4KDRA

Crystal structure of ubig/sah complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
208
Chain Sequence
b'HNVDHEEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFSTLNRNGVKKFIKPAELLGWVDQTSLKERHITGLHYNPITNTFKLGPGVDVNYMLHTQNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-demethylubiquinone-9 3-methyltransferase
molecule tags Transferase
source organism Escherichia coli
publication title Crystal Structure of the UBIG/SAH complex
rcsb
total genus 69
structure length 208
sequence length 208
ec nomenclature ec 2.1.1.222: 2-polyprenyl-6-hydroxyphenol methylase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kdrA00
3E05A 4M37A 1M0EA 3P71T 4IV8A 3TQSA 3WSTA 3KPUA 2NXCA 5GP1A 4RTPA 1VPTA 3GCZA 1RI2A 4GBED 2XVAA 1UFKA 4ISCA 4P7GA 4FGZA 3FPJA 4ER6A 1AQIA 3CKKA 1L3BA 2C7QA 5DX1A 1X1CA 3HCAA 5DX0A 3OU2A 2AS0A 2FHPA 2NXEA 2XYRA 3M4XA 3P9NA 4LG1A 5FQNA 3FUVA 3G7UA 4DCGA 4R8SA 1O54A 3OFJA 1NT2A 1INLA 3UJDA 3KPWA 3O31A 2BR4A 3HA3A 3MTEA 4PIMA 3U81A 3HCDA 4E70A 3BZBA 4RVGA 5LQJA 3P2IA 1DCTA 1VIDA 4HC4A 3C0KA 4X61A 2VDVE 2E5WA 4KW7A 4CXMA 3LBFA 3PLAE 5FHQA 3LX6A 1G60A 3ELWA 3MQ2A 5CM2Z 4AZWA 2JHPA 3B3GA 2AZTA 5EC8A 3GXOA 4WVLA 4KDCA 2WK1A 4YV1A 5FHRA 2UYOA 1YF3A 1RI1A 2H1RA 2P40A 3ANXA 3K6RA 2VDUE 5HZMA 4GOLD 5EMKA 1KIAA 3R24A 1JQDA 3NW9A 5EZSA 3KHKA 3FUUA 3EVZA 2QM3A 3AJDA 4PYJA 3P97A 3ELYA 1OR8A 5KS2A 3G2OA 3BGDA 3A4TA 3PB3A 4FSDA 2B9EA 4PYKA 1YUBA 4F86A 1EJ6A 2YXEA 5LQNA 4EMSA 5K0CA 5GM2A 1ORHA 1NW3A 4KWCA 4QTUB 4Y2HA 4C08A 2C7RA 1JG3A 3A7DA 2VP3A 5EHIA 3UJCA 3G88A 3L8DA 3BUSA 4GC9A 5G02A 5HOQA 5K0FA 4QVKA 2Z6UA 2PV0A 1I4WA 3GO4A 2IIPA 1XDZA 4U7PB 3CCFA 4OQDA 5E2AA 3HVIA 4CWAA 5FULA 5BP7A 3R6TA 3EVGA 3KR2A 3UFBA 5ICGA 3G5LA 4KRGA 1QYRA 3I58A 5EEGA 1D2CA 3M70A 5CIYA 5EG5A 4V0RA 3GRRA 2EG5A 2ZZNA 4LWPA 3TM5A 1SUSA 1IY9A 3GU3A 3Q87B 5DRTA 1O9HA 5DRYA 4RV9A 3SR4A 4K6MA 3G2PA 2EFJA 1QAMA 1WY7A 3OPNA 3FTCA 1NBIA 3NDJA 3MTIA 4IWNA 4Z2YA 5CCXA 1I9GA 4YV2A 5DWQA 2XBMA 3GWZA 1L1EA 2AVDA 2GS9A 4PWYA 2PT9A 5DSXA 3RIEA 5LQAA 3T7TA 1ZKDA 4IKPA 3LKZA 1KP9A 1F3LA 2Y1XA 1EJ0A 4ZTBA 1EIZA 2IDJA 2A14A 1SQFA 3T7SA 4PYMA 2QRVA 2QE6A 4RTLA 3FRHA 1ZHFA 1FBNA 3GJYA 1RJFA 2O07A 2PX8A 5ICCA 3HA7A 4ER7A 1KYWA 5K0GA 3ME5A 1Q0SA 4P7KA 4ER3A 4O29A 2GPYA 2G72A 3DUWA 4RYLA 1RJEA 1KR5A 1P91A 5ICEA 3S68A 4BLUA 5HIJA 3EVCA 3PFHA 3BT7A 2QYOA 2ZBRA 1DL5A 1EQAA 1FPQA 1P1CA 1PJZA 2JH8A 3AY0A 3BWCA 3C3PA 3MAGA 2OB2A 3O4FA 2ZULA 2EJTA 2FPOA 1O9GA 2FRXA 4JXJA 4P7JA 1N2XA 2PJDA 1VLMA 3VC2A 3P2EA 4QPNA 2NYUA 4MTLA 1H1DA 2YVLA 5LQUA 3UA3A 2DPMA 1SVUA 1BKYA 2F8LA 4LWOA 4RTMA 4PIPA 4HTFA 1BOOA 2FK8A 2PXXA 4E31A 3SSOA 5HIKA 2BM9A 2P3QA 5HIMA 3UJBA 8MHTA 2QY6A 3QOWA 4YUVA 2IBTA 4UOEA 1RJGA 3OFKA 1QAOA 1R8XA 4BP3A 4YUYA 3HNRA 2XVMA 4EKGA 5E8RA 5DM0A 3BWYA 3DP7A 1IM8A 2O0LA 2PWPA 1XJ5A 2AOXA 1ZGAA 3ERCA 2ONYA 4YMGA 2AOWA 5K0JA 4HG2A 3BXOA 3UA4A 3PT9A 2G70A 1XCLA 3BWMA 3EMDA 3LDUA 1YB2A 5T64A 5K05A 2PX4A 1YZHA 2JH9A 2Y1WA 4GOOD 4XCXA 4BP1A 3TRKA 5E9WA 3KQPA 5GM1A 2AN4A 1L3IA 2ZIFA 4DMGA 5BXYA 3DOUA 3TFWA 5C0OE 3CJRA 2PX2A 3A7EA 4E30A 2QRVB 2YX1A 1UWVA 4E2ZA 4OBXA 4CKBA 2BH2A 3UJ9A 2YXLA 1ZG3A 3BKXA 3G5TA 2EJUA 4KIFA 4MWZA 2IFTA 2VDWA 2B78A 2AOUA 2AR0A 2P3OA 4HGYA 1ORIA 4PYOA 2OYRA 3JWJA 3M6XA 3KQWA 5DSTA 5E2BA 5LQRA 4XUEA 2AOTB 2AOUB 5DXAA 3MCTA 5D1NA 5K03A 3A27A 5CVEA 2JHCA 1F38A 3KR0A 2I6GA 5JUWA 3FPGA 3JWHA 2ZIGA 3FUTA 1R74A 2Q41A 3MGGA 4U7TB 3LPMA 2ZVJA 4GF5A 3O7WA 4AZVA 3REOA 2FK7A 4E2XA 2O06A 3V8VA 4PNEA 1BC5A 4QVGA 3ER9A 1WXXA 2NP7A 1ZQ9A 1G8AA 4DF3A 2OB1A 2IH4A 1NV9A 1VBFA 2CKDA 2LD4A 3OZRA 4OA5A 2ZWVA 1X1AA 2OZVA 3ID6C 3M6VA 5FTWA 3GRVA 3EMBA 1NBHA 2WA2A 1MJFA 1Q0TA 3ELUA 1WS6A 2AOTA 3TLJA 3SSMA 1D2GA 2V7EA 5EKXA 3SMQA 3LL7A 5HFJA 4KDRA 2YXDA 1PRYA 5E1BA 2AOVA 2JJQA 3NWBA 1NW8A 2GB4A 3EGIA 4NECA 1B42A 5K0LA 4BLWA 2NNWB 3DH0A 1L9KA 4CTKA 1HNNA 3BGVA 2R3SA 5DXJA 4DM3A 5EPEA 9MHTA 2EX4A 3CGGA 1TW2A 2O05A 3DXXA 3DR5A 3OE5A 3T0IA 4ATNA 5E1DA 2IH2A 3GGDA 3JWIA 3HTXA 4E33A 5E9JA 3G2MA 5FQOA 3C3YA 4G56A 3NMUF 1Z3CA 1NV8A 4YUWA 4P58A 3IEIA 4Y30A 3A26A 1FP2A 2ZLBA 3EGEA 3DXZA 4X63A 4A6DA 2UYHA 2NXJA 3CJQA 4QPPA 4F84A 3P8ZA 2PT6A 3SM3A 3UJ8A 4A6EA 4E32A 3PFGA 5LQKA 3ER8A 2FCAA 2ADMA 2OKCA 1NW6A 5DLYA 3SXJA 3NWEA 3HEMA 3FYDA 5LSAA 1SG9A 1KPIA 3VC1A 5CD1A 10MHA 3GIWA 2HR1A 3FPFA 1VP9A 2PSSA 4GC5A 3M6WA 4C03A 4F85A 5HILA 3B3FA 3E8SA 4PINA 2GAFA 3BWBA 4PCAA 4QQKA 2ZSUA 3V97A 1DUSA 3UBTA 5FWAA 1SKMA 1G6Q1 2PWYA 1NKVA 3HVJA 4IV0A 1QANA 3EVDA 5EEHA 5E8JA 2DULA 3RODA 4RVFA 4OA8A 5CVUA 1VQ1A 2G71A 3FPEA 5DM1A 3THRA 4PGGA 3TKAA 1IXKA 1MHTA 3HCCA 1JR4A 2ZFUA 5GIPE 4RTSA 3AXTA 5DTRA 3DULA 1D2HA 2ZW9A 4HTFB 4QTTB 3P2KA 4X41A 3AXSA 3K0BA 2XYVA 4DA4A 3M33A 1NW7A 1NW5A 3QOXA 3E23A 1U2ZA 3G8AA 5GOZA 4E2WA 4DCMA 3DLCA 5EMJA 4EQZA 2I7CA 5M5BA 1JG1A 3EVEA 1EG2A 3NTVA 1WXWA 2CMHA 3GDHA 3KR9A 3PX2A 4XUCA 4CKCA 2PY6A 2CMGA 3C6MA 4MQ4A 2OXTA 3FTEA 1NE2A 5T67A 3EEOA 1Y8CA 2HMYB 2OBFA 3CC8A 4C06A 4GOND 1SQGA 4PYQA 3IHTA 2K4MA 5FA5A 4C4AA 3SSNA 1G55A 4MIKA 2ORED 3G89A 1KPHA 5FADA 2YTZA 4C05A 4CTJA 2P35A 5BW5A 5C1IA 1VP3A 2AVNA 1TW3A 4XUDA 3OU6A 5DTQA 5EIWA 5EKUA 2OY0A 5H02A 2B25A 4CKEA 5LQCA 3GRUA 1QZZA 3DMGA 3TKYA 2YR0A 3PX3A 5K0NA 4GQBA 4EK9A 2V74B 5CUQA 1YZ3A 3LBYA 4YMHA 3LDGA 3IV6A 4RSRA 1XDUA 3P9CA 3BGIA 2GA9A 2HV9A 4AUKA 1HMYA 2ZTHA 3X0DA 3FTFA 3KQQA 3B89A 1G8SA 1JSXA 2KW5A 3KQMA 4HH4A 5ICFA 2OO3A 1XVAA 3B3JA 2UYQA 4KVZA 1RI5A 5FA8A 3TPZA 5E1OA 4C07A 5KQSA 3EEYA 5DX8A 4RTNA 4RTRA 4M38A 1RI4A 3DLIA 2GH1A 3LCUA 3R3HA 4C04A 1AF7A 1I1NA 3G8BA 3M6UA 5HIIA 2ONZA 5K0EA 4PGHA 2IBSA 5F2OA 2PXAA 2OPBA 1X1BA 1JQEA 2P3LA 3FTDA 3LHDA 3B5IA 3KR1A 5CVDA 3D2LA 2PX5A 3TR6A 3AWIA 3UJ6A 4E2YA 4ER5A 5LR6A 2IPXA 3TM4A 4QQNA 2VS1A 3FUWA 1YFJA 2HWKA 3OU7A 4RX1A 4RTQA 5EZQA 4L7VA 4HSGA 4RTOA 1JG4A 2C7OA 3EVFA 2P1DA 2I9KA 3H2BA 3DTNA 5FWDA 1ZGJA 4M36A 1YFLA 1XDSA 2IH5A 1TPYA 1WG8A 2BZGA 3ELDA 1N7IA 2ERCA 2O57A 5GWXA 4MHTA 5EMMA 1KYZA 4PONA 4FZVA 1FP1D 3B7PA 5E1MA 5BW4A 5KVAA 3F4KA 1G38A 3P9IA 5HEKA 4PYIA 3R0QA 4GEKA 4DQ0A 2R6ZA 2B2CA 1P39A 2BR5A 2VZ9A 5EVJA 5IH3A 5GINE 2JG3A 2ZIEA 3HVKA 4R05A 3OZSA 4YUZA 3FPHA 2BM8A 2IDKA 2P8JA 4FT2A 3SVZA 4RTKA 1T43A 2H00A 2P7HA 3A25A 3LCVB 3MHTA 3IYLW 3PVCA 2PBFA 4LECA 3TOSA 2IGTA 1WZNA 2ZCJA 2ZZKA 1JG2A 3NDIA 3TMAA 2FYTA 3EGVA 2ESRA 5IKMA 3DMFA 2ZBQA 2AN5A 3KQYA 2WA1A 4RVDA 2XYQA 3CVOA 4AZSA 2PVCA 5DTMA 1BHJA 3CJTA 5ERGB 3UJ7A 5K09A 5U4XA 2Z6QA 3PS9A 3QV2A 1KHHA 1XTPA 3KU1A 2BR3A 3MERA 4FS8A 5B1SA 5JR3A 3RW9A 4X1OA 5K8VA 2HTEA 5EHGA 3KQSA 4FSXA 2HNKA 1KPGA 4FR0A 5F2KA 3E7PA 1FJXA 4PCLA 3GNLA 1X1DA 3MCZA 5DM2A 3UJAA 4FP9A 5CVJA 4OX9Y 5FUBA 4H0NA 3DXYA 4R6WA 2H11A 3NJRA 4YV0A 5KYGA 2G1PA 3DMHA 3LCCA 1L3CA 3EVAA 2N47A 1JTEA 3LGAA 5EOVA 3HM2A 4B17A 3EPPA 1AV6A 1VE3A 2P7IA 3OZTA 1XXLA 3NVMB 2NP6A 5EMLA 2I62A 3SX0A 1M6YA 3I64A 3THSA 2UYCA 4HGZA 5K01A 3I5UA 3I9FA 4FT4A 7MHTA 3HCBA 2GLUA 4HRAA 4EKIA 2PLWA 3UZUA 4R8RA 3HVHA 1EAMA 3OCJA 4POOA 4RTJA 2Z6AA 3SGLA 3LSTA 3Q7EA 2NXNA 5EQJB 2P41A 4RWZA 4QDKA 4DKJA 3OE4A 3KPYA 1M6EX 5KQRA 4GOMD 4PYNA 3KQTA 5D1HA 3VSEA 4P7FA 3UWPA 2ZZMA 5DM4A 3FRIA 5FCDA 4R6XA 2IP2A 3KPVA 5K0BA 1KXZA 3ORHA 2YQZA 2PGXA 3KQVA 4BLVA 3NVKI 1JSZA 1JQ3A 3KQOA 2CWWA 3LDFA 1P1BA 4GUAA 4QDJA 3FZGA 4RVHA 5P8WA 3T7RA 3R9XB 4BY9E 4OQEA 1VL5A 3PTAA 5MHTA 5DPMA 5CCBA 1RJDA 2B3TA 3MB5A 2AN3A 4AZTA 3FYCA 1AQJA 3C6KA 3EVBA 3P9KA 5EIFA 5F2NA 5E9QA 3HCEA 4WXHA 4OBWA 1JTFA 4EVIA 3LKDA 1R8YA 2YUIA 3FUXA 5T6BA 4AX8A 3BKWA 1R00A 1RI3A 3LECA 3KPJA 4M7RA 1X19A 1QAQA 1SUIA 4X60A 5EGSA 1R6AA 3CBGA 2CL5A 1UIRA 4DZRA 1V39A 3GRYA 3HCFA 4KIGA 5CVVA 3G2QA 3HP7A 3HA5A 3I53A 3KKZA 4PYLA 4V0QA 4YUXA 2G8NA 1N7JA 3VYWA 2C7PA 1R18A 5GIOE 1XCJA 2JHAA 2PKWA 3JWGA 5DT2A 2UZ4A 5C9ZA 2ZWAA 2PXCA 2ZBPA 4ER0A 3GRZA
chains in the Genus database with same CATH superfamily
1GNTA 3EEQA 2XOXA 2LDXA 3PI7A 3NIBA 3IPLA 1JPUA 3ZV6A 5K8IA 3CX7A 2VJKA 4I2VA 5JSFA 3UMYA 4GZMA 5L4SA 4J0QA 4D9CA 2I3DA 4YYEA 5KNBA 4WLEA 1AQIA 1CB7A 3HBJA 2J0UB 3F9IA 2HDWA 4JBGA 1SURA 2B6NA 2BC9A 4FONA 2WJWA 3MTDA 5KVQA 5KOIA 4DCGA 4EATA 3KZVA 4MYTA 5MFPA 2BV3A 4OB8A 5ALUA 2QX4A 1V7ZA 3L82B 4K2HA 3ZWPA 4ZGWA 4JEUA 4YMVA 2CGEA 4TM8A 5KQGA 4KEAA 2YXNA 3PWKA 4JAVC 3R7SA 2DFNA 2WKPA 4EYOA 2DKFA 3DWIA 5JSZB 1GQYA 2KB0A 1EDZA 3PUYA 4P1ZA 1E3EA 1ZI8A 3UIEA 2PEZA 3ZK7A 3GXOA 5LMNB 1V5FA 5IKOA 1H3NA 3VDXA 3UK6A 5JJLA 3BRQA 4M21A 5H8WA 1GA4A 2W9XA 1GGNA 3K6RA 4B6SA 1U2DC 5HUHA 5HZMA 2DERA 3T7DA 3ORFA 3G5UA 3TW0A 3GQVA 3WGIA 3AW8A 2F3PA 3KHKA 4EKNB 4CETA 1MEEA 3GJZA 3NEJA 4LJSA 1BO6A 4GI7A 2DKNA 1R4MA 1HFEL 1YB6A 5CB4F 2XNKA 2JL1A 2XKKA 2VUUA 4KO1S 4BKOA 2B9EA 3JTMA 2BDUA 3NAZA 1E8MA 2F43A 2ODBA 1NI4B 4PBSA 4YQYA 2XUIA 3ASYA 3D5TA 2JCXA 3KLPX 4LNHA 3OLZA 4LRXA 1H69A 2VJAA 2CV1A 3A6PC 1HQDA 2HF8A 3FKQA 4GM1A 2QT9A 3F6YA 2WTXA 3OC6A 1S02A 3BRWD 3DBOB 4OJMX 5EJ6A 3V8BA 1WETA 1XDZA 1JEDA 1UZUA 3BBPA 3EXHA 3HVIA 1SBZA 2GCOB 1IZ9A 2I99A 5KNCH 3UFBA 1KJYA 1RQ7A 2YYSA 1Z56C 2WVJA 4YUAA 4K8RB 4OSOA 4Y18A 4CI9A 3ZQUA 1E5LA 3GRRA 3GDOA 1FLDA 2RI6A 1ACMA 2HPHA 1Y9EA 1JQAA 2JLCA 2VLBA 3SZMA 3NXSA 3TAUA 3JAMA 3GT7A 2VXYA 1IY9A 3H9BA 2G28A 1TO1E 2GZ1A 4YPOA 1RWVA 4XWOA 1JG6A 3ISVA 2Q99A 4UASA 3W8FA 4RPLA 1GPJA 2WM3A 1GA1A 4WCFC 3VYVA 3DWGA 4WY8A 1BEUB 2PWAA 2X42A 1V3TA 2ZUVA 2WQ6A 4ZDIA 3NBFA 1YZNA 1QYIA 3TQHA 4AP9A 5KNCA 3R20A 4I5DA 3M6LA 4HI0E 4Z4QA 3HB5X 4LTNA 4B43A 1PI3A 1W2GA 4QJ5A 5BSKA 1M5TA 2QMQA 2GCGA 3CX8A 1REQA 2WHRA 2VEDA 4MI9A 4QAQA 5DI3A 3I04A 4Z0TA 3H7IA 3FF4A 4JK3A 4UTVA 1VMIA 1CJKC 1EXWA 3QELB 3OQBA 6REQB 1FMTA 2FUG6 1NQ5A 4GXTA 3MCVA 5J5CA 3GC6A 5FJJA 3W9BA 1AUPA 3CPHA 2JIZA 3WJ7A 3O9ZA 3FI9A 1QGDA 2R96A 2Q5HA 1DLIA 2V5UA 4U0KA 3IDOA 4F71A 4O2BF 4X8HA 2JNWA 2A84A 5EWJA 5TARA 1PL0A 3AY0A 4INPA 4IOJA 1KVUA 3ND8A 1O1YA 3C5HA 2OGUA 3D8RA 4JJ6A 2CCGA 1X0XA 2XDWA 2PJDA 2XT6A 1RHMA 3SKYA 5ILGA 3OWOA 3P2EA 1C0EA 3RLIA 4UNNA 2R8EA 3FN4A 3PEFA 1M5UA 3CLUC 2NVUB 2ZYTX 1NAHA 1ADYA 4PSDA 1R37A 2F8LA 2ZB2A 1Z0JA 4A6XA 2ZQ5A 2YJGA 4RQTA 2LCQA 2FK8A 4BZQA 4GI1A 1XTIA 1FL9A 5JSYA 2PDAA 3QOWA 5CH3A 3VU8A 1RJGA 2CFTA 4XGIA 5TNXA 4CMHA 4JT8A 4MHOA 3VR1A 2DVMA 3ZCXA 4U39A 3W9SA 3RVSA 5EP3A 3HN6A 1CIVA 4DARA 1WF3A 3ZHBA 2A0XA 1S2IA 2J41A 3UHJA 5KTSA 3QEAZ 3VPAA 3B1VA 4EHFA 3L49A 3TBFA 4P35A 4C6TA 4EX7A 3UK0A 1QVWA 4N0EA 2BEKA 3P0FA 1TXGA 1XO1A 2FA9A 2OBYA 4ZHQB 3O0TA 5AM3A 2GZ3A 3W7BA 5KNBH 4KLNA 1ZIOA 2A4MA 1SUDA 2QHXA 3HYNA 1OFVA 3PPVA 4JYPA 4XTCS 4I81A 2F1OA 4KK4A 4XCVA 1BDJA 4G5FA 5CK4A 5HUQA 3UMSA 2CHVA 1KWKA 1LEHA 4DA9A 1NF3A 5KYXA 1FZQA 3WAKA 3LWNA 2BE7A 2CVHA 3B6JA 5H59A 2WTAA 3UJ9A 1MQ9A 1LUAA 2PMWB 5CB4A 1PJAA 1BCSA 2BZSA 4UMEA 2AOUA 4GX0A 3ND7A 4BB5A 1GFSA 4HY3A 5DHAA 2O52A 4YRGA 4YXFA 2BE9A 3LC1O 2G77B 3FI0A 1VOTA 4KQ2A 3KQWA 3X1WA 4BMSA 2FZ4A 3SZ3A 3KVVA 3N8KA 3AEUB 2AOUB 2IWHA 3ZWAA 4RNDB 3AVVA 3GT3A 4H7KA 5CXXA 4BLOA 2F8TA 1I3OA 3I12A 2IP1A 2DLNA 1J1ZA 4R5HA 3CT4A 4G89A 3DBLA 1Q6YA 4D8WA 2V7QA 3NOQA 1L7PA 1XTZA 2R1VA 3R6LA 1SBNE 2IITA 1MW8X 3RYFA 4GW3A 2D06A 2PMEA 3ZV3A 2IX3A 2Y71A 4E88A 5KCMA 3KYCA 5HM6A 1NT4A 1OTHA 1BC5A 1TCVA 2LKCA 1T0HB 4AROA 1G5IA 1NX6A 2BD0A 2VSQA 1QYWA 3TNJA 1TM2A 4A8JA 1LSUA 4BGIA 1Z47A 1U3TA 1JEOA 1WZUA 2D1QA 2A1TR 1C80A 3PPWA 1XLTC 3CR3C 1LPSA 1NA5A 4HJXA 5AKJA 5TGDA 4BRZA 3M6VA 3O8QA 3I5MA 1B14A 4NBWA 1Y37A 4HCJA 2OCGA 4ONEA 2AFHE 5JATA 1E92A 3FHLA 1JH8A 1D2GA 2V7EA 4PFQA 2W8BB 5EKXA 3R77A 2OHJA 2EX1A 2Y4OA 1GTZA 4L22A 4OHFA 2HA5A 1NSFA 1EJ2A 4JB0A 4OYYA 4DOMA 4E2FA 4Z3DA 2J3LA 3ONFA 4MDEA 1R0YA 2C5HA 3DO6A 1GPBA 4QPDA 3Q6MA 3Q3EA 8ATCA 1N5DA 3HCWA 3OE5A 2NUTB 3DXXA 2SNIE 2CNOA 2VG8A 4FINA 3O1HB 3Q7RA 1PHPA 2UZIR 4KTTE 4NAUA 2WW8A 5E1DA 3WE7A 4RDHA 1S2MA 4E33A 2B4KA 4G56A 4L6CA 1HYEA 3VJMA 2L19A 3VPCA 3LYHA 1MAAA 3CVWA 2AKYA 1RM3A 1X1RA 1S5PA 2CK3D 1N3LA 2FRDA 1UBMS 3DZKA 3IAXA 2PLRA 3LC0A 4RKYA 5IS2A 3ED5A 3PE6A 4HS4A 1S2LA 3BQ9A 1E1LA 3D3KA 3CEPB 4KGXA 3UJ8A 2FCAA 3ZLUA 4CCAA 3K1ZA 4CKBB 4LXGA 1RPZA 5TQVA 3LX5A 4DKXA 2ZXUA 1SG9A 1K8ZB 5THKA 4F72A 1Z7BA 4C2UA 2ATXA 2QVBA 1GR1A 4H17A 2HN9A 4QRHA 1HL7A 1SB9A 4W5WA 1T15A 2XUKA 2BGJA 1Q83A 4PCAA 3K8OE 2WYVA 2Y0BA 1ILEA 1SCAA 2NO7A 1LSOA 1J70A 4LRUA 4JMLA 1HA3A 1OFHA 1YJAA 3FR7A 3O3NB 4IV0A 4U2EA 2RAVA 3EVDA 3PR1A 5EEHA 1CJUC 1NJ6A 2IYRA 1CP3A 3RRBA 1XEAA 1K8RA 1VQ1A 2G71A 5K8UA 3THRA 2REBA 3FPKA 2YWDA 2ZFUA 4H6XA 3T7CA 1HG0A 2QSZA 3JVUA 2LDBA 2ID4A 4D41A 3ZNPA 4C76A 1SD1A 1XDDA 3NV7A 4HAOA 2C3OA 4DA4A 3E23A 4IS3A 2IEZA 4MCHA 3ROPA 1LTKA 1HYGA 1R9NA 3OTWA 2AG8A 3R0XA 1TX4B 3TCXB 2O8EB 5M5BA 3EVEA 3JQ8A 5L51A 2YMQA 1KI1A 4MULA 3INTA 3QPCA 4IZIA 1XRQA 4KQGA 1Y7HA 1NQAO 4M8LA 3NBZC 1F17A 1Y5IA 4PYQA 1USWA 1XTJA 2GAIA 3F3MA 3BZUA 2Q3LA 2H1IA 4II3A 4BNNA 3AHIA 4DQXA 4RD0A 3PJDA 4PWZA 5HCUA 1UPBA 5AHKA 4W5RA 2X7XA 3KTOA 3LYAA 1RBYA 3W90A 5IANA 1NZDA 2O5EA 3KFVA 2B5OA 4QKQA 1DXYA 4I3GA 1IU9A 3FJ1A 4B48A 4BEWA 1SXIA 4U5QA 1R64A 3HABA 4BP9A 3FFBA 3PENA 2FQQA 3EARA 4UW9A 3T5DA 1QPZA 3LZ6A 5E6SA 1E62A 2YIVX 5JCPA 1GQFA 1IEQA 1GSHA 5DTIA 2REQB 5M3BA 1AH2A 1ODIA 2WJ6A 5LZ2A 3SXUB 2NYVA 1H5QA 3BREA 3B3JA 5EXTA 5HPYB 4CLEA 4N41A 4KREA 4ZEMA 1MC5A 3KO8A 1E3IA 3SVLA 4MO9A 3OSUA 3L8YA 4CV0A 1ZU4A 4RLQA 3TE6A 1RI4A 2R8XA 3K2BA 3KAKA 3ZD8A 2F9FA 1VHWA 1A04A 3I5AA 5IKXA 3GZTB 5FV7A 1NXVA 4NAHA 3TNYA 1YH3A 5F2OA 4AAYA 1I6WA 1VHTA 1RAIA 2CLCX 3H83A 4ER5A 4UU7A 1B8VA 5ES3A 4Z7NB 4MZXA 4U00A 4V0LA 3L0YA 4CV1A 1EGAA 1YR1A 2HA4A 3AINA 4QPCA 1K3FA 3O47A 1U04A 1UOPA 1YMUA 2W2KB 1D2MA 4KLZA 4MWCA 2ILVA 2CB0A 4FYWA 4KQEA 4R2LA 5TPZD 4M36A 1RWXA 1XLTA 1U2EA 1Y89A 4UBKA 5TXGA 4YB8A 5I9LA 4YRZA 5JSUA 1B16A 5JAPA 4NYMR 4I8IA 2AE2A 2H1VA 3QY0A 3RJTA 1G63A 2FEOA 4BBJA 4H7JA 4HWSA 2XDQB 2Q5LA 3BIFA 4PIVA 1UBFA 3H5RA 4LFBB 1TCCA 4X1YA 2NO1A 3VO2A 3BGSA 1MLDA 2H00A 5EJ4A 3RWBA 4UCXA 3GT0A 2I29A 1O94A 1VLVA 1PK8A 2PBFA 3IAM6 1AQ6A 2BJVA 3JW8A 5KMGB 1D3AA 2PZEA 3CNBA 2JAOA 1M75A 2YFKA 1JMYA 2WAMA 4CR7A 1U4SA 1Y1PA 4NDNE 3DMFA 5IKMA 1WCIB 4F2PA 5B3AA 1WEHA 2WA1A 3OMLA 3RVDA 3UHPA 1CF4A 4ESEA 3GEHA 5JXWA 2HU2A 1EFVA 3I6BA 5SY6A 4CHTA 2IXDA 1EEXB 3LOUA 4M89A 1U1DA 2GWHA 2ISQA 5F1YA 4D9MA 2O48X 4N18A 3K15A 5ALFA 2HCJB 1J9EA 4DLRA 3ZE8A 2HMTA 2D2IA 1MNAA 1BFKA 4GMDA 3RUIA 4FGKA 5JW6A 3SR0A 1KAMA 4KI7A 1KEEA 2HNKA 2YXBA 1D8TA 2WJZB 3K6SB 3T3GA 4O2AF 1ISFA 4EEXA 1YJCA 2ODPA 1NPDA 2B8TA 2D7JA 1BGWA 4H6PA 2XHEA 1U1IA 2ZR9A 3LXUX 3BRSA 3O9MA 3QU2A 3G0DA 4HUQA 4M7WA 3CLHA 2R1VB 2ZSBA 3HM2A 1AV6A 2O5RA 2NZWA 1AZLA 2FSUA 2J3MA 4OHRA 3OQ1A 4HVAA 2X0EA 4AKEA 3E84A 4M49A 1JDTA 3A3PA 2B98A 1Y3AA 1E6LA 2IF2A 4QUIA 4FX2A 4KQHA 1NAIA 3DQPA 7MHTA 4HRAA 3ETDA 4EKIA 1I01A 2V4ZA 2F3UA 2GJ4A 1T2VA 3RRMA 5BN3B 3VJRA 3EZ2A 4D92A 1SJ9A 2QN6A 5CURA 5FI1B 1DO8A 2DPHA 3LQRA 4LYYA 1E1DA 1Z6AA 2KWIA 5T7BA 1MABB 4GO1A 3EXHB 2SKCA 4L73A 5HFNA 4MUFA 1XA4A 1LRLA 4CQMA 4JUBA 3F6RA 4EFLA 3W5HA 2CWWA 1T3TA 4KN6A 4M9CA 4RXMA 2WT4A 4NEHB 5P8WA 4HO1X 5CW1A 1YRWA 1VL5A 3B1XA 4HWTA 1MCZA 3IPAA 4I50B 3Q0EA 2ICAA 3X1DA 5CCBA 3L0DA 4MUJA 5KO2A 1ESZA 2WWXA 2ZSFA 3INGA 2DPYA 1GG5A 2J31A 3D1VA 2HBZA 4JP3A 3PLRA 3LG2A 4NZNA 3R7NA 4F3TA 2EGUA 4XM1A 1JTFA 3P1JA 3D4IA 3LKDA 3G1WA 3MPOA 1NBME 4IGFA 2VDKB 3HDTA 2PSEA 2ZE8A 4PPQA 4UPVA 3TSYA 5BV2P 1AK1A 1U7HA 3KPJA 4RYDA 5AK5A 2A5JA 1YQQA 4LIPD 4K9KA 2D1YA 5EGSA 5HKKA 2BEVA 4RDCA 3AR5A 4XWAA 3OJ0A 4WJZA 3HMQA 4JLUA 2VJNA 1HEYA 1ADBA 3MCUA 4RGQA 3A1FA 4URUR 4YFVA 3RUCA 2GEFA 5ILQA 4TL9A 4G23A 1II0A 3MWKA 4UUQA 1LPOA 3V8MA 4UUBA 1H85A 2YFHA 5C9ZA 3GRFA 4M98A 4WN9B 4BN5A 2HWUA 1TVCA 2OO5C 1GGVA 3A70A 4TLAA 2WF5A 4ZJYA 4BKRA 4G4SO 4IUCS 4BS9A 2GAJA 5BPFA 1EK1A 2F9MA 4FFNA 4GGMX 1V1MA 3IT0A 2OENG 1E1RD 3CLTD 4UM7A 1X1CA 3VI3B 1DP4A 1FE8A 2XUGA 4OAPA 3Q15C 4OLFA 3RAGA 1OREA 2C1ZA 2O2XA 1P2UA 3JZAA 1PNRA 1H5UA 4RU1A 1Z8NA 2O20A 3LM8A 4FBMA 1I33A 2D74A 4X61A 2K7FA 3RJ9A 2E5WA 1A8QA 3DB2A 2Q45A 4N3CA 2B21A 5A05A 1OWOA 3E82A 4UBJA 2CJWA 4U7FA 1CG6A 2FLVA 2G0TA 2W71A 3OPVA 4IH1A 3UAZA 5EHZA 1CUUA 4H9GA 4TL7A 4K9OA 4BX8A 5JALA 2HQ1A 4IIDA 4C89A 5ALDA 1JIKA 3JYQA 4HOYA 4FKZA 5AO9A 4PQYA 2XE8A 1NHWA 4C7OB 3V1LA 1E59A 1A5SB 1XIVA 2ZIWB 4BJ6A 1Q84A 4BNKA 2ADOA 1ENZA 2BSQA 2CB9A 5A62A 4NNOA 1RQRA 2B7CA 4CZ2A 4LF5B 5KTYA 1YACA 5EZSA 4KJXA 3ZQKA 2V0GA 3UENA 1FFYA 2EYUA 1YR9A 1LQ2A 4MYHA 5EFOA 2Q5EA 1QHIA 2VTKA 1TM4E 3BX1A 4D8TA 3E81A 1RFGE 3EGDB 1KBZA 2ANBA 1K3TA 2Z3ZA 3DGFC 4PYKA 4O8ZA 4FWTA 3QJGA 2IKQA 1J07A 1FFCA 1U0HC 5HK8A 5CCDA 3T7JA 1NW3A 4EA6A 5JFGA 5JSZA 4BEVA 4Q19A 5IVKA 1X3LA 1JG3A 1MA3A 2P68A 3GN1A 5FO1A 1CDOA 1Z4OA 1RWBA 2OCXA 1T1JA 1UFQA 3DZCA 4LJ5A 5JMWA 1LQTA 3H16A 1YD7A 3M3HA 3L7IA 4KODA 5DT9A 1DQNA 1U0RA 3KC2A 1H2FA 4PR0A 2FDXA 3H1GA 4LK2A 3D5EA 4UEKA 4EHAA 3T1QA 1N6PA 1ZIDA 2DTDA 4HPWA 4HXFB 3Q9LA 4CFSA 1QH0A 1LV7A 1ZAKA 1UADA 2ZR7A 1J00A 2R7LA 4NNPA 4OUDB 4ANFA 1XSEA 3BMNA 4DLTA 3FYTA 3AIIA 4NATA 5JCJA 3RU3A 2PVPA 3USES 5KYNA 3SIPA 2UU9B 1I0IA 5IAGA 3FBGA 3AR4A 2AYXA 2Y2UA 1QRAA 1WPQA 3MUNA 3WK5A 4XYLA 4IH9A 5A9RA 3BMNB 1RW4A 3ORSA 3KJXA 2KHZA 1N9GA 2PRZA 3KNZA 3GJXC 4K6KA 4IWNA 4RF2A 5D5QA 2XLBA 5JCOA 3L6OO 5EXDA 4EA7A 1G3QA 2AEEA 4LXUA 3S2UA 1D07A 3KQLA 4B5LA 2Q5CA 4ITVA 3QF4A 2ZI7A 1U3GA 4OU4A 1QQ5A 1MOSA 2ZE7A 3HJNA 3G02A 2AV6A 2Y1XA 3D8TA 1VJ5A 1CEQA 4F04A 2O2IA 4YH1A 2ZJ7A 3HYSA 1DQZA 4PBRA 3T54A 3AVQA 1MQSA 2EJCA 3GJ6A 3KKMA 1EUCB 1EP3B 1CYEA 1A50B 5D00A 1UZAA 3BHMA 5IZCC 4AMVA 3S40A 1P5HA 3ZJUA 4O29A 3GHHA 2G72A 4FHFA 3ESXA 3ESYA 5E6RA 3CY6A 5ICEA 2O8FA 4FYIA 1GPH1 1V1MB 2FNAA 2GEBA 3WMFA 2FW6A 4M2LA 1HH4A 4FEYA 3U4MA 3MAGA 4GX1A 5AW6A 4DMRA 1PBNA 1L5OA 5JS8A 3ROQA 1B3BA 3IP3A 2CUNA 1IWOA 1AQLA 1GQRA 2LE0A 4HNUA 1H0KA 3FM9A 3G2IA 4MTLA 1XYGA 1N5KA 2DOKA 1UPTA 3A6KA 1XQYA 4LWOA 4CIDA 2DR3A 3I1YA 3HH8A 1Q74A 4NZPA 3I8OA 3O4JA 3AESA 1NG9A 1QE0A 1SG6A 2NZVG 2IBTA 1QAOA 4ZZ0A 1GNPA 2H2IA 5AW1A 3DVAB 2NU6B 2XD9A 3PCXA 2R85A 2RBGA 3DP7A 4GPIB 5EY5B 1XCMA 3W5AA 1ONBA 2IRWA 5KJEA 1ATZA 3GGJA 2OOKA 1U7TA 1ZFNA 2G70A 2H31A 3MJSA 4OMDA 3UPDA 5AW7A 3OX4A 1F4VA 3UEOA 3ORYA 1PGOA 1ODSA 1S3GA 5H1YA 2WOOA 3AP1A 1LLQA 2C96A 4UEQA 4DMGA 4BZPA 5F73A 4UE6A 1NI4A 3FFTA 3A9TA 1BZYA 5ESWA 5LJIA 3U44A 4Q3DA 2ID8A 1QFJA 6GPBA 1PHRA 2YKGA 3RTEA 3BFVA 4UM8B 2QR5A 1E9SA 2EJUA 3K31A 4HATA 2PRYA 2UKDA 4L72A 4IIEA 2QTAA 3T7IA 2B78A 2CXQA 2OV4A 4K9PA 4PG5A 3TIGA 2REQA 1EVYA 2X0IA 1QMGA 1V2GA 4QM6A 2CJFA 1RAGA 4G81A 1W19A 3H2JA 4FFSA 1MHPA 1YUNA 3AZOA 3CYFA 2QAJA 3VKVA 1NGSA 3IKJA 5A7FA 4YRBA 4CQNA 4DWOA 2OLKA 3QE4A 3NEYA 1FYEA 2NIPA 1XCOA 2XWBF 3OBIA 3Q10A 5B6IA 1DO0A 4DIFA 2V5AA 4QZVA 2YYAA 3A04A 2CY0A 2LRHA 3EQ8A 2RBKA 2W8ZA 2A33A 3VR5D 1PD1A 1DJMA 2Q41A 4EGCB 2PGNA 1COWA 1O0CA 4AZVA 2EKPA 1W87A 1NP6A 2O06A 2ZBFA 3D3NA 2HA6A 3J7AC 3QMWA 2OWEA 1EWVA 1WXXA 1K27A 1YCHA 3I1FA 4E11A 4NZOA 2OB1A 2JJ1D 2E4AA 2QENA 1Y5MA 4P84A 4QOFA 4HDRB 5DP1A 2UXCB 1OWPA 1X1AA 4NH0A 4EHIA 3DG9A 1CNMA 4GBJA 1EYZA 5GZ6A 1NWCA 4TMXA 3S5UA 2ZRQA 4MRNA 3DBRA 4TQUS 5E1BA 1SA0A 1CZOA 3FOCA 4H4EA 4I50F 2GZ2A 2PFGA 4W6ZA 1PQWA 1DNPA 4BLWA 5CIWA 3G8CA 1PGPA 5DKFA 1Q7GA 5JNRA 5J2TB 4PGAA 4Z9AA 4M1TA 2CXRA 4TLCA 1ZK4A 4D4LA 5GJBA 3DW3X 4OXYA 1XVTA 1G9XA 1KK2A 4IIYA 2NMVA 4LXTA 3H4TA 4WOJA 4HQLA 4M86A 3WGMA 3OVMA 4AQDA 5CDFE 3KJHA 1B6TA 1X9IA 2D1TA 4P5DA 2A67A 3TK1A 5CHEA 1C7JA 1LLDA 4L51A 2WHPB 4IVPA 4KKXB 5GIOE 3PU6A 4JSTA 3DXZA 3H04A 3HJAA 1JPJA 4IIJA 4NCNA 1RLIA 1J99A 3F6PA 1J06A 2OKCA 4R16A 3E15A 2YW9A 5AUPB 2QNBA 2PUGA 3RTBA 5HSGA 1KFBB 3HJHA 1QGZA 4CF4A 4AF6A 1VHJA 1STOA 4KAXA 1BG6A 1PV2A 2V5VA 4J1TA 4OJNA 4JT4A 2VL7A 5JSQA 3D1LA 4DFDA 1GP2A 1GV1A 1LY1A 2R65A 1DUSA 3GOHA 4OFBA 4QQKA 5IPFA 2CEKA 3LY9A 1XV5A 3HVJA 1NKVA 4HD8A 4W1SA 1W0JA 1GEGA 1TO2E 3U7QA 1EZ1A 2GKSA 2QN2A 3FNFA 4BGEA 4OQ4A 1DAEA 4FDTA 1Y1KE 4UVHA 3H4IA 5DM1A 1PW5A 4BX0A 1BW9A 1QP8A 3GJ3A 4HTFB 1NXQA 3LF2A 4QTTB 2OHFA 3O3MB 4EJSC 5JS7A 3N0VA 3WL6A 3V4PB 4Z8XA 2I76A 3IFSA 4A82A 4E2WA 3VTZA 1MZPA 5ALQA 1TVKA 2IPNA 4NJEB 4XUCA 1OYYA 1U7UA 3LC7O 3RQIA 5JPDA 3AHHA 3Q6IA 1ESDA 2AMVA 3QU7A 1FDRA 2C2XA 2MYTA 5T67A 3BJMA 3KDPA 4HGRA 2ZBUA 1JAIA 3KUXA 1Q1EA 3E7DA 4I4TF 4RIHA 5TGTA 4KPEC 3V8QA 1NQWA 1JEYB 2RD2A 3TBKA 3DE3X 5ALPA 5FADA 4JLSA 1U5CA 3HI6A 3M3DA 1I3LA 1KZYC 3GEMA 3G68A 3INNA 4ZAYA 4ZI2A 3IB3A 3ZDQA 5EKSA 4X1IB 1YE8A 3R7LA 5CUQA 5DGDA 4Y2GA 4Y2SA 4ZT5A 3JQ6A 4R68A 4BQPA 1HE4A 1TJ3A 1YKFA 1ZBQA 4BMZA 1JNXX 5H3HA 4DQLA 2FFHA 4XZ3A 1MH9A 4Q7EA 3B1YA 1KRXA 4LGCA 4UMDA 4Z99A 4B35A 2A1UB 3GUCA 2P6NA 3B89A 8GPBA 4OB6A 4XA8A 4UKDA 4JHLA 4AMBA 1QIDA 1CZKA 4UTOA 5EJIA 3ZW9A 3H9UA 1VGVA 3EBPA 1EA7A 5DB4A 4C07A 4EENA 4BNDB 2H85A 1CZHA 1L4KA 4UDYX 5EIBC 1IPEA 3GF4A 4Q21A 4HQ0A 3R7WA 1PL7A 2UVPB 2NZUG 3Q41A 1YS1X 5AHXA 3HI4A 2V7XA 3N07A 2ZIXA 1UCFA 4JITA 5DNWA 3ZKAA 3OQMA 3WLSA 1JQEA 1DMSA 1HFJA 3B5IA 3KR1A 4RVUA 3VR4H 3KUDA 4YAJA 3AWIA 4ZT6A 5J2UF 3EEIA 4R7TA 4ZI3A 1QH1A 1MBZA 3F0TA 3EXEB 2JIBA 3HEAA 4OSEA 5JZOA 3LVQE 2Y77A 4ML3A 1RKBA 2FWJA 3OJLA 5DZSA 5JAQA 3A32A 5IUNC 2I9KA 4DQUA 1QTQA 3NTQA 3ZCTA 3T9CA 1C3EA 5FL7D 1T3HA 1JP7A 4PAQA 3K94A 1F12A 1NKTA 1XMJA 2ERCA 1GFWA 3LC2O 3O26A 3DEJA 1AVTA 2JZCA 3AIKA 5E1MA 4J3FA 1F6BA 3UH1A 2VSNA 3F4KA 3A6EA 3QVJA 1J2YA 4H7FA 4L5IA 5CA0F 4NXMB 2VWHA 2B2CA 1P39A 1JLSA 3UQZA 3FPAA 3HVKA 5H83A 4YUZA 5KMGA 4ZALA 1XVVA 1KOLA 2ZTSA 5A04A 2F8MA 3OCUA 1PFKA 2BEUA 5CLGA 4H1HA 1YS2X 3CNEA 3UWDA 2ILTA 1A8PA 2FYTA 3L02A 2NTVA 4CN8A 4G0UA 3BWVA 2HFKA 2YWRA 2I2XB 3O4HA 5J5AA 5ALKA 5F5LA 4HRXA 2WB2A 1D4AA 3IAEA 2QY9A 1LLUA 2PV7A 1F0KA 2Q3FA 4M6WB 3VKFA 1XKTA 2CXOA 2JCVA 2PVCA 3MMZA 4R2WA 1IQPA 4RL4A 3B6KA 1KQOA 3RSGA 1X80B 5AI9A 1U9CA 1UFVA 3VKHA 2EOAA 3W5BA 1XU4A 1XTPA 3KU1A 3MMXA 1KI9A 4FS8A 4MROA 1IDOA 5B1SA 4YR9A 4G01B 3TRFA 4GDMA 5DMHA 1B76A 3G9QA 3GP5A 4EVRA 2HTEA 3KQSA 5DO9A 2FSFA 3ECSA 1WO8A 1DAIA 4HDAA 1X1DA 2V65A 2X7JA 3NYIA 1WULS 3KT0A 1E94E 5ANRB 5FBKA 3IUEA 3K0EA 4EB3A 1FDTA 5HRUA 5HR5A 4FK8A 3HUEA 2FUG1 2MMGA 2I4IA 1GQQA 2PSFA 3L93A 4ALIA 3IXMA 4E3WA 1CB0A 2I62A 3BL6A 2QMHA 3R4VA 3MWEA 3ZE0B 2F90A 2EQAA 1N32B 4HGZA 4BDTA 3AJAA 3NTLA 1ID8A 3DM5A 1XTRA 1GZHB 3HCBA 2CWDA 3NHRA 1H2ZA 5I4IA 6PFKA 2Y0PA 4MQ5A 2G80A 2P9TA 4B82A 2Z6AA 3UT0A 2NXNA 1DWOA 2IYXA 5ALMA 2C57A 3KPYA 4ZCRA 3VR0A 4G1MB 5LOVF 2PHZA 3ZU3A 4ZICA 4C6RA 2WJYA 3NIFB 3RR2A 5DM4A 1E2QA 4B80A 5EZ6B 4E5DA 4EG1A 1KXZA 5BQ3A 1B6SA 1E2UA 2IIVA 1G21B 2MIIA 1M54A 3CSSA 4NMWA 5FPQA 5IHPA 3WICA 1U8EA 1UDCA 1EBFA 4I7EA 4NEQA 4X6UA 4H08A 3H9JA 3OP1A 2PRKA 2FW9A 1X70A 1HZZC 3MB5A 4KWTA 4M1YA 2EKDA 3UW3A 5JROA 1EBBA 3HXPA 2VSYA 1PGNA 1THTA 1YKGA 4NV3A 1J1UA 3RVMA 1SAYA 1KY2A 4I08A 4U7WA 1FYVA 1OHHA 2XIJA 2WYHA 3IVAA 5GV8A 2GYYA 1V0JA 4IEFB 2PK3A 3CW9A 3V32A 4OQZA 3K3PA 1RI3A 3LECA 3TGWA 4Y9SA 3MWEB 4EUHA 1A9OA 4NPHA 4YAKA 2VP9A 5AKKA 5A7HA 4BVFA 1Y1SA 3NBMA 2WFLA 3JVEA 4CLRB 1KJQA 1WW3A 3G2QA 4IEIA 3D64A 2JK0A 1DIOB 3UK2A 3N8GA 1KSFX 3B12A 2W98A 3DMRA 3KTAB 3UUFA 1V3QE 3LP8A 2ZWMA 1VLQA 3H5LA 3MRTA 3NX4A 2O3JA 4MQFA 5IK2A 1I2DA 4UHKA 4RANA 2PFSA 3WQBA 2JW5A 2WICA 3F71A 3JAKA 3Q7TA 4LA4A 4QPJC 5EAIA 3UK1A 2Q8PA 4WI1A 5HYVA 4EMUA 4XVQA 3WIUA 4UD2A 2VP6A 2WM8A 3NHWA 4F6RB 3ZNNA 3EOAI 5DIFA 1Y81A 3GPDG 4FQ7A 2GM4A 3K8QA 1Z36A 2GZSA 4BC0A 1DQYA 2CLEB 3JD3A 4J2TA 3RC9A 4B85A 1SUAA 1TIKA 1FUUA 4HQNA 3ZCSA 5K6AA 4NABA 3VR4A 5ITSA 1ZCZA 1NUSA 4E70A 2K2WA 5CEEA 3PP8A 4HC4A 3MLEA 5AJXA 3LCMA 3STVA 2C4UA 4K46A 1ZVKA 4KH0A 4P3NA 2QG4A 3MQ2A 1AE1A 1P2TA 2W6JD 2XCIA 5DISB 1PKEA 4L4UA 5FL7A 2H1OA 3OE7D 2DCUA 3OJWA 4HYYA 4H1UA 5DNVA 1UWCA 3E7WA 3NUGA 1UPUA 5FLYA 1K98A 2Y68A 4NTZA 5BN4B 1W5TA 1CNFA 3QLTA 5D5HA 2PZ8A 5EMKA 3V1TC 3R24A 5KI6A 1A8SA 3NW9A 2AW3A 2CFIA 4QASA 1JLKA 3C4VA 5B7QA 2VNSA 4YV7A 2G8LA 2VHJA 5G1PA 5K3EA 3PGA1 4X71A 2WNSA 3X1ZA 3WLMA 1YQGA 2G88A 5KS2A 1F48A 2BGKA 4B33A 3AM3A 3PIDA 4N54A 4RDXA 4B3GA 2XRFA 3R5SA 4BX2A 2OXIA 1HDRA 3ZHSA 1WU7A 5LU8A 2C7RA 1ES9A 2AL7A 1ZZGA 3U4QB 1D03A 1W76A 1BDHA 3IDFA 2QYSA 2R8YA 3QHPA 3R3SA 3C8UA 4G4GA 2PM8A 3MT0A 1E98A 4U7PB 3C39A 4OQDA 1W88B 3R1IA 2EYQA 4MW4A 2E21A 2IUFA 3RHTA 4I5GA 2HHHB 2XSZD 3B6IA 2R44A 2QXTA 4LX8A 3IODA 4NI5A 2J3HA 2X86A 3R9XA 1N1DA 3FVWA 1SQ5A 4LX0A 2GTPA 3W6UA 3RUHA 4MUYA 1XMVA 1ZM9A 5E0OA 3FOBA 1DS6A 1FNNA 1K08A 2DPXA 3EDQA 2NU8A 5LZ9A 2AX4A 3TS1A 1NBMA 5KYYB 2I1WA 3SR4A 4DMMA 2H16A 2GASA 3BTUA 4K6MA 3TLMA 1UJMA 2J0QA 4DGSA 3GJ0A 2OGTA 1WXDA 2H3HA 3TCKA 3DHYA 4TS9A 1GYQA 4KXYA 4RKFA 2JKYA 5LNK6 5HF9A 1T1GA 2P9YA 5LBIA 1KH1A 4EB8A 3OTHA 3GWZA 3II6X 3PDIB 4RS4A 3THWA 4MWBA 2VHEA 1Z4JA 2D2XA 4OHZA 2OQRA 3IBCA 4GE3A 1PD0A 1S7CA 4HN2A 1OI3A 5DBHX 5I51A 4MV0A 1JSLA 4XLTA 4EG5A 4BJ3A 3EXIB 2Q3EA 1XNQB 4ZAWA 2HXYA 2O19A 2AR7A 4D8VA 3C70A 2C83A 2JGDB 5LB2A 3ASVA 1FBNA 3OD1A 4Q4AA 3S7TA 4HDKA 1F8FA 4XRGA 2G4LA 2QU7A 2QZ4A 5LXTA 3E8XA 1XMIA 1EP2B 4P7BA 3T5MA 1E3QA 1GPKA 2XI4A 1M7HA 4YO8A 4TYWA 1TGYA 2IW3A 1TE2A 4OTZA 3TLYA 2GAAA 2HU8A 1GRVA 5FPKA 1QHSA 4N3GA 1NVXQ 4MW0A 3FB4A 4Y2JA 3NWOA 3EFOB 3JALA 1M2NA 3K4HA 2QYOA 2ZBRA 4TX1A 3UK7A 5LYJF 2Q50A 1CR0A 2K7ZA 3S8YA 3BB3A 5JC1A 4H7DA 3THOA 2OFWA 4D46A 1VLMA 4WBNB 1FXWF 1M2OA 1MVNA 2ZETA 4ZV7A 3ZE9A 2XTJA 2XXJA 2C03A 4IJWA 1U02A 1D4OA 1X6VA 3HJUA 3TYXA 1Q1GA 1ZMBA 1ZO8A 2GPAA 1BKYA 4R2KA 1KVRA 1UANA 3K6JA 4ARCA 1BOOA 4UEWA 2EGGA 3R0JA 5HIMA 3KB2A 1YQDA 1UK7A 3H2ZA 5ELXA 4Q05A 5LUBA 3D4NA 1G8MA 4DV7B 2RFLA 3QM1A 4DCOA 4KH1A 5COBA 1QIJA 4ISBA 3PD1A 1X1SA 2AI2A 3JSXA 4M83A 5AJZA 3VO9A 1IM8A 2PWPA 2JLQA 1O8BA 3CLKA 4RF4A 3CXUA 4ZI7A 2Z43A 3RF6A 1CFJA 2DQYA 1RT9A 3AB8A 3LDUA 5DN9A 1EK6A 5K05A 2Z4TA 2PX4A 1IXSB 2Y1WA 2OCDA 1XZQA 4YT8A 3DCIA 3PEWA 1GVHA 1SIOA 3EIEA 2GNAA 1EUYA 2P1ZA 3KRTA 1KSJA 4YLGA 1ONNA 2I4OA 3BIOA 3LBNA 1COWD 1BH2A 3EG9A 5CBKA 2IT1A 1R66A 2YX1A 4DEXA 5K3OA 3K9WA 3FSGD 1IBMB 4OBXA 1BDBA 3A9CA 4EJ6A 1K7EB 1DT5A 1GV0A 3I05A 3UYKA 1PUXA 1I8TA 4GPAA 1OXVA 1KO4A 5G1NA 1DKUA 4YAFA 5DM60 2WIAA 3SE0A 5LQRA 4B1FA 5A4IS 2DHCA 3OZWA 3AHGA 3UGKA 4FR5A 3RSOA 4D4JA 4WCDA 3B5JA 4PO9A 2W70A 5HJ5A 3SLKA 3OFSA 1GQSA 3Q5DA 5J9FA 4RJTA 1XNRB 2QTWB 3KZKA 4FMPA 2NO0A 2W2OA 3NJ4A 4WKCA 2ZG6A 3LMKA 1EGMB 2BFDB 3PXEA 1RC1A 1DX4A 2WHXA 1NQOA 3NVAA 2ZYIA 4ZU3A 1HE3A 3K9NA 5HQJA 1T34A 2PT7A 4US1R 3FVVA 4MA0A 1N6RA 3B3QA 3L7LA 3HFRA 2QUJA 4EA9A 3AJ9A 4DF3A 3HKEB 3T61A 3OZRA 4C5CA 2MSLA 3DYIA 3E2MA 3L8MA 4FGLA 3B1KA 5JZ9A 5KAMA 2AC4A 3ABOB 4Q01A 5EXEA 4DDTA 3CLSD 3E7FA 4FCCA 5HK9A 1Q0TA 1V96A 3MMPA 2QJOA 2XF2A 2VUSA 2Z1MA 3LVBA 2NUPB 3QG1A 2C8JA 4ZFNA 2AZXA 4BUCA 3ZYZA 1PRYA 1CUXA 1IOZA 4WJLA 4Q3NA 1CQXA 3EGIA 3SX2A 4O59O 5BV8A 1I9CA 1VIYA 2QAGA 2UYYA 3TXXA 1KYXA 4F60A 1U63A 2XVYA 2W7TA 2EBHX 4KVAA 1ZL2A 5EPEA 2NV2B 5TC4A 1TW2A 4X3CA 1BD4A 4AN4A 4B3FX 1YONA 2ZT8A 4LC0A 4FDUA 4GEGA 2ZREA 3MIZA 4B9EA 1ZRSA 5I45A 3LPDA 4QYXA 4RCZA 4DV5B 1ZXLA 3NASA 3V8EA 2AWNA 1C1XB 4EG3A 3NYWA 4GOXA 4R8LA 4Y30A 1HK7A 3DBHA 3AP2A 4Q1FA 1B8UA 1ZZEA 4G9GA 1CETA 2GSWA 3EGEA 3GD7A 4X63A 5TPZA 4OHYA 1XHEA 3ZNQA 1C4KA 4Q34A 2DECA 3IIEA 3W5SA 2TYSB 1UZMA 5BSGA 5LP1A 4G1VA 4WNAA 1T5LA 3GRKA 4N6GA 5DI9A 3FYDA 2B8EA 3L6UA 4CG3A 2Q1UA 3FPSA 2GERA 3ZZNA 3WYFA 1RMYA 1M6VA 2Y27A 1YCFA 3SX4A 4QNRA 3I5YA 4RZIA 2J08A 1XEWY 2WABA 3V46A 2ONKA 3TEJA 1HDIA 2WC1A 4C4RA 4CLHA 1G6Q1 4RA9B 4U1RA 4BFVA 1ZK1A 1VRVA 4BKQA 5FAXA 1F2VA 1SEVA 3RODA 3QVUA 4NSNA 3UHFA 4EY3A 2D13A 4NCXA 3U9SA 2DSNA 1XKLA 1XDWA 1GJRA 2AZMA 4J2HA 2HK7A 1B73A 1Y3FE 1U2ZA 3DEAA 5GOZA 3EQ2A 4IQ0A 2M1XA 1QU3A 4UTNA 4N5DA 4ZO6A 1PZNA 1V6CA 3FIJA 1K68A 1NQVA 3O4IA 4L4SA 1TMYA 2WU8A 2V55B 1IC6A 3RJMA 2OBFA 3DV0B 1AMNA 2HYIC 1PFWA 4QO8A 5ALHA 2W2PA 3KT3A 4PLWA 1EFTA 2V9PA 1E5QA 3C5CA 5LA6B 1Z5UA 1G55A 4MIKA 3SSNA 5BW5A 1LF5A 3ZDYB 1BCRB 1RNLA 2IY8A 2NPOA 4EG7A 2VAMA 1N7HA 1Z2OX 5EIWA 1RRKA 1TTPB 2Z9CA 4DC0A 1D0VA 1LB1B 2YR0A 4B4KA 5JBQA 5IDQA 2WFZA 3I9MA 3LBYA 4IW3B 4W9NC 5IN5A 1KY5A 4DLAA 1Y4SA 5F1PA 1JHOA 4EO9A 4AUKA 1A7KA 1VSQA 5CTJA 5HDQA 1JYSA 3X0DA 1Q17A 1FFSA 2CXNA 3TPCA 2Z9DA 3C3WA 5CM8B 2VSXA 5I8ZA 1JSXA 3AUJB 5HKLA 3CG0A 4WFJA 3BSWA 5E4YA 4GU5A 3QFRA 5AD1A 4H3HB 4WLOA 1PJCA 3TD2A 3GAZA 5AW4A 2Q3MA 1DBPA 3BDAA 1QBKC 4JMPA 3K8YA 1JU4A 2UVPA 4LHYA 3DUFA 3N2GA 5FYDA 2YVUA 3UHAA 3X3HA 1T1IA 2ZBDA 5F9FA 4H59A 2FP4B 1MD9A 3FCCA 3WYDA 3LCUA 3A9RA 4KZKA 1I1NA 4CV3A 3IQEA 4NFHA 5BT8A 2VHVA 3GMSA 1RZ3A 1X8LA 4ND6A 4DDHA 5C8ZA 3DJYA 5M04A 4YJGA 4Q4HB 2BWJA 2ZDHA 7YASA 1R0LA 2Q3CA 2QIPA 2C2KA 4EM6A 4GBGA 5BNFA 4EUFA 1T26A 2IUYA 1VSTA 2HWKA 3MYYA 4PLPA 4TTJA 3UXHA 4B71A 3AGPA 3T3EA 4KFTA 1FSPA 2O5VA 4JWTA 4QYIB 3SJBA 2CCJA 4LEIA 5EN4A 1DRWA 2AMLA 3ZHCA 4F8EA 2Z5GA 3DDOA 1BMDA 2F3SA 4MPDA 4TKVB 5JZSA 1AN0A 2P62A 5LZ4A 1TPYA 3S44A 1CBUA 2WWIA 1FA9A 5LPNA 2ZCUA 5T3UA 2EKBA 2VA9A 1WMSA 3KAQA 3WDKA 2PD3A 5JRDS 4OCZA 4B3BA 4DEYA 4ZVUA 3M1AA 4B2LA 1P6QA 3Q1LA 1L7AA 1FMJA 4LQCA 1IULA 4AYXA 2LGJA 2Z1DA 4TL8A 4WUTA 4NBVA 3TTTA 4XYBA 5U4QA 1MJHA 1R5NA 3QKRB 4BRWA 3QITA 4FLEA 3BIJA 2EJWA 3ROGA 4GXNA 4KLCA 2FPKA 1UKAA 2V8BA 4H7PA 5BURA 5LBTA 4LJ8A 2I3ZA 4L6IA 3P9YA 1JDBB 3EF1A 5F7ZA 1YBAA 2CD7A 3NDRA 3UCFA 2D7DA 1UMDB 2VI5A 3EA4A 1Y3IA 5T4BA 2XNDD 5I8WA 3LHFA 1DTWA 4RD3A 2I22A 3QKWA 1A5ZA 1K6XA 4DS3A 2H2GA 3ZS9A 1MENA 2AJCA 1CQIA 2CZCA 4INAA 1KHHA 4Y2XA 3WBBA 1KTIA 2JLYA 1IL0A 5EMNA 3N28A 1H4QA 3COSA 4XD2A 3U3JA 1R6TA 3SIRA 1ZJJA 3E9MA 1KPGA 2C8VA 3WL4A 4CIBA 2Q1SA 3VTFA 4BASA 5JXJA 5M7EA 2NZXA 3M5CA 5LQDA 4I4TA 2JKVA 3EZFA 4H0NA 3NM6B 3U31A 4P3XA 4DLWA 4IXTA 3P94A 4JOQA 2XMBA 4QNMA 1R0WA 4DSAA 1OBFO 4TLDA 1KJ8A 3QPWA 3LGAA 2OZKA 3UKDA 1G291 1ZNWA 3K5IA 3PNQA 3A11A 1EWKA 1VE3A 2H2WA 1RRVA 3I4LA 2WF8A 1LTQA 1TL7C 3H5OA 1TVEA 4G63A 3HFSA 1XZKA 1Q20A 2I2FA 1WY5A 4GQIA 4LSZA 1DQPA 1ZRHA 2UZ1B 4CMIB 3SHOA 3UWOA 4ZKDA 2PLWA 1XAHA 1SHZA 2P65A 1WSAA 3KXPA 3OCJA 4IWXA 4RTJA 3ZGNA 3SOZA 4RWZA 4EHJA 2VRNA 1EUDA 4MGYR 4MXDA 4NU0A 4S1WA 4J16A 4DLVA 3HZRA 2CT8A 3JARA 4JI4B 4W99A 4OHWA 1KYQA 3DZ8A 1M6WA 2ORYA 3E9NA 5LKAA 4BLVA 5FOWA 3VDRA 1PSDA 4CV2A 4HMPA 5ITZB 1G20B 5IK2D 1P1BA 4N40A 5AFSA 4UJ5A 2H2HA 3CH4B 1AK2A 2OHVA 3GNTA 3S2FA 3A8TA 4NDAA 4KOEC 1BRTA 1ZAYA 2IDZA 3EZNA 4M7OA 4KO4S 4Y2PA 4HK4A 5KSPA 3ZZTA 1P61B 2P2SA 3IVXA 4Z2AA 3K2QA 3ST7A 2FPPB 2ZJBA 3BD6A 3QRWA 3R3YA 2CMDA 4RESA 5FOTA 2Y1GA 3FVTA 4Q4HA 3GP8A 1Q7BA 5AXBA 4AX8A 4I36A 3W2IA 1EGVB 1H94A 4G5HA 1YU6A 4P8RA 4A5OA 2H17A 3ZOKA 4Q9LA 5D5PA 1YSCA 4XDZA 3YASA 1TAQA 4B34A 4TS3A 2GEKA 1X1EA 4NZMA 1ZBDA 4PYLA 3JQ9C 5L3QA 1EXNA 1XKXA 1ZH0A 2FKNA 3QTLA 4K40A 4PLVA 1QO0A 5EIBD 1UAYA 2EXXA 1FNDA 1O8CA 1ETUA 1GGFA 1T3LA 2YHAA 4GYJA 4Q24A 5EJMA 2Z8ZA 3H99A 5G0WA 1AS3A 2ZJ8A 3WO1A 2XY4A 1TZCA 1J8YF 1BIFA 2HZBA 1W1WA 4A8HA 2V7GA 5AKXA 2FVXA 1RHKA 4W63A 3B20A 1FJHA 4PNZA 4ZQIA 2PNFA 5IMBA 5ITVA 1BXZA 4O4HB 3K5PA 2RK3A 1OFTA 3IOMA 4ISCA 4JJ7A 4LDJA 2VKTA 1LW7A 4ER6A 4XEHA 3RO7A 3TIVA 2ISCA 1WX1A 1ADGA 4TSFD 3T9DA 3U7QB 4ZDKA 2O54A 1XQ6A 1N8NA 1ZGBA 2KBEA 4N3BA 5JAOA 3PNKA 2ZYSA 4C88A 1ODLA 2WNIA 4PAGA 3RS7A 5BSWA 3HDGA 1TU0A 4I1PA 4JL8A 1YXMA 2PKYX 4LISA 4WKGA 5KJ6A 3LPLA 3RQSA 3O2JA 4PRZA 3VYSB 3IE2A 4A0HA 1NULA 1Y9ZA 5EWMB 4YRJA 3HADA 3NCHA 1UEJA 2ZXFA 2VJYA 2QVCA 5FBVB 5LKRA 1ECFA 1NVAA 3BEDA 3DL2A 3RC7A 4J49A 2AJTA 2JHPA 4ZRNA 2C7BA 1JBEA 5JDCA 4KNVA 1DDIA 4U5XA 1G8PA 2ZUBA 2BHLA 1W47A 3TXYA 4CLDA 4YXWD 3JATB 1OX6A 4KV9A 4HAUA 3ICEA 1O6FA 1WUTA 2P40A 2YWFA 3ANXA 2AFIA 3W6NA 2AG6A 3OPYI 1GAWA 2IYAA 3PHJA 4G0YA 4GOLD 1P72A 1KIAA 4R51A 3AB3A 3D7RA 4XVCA 1IG0A 4LNUA 1C81A 3FNQA 5DGIA 2HF2A 3AJDA 3C7CB 5BR7A 1FNSA 4LCBA 4Z53A 5CIQA 1D2AA 4L5BA 4FJ2A 1XUOA 4ECAA 4BVGA 4C2TA 4D3FA 1IVYA 3HV2A 2YXEA 3TSOA 3QVSA 4XPIA 1R0SA 1JQJC 2N9UA 3QA3E 3TRJA 2OSBA 4A8JB 5JI2E 3R9WA 1N8KA 1RADA 1N2JA 1JEJA 1BDIA 3L8DA 1ABBA 4K9MA 2H4YA 1P0QA 4IDAA 3WY9A 4BB9A 3Q7SA 1K7SN 3SYMA 4EIWA 2IHKA 3QVOA 2BKUA 2QRNA 1E1CB 1M3SA 1L5VA 2OV6A 3C6BA 4MJLA 2IUSA 4KMMA 5E2AA 2PAFA 4IX1A 4J0HA 3R6TA 5B1IA 1N5MA 3U4HA 1W25A 4GXRA 2WE7A 4GLOA 3I58A 3PTLA 5H4HA 1D2CA 2ENUA 4YIKA 5FT9A 2PGLA 1QRTA 1OKKA 16PKA 1DBRA 1PYOA 2GVNA 2O8NA 4Q3LA 2EG5A 1QYCA 3NOVA 1Z6PA 1A2KC 4GPEA 2WU3A 2PZJA 4S1OA 4EHLA 1RWWA 3B48A 2Y9PB 2KYRA 4HSEA 2FWIA 3DF7A 4TSKA 1WY7A 1JIIA 2HRZA 3OMWA 3OPNA 4WA8A 4HDCA 4DM4A 2G3YA 1ZRMA 2P69A 1TUEA 3IMCA 1RQGA 1KS2A 1XZDA 3M1LA 2JPDA 3HJFA 3B8HA 4AIRA 2BEJA 2H51A 3B6MA 3NYRA 3UKOA 4K5QA 3O9VA 1JWAB 2B1GA 1WHSB 4IKPA 4NBKA 2YOGA 1M2JA 3GG2A 4JT9A 4FN5A 2ZJ2A 1CEYA 4ZTBA 1NASA 1J56A 2VCEA 3L1KA 4G86A 3DPUA 4UU8A 1AZTA 3E3AA 2ZQZA 4YNBA 5JNVA 1J2UA 5JH7F 2FGKA 1SCDA 2XF8A 5EJ7A 1L0BA 1X7ZB 1Y80A 4LHVA 1HT3A 4LDQA 4ER3A 1TQ6A 1V16B 2FJUA 3TLGA 1LFAA 2DHEA 2F48A 2ODAA 4MWOA 4Q7KA 5LZ7A 2GN2A 3BT7A 5A9SB 1FDWA 5LZ8A 4CMGA 3MJDA 1FX1A 3BWCA 3LQYA 3C7AA 5D7BA 4DVGA 1FUIA 3BMCB 5CNKA 4F3CA 1UBLS 1VCMA 2W6ZA 2F9LA 3ICCA 4TSRA 2OCBA 3GL9A 1L5NA 4PU0A 4C1BA 4NQZA 3LT0A 2BMJA 1ZYUA 2VBCA 4H18A 4OAQA 5H5JA 3AF5A 2YVLA 1S2OA 5AW9A 1KGDA 1UR5A 3SJ7A 3HQ4O 4U6QA 1MO5A 3PJEA 4DIOA 4Q9NA 4HTFA 5C5DA 2Y1CA 1KI7A 1U0BB 4RQBA 2M6SA 1UC9A 3SSOA 5LWQA 4DB2A 1LDNA 1YDGA 4DG9A 3VX3A 1RPTA 2O2GA 3E0XA 3H84A 4HKTA 1BEZA 3O84A 4DSOA 3K05A 2A4KA 4DG5A 4AKHA 2VYVA 1NVUQ 4YREA 4FNOA 3OUZA 3L4KA 2GSDA 4ND1A 2FUCA 4EABA 5LOVA 3I83A 1WDLA 2G0NA 5FR2A 1NVKA 4YQFA 4JENA 3ORQA 5IBRA 3CUYA 3GFPA 3JVVA 4BWVA 1E6MA 2APJA 1CUGA 1DXQA 1QHEA 2A9FA 2LBPA 3W6PA 2JH9A 3W79A 4EGAA 4CL8A 4GOOD 3KJFA 4GLJA 1L5LA 4BCDA 1U3CA 4HXYA 5KVCA 2IZ6A 1BH6A 3NHAA 4ZOEA 4A0RA 3WYNA 3K0SA 1ZJWA 1DKLA 1U9YA 3NHKA 4TTPA 3DBHB 5BXYA 5IMSA 3KZCA 4EL0A 1ZJYA 2I2BA 1XZPA 3NJ8A 4OHOA 4OJYA 3HY4A 1E61A 1CJVC 4P31A 4W1QA 1H1LB 2HZ7A 1J39A 4RZXA 1ZNYA 3E9ZA 3LCRA 1IZYA 4OV6B 1I7QB 1SC4A 4W5NA 3I61A 1GQOA 3BAZA 3RT9A 1KQPA 1YL7A 4OMFG 3ZY3A 1USIA 2LKDA 2QUZA 3ZTWA 5JNWA 2FWNA 3ONVA 5H82A 5JVDB 2ZSHA 3ABSB 2R00A 3NT2A 4B3TB 2G63A 3KB1A 3DMDA 5J63A 4L9SA 5ALGA 1UT5A 2MSDB 1T2NA 3C7KA 3CVJA 3WYAA 1GZDA 4BKMA 2ROQA 2R0QC 1CUHA 4B6FA 4Z7JA 1R12A 2QZJA 2D5LA 3ZWBA 1I7SB 3SKVA 4EKYA 4KP7A 2CNWA 2Z04A 3KFXA 3OKAA 2LCFA 4MV5A 1L8OA 1KARA 2C59A 5TQJA 1QHYA 4X65B 3A06A 4OBEA 3IBTA 3LUBA 3HM9A 1CP2A 2FMFA 2QG9A 3GUYA 1XTUA 3CF2A 1E9VA 1ZH4A 4Q9KA 1UUFA 1YL5A 3WS7A 4LZLA 3EGCA 4BGVA 2R47A 1MB9A 4IO1A 3VBCA 2EP8A 2JGKA 2NADA 2ZWVA 4JQZA 3WYCA 1JZSA 3EMVA 1WL8A 4LRYA 4C3VA 3PNMA 5HVNA 4C0LA 2X8WA 1MZVA 2VBIA 2UZ3A 2FN7A 1LNZA 1N5LA 1NBHA 3HMKA 3ILHA 1DGQA 3DAHA 3E5MA 2IIBA 3PD7A 3JD1A 4B84A 2OBBA 4NBRA 2VFAA 1I5EA 4NYMQ 3ABRB 2I6FA 4IG4A 5AUQA 5T4FA 1QGYA 3SHWA 4LOAA 5CW2A 4Q6BA 1J8QA 2NNWB 5CLFA 2E2WA 1YBFA 1JLRA 3K2EA 3NVDA 4AT1A 1NBEA 2O0MA 3MB8A 4M1EA 2NZ8A 2O7QA 4ATNA 2PU7A 4PN7A 1SU7A 3GJSA 5DNAA 3FA2A 4QODA 4UTPA 3WV5A 2QYHA 5FTNA 4DMCA 5E9JA 3IT2A 5ALZA 1MGPA 2G9NA 2F8SA 1GTVA 4K0RA 5DSZA 3QYFA 4KR7A 3E22A 2OHHA 4PW0A 5J3JA 2FR8C 1DDGA 2EL7A 2V59A 3GAFA 3RM3A 4YIHA 3VZSA 1F7VA 4PQFA 3VBEA 4BVJA 1V5GA 1NU6A 2C5FA 4PAMA 1P3DA 1NDQA 1RBZA 4NL4H 2JLWA 1OA1A 1GCAA 1XPUA 1T29A 1CJTC 4D81A 2C5LA 3VC1A 4IIVA 1EGHA 1K7CA 5F77A 1CHDA 1VRWA 3PUHA 1FYFA 3GLKA 4CL0A 1U0OC 3K9HA 3EC2A 1K1EA 1VYHA 1GXSA 2BEWB 2BMDA 3HWRA 3WG9A 4W9MC 1E2MA 1N75A 3EDMA 5GGYA 4WBSA 1US8B 1XAJA 3ZDXB 1XK6A 2ZJ6A 4D4IA 3QBDA 4OFXA 1G59A 1PR1A 1K97A 2FMTA 1SOUA 3K1TA 1PS8A 1SCNE 3SBDA 1NOJA 2Q9CA 1IUPA 2TMGA 4C4PA 4ZGGA 2IYNA 1WVMA 4H1VA 3P45A 4QBHA 4DC9A 4WBNA 2JBAA 5C4GB 4DLXA 4UUOA 1SM4A 2RHDA 2SBTA 2OILA 4LKRA 3NUQA 4R81A 4OXXA 2IZ5A 5A7GA 1N2CE 4IV5A 4A6PA 3F9CA 2D3TA 4C4SA 3LX8A 3C4JA 1XMQB 3H11A 3LY7A 2PEYA 4FFBA 4J0FA 3EXHC 5EIEA 2GPWA 1NUPA 3BDIA 3OCYA 2O1SA 4KU4A 2C88A 1NN1A 2K4MA 3FBWA 1LF0A 1XTSA 3V2GA 3TGLA 3NRBA 1Z39A 4XWTA 5C8YF 1BD3A 1OVGA 5KBYA 1UH5A 1WDTA 1TW3A 2B82A 4LBYA 1U2RA 1G17A 1AXRA 3EFOA 3CEAA 5B37A 3UWSA 3BHJA 2YVAA 4LBVA 1QZZA 2FW7A 4Q03A 4DXHA 1DBVO 4A23A 4G4SP 4LOKA 2PBZA 5JYDA 1HLFA 5IZ4A 3BDVA 3CG4A 5JS1A 2RHGB 2IV2X 1JKIA 2ODWA 4ZVSA 1PEKE 2KW5A 4FYHA 1QDLB 1PFYA 2UYQA 2D62A 1IZZA 2VT2A 4QGGA 3P4XA 3NYQA 3I5XA 3EIXA 3GCGA 5JASA 4ARIA 2JD0A 3V55A 3VH1A 4B6PA 1JEEA 2HO5A 1DFGA 1SHKA 2NU8B 1KO8A 2AHOA 2W6QA 1WPRA 3NWPA 2O3UA 4BQOA 1NY5A 1H0HA 2BUAA 3AFHA 3AG6A 5K0EA 4IHQA 4KXXA 3HPRA 4NBTA 2OPBA 1X1BA 3S2ZA 4G5SA 3WLAA 1R0ZA 3MTGA 3TR6A 3D2LA 3UJ6A 3DDNA 4F12A 2QTNA 5GAJA 1TJ5A 3ENKA 4MVWA 2W2LA 1NNI1 1VKRA 5EZQA 2BKXA 4Q9JA 1F2TA 1M34A 4MUIA 4EWLA 3KHUA 3HSYA 3TJMA 2EZUA 4AJ2A 4Z9XA 2R00C 1XDSA 1W1IA 2IHTA 4G65A 3KZOA 5FEMA 4B3HA 3KQKA 4E3ZA 3JPYA 5AK3A 5DXFA 4GYWA 1KYZA 5KX5F 5KVAA 3B7PA 4H31A 2JJMA 2A9JA 3ZI7A 3PEUA 4CI0B 1T9ZA 3BZWA 3EA0A 3AV3A 3R0QA 4RIGA 2NPFA 3K4PA 2FXVA 4XCQA 5EVJA 4GI3A 3JQBC 3N74A 3L77A 3ZBQA 2FP3A 2QSUA 5K4HA 4AD8A 4FMBB 4LY9A 2X2PA 3IUMA 1JJIA 1NBWB 2AXQA 4Y6RA 2A9VA 5FBLB 3U0BA 2FGJA 3ZDFA 2DFLA 3FRJA 5CP8A 5F3RA 1LVHA 2E48A 2IGTA 1V5WA 3DDZX 2XMDA 3NDIA 3HJRA 4DV0B 3PF9A 1T8WA 5JE8A 3RTGA 5FUYA 4M22A 2EJVA 2WPDA 1YDFA 4ZK6A 2HMSA 1T1EA 2R751 4KFRA 4HX5A 3C15C 4PC2A 5E7MA 5HBRA 1IBKB 2W4MA 4TV8B 5THXA 2YJNA 2UXBB 3NKFA 2C2YA 3IIJA 4RNCA 5BQFA 2BELA 1TCAA 3DQZA 4TMWA 3RK1A 2XOEA 3RBZA 3VPFA 4AU1A 5HRAA 1PT9A 3JYPA 4MWEA 5KEIA 2PYDA 2BGWA 1WW2A 2PGIA 2COKA 1DI0A 1O57A 2VAXA 4I9HA 4F45A 5EHGA 4ZV4A 2OHGA 2Q2NA 3CS3A 2B6HA 4M1QA 3UOWA 3AF1A 3J81k 1W4LA 1YQUA 4XJVA 2V9CA 3WGOA 5HQ3B 1E3WB 3OG9A 4FFBB 3EXAA 1YR3A 3JAWB 2ZTVA 1OI4A 3KSMA 3P9SA 1P1FA 2H07A 3PUKA 4G8BA 4IKOA 4E5NA 1XRNA 4URHA 1EXMA 1II8B 1F6DA 5E3JA 5CYOA 1BS1A 2J4CA 4MW5A 3OZDA 2C2WA 1SELA 1US8A 3V4OA 1C1DB 4YY3B 1N1EA 5JAMA 2DQZA 4QUKA 4PCVA 2YZ2A 2UYCA 1L5HB 3UMGA 4H35A 2XQGA 4RO0A 5ESXA 1HE5A 3HJCA 4ND7A 3TQRA 1U81A 3PYMA 2QTVA 1PZEA 3LUPA 1MTOA 1SIWA 4EF6A 4TTTS 3EY9A 2ZXEA 3IXLA 6ABPA 1F2UA 2YYZA 5AOVA 5INTA 1CUFA 4JLBA 5FPTA 4BRUA 1ZESA 1LCIA 3VYUB 3KQVA 4MRMB 3O73A 2Y6UA 3EGOA 4E5YA 3U9TA 3LDFA 1G8GA 1XEXB 2JEZA 4LJ6A 3AUXA 1KJNA 5JSHA 1G0OA 1T9CA 3DFUA 4TXHA 2QX8A 1RZUA 4GAEA 4DCNA 2B3TA 3GI1A 5BR1A 4AZTA 1THGA 3RAEC 1USUA 5F9HA 3MG9A 1AQJA 1DB3A 3EXEA 4WXHA 1WOYA 1A98A 2BRUA 4UCFA 1HZJA 2B92A 2BIFA 3FUXA 4RWEA 1ISSA 3MFYA 5AW0A 1R00A 2FFQA 3I42A 4KDFA 4WASA 4UNIA 4MUAA 1VE1A 1NATA 1UIRA 3UKJA 1IYZA 1W6RA 1F6WA 5CEJA 3GBSA 4UQPA 1HDGO 2VYCA 1WIWA 2WF7A 2R6R1 3RIHA 3VYWA 1KU0A 1YU9A 3L41A 1J5XA 4NHEA 2W6IA 3CIFA 1I6KA 5HDBB 5TX7A 1Z8FA 2LP4Y 4CLXA 2H18A 4G0WA 2UZ4A 1CHNA 1SBTA 3R09A 3PHLA 3PUXA 4OVKA 1ZIYA 3AEUA 3E70C 1C7ZA 2CKMA 4S1VA 1NF9A 4IGEA 1NYTA 2EZ8A 3BULA 3N6XA 4JU8A 4PZPA 1VLLA 1A9RA 2EFEB 3DR3A 5B55A 1EFUA 3DS8A 4FFPA 1TEXA 2WFAA 1FUKA 3WGVA 5TIIA 1ORRA 4U02A 2AK2A 3IR5A 3L3BA 3V9AA 2P79A 3P9NA 2XNJA 3H19A 2XDAA 3G7UA 2G4CA 2DQ4A 4TRMA 3WYGA 3L05A 4L8GA 4P4SB 4QXRA 3QKTA 4RGVA 4YC7A 2H4ZA 1TJYA 2H29A 3N53A 3PCRB 2YOFA 3AVXA 3HA3A 3JYLA 3VJLA 1KI8A 1VIDA 4CJXA 4DTCA 2H3EA 4L07A 1JHDA 4WBXC 1EVJA 4ZVMA 1G60A 4MUHA 5AICA 3PQFA 3UHOA 5D3MA 1FP4A 1ITZA 3OX3A 3OKFA 1Q2XA 2HRRA 2FPXA 3B3GA 4BV2A 2IHZA 4GIBA 2C20A 1WJGA 2D1SA 5BN4A 1ODTC 1EVZA 1HUQA 1ZCAA 4ZQGA 2D8MA 1APBA 3U48A 4K3VA 3NHSA 3ZYCA 1GZ4A 1XQ9A 4HR7A 4J0KA 5E7IA 4PTZA 4RZSA 4FEGA 2CLDX 3EDRA 2IV7A 4JYAB 3O8DA 3L07A 4M9SA 4MW9A 1HI9A 2WTBA 1IWBB 3OWHA 4ZOBA 2V7UA 4GXQA 4OQPA 3P97A 5DW3A 3WNQA 3WLKX 5I7OA 4BWYA 1B3RA 5ENZA 1XWIA 1TUBA 2NOAA 3V42A 1EMDA 4C1NA 1JILA 4LOIA 5L6MB 1YZUA 3BXHA 3CFYA 4Q9DA 3ZCQA 3IEKA 4E94A 2NNLD 2P6MA 1OZHA 4G8DA 1OX5A 2FMIA 2PR7A 3EZ7A 1MFZA 5LCXA 4DV2B 3A3YA 1MJGA 1PEAA 2TS1A 3OQIB 4O33A 4O4LB 3UJCA 4EO7A 5KNDA 2FFAA 5AVVA 3M1YA 2CLMB 3FD8A 2X5OA 2VHYA 2IXAA 2PV0A 4D1YA 1L9XA 2OE2A 5F1KA 4FHGA 4DY6A 1KJWA 3CZ5A 3HY3A 3KR2A 4P5PA 4XSHA 4KRGA 2QUIA 5CB6A 4LNUB 2XQIA 3B60A 4L28A 4OO3A 2DBVO 3S2IA 2BKEA 5KJFA 1CQJA 5AIBA 4LZPA 2ZZNA 4R8VA 2NTJA 1C0IA 3PRHA 5DRTA 3O5AA 1D4FA 3PT5A 4M1WA 4MDHA 4UULA 5J59A 4UTRA 1H9AA 2QG6A 3JQEA 5FNZA 3TRDA 2VWQA 3IE0A 3K32A 4DA0A 5CT6A 2ATIA 5CCXA 1SNYA 1WSBA 4Z49A 3PRKE 2VQEB 3IERA 4JU9A 2GESA 1XF1A 4EFMA 3L7DA 4DIBA 4IM7A 1YVRA 4GL2A 1MQAA 5AI0A 4MUGA 3AERA 2QTTA 2Q1WA 1Z83A 1JAHA 3DFKA 3NBUA 2W0SA 3K16A 4TXLA 3I6ZA 4LRTB 4V0SA 5AVOA 5KOJB 3K0HA 4HQRA 3D8NA 4E1AA 3ZLVA 1Y82A 1OXBB 4EVQA 1JS1X 3HA7A 3O94A 3R0ZA 2A7QA 2MU1A 1B74A 2C84A 1EX1A 2PD4A 3DDHA 4JUFA 3CF4G 4P2BA 3V2HA 2ZWPA 4H16A 1E7MA 1L4EA 1PN3A 3SQNA 2BSAA 4GX5A 4AQ7A 1RJEA 2V54A 3ETGA 1M8PA 2G4VA 1Z62A 4PS1A 4CIVA 4C3ZA 3FNHA 1QV9A 5DE3A 2PMFA 3K0FB 1E2DA 1IN1A 1PJZA 4H15A 1GUAA 4NENB 1QRRA 2IEGA 3T0GA 2FPOA 3A4NA 4LMBA 5BYBA 4TMKA 3ZD7A 1G1MA 2EC5A 2Y67A 4I5EA 3TAHA 1P31A 1Z15A 3AY7A 1E2EA 1UXIA 2CK3A 3AF4A 3HR4A 5DHRA 2XYGA 3TQIA 3D8HA 4UTZA 2R4TA 4S1PA 4KIJA 1ORWA 3RHSA 4UOEA 1PJ8A 1BWRA 4JC0A 3X1KA 4DAEA 3STUA 3HO1A 1NVVR 2AMJA 5G0VA 2C1XA 4PFKA 2QSYA 3KYJB 3W77A 2GN9A 3TZKA 2QUBA 1DG1G 3QEKA 1P17A 1ICEA 3BXOA 3NHJA 4IJUA 4BQRA 2FPIB 4DQKA 2J5KA 2P8SA 2IEBA 3DFFA 5EL0A 1GKUB 5A5GA 4U9IS 1Q0ZA 5A6VA 3K70C 3RFTA 7GPBA 2V96A 3KB6A 2BF7A 4OF4A 5DEIA 5A6SA 3MJEA 4AF7A 2E4ZA 3SK0A 3VPSA 1CQIB 3WIOA 4CM6A 1UXOA 1ZA2A 3A7EA 3GH3A 4RMHA 2QRVB 3CIOA 3MJ4A 4XJXA 4HGNA 4OHBA 5L7TA 1L6RA 4GVXA 3DMNA 3E1SA 4XJSA 4XRRA 3RD5A 2VDNB 3HCOA 1Q11A 5FWNA 1T1SA 3C1AA 4NU8X 1K0UA 4OI4A 2E1PA 2AA3A 2WVGA 3JCZA 4AKSA 1WZIA 1ULSA 1NJ8A 1NN0A 1VCIA 2NT4A 4BNDA