A 3ZWXA 2Y1LA 3NVDA 1VKJA 2DYKA 1LDGA 2PX5A 1BN6A 2BTEA 5H5JA 1CVRA 4HQLA 2KI5A 4D46A 5DCYA 1JDTA 4HWGA 3NGMA 4R68A 1T24A 4ZT6A 1P5ZB 1SUWA 4YJFA 2MYPA 3WFJA 4JBYA 2BAGA 1U9IA 3AFOA 1OZFA 1QGUB 4FCVA 1VA4A 1HZZC 5G53C 2JDIA 4IHJF 3E22B 2ZJ4A 3QLTA 1A77A 3ED5A 1FTGA 1U0TA 3GGPA 3QVGA 4X54A 4N9WA 4OBXA 4PC2A 3FYUA 3KEOA 3UC5A 1XO1A 5B3LA 1F2UA 4BFVA 4R71A 1EXNA 2GBLC 1O77A 3B6KA 3CVWA 1E6WA 3CUSA 1E1YA 2D1QA 2IE0A 1WULS 3VSCA 3N6XA 4IP0A 3AEUA 1N1GA 2ZEJA 3K9LA 3MYRA 3A6EA 1KR5A 1ZQ1A 4UMFA 3AETA 4GM0A 5EZYB 3UB2A 4AJNA 2F2TA 1Q17A 2VZ8A 3DSRA 1V8FA 2HMSA 4GVXA 3FWHA 5LUAA 1JKIA 1Z7GA 2JVIA 5JNLA 2OB2A 3U2QA 4MW2A 3EXIA 1OLXA 1BD4A 1U1IA 3I8SA 4ZAZA 2NQ2C 4CMEC 3FRJA 3HJAA 3K1JA 1CYDA 2OO5C 3MELA 3UCEA 2B9VA 1QVAA 1J1ZA 2X8JA 4HG2A 2WB2A 4HB3A 1S6YA 1WPQA 4ITRC 3KUXA 3NHFA 2Q49A 3NATA 8AT1A 1G6OA 5AO9A 5BR8B 4BLOA 5AW9A 2G6BA 4HCJA 4KGDA 1DAEA 2NXCA 1PR0A 1XD2A 2HK6A 3C6YA 3SBDA 5IHXA 1EQUA 1R6BX 2VJMA 4TQUS 3PTZA 1QPGA 2X77A 1MXFA 5BPHA 2BI8A 3O5AA 1ULAA 3A32A 3CEAA 5J5CA 1ISMA 1TC2A 3QY0A 2ZBRA 4Z9FA 3RVRA 3DKIA 2O1SA 3KR9A 4IVPA 3I39X 3WGLA 1P4SA 2L82A 4ZRMA 2I8AA 2DEUA 3GGOA 3GK3A 5DRTA 4DBZA 1M6VB 1ZGHA 5EP1A 1VHWA 2HI0A 1A76A 3QZUA 2YL2A 3W5SA 3CO5A 4PO3X 3BAZA 4RX1A 4Y0NA 3KQTA 3RSHA 1WW3A 3PEUA 1M2GA 3EFBA 2F9MA 4QRDA 5GZ6A 1Z45A 2G0AA 5KU1A 1W5EA 1Y7LA 1Z06A 2POQX 4W7HA 3WK5A 4X1KB 3LWBA 3PGLA 2C3YA 1Y33E 3K0CC 3RRXA 3S4YA 1KMIY 1C4WA 1FFXB 1KS2A 1X94A 4YRRA 1B2LA 1THTA 1H2EA 2E6UX 3N76A 4RHFA 5A5EA 4F5WA 2YXNA 3CPJB 1KQFA 3FTPA 4EA9A 2Y1KA 3FYHA 1CQZA 1QG6A 1YV9A 2KS6A 4CCAA 5B4TA 1QYRA 2XUHA 3QEMA 4GI2A 4E2FA 3A6PC 1TYDE 1P2FA 4WKNA 2C7BA 4BPBA 4AP9A 3R7SA 1Q3TA 1E8MA 1JTEA 4YMVA 1TK9A 3JW8A 3Q7QA 2RI0A 5DM70 4F7DA 3KOYA 1UJ5A 4RE6A 5J4HA 3FSGA 3LXXA 2CJWB 4XH9B 4R2WA 1YZ3A 4PZPA 3UG6A 2QW1A 2K7ZA 3PB3A 1ESEA 3IE2A 4NNOA 1TF2A 1F8YA 1GCAA 2QTTA 2YZMA 3LSTA 4FXPA 5CW2A 1HLGA 2GPTA 1X9GA 4LBWA 3PJGA 4AWXA 2H8KA 1VE7A 1JIJA 2WQZA 1IHXA 1XJ0A 4FCCA 2G04A 3J7TA 4U1RA 3RV3A 3PUVA 1E9EA 1M0EA 2Q9BA 2Y1EA 4UHKA 1XYVA 2B92A 3TBKA 2ZB8A 3VHXB 1VJDA 2F1OA 5D6OA 3TX2A 2UZ3A 4AROA 4Y7CA 3V1UA 4NZPA 2D00A 1ZKMA 5AM2A 4JI0B 1FRQA 3SZOA 2EL9A 2ZRKA 3F2IA 3P0HA 4QUKA 5DRYA 1X87A 3MWLA 2ZQ5A 1U31A 2Z57A 3AY0A 3U44A 1V5EA 5DM4A 1FLDA 3FNFA 4Q9IA 2AOUA 5E6UB 1QS0A 1JA9A 3I32A 2VDWA 3NC0C 1H3NA 3WHLA 2C94A 3DEYX 3KTDA 4I6EA 5FRDA 2DCMA 4QYIB 3UTDA 1WB6A 1N5IA 4H3SA 5IVDA 4DE5A 2FPGA 3BERA 2XUKA 1LVHA 3MJEA 4HXYA 3N6VA 1U7OA 4RQTA 4DCGA 2QVYX 1O54A 1G9SA 2PBLA 3ROMA 1MJNA 1O7JA 4AQYB 1E2IA 1KH3A 1M0WA 4HH4A 5FLXA 4ND5A 4E5KA 5BVHA 2H6EA 1MB4A 5SYMA 3T9FA 3MS2A 4M9QA 3ZQ4A 1IEWA 2H54A 2AJ8A 3FF4A 3GNSA 3RRJA 4B82A 1W7AA 1RXEA 3TFQA 4Z86A 1DLIA 3UPDA 3V8PA 2H52A 2NZVG 4TM7A 1WW8A 4E51A 4I46A 4L5JA 1SURA 3OPYI 1KYYA 2JHFA 2M1XA 4FSXA 5A3QA 1SEVA 3DAHA 1EFTA 3A8TA 3AF0A 1DKLA 1E60A 1XDBA 3N0XA 2OGTA 5FTMA 1UMDB 4JBWA 4PPNA 1QIEA 1L5ZA 3A06A 5G40A 5JD6A 4X65B 3PJFA 4K0KB 1V4NA 3E5NA 3MSXA 3QSYA 2ZWOA 5T4HA 3EH1A 3EG9A 3G5LA 2AA3A 4O4IF 4JOQA 4U7JA 2HF9A 1XZ8A 3EVDA 4M7WA 2R0QC 1XMQB 3KT6A 2BFAA 5HJ7A 5LMZA 2IYRA 4FDAA 5LXTA 3ZJ4A 1MQAA 2AMFA 1NAHA 4XYEA 3DP7A 3VU3A 3IMEA 4HNGA 1EVKA 5E95A 1EFRD 4LJ5A 2PD3A 4DREA 1OWNA 2VF4X 1E1DA 3G0GA 1CNEA 4Z2YA 4FN5A 4RPKA 3SR3A 4DLRA 1R6AA 2NVBA 3QEKA 5E4JA 1YVPA 5K99A 3AHIA 4F8EA 1X7DA 1Q1AA 3PC6A 3B8EA 3S5UA 2ORYA 2H65A 5U4QA 3VYTB 1ZVKA 3OFVA 4LHSA 2AJCA 2FJUA 2VDOB 2XDQA 1H42A 2EQAA 2LPMA 4IKEA 1M7GA 4LNUB 3SNKA 3V8NA 3C3KA 4TMZA 1A9SA 1P2BA 4US1R 1T36A 2FSIA 3I01A 4MI9A 4R1MA 5A7GA 2XT9A 4O4JF 4ETIA 3O8OB 3L8YA 3ZXSA 4C2TA 1XQYA 1D4ZA 5T4BA 3TINA 4PWZA 1FNBA 3TMAA 1VOTA 3X1DA 3WRWA 2IS6A 5KEIA 1EFVA 4MKHA 2HCBA 3AUSA 2WPDA 3L6CA 4JNCA 3D1JA 2FPPA 2GN0A 2QNRA 5CITA 4IZ6A 3A9TA 2Y9PB 4GOOD 2V7VA 4R8KA 2ETVA 3JYLA 2DZDA 2GA9A 2G09A 3BXXA 3M9XA 3ONEA 4D9KA 4RTNA 1MNAA 3N2GA 1E9SA 2JVKA 3D4BA 4MRSA 3MJ4A 3MAJA 1XLWA 5DXJA 1BU5A 3K6SB 2ADFA 2GO1A 3FM9A 2FRDA 5B2FA 1GNRA 1YCGA 3HCFA 2VTBB 3UWMA 3OZWA 2DWCA 3TRHA 1E6UA 1E5TA 1LK5A 1XFAA 4TS1A 1CTQA 3I5UA 3ZEIA 4A8JC 3EEIA 1B26A 5C5EA 3U4MA 4LAFA 2IQ5A 2EFHB 2JL1A 3NG1A 1M6YA 4I5GA 2LBPA 5JJKA 4ZOBA 2YWEA 4FYVA 5GY7A 1AKTA 2Q4EA 3DAOA 3VR5A 5LOVF 4ILEA 4DQVA 3N8NA 3G68A 3V8RA 1J8DA 1KAMA 4H1WA 1JLLB 1ULTA 1LSJA 1ZITA 2G7MC 2W6ID 5DCLA 1DP4A 4ND3A 3W04A 5L53A 1B3RA 3E3NA 4LEIA 4C0HA 2CV1A 2BFCA 5EJ2A 1K06A 4J1SA 4A82A 3IAFA 4NH4A 3BMOA 2J09A 1T6BY 4REOA 3QV1A 2DHQA 2O2CA 1I4TD 3G2QA 3MSCA 4NICA 4QUEA 4CMJA 3JASA 3M4ZA 4K5QA 4YNBA 2ODEA 3V33A 4EJSA 4EI9A 1POXA 3VNAA 2IHUA 3IDOA 3F6EX 4IZIA 5BORA 1C9KA 1P61B 5EYPA 5I7UA 5TC4A 3VO1A 4EITA 2CZCA 1SCJA 1F12A 2KE5A 4Q6BA 4OHCA 5ALMA 1ZSNA 2XA1A 5EJ5A 1ZK0A 4M38A 1YMQA 5LYJF 2ZK7A 1SBNE 2DPXA 1NV8A 1P3Y1 4Y1RB 3REQB 5AT1A 4ZYYA 2IX9A 2P4UA 2I80A 3RQSA 2P2CA 1TU0A 1J7JA 1BOFA 2QN6A 3ORFA 4JWTA 3ILSA 5HX7A 1QIIA 2WTXA 1M1YE 2PGNA 5GM2A 3E8XA 3QI7A 1NPTO 1YJXA 1YR8A 3OP4A 3B60A 6CHYA 4MR7B 2LE0A 3GUZA 3EPJA 4QYSA 1DGQA 2C57A 2OR3A 1U2DC 2VNAA 3OUUA 1C8KA 3L1VA 1NI3A 3QW2A 1CF4A 1EIZA 1KYWA 2JGDA 2JAXA 2VPQA 3HO8A 3QVSA 2J0UB 2HFKA 1D0IA 3KP1A 4J29A 3WVNA 3DMFA 2ZE7A 1R9GA 2X9GA 1XI2A 2FMIA 3PV0A 2FP3A 4IGKA 3RS8A 4DUGD 2V6IA 3IEXA 3V7NA 3TZBA 2ONZA 2OCAA 1DDGA 1Q20A 2DFLA 2I8LA 3B5JA 4OXRA 3CU5A 1N0VC 4ZIRA 1E3WA 4KQ6A 1YFJA 2OWEA 3I05A 1XA0A 3AR7A 3IUBA 4G63A 4RY0A 5EE1A 4D4JA 1VC2A 1MOPA 2VCYA 5EXXA 1XNGA 4O0LA 3IOBA 3TNYA 4D96A 5L4LA 1C1HA 2FSUA 2OHGA 3V4PB 1S9HA 1Y1RA 3L6DA 1DO2A 4NJOA 1H5UA 4MYHA 3WX0A 4D9GA 3ILHA 3C3JA 5BV0A 3TZCA 2MYTA 9ABPA 1AH2A 1JI0A 3MPOA 4G5HA 1S2GA 1XTQA 3DVLA 3GIWA 3UWPA 4DIOA 4EHAA 2XUFA 2WHXA 4OKIA 2C9YA 1HE5A 4Y2VA 1JHXA 3AF2A 5B3JA 4KPYA 4G5GA 1QYVA 1P1KA 1LPNA 1QHIA 3M33A 2I7DA 1S2NA 3H99A 4OGGA 5A06A 5J4VA 4JYCA 4JXZA 3SEZA 2PAFA 2V8BA 2QTVA 2HEGA 4GZLA 2HFJA 3OTQA 2ICAA 5M29A 1T6XA 1P74A 1PJSA 2OB1A 2DVMA 2VZ9A 4G1EB 1JDBC 2P3SA 1EUDA 3K1ZA 4WBNA 4DIDA 2FUKA 3UG7A 4O1MA 5K9ZA 4XYGA 1ATZA 1SHZA 2WVGA 3KQYA 5A03A 4QWMA 5HK9A 3GVXA 2HNKA 4PZUA 1D8TA 3MBIA 5FXMA 1NW3A 1JH8A 3GVPA 3RIXA 4XIGS 5ERXA 4EHKA 4UE6A 4DDMA 2Q5EA 2MHCA 3FPHA 4MVJP 3KD3A 5DLQC 2OPHA 2Z5LA 4EAAA 2ACKA 2KJQA 3RG2A 5J1SB 4QE3A 4ATNA 1NJGA 2E49A 4YMTA 2ZSKA 4BNHA 4AMYA 5EHGA 3IAHA 1O95D 1YCDA 5C8YB 2FW7A 2RHGB 1P1JA 4EUFA 2XUIA 4QXOA 4ZVVA 3M3DA 4PZAA 2PLRA 2CJYA 1UMCB 1P0MA 1TIPA 3CNQS 3FETA 2CLFB 1AO3A 2PKQO 5AVTA 2IH5A 4N7MA 3PDUA 2AFIE 3NT2A 2D2IA 1OYOA 4HDQB 1LZLA 4M9UA 3AIOA 4ZVPA 1H85A 1H8ED 3GAFA 1C9DB 1EWQA 2FZWA 3FUCA 2X0FA 3MOSA 4UXIA 4FM9A 4CG1A 1Y81A 1T9ZA 1Y5MA 2OBLA 4RFSA 4V0NA 1AGRA 5D6NA 4CJXA 5FULA 2CSXA 2G1AA 1QIGA 5H80A 3TD9A 3CF0A 3WJ1A 4EB3A 3SGLA 4R1PA 3H97A 4PXSA 4YO8A 2JFWA 2DF8A 2YQ4A 4TT8A 1OREA 2RB5A 3TZHA 2IZOA 5HRCA 5FBQB 2CV0A 3VZPA 1JHAA 1BMDA 2X22A 3EPLA 4ETWA 2QMZA 4EATA 1ZSVA 2XPCA 4O8ZA 1G20B 2FK8A 3W3AD 4EPRA 2P75A 1VQ1A 3H8JA 3RUEA 4FFBB 2V6JA 1C14A 4TS9A 1PZEA 3RTCA 4U7WA 1JQLB 3AKYA 4M86A 1V47A 2IXAA 2IOQA 2NSJA 2W58A 3GT4A 3KR2A 4BKQA 5HZGA 2YQ5A 5AKKA 5CH5A 4YRQA 1NVTA 2EVWX 1OZGA 2HL6A 2QM3A 3HBFA 3PU6A 4Q4HA 4XTRA 1MO3A 3AF1A 5AQEA 1C30B 4TTJA 4FGKA 4LSZA 4V1CB 1P2VA 5LQUA 4OX9Y 3JQAB 4Z9XA 2E5LB 3GLFE 4U7GA 3EMKA 4WLNA 4BMOB 2H1FA 4QBHA 1JDZA 1MRNA 1MV5A 1JHMA 3HP7A 5JMOA 5CVCA 4PM4A 1M2WA 1VSTA