4KDRA

Crystal structure of ubig/sah complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
208
Chain Sequence
HNVDHEEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFSTLNRNGVKKFIKPAELLGWVDQTSLKERHITGLHYNPITNTFKLGPGVDVNYMLHTQNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-demethylubiquinone-9 3-methyltransferase
publication title Crystal Structure of the UBIG/SAH complex
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 69
structure length 208
sequence length 208
ec nomenclature ec 2.1.1.222: 2-polyprenyl-6-hydroxyphenol methylase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kdrA00
2I9KA 3ELWA 3I9FA 2B9EA 2JH8A 2PWYA 2IFTA 3IHTA 4U7TB 1XVAA 4C03A 4F85A 5D1HA 2R6ZA 3GWZA 1YUBA 1NV8A 2B78A 1WY7A 2V7EA 3EPPA 1RJDA 3UJBA 4C4AA 5GIOE 3P9IA 3EVZA 5DM4A 3R9XB 4LWOA 1ZGAA 3BXOA 5EMLA 4FZVA 4OBWA 2VDVE 4A6EA 4FT2A 2P3OA 3PFHA 1R6AA 4GC5A 1AQIA 5ICGA 3E05A 3MTEA 4R6WA 2AOVA 2G71A 2AS0A 3THRA 1JG1A 4P7GA 2FYTA 2PXCA 3VC2A 4F84A 1R8XA 1V39A 4RTSA 5LQCA 1WXXA 3EVBA 1B42A 1KR5A 2B3TA 2PX2A 3FZGA 3TRKA 3PX2A 3MB5A 1NW6A 3HCCA 1EIZA 5FWDA 4E2WA 3OZTA 3G2MA 1VBFA 3A4TA 1SQFA 3KQMA 5M5BA 5DT2A 4OA8A 1Y8CA 5KVAA 2C7RA 3JWGA 3OU6A 4P58A 4PCLA 4V0QA 1ZHFA 2G8NA 4IWNA 2UZ4A 2QYOA 3M33A 1EAMA 3MAGA 3SGLA 3NMUF 2FHPA 3G88A 3HEMA 2BZGA 3REOA 5FTWA 3I53A 1G55A 1VIDA 2N47A 4MQ4A 3V8VA 2G72A 4O29A 3TM5A 4QTUB 2HNKA 3C3PA 1VP3A 3K6RA 3FUWA 1ZGJA 1EQAA 3ID6C 3PB3A 4GOND 3A26A 2C7PA 3NDIA 4GOOD 5E9WA 3NDJA 1G60A 3G5TA 1NT2A 3LL7A 3EVAA 3O31A 2ZIGA 3A7EA 4YV2A 1VQ1A 4UOEA 2OXTA 4RTNA 1ZKDA 2VP3A 2IP2A 3G2OA 2BR5A 3KPUA 2ZZMA 3FYCA 4PYOA 5DX8A 1P39A 1X1AA 2FPOA 3OFJA 2AOUA 3DH0A 3IEIA 5BP7A 4E70A 3UJAA 5LQRA 1Q0TA 3KR0A 3G8AA 2NP6A 2OZVA 4QDKA 5FUBA 3MQ2A 3DR5A 3FPJA 3LDFA 4FP9A 2GS9A 4HTFA 2XYVA 4PINA 3ER8A 5HILA 5ICFA 3FTEA 3Q87B 5DLYA 2CKDA 4M7RA 4DKJA 2YX1A 1NKVA 3HCEA 1I9GA 2PXXA 3OZRA 3R0QA 3DP7A 4RVFA 3HVIA 3LPMA 2EG5A 1YZ3A 1KYWA 1OR8A 4WXHA 4RTPA 2YR0A 4B17A 3BWBA 3R6TA 5B1SA 3HCDA 4RVHA 1IY9A 3BKWA 2NXCA 4E2ZA 2A14A 2WK1A 5E8JA 5K0JA 1HMYA 3A7DA 3GNLA 4QPPA 5EZQA 3EVFA 3KQYA 1X1BA 4FT4A 1P1BA 1SG9A 4KWCA 3LKDA 3BZBA 3DXYA 5E1DA 2NNWB 5FHRA 4R05A 2GA9A 1DCTA 2JHPA 1JTEA 3T7RA 3OZSA 1QYRA 2CMHA 3BGDA 3UJ7A 4CWAA 2AN5A 3E8SA 5EHGA 3O7WA 1N7JA 3UWPA 5DTMA 4CTKA 2XVMA 4G56A 1FP1D 5HIIA 5KS2A 3PTAA 3TLJA 2ZLBA 3BWMA 4XCXA 2AVNA 3TQSA 1KPGA 5K0GA 3FYDA 5DM2A 7MHTA 2PJDA 3HVHA 3UJCA 1JSZA 5HOQA 2B2CA 1XXLA 1NW3A 4KRGA 3EGIA 3JWJA 3JWHA 3LCCA 4FSDA 2P35A 1XCJA 4F86A 3T7SA 1PJZA 4POOA 3MCTA 1G6Q1 4L7VA 1SKMA 1SVUA 4RVDA 4P7KA 5EIWA 4Y30A 1VLMA 3TR6A 5T67A 4DCMA 3EVDA 5ICCA 4AZTA 2ZTHA 1R18A 3S68A 4E33A 3T0IA 2IPXA 5LQJA 1O9GA 4IKPA 3EMDA 4HH4A 3AXTA 1JQDA 5C9ZA 3A25A 4PGGA 3P2IA 3H2BA 4ISCA 3THSA 3VSEA 2ZWVA 5K0NA 3LBYA 4CTJA 3SSNA 3L8DA 4GBED 4PWYA 5BXYA 4YUXA 2ZBPA 3OPNA 4GEKA 1XDSA 4P7FA 3FRHA 2OY0A 2PGXA 3CKKA 2PT9A 3P9CA 1EJ6A 4IV8A 4PIPA 4RTQA 3GRYA 4KW7A 5E2BA 2LD4A 5K8VA 3OU7A 4RTOA 3PLAE 2ONZA 1T43A 1VP9A 1KP9A 5DX0A 5IKMA 4MIKA 3DXZA 1RJFA 3FRIA 3GRUA 1YF3A 2OPBA 2Z6AA 2HTEA 4RYLA 2O05A 4XUDA 5EC8A 1INLA 5GINE 1QANA 3R24A 3MERA 1F3LA 5LQUA 3DMFA 5C0OE 1QAQA 3P2EA 4YUVA 3TFWA 4WVLA 4MHTA 1EJ0A 3KPVA 5T64A 3TM4A 5LQNA 4DM3A 3B3GA 1NW7A 3A27A 4PYNA 1M6EX 3EGVA 5EMMA 3R3HA 4R8RA 2AOTA 2PX5A 2CWWA 2HV9A 4GOMD 2BR3A 2VDWA 3Q7EA 4OBXA 3NVKI 2YTZA 4A6DA 4E30A 4NECA 5DM1A 3M6WA 2I62A 4HSGA 2ZVJA 1D2HA 1JG2A 2ZZKA 4HRAA 5FWAA 5K0EA 5FA8A 1R00A 5E2AA 4DMGA 1TW3A 1QAMA 1SUIA 3FTFA 3SMQA 1XDZA 3GGDA 4GUAA 3VC1A 3KQSA 1JTFA 5HIJA 4RTJA 1JQEA 2YXEA 1YFJA 3BWCA 2AOWA 5EGSA 5ERGB 5EMKA 2IH2A 2GB4A 5BW4A 4AZSA 1RI4A 3P8ZA 2PKWA 4FR0A 3HA5A 1RI2A 3FPEA 3JWIA 3KQPA 2CMGA 3BGVA 4E2YA 3DOUA 2UYQA 2YXDA 3HNRA 1RI1A 3UBTA 3B89A 5CVDA 2G1PA 5DTQA 1NW8A 4QPNA 4QQNA 3HM2A 4E2XA 1KXZA 5CCBA 2C7OA 5F2NA 1XTPA 2V74B 1QAOA 3B5IA 2BH2A 1D2CA 2YQZA 3HA7A 2VDUE 4U7PB 2ZSUA 5CIYA 2ZFUA 5DXJA 3FUVA 3M4XA 3GIWA 3M6XA 3P9KA 4OX9Y 4YUYA 3ORHA 4GQBA 5GIPE 2R3SA 3ELDA 1TPYA 3GDHA 5F2KA 5DRTA 3GCZA 4CKCA 1VL5A 3HP7A 2NP7A 1DUSA 1YZHA 1YFLA 2YVLA 3G8BA 5DSXA 3LDGA 5FHQA 3UZUA 2H00A 4X41A 1NV9A 1JG4A 4E32A 2IDJA 5KQSA 2QRVB 3P71T 1RI3A 2GAFA 3GXOA 4EKGA 4RV9A 1JR4A 3IV6A 3LDUA 4RTLA 4OQEA 5HIMA 3P9NA 4GOLD 4ER6A 1U2ZA 3VYWA 2G70A 2NYUA 2Q41A 3EEYA 4PGHA 2JJQA 5CUQA 3UJ9A 1I4WA 3AY0A 3CVOA 3NJRA 2O0LA 3B3FA 2VS1A 5BW5A 1DL5A 2PY6A 1BHJA 4MTLA 1EG2A 5GOZA 3NWEA 4ER0A 5KYGA 2P1DA 1AQJA 5CD1A 3ER9A 3BT7A 1L3IA 2UYHA 5FCDA 2ZULA 3EVCA 5LR6A 1M0EA 3LHDA 4YUZA 4PYLA 3UA4A 1UWVA 2ORED 3UJDA 3G2PA 2UYCA 2YUIA 5CVJA 4X1OA 3KQVA 3U81A 3B7PA 4HGZA 4KIFA 1JG3A 4RTKA 4RTMA 3LCVB 4ER7A 2IH4A 5HIKA 3CGGA 1D2GA 1G8SA 3CJRA 3T7TA 3UA3A 3TKAA 4K6MA 1QZZA 2O57A 3LECA 5LSAA 5DSTA 5FADA 4DF3A 2ZIEA 1N7IA 2YXLA 2QY6A 5FA5A 1M6YA 2NXEA 2C7QA 5GWXA 2Z6QA 4YV0A 3KR9A 5K03A 1AV6A 5EG5A 2Z6UA 4OQDA 2EJTA 3KPWA 4BP1A 4HTFB 4LECA 4X61A 1KPIA 3GRVA 4DQ0A 3P97A 1KPHA 2K4MA 3HA3A 1FJXA 4LWPA 3I64A 5E1OA 4QVKA 4XUEA 3BUSA 5K01A 5DM0A 2Y1WA 4KIGA 4PCAA 5E1BA 3SVZA 3I58A 4IV0A 2ZWAA 5IH3A 2ZBRA 3EGEA 4QQKA 1IXKA 1RJEA 4HGYA 4QVGA 4X60A 4X63A 3FTDA 5K0FA 1RJGA 1X19A 2AZTA 2GH1A 5EIFA 3SM3A 2IH5A 5E1MA 3ERCA 5FULA 2NXNA 2OB1A 3FUUA 1O9HA 2QM3A 3EMBA 3D2LA 5DWQA 2I7CA 5DXAA 4PYJA 2IBSA 3RODA 3SSOA 1L3BA 2FRXA 4BY9E 4KDRA 4EQZA 2ZCJA 2P7IA 2FCAA 1IM8A 1L1EA 3BKXA 3G89A 3QV2A 4QDJA 2WA2A 1XCLA 2AN3A 4PIMA 5K05A 3MCZA 3MGGA 5E9QA 5EQJB 1AF7A 3CJTA 2Y1XA 3SR4A 2PWPA 1NBIA 3PVCA 1L3CA 2PX8A 2XYQA 2JHAA 4OA5A 3HVJA 4PYKA 3TPZA 5E8RA 4YV1A 1N2XA 3LGAA 3GRZA 2DULA 2ADMA 5EKXA 2JG3A 1NW5A 3HVKA 5EPEA 3PT9A 4BLVA 3LKZA 1NBHA 3V97A 2AR0A 2BM9A 1TW2A 3C0KA 3NTVA 4FSXA 3KPYA 5HFJA 4PNEA 5CCXA 4RVGA 3RIEA 3GO4A 3X0DA 1KIAA 1ZG3A 2UYOA 1FBNA 3OU2A 2H11A 4RWZA 1WG8A 1WXWA 8MHTA 2IDKA 3E23A 5GP1A 2VZ9A 3OFKA 5E9JA 1UFKA 4C07A 3CCFA 5EZSA 3EVEA 3HCFA 5K0LA 1JSXA 5DRYA 4YMGA 4C04A 2P8JA 5CVUA 4CKEA 4C08A 4PYMA 4AUKA 3FPHA 5JR3A 2QRVA 3SX0A 4QTTB 4BP3A 2WA1A 4GC9A 4ER5A 2IBTA 4XUCA 4V0RA 3G7UA 4ATNA 3K0BA 3FUXA 4M37A 2PLWA 2P7HA 1X1DA 3KQWA 3MTIA 2CL5A 4FS8A 4C05A 1XDUA 5DTRA 2I6GA 3HCBA 2OYRA 3F4KA 5KQRA 3QOWA 1P91A 4RX1A 4CKBA 1H1DA 1SQGA 3DLCA 3TOSA 4R8SA 4Y2HA 2BM8A 3BGIA 1FPQA 2EJUA 5EHIA 1MHTA 1VE3A 3KR2A 2XBMA 1JQ3A 5LQKA 3LSTA 1XJ5A 5EEHA 2FK8A 2GPYA 1HNNA 3KKZA 4LG1A 1I1NA 2P3QA 4PYQA 2B25A 2EX4A 3I5UA 3AJDA 3IYLW 4ZTBA 3TKYA 3KPJA 4YUWA 3EEOA 5JUWA 3GRRA 3BWYA 4AZWA 3AWIA 5C1IA 2HWKA 4MWZA 2XYRA 1KHHA 3DMGA 3G2QA 2PVCA 3WSTA 5HZMA 3UFBA 3OCJA 4H0NA 5U4XA 5EMJA 1UIRA 5K09A 4FGZA 2H1RA 2FK7A 5DX1A 3GJYA 2XVAA 2ZBQA 3DULA 3KQTA 2O07A 4YMHA 3P2KA 1WS6A 2AOXA 2ZW9A 1R74A 2PV0A 1ZQ9A 1PRYA 3B3JA 4EK9A 1G38A 2OKCA 3OE5A 3ME5A 2JHCA 3M70A 5T6BA 5CM2Z 5EKUA 1L9KA 2E5WA 3CC8A 2AOTB 3LCUA 4AX8A 4EMSA 3UJ8A 3PS9A 2PX4A 3NW9A 3E7PA 3UJ6A 1ORIA 2EFJA 3LX6A 1YB2A 4P7JA 5CVVA 4PONA 2PXAA 5H02A 3DUWA 1BC5A 4HG2A 3DMHA 1X1CA 2BR4A 3OE4A 2ZIFA 3DTNA 4HC4A 2KW5A 5F2OA 5K0BA 1BKYA 1Z3CA 3CBGA 5CVEA 3NVMB 4RTRA 5D1NA 5EVJA 2PSSA 2HR1A 2O06A 3HCAA 2AVDA 1FP2A 2DPMA 3CJQA 3KQOA 3LBFA 3C3YA 4M36A 5HEKA 5GM1A 3C6KA 4EVIA 3KHKA 1VPTA 2PT6A 3KR1A 2OO3A 3FTCA 3TMAA 2AOUB 4DCGA 2GLUA 3RW9A 5P8WA 4DZRA 4RSRA 4ER3A 4BLUA 4E31A 2JH9A 2OBFA 3FUTA 1P1CA 4KDCA 1KYZA 4AZVA 5LQAA 3KQQA 2OB2A 10MHA 3G5LA 1ORHA 3EVGA 3QOXA 3C6MA 4EKIA 2F8LA 5EEGA 3PX3A 4M38A 1BOOA 1O54A 2IGTA 4JXJA 2IIPA 3DLIA 4PYIA 9MHTA 5MHTA 2AN4A 2P3LA 1SUSA 4BLWA 3M6VA 3ANXA 3SXJA 2NXJA 5GM2A 5EOVA 2QE6A 2PBFA 3DXXA 3GU3A 3SSMA 4C06A 5K0CA 5FQOA 5ICEA 3ELUA 2P41A 3AXSA 4R6XA 5DPMA 2ZZNA 3FPFA 3KU1A 1RI5A 1R8YA 2HMYB 1G8AA 3PFGA 4GF5A 5G02A 4CXMA 2ERCA 2ONYA 1NE2A 3M6UA 3ELYA 1Q0SA 3MHTA 3NWBA 1F38A 2ESRA 4KVZA 2P40A 5FQNA 3O4FA 3HTXA 1MJFA 1WZNA 3FPGA 4Z2YA 4DA4A
chains in the Genus database with same CATH superfamily
2V7UA 3VNQA 3GBSA 4HS4A 1E9AA 4AC9A 1N6NA 4ZAZA 2ZIVB 3HACA 1HY3A 2P5TB 1AA6A 5AHRA 1ZUNA 4I6JA 2ZSBA 4LXHA 4D0RA 3RYIB 5EMLA 1DJMA 3I6YA 4LHWA 1JTVA 3J7TA 1MGOA 4C0HA 1DBIA 1SBHA 2CLHB 3BB4A 4U63A 4DLWA 4G1MB 3PFKA 2PPLA 3NGXA 2KE5A 4REQA 1ML3A 1QQ6A 1LS6A 1OU4A 2OHVA 1I0ZA 2PXCA 3DFMA 4Y6GB 5LQCA 2FRDA 3E5HA 4JQZA 1N33B 2RHTA 1XRRA 1ZIPA 4P33A 1QP7A 4P9NA 3OPMA 4C9BA 3A3OA 5JYCA 4JUCA 1E1YA 3OH8A 4AG5A 1ZXXA 3NHRA 3K5IA 2VOJA 5JWHA 1JJBA 3N0XA 2G8NA 3RLFA 2PO7A 1HOXA 1Y4UA 2HTFA 1SXJA 2QD5A 1IRIA 1ESEA 4PXYA 3VZBA 3G9ZA 4WZBB 5TC4A 1XVUA 3WL4A 3DEKA 5L3SA 2WVJA 1CZLA 2J09A 1E66A 5DP1A 3G85A 5FLXA 2WU8A 6PFKA 3BTOA 1TM1E 1ZW6A 2ATEA 1CR4A 4XWKA 3IMFA 4PC6A 1JHXA 2ZBDA 2DLNA 3LL7A 3OZIA 4TTTS 2ZE8A 4WADA 3DDUA 4ZVTA 4J3NA 4B5LA 2IUSA 2PRYA 4JC0A 3ISTA 1L7OA 2X2FA 3IIEA 4G0MA 5JLJA 3L0DA 3EBLA 2DP4E 4LMAA 3WBJA 4Z0TA 1KEEB 2GCOA 1ML4A 1XMIA 4I1OA 4IEFB 4D0GA 2V3VA 1EK0A 2B1QA 4M2LA 1ZH4A 1F7VA 3A10A 3CMCO 1EVQA 5BQPA 1TDJA 4D3YA 5REQB 1OD6A 1WE2A 2NXWA 3VISA 5HCNA 4YN3A 4AJOA 3LHKA 1GZHB 3MJCA 1QCCA 4GM4A 4J1TA 4R4JA 3VM6A 2GZ3A 1G21A 3VPXA 4UM7A 3W5AA 1JKJA 2JVJA 4O2AF 2PUTA 3H8VA 3IR7A 3QA9A 1VMEA 3L0OA 1EVIA 3LK7A 3SM9A 3M5CA 2MYUA 4HZUA 4P8RA 1BXRB 2UZ0A 3GFTA 4U2KA 4UM5A 4WXEA 3GRCA 1GUZA 3WMGA 3H9EO 1P0MA 3F3YA 4B1FA 4TQUS 4HZGA 5TPWB 1GLNA 1P75A 4GLJA 1NTRA 5FJIA 4QBHA 4UQLA 3FOZA 3LP6A 2QM0A 3IE1A 1I9GA 3ND5A 2G07A 5E3JA 2PVPA 4Y98A 3HVIA 3RUEA 1P9WA 5LN1A 4C4SA 3AUFA 5H3CA 2O2GA 1VPVA 3FNHA 1FS4A 4D4JA 3WLPA 1E1CB 1O3YA 1FFGA 5TT0A 3RV3A 3RWMB 4IP0A 3ZHVA 2CV2A 3U6BA 3LCJA 3D54D 3QVMA 1U2DC 4AO6A 1I4OA 5GZ1A 3D3QA 1DO2A 1VMKA 1NTOA 3PDHA 3K9QO 4FKMA 2H2GA 5AQ1A 3VH1A 3B6IA 2RMKA 1JALA 5JCOA 5CVTA 1Q15A 5JAPA 2FMUA 1DLJA 5CGZA 3HHEA 5AKXA 4EELA 3GLUA 2XUGA 4OD0A 3D3WA 3WB0A 2WI8A 1B6GA 3C6XA 3OLCX 3VDQA 1KETA 2G9ZA 4MRMA 4OQXA 1VGRA 3LXMA 4GYWA 1BN7A 1OKKD 1QYRA 2HU5A 5BO5A 5JQGA 2X9NA 3G9XA 4XTCS 4YMTA 4H2DA 4L4ZA 2MMGA 3F1KA 5AHXA 2XVMA 3HYTA 2WOOA 4X8MA 4U39A 5HIIA 3TLJA 2ZT5A 4ZVRA 1DRKA 1GT91 2H08A 3PPWA 1WSAA 5F12A 5JFGA 4KLAA 1LQTA 4NAUA 3QUQA 2PA3A 1NY5A 2QMZA 2ZI7A 3THYB 2HHJA 3HFRA 4M99A 1OFUA 3E3AA 3LFHA 4PZDA 3M5WA 4F38A 4EY5A 4JLUA 1PJZA 3ZLTA 1YZGA 2HT1A 4CQMD 1RADA 4JNCA 5ADUS 1CUCA 2IHJA 4EQ6B 2OHGA 3E9CA 2C4NA 3VBCA 4DCMA 1XZHA 1ECLA 4LCEA 4OJQA 4K6OA 3HVUA 4Y1EA 2LCFA 3S68A 4WGGA 2IPXA 1ZCBA 5SY9A 4CTMA 2W71A 1WOYA 4GVLA 5ES3A 5K8LA 3F6PA 4PLHA 4ZVNA 4BN0A 3DDCA 1QNLA 3CUEF 1JMYA 3ETJA 4C0KA 3W5DA 3TFOA 2ZWVA 3LBYA 1EQ2A 1JLKA 1M6WA 1Q22A 2EC5A 3LPNA 3S81A 5IWCA 2EWVA 2J5RA 3T4UA 2AR9A 2D54A 2ZBPA 3IUPA 2ZQYA 4GEKA 1ZP6A 3Q9NA 2PGXA 4J2HA 2DRIA 2O8FB 3CX6A 2WVGA 3HUFA 1FW8A 4R0NA 4YCDA 1T8YA 4ZVKA 4Q9KA 4BNGA 3O8LA 1N9KA 4D6XA 2F64A 1JA1A 1K27A 1QLJA 1XTRA 4TKZA 3TH5A 4X45A 5I9IA 3UK7A 3DZCA 4YWJA 2FR0A 5DTIA 3NONA 4ZAFA 2H4FA 1TYCA 3OM8A 4QFDA 3U3OA 2VK4A 2MSCB 4DUGA 5BY2A 3FFXA 4XWAA 4PPQA 1JLRA 5EXPA 4IDDA 2OHFA 1MX9A 2P75A 2XTZA 2J48A 2AE1A 4C87A 3AFOA 1AK9A 3E18A 3GJ3A 1H9CA 2WZBA 5LDDC 4J1SA 1PZEA 5LQNA 3B3GA 3AEQA 4C4XA 1RCUA 3AUYA 4GWLA 2A84A 3IAUA 4EFNA 3O8OA 4M1KA 4J16A 5ESWA 2Y0PA 1GPH1 2GXAA 1WLSA 2BCEA 1D6SA 3M6FA 3F90A 3ZWPA 4TZ6A 3NKFA 3AEUA 2V9PA 5HF8A 1WB4A 4E12A 1YZUA 2CXSA 3PUWA 1PYGA 2QNRA 1CVLA 1QLHA 4GMDA 1XNRB 4DW8A 2OQRA 4KXMA 1VBMA 4NICA 4NENB 1WAMA 3H1BA 3P9SA 5DHQA 1ZI6A 3O9ZA 1IZ8A 1QB7A 3SMQA 3NQ41 4GUAA 4ND6A 4OI2A 2P4SA 5IAJA 1PGJA 2CDRA 3IIJA 1YFJA 1GARA 4JQCA 4L6CA 1D0IA 1ESNA 1ATZA 1USVA 2A9PA 2ZUCA 5AM1A 4C0QC 4ZYVA 4B2IA 5BW4A 1E3SA 2NV6A 2P4QA 9ABPA 1VLLA 1C9NA 1EM8A 5CXSA 5BR7A 1PDWA 2AN1A 3WQRA 1LSOA 5IN4A 2G8LA 4LJ8A 4Q39A 3OPVA 4MZXA 1AK1A 4V2UA 3ZX5A 3N2KB 3PNSA 5CVDA 1NSYA 3B5JA 1P74A 1SPBS 1L4KA 1C9DB 3I9JA 4CF4A 5IVDA 4KH1A 4KGDA 3WOHA 3KQUA 1P3JA 2PYDA 3GA5A 3GLIE 5CBKA 3NV7A 1CY7A 1O03A 1QR2A 2F59A 2SBTA 5DYIA 3KTAB 5E2IA 3LWDA 2NZ8A 4CQNA 4QAJA 4HUJA 1CUFA 1XVIA 3IP1A 2AK2A 3KKKA 4H6XA 3DL2A 5ULLA 4DYHA 2B98A 3AERB 2R4QA 4IMPA 3V80A 4RVOA 4KE8A 5F1PA 3WRYA 4DL9A 2PS0A 2ZVQX 3AP1A 3RSQA 4NX2A 3OQJA 5LIRA 3U4CA 1M74A 3BS4A 3JQ7A 3LQRA 4Z51A 2BM0A 2GCEA 3DOCA 4G63A 1XNQB 1W0JA 3DOHA 1XTQA 3CE6A 1YFZA 2Q1WA 2B3DA 4RH1A 4GOLD 3ESQA 5KI6A 2YHBA 2NU7A 1BHJA 3RUDA 3Q7PA 5KX5A 4QYXA 2C0PA 2UYHA 1YMUA 3WWYA 3VTZA 3TTWA 1RDFA 1A7JA 2QN1A 2YOHA 3AF0A 3A1FA 1K08A 5AXCA 3KD3A 1MOSA 3U4IA 4YDSA 1RKBA 1E4EB 2D2XA 5ER6A 2XJ9A 3RS9A 4UNQA 2ODEA 4K88A 3HGMA 1GPMA 3IUMA 4FC7A 3LK6A 2P78A 2WM3A 3CJRA 2PZGA 3ZHSA 2QVXX 2JLUA 2NZYA 1A5SB 3TWOA 5J4HA 1NJ5A 4Q16A 1JP7A 2FFHA 2RHLA 1RXVA 2UUBB 2VVTA 3E7WA 3U16A 1FFDA 2Z6QA 2OWDA 2EDAA 4BTEA 4YV0A 3T1TA 3H3FA 3UAYA 3BHJA 4XCQA 5DBHX 3TOCA 2I80A 4GOXA 2RONA 3RLIA 1RFGE 2WJGA 3G79A 5ALHA 4D43A 3C3KA 3S2YA 4EVQA 4LECA 4MB2A 4B80A 3KE9A 2K4MA 3DO6A 4I8DA 4LDQA 4CLHA 5BXQC 4HP8A 4JLKA 5DM0A 1NGSA 2ECKA 3FPBA 3KXIA 3ZDQA 1NVXQ 5FBRB 1CUSA 2HF7A 2VSYA 1F51E 2WWTA 3L8EA 4CQMB 5GGXA 2RAFA 3SZUA 2HL6A 3V1NA 1T13A 1V8FA 3MN1A 3W2HA 4X63A 4IGEA 2HCBA 1GZVA 1WXIA 2HRDA 1X7HA 2XTJA 2UZ3A 3H4TA 4FEGA 4HDMB 4LOIA 4G0VA 1AMOA 1XZJA 3WYAA 4DRXB 4BQIA 3CVYA 4L4UA 5DXAA 3HB9A 4F4UA 4R9UC 1FYWA 3VAYA 4EA9A 4A2QA 4RKQA 1PSWA 1K9SA 4IHJF 4AXXA 2P67A 2Y1XA 2F3RA 4KGXA 1L3CA 1B8UA 1U8CB 3MT9A 3HVJA 3PZBA 4LQ4A 3DNFA 3OC0A 5DW0A 2Y0BA 1BO6A 3K6KA 3ZE7A 2DULA 5CH3A 1GAEO 2GN4A 5KOIA 2EP8A 3VHQA 5HFJA 3O4GA 5B55A 5COQA 3ZQJA 2A6PA 1HMPA 3OO0A 4WAUA 5K3BA 4Q02A 5CCXA 4PZYA 3GO4A 1R0RE 1ZXLA 1EVYA 1IY2A 4EPWA 2XMZA 3C97A 1X3SA 4LWZA 1AHHA 5BQXA 2VRNA 5K3AA 5BRJA 2FPMA 3LO8A 3HWRA 2HFKA 5A0FA 3TFQA 2ADOA 2AJCA 2FW8A 1GZ5A 1IQUA 2HRRA 2P8JA 1F6BA 1WWKA 1EFCA 4RW0A 2SNIE 4QUIA 2W4MA 3EMVA 3EXHB 1IN8A 2GK4A 2WUEA 5G1PA 3FYUC 1XCMA 2GF0A 3FUXA 4FHGA 3PJGA 4IIDA 4FK8A 2VJMA 3FMPB 3D4BA 2H0RA 1GPWB 3EXG1 3V8MA 5JH7A 2CL5A 4FS8A 3IX7A 1RRPA 3ZZNA 1MJ5A 4A73A 1UH5A 1T3HA 3IODA 3Q8XB 4RK1A 1S2LA 3G7NA 3TE7A 5LJIA 4GQAA 5LA6F 1N75A 4OHOA 4EW3A 3EXFA 1M2WA 1Y6ZA 1BIFA 5GOZA 2I65A 4B84A 4ZTBA 1AUOA 4DCUA 2IHZA 3VVLA 4YUWA 3AJDA 1S3FA 1TUGA 2PLAA 1H2RS 4E3ZA 2OCYC 2M32A 2PZJA 5JRJA 4KFRA 2QYHA 3KKMA 4BJ1A 4MCIA 2XJ4A 2DQ4A 3CEJA 3I05A 3VU0A 3T52A 3O90A 4WACA 5GONF 1UADA 3BRQA 3U4QA 2F48A 1GOTA 1C14A 3OCJA 3OIVA 3RCBA 3RAFC 3P4YA 4BKQA 5J2TA 1A69A 1LLFA 1MAHA 3TEFA 5DU2A 3MPOA 4R2XA 5EXEA 5CLIA 4YMHA 3O8NA 3AONB 2XXBA 2PH3A 1S8AA 1U0SY 2ZW9A 4XI9A 5C32A 1WUKS 4Y6RA 4C2AA 4P93A 3RIHA 2Q4RA 2VCHA 3ME5A 4TT3D 2XH8A 4MGIR 2HA7A 4G6ZA 3AX6A 1YRQA 4PU0A 5IXYA 2JLZA 1ZWKA 6REQB 1FUUA 5FOVA 2EQ5A 5CVVA 3KZKA 1FRZA 1JAZA 2ZVDA 2YWCA 1Y5MA 3KUUA 4RZIA 1UDAA 4BMVA 2C59A 1BDIA 3DTNA 2DBYA 3H87A 2CL0X 2EZUA 1Q7RA 2HWXA 2YN0A 4S1NA 4EB0A 1AMUA 4RTRA 5DE3A 1MAAA 4GI1A 3WJAA 2B35A 2R66A 4G3XA 3D5TA 4OMFG 5LZ5A 3H4IA 2DE0X 3VVCA 4MUFA 2J9GA 3ESRA 2WYWA 3PFFA 4OUKX 1G2OA 3TTUA 2J08A 2JJ2D 5CEJA 5L7TA 1UJMA 4CF5A 1S8FA 4AN1A 3EZ6A 4F4HA 4S24A 2ZSDA 2PMFA 5IP5A 1H66A 2OBFA 1TEXA 4BV9A 5DSZA 1IN6A 3A9VA 1O89A 1QIHA 2ZK7A 3KQQA 3L93A 4JBNA 4U8GA 4UUNA 4X0EA 5EE3A 5IAEA 1MP0A 4N3BA 2Q8PA 3D81A 1G17A 3KHTA 3R9IA 4Q1BA 2HRZA 1BXGB 1KERA 4PV7A 2ID9A 3Q2OA 1G6OA 4FZ3A 2HIGA 4W82A 3H9UA 5G1NA 3RVJA 3BFKA 5CDUA 1F1JA 3K31A 3MUFA 3R0JA 3IP7A 2NO4A 4LQCA 1WLYA 3QVUA 2BLLA 1LDEA 1UR5A 3CKLA 1F2TA 1TQ4A 5ALYA 4EATA 5F7XA 5AKKA 2BGNA 1O95C 1U9IC 4LV8B 1RP7A 2BFPA 3ELUA 5B2FA 5M34A 2FN9A 5BQOA 4IF6A 3QUTA 1ZD2P 4XJXA 1G8AA 4CLDA 2JARA 3JQAD 3MAAC 1Y9JA 4BRSA 2C29D 4I66A 3DPUA 4BGVA 3JQQA 1ANKA 4MVCA 1ADGA 4KO4S 1UDXA 2YRFA 1XRSB 4QNRA 4DDTA 5TQ0A 3L8CA 5J9FA 4E1VA 1SCIA 4KB5A 4ZI7B 1DAEA 5C8ZA 1WPRA 5AVXA 3N3AC 2QD4A 4LF9B 2JHFA 2C5EA 4M8NE 4G5YA 1V3VA 1YUBA 2G04A 4IFBA 4ZT6A 3VPHA 1J21A 5KOJA 1W36D 2JGDB 1KH2A 4DQXA 4JGGA 3DD5A 1XE3A 3HXKA 4DPMA 5JQWA 2MINA 1SG0A 2YZ7A 4JN6B 5H7XA 4A6EA 5L4SA 4EF6A 2P3OA 4QJ5A 5JD4A 3U44B 1R6DA 2AB0A 1W2HA 3K5HA 1TA9A 3ER6A 5U1PA 3NCTA 3CUYA 4S0ZA 5IBPA 3TI7A 2IS6A 3ZWYA 1NAHA 2QKYA 2HIHA 4FYWA 5LL6P 3K2QA 5FWYB 3JWPA 4L9WA 5FJJA 2B69A 1EYZA 3WKEA 2DX7A 4GVPA 5KNBH 3ETGA 4Q1FA 4NCKA 4N03A 4QHYA 4GWKA 2IITA 1M0WA 4I7EA 4EJ2A 3PQ7A 4BKMA 4OLJA 5M5BA 5HHTA 3ROZA 4N5NA 5ENDA 3EC7A 3GUUA 5JH7F 1G3RA 1PE0A 1DX4A 4GO1A 1C41A 3V4SA 4BFUA 5TEWA 3DZKA 4V1CB 5TY0A 1M67A 3HEMA 3NEYA 3NOQA 4ZRMA 1XEWX 3WJ7A 2G40A 2JEYA 2GM4A 3ZR4B 5IYZA 2WNHA 4P98A 4OHYA 4P36A 4Q3OA 2C5LA 3LF1A 4GOND 1K4MA 2O4UX 3MIIA 4PO9A 4ZK2A 4ENWA 2QT1A 1GXSA 3A6GA 3QNMA 1G66A 2QUIA 3SFZA 2PN1A 4QDZA 4N48A 2V7QA 1CZOA 2WEKA 2VPXA 2AMYA 4AURA 4XLZA 1UDCA 2FSHA 3BSFA 3NATA 5F2EA 3FMIA 1Z06A 2G82A 3KFLA 1N1EA 5F9HA 1A27A 1BD4A 3QF4B 3C3WA 4C29A 5CLHA 1QRTA 1A97A 3MCVA 1Z5ZA 5K3CA 4RDIA 5BMOA 1YL6A 1J0DA 5DNAA 1AM4D 5EJ4A 3C5HA 3WGIA 3H13A 1CP2A 3IEIA 3UT6A 4AROA 5BN5A 5TR9A 4ALJA 3KR0A 4QYIA 3RAEC 2IIQA 3ZLJA 3EQ9A 2JLVA 3TAUA 2QG4A 3D2BA 3FPJA 3LDFA 3U26A 1ZOIA 2QJTA 2FPUA 4OU5A 2O23A 3L7OA 4ZXPA 2ZTMA 4OTZA 2JFPA 5KTPA 3ZY2A 2VRCD 1XG5A 1VKNA 2J4FA 3IP8A 4LHSA 1U94A 3KWLA 3S2FA 3F4LA 4CTNA 4QTYA 2QI9C 2AQHA 4H4CA 1UEXC 4J0EA 5GAJA 4CQLB 4C1NA 1J0BA 3D8RA 2HA6A 3QPDA 1G3IA 1OR8A 2MSWA 3QPCA 3Q8WA 1EGHA 3HI6A 1FNBA 4MR7B 4DV7B 3S70A 2E1PA 1XN1A 1C3OB 1DJLA 2BI8A 3F9RA 3L5KA 1LB1B 2QQ0A 3B85A 4NS4A 4RZ3A 1MX1A 4AWBA 4BX3A 2A14A 2QN2A 1UKZA 4KGZA 4YJHA 1E98A 2WK1A 3RSSA 3WTCA 1Z0DA 1CUHA 1R6BX 3VGPA 4Y1FA 3K3PA 1FF9A 2NTNA 1TT5B 2BGIA 5HFNA 4D56A 3KKNA 1XGKA 1P1BA 3D8TA 2CNKA 4UARA 1PNTA 1ZNXA 4C7OB 3STUA 1T0UA 2YJNA 2PKYX 3DGEC 4ACBA 3ZNQA 2JHPA 2R2AA 1CZHA 2EW1A 2PGIA 1Z4PX 4R0VA 3PXEA 1EUDB 4G5GA 5EERA 5IJ0A 2WBLC 2GD2A 1DWUA 4TKMA 1M7HA 4MZDA 3F74A 4O2RA 2FSSA 2B8JA 3TQSA 4ALNA 1SXGA 1AXRA 1E6EA 3DC2A 3FYDA 2JA2A 3LIIA 1I0IA 2B2CA 2VDQB 4KRGA 1E5XA 4FSDA 1HT2E 2ATXA 3AI1A 2VLIA 4F86A 2IYRA 4A1OA 4IIVA 2W42A 1YE8A 3OUZA 4RQAA 3GL9A 1L6RA 1W2GA 1GQOA 1WMAA 1E4VA 3C8ZA 2XPCA 4XYLA 1Z12A 4RD6A 2NUAA 5FIUA 4BLTA 4F71A 2QTBA 5DGTA 2OVBA 1R18A 3RSHA 1IHPA 1Q0PA 2IU3A 2OORA 1MX3A 3DDSA 2A1TS 1ZISA 2ZRJA 3ZHRA 4UD6A 3HJCA 3Q9UA 1UKCA 4WNAB 2NO9A 5ENZA 5IASA 4NY1A 3STWA 2EWMA 5G53C 4CTJA 3ZS8A 1TAGA 1BEUB 1JYSA 1K7EB 4NJEA 3V2HA 1PTJC 5DKFA 1FE8A 3CVVA 3KU4A 4P7FA 2VNSA 3THOA 1VPEA 3OM1A 2QTLA 3LC1O 3L7NA 4FIZA 1JDJA 1GZ7A 2EX0A 4G5FA 4KLNA 4LGMA 1F8FA 4UULA 4B33A 1I2ZA 1DB3A 3AJ8A 3ENQA 4RJLA 1WXFA 2ZRBA 4HTAA 4UEWA 4TVKA 5E6RA 3OQMA 5JNVA 1C8KA 2CY0A 2G0TA 3R5JA 4DV6B 1JUDA 3Q7RA 5I9MA 4ECAA 1G5HA 4ARZB 3G0DA 1YXMA 5M7EA 4FMPA 3ECCA 4MQ6A 4INAA 1G9SA 4F2WA 1F8UA 4HWSA 1IAVA 4U7GA 1DEKA 1OLUB 1HE4A 1NT4A 5ALQA 4G81A 3VHXA 1PT9A 3FB1A 1EE1A 1F14A 1FVFA 1LJ8A 1R3DA 2G76A 4TUYF 4WVLA 1DAHA 2CD9A 4CL8A 5AIBA 1A8UA 3FN4A 4LBVA 4QL3A 1T9AA 3RO7A 4A16A 2ANCA 5FUQA 3A27A 1B00A 1D1PA 4QYSA 4ZPXA 4F6RB 1WKVA 1GYQA 4NBTA 1FIUA 4P4GA 4BNLA 1G98A 1RRGA 2D2IA 1P9OA 1E7SA 1QP8A 2BY4A 3O1IC 1U8TA 3D2AA 3JV7A 2ZRDA 3ANNA 2X2EA 2Q1TA 2E21A 1EFRD 2HQ1A 3WNDA 1PJ4A 4GYYA 5E4FA 2AWNA 1N9GA 1RQNA 3QU2A 4WDQA 5K0EA 3O84A 3W2IA 5IEJA 1OJLA 1D2EA 2JKVA 1QPBA 2X9LA 3AI2A 3D6FA 4PNPA 5DO9A 1RFLA 2O1SA 4MI9A 2G1UA 1FJHA 1T8UA 4LX0A 1QAMA 2QGNA 4OH7A 4R0MA 1SK8A 5KEIA 5KJ6A 4YI3A 1M5RA 3BFXA 2L0XA 2ZUUA 5HIJA 1AGPA 5BOSA 1T2DA 2CF5A 2OQIA 4BMXA 2ZSIA 4L74A 1IBRA 2XUOA 4INPA 1Y4DE 4R69A 5DHFA 5EGSA 1E61A 1PT7A 5CLFA 2VHJA 2Z04A 1B7GO 3H0KA 3I5MA 4KO8A 4NVRA 2IH2A 5EHXA 2NZ2A 4PZLA 2RAPA 3ZHQA 1NUSA 1Y6JA 3I6QA 2R48A 3IAM1 3M2TA 1T5IA 3I34X 2PH7A 3LM8A 1LWNA 1IOZA 4LGVA 1TI7A 1TYDE 1ZZEA 3TW4A 1B6TA 3NHSA 2EFEB 3IE2A 3LUAA 2X7JA 4R7ZA 3SDSA 5KNLA 2WSBA 4PLZA 4EF4A 1OZ0A 1C7JA 3U1VA 1U2EA 3NIGB 3L4BA 4KDEA 2BDTA 2ZFUA 3JVUA 1KDVA 4CR7A 4OX9Y 2REQA 4JLVA 4AYWA 4XXHA 1HURA 2RG1A 3U3XA 4GQBA 5HE8A 2XTAA 1TPYA 4UBMA 5B58T 3AIOA 3GCXA 1QH1B 5AVZA 1YUNA 3N7TA 4JKOA 2FPGA 1ZPDA 3QNUA 1Q3KA 3BXPA 2YVLA 1EWYA 4D9KA 3LP5A 4L16A 3QVOA 3ZWKA 4X41A 3AVYA 2CHEA 2GAFA 1XA4A 3KKEA 4WCFC 1H6DA 1JR4A 1XKTA 1STOA 4I50F 3ZCSA 2OE2A 2RGRA 2Q5OA 4QODA 4EY3A 3UK2A 2EFCB 1PZFA 1H6CA 4Y6OA 2Q2NA 3B13B 3FPSA 1PHPA 1X42A 1GFWA 1M6NA 1W5BA 2JFXA 3DJFA 3Q40A 2ZG6A 1WUTA 5HIAA 4QOJA 4XE5A 4KQKA 1E2KA 3IOBA 1M0EA 5L4LA 4B47A 4R1OA 1U2QA 1KH3A 1Z6PA 2SCUA 2VOEA 3W2FA 2D2EA 2C2MA 2VYNA 4ZQGA 1A0OA 1IIBA 4O4HF 4PG6A 1YRLA 5FF9A 1KHTA 3L1KA 3Q3GE 4KLCA 3DBHB 3B7PA 1KMNA 2PIAA 3URMA 4P1ZA 2F62A 4MUYA 3S2EA 5HIKA 1PHRA 3EW7A 2JFBA 4JVMA 1FUIA 3DTVD 5KYKA 3AR3A 1YI0A 4DF3A 5F5LA 2R85A 3E82A 5FA5A 3P9QA 3M83A 3K9HA 1H9AA 2RHBA 4DLSA 1F20A 3H99A 2ECPA 5DTJA 3TLBA 13PKA 1KIMA 5L53A 5L6MB 2I87A 4J0DA 5C18A 2H1IA 5AVOA 3PNQA 4OHVA 3R7AA 5EKXA 4CKYA 5JASA 4ND4A 2C9OA 1Z4LA 3DNMA 4I19A 3FNGA 3VOSA 5C81A 1DP4A 3G17A 2QQFA 1O5TA 5BVGB 1NBME 4XR9A 5AKHA 4FDAA 4AS1A 1QTQA 3NHJA 1LPAB 4CT4B 3RR2A 2XV1A 5K1ZA 4QVGA 1U7UA 3GVXA 5C7LO 2I7XA 1NI3A 2RFLA 2ZB2A 4WKOA 4Q3CA 1C0IA 3L1HA 3ERCA 2WQ6A 2R8RA 3WGTA 1KSGA 3L4EA 3QLEA 3EZLA 1EJBA 2XB6A 2WE8A 1MVLA 2P9ZA 1L3BA 4EG4A 3A1CA 3NPMA 3WHIA 1DKOA 1XDGA 4PO1A 3KAPA 2H1VA 3GN1A 2NO1A 4R41A 1U0JA 4J0FA 2HLDD 1MB4A 1Z9BA 3NYWA 4BAGA 5A03A 2JGJA 3PVCA 1BSVA 2ZSAA 4XDHA 3DEZA 4AJHA 3TNDA 3TR0A 3GRZA 1PGQA 2XWBF 3OPYI 2ODBA 3PWZA 3HVKA 4IXDA 3LH5A 3QFCA 4R8VA 1QH8A 2R6CA 4I5FA 3UK6A 2RGGA 4LMRA 4WLEA 5ARBA 5TS3A 2XWQA 3I8SA 1NQUA 2DFTA 2Q4DA 4B3IA 4LHEA 3HZHA 4D9JA 2H11A 2IY8A 2HO4A 3BE8A 4MUAA 2JJYA 3BL5A 3VYTB 2QGFA 4L0QA 2HQBA 1XU4A 5JVDA 1NLMA 3A37A 3MTBA 4CBVA 4FGUA 3AQ4A 2VZ8A 3WS7A 2PQ2A 2DHEA 3WWOA 3I28A 4JLMA 3HDQA 2W70A 5KYNA 1G4HA 2XW6A 4R3WA 2O2SA 3BHMA 1QCDA 3N59A 1PSZA 4FJ2A 5TVGA 3R8CA 1C7RA 4I8XA 1Z5VA 2Q1SA 3KYDB 4EKEA 3SEZA 4ENTA 5HJ7A 4QRDA 1EUCB 2JCSA 3P5BA 4PZ0A 4KVGA 1GGJA 2W4QA 7REQB 2FUKA 3QPVA 2ZIUB 3VSBA 5TS2A 1IOLA 4OHUA 1ZJ4A 1L4NA 4TMFA 4WY2A 4L78A 3AFIA 3AF4A 4TYNA 3HDGA 1GG5A 3TOVA 3HGTA 1BQEA 1U7TA 3F0TA 3K0FB 3QUSA 1QKJA 4XIYA 3OP4A 1AX9A 2AWOA 3GQVA 1YOVA 5EEHA 3JZAA 4KZPA 1KE2A 4KZKA 4BQRA 1N2SA 1DV1A 1KA9H 3KSZO 2DT5A 1ZM9A 3AWIA 1YT5A 1E7RA 1KQ3A 3OTHA 4EABA 1PGOA 1E5DA 3WSTA 5HZMA 1PR2A 1FUKA 2GZ2A 3BA1A 2F3SA 3FVRA 4OP2A 4R7TA 1ZN9A 3VR5D 1TQ2A 2FEXA 4RABA 4Y2XA 1ABEA 1YR6A 1W8DA 4XVQA 2Y4NA 1J06A 1OX4B 2O8DA 3V2UA 1CS0B 1MDBA 1I51A 1ZQ9A 3B3JA 2B82A 2VBGA 4LHVA 1M10A 4YONB 1KMQA 5IJWA 1E2HA 1ZOPA 2JHCA 4L2IA 5JBIA 1YWGO 2YMLA 4WZ6A 5CM2Z 1EUYA 3I83A 5HDBB 3TOZA 4ZYWA 2Q2OA 2W5UA 2PT5A 5BSRA 3E7PA 1Y8RA 4QPZA 2V54A 5A9RA 2ZIZA 3O83A 4AF6A 2X86A 1DPGA 1GTG1 3WA6A 1X9IA 2FEWB 5TGTA 1PG5A 3BYZA 1KR2A 1EM6A 2OCLA 3JVEA 2AC7A 2IPNA 2IXTA 2GN9A 2PSDA 3SEFA 3OZ7A 5D1NA 5DOVA 1O08A 4JWTA 1BMFA 2IZOA 2PMKA 4ZVLA 821PA 5J2UA 2AVDA 3KQOA 2J7PA 2OZLB 1FFWA 2P5SA 3N53A 4MMXB 4EVIA 2DTDA 1DRJA 2GLUA 3G2JA 2LGJA 1N0IA 2I7VA 2YVAA 3BJZA 1I7DA 1A9RA 1O0SA 2FQ1A 3QWAA 1NLFA 3QHPA 4KJXA 3U3RA 2X1LA 2P6PA 1MO2A 4HWRA 2ZTUA 1DIHA 3WDSA 5AVUA 10MHA 4J07A 1ORHA 2AI2A 4L3WA 5J3JA 4WFJA 1G8PA 5ALGA 5K20A 3OCYA 2F67A 1SBYA 3VBEA 1CY6A 4KQ1A 5JS2A 1GTL1 3RHSA 1O6GA 3AOEC 4Q15A 1MO4A 3DHWC 2C98A 1I5RA 1A7AA 1XFAA 2NXJA 1W76A 1E9VA 3KB6A 3GU3A 4L51A 3I12A 5LUAA 4ECEA 3HNPA 4LZPA 4J6FA 5EIOA 1JKXA 2BEUA 4AUNA 5CFPA 4DV3B 1J90A 4BMDA 3E61A 3BWEA 2CLLB 1EKXA 4YP0A 1U1IA 1BMDA 1SVOA 1Q0SA 2OFWA 3ET5A 3T5BA 3BRWA 1DBWA 4IJWA 3N1UA 2Q9CA 3N9IA 4ALLA 2HC9A 2GO1A 3HPQA 5A3VA 4DA4A 3VNVA 3ENKA 3G59A 4F85A 2DR0A 3ENZA 1GCUA 4TL9A 1NLYA 4V3BA 4L50A 2F1OA 4MWBA 1M1UA 3TR5A 3K4QA 1QO0D 3I5AA 3S8YA 1XZCA 2I03A 2JLBA 2YN2A 3ZD6A 1UBCA 4NESA 4IDEA 1KJNA 1IQ0A 1OGJA 4GC5A 4CM4A 3RRMA 3LI2A 1NMSA 3KB8A 5AD1A 3W2EA 1XKQA 2EG9A 4AJPA 2IV2X 2QHXA 2K87A 1WXXA 1XWWA 3HR4A 4OHKA 1KMHA 1KR5A 3BDVA 3PUXA 2HA5A 1UKYA 1M2GA 2L69A 4FTWA 2C2YA 3ZXSA 3G7SA 2V1UA 4RE5A 1FDVA 4IFIA 1YZVA 3DTTA 2JAWA 3PQ8A 4NQZA 5TEVA 4E2WA 3HZRA 1E5TA 4ZREA 3SS9X 4F3NA 2YDXA 2O6HA 3FHLA 2KX7A 1X1EA 5JATA 1NRWA 5I9SA 4CGYA 4R1NA 2QZPA 4UHCA 3IO3A 1NHGA 4JDPA 2CN1A 5B7GA 4YIHA 3CTMA 2WPDA 4CEHB 2J33A 4KODA 1ZS9A 3RGWS 3FGZA 2Y9PB 3WV5A 1U5AA 3OLWA 3SKXA 3O8DA 1SG6A 2II6A 4G85A 4X6YA 3URKA 3V1LA 1YQDA 2WOJA 3IIKA 2CJYA 5JHHB 1CFZA 1O94A 2JCGA 3CEPB 1UJNA 2RG7A 2RGEA 3EXEA 4LA4A 4LOJA 5TGZA 1T5HX 3DBVO 4X71A 1YV9A 2FUG6 4MS3B 2QOEA 4DNFA 2VN8A 3WTBA 2Q6VA 2H9IA 3CLSC 4BBZA 2JAXA 3GLFE 4CIYA 4PG5A 3ZKWA 1HEIA 4H1HA 1UK9A 2W22A 1QHNA 1IC6A 3V1YA 4EUKA 5BT8A 5I3CA 5BYKA 3R4CA 5EE1A 3B6JA 4GR9A 4ENQA 5L3QA 4DLLA 3NM4A 3MZ0A 1GA4A 4IIXA 3LLUA 4KYIB 2OGTA 3RI3A 1DFIA 2VPIA 3FYCA 1TK3A 4WZBE 1OXVA 3ZJYA 2OV3A 3KJFA 4B74A 1O1YA 4WBXC 2Y77A 4LJ9A 1EFVB 1J2YA 2QORA 3IV7A 3JAWB 4B0OA 3NRCA 1N0VC 3F5FA 5KTNA 5CA1F 1P81A 2CXPA 1NP6A 1QFYA 3MBOA 2IIBA 5G4KB 3WK7A 3AM3A 4BFXA 2NP6A 1L5WA 2ZB7A 2WV7A 1ZRHA 3C6ZA 3JD4A 4TPKA 1VSVA 5FUBA 4B85A 3UJNA 1QQ5A 3Q8MA 2FUCA 2CVFA 2BDEA 3DVAA 1NVEA 4L4RA 4Q12A 1G8GA 2C8LA 1T34A 2NT3A 2YJ3A 1CUBA 4J4BA 1W85A 2HK9A 3U40A 2GYWA 2OAP1 2F55A 3Q3HA 4O08A 1YK1A 3GX1A 1BWPA 2OAQ1 4YRIA 3OM0A 2BFDA 1RTTA 4OOFA 4P31A 4YQYA 4RVFA 4BNNA 4W9MC 1VI2A 2G09A 4PHFA 1KYWA 1MG5A 3ONWA 2OZPA 4CUKA 1CF2O 1WULS 1X0VA 5I7SA 3DAPA 3GMSA 1QHHA 5TB5A 1GUFA 2F6RA 3AR9A 1HE8B 3OEED 1OXUA 5AVWA 3U5ZB 4ID3A 1U3VA 2OGZA 2CFIA 4UU1A 3OJFA 4KPGA 1O6BA 2BMWA 4FFVA 4JS0A 1XUOA 2X6TA 4JT4A 4P83A 4PW0A 3A0RB 1UC5B 4K1XA 4EEXA 1HTBA 4ZGBA 5BV1A 3EQ7A 3OCCA 5FPPA 1DJNA 2X2OA 5LXTA 2WWIA 3REQA 1C9YA 1MO5A 3T4XA 5ADVA 4ARBA 4F2HA 1ZGGA 1TZMA 4LRWA 1ESZA 5DGXA 1BA2A 2BT4A 2VJOA 5G0VA 3K2BA 3SXPA 4EM6A 4G5HA 3HM9A 1M1ZA 3PTAA 4RM2A 2Y1CA 4HR7A 1P7VA 3TZQA 1W96A 2Z4TA 3CNQS 4RIHA 4XCVA 4IXTA 1XXLA 2FJ0A 3FNRA 3NALA 4LPSA 1UFOA 3JWJA 1ZRNA 1UM9B 2P35A 4NBKA 3MAJA 1MH1A 3EGOA 5IVPA 4YTEA 1S7GA 3AF6A 3KSDO 2OR3A 3I09A 4NOJA 8ADHA 5B3JC 1GTZA 1RNLA 4Y2PA 3UFXA 3D6MA 5CB4B 1TEHA 2D0IA 4ARUA 4BBAA 1X74A 3EODA 4HB0A 3MGAA 4UUMA 1EHYA 2HRQA 3NRBA 2QW0X 4MWOA 3AI3A 4PLCA 3FLBA 1DVRA 3HSKA 4YJ3A 5DLPA 4MDYA 2FWAA 1ZUIA 2YWEA 1W94A 3T95A 4LJRA 1H8ED 3RYCB 3CG4A 1D7AA 4GAEA 4J43A 2XEDA 4CMEC 5AWFC 1G5IA 2O7VA 4B7ZA 2HNAA 4IDPA 1M72A 3DQZA 2PIDA 4E5UA 1CERA 2C5FA 3E5RA 5CCEA 1FUYB 4YCBA 4HQRA 1MVNA 3FGOA 4S2EA 1CWUA 4RD3A 5PNTA 1NHWA 3N2ZB 4M86A 1K6MA 4NE2A 4QXQA 4X8OA 4RTQA 3PLAE 1ZZGA 2AFIA 3BL8A 1ZI9A 3VX4A 3L0SA 2WU4A 2RAUA 4AKEA 2J3MA 4OL9A 4IWYA 2JDIA 3B1FA 3DE0X 5EC8A 2B8WA 3R24A 1NW4A 4II7A 3MERA 3ZGVA 1DKLA 5AK4A 1IZ0A 2CD7A 4P5PA 3VXKA 5KU1A 4KR2A 2QQEA 3I6MA 4CKWB 5I5EA 3RAGA 1E2IA 3DHEA 1UXHA 2LVBA 4XKJA 3UMCA 1QF6A 1NW7A 2WC1A 5A5VA 3QA3E 3T7EA 3DPSA 1JDNA 2G06A 3N0VA 2Q5IA 3OJOA 4NS1A 2CWWA 5BT9A 3F6YA 3PCXA 4OBXA 4A03A 2P6MA 2PQ0A 2YTZA 1OFVA 4KO2S 5LZ9A 4JENA 3FSEA 2G4LA 4R1MA 5JSUA 1JG2A 5HCUA 1MTOA 4TTAA 5CEFA 4MK4A 3LGSA 1GVHA 4F8YA 5JROA 1ZITA 3FOEC 2F3TA 3ZJ5A 1MQ8B 1P3DA 3W6NA 3LBAA 1N7HA 3EWSA 3HLTA 4JYBA 4N0QA 5AK6A 1Y6RA 1SUIA 3I01M 4K26A 3TEJA 3EQ2A 4PX3A 5A6VA 4FN4A 3GT0A 5JIBA 1JQEA 3IUJA 2RK4A 2B4QA 1H6AA 2HU2A 3CR7A 1XDWA 4HB2A 5CURA 2CNWA 2VYVA 3IQZA 3JQ9A 4KQGA 1TT7A 1B2RA 3JWIA 3CT4A 1Z2EA 1K7YA 1AUXA 1AXEA 1G8MA 1ORDA 1U3FA 2O7SA 5FUWA 4FWBA 4DSUA 4F5EA 1QG2A 3SC2B 4BIIA 4HWGA 4Q47A 4OU4A 2J9YB 5EJGA 1TQHA 1JPNA 4UJ3A 3DHYA 3IXMA 4UVIA 4BNWA 3O2QB 2IHBA 5ADWA 4D99A 4B6PA 4E6EA 4W5JA 2I4IA 2QTWB 2I6UA 5WRFA 5TMBA 1QWOA 2J3DA 1L7RA 2QY9A 1RVDA 3M6XA 4JBWA 4OG2A 3UCEA 2YVUA 1V7PC 1F4LA 3JU3A 1GYPA 5HXAA 3SIXA 3GCZA 1IXRC 3D6VA 4YRMA 1ADFA 3I8OA 5AJUA 1K86A 2QW8A 3UZUA 3RUFA 4H15A 1X1QA 1DCTA 4Y9UA 3ZVNA 4HYQA 3GLVA 2JD2A 2CE7A 3UEOA 2E5LB 3PC6A 4UDOA 4YRLA 4PYRA 4AF7A 4JJ8A 1E63A 1M34A 2Q9AA 3A1WA 4LVUA 2H31A 1NDHA 1QO7A 2YNMD 3K4PA 5L7YA 1JNYA 2HEIA 1LA2A 2E37A 3I4LA 3H97A 5IC5A 1B1CA 4ENVA 3RYFB 2ODWA 5HS4A 5E4TA 2PY6A 4XIJA 5DGHA 5BW5A 3E3LA 4RBNA 3AUAA 1P2FA 1KDPA 4HN4B 3ES9A 2DSTA 2G5PA 1KJ9A 2RHDA 1D04A 1J9GA 1NF3A 5IBCA 2CJWA 4E5SA 1FQKA 3UA4A 3DWFA 5BNFA 1UAGA 4A8JC 5JBQA 4GR4A 2WYIA 3H1TA 3KHUA 2IYEA 3QQ5A 4JSYA 3ZUGA 1XAJA 5JRDS 3FPLA 1JSLA 1R12A 1W35A 1GQSA 2EYQA 2Y3IA 2JK1A 3ZWMA 1J70A 1JLHA 2ET6A 4DSOA 4TTVA 3TKAA 4IDCA 2UXBB 4YCAA 2GWHA 1V45E 3TDKA 1T9GS 1FDIA 2PPVA 2QQGA 1I24A 1UBRS 2FPIB 3K4HA 4A5OA 3CLKA 5GWXA 4BNKA 2FE1A 1AV6A 4TMVA 1C4KA 2ZUDA 4WNIA 1MZPA 121PA 3OWOA 4L8VA 3EDYA 4D4KA 3IDAA 4KITB 1J22A 3EFHA 1F8GA 3ZJTA 3QE4A 1ZCAA 4B6FA 1Q7GA 3DAHA 2YJ5A 1PD1A 1CJCA 4C6SA 2GAOA 1FX0B 4CF6A 4IMJB 5C5CA 2IVZA 3CX7A 4O2AB 2P1ZA 4XUEA 1BH2A 3KWMA 2NUTA 3FDIA 4LOAA 3I58A 2B4YA 3IQXA 3LSYA 1BX0A 3SZLA 1OB2A 1SD1A 1GFIA 1NXXA 4TV8A 4OQNA 2AKAB 3O26A 1R15A 3RQIA 5AQEA 1GP2A 1U0GA 5IARA 3V33A 4XFKA 1NOIA 2QVZX 4DCPA 3Q3IA 1Y3BE 2NXNA 3R0IA 3H05A 3FUUA 3V9AA 1JEYB 5A7FA 4B4OA 2WFAA 4FOTA 1XOIA 3OVMA 2CB0A 2MYPA 1I32A 2ZYSA 1E0DA 2IOYA 4EMTA 2AXPA 1E79A 3KJXA 2VDOB 2OAEA 4G1CA 4LSMA 1Y1QA 2H07A 1VXRA 2GF9A 3CVJA 4PM4A 3JQBA 1N32B 4OUDB 3OLQA 2ZJ8A 2XBLA 1ODKA 4OA5A 1TO1E 4WLOA 1QXSA 4BVHA 1PR4A 1BCSB 3M0EA 3SWWA 3A1NA 3DHVA 2CXRA 4CMBA 2ZDHA 2VT7A 5GV8A 1W581 4LYGA 3ZOKA 4M54A 3K9LA 4Z9XA 4CMCA 4FSXA 2J0SA 1C1DA 4CU5A 1XMJA 1WZCA 1TMOA 4PAGA 5DFAA 1FBNA 2Y05A 3NU1A 3PUVA 4YPFA 2BFEA 3RTGA 8MHTA 4AP5A 5I7HA 5AUPB 3OFKA 3SLRA 4K9QA 1A95A 1SC9A 2VUIB 3UGKA 3OIGA 1N0UA 3EW9A 4JKIA 1FLDA 2RHJA 2X58A 3EGXB 3M82A 4FLMA 2V7WA 4G5QA 4IDBA 3P9YA 5TQ2A 4DGSA 1PFQA 5HUJA 4LC1A 4MYCA 1RAEA 4OHMA 3B7WA 4X7MA 1LDMA 1N8SA 2E49A 2C58A 5D85A 2YYAA 1A1SA 2W2NA 4B09A 4ATNA 2H9YA 2PA0A 4MS1A 5F9MA 5IZCA 3H75A 4L7QA 4AD8A 5I9TA 1Z22A 2YFHA 2EKQA 2OHHA 4IJ6A 4ZPJA 9LDTA 5KDDA 5DHPA 5AI9A 3F4KA 1JFVA 4PQGA 4AZ3A 1ZUNB 4NIMA 2GCPA 4IH1A 3FVWA 4JYMA 4M7WA 4CMGA 3I9OA 5DHTA 3CISA 2VUUA 1CE8A 5D6NA 2PRZA 1MJGM 3CWQA 3GARA 2GM3A 3I0MA 4PBRA 4RV5A 3AJEA 4REQB 2B8NA 1JLMA 1FFAA 5AMXA 1Q1AA 3PTLA 1PEDA 3IPYA 4TTPA 1X80A 4J0JA 2GZRA 3JD0A 4NZ9A 4QQRA 4X90A 3K6JA 1W30A 1G9XA 3K35A 1P5HA 1ZC3A 2OCPA 3HO8A 5E3IA 3H5LA 4Q4CA 3J81A 1CIJA 3K9GA 3PEEA 4B4KA 3K8ZA 1BGXT 1YULA 3IIIA 1QGYA 3PU6A 3RU3A 4LFAB 2AG1A 1JG6A 3HYRA 4L5CA 4C3UA 1SHJA 2NZUG 1G38A 1KEPA 2YV3A 4IJ5A 3UYKA 1Z4KA 2PUWA 3M70A 4Z8XA 1KGSA 3LCUA 2ISSD 5AJVB 5CYOA 1ODIA 5L3SB 1HE2A 5A5EA 1DOHA 1N78A 2P0YA 2AMFA 5A02A 4OB8A 3GFRA 4YAWA 1EDEA 3KLMX 4HNAA 1UZAA 1EDBA 2J3EA 4IW3B 2A1UA 2YHSA 1K0FA 2L18A 3CG0A 1UBHS 3IMGA 1YR7A 2V96A 4V38A 3D64A 4LSWA 2CUTA 4Q19A 4KNVA 3A28A 1Q50A 4X97A 3CZ9A 3HYLA 4CE6A 1BKYA 1VJ5A 2E85A 1XMSA 5EWJA 4E13A 4C4YA 4PRZA 1Z5GA 2WSYB 2VBFA 2DPMA 1IN1A 1VG1A 3WL7A 2ZXEA 4IMIB 3KHKA 3LHFA 1PR1A 5NULA 1NDQA 4WOJA 1CTQA 4CM6A 2NPOA 2W7TA 2HY7A 1FFBA 3TB4A 2GBPA 4BE9A 3HMQA 3N2IA 5BV0A 3WLMA 3IUBA 5HCIA 3KVRA 3QNWA 3SZGA 1URPA 1GJRA 2ECFA 1G21B 4FMCF 3W9SA 4F91B 1JKJB 3KQNA 3DB2A 2FWJA 4ZYYA 4JMPA 2JATA 4TLBA 1D4OA 1HA3A 4A6XA 1RHKA 3PX3A 1Q20A 1O54A 3H5VA 1NM5C 2OD7A 1AU9A 1GAWA 4N5IX 1GN9A 3GJZA 1A9XA 3TLYA 5DNEA 2YUTA 5MHTA 2OYSA 3I2FA 5LBUA 4B6JA 4ZO7A 3U7JA 4M1ZA 3GH3A 1QYWA 3M6VA 5IM5A 3BXXA 1NMEA 1KJJA 3K9FC 3CH6A 5ALSA 3DE4X 1BYUA 2AFVA 1THMA 1NR1A 2WFLB 3PXGA 4CXMA 5G02A 5F73A 4BVFA 3LUFA 5CJPA 4QLBA 2Z98A 3WP1B 3ELYA 1RAHA 4GKVA 2XT9A 2SKEA 3GEDA 1KYVA 1X70A 2P40A 3ZBPA 3E1GA 2QP3A 1P2BA 2JC3A 4QULA 3BJRA 1ECGA 2ASVA 2WJWA 4D9IA 3DLHA 1Q2XA 4AO7A 3DHNA 4OQQA 3D3WB 3HKBA 1P1JA 1WY7A 3H9BA 3DDZX 2A7XA 4B81A 4MRMB 1RM5A 3OZDA 3FY4A 3GT4A 4DWVA 2PUDA 4QSHA 4GXTA 5TIIA 3PDIB 4S0XA 5THKA 4IUDS 4OQPA 1A82A 1ECFA 3MGKA 1RBQA 1NUTA 4F84A 1L5KA 4FI3C 4NAVA 1R8XA 2NAFA 4A0SA 5DYNA 4W5NA 4P53A 2AEEA 3MWKA 1PK7A 4YLYA 2PGOA 2YQ5A 3D0RA 1NW6A 2HA0A 4P4LA 2PMDA 2GCGA 5BYJA 1E8NA 3G2MA 5LP6C 1CLEA 2GPBA 2VJKA 4OL0A 1SQFA 2FPLA 2PCLA 3S4YA 3UYLA 1TMGE 4D2IA 4DUYB 1Q44A 1JR2A 1KRHA 3AF3A 3FNIA 3FPAA 3GGOA 4GRDA 4ZHSA 4M0MA 4Z4GA 1X1RA 2VJDA 4EHJA 1TJ3A 4ZYZA 1HDCA 2FHPA 3VPFA 3G88A 1OXKB 3SQOA 2WSSD 1RRKA 3K72B 1OJ7A 3I53A 4MQ4A 3PITA 3COVA 4O1HA 3VNRA 2HNKA 4YROA 4JJ6A 4AZ0B 1WXHA 1YVEI 3O4JA 1K5PA 4V0MA 3ASVA 3LXXA 4G4GA 1KFCB 4GOOD 4N3CA 5GQSA 2B6NA 4D74A 1GTVA 3PC7A 1PJSA 1NT2A 5AJYA 4DBLE 4YV2A 5IBRA 2W2LD 2CYAA 3BE5A 4Y2GA 3A9UA 5LKAA 1H2HA 3BWXA 3H2ZA 1Y42X 2ZETA 1GPLA 1X92A 2LWIA 2DPHA 4CM9A 2IYPA 4YDHB 3B1YA 4QGAA 3R76A 3BORA 1QP0A 1GNTA 2WF6A 3G1TA 1LDNA 2VHZA 3PR1A 5AR1A 1X1AA 4UTVA 1NAIA 3QHQA 5KKAA 4C5BA 2WQZA 4CDNA 4DLAA 2YASA 3LWBA 1OTXA 2PZFA 5HTKA 4M6WB 4QJ4A 3OOSA 1FQOA 4PG8A 1LV8A 1WMEA 4ZI5A 2DQZA 2QRKA 3MRSA 4G0PA 3CSSA 3OMXA 3TDNA 5JDCA 1CPYA 4OMUA 4C6TA 5BQFA 1ELOA 1LDGA 5ILGA 3M5DA 4ILEA 3AEQB 4UC0A 3QX7A 4K2AA 4K86A 3O95A 2YRXA 1SIUA 2X41A 3LUDA 3O8OB 4IHJB 3V7YA 5HKBA 5KBYA 2G77B 1LLCA 1G8KA 1XF9A 2IE8A 3PPYA 4KBGA 4PZZA 4RCVA 1C7QA 3EOZA 4QUJA 4FYVA 2O3RA 4B6SA 4BFLA 5LM3A 2NVOA 1QMGA 5ESXA 3RT9A 3P2JA 2JIZD 2RHWA 3AEUB 3NXSA 5CT6A 4YH1A 4AP6A 2ZJ1A 1NYLA 2XZTA 3OEWA 3ORRA 4H3HB 4UE2A 5FLYA 4EHDA 3W5SA 3WGKA 3UGTA 1MT0A 2FR1A 4NU0A 3SC6A 4KYVA 5IT4A 3H2JA 1G8HA 1ORTA 4NBLA 3T3DA 3PKIA 4YRDA 1FW6A 3K7EA 3SJAA 4KREA 2R6HA 3AR4A 2FWPA 4R71A 5MDHA 3V3KA 3U9SA 4IIEA 1QTRA 3OKCA 1S1MA 2Y68A 3K71B 3IV9A 1AUPA 3ZLBA 2Q7XA 1XRMA 3N86A 4EKYA 1PR9A 3I1JA 4FC6A 4KWCA 4MDHA 3ZWWA 5E1DA 1FMFA 3PNPA 1EA5A 1YQUA 3FCYA 3MQ4A 4FOLA 3RVPA 4QOSA 1L8LA 1CQZA 1H1LA 3T9AA 4HFJA 1EM8B 2CMHA 1DGQA 2VHXA 1KI6A 1N7JA 1DC6A 4FCVA 4C0WA 2I34A 2P9FA 3NHZA 3OSUA 1ACLA 3L4JA 2I2BA 2DSNA 1Q0UA 1DKNA 1E4YA 2VXOA 1ZL2A 1OI2A 2C8KA 4XCXA 5COAA 3DPIA 3RVNA 2I5PO 5ILOA 1JQKA 3LQ4A 3E27A 1WCXA 1ORRA 3D8SA 3EFBA 3EISA 1X9GA 3ZU5A 4H1WA 3PSHA 3KQKA 1FMCA 1W59A 4FONA 4HKTA 4RPKA 3PFBA 4UVEA 3OEHD 1KC1A 5FPHA 3CZ5A 3PFIA 4UTZA 1S2MA 1WXGA 1T2NA 3BFVA 3LTEA 3T0IA 4FFLA 4DLXA 5GONB 1Y89A 3DMNA 5AJZA 2W98A 2H2FA 1GRVA 1II0A 4C76A 2RGDA 3THSA 2F9FA 3HO6A 4KQEA 3VZCA 5K4HA 3KOXA 3QBEA 4HX5A 1GGFA 1VJCA 2EFDB 3TRHA 1WPXA 3THWB 1T0JB 3IS3A 1XDSA 1U28A 2NU7B 2OY0A 3FRHA 2O3TA 2ZBUA 3CKKA 2J32A 4ABYA 1SUAA 3TECE 2QJFA 1YKFA 1EHIA 1MIHA 4IV8A 1BX3A 4AMUA 1DFGA 1RWXA 2HHCA 3DBLA 2R25B 3KJZA 4FS3A 4QNMA 4RTOA 2C5SA 1XD9A 3IVRA 3IAHA 4CM8A 1PP4A 1RJFA 3LXRA 2NO5A 3W5CA 4FUTA 2O05A 3K94A 1PJTA 5GINE 3KOOA 3ZHXA 2H7YA 4Q18A 1JU9A 3GP8A 3DMFA 1AUQA 1B43A 1OLOA 1U0TA 2AJTA 2AQKA 3I01A 1DO8A 1O8BA 3C8HA 2B1GA 1XZNA 1BHO1 1JFLA 3N39C 2FDRA 4PZUA 2WD7A 3D0KA 5CDFE 3ITDA 2XQVA 1R5JA 1K7XB 3AYXB 5GPBA 1TUEA 3SHQA 1Z63A 2AG5A 3L41A 5KNBD 4GOMD 2GZSA 3KS9A 1ID1A 1XVLA 1TJYA 4C14A 3HXLA 4DNQA 4K03A 5DM1A 1MRNA 4W6ZA 2QD1A 3STTA 2JCVA 2XF8A 3QBJA 2QL6A 2HPZA 3QVXA 4GZ6A 2Q62A 4ND8B 4HQNA 3ZW7A 2B94A 2WG2A 3ZHOA 4E7OA 2YWHA 3L7DA 1RBMA 2PU5A 3QJGA 5F35A 4KUEA 2WY2D 3VU9A 3PDWA 3AUTA 2R4TA 4IILA 4D0NA 1TW3A 4EWLA 1M7GA 2NX2A 5IDQA 3IAFA 4B9AA 4BO3A 3K6SB 1VKRA 1Q16A 3HBLA 3OT1A 2ZSFA 5ERXA 3S2GA 3BWCA 2C78A 2G25A 1FZTA 1YOBA 2HPAA 3IP9A 1XD2A 2FZGA 1GQFA 2XMSA 2PKWA 4MNTA 4XWTA 1J9EA 3IEKA 1QP4A 4JDUA 3FPEA 2D7CA 4LRSB 2CMGA 4XOIA 2VDLB 5LC1A 2Q45A 2W9XA 2E89A 3W5UA 3JARA 4Z99A 4P0TA 1ZVQA 5AW8A 3GPBA 1QZUA 2YICA 4HH1A 4EJSA 4GKKB 4ND2A 1E3WB 6GPBA 4IG9A 1YQXA 1V48A 1DIAA 3I3OA 1CEYA 5HVNA 4Q37A 3S2UA 3MS4A 4AL4A 5FTNA 1CULC 3L84A 5DYWA 3INGA 3N3BC 4OXNA 4U7PB 4KK4A 2O7RA 1DIBA 1EX6A 4CDGA 1H0KA 3DL0A 3SQDA 1IB6A 4GBJA 3ADKA 3ELDA 3LV8A 3HP7A 4ZYLA 1F0KA 1Z16A 4N6GA 2BE7A 2V7QD 1FRQA 4A4DA 1YFLA 4IIHA 1D2MA 4B34A 5HDQA 2IK8A 2O2EA 4XQCA 3X2EA 5KQSA 2HK6A 2HSGA 3KEFA 3UAWA 4UPEA 3HXQA 2MT9A 4J0QA 1R16A 4X3PA 4YNBA 5B1YA 1LK0A 2Q3LA 3U7HB 2Q1XA 1US8A 1V1RB 1KNXA 2CMDA 2E55A 4M0UA 2VJMB 1SR8A 4OGLA 5FNZA 2HH9A 1I4WA 3TVTA 4PN3A 5JH7B 4CYMA 5K0BA 4D5EA 3QKSA 2ZI5A 2RGBA 3VR4D 3OZAA 4ONEA 5CDYA 3PJEA 4B3RB 3DEHA 1R5BA 3OPYB 2ZAYA 1XL0A 5JT1A 2CGEA 3EXFB 4KUHA 2QF7A 4WSOA 1EK6A 2A92A 2UYCA 5CVJA 1TYBE 3KAQA 1AQ6A 3U81A 3GNTA 3BMQA 3BK1A 4C4ZA 3P1JA 4LQLA 4RHTA 3ICOA 1BKDR 4N12A 1CRZA 4O1MA 5A3SA 2EEPA 1V16A 4LIPD 1O5IA 4XEHA 4JLAA 1UL1X 3Q3CA 3D7SA 5J2TB 3BAFA 2H3EA 4D92A 5CB0A 3KR9A 5K03A 2IYOA 3KAKA 4KRXA 2J7KA 1P9LA 3ZE0B 2JLXA 3NUZA 2H8GA 3PA6A 3H3XA 3H83A 4WZAB 3OUUA 4N8DA 3VGJA 1VPDA 4C7BA 5AVJA 2VBIA 4IXNA 3K1AB 3HA3A 1FJXA 1X7GA 3G0HA 3SYLA 4D8YA 3G8YA 5JO0A 4QVKA 2PKQP 3PC8C 3GJQA 2BFFA 3JVDA 2X3UA 5C53B 3LKBA 4F72A 5A4IS 3LS2A 1SKBA 1ULTA 3SX4A 1YR8A 5CBPA 4HGYA 5DCUA 2AXNA 4NJMA 4WWHA 1HETA 2GPAA 4LHZA 4L5AA 3RUPA 2VT2A 1EFAA 2OBLA 3O0DA 3MJRA 2E4XA 4MS4B 5J4KA 1O9HA 5JECA 1UIMA 2P9GA 1TU4A 3EK2A 2BWJA 1AKNA 4FFRA 1NVDA 1V8PA 2JZNA 3BGOS 4Q03A 3BEDA 4RJ2A 4TOIA 3X1XA 1IXYA 4KDRA 2P7IA 5LR6A 2DMRA 2GSWA 4BQFA 5K05A 1PG0A 5T4EA 1OA0A 2Q3CA 1XNHA 1MABA 1EX1A 4D82A 1Z6YA 4NABA 1KDTA 1V1MA 5M29A 1FU7A 1NVVR 2PJUA 2JHAA 5KAPA 3KM0A 5ERYA 1L4LA 1N2XA 3U39A 1T24A 3AW8A 3FX2A 3GA7A 2LIVA 1NNLA 1K88A 3SNKA 1I33A 4Y9RA 3W8EA 3IMCA 4AJJA 3ESXA 2GXSA 2QJOA 2XOXA 1CK4A 2BM9A 2WJZB 3A2LA 1LPBB 1KTIA 2QZ4A 2TMDA 3F6EX 2JKZA 5TLSA 2JFZA 1Z6AA 1UKBA 3RUIA 3HKEA 1Q0RA 3V3TA 1GT6A 4E15A 5IX8A 1R2QA 1ICEA 1YJQA 1HLFA 1UFKA 1Z39A 2H7CA 4AQ7A 4K9PA 2WTEA 3T5GA 1EFUA 1GNPA 3E9NA 4K8OA 2XDAA 3ZWQA 2UVDA 5AXBA 2O2CA 3VC7A 1PNVA 5AJTA 1QONA 1K6IA 2W6IA 1V8DA 4MKRA 3VSDA 3IFSA 4ETIA 4EL5A 3IXQA 3LPDA 4JITA 3KUKA 4M83A 1OI4A 1I8TA 1S2GA 2IY9A 5B3LA 4C2UA 2PLWA 3LA6A 4KQXA 2UZAA 3DZDA 4C05A 2VSXA 4O4JF 3L3BA 1TYEB 1IXSB 3L7YA 2JH3A 4N3NA 3WL8A 4YMUA 3RTEA 1SAYA 3WLHA 4BP8A 4EUHA 4G0WA 2WTUA 4WBNF 4P0QB 1YACA 4DLZA 1R3UA 2DQSA 2MINB 2IYWA 1VECA 1H5NA 2O0HA 2P62A 1FK8A 2OC9A 1UK8A 3I42A 3O4IA 1K75A 2FZ5A 3BN3A 4G1UC 2HZ7A 3KIPA 3SIRA 3U7RA 4YPVA 2Z8ZA 4YRGA 3TKYA 1MH9A 2GYYA 1NXSA 3T35A 4RXTA 3EEOA 4TLEA 1DBRA 1P2UA 2VATA 4KQ6A 4I6GA 1V95A 3C8DA 4D9FA 3DUFA 2PVCA 1I94B 4MKFA 4KV9A 1SUPA 5EMJA 4MVJP 1O96B 1Q3HA 3SBDA 3KQTA 2YBEA 2GFHA 4YGYA 4N40A 2F1RA 3UICA 1RAFA 2FN3A 3TOXA 1EFPA 4JQOA 3KQHA 2BKAA 1WDKA 2R79A 1ZH2A 3QUAA 4PE5B 4NEQA 1TC2A 3S1SA 3T3HA 3AIIA 3DF9A 4PANA 5AXDA 1Z13A 2M6KA 3AKYA 1IIRA 3P9XA 4TUYB 2R5WA 3CC8A 4YO7A 4GLFA 4FFDA 1P4HA 3AP2A 3GCGA 1YBHA 3BGWA 3Q0EA 3WG9A 5IYZB 2XR1A 1I80A 4LRUA 1XTZA 3T9CA 4WKNA 1T1GA 4BX0A 2P2LA 2QVCA 4YP7A 1TIBA 2GILA 1GXSB 1GDHA 1T26A 3SP1A 1UPFA 2NWQA 2ZBFA 5A4AA 3HDVA 3U7GA 3ST7A 3WRXC 4QTXA 1GZ6A 3DEYX 4MB0A 5ECWA 5KPDA 3OCXA 4LJ6A 5CVEA 3F7TA 1JSCA 1SCJA 2XOKA 3REGA 1LPOA 1J00A 5HJ2A 1I4EB 5BW8A 5C2JB 2D8MA 1WPQA 1QDLB 4X24A 3LBFA 1OCEA 2MOKA 3K8OE 1CQWA 1LPMA 3FF1A 5EJ5A 1SQ6A 2W6CX 1IK6A 2Z4RA 1PQWA 4N0DA 4U2GA 1RSZA 3TSOA 2X15A 3ZQ4A 4D9HA 1CNMA 5BN5B 4ER3A 4QOGA 1VB5A 4PAWA 2YWJA 3SXUB 4DC0A 1KYZA 4RJKA 3G9UA 4CLEA 2VPQA 1KORA 4CCSA 1ZK1A 4FMBB 4HDNA 1OPRA 4KIUA 2A9OA 3AR8A 5B7QA 4EB3A 5EL0A 3G6KA 4NXMB 2JFQA 2F9LA 4KR6A 3K0KA 4C4RA 1VGVA 2WHEA 3TGWA 4EUEA 3NFYA 3ZTTA 4OIFA 2OTCA 2PBFA 3BQMB 3FYUA 3P0RA 3PNYA 4WEQA 3LC2O 4OCZA 4ZT7A 5TRTA 2R0QC 1G3UA 4NPAA 3U6KA 2V6BA 3DFZA 4AX4A 5FTLA 1ZIOA 4RGVA 3WIUA 2DFNA 4FNAA 2GN0A 4CODB 3AZOA 1DC8A 1AHIA 1FYDA 3SPXA 1K97A 4B2YA 4KQIA 3V1TC 2HSJA 2FGKA 4BVLA 3CRVA 3RSCA 4YHHB 3HTXA 1CU1A 4NFLA 3N8KA 4BVGA 2VKQA 3FZNA 1BXKA 4F2DA 1PK9A 2HDWA 1ZM7A 2DZDA 2PQ6A 3O82A 2IFTA 3C39A 3EARA 2IYSA 3WGJA 2WIJA 4MLCA 2J3HA 3SJCA 1PJCA 1G20B 3ZS9A 1IXZA 3OFNA 4LZWA 3TSCA 1C3XA 1GQQA 1PW5A 2QTHA 3DFIA 3MF4A 4I50B 2A9VA 4RANA 5FL3A 4JEHA 5IJ0B 1ISJA 1U2RA 1H5UA 2AIRA 3E05A 4EFLA 2NTEA 1N6LA 2K6GA 3A6LA 3PCRB 4E5NA 1WUJS 1IULA 2X4DA 3K9WA 4MGYR 4EO9A 2QTVA 4R1LA 3PUHA 3P94A 4BFCA 1RM3A 5KMGA 3EVBA 5C51B 3MLAA 4LHYA 1Z47A 1NE7A 3PX2A 5ITWA 2Y1DA 1MUUA 3RROA 3VJRA 5G0TA 3T5CA 5BR4A 3UMMA 2GRJA 3AEKA 1QMPA 4ZO6A 3W2TA 1VBFA 5FV7A 4BMZA 3OAAD 1NONA 1G5FA 4GSYA 3T5AA 3L7AA 5LQKA 2MSNA 1H3FA 4YQFA 1OREA 3KHSA 2VHEA 4UW9A 3KUXA 3W0LB 8OHMA 2IYNA 4R8KA 1W48A 3OEYA 1YQTA 3V7FA 1U0FA 4M9ZA 1IJFA 2GARA 4Q3EA 4L27A 2PZ8A 1LS1A 3SVLA 4X6XA 3VR3A 1O9BA 3AR5A 3DZBA 2N47A 4BVBA 1PJ2A 1VHTA 2WJJA 3QFHA 1JXMA 3AJRA 2J5KA 3DO8A 2JCYA 3GAMA 3II6X 3F3MA 2WF8A 3DCNA 4O29A 4NJEB 3D8HA 4RH0A 3EXHC 5JNRA 3N07A 2JZOA 1WUYA 3JXEA 3LW7A 1Z68A 1M2VB 1U02A 1UT6A 4LHXA 3KDAA 3OCVA 2ETVA 4ZDJA 1G59A 2CNNA 1VQ1A 3V42A 1OFTA 2I3BA 2ZBEA 4W1SA 1KQNA 1Y5RA 5IPFA 3W6OA 2Q6LA 4M0FA 4RPGA 4Y67A 3OTOB 1ORVA 3IEXA 4TL8A 1E2GA 1PEAA 2BW0A 1L1RA 3QU9A 3ZHCA 3CN9A 4M9UA 3H5RA 4Y2QA 1FX1A 2FSPA 2GNOA 2AOUA 3WRVA 2PYIA 1VM6A 1F4VA 2HMTA 3LY5A 2WV9A 4LJ5A 4RL4A 4KO1S 3PUIA 4GMXA 4DY6A 4Z4QA 1V5EA 3G8AA 4Q4JA 1Z33A 3A05A 2VYQA 2I54A 2ZREA 3F3KA 4UAGA 3UBTA 2WICA 2XNJA 3JQCA 1L5ZA 1SD2A 1U9IA 4H3VA 3FFAA 1JE0A 4HTFA 4OFWA 4AFNA 1CT9A 1SC6A 4LSZA 5KUTA 5DLYA 4BPBA 4GGMX 2EARA 3EAFA 4PZ9A 1S1CA 1QGAA 3DZJA 3BZWA 5AKIA 3FWPA 3WLLA 3D8NA 5A9SA 1D2AA 2Q0QA 4HDCA 5B1IA 3SS7X 3DP7A 3VOTA 5TPZA 3CVWA 1SIWA 1ZD4A 3ZD9A 2VSNA 4UTPA 1DEXA 3GK3A 5LNK1 2HD4A 3TO5A 3RYHB 3ROPA 4BV3A 2QTRA 1N9GB 1OPXA 4TM7A 4LNUA 1J8QA 1BGWA 5FPSA 4A82A 4BV2A 2C2ZA 3L0ZA 4OM8A 5LJLA 2BSAA 3QVVA 4GVXA 1B6RA 2TS1A 5L9AA 2NO6A 1QU3A 2F3QA 3H1GA 3KQYA 5BOSB 1O0CA 2IWRA 1QKKA 2ZB4A 5E6SA 1FSSA 3SJUA 3LL4A 4BO7A 1RZRA 3CNLA 3L7LA 2CSXA 4TZ0A 4ARCA 1EVKA 4CIDA 3H19A 4M87A 2DUUA 1M5TA 2XITA 4L5JA 4C0SA 2ZUEA 4MARA 3WWZA 1N2CB 1T1RA 2D1TA 5FYQA 2R1TA 4Q5IA 2D5LA 5CLQA 2GAJA 5BRNA 4MW4A 3AVPA 2W2OA 2HRCA 1NN5A 2ZSKA 1TK9A 3GLGB 4AMZA 2HOQA 1KVSA 2TRSB 3TGLA 2I3AA 2P5UA 4NG4A 3VR2A 3E1SA 3VHLB 4A5SA 2XGJA 8ATCA 2BMAA 3E9EA 1KPGA 4HAYA 2OP0A 4WGFA 2AG6A 4PXSA 2IUUA 3T0GA 1BDBA 2LV8A 4MICA 4G9GA 3JWHA 4JLNA 4LNAA 1NC3A 1LDYA 1FOEB 2YV1A 2Q0HA 3OICA 4MW0A 4B76A 4POOA 4K9DA 3W7AA 1XK7A 3P4UA 5FBKA 2OMKA 3QV1A 1SKMA 3PHHA 3ZWDA 5LYJA 1RC0A 5EIWA 4P7KA 5BSWA