4H7EA

Crystal structure of haloalkane dehalogenase linb v112a mutant from sphingobium sp. mi1205
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYTYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAVTMPLEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGHLTTGRIRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Crystal Structure and Site-Directed Mutagenesis Analyses of Haloalkane Dehalogenase LinB from Sphingobium sp. Strain MI1205.
pubmed doi rcsb
source organism Sphingobium
molecule tags Hydrolase
total genus 112
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4h7eA00
2XUOA 4KRYA 4FLEA 4BAGA 2JF0A 5AI9A 3MGAA 1YAJA 1XRPA 4UBJA 5ALNA 3W04A 5CMLA 3WKCA 4ETWA 3WYDA 4E15A 1R9MA 2BKLA 1CEXA 3ZLUA 4J03A 5HQ3A 3O4IA 2ZJFA 1YA4A 1EDBA 2H7YA 3HC7A 5HFNA 2CMFA 5JAHA 2OCGA 2J3QA 3IUNA 2IIVA 4A5SA 4DMKA 4F21A 2CB9A 4FFVA 4QA9A 1LNSA 2ZJ6A 2JEYA 2Y2VA 4LYEA 5AI0A 2B20A 2GZSA 1OILA 3FLAA 1X2BA 4GBGA 4QWWA 1VE7A 1GPKA 1FFCA 1VZ3A 4X6XA 3ZI7A 1FSSA 1VZ2A 2ONCA 4E46A 4EB0A 1ZI9A 3JYHA 5K3FA 1MNQA 4BTLA 1W1IA 5FP0A 4HAIA 4GEGA 1HPLA 1LZKA 1WB6A 2GBGA 3NOXA 4UBMA 3DLTA 2C58A 2XUFA 2Z3ZA 3C5WP 1VA4A 5ALUA 1PV1A 1MPXA 1CFJA 3TEJA 1ACJA 1QOZA 4PF1A 2JGEA 4MYSA 4HXEB 5AOCA 1AMNA 2OQIA 4AN0A 2XUDA 2XQKA 4CCYB 3UMJA 3HYSA 4B9AA 1J06A 1H2XA 2PM8A 4HS9A 2BGNA 1E8DA 4G8DA 2WTNA 4IH4A 1G4HA 1SCKA 2AJDA 1GPNA 2WFMA 3V9AA 5FPQA 3C45A 4OB6A 4KJXA 4YX9A 3PI6A 2O2HA 4K2AA 4OB7A 4OB8A 4AMZA 5YASA 4H77A 2GZRA 5HF5A 2C5GA 2QZPA 4L0CA 5DYYA 2HA0A 5AM3A 2X76A 2QXUA 3AJAA 5FPPA 5KBYA 4C01A 4K6GA 3DKKA 5AKXA 2WG0A 1XKTA 2HDWA 4PSUA 4Q82A 2WUEA 4X85A 1VLQA 2Z8XA 1FFDA 4XIIA 3B5EA 5ALFA 2H1IA 4P08A 1BU8A 2ECFA 4CG3A 5HKAA 3BF8A 1DU4A 4KEAA 2VJDA 3KOOA 3AIMA 1XZGA 2G63A 4X3CA 3B12A 2D0DA 5CT9A 2CKMA 2WU3A 5EIHA 5DYTA 1ZD2P 1F6WA 4W63A 4EZIA 3STVA 1WM1A 2VT6A 4AO8A 1A8UA 4KAAA 2OCLA 4QDOA 3ZLVA 5JYCA 1EI9A 1QGED 5DYWA 3DD5A 1CUBA 2C5FA 3QPAA 1C7IA 4FMPA 4DNOA 1CUDA 3ANTA 2ES4A 2O7VA 4MQLA 3STWA 3WKAA 2VJCA 3F98A 2QOEA 3WWPA 4BRZA 1M33A 1QIHA 5K3DA 2VA9A 3WK8A 4Q3OA 4EA6A 2WHQA 5K3AA 4X6UA 4KE7A 1W52X 3AFIA 3CCCA 7YASA 3LIPA 3V1NA 2XMCA 5HFAA 4ZXFA 1H2WA 2G4LA 2Z3WA 2H7XA 3FWHA 2PUJA 3WWOA 2QR5A 3UUEA 3F96A 2HA4A 4FWBA 5ALMA 4H18A 2JGLA 3H2KA 3ZPXA 1F8UA 4OPMA 1ZI8A 4LHEA 3ZWQA 1RYYA 4AQDA 4O08A 4X97A 2X5XA 3C8HA 3G0GA 4B0OA 2OLEA 4MXDA 3T52A 4FNMA 2XB6A 3WL8A 1DT3A 2HHAA 1EHYA 3FVTA 5AKHA 4JEIA 3PUIA 3G9ZA 4WDRA 1TAHA 4FLMA 3QITA 5ALKA 3N2ZB 4PNZA 5LZ4A 1AZWA 3DL4A 4QDXA 2RI6A 1AUOA 2VQ6A 3L1IA 4GLBA 1CQZA 3NUZA 3LIIA 3QBJA 4EY7A 2XQJA 3I2KA 2YXPX 5D3ZA 1WCYA 1QO7A 3R0VA 3H1BA 5LZ2A 3ANSA 4DNFA 4QLAA 2HIHA 4J7AA 4HZGA 4H7HA 3DEAA 2E3JA 3VJLA 1W76A 4C88A 1GKKA 1NX9A 1EX9A 4B9EA 2WLSA 4CG2A 4UHHA 2OAEA 5F4ZA 3N0TA 5ALSA 5AM1A 3DS8A 3OG9A 2XDWA 1WHTA 4EUSA 5CRIA 1QO9A 1MT3A 1GT6A 4DIUA 4DTCA 3DQZA 5AM0A 3ILSA 3FLBA 3KWFA 4AZ3A 2H9YA 5I8PA 3WL5A 1HKHA 4FKBA 1NU8A 4H7EA 1WHSA 3B3QA 5EIEA 1P0QA 5AH0A 3G0IA 5AK3A 3DOIA 1UKCA 4JH0A 2OCKA 4BVKA 3DOHA 4DGQA 3O95A 4NZZA 1SC9A 2QJRA 1AQLA 1XFDA 3R3VA 4BRSA 4XJVA 2QXTA 3IURA 5ALEA 3A2MA 2Y6VA 2ZYSA 2C4HA 1QTIA 5ALXA 2O2GA 3AUKA 4ARBA 2Y6UA 4BAUA 1MX5A 1K5PA 1XZKA 4F0JA 2J4CA 3I6ZA 1YS1X 2W22A 4UPDA 5JADA 1QIDA 1XZHA 4X71A 2CZQA 3SWWA 5EGNA 1UK9A 5HCUA 4QNNA 4UHBA 4EY4A 2WFLB 1CQWA 3GFFA 4MJ3A 3W9UA 2I3DA 4GXNA 1G66A 3IUQA 2DCMA 3WYNA 4CCWA 4BC0A 1SOMA 4C4XA 2CJPA 3HEAA 4KYVA 3EQ9A 5IKXA 3X3HA 4CFSA 1L7RA 1U2EA 1USWA 4UFNA 1A7UA 4N5IX 3F97A 5IVIA 1LPNA 4G9GA 3HXKA 4FNGA 2V9ZA 1UFOA 1VKHA 3GELA 4FDMA 3D59A 1KU0A 4JYMA 5HQ3B 1THTA 2WU4A 4RPCA 3WK7A 2QUAA 4B0PA 4BVJA 4FBLA 4B7ZA 2QT9A 4X7BA 4NS4A 4MQMA 2WG1A 3H1AA 3C6YA 5K3CA 4DSAA 4U2DA 4BTVA 3WK4A 4MWTA 4AO6A 1EB8A 1UKBA 5T4HA 5AKLA 1CR6A 4X6YA 2OG1A 2HRRA 1JJIA 4W9RA 2ZYIA 3MUNA 1XLVA 2XQIA 5ALRA 5K3FB 5AKYA 3QZUA 3WL7A 4EHBA 2ZVDA 4QLOA 4B83A 2DSNA 2HL6A 4TPKA 1XRRA 2V97A 3DDUA 1XLWA 4QE3A 3A70A 5T4EA 1BCSA 4A23A 2WUGA 3R3ZA 5ALOA 4BCDA 3H2JA 1XZDA 1CUFA 2WTMA 3WLAA 1BRTA 1EH5A 5ALQA 3AINA 4AX4A 1EA5A 2WUFA 1QONA 2B9VA 4X93A 3H0CA 1XQVA 3FYUA 4EY5A 4HXGA 2HA3A 4C89A 2LIPA 2DQYA 4D9JA 1TCBA 1FFAA 3Q0TA 4IH9A 5AM4A 2WIDA 1QFMA 4FOLA 5ALJA 3W9BA 1N1MA 3ICVA 4L72A 5CBKA 1CUIA 1UK8A 3GA7A 4MYDA 1ZD3A 3O0DA 2RAUA 3D5EA 3G9XA 4DMHA 2VTVA 3E1GA 2BGRA 3ICWA 5BWCA 1YSCA 2WG2A 1EB9A 4J0KA 1GXSA 3WK9A 1BE0A 5LYYA 2ORYA 1XRNA 2JEZA 5T4BA 3PF8A 4M0EA 1QZ3A 2RONA 4W1QA 2XUAA 4ZRDA 3KXPA 1CUCA 5AK6A 3VJKA 4AMYA 3A2LA 3VDXA 1B41A 5ALIA 1F0PA 3BJRA 4Y2TA 1R9NA 3IUJA 5DWDA 3CN7A 1TIBA 2BJHA 5HZGA 4QDUA 2BUAA 3FCXA 3FCYA 5JZSA 3I2FA 2ZYHA 5ALHA 1W6RA 3R3WA 2XMZA 3SC2A 2XMSA 3S8YA 1LPBB 1E66A 3DKRA 2OCIA 2RHWA 5AI4A 3H17A 4E14A 1AX9A 4P9NA 4J3JA 2PSEA 2X8BA 1MU0A 4BP8A 3BDVA 2WFZA 4IHAA 2GYVA 4Y2PA 3BL8A 5DNVA 3IDAA 1P0MA 3OTQA 3VJMA 2QVBA 3AZOA 4G4JA 3M82A 5LZ5A 5CH5A 1OXMA 3R3XA 5HF6A 1ISPA 4ZGBA 1GGVA 4LXGA 4H7IA 4J0IA 4Q3LA 3VKFA 2HA2A 4BB0A 1QIJA 4S0XA 4LYDA 1AURA 2PU7A 4UFPA 1XQWA 4OUKX 3WJ1A 1UT6A 1TCCA 2J3DA 1AKNA 4U2BA 4DMCA 5DJ5A 3DL7A 3WKDA 3JW8A 3VISA 1R4ZA 2ACKA 2PVSA 1YCDA 4GI1A 5A7HA 1HDEA 3UUFA 3K2IA 1BEEA 2JGKA 3WWCA 4LXHA 1CIJA 2EDCA 3I2HA 1J1IA 3IA2A 3FLEA 2BUBA 2XMQA 4K6HA 1XRQA 4QEKA 1JU3A 3DCNA 3EF3A 4I3FA 3HJUA 3HLKA 4MWSA 1Q84A 3R3UA 1Y37A 4GDMA 3CCBA 4DLNA 1VJ5A 2ACEA 5AKEA 4C87A 5ALVA 4B6GA 4Q1VA 2IX9A 1E8NA 4M0FA 3STXA 1JFRA 5A2GA 3O9MA 1QIFA 1YA8A 2FX5A 4WFIA 1L7QA 4UBIA 4H7FA 4P93A 4AO7A 3U0VA 1UXOA 3C6BA 1HLGA 4CIAA 4BAZA 1ZD4A 4GHWA 3I1YA 4LXIA 5AM2A 3D4LA 4FTWA 4BYMA 4PV7A 1L7AA 4K6KA 2D5LA 4Y2QA 4U2EA 3QYJA 4ITVA 4OU4A 2WSLA 4CCYA 4G9EA 3QMVA 4JNCA 3QPDA 5EHXA 2WHPA 3FYTA 2C0PA 1X70A 4H0CA 2DHCA 1N5RA 3IVMA 5AO9A 5FOQA 4RNCA 5ALLA 1ZJ4A 1XQYA 4PQEA 5IVDA 5FDFA 3D7RA 1IUNA 3C70A 4RGYA 2Z8ZA 1C4XA 2XT0A 1G42A 1ZICA 3EBLA 1LGYA 1UOOA 5IVHA 5FUMA 1JMYA 1Y7HA 2O7RA 2R8BA 1XZIA 3F9CA 2R11A 4DSZA 3M83A 1CVLA 2P8SA 2YH2A 4X94A 4DNPA 5LP1A 3WKBA 1VXOA 1BROA 3WZLA 4E11A 3EQ7A 4IQ4A 5ALGA 1YASA 4KE6A 3GROA 1DINA 4ZV9A 1A88A 1H23A 3M3DA 4BATA 3HRHA 2DFPA 5ALPA 1QTRA 5JIBA 3W2TA 3FSGA 2JIDA 5AOAA 4DM7A 5AKZA 2PKYX 2BCEA 1YS2X 2EDAA 3WIOA 1GZ7A 5A62A 4KE8A 3SK0A 2C7BA 3G9UA 4DMFA 2YYSA 3FOBA 3QMWA 4B85A 4ZWNA 1FFBA 1Y7IA 5KREA 1DQYA 2ZSIA 3WL6A 4Y2XA 2FUKA 1Q0ZA 5AKKA 1U65A 2VEOA 1HL7A 1NU6A 4UHDA 2WJ6A 3STUA 1PFQA 3ZV7A 4KE9A 5AP9A 1CUYA 2GBFA 4UBLA 1MTZA 1UOQA 3IB3A 2JBWA 1THGA 4KACA 1CUUA 5FKJA 4INZA 2UZ0A 4WFJA 4QDTA 2RGUA 5D7BA 1OCEA 4GWLA 3H18A 1JT2A 4G4GA 1XZAA 2YASA 1WB4A 1GPLA 1ODTC 3D3NA 4XWGA 3I2GA 1N8SA 2XUJA 4UBNA 4A16A 3HI4A 4OD0A 4U2CA 3ZLTA 5JARA 4OCZA 3BIWA 2QJWA 2AXEA 1TRHA 1QIGA 4J0HA 5HF8A 5E2IA 2Q0XA 4HRYA 1QIEA 4UUQA 5C7YA 4OYLA 4WFKA 2QM0A 1A8SA 3PDCA 2XMDA 1UZAA 1D07A 4H35A 2JGMA 4PSDA 4ZI5A 4ZV7A 2W6CX 3G0DA 2XQGA 1H2YA 4OSEA 3NWOA 1P0PA 1XRMA 5CH3A 1QJ4A 4Q34A 5DTIA 4FBMA 1CV2A 5JAOA 3I6YA 2XUGA 3DNMA 5EFZA 1QE3A 1WPRA 4JYPA 2XLBA 3O4HA 2RHTA 4H7DA 4BE9A 1YR2A 4XVCA 4QWMA 1G5FA 4EBBA 4I19A 4G1FA 3A6ZA 5IVKA 1CUWA 2XUQA 2B4KA 1IVYA 4WCVA 5FRDA 3H2IA 4Y2RA 5C8ZA 1KEZA 1AGYA 2HA7A 2J4FA 1Q0RA 1ZJ5A 2WJ3A 1B6GA 4KRXA 2K2QB 5ESRA 1CUAA 2AJBA 1LPOA 4N8DA 1O6GA 5JATA 1MAHA 2AJLI 1QIMA 3GUUA 5AIAA 5A6VA 5JZ9A 4UHCA 3WKEA 3BXPA 5CT4A 4WY5A 1DWQA 3BJMA 2DHDA 1QFSA 2HFKA 2NW6A 1DWPA 5C81A 3E0XA 2OGZA 2HM7A 2HA6A 1K4YA 2QUBA 1QIKA 4KR0A 3VVMA 3PFBA 5BOVA 3M81A 1BN6A 4Z49A 4JUIA 4BC1A 2GBCA 4L9AA 3PUHA 1ORVA 5H3HA 1K6EA 2CUTA 4UHFA 4K5QA 3FAKA 1UKAA 3STYA 2ZYRA 3FSGD 1XZFA 3AZQA 1DQZA 5CW2A 1ETHA 3CN9A 2I78A 1R1DA 2EEPA 1MJ5A 3HABA 5JAUA 2PX6A 4B81A 2JGIA 4G8CA 2OGSA 5CXUA 2HU5A 1XZEA 1CUHA 2XMGA 4QZVA 4TVKA 1ZI6A 1SCIA 1XZLA 4J0DA 2XUKA 3TJMA 1HQDA 5LKRA 3F8SA 3WIBA 5AI6A 3IULA 2PSFA 3FVRA 3BDIA 3NGMA 5JD6A 3D2BA 1EINA 3BWXA 3G7NA 3TRDA 5HF9A 1ZIXA 2XI4A 3I6MA 5AICA 2WIGA 4KAFA 4FFWA 2XQFA 3WJ2A 1E5TA 2OXEA 2Y2UA 5AKJA 4Y2YA 5SYNA 5AI8A 4P92A 4BDTA 1VXRA 5A7FA 1LBTA 1XRLA 5FXMA 3TGLA 3LLCA 3AILA 5LIPA 5DNWA 1FFEA 2QMQA 2HA5A 5JALA 1WOMA 1LPAB 1CUXA 3F67A 3W06A 5CT8A 5ALDA 1XLUA 3R41A 4B80A 4OYYA 2OQVA 4UFOA 1EVEA 4G4IA 4Y2JA 3K6KA 4DYHA 3AZPA 3O4JA 1LZLA 4I4CA 5C8XA 3HSSA 3WZMA 5AKIA 1HBJA 1IUOA 3WMRA 1GQSA 2C0QA 2I3ZA 1SCQA 5LKAA 2XMRA 4X90A 3C87A 4CG1A 4F5ZA 1E8MA 3ED1A 4J0CA 1VE6A 2QS9A 4FHZA 3GBSA 5JD5A 2XE4A 4BCBA 1IMJA 2WJ4A 3EQ8A 4C4ZA 4F60A 3H19A 5KWJA 1XZBA 1VOTA 5JD4A 4MEBA 2PSHA 1KU6A 3C6XA 5LZ9A 3E3AA 2FJPA 1CPYA 1T2NA 3VVLA 5FV4A 5EHZA 3C43A 2WILA 1LBSA 5E4YA 1S8OA 2WHPB 4M0MA 3YASA 3D2AA 2HU8A 1BEZA 1J2EA 5BV7A 3I1IA 4AB1A 3SX4A 2VJBA 3QMMA 5CT6A 1CUGA 1VA5A 1TK3A 1FJ2A 1I6WA 5AK5A 1UK7A 4NVRA 4NMWA 5LZ7A 3G9TA 3QPCA 1SFRA 3QM1A 1ORWA 4UHEA 1MO2A 4BDSA 4CIBA 3AIOA 4MEAA 1YB7A 3A2NA 1BCRA 3G0CA 1BS9A 3L1JA 4Y2SA 5ALZA 3ESDA 3QVMA 3KD2A 3BF7A 2VSQA 4BP9A 1K8QA 2XUHA 4Q05A 1W75A 1ZIYA 3HACA 2HRQA 1EK2A 4X00A 1CUZA 2XUPA 1CLEA 4XX1A 2OAGA 2GYWA 2DQZA 5JANA 2QRUA 4WDQA 2XLCA 2AJ8A 3G0BA 4J0GA 2I03A 3RM3A 1J07A 4G5XA 4X95A 3OOSA 1GKLA 3OURA 5AOBA 5AK4A 3L1HA 1DX6A 1CRLA 3FYUC 2WIJA 3JWEA 3OM8A 4RE6A 2PU5A 1UOPA 1MX1A 3WA7A 5ALTA 4PSCA 2WKWA 5CT5A 5LZ8A 4EY8A 1ODSA 3DYVA 4H7JA 2JGJA 3ESCA 2OPHA 4B82A 4GECA 3WWDA 4PW0A 5ALYA 4IO0A 1XQXA 5CTAA 3IIIA 3MUOA 4W1RA 3VXKA 3KWJA 4DNQA 4TGLA 5HK8A 1P0IA 5D3KA 1C7JA 2RIPA 4YPVA 4G8BA 3RK4A 1DWOA 2JGFA 3DJYA 3S2ZA 3FBWA 1T4MA 2PL5A 4BBZA 3K9BA 1XKLA 5A71A 1CUEA 3LS2A 1A8QA 5HKBA 3WK6A 1ZGBA 5FLKA 1MAAA 1QIIA 1IZ8A 5AM5A 2WHRA 1H22A 4OU5A 4UBKA 2PUHA 4C4YA 3PE6A 3H2GA 5K3BA 2WQZA 2WIKA 3BIXA 2Z5GA 3G8YA 2VF2A 1JKMA 3KDAA 1XZMA 3O4GA 3QH4A 4BZZA 1CUVA 2FJ0A 5I7UA 1YAHA 3I2JA 4UBOA 2HADA 3EIOA 3RLIA 2OGTA 4ROTA 2H7CA 2BAGA 2QKYA 4B84A 1ODCA 2VATA 5AHXA 2ROQA 2G5TA 2VJAA 1WB5A 1TKRA 3DYIA 4AZ0A 1JI3A 5C8VA 1XROA 2CEKA 3OC0A 4KAJA 5T4FA 1U4NA 5D6OA 1EVQA 3C5VA 4C6HA 5LLSA 3Q8WA 4W1SA 5HK9A 5JZBA 4HRXA 3R40A 4Y2UA 5EIAA 4L3WA 4Y7DA 3IUMA 3WWEA 1X2EA 6YASA 1EXWA 2GBIA 4J0JA 5CXXA 3RARA 2DHEA 4X91A 1RP1A 1EDDA 5CURA 2CBGA 4YK7A 4PO3X 2B61A 5IH7A 3V1LA 4LIPD 2VAVA 2QTBA 3T4UA 3PF9A 3ESBA 2ZJ7A 1O6FA 5KWIA 4Q3KA 2WIFA 4AN1A 1IZ7A 3KSRA 1ZGCA 3ESAA 4N8EA 1MNAA 2IITA 3C8DA 1RWQA 5ALWA 1H2ZA 4H7KA 3O9VA 4YASA 1TQHA 1R3DA 3IBTA 5ISMA 1WPXA 2PPLA 5CH8A 4IH1A 1ZD5A 2Y1KA 5AKGA 1LPMA 5E4JA 4ZREA 3FYUB 4HXFB 3WK5A 1UWCA 3I2IA 5AJHA 1CUSA 1XZCA 2VAXA 3LP5A 1XZJA 1JJBA 2HU7A 5EI5A 2WUDA 1F0NA 1MX9A 5JASA 4CI9A 1R88A 4N8SA 1DT5A 1JU4A 1AC5A 1E3QA 3WI7A 1UK6A 5AI5A 3PICA 3H04A 5E4TA 3W05A 2DR0A 4Y2VA 1DX4A 1JMKC 3LCRA 3C6ZA 3WA6A 4W1PA 5J3JA 2WM2A 2G5PA 4U2FA 3MVEA 4AXBA 1TCAA 3V1KA 1PJAA 1IUPA 4LKOA 5I9IA 2O2IA 4GW3A 1GQRA 1EDEA 1JJFA 4BE4A 5BWBA 1ACLA 1ZOIA 1LPPA 3HZOA 1BN7A 4WY8A 1QLWA 5EHQA 5DLPA 3BE8A 3OPMA 3STTA 5DTJA 1MN6A 3U1TA 2BUCA 3R3YA 4U2GA 3CXUA 1CUJA 3D0KA 4HVTA 3RKSA 4EY6A 1K63A 4FLFA 2VT7A 2ZSHA 1YB6A 1Z68A 5K5EA 3V48A 3G02A 1LLFA 1DTEA 3AIKA 4N5HX 1E89A 2BFNA 1EK1A 4V2IA 3D2CA 2PSDA 2AJCA 5AIBA 1R50A 2V96A 2PSJA 5JAPA 2V98A 2XUIA 3FNBA 3V1MA 4BCCA 1LPSA 1N5MA 2WFLA 4BVLA 4QDZA 2GYUA 1Q83A 4X92A 4BZWA 5K3EA 5EHNA 3H2HA 4RE5A 3PFCA 3I28A 4HTAA 4WJLA 5A7GA 2XMBA 2HFJA 2PBLA 3GZJA 1W4LA 3P2MA 4ARAA 3E4DA 5DNUA 1U8EA 4Y9SA 5SYMA 3WQHA
chains in the Genus database with same CATH superfamily
1KFKB 1UBGA 2H5IA 3ORHA 3W5CA 5A9TA 2RGXA 2WT4A 3VO2A 5A6SA 4BGUA 3S5JA 4B5LA 3QY0A 2VSFA 3RSHA 4MRVA 2QD3A 3EGVA 3AVUA 1TU4A 1XXLA 1F8YA 5CUQA 3T9AA 5MF6A 1U0OC 4YAFA 3QXCA 4EHIA 2O2XA 5CMLA 5TVGA 3UBMA 4E15A 3L1KA 3NRBA 2CCJA 2GN2A 3F5DA 4GLOA 2YDXA 3R9WA 1KVRA 1POWA 3RREA 4X63A 3O4IA 2ZJFA 3ZLUA 1NMEA 1CYDA 4RZHA 1SCUA 3KIPA 3V8RA 2WMYA 5JDIA 1BS2A 3O31A 1RPNA 4PS0A 4A0SA 3CGGA 4UC0A 5HFNA 1JR3A 4JROA 5F2NA 1WRBA 3JS5A 1JIUA 2P30A 1JQDA 2OCGA 1DKUA 2QJTA 2J3QA 3LECA 4I55F 4JVLA 1XPRA 1GNSA 1D1QA 4ZDIA 1EGHA 1ZRMA 3SU8A 2IIVA 3A4NA 5FB3A 4DMKA 4F21A 1E0SA 3ERCA 621PA 3U7EB 3ZHRA 1I4TD 3HCNA 4FFVA 4H15A 1JEYA 4YV7A 4KO8A 1IQ0A 2V7XA 2W8BB 2BGTA 3UANA 3ZGVA 4UTVA 4A0FA 3J81A 1LI5A 1BCRB 1ZM9A 4R68A 3ZJUA 5C4GB 1YQQA 5A5GA 3I04M 1LUAA 3K0EA 2UKDA 4LYEA 5AI0A 4A3SA 1T35A 1JEDA 2H1FA 4PVDA 2YV3A 4Y18A 2EARA 4Q16A 3GJRA 4BLWA 1TO1E 1ZGGA 2F90A 4QQKA 3BXHA 3GEGA 3VUFA 4CIVA 3HI6A 2ZI9A 4UOZA 1W36C 1P8JA 2ZSAA 3BXXA 3OX1A 3TR5A 1S7CA 3OU7A 3HWRA 2W2LD 1JTFA 3IV9A 3TSWA 2DB3A 3AK4A 5KOIA 4ICIA 4DWWA 3ZI7A 1TEZA 1UBNA 2FP4A 3CISA 1FSSA 1VZ2A 2ONCA 3H3JA 2CW5A 4FYJA 1FEZA 1RXCA 2HDOA 4G0YA 2QMEA 3LF2A 4RMJA 3RS0A 1ZI9A 4MB0A 3JYHA 5K3FA 3CZRA 4J3FA 3AL2A 5ICSA 1DTWA 3MA0A 4DUGA 8ABPA 3AP3A 5I9NA 5KWSA 4BNGA 2QZ9A 3NGXA 4GEGA 4ZQGA 3H5RA 2PT9A 1ZH8A 2WLTA 3PA6A 5G40A 3TNDA 1M67A 5GONA 1JQ3A 3DLTA 4Z54A 5HIIA 1II8A 1Q1QA 4URWR 2C58A 1V95A 2C3YA 2XUFA 1NLMA 5JS1A 3RWOA 2EYQA 3TTWA 5BWOA 1YGYA 2HF2A 5DKFA 3QKWA 3V33A 2B1IA 5DP2A 1KY2A 2BFMA 4K05A 3TEJA 1ACJA 3RS5A 4JI8B 1NYQA 4UXHA 3BB4A 1SXPA 4YI3A 4XM2A 1QOZA 3DZHA 2BM9A 2W2TA 1YBHA 3GIWA 4M0LA 4R8SA 3EC2A 1T0UA 4WZBB 4CYMA 1VG0B 2G88A 1X1RA 2IYUA 3AX6A 3CNLA 3SEAA 2D4AA 3LC0A 5CA1B 1QDUA 2QX6A 3DE1X 4B9AA 1CX9B 3U40A 1H2XA 1NN0A 1R8JA 2J9RA 4GP7A 2CT8A 2OBXA 3BDAA 4NCXA 3ZDXB 4WW0A 5DTRA 2WTNA 4JA0A 5K0JA 4G4SO 1BDJA 4B8ZA 5GINE 3RTEA 4B3BA 4E5SA 1Z5PA 2D1YA 1SCKA 5H83A 4QTYA 1A2OA 3Q9SA 4QVKA 2R8OA 2Q3FA 3TLGA 4LZJA 4EARA 4BN0A 4KOAA 2DR2A 4U0JA 4TV8A 5FPQA 2NV0A 1SUAA 3C45A 3AL3A 2PCJA 3PNSA 4LE2A 3SXUB 1V5IA 3BORA 5E1MA 3DD1A 1T4BA 3AR9A 3LWNA 1JXOA 2J3HA 4JOQA 1NI3A 1GO2A 3R5JA 4R81A 3QHAA 1XEXA 3K2QA 5D85A 5EPUA 3AOEA 1H8EA 5YASA 3V1YA 3H5LA 4CCSA 2IYAA 3TLJA 3QKSB 1QFYA 3NHSA 2QZPA 4ADSG 5H81A 4AYWA 4R7ZA 1QV9A 2DULA 3GV0A 3VPBA 4CM3A 1DC7A 5E3HA 5LN1A 4YREA 2A4KA 3M6IA 3RFUA 5L7YA 5IAOA 4MR8A 2QMYA 4GBED 4MJXA 1JHXA 5FPTA 4YMIA 5F1OA 1ZXBA 2GVDC 2CXHA 3H8WA 3I1FA 1E1QD 3ONDA 5AXAA 3RE1A 2PNJA 4C6TA 1XTKA 2OFOA 3AJAA 3I6IA 1D03A 4PM4A 4URVR 5I6DA 5KBYA 3OFKA 3TOZA 4C01A 2JAXA 3ZQUA 1L5HA 4ZN6A 2R7MA 3A1SA 9ABPA 2H1SA 3NJRA 3A31A 3MGCA 3OWXA 3TD9A 4JUBA 4MUAA 4XVRA 5AXBA 1QXSA 5JO9A 1XKTA 4LNUB 3WDSA 2Y27A 2QUHA 3NNSA 4JL5A 1P2SA 1GVNB 3T7CA 1MAVA 4I6JA 4EFKA 3LUHA 4JLKA 2VJNA 2A94A 2LE0A 4CMGA 1PVDA 5A4IS 4Z5XA 2F9LA 1NUPA 1VDMA 1C3LA 3EIHA 2PNFA 1V7PC 4CV2A 1NUUA 4RFLA 1VLQA 3UV7A 2Z8XA 4HBGA 3VHRA 1KORA 4HDCA 4Z2AA 1Z4PX 3FDIA 4XDZA 2C5AA 2H1IA 2X3UA 1ECCA 3FUUA 4LZAA 4QT4A 3Q7QA 3NHUA 4C4AA 5BSHA 4KEAA 5HE9A 4OQDA 2DMRA 2ZTVA 1RAAA 1PNVA 3DDWA 1DP4A 4J3NA 4Y0NA 1NW8A 1NW5A 1L9KA 2G5CA 3K96A 3VJRA 3DTYA 2YQ5A 1JR2A 5BRAA 3A9TA 3SC6A 521PA 3UMMA 4DANA 1QHEA 1T2AA 1C30B 4G1UC 3INYA 2GBLC 4GMDA 4KV9A 1TT5A 4L4UA 4UEKA 1YQDA 3ZH2A 1ZD2P 1GFWA 2OV2A 1F6WA 3RBAA 2Z1DA 4N76A 4F91B 4Z6KA 4ZO4A 2VBFA 2VT6A 4HQFA 4AO8A 1EUDB 1A8UA 2J09A 1K2VN 1ZH2A 1O87A 2VI5A 3C85A 4H6VA 2IU6A 2OCLA 3EFOA 3GGOA 1O0SA 4KAAA 3ZLVA 1O0BA 4TYMA 3EDMA 1M34A 4FDVA 4RKEA 4C22A 4O8ZA 3MGGA 1BDMA 3DMNA 1CUBA 5HMMA 3TFOA 1CVIA 3EUWA 4FJ0A 1J9ZA 2JHAA 2W83A 3SE0A 4DLRA 1I2CA 4F38A 4NZMA 5DW3A 1WE2A 2EP5A 2P40A 3KQPA 1TE2A 2P2SA 3CNQS 2HPAA 1R6DA 4YLGA 4YMVA 4YNBA 2D8AA 5A3QA 2ES4A 4DBLE 2IFTA 3JTMA 1TDJA 4F6LA 2IPNA 5CJ2A 2FEOA 4EIWA 3DZIA 4YDQA 4DRXB 2Q49A 6LDHA 3T95A 3EPJA 1E3JA 3F98A 3A2KA 5E7IA 1YQGA 3JZDA 1UODA 3GLGB 4MEJA 1A9QA 2OFXA 3HJNA 4GPAA 4BKMA 4DDVA 4KPGA 1TF2A 4E5NA 3DKPA 1E5XA 4RKQA 1GDHA 1QFXA 2DTXA 3JRXA 2XGSA 4Q4DA 4NYIR 3WK8A 4MDHA 2XODA 5AUOB 5IBCA 4IVRA 2OD7A 4AF7A 4RJTA 1WZNA 4PRLA 1N2IA 4MMXB 5ICMA 2XRFA 3FDJA 1B00A 3OOJA 2WHQA 4AT1A 2VVTA 5EPOA 2HRBA 2XOKA 3AONB 1MJHA 1PQPA 3D4BA 4MUFA 1CP2A 2IH2A 2M1XA 4KODA 4MVJP 4UDYX 2SBTA 2XMCA 4QFCA 4P33A 3DH0A 1S4QA 4JLUA 5FYDA 1UMBA 4ZXFA 4EG5A 1ZS9A 3TR6A 4GUAA 2G72A 3EXG1 2G4LA 3PQ2A 3UV6A 2Z3WA 1QF6A 1RVDA 1KRWA 2IELA 1ODLA 1YMVA 1KI6B 4QHTA 4RFVA 3ZIUA 3W2FA 1QDLB 1EFVA 3FWHA 2PUJA 5IUJC 3N8GA 3SICE 2QR5A 1WU7A 3OAAA 4G6ZA 2ZXFA 3I9V6 4KXUA 4Q4HB 1T0HB 4BFWA 5IKEA 3GRYA 2QU7A 4AC9A 3LNCA 2FW7A 4PCAA 4LJKA 4TSKA 4TSFA 1ZI8A 2OCXA 3ONVA 1RYYA 1HETA 3I9V1 1IEQA 3QLVC 3U3RA 1W36B 1YC5A 5T67A 4G36A 3GZNB 4MH0R 1BXZA 2ZT8A 3Q11A 1DUVG 1RC0A 4FFOA 4D6YA 3D7MA 3L6RA 1B6RA 1YZKA 2JD0A 4V0RA 3G23A 4XCQA 2GCIA 5JLAA 2Q3BA 1T24A 1CY7A 2YJ6A 5KX5B 2YYAA 3LP8A 3BHIA 1DT3A 4HNRA 4ZK2A 2HO4A 4BASA 2GAOA 5LJLA 1HF3A 2OGUA 3N39C 4BJHB 5KTSA 4JEIA 4GOND 3AXTA 1V9CA 1R3UA 2VQ3A 1QFJA 1IXKA 4WXEA 5ITZB 3L8HA 4DJFC 2BZ1A 1M2OB 2BDUA 3DPUA 1C4KA 3IIMA 4FLMA 2QVCA 3QITA 3B9RA 4NU5A 3TRFA 4EYEA 3R3JA 4D4IA 2VKQA 3HUFA 2ZPTX 3ZDYB 1YUBA 2VYQA 3DTTA 3E9DA 1ND6A 3HSYA 3TJZA 1AUOA 5EJEA 1NKTA 2FE1A 2NO5A 3N86A 2VQ6A 1BFUA 3L1IA 2Z08A 2Y8EA 2D00A 3OEWA 1K4KA 1QH0A 3AFMA 4IEFB 4L2IB 1GVHA 4M1QA 4BVHA 3GLIE 4TLLB 1VHDA 2RGRA 3N8KA 4Q3DA 2R6GA 3LIIA 4PLHA 2WF9A 4BLQA 4DLLA 3G1TA 1Q7EA 4NJMB 1C0IA 2Q6VA 3A36A 1DQSA 3AXSA 1P19A 2WPDA 2ZBGA 5CLLA 5TV2A 3LBAA 3OE1A 3A58B 4NE7A 4EMUA 1U0BB 3I64A 1HOXA 2QK4A 2M98A 4W5NA 3FUTA 3IGFA 3IDQA 4Q1BA 1C9EA 4QJIA 1E59A 1WCYA 1T2EA 1UF9A 2F3QA 3REOA 2FZ5A 4F9EA 1WOYA 3KYDA 4D8WA 3B89A 5AJTA 3H1BA 5BRNA 5IH3A 1CS0B 4TN1A 1UKEA 2YCBA 3KAPA 4QDJA 1XVIA 5IM5A 3NT2A 1K5HA 4OL9A 2Z2XA 5DM2A 4CM8A 1WCIB 4P3NA 5EZQA 3BA1A 3ETDA 3V5NA 4F6RB 3NX4A 4AJ4A 1J1ZA 2BJVA 2FR0A 3C3XA 4O4HB 5LNK6 3B60A 4JJIA 2OVFA 3FI0A 3M2PA 4HZGA 1PK9A 2FFBA 4J7AA 5G02A 5EUCA 3UUWA 3WO0A 4JU8A 3ZY6A 4EJ0A 2Z04A 1CZOA 3VJLA 5I3ZA 5LNK1 3IBCA 3EIQA 3KT6A 5BP7A 4JB0A 4C88A 1W34A 4K1LA 1H1DA 3VV2A 5E3IA 2NT3A 1GUBA 2HK7A 3RBZA 1TFUA 2ZSEA 9LDTA 4PRYA 2QORA 2QG9A 2ZBVA 4RVGA 2QSJA 2LV8A 4CG2A 3WAGA 3A1DA 2OAEA 5IS2A 2RGNC 4MV7A 2P75A 3UK0A 1SQGA 2C9CA 3EXEA 3FMVA 3N0TA 4FFNA 5ALSA 3BL5A 3CPJB 4AW9A 4EPVA 3HJAA 3U39A 1WHTA 3LLVA 4UEOA 4RHFA 3F3YA 4EUSA 2CNOA 1MCZA 3AEUB 3KYCA 4C05A 3MW8A 1HDRA 1QO9A 1FX1A 2WF8A 4KYIB 2Z8YA 3BJIC 4NQRA 1QYCA 1GT6A 3O1JC 4WECA 1XWFA 4REQA 1WDTA 2FDXA 2VP6A 5DHRA 3DB1A 1GCUA 3L7OA 3FLBA 5H59A 4AL4A 2YIMA 2Z2KA 4CM9A 2P90A 4WVLA 1YJQA 2H9YA 4AZ3A 2JCBA 4UVGA 4NBWA 1S1CA 5DX1A 2C3UA 3F1LA 1TB4A 1VE1A 2CVFA 2PX3A 3FETA 3GZTB 4K03A 3PQDA 5FF9A 5FV7A 1CR2A 1UPUA 3P9XA 5KC8A 7ABPA 1C7QA 1J0BA 2RHCA 3G0IA 4BMSA 1E4VA 3NOVA 3TMKA 1RTTA 3PIRA 2KLBA 2FK8A 4JH0A 2IZ6A 1X1TA 4ZANA 5C8YA 4BVKA 5BWMA 1KVQA 4JBLA 3DOHA 5GTDA 1K7SN 2JFQA 4DGQA 2UUAB 1SRRA 4E3WA 3VYWA 2QJRA 5K0GA 3OVMA 1JUDA 4CLDA 1BMTA 1OC2A 3ZLBA 2WWHA 3JD3A 3HFGA 3OIDA 1W47A 2Q9CA 4E2XA 2KX7A 3G7UA 4R51A 4UVIA 4BRSA 1VP3A 1S4MA 4N3NA 4XJVA 3IURA 3VAAA 4D4MA 4QBIA 1BGVA 1IB0A 3A2MA 4RENA 4DMMA 3RRFA 4JBHA 3I83A 3AUKA 4JB8A 4MV9A 3RF7A 1ZW6A 1IU9A 1KOLA 5IBRA 1CJSA 3T34A 3O26A 1T15A 2QG4A 4BAUA 4IUYA 2FE4A 2R4QA 1K5PA 4QXRA 4ZC8A 2QRGA 1GQFA 3Q3JB 1GZUA 4MS1B 3SG0A 2C2HA 2DQ4A 4HDSB 1W5EA 1N6RA 5TEWA 5JADA 1NXQA 1RQ7A 1XL1A 3FWZA 4AP6A 1XZHA 2HHJA 4QPDA 4MYHA 5KCMA 1FFSA 4L6IA 3SLKA 2HJWA 5CFMA 5M34A 2D59A 2NUPA 4DLAA 1H3FA 2VF5X 1ONSA 3H5NA 1M5RA 2VFAA 3KQHA 3WOVA 4QYIA 3HB4X 3AEYA 2YZMA 2NYVA 4DS3A 3UFBA 1SHTX 2FEKA 2JFZA 2PR7A 2BFFA 2VKTA 2ALJA 4OHXA 4Z7NB 4XJTA 4QSMA 5FOXA 1NC1A 3W9UA 4NHOA 2NU8B 1FFWA 2ZSKA 3JQPA 1O94C 1IIBA 3S8YA 1EPUA 1XC7A 4L57A 1XDUA 2DCMA 4FEAA 2Q4TA 3WYNA 3WGHA 3CF2A 1NWCA 1RCUA 2JA2A 2PY6A 3A3YA 4BC0A 1DADA 4MCAA 4ZYZA 2ZJ2A 4C4XA 3C1AA 2H48A 3HEAA 1N2JA 1KARA 3A37A 1F6BA 5CFOA 3W3AA 3CLTD 1MPTA 3OIWA 3X3HA 3CV3A 4RADA 2Y0EA 1U2EA 1YHYA 2JGDA 4RHTA 4ZVLA 5K8IA 2ZFUA 2VXBA 4F85A 4PPQA 2QPOA 1QNLA 3O91A 4JKOA 4LHWA 3PPYA 3MERA 5IP5A 3ZGZA 2QVGA 1A7UA 3LXXA 4F4UA 4EELA 4CKCA 1TJ3A 3IMEA 1JAXA 1SZCA 1GTMA 4B3DA 4G9GA 4IDBA 2AD5A 5JCJA 3GLTA 2Q6IA 4PTZA 1GITA 4RJKA 1AK9A 4JXJA 4FNGA 5JROA 4KR3A 1Y6RA 2C00A 2JCXA 1G5RA 4KSCA 5EZYA 1F4PA 1UFOA 5CGQB 3F6EX 1DBVO 2W2VA 4H1TA 4HDNB 4HQKA 4V0SA 3QVGB 3PC8A 1X9IA 1NVTA 1VIVA 2GRJA 4IVQA 3RASA 4EHDA 4JYMA 1GARA 2QN9A 3D7NA 5F51A 4B34A 3RC7A 4PPGA 4HF7A 2QMOA 2OHXA 4D4JA 3IDSA 4X6LA 4YRCA 3WK7A 4J1TA 4RPCA 2IHZA 2Y1DA 4DDKA 1EVLA 4DLYA 1WUKS 5EMKA 1IXZA 4X5OA 3A1FA 4OXIA 2G4VA 3ZOKA 1XJ5A 2VPWA 2WWTA 2BFAA 3C7AA 4G24A 1KMHB 1BXGB 4Q3CA 3ITKA 3LCMA 4EX6A 5IM4F 2W6JD 5I45A 3M1AA 3CZ5A 3DM5A 4KLRA 3F7OA 3SJCA 1MIHA 1RCTE 4J94A 1CSEE 3IJPA 1TA0A 2IK8A 3P2IA 3AY3A 2WG1A 2Q8QA 3JATA 3KSDO 1NTOA 1CBUA 4GP9A 3BZBA 1QGUA 4IOMA 1PIWA 2ZP1A 1QV6A 3Q5GA 4IIBA 3V7FA 3UAVA 2O59A 2XD4A 4KQXA 1PJTA 3IR7A 5T4HA 5E3JA 1WXGA 3G1UA 2WT8A 2XCSB 2JZCA 4A2CA 3IHKA 3HA2A 4PO1A 1JNXX 1CR6A 2O1SA 2QE7D 3GVHA 3INRA 2OG1A 1G8JA 1NJ6A 5FOWA 3RC8A 2O8VA 4JGGA 5CFLA 2FWAA 3KDPA 3SE7A 4QNRA 1JG1A 5HM8A 1F2UA 4BUZA 1YI8A 2HJGA 2ZTMA 4R98A 1B76A 3U5ZB 4CE6A 3G5UA 3S1LA 1JLRA 3F0TA 4GX0A 2ZM5A 2RGWA 4DIOA 1VM6A 2OECA 4X7PA 4O3MA 4H3HB 3IR6A 4KUHA 3K31A 3WGMA 1EJ6A 5A4KA 1WX1A 3QX9A 1BZYA 1GT91 2Q9UA 4FSDA 4EHBA 1IBRA 2BEUA 2Z2IA 2NPFA 2FSSA 2XYRA 3M1LA 2AMVA 4LMRA 4PGGA 2GAFA 4ND6A 4UNIA 5HFJA 3DBLA 3CUTA 3VPGA 4MIKA 3QE9Y 3HU3A 1YO6A 1LLCA 4AG5A 2P27A 3R6GA 2R6CA 4MLPA 5CNJA 4RMGA 5U1PA 3HUTA 1KO1A 1LBEA 1OAAA 3PDWA 2BMAA 4FNAA 3W6OA 3GRPA 3R3ZA 2VRCD 3S5UA 1SOAA 4MKXA 4MPTA 4XOIA 4D9MA 3N58A 2IIQA 1O96A 1DAHA 2J0VA 5ALQA 5T7BA 4Z4EA 2V59A 3SYKA 4RKFA 4RKWA 3K0FA 4IG4A 4DJTA 1RC1A 4LC1A 3BE5A 2VXYA 5BNZA 2SECE 2IEIA 1EQUA 2IZ7A 3SKVA 5KTOA 2AN9A 4PYIA 2WUFA 5DP1A 3RVPA 1NT4A 3KUDA 1OB2A 4YJ3B 4B2IA 4DG5A 4RIGA 3K70C 2XZDA 3FNIA 3NYWA 1KJJA 3QKRB 4R2LA 4XCVA 5IT4A 4R3NA 5MGNA 4FC6A 1G21E 1SPXA 4CDRA 1S1MA 2G8NA 1YQTA 2GF2A 2HA3A 2YN2A 4L4RA 3TBFA 5JVDB 3ZX4A 4F2WA 3UAOA 1W9HA 4LE1A 4S24A 1F60A 2ZRAA 3DLBA 1JU9A 4CFYA 1P1BA 2OKGA 4LCEA 4ZAWA 2C8JA 4QUBA 3Q0TA 4MAMA 4PX2A 4RQBA 5DGDA 5FI1B 2CFCA 3BGOS 3QJGA 4YQYA 1U8YA 2Q27A 3TUJC 4YRKA 3ORYA 3COJA 3ULKA 1SUIA 1GZHB 3HLTA 4HDRB 1QFMA 3QE2A 4NBRA 3WXMA 5ALJA 4NENB 5AJUA 5DHSA 3S68A 4IRXA 3ICVA 1JSCA 3RU2A 4OLJA 2P2ZA 3EJWA 1H05A 3TLMA 5K0SA 2YJTD 2X8LA 4LRQA 4HQ0A 5H80A 3U7IA 3TPZA 2ZRIA 3IT3A 4LBVA 3GA7A 3RVBA 3D3WA 5LB2A 5JAZA 4MQEB 3BKWA 2MMCA 1D8AA 1QANA 3DBHA 4TRJA 5E8RA 1JHPA 4KWCA 4QGGA 4R6XA 4CTMA 3D4NA 3ENZA 2HR1A 4LBZA 4II2A 2ZIXB 5DI3B 6CHYA 1SXGA 2JAHA 1JWBB 3NASA 2VAWA 3DMFA 2HJ9A 4O8CA 1Y7LA 1XDGA 1EB9A 2H5LA 4QUAA 1Z0FA 4RIEA 3TS1A 4HVLA 1L5YA 2WSIA 3OIVA 4REMA 3ZHSA 3FUCA 5EP2A 1V39A 2C2OA 4CDMA 3WBFA 4Q1FA 4UE6A 3TQIA 4KN6A 4BO0A 3X1XA 2RCYA 2B2CA 2XWQA 1KEEA 4ZYTA 4NAHA 1OIVA 1NTRA 3AL0C 3GRVA 2J0EA 1CZUA 1YS4A 3VNVA 1ADBA 2YHBA 5EVCA 1RJ9B 3WG9A 3OX3A 3DXXA 1A8HA 2XUAA 4L9WA 3OKCA 3GGSA 4BO5A 1JSRA 1UBTS 2RAFA 3N2KA 4D6PA 1CUCA 4MRRA 2HEGA 4MV1A 5I48A 3OMLA 2PFSA 3C3DA 2I1VB 5AK6A 4ZEMA 3ITDA 5MHTA 2C97A 1KZ4A 5TIIA 3E2IA 1SCAA 3JARB 3LWZA 3JV7A 5KVSA 1M7BA 4R05A 1UADA 3LPDA 1QQTA 1U9IA 4X41A 2CDBA 3IUJA 4LQDA 4P7BA 2GXQA 1TGVA 1U3WA 2BJHA 2GB4A 2Y0DA 2QD1A 3OLXA 4LJ8A 5HZGA 3QFHA 5EN4A 1N2CE 4B8YA 4XVUA 2RHGB 3FCXA 4RHUA 5E1BA 2IW1A 3C5CA 5BV0A 5JZSA 2VCHA 3P2EA 4WOCA 3UMCA 5K0ZA 4GUDA 1QRTA 4JLAA 4JSRA 5IW8A 2OUKA 5HS4A 1FP2A 3R3WA 4ZVRA 4H1WA 3LGAA 2AZMA 1I6MA 4LJLA 3WLOA 1X19A 3SC2A 3EEOA 3QX3A 1SCBA 3OFSA 3VDQA 1EYZA 1AKYA 1LPBB 3TKYA 2OV4A 4TS1A 3WLRA 4PZ0A 2PXXA 4Z0PA 1RVV1 2H0RA 4Y6PA 3T1OA 3NBFA 2YWGA 4B71A 5AYVA 1TM1E 3GLFB 2W93A 3DGFC 2C9YA 3I8OA 2IHKA 2WYVA 5AJWA 1ISJA 4PPNA 2P9HA 3V2IA 1HG0A 3LLSA 1AB5A 2WC1A 4GWGA 4IFTA 4KMMA 1NRWA 1P17A 2G9RA 3OBIA 4IYRA 4QEZA 3VZQA 2JLYA 1LDYA 3GHHA 2EATA 4IAOA 4MDYA 4QU5A 2HXYA 2OSVA 4WEOA 3EIEA 5KQMA 3UENA 2CHEA 2WFZA 5KKAA 5TMBA 1LW6E 4FHEA 1TIPA 4BJ6A 5LMCA 4O4LB 4JJZA 2DEUA 2VWQA 1AXGA 1NVVR 4DILA 3BL8A 5KNDA 3SS8A 2F43A 2QR3A 5KI6A 3UHOA 1CIPA 2O3SA 5BWNA 1O08A 2I55A 2QM3A 1PAUA 2X14A 3QU5A 1G9TA 1NXWA 5DZSA 2Z4TA 2Q0QA 4EJFA 3CKKA 3CF4A 4MAAA 1Z63A 2A0WA 4AY2A 3FHJA 1MIOA 4QUKA 4ZQBA 4ETNA 3LBFA 2ZIZA 4L75A 1T5SA 1QU3A 1HT2E 4HWGA 4G4JA 4Q9NA 1IAVA 1L5NA 3K30A 4GR5A 4GRIA 1UC4B 1ULHA 3K72B 4M1MA 5L3SA 5KSWB 1K8RA 4JYBA 5E7MA 1ISPA 5HF6A 4ZGBA 2V5AA 2JFXA 3BEDA 2IDKA 5BO5A 4WINA 1P4AA 3IP5A 5IZCC 1OGIA 3WV4A 3SMQA 4PZUA 1V9SA 1QIJA 3MQ4A 5HKKD 2PQMA 2YX1A 1PBTA 2X9VA 3QXJA 1EK6A 3D0OA 1P4GA 2DT8A 1GZ4A 3IVRA 4G8JA 1P3JA 1NQOA 4UFPA 3UHFA 1VYUA 3VHXA 1LRLA 1DTSA 1Q2UA 2OMEA 2YXDA 4D74A 5HIMA 1I9CA 3B3AA 4FILA 1TCCA 1T4CB 4FYYA 1F14A 4F3CA 3MD9A 2EFYA 4JVNA 3RFTA 4ZP1A 3S4YA 4CF6A 4XFDA 2O3JA 4ER6A 5IK2D 2ZSBA 4DXHA 4OI0A 3EXAA 3O2SB 4FYXA 2R00C 3JPWA 1TX4B 3LCJA 4CDGA 3JW8A 3U13A 5I3CA 3TOCA 3PU6A 3M9WA 2HT1A 2FI1A 3X1JA 3I72A 2BMDA 2UYQA 3BQMB 1JDSA 1HDEA 1ZN2A 4N5DA 4DSNA 4HB0A 2I7VA 4QATA 2I5PO 1BX1A 3QJ5A 2Q4BA 4JAVC 4MTCA 1UINA 4YUVA 3GJZA 1W5TA 4E4TA 5EA2A 4MRAA 2X0EA 1XYYA 1YI1A 2EDCA 4OKNA 3IA2A 3A3OA 5CEFA 3LHFA 3ZV6A 1SQ0A 2X5KO 1AKRA 3PUXA 5FBZA 3KJGA 1THMA 2VBGA 5DMXA 2ZJAA 1EFPA 1XRQA 3DW1X 4K6HA 3VKWA 2ZREA 2VDJA 2OVBA 3GYBA 2WKSA 4M8NE 3FOFC 4KU4A 3HLKA 4G5OA 1A9TA 3KQYA 4MWSA 4ENRA 4RQTA 1XAHA 3HVKA 1A7AA 2B8TA 2I0FA 1IXSB 4MWCA 4OXRA 4N3AA 1ONBA 2BGLA 3L6BA 4BNWA 5REQA 2A9KA 3OPYI 4UZEA 2DKFA 5AKEA 3EMBA 2F3RA 4QBTA 2FW1A 4W6ZA 1U3VA 3K70B 3M1YA 1OHHA 4YP7A 2LW7A 1PR2A 3HFRA 3M3PA 2ZB2A 2B35A 1ZKMA 2C8KA 1U81A 3DLPX 2G8LA 3ETCA 3HS3A 3CKLA 3HO6A 3L9XA 3X43A 2KB0A 4EW1A 1W88B 1JFRA 2B5VA 1IVSA 5A2GA 3TLKA 3O9MA 4J7UA 1UXJA 4RFSB 5DM0A 5JQGA 1P80A 1E2FA 5IG2A 1VIDA 3GP5A 1VCNA 2D0OB 4UBIA 4H7FA 3EFEA 4URUR 4CKBB 2W8ZA 1A2QA 2FAXA 4RZSA 4UD2A 1SUWA 2HQOA 2ZWMA 1EVKA 2ZBDA 1J7JA 1KKLA 3LCUA 3L8GA 4KRFA 4RETA 2A8YA 3CH4B 4FI3C 4BVBA 3HDQA 4C7XA 3UJNA 4WLFA 3DOCA 3EW7A 4ZVSA 1OBFO 5BMVB 2X58A 1I7SB 3MWDB 1AUVA 4ETIA 1A04A 3PHGA 3OPYB 2PS1A 4P6VF 4PV7A 3KB8A 1KWKA 4ZVTA 4I50B 2XVXA 2NO1A 4C0WA 1E3IA 2GTHA 3EDRA 3F2IA 2C03A 4Y1RA 1ZD8A 3A06A 3HP4A 2IDJA 5TE9A 5IXYA 4OU4A 1FRQA 3HB1A 1RRVA 5KOYA 1I14A 3QI2A 3E15A 5KTRA 3T9DA 2QAJA 3KL4A 3KM0A 3L7DA 4G9EA 4BQRA 1Q3TA 3QMVA 1Y8QB 2P2NA 4QTZA 4JNCA 2NYUA 4LZLA 1JKIA 5JSHA 1WHSB 1QVVA 5KDDA 1Q0LA 1U7HA 3C4JA 3GLIA 1QBGA 4WOPA 3I45A 4EH1A 2C0PA 4H0CA 4M6WB 2DHCA 1FJXA 2XDAA 4C4TA 2EAUA 2CL0X 5DLQC 4KO1S 4EHFA 3A1NA 4GOMD 4V3CA 3MRVA 4X7RA 3VDNB 1U80A 2I2CA 4Z3DA 3HEBA 3GFGA 5B3JA 1G6OA 4NDZA 4WLOA 2HK6A 2ATEA 2L18A 2HK9A 5F1YA 3CJRA 1TEXA 3HVHA 5K6AA 1IUNA 3C70A 1XBTA 2C82A 3Q12A 5CX4A 5KWEA 3IQHX 1KY3A 3CPHA 3EGXB 4FGJA 2Z8ZA 3AKEA 1DDIA 3IQDB 4OQNA 1C4XA 4UCQA 3ZHXA 4EGSA 2R6HA 4HB2A 2RBEA 3P0EA 4HMPA 4EFMA 5CB0A 1PE0A 5CCEA 2EJTA 3B52X 4ZHQB 1A72A 2WJHA 3MS7A 5FUMA 1BMDA 3A0RB 3E7WA 2K5UA 1TO2E 2VPYA 3I42A 1P2FA 3BWEA 2PT7A 1W59A 3N0XA 2CE2X 2ZYAA 4IDHA 3EY9A 5AVWA 2PZAA 5AVXA 2O7RA 4HLUA 4L9SA 1W96A 2Z8YM 3F9CA 3ORQA 4L8GA 4P4NA 2FF5A 1G3UA 5HJ5A 1F4LA 2QV0A 1Z08A 3CEHA 4WZBE 2PUTA 4QQFA 4DXAA 4XSHA 5AVOA 3LC2O 2ZI5A 3T3DA 4DBVO 4F9TA 2CHFA 4BNDB 2GN1A 1E6CA 3ABIA 5K09A 4JWTA 3O73A 3T9FA 1W1WA 2MDTA 3MJHA 4UVDA 4DB4A 2P6UA 3T9EA 2NXWA 2IHBA 4IUDS 2FRXA 1YE5A 1DX9A 4CKEB 1KFBB 1VXOA 3AVQA 2OHHA 5K3SA 2VTEA 1M73E 4O1MA 3EQ7A 3TE7A 4B33A 1PFUA 4DDUA 4EVRA 1ODFA 1Z12A 4WADA 3OFNA 4Q24A 4CMIB 1VLMA 1H23A 4F1JA 2OHFA 1ES9A 1SQFA 4DTIA 3M3DA 4BATA 1B74A 1YQUA 3NHLA 4C3OB 4TZ6A 1X8KA 1PS0A 3W8FA 4RSGA 1GPAA 1HT1E 1MUUA 1LWNA 4RORA 3KOZA 5HVNA 1TYAE 1I4OA 3B53X 3PQ4A 4H0FA 1Q1EA 3FSGA 1XVTA 2PLAA 2LPMA 1MOQA 1X1DA 3BK2A 3FMOB 2GCOB 7REQA 1IJFA 5BN5A 1ENYA 3RAJA 1P9OA 1XZQA 1NBMA 1ZL0A 4XLTA 1GAXA 4NDAA 4OLFA 1H0RA 1W5FA 5FBHA 4H3SA 1GZ7A 3R6DA 3WIOA 1U7DA 2YJGA 4KE8A 5A62A 4BPBA 1WO8A 3SK0A 4EYGA 2IQ5A 1QO0D 2XZTA 1RYZA 4FGZA 3ZV4A 2YZ2A 5HUQA 4C7OA 2P4EA 3G9UA 1FDSA 3EH2A 4DMFA 1EFRD 1FQJA 4M9ZA 4RQUA 4CLHA 1WAMA 2GESA 4Z1MA 1QSGA 1HORA 1C1HA 4J0EA 3DGEC 5IYZB 4X64B 3JZAA 2I29A 3Q7PA 4I8IA 4MVJD 3JAMA 2YBEA 4V0LA 4BZQA 1E77A 4ENQA 1TVKB 1NAIA 2B1QA 4INJA 3S70A 5MDHA 5LR6A 3WL6A 1T9GS 2I4OA 4RH0A 2PGOA 2ZWVA 5AW0A 1Q0ZA 1TKBA 4C4RA 1RAEA 1QB7A 2DQKA 1SC6A 4B46A 4CL0A 1JLMA 4GEKA 1T36A 3KVNA 3T7TA 4LHYA 1V3QE 1X80A 2FYTA 3CQ9A 3U6KA 1UZMA 1YHNA 2WJ6A 2ZVPX 2MSKA 3D02A 3KEOA 5ECDA 2V58A 3RRMA 4FZ5A 2ZXEA 1NUSA 2PGNA 3P2OA 3L8ZA 4P53A 4JUFA 4UBLA 4KK3A 1Z9BA 3RAGA 3ROEA 1AS3A 1Z0DA 1NVWQ 1UOQA 1K5DA 2WK1A 1SVOA 2HUPA 5H9VA 3OEHA 4LYGA 4A8JA 1THGA 4KACA 1CUUA 3LHSA 2HF9A 4JFRA 3FPCA 5GJCA 1NIJA 1IZYA 3SX0A 3U17A 3DFMA 4Q7LA 3B20A 3U4MA 2ZIAA 1M8JA 5ADVA 2FUCA 2RGUA 1JVNA 4KYUA 2HXGA 2HTEA 2QYSA 4YAKA 3WVNA 4BZXA 1V4NA 4GWLA 3EXIB 1NDHA 4R9RA 4RC9A 4CU5A 4KTTE 4UPVA 3VKVA 3LRXA 2Z4SA 4JVSB 1G2QA 3QVUA 5H0IA 1ODTC 4RDCA 1EWRA 4TS9A 3CVYA 5EIWA 1M75A 3BH0A 2P6PA 4JEHA 1A9ZA 3DVSX 3PP8A 3TM4A 3OF5A 3UJ7A 2V6FA 1D4ZA 1JTVA 1EP1B 1WKCA 1Y6JA 2OTCA 2P7IA 2VZ9A 3PDHA 3P9RA 4O4IF 5KTMA 1E4EB 4U2CA 4CMAA 3S29A 3ZLTA 2VOJA 3W0LB 1E99A 4GQBA 3TZQA 4W5OA 4MHTA 1ZMOA 5HRUA 4S1PA 3W6PA 4O5OA 2IVFA 2XXBA 3LYAA 1Q16A 3DR3A 4L7VA 3KR0A 3TCXB 1UM9B 3VPSA 4EG1A 1QG0A 4NOKA 2YMQA 5HIKA 1NNEA 1BCSB 1L4HA 3GLGE 5KWVA 1IEVA 2JRLA 5TT1A 1QGZA 4J0HA 3B7GA 5KU7A 1E62A 2VYNA 5E2IA 3ANXA 3DPSA 3IAUA 4JP8A 4BGDA 4WNCA 5C1IA 1J2TA 3E9ZA 5U9CA 1SCJA 4QQRA 3DE3X 5TMPA 3HVRA 1KZHA 5BOSB 1NLYA 2AUTA 2WVAA 2XYPA 2YWEA 5KAMA 5KTPA 1OFGA 4GBMA 5FI3A 1M5TA 4Z0NA 4LRTB 4CUKA 2X1MA 1Y4UA 2Q5JA 1V96A 2HX1A 4JXXA 3FMPB 4ZXPA 2RH8A 3ESRA 4EYQA 1H2FA 3U7QA 4UNQA 3SR0A 1XU9A 4G0VA 2MHCA 4B17A 3NWOA 4S12A 1Y8CA 1P7VA 3FPLA 2AZXA 1P0PA 3ZXYA 4LC9A 2WYHA 4PYRA 4O1HA 4BLUA 2R62A 4JBYA 1OX5A 2PKXA 4QUDA 3E1KA 5DW0A 5E0OA 5ICFA 3OI7A 4LJ5A 1VECA 1CV2A 3GJ5A 3VTFA 4BKRA 3PLAE 1AV7A 4YPFA 5CX1B 3HCRA 5KYGA 4DR7B 3B2NA 4QYSA 2ZTLA 4C43A 5AESA 3ICEA 1QE3A 1YCFA 5LOVA 4V2UA 5K0NA 4JFAA 1AQNA 2RHTA 5LU9A 4BE9A 5FH9A 4YRSA 1XNQB 2O3RA 1JBEA 2Y1OA 2RI0A 1G98A 1U8XX 3LBIA 1ZSNA 4KXLA 1J9EA 3ZXIA 3ZHVA 3P9ZA 3SYMA 2FWNA 2F4NA 4G1FA 4UTZA 1RWNA 4D9IA 1GA1A 4IDOA 3HYCA 4KBFA 2I6XA 4TTPA 2FU5C 2B4KA 3IT0A 1CW2B 1IVYA 1N3IA 3ASZA 5FRDA 3ASUA 4C1NA 1HUQA 5C8ZA 1S6YA 1KEZA 5HXAA 1FL9A 4TQGA 3AEQB 4WJKB 5EJIA 2OSBA 2J4FA 1R0WA 1Q0RA 1NP7A 4HQRA 4B3XA 2Q4EA 3KUXA 4FFMA 4JS0A 5CG1A 5A4AA 4KNYA 4KRXA 1CY2A 3OA2A 3AM1A 2HTFA 2PJDA 4FP9A 5LQRA 2Y1GA 3DLCA 4UNPA 2K2QB 4ENWA 5ESRA 2CJWB 5ERYA 3MHTA 4AZSA 2O4CA 1PWZA 5CPFA 4E03A 1FUUA 2K87A 1PDWA 4EENA 1GNPA 3BIOA 5DX0A 3HXOA 3HGMA 2K2WA 3RD5A 3SVZA 5JATA 3I0ZA 1MAHA 3KT8A 2AJLI 1A1VA 1SBHA 1T2VA 2IC5A 4XWWA 3JQQA 4YCLA 4KREA 1TYBE 1DRKA 3I1JA 4BQNA 4IYJA 3S3TA 2XOXA 1ZUWA 2CXOA 5TF4A 3SYRA 1MV8A 3GEEA 3U16A 3KZVA 4B3SB 4Q7JB 1U9CA 2EHJA 2PWBA 3BXPA 4KB5A 4BNZA 1U2TA 2G40A 1O1YA 1C0KA 3OZEA 1JHQA 1OAOC 1VMEA 2NW6A 3L7YA 4JC0A 4BMXA 2E6KA 5KOJB 3G85A 2ZIFA 1WQ1R 2EGHA 2OGZA 3BVPA 2HA6A 4OHPA 2D2IA 3FJ1A 3NIFB 1KY4A 1SOUA 3PFBA 3SHFA 3O5AA 5JWRA 4HMQA 4BQFA 1BN6A 1TIKA 4EM6A 3PUYA 1XN1A 4E5MA 1YWGO 4G0WA 1M6NA 2PLWA 3T5CA 1XZNA 2NVUA 2A59A 4BC1A 4E88A 1Y6ZA 3DMDA 5D6NA 3VC3A 5C1PA 4BV3A 1R8QA 4UU0A 2NTYC 4WOBA 3SQNA 3HJRA 1E58A 4D44A 3R9IA 2FPLA 2GPSA 1YULA 2RJ3A 4UHFA 4K5QA 2ZCJA 4P34A 1JRLA 1UXGA 1TM4E 5DX8A 1ENZA 1I0LA 3VYTB 2QVXX 3FYDA 1DQZA 2PBZA 2IA5A 3AI1A 1ETHA 3CN9A 4YMSA 2H1WA 5FBVB 2CNDA 3FNFA 1EJ0A 1MJ5A 5CB8A 5CB4F 1U3CA 5DVZA 5JAUA 2ZETA 1B8VA 1T0BA 2JKZA 3UWDA 3G13A 1FU7A 1BVUA 1YBAA 1UEIA 2ILTA 2OBMA 3W90A 5IX8A 4IHJB 2BI7A 5CIYA 2XMGA 3HKEA 2VDPB 1USVA 5EINA 1D7OA 3VR0A 2F00A 1TKCA 3DUFB 1MF7A 4M0CA 1HL3A 2GUGA 4B6RA 1BW9A 1U04A 2J5QA 1D3AA 4HYTA 4L4SA 5SZHB 2G1UA 1WBBA 4M60A 2JEOA 1ZNQO 1ZK4A 1QRAA 2CXQA 3EWNA 1FDVA 3K92A 1KR5A 2QRNA 4I99A 5LQSA 3T1YB 3BH6A 1RWVA 1TT7A 4RVUA 3IULA 5ENDA 1JKXA 2QUKA 3ECAA 1OYWA 1R8SA 3FVRA 1J0XO 2GCNA 4KXXA 1A77A 1DAKA 1SC1A 2AYXA 4Z4CA 4IIGA 3M6FA 1GILA 3GRRA 2A57A 3K1AA 4EB8A 1E1KA 3DEZA 4Y6OA 3AVWA 4PSVA 1E2KA 1JIKA 1WEKA 5K2OA 1JPJA 3ZTTA 1TFRA 5C7IO 4ASUA 4EB6A 5HF9A 2XI4A 4B2YA 3FGNA 4W5TA 4FCWA 2XB4A 3OF3A 2WIGA 3FPJA 3QENA 3NVAA 2EFEB 1N2CA 4P58A 4PWYA 3QW2A 4FFWA 4NFSA 1Y7PA 4QU9A 3QG5A 1I1NA 1P7PA 3U49A 1E5TA 2JBAB 3COPA 1TECE 4QBHA 4JV5B 5HRCA 2YKGA 2Y2UA 2C0CA 3LPCA 1EHIA 4E6EA 3KYIB 3ZGNA 3ILVA 4ACBA 1U2QA 4IIHA 3HCDA 1M76A 2ZB3A 1JFTA 2JD2A 1IN1A 5F33A 4YEDA 7AT1A 2X9NA 3ESZA 3N7AA 1XRLA 1ZK0A 2DJ5A 1DXHA 3ADOA 4MPPA 4TMFA 1AY0A 3BL6A 3OCCA 4XEHA 1DFIA 1N3LA 2O2EA 3A6DA 3AILA 4N6GA 5BNFA 1MENA 4UMEA 4JI6B 4AF6A 5LIPA 3IODA 3DCJA 3JCZA 5FJIA 5FWDA 1WOMA 3T35A 2ZS7A 2MSLA 3KR1A 5JALA 4PEVA 2EQAA 1CUXA 3OHSX 2CVOA 3F67A 2NU7B 3PVCA 2WSSD 4BIIA 3LD9A 1R0RE 4ZODA 5A5DA 4RZUA 2GAJA 5ALDA 1DG1G 4NEGA 5IC4A 2CXRA 4C2UA 2WDZA 2FPPB 1UJMA 5A1JA 5LFAA 2VWPA 1OZAA 1U5AA 4K6CA 1QMPA 2PEYA 3OCVA 4UFOA 5CFRA 2HSZA 3LQ1A 5DMHA 3DHNA 4BEVA 2XSZD 5JYDA 3R24A 2R87A 4Y2JA 3LP6A 1I2AA 1ZCAA 2I6UA 2E18A 1MV5A 3RVOA 3TL2A 4B40A 4RK0A 5AKIA 1GRQA 1EAYA 3C4QA 2ZOSA 4R2WA 1SG9A 4HZIA 3HE3A 3HFJA 1V1MB 3AHHA 1QYRA 3AR5A 1GQSA 2I2AA 2QGNA 3NHBA 4EUHA 1UAAA 2PGDA 3E58A 1SCQA 4BZPA 4OHKA 2VJPA 4XH9B 4R1UA 1EMDA 2J3KA 2XMRA 2AG5A 4EYKA 2OCBA 1T13A 3C87A 5E9JA 1M74A 1KFCB 3ZC3A 4F5ZA 1E8MA 3R0XA 2ST1A 1B3BA 2MSCB 2QS9A 4FXOA 2ORVA 1TUBB 3K4PA 1GQOA 3B1KA 2V0GA 1IMJA 2JATA 2XCQA 3UTCA 3HWSA 1Y3HA 3EXHC 3LZCA 3RAFC 5HPYB 2CXXA 3TAHA 3DAGA 2Z57A 3W5JA 3O8OB 2G7ZA 4TUYB 3DLAA 1DG9A 2HZBA 1T9GR 5J2UA 1P75A 2A9FA 3LDGA 2IYPA 1ZOPA 3ET5A 3EGDB 1LVGA 1U90A 4L74A 2ZRMA 5K1ZA 5JD4A 2V54A 2OPBA 4IRMA 4MEBA 4RTKA 3VSDA 1KPHA 2AG1A 1EUCB 3QU4A 3VZCA 5KQGA 4OHCA 3E3AA 2OKCA 3TQQA 1RAHA 5IF9A 4IGEA 3EUAA 1UDCA 4FWTA 4WWHA 4MW4A 1K1EA 4PQRA 4F3TA 3ZIAA 4HNAB 4BV8A 2GAIA 1KAEA 3SF0A 3C43A 5DEOA 3U9LA 4YRJA 2WILA 3UJ3X 3WGYA 3WLJA 1MB9A 2GEFA 2IOYA 3IAS6 3W9SA 5E4YA 3JAKB 1XXHB 3Q9NA 3B1ZA 2BPOA 3Q98A 1POXA 4GD3Q 1OXXK 1QC5A 4LHXA 3E6AA 3IAS1 4FYWA 2TECE 3UO8B 2HLHA 4FOOA 2V4ZA 5D2CA 3RJ9A 5JCOA 4EWLA 3KKZA 2ZRNA 3KPUA 2R48A 3WBJA 3DR5A 5EXEA 3E05A 1U8FO 2GEUA 2RARA 1ZJZA 2PK3A 2HU8A 2VYVD 4Y8VA 2I4MA 4ZIRB 3L01A 5DOVA 3UC5A 2ZKLA 4JYAB 1WW8A 2B2NA 4R2HA 4WZAE 4OXQA 4BFSA 4KH0A 3QLUA 4LHVA 4I4TF 4AB1A 3X1DA 3GD7A 5KPDA 2V5UA 5C8YF 2XBLA 5EMJA 5IBQA 3FI9A 1KI4A 3LPLA 3QEOA 1VA5A 1OIWA 1TK3A 4I4NA 4PX3A 2I8LA 4GGPA 2EJWA 4TWIA 3RSLA 1PBNA 5AXCA 3V3KA 3MJSA 1LWOA 4LK2A 4GMGA 3DMTC 1WLSA 3AKDA 5JEDA 1UK7A 2CLFB 4NMWA 1SA0B 3STHA 3T0GA 1CHNA 1TEVA 2W2XA 3L7LA 4ATNA 3F9IA 3UYKA 3MAJA 1ECFA 1ZUD1 4ISBA 5H4GA 4Z9BA 3T5AA 3ZDEA 4BKQA 4WESA 1C3XA 1RD4A 2NQ2C 3N75A 1HQYE 3S0JA 3KT0A 3P5BA 3ZS9A 4U9IS 3ZCPA 2I7TA 1ORWA 4YYEA 5JPDA 4AKTA 2OL4A 1E3WB 2A92A 2W8BA 4MQFA 3AIOA 1XD2B 3GD5A 1YB7A 4BDSA 5KUTA 1E1RA 1BCRA 2GPBA 3ENWA 1BS9A 4WI1A 1DS6A 2DE0X 4D3YA 3JWHA 5DGXA 1DXOA 5E6UB 4RF5A 3O4FA 3AFGA 4Y2SA 2JAOA 5JNVA 1QU2A 1DUSA 5FO1A 3AWDA 1L8LA 2Q8PA 3WS7A 1JDBC 2RGYA 1MB4A 3SHOA 2PD4A 3FH0A 3D4OA 1JFVA 1TCUA 2IZ5A 2GK4A 3ASVA 1PGQA 4PC1A 4BP9A 2CF6A 2I66A 1K8QA 1IHPA 1VBKA 4XJXA 3ONEA 1GCGA 3H4VA 4KH1A 4PWZA 4Q05A 4XARA 5DWQA 3LHDA 1GRRA 3PL1A 4J9VA 4JGIA 3UM9A 3W5HA 1EK2A 1J99A 3LAWA 2GILA 3MJDA 3CE9A 1CUZA 3THYA 1OD6A 2JIZA 5EIBC 4QG7A 4LY9A 3CVWA 3K05A 1A71A 1Z6TA 1K98A 4JBIA 4A26A 4XX1A 1B4DA 1FC0A 1CCWA 3N2GB 1HE3A 1U2ZA 2OBLA 3F4LA 4WDQA 1GUAA 6AT1A 1GSIA 2JLRA 4ZARA 1Q92A 2XLCA 3ZE9A 3ADDA 4NHEA 4RZ2A 1YC2A 2BP7B 2NZWA 3G0BA 4J0GA 4MQ4A 4URYR 2EQ5A 4B3CA 5HW0A 2V4UA 3RM3A 4DG9A 3LPMA 1VL5A 2YY7A 1H6BA 4Q1EA 4HTFA 3OOSA 1VSVA 1H5UA 3FY4A 1E60A 1Z0IA 4G3XA 5B3LA 1GKLA 4PG5A 4PR3A 2BHRA 3OURA 4CKZA 3FPFA 1OWNA 1SHLA 2ZYDA 1R64A 4RAOA 1CJCA 3M9XA 1JSZA 2HV8A 1CRLA 2ENUA 3HNOA 1GPBA 5IARA 2FFRA 4WZBA 3VM6A 3CONA 1RXVA 3ZY4A 2RH4A 4QGAA 5FFNA 1FDWA 1ULUA 1YRBA 1LTHR 5IDXA 3EFBA 4KK4A 1TI7A 4ZRMA 4LUCA 4OFXA 1N92A 4MR9A 5CT5A 4YONB 3SJUA 5LZ8A 5JISA 2QAGC 4DL9A 3D1LA 1ULSA 1ODSA 2H1RA 2Z5FA 3ANYB 4TXHA 4QUHA 1QGAA 4G0QA 3NZEA 3UCFA 3IUYA 3LSTA 5EOVA 1D0IA 3U62A 3U1BA 1NJ5A 4X20A 3BJZA 4B82A 4ODIA 4EHJA 4TS4A 1UCFA 3L77A 4MA0A 1Z6XA 4GECA 1N7JA 1SVMA 4RHEA 4H4CA 2QN6A 1ITZA 3I58A 5C34B 1PR0A 1HNWB 3BTSA 4TLMB 4NF2A 2P5TB 2DWQA 2PHZA 3CXRA 1KK0A 1M8FA 3GUZA 2D4HA 3PHIA 5A1TA 1U2DC 2BI4A 4M87A 4W1RA 4Q6BA 1OXUA 3ZCSA 1A4IA 1OI7A 1IVNA 5TGTA 1Y5MA 4FW9A 3QF4B 4TM8A 3JRNA 2XE6A 4N4AA 2BVNA 4EJ6A 1XP5A 4MO2A 4EQ6B 3PGJA 2RIPA 4AJ2A 3JQBC 1B2LA 4RGBA 2HMYB 3ZGLA 2XTZA 1HFWA 2AS0A 2C9DA 2FPMA 3EODA 2J3LA 2AN4A 2NZYA 3II6X 1KBQA 2QQFA 3H1TA 1WF6A 4BLOA 4US2R 2J0UA 3KLPX 3QY9A 3SSAA 1R0YA 4M1KA 5IDYA 3C3AA 2QUZA 3GLFE 2O8BA 1T5BA 3VOSA 4WNYA 4YN3A 2Y3IA 1NPTO 2ODEA 2QI9C 1HZZC 2ET6A 2V3WA 2FA9A 1CD5A 2YMPA 2ZCVA 4LZPA 3URMA 2BKUA 4BHTA 3S1SA 2Q45A 1PJLA 3K1JA 2ONYA 4ZOLA 3WFJA 1E7YA 2EV9A 5GADl 4MS4B 3LS2A 2J30A 3MMPA 2H1CA 2YMMA 3DWIA 3PXCX 1XTRA 3N0WA 3OTOB 1P1KA 5FLKA 2WHEA 1E6WA 3RIHA 2V03A 3EXHB 3V7WA 1ULZA 2Q7OE 3K6SB 2GN4A 3HZZA 1EQAA 4UZFA 1UUFA 2C2WA 2GHQA 2JHFA 4OU5A 3CBQA 3TIGA 2XEDA 1P9LA 3PE6A 2WKQA 1SO8A 2H2AA 4NY1A 1IG0A 5BSTA 2IP4A 1ZCJA 3VYUB 5BUQA 1U0HC 1DC6A 1H8HD 4G5HA 1F5SA 1OR8A 2C99A 2X0NA 3DSRA 2RHMA 4GOKA 1ZSVA 1BH2A 3IQIX 4MCJA 5I5GA 1JB9A 3N5CA 3RSSA 1EX7A 3O4GA 3JQRA 3QH4A 3KOWA 3RUIA 3TW8B 4YRAA 3GDFA 2EW2A 1IFXA 2O54A 1K08A 2D3TA 3WGLA 1R0SA 1C30A 5K8JB 1P2VA 2C77A 2CK3D 5K3OA 3NHYA 3ZS8A 3AYZB 3CF4G 1C8LA 1YFJA 1P3DA 1EUDA 2OAP1 4WQMA 5JBNA 2VJLA 1VG8A 1M1XB 3SDSA 2DHQA 1JIXA 1U9ZA 4IINA 4KPUB 1L1QA 3WQSB 1BVHA 3PCRB 1Z56C 3OBBA 5DBOA 1SU7A 3QWHA 4Y6GB 5IAEA 2MWMA 4B84A 1P0FA 4OJKA 1XKXA 2ZJBA 3C3JA 2IUYA 2ROQA 2G5TA 3G82C 2VJAA 5AVKA 3K32A 1UZLA 5DRTA 3NAMA 1DJLA 3DTVB 3USES 5KVAA 1SM4A 3LT4A 1YBFA 2AXPA 4GE0A 1C3JA 1GGEA 2C59A 3DYIA 4AFNA 4IFBA 1D5CA 3VTZA 5LYJF 4UAGA 1W0KA 3VV3A 1RBMA 3GFRA 2AKYA 5COAA 1WMAA 4C2TA 1XROA 3HBLA 3M6AA 2Q5OA 1U4NA 3LT5A 3OZBA 4KAJA 3FCSB 4P86A 5D6OA 1BHJA 1EVQA 1ZGHA 1T8TA 2KJQA 3IP1A 2QDXA 3R5XA 4C6HA 2CD9A 2N47A 5K0CA 3N3BC 4PLWA 5LLSA 5HK9A 3I5UA 3PDUA 3T94A 3THRA 2O8EB 2VUUA 4LV8B 3LFTA 1NRIA 4AZ0B 2UZ3A 3G8CA 2EJCA 3EVTA 5MFZA 3NETA 1KO5A 4HQNA 2WRZA 2CSXA 2JAPA 2JJ1D 1Y1PA 4Q19A 3J80A 4LOJA 4P4SA 2NUTB 5IJZA 3BULA 3FPHA 2I71A 5TT0A 4DIMA 3UCXA 1F17A 2J3JA 1T5DX 4TMWA 5EIAA 3LY7A 1G2PA 1Q0SA 1T4DA 3MLEA 4OP2A 3IUMA 4IMJB 4IILA 1XNJA 1WDKA 1KF0A 1SZDA 4JP3A 1EXWA 3H5VA 2ZUDA 5U4XA 4J0JA 4FONA 4D3XA 2ODBA 3IX7A 2FSVC 5GWXA 3GY0A 5EKUA 1RP1A 1ZWKA 3L1UA 1WSBA 3JASB 4Q3EA 4Q4HA 4QFDA 4JLMA 3JX9A 3ZY3A 4IV0A 4N7JA 2VSOA 4ER5A 4NESA 3BK7A 3QLJA 2XWBF 3A1TA 4KFSA 4PO3X 3F90A 4F1KA 4N54A 5DBFA 1JDBB 1CE8B 1YL6A 4FPXA 4LIPD 3V1LA 3HCAA 4GPD1 3OZTA 1Z22A 3GZNA 2CVHA 4OXXA 1QCZA 2VAVA 1V4BA 2FFJA 4OXNA 4BO9A 4TYWA 4FYVA 4PLZA 4WJZA 4C7JA 4ND5A 3JQ8B 5KWIA 3ND6A 5KX5A 5EE0A 1N33B 3P9IA 1N3BA 3KSRA 5GGXA 1P1HA 1WCWA 4FEEA 3ZHBA 3IE2A 3RI3A 2CXSA 2FEAA 1KYYA 2H2DA 4ENSA 1A8IA 1MNAA 2C7GA 4MCIA 1R6AA 2IITA 2WTEA 4PIMA 5SYAA 4QJBA 2QRHA 3TQTA 1X74A 2BHTA 4OJYA 4P54A 2OAQ1 1O94D 3O9VA 1IBCA 2YCLA 4IVNA 3UA3A 4E1VA 2O0LA 5GGYA 5ISMA 3OQ6A 2WEKA 3MQ2A 4BNTA 5JXJA 1PEDA 4ROSA 2HSDA 2ZAIA 2IF2A 4GI7A 4AWXA 1GNVA 4KL8S 3KOXA 3WBBA 4YXWA 3DWGA 1DZIA 1ZD5A 4S04A 2C1XA 1W4RA 1XHLA 3GVXA 5EIOA 2O8CB 3DZCA 4L2IA 4I9FA 5C5IA 4LRYA 5TPWB 3U81A 2HRZA 5IDVA 2H92A 2PMCA 1U7XA 2QL9A 4MLDA 3AQIA 5FOUA 2NU6A 1KXJA 1ZIPA 1F3OA 5AJHA 3DZGA 4TYNA 2JH8A 1Y1QA 2FOLA 3DPIA 1DC5A 2W11A 4G5FA 4IOJA 2GFHA 3PG5A 5DXFA 3WY9A 2AMLA 4RZIA 1IONA 3B1JA 2QAGB 5E7QA 1Y33E 3FPEA 3LFHA 4OAOA 5LB4A 4DXDA 4PC6A 1CS0A 4JOBA 4URZR 1Q19A 2EP7A 5DF1A 2QX8A 3JYQA 1AMOA 4OHBA 1WCIA 4EY3A 2KMLA 4CT5A 5JH7F 4CMJA 4EKIA 2BEWA 4WKBA 4OHRA 2G9QA 3PRYA 3EYWA 2CUNA 1ZH0A 1KAHA 2N75A 2NSJA 2OBBA 3GAZA 1R88A 3JVUA 4KNWA 4CI9A 1Z6AA 5JASA 3AM4A 4CODB 3IXMA 3QE4A 1JU4A 1AC5A 2AW3A 5B7NA 1E3QA 1NW4A 5GQSA 2BGMA 1QHNA 3M5PA 2AC4A 3MPOA 1CJKC 2ISQA 3M89A 1D2RA 4JJEA 1MC4A 5AI5A 4AI6A 1HK7A 4RVSA 1QG2A 2F8LA 4L02A 4HVCA 3PC6A 2J3IA 1U11A 3IAEA 4L9RA 5I9LA 1RZRA 3MNFA 4Z4FA 1JMKC 3FZQA 1GTSA 1O6BA 4F06A 4YCAA 2QRJA 4BV2A 5K99A 3ELDA 3Q3GE 1GKYA 2ZRLA 1QFZA 2VAMA 3KPJA 1NZFA 4AXBA 4D4KA 1P44A 2O2JA 5B12A 4TKMA 1N4AA 3GRUA 5IJAA 5AVRA 4JJ7A 1HLDA 2YNMC 3BD9A 5EJFA 2YJ4A 5EJAA 4RTSA 1UP6A 3MBKA 1OV4A 4AQYB 2E89A 4FN4A 1PL8A 2B34A 2FZ4A 3NV7A 3SCZA 2RHHA 4BE4A 3KVYA 2IXFA 3PSAA 3PFNA 4D9CA 5BWBA 5IT5A 4NJEB 1MHPA 2VH1A 1CF4A 1XMXA 4MO9A 4PS1A 3ZBTA 1BN7A 1DARA 2VLBA 1QLWA 4GI2A 4EW6A 3A4IA 4XPIB 4C2AA 3W78A 4DCTA 2G82A 1XE3A 2PKQP 1OROA 2R8PA 4RTJA 2PUDA 1KIAA 4RV9A 3GFPA 1Y3BE 3IP7A 2XIJA 5BPHA 5TB5A 4G0XA 5DLPA 2COKA 1Z4IA 1RPJA 4LTNA 1HV8A 4XRRA 2FZEA 3STTA 2Z9BA 2UXDB 3DCIA 5DTJA 3KEMA 3OQMA 1L4YA 4GXTA 1N32B 2JA1A 4DDWA 3N0RA 1U1GA 2BUCA 3PNPA 4QGBA 3U1TA 1UPAA 4LFAB 4F5WA 1W0CA 4N7RA 3NHAA 3E48A 4U2GA 3IL2A 1IN8A 3RKSA 2TYSB 1Z5GA 1DJQA 4FLFA 2E0IA 2VNHA 2PXHA 3P32A 2W2KA 3DG9A 3GPIA 5K5EA 1DRJA 1QV7A 1B8OA 1VPTA 4M8IA 5BXYA 1F2DA 4K9PA 4BFVA 3QVTA 2QWXA 1ULAA 2GBLA 2FRDC 2A33A 4WCFC 1WXEA 3ASYA 3V8VA 4DPMA 1FYEA 1EFKA 1EK1A 2OHOA 3V00A 4MIYA 3W1EA 3V55A 3V6MA 4GS5A 3D2CA 5JMOA 5AIBA 1R50A 2BE7A 2V96A 4HDSA 1JDZA 4HZUA 2N9UA 1NF3A 2XY4A 2V98A 4Q5IA 1U8CB 1YZ3A 4DKXA 2XUIA 3FNBA 5JQGF 2ZIVB 3O92A 4JN6B 2QPTA 4FGWA 4EDFA 5TQ2B 3MXOA 4PO8A 4R3UC 2BLLA 2GZ1A 1P1CA 2AK3A 5KYNA 1E98A 2RHJA 5A05A 2YWRA 4WBXC 1CIVA 4KCGA 3MAAC 3UWPA 3AESB 1C9DB 4D99A 4QFMA 1Q83A 1YZVA 1ISFA 1EG2A 1PWEA 3EZFA 3NEYA 4E2FA 4DR2B 2CMGA 2P2LA 1PLLA 2YZKA 1NOKA 2J33A 1FNSA 4HTAA 3W4IA 4A6PA 4QD3A 3USCS 2HFJA 2VDWB 5LUBA 3EUEA 4K40A 2EFGA 3TRHA 3QUSA 2R84A 1MD9A 4BGIA 2AC2A 2PYZA 3P2MA 2F8TA 1FQWA 2XNSA 2NQ8A