4KDRA

Crystal structure of ubig/sah complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
208
structure length
208
Chain Sequence
HNVDHEEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERAGGLFGKKVLDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFSTLNRNGVKKFIKPAELLGWVDQTSLKERHITGLHYNPITNTFKLGPGVDVNYMLHTQNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 3-demethylubiquinone-9 3-methyltransferase
publication title Crystal Structure of the UBIG/SAH complex
rcsb
source organism Escherichia coli
total genus 69
structure length 208
sequence length 208
ec nomenclature ec 2.1.1.222: 2-polyprenyl-6-hydroxyphenol methylase.
pdb deposition date 2013-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4kdrA00
1NBIA 2IDKA 3SVZA 4PINA 5DX0A 3LDGA 1FP2A 1NV8A 2CMHA 2FRXA 3R24A 3DULA 4XUEA 5K03A 3B3JA 5HIMA 2AOWA 1ORIA 5DM1A 4M36A 1ZGJA 5EMKA 5ICGA 4M37A 1YZ3A 2PY6A 5C0OE 4R8SA 3GU3A 1RJFA 4DMGA 3NWEA 5DM0A 3HCBA 4C4AA 3B7PA 2YQZA 2Z6AA 3M33A 1NW5A 1BC5A 1PRYA 3MCTA 3P2IA 2YR0A 4AX8A 1ORHA 4IV0A 2UYOA 1QAOA 1XCLA 4KRGA 4GOMD 3LBFA 3HCAA 4PCAA 2XYQA 5EMLA 3REOA 3TR6A 2AOVA 2FCAA 2AZTA 1OR8A 3LKZA 5DM2A 3SGLA 5FUBA 3FUWA 4YMHA 2HV9A 2GLUA 3FTDA 4RTLA 4RTMA 4HTFB 5FQNA 2CKDA 3E7PA 5BXYA 1AV6A 5DXAA 2XYRA 3UJAA 5C9ZA 4RWZA 3FUTA 4YMGA 3MAGA 4DA4A 4AZWA 4CKEA 4IWNA 4M7RA 4OBXA 5E9QA 3M6UA 3IHTA 4OQDA 4RVGA 3TOSA 1RJDA 3K6RA 2GAFA 3TKAA 1FBNA 5EKUA 3TM5A 5HIIA 4FT4A 1V39A 3A27A 3UJ7A 1QAMA 3EMBA 3EMDA 2ZWVA 3EEOA 3I53A 2ZSUA 2OO3A 5C1IA 2NXJA 3AXSA 3KQOA 2ORED 3P9KA 4C03A 2XBMA 4NECA 1BHJA 3HA5A 5LQAA 2XYVA 1M6YA 1VPTA 5F2KA 3CJRA 3CGGA 5IKMA 2C7OA 4GUAA 3BGVA 5DTQA 1JSZA 3DMHA 3CVOA 1G8SA 2O06A 3BWCA 2OY0A 4AUKA 1I9GA 1XDSA 3B89A 2PX2A 3FPJA 3LCCA 4WXHA 5DX8A 3GRYA 1B42A 3HA3A 3A25A 4RTKA 2V74B 3FPFA 3DXXA 2ZWAA 3HCFA 4PGHA 4PYQA 5DX1A 3OU2A 2B78A 3SX0A 2G72A 4HGZA 3K0BA 2JHAA 5K0FA 3OE5A 7MHTA 3BWYA 5CM2Z 4BLVA 1IXKA 1G55A 1G8AA 1P1BA 3FPEA 3LHDA 3PTAA 4AZTA 3G89A 3MTIA 4PWYA 2B3TA 2G1PA 2PSSA 3UJDA 2OZVA 3C6MA 3F4KA 3HVIA 1SUSA 3GJYA 5EMMA 4YV2A 5K09A 5E8RA 3RW9A 1IM8A 3JWGA 3GXOA 1XTPA 5LQKA 1XXLA 1BKYA 5CVDA 4G56A 5DPMA 2IGTA 4E2XA 3R3HA 4F86A 1DCTA 1F3LA 4PYMA 2HNKA 3OU7A 5F2NA 2ADMA 3M6WA 2KW5A 3EVCA 3P2KA 4RTRA 3C0KA 1N2XA 3HM2A 3I9FA 1NW6A 2PWYA 4H0NA 5T6BA 1VBFA 2DPMA 2YUIA 1PJZA 1WXXA 1ZQ9A 5KQRA 3MERA 3SSMA 5GINE 4A6DA 4KVZA 4F84A 5ICFA 5DRTA 4ER6A 5E1OA 3C3PA 2BR5A 1AQJA 2CL5A 2AN5A 3V8VA 4HC4A 4R05A 1EG2A 2O0LA 3P9NA 4YV0A 3KQMA 2PGXA 1U2ZA 1NT2A 4CXMA 4OX9Y 4E2WA 1ZGAA 2EG5A 3H2BA 3NDIA 2P41A 4C06A 4CTKA 3V97A 3EVGA 2FYTA 4EMSA 5KS2A 1ZG3A 5FHRA 1O54A 2H1RA 5CD1A 1WY7A 4CTJA 3MHTA 2ZCJA 3L8DA 4QTUB 3M6VA 3HCCA 3TM4A 3PS9A 3BZBA 4E2YA 2A14A 4DF3A 2WA2A 5K05A 4QQKA 1R6AA 4LWPA 3BWMA 3HCDA 5CVEA 2P8JA 3UJ8A 5BW4A 3G2QA 5GIOE 5JR3A 4BY9E 2ZZMA 3R9XB 10MHA 2C7QA 2BR3A 3CJQA 3GRVA 1JTEA 5EQJB 2IDJA 2VDWA 3GRUA 5D1HA 1IY9A 2AOUB 1R18A 2AOTA 4FP9A 3FTEA 2Y1WA 5T64A 5K0JA 3HP7A 3FUUA 3M70A 4P58A 3KR9A 1L9KA 2LD4A 3OZTA 4U7PB 4X60A 5EGSA 1JG2A 1X1BA 3G88A 2OXTA 5LQUA 5D1NA 1G6Q1 3BUSA 3CJTA 2JHCA 1KPGA 2YVLA 2ZVJA 4PCLA 4UOEA 2ZLBA 2VDVE 4RTPA 2JJQA 2N47A 1FP1D 1X1CA 3DP7A 3PX3A 3TFWA 3TLJA 3MCZA 5EEHA 4KWCA 4XUDA 1D2HA 1NW8A 5DXJA 5EG5A 5K0NA 4OA8A 5E9JA 1JQEA 5BP7A 3ANXA 4QTTB 1SG9A 1XDUA 2DULA 4PYIA 3WSTA 4P7GA 4DM3A 1RI4A 3OZRA 2AN4A 1EQAA 3O4FA 5FULA 3LSTA 4RVDA 3GNLA 2O57A 4L7VA 1KP9A 5LQRA 1WXWA 3PX2A 1Q0TA 5DTMA 5E1MA 4X1OA 5K0EA 2P3LA 4E32A 4U7TB 3PVCA 3SM3A 5M5BA 3DXZA 2AS0A 1SKMA 1F38A 2AVDA 3KHKA 2PT6A 3GGDA 4OBWA 2BZGA 1T43A 5ERGB 1QAQA 3FYDA 3DXYA 3EGEA 2PX5A 2XVAA 5LR6A 2P40A 3EVFA 5FTWA 3JWJA 3HA7A 3KU1A 5CVJA 5HIKA 1P91A 1XCJA 2P35A 3FRIA 1EAMA 4HSGA 4RSRA 5GIPE 3P9IA 2PXAA 1O9GA 3PFHA 5GWXA 1RI3A 4YUWA 3IYLW 4RTQA 5HFJA 3FYCA 3GWZA 3IEIA 2F8LA 3GDHA 1JG4A 4P7FA 5EZQA 1XVAA 3KPWA 5HOQA 2P7HA 4GEKA 3CCFA 2CWWA 5EVJA 1XDZA 1YF3A 3OFKA 1NW3A 3BGIA 5FA5A 3EVEA 4KDCA 4ZTBA 3DOUA 4V0QA 5LQNA 3G2MA 5K0BA 4PYJA 2QY6A 4FT2A 4A6EA 5EIWA 2ESRA 3NMUF 4HGYA 3BXOA 2IP2A 3C3YA 5E1DA 4DCGA 2I7CA 4BP1A 3LKDA 2IH2A 1KYWA 5DT2A 2C7PA 3NVMB 2IH4A 3MQ2A 4YUYA 4PYKA 3SXJA 3G7UA 1QZZA 4ER0A 3B5IA 3KR2A 4XCXA 2P3OA 1AF7A 3P97A 1MJFA 3CC8A 3E8SA 4GOND 5LSAA 5T67A 2PX8A 3KR1A 3OU6A 3TKYA 2FPOA 1VP9A 1SQGA 3FPGA 4YUZA 1M6EX 4CKBA 4MWZA 4E33A 3GCZA 3DMGA 1KPIA 5IH3A 1YUBA 2R3SA 2P7IA 3FRHA 1UFKA 1JG1A 1WG8A 2AOXA 1DL5A 4HH4A 5FQOA 3U81A 1RJGA 3EPPA 2ZZNA 3VC2A 2OPBA 2IFTA 4PYNA 5HEKA 3VC1A 5ICEA 3O31A 1KR5A 4E2ZA 3ME5A 3VYWA 2P1DA 3LX6A 3OCJA 5U4XA 1HMYA 5CCXA 3B3GA 1N7JA 3OZSA 5BW5A 3PB3A 4E70A 1VIDA 3EVBA 2EFJA 2HTEA 2G8NA 5KQSA 3P2EA 2Z6UA 3NVKI 1Y8CA 2H00A 4GOOD 5DM4A 1P1CA 4FSXA 4RV9A 2OBFA 1NW7A 4Y2HA 1WS6A 3LL7A 2O05A 3B3FA 3MGGA 2B2CA 3IV6A 4OQEA 4DKJA 2ZIGA 2ZFUA 3KKZA 4PYOA 3HEMA 2QRVA 3E23A 3NTVA 3NW9A 3OE4A 3RIEA 4EKIA 2UYQA 3LECA 4PNEA 3E05A 2UYHA 5EHIA 3THSA 2BR4A 3T7TA 1H1DA 4EK9A 3OPNA 2VP3A 5HILA 5FWAA 3PFGA 4BLWA 2ZIFA 4MIKA 4PGGA 4RYLA 3GRRA 3LDUA 3UJ6A 4FGZA 3KQPA 5DTRA 3GRZA 3FPHA 4V0RA 3M6XA 5K01A 3BWBA 5E8JA 3AWIA 3DMFA 5FWDA 3ELYA 2GB4A 3X0DA 5CIYA 5DSTA 2K4MA 1BOOA 4R8RA 5GOZA 5EKXA 4AZVA 4C05A 3KQYA 3ELDA 4BLUA 1Z3CA 2FK8A 3BGDA 4PIPA 5CUQA 2Y1XA 4EVIA 3SR4A 5CCBA 2BM9A 4KDRA 1L1EA 1L3BA 2NXCA 5EEGA 4PONA 4QDKA 5GM1A 3UZUA 3LBYA 2I62A 2ZW9A 4ER7A 5K0GA 5F2OA 4GF5A 4BP3A 3P71T 4GBED 3SSNA 2YXDA 1UWVA 1YFLA 1N7IA 4E30A 2H11A 1YB2A 4F85A 3GIWA 1JTFA 2G71A 2V7EA 3FZGA 8MHTA 1INLA 2R6ZA 2ZIEA 3LCUA 4HG2A 1NE2A 5EIFA 4ER3A 2BM8A 2GA9A 2P3QA 3FUXA 3G8BA 2G70A 3QOWA 4P7JA 5FHQA 1X1DA 3EGVA 4RVHA 3EVAA 1JQ3A 4C08A 1FPQA 2PBFA 3PLAE 1RI2A 5DWQA 5FCDA 4KIFA 3SMQA 2OB2A 1FJXA 2ZULA 3KPYA 4E31A 2NP6A 2OKCA 1TW2A 9MHTA 5DRYA 1EIZA 1KHHA 2FK7A 5HZMA 1KXZA 2ZTHA 4HTFA 4IV8A 4QVKA 3RODA 3UJ9A 1D2GA 3VSEA 3FTCA 1NV9A 3UJBA 3HCEA 2IBTA 1R00A 2B25A 2JH8A 4X63A 3T7RA 4CWAA 1R8XA 4QPNA 5GP1A 1NKVA 1VQ1A 3KQSA 3R0QA 5E9WA 2OYRA 2AR0A 3OFJA 3QV2A 3DR5A 3KPUA 2ZBRA 1MHTA 1L3IA 2PXCA 4GC9A 4Z2YA 4PYLA 4YUVA 4XUCA 3G2PA 3TPZA 3G2OA 2WA1A 3KQTA 3EGIA 2ERCA 4LG1A 3EEYA 5EHGA 1DUSA 2OB1A 2YXEA 3Q7EA 3AY0A 2GS9A 3A7EA 3P8ZA 4QPPA 3SSOA 5EMJA 4FSDA 1KPHA 1SVUA 1VLMA 4FS8A 2NYUA 4GOLD 4EKGA 1JG3A 4WVLA 5JUWA 5ICCA 2QE6A 2WK1A 4DZRA 1I4WA 3LGAA 4RTJA 1YZHA 2AVNA 5MHTA 3TQSA 2Z6QA 4MTLA 2PLWA 4K6MA 4O29A 4X61A 5EPEA 3AJDA 2B9EA 1RI1A 2VZ9A 3O7WA 1X1AA 2ZBQA 3NDJA 5KYGA 4JXJA 3TMAA 1ZHFA 5P8WA 4HRAA 3ELWA 2NNWB 3MTEA 1RJEA 3BKXA 3A4TA 5E2BA 3I64A 3QOXA 4GC5A 4QQNA 2YXLA 3UA3A 2UZ4A 4Y30A 2UYCA 3LDFA 3G5TA 2EJUA 2ONZA 3EVZA 4MHTA 2IH5A 3THRA 3DLCA 2XVMA 4FZVA 2ONYA 2EJTA 2QM3A 1Q0SA 1O9HA 2C7RA 1VL5A 4P7KA 1VP3A 4CKCA 1R8YA 3JWHA 3HTXA 2AN3A 1WZNA 3M4XA 2ZZKA 1ZKDA 2E5WA 2PX4A 4RTNA 1M0EA 4C07A 2PJDA 2PWPA 4MQ4A 5E2AA 1KYZA 3HNRA 4R6XA 3LCVB 1HNNA 3DLIA 2YTZA 1QANA 1TPYA 1JSXA 3T7SA 4RTOA 3AXTA 4DQ0A 3HVKA 3UJCA 3UWPA 3A26A 1UIRA 4LWOA 4OA5A 2JH9A 2PXXA 3DH0A 3S68A 4PIMA 1KIAA 4ER5A 5EOVA 1EJ0A 1JQDA 1SQFA 2Q41A 4B17A 3NWBA 2NXEA 3KQQA 1RI5A 2PV0A 4QDJA 4M38A 2YX1A 1SUIA 4ISCA 5FA8A 5CVVA 3D2LA 2HR1A 3P9CA 3ID6C 3KQVA 2NP7A 3UBTA 5GM2A 1D2CA 3ERCA 4GQBA 2VS1A 3GO4A 2HMYB 3I5UA 2FHPA 4LECA 4KW7A 4FR0A 5EZSA 4RTSA 3UFBA 2JG3A 5K8VA 3DUWA 2IBSA 2GH1A 3UA4A 5B1SA 5DLYA 5FADA 3FTFA 3G8AA 4R6WA 5LQJA 1I1NA 1L3CA 3DTNA 5DSXA 3TRKA 4ATNA 4C04A 3CBGA 2I9KA 4AZSA 3T0IA 2QRVB 3A7DA 2AOUA 5LQCA 3BKWA 3KQWA 5EC8A 2BH2A 5CVUA 3LPMA 2PVCA 3PT9A 2O07A 4YV1A 3JWIA 4DCMA 1VE3A 5G02A 4QVGA 3Q87B 3MB5A 5HIJA 5K0LA 3KPJA 3ER8A 4X41A 5KVAA 2HWKA 1AQIA 2CMGA 3G5LA 4RVFA 1XJ5A 2IPXA 2PKWA 3ER9A 3HVJA 3R6TA 1P39A 5E1BA 3KPVA 3ORHA 5H02A 2AOTB 4POOA 2IIPA 3EVDA 2NXNA 1QYRA 1G38A 1R74A 1X19A 2ZBPA 3NJRA 2PT9A 3C6KA 4RX1A 3CKKA 5K0CA 4IKPA 4YUXA 4EQZA 2QYOA 3I58A 3ELUA 2EX4A 1NBHA 4KIGA 1G60A 1YFJA 3HVHA 2GPYA 1TW3A 3FUVA 3BT7A 1EJ6A 2VDUE 2I6GA 1JR4A 3KR0A 2JHPA
chains in the Genus database with same CATH superfamily
4RF4A 2I78A 5A4MS 3D3WB 5ESWA 1WAMA 4AWXA 1ZK3A 5JROA 2C9OA 2VBFA 4LZZA 4WIAA 3K9HA 2Y1DA 4J0DA 3D7NA 3ZDZB 1DTSA 1XU7A 3T4EA 2CBGA 3H11B 1ORDA 4L22A 1NOJA 2IOFK 3B7PA 4CM5A 5D01A 4DY4A 1JR3E 2VDRB 2X40A 3AEQA 2GHIA 2Q6OA 4GLBA 1PJAA 3MCTA 2YR0A 4GPBA 2ZJBA 4ZREA 1QVZA 5E7QA 3K9QO 3JU3A 4FYVA 3TLZA 3ZWCA 1C7EA 1GP2A 3REOA 4NZZA 3GAAA 4ZOLF 3PWSA 3X43A 1HA3A 2LKDA 1VPLA 1TJYA 2G36A 2R2GA 2DHEA 2DFTA 1OZGA 4KX3A 1G5HA 2YHIA 4PG4A 3VZDA 3ZV6A 1W9MA 2I6SA 4Y2TA 4YAJA 4WPGA 3FUTA 1ZM9A 2QVBA 3K1ZA 4DA4A 2ZR8A 4L8FA 1H05A 2VK4A 4IWNA 5AESA 1YE5A 4MV7A 5JPCA 1XZBA 3SXPA 4ABTA 3Q8KA 3QGMA 4X1KB 3OJLA 4CI0B 1UPXA 3FR8A 4BJHB 5J4VA 1NQXA 3FRJA 4W5OA 4D3DA 2G04A 3LA6A 2DETA 3E4DA 2Z2IA 3GIDA 1M72A 2JFYA 4YJFB 2IXDA 1MB9A 4UU0A 4GMFA 3DNFA 2F8SA 1CB7A 2IU3A 3HGMA 4GDMA 5LQAA 2TMYA 3CVWA 3K70C 1EK6A 1F5NA 1GGJA 1O4VA 1QX3A 2A9PA 2JGLA 2XUZA 2UZAA 3ASZA 3M9LA 3O2JA 4MVYA 3LBIA 3SS7X 4E88A 3V9AA 5KOJB 1RXIA 4C7VA 1UOEA 4ZT3A 3KKMA 1J2RA 1WW8A 2NN3C 1BX0A 2WTEA 1JBQA 3QVXA 2V74B 3GH3A 1IQPA 4RCZA 2WFLA 1XL1A 3A05A 3PUJA 2JHAA 4PHFA 3OE5A 4M9CA 5EE9A 3IAFA 5ES3A 5K0ZA 1J21A 3HADA 3K71B 3LZ6A 5BY2A 1XRNA 2WABA 2FXVA 1PLKA 3BC1A 3SSAA 3DLTA 1GZ4A 4NFLA 1JB9A 2VT3A 1GXSB 4FU0A 1DXQA 1UF9A 4LGCA 4D1YA 3MWYW 2OKGA 4YCDA 1G7CA 4DDUA 5MN4A 3ACBA 2YXPX 2J45A 4B6SA 5J4YA 5KYWB 2O8FB 3HC7A 1ULBA 1EFRD 2VO1A 3G49A 1Q5PA 4JMLA 5TEVA 4DV4B 1IU9A 4KG7A 1F3LA 3DHEA 4L2IB 1EUCA 3VPHA 1NUAA 3VDXA 3KKNA 3QVMA 4IV5A 1US8B 1V8PA 1ZOLA 1FJGB 1NW6A 4PVCA 4QOFA 4MKZA 2ISQA 4DG9A 2VP5A 1ZD5A 1YKSA 2XCLA 1EFRA 1L4UA 3RF6A 1UIMA 2YUIA 2B8WA 1ZQ9A 1OILA 2A1TS 5T4FA 5JWRA 2TRSB 4IJ5A 2D54A 5JNSA 3N0VA 3RSSA 3QW4B 4ER6A 3DBVO 1BMDA 4G1CA 1ZNQO 3LWZA 4OHYA 2FEMA 1GQRA 3C39A 5K4AA 1Q50A 1QZUA 2BI7A 4HEQA 3KQMA 2RGDA 4X95A 4Q1VA 1XOIA 3MWFA 2VJCA 3UXEA 2XQGA 4OQ4A 2QNRA 5HA5A 2QYHA 4N49A 3Q7TA 3IIKA 4NIMA 4N47A 5I9TA 1G18A 4RABA 1RCTE 2YHSA 5NLLA 2B8NA 1YWGO 1UJBA 3HR4A 3IIIA 5TE9A 4BVBA 1JJ7A 3M6VA 1NFRA 5JNVA 3R44A 5AJUA 4Z1MD 1BWRA 3CCBA 3GLSA 1H2ZA 4GI2A 1D1QA 1N2ZA 2CV2A 1Y4AE 3CLSD 1MP0A 2DGDA 4ND4A 2C7GA 10MHA 3ZDYB 5ALOA 3BA6A 2DUWA 2QTRA 5DOVA 2QSZA 2XXAA 1FXWA 2B92A 4ENUA 1K4KA 1CJUC 2AOTA 4OQZA 4Z1MA 1KJ8A 5ABPA 2AUMA 4D6XA 1MBZA 4V0ME 1N6LA 3FUUA 1L9KA 2LD4A 3JQAA 1HQYE 4LXYA 4X60A 3SJAA 1BGWA 2AJDA 2ZJ3A 1EGAA 2C2WA 3D7LA 4BQOA 3MK31 4Z3DA 4EFKA 4B8YA 2N47A 1N75A 2HO4A 2W43A 3DP7A 3TLCA 1P1RA 3VPSA 1DIHA 3IXMA 3PA8A 2P4HX 2V9PA 1JXOA 5ALKA 4CR8A 4ZPXA 3PDJA 2BFDA 1AGXA 2DHDA 1GPWB 3AF2A 3P0EA 1M6HA 3SC4A 1JECA 1FYWA 1KGSA 4NBKA 5I7UA 4E5KA 5TC4A 1TEVA 2VHVA 2ETVA 3UIEA 1W581 3FYSA 4CNBA 3KD2A 1ZMOA 1IWBB 2IYXA 4O02B 2D59A 3CLSC 1KP9A 4RMHA 3TZCA 1CY8A 1PFVA 4UMVA 1WUHS 5BSRA 1O96A 3UXMA 4DVJA 1J9EA 4ZYWA 5KNCD 4PFSA 1K8RA 1U2DA 2D2EA 2YFYA 4JEIA 3NUGA 4QPCA 4IRXA 5HMMA 4ALLA 4QYXA 5ITZA 3DE5X 5A02A 4GI3A 3IESA 4M8KA 2WJWA 3PIIA 4TTVA 3VX4A 5BUZA 1IDN1 5FTWA 2WQ6A 3CMCO 3HKDA 4PW0A 1ID8A 1VRWA 4EHKA 2ZRPA 2Z08A 1AZTA 2PXAA 1N2JA 2ZIZA 2NO5A 5I8PA 5JASA 1SKYB 3DT8A 4YQEA 1F6DA 4MGYR 4ZOBA 3ZCPA 1Y48E 3I52A 4WK2B 3KKPA 3R7DA 5JAOA 1DFHA 2O5EA 1EFKA 3NDBB 1JSLA 1EGVB 4L95C 1DQZA 1U2DC 2FSHA 2ODWA 1T25A 2MHCA 3BGIA 5IT4A 2VKQA 2BEVA 4KDCA 1NDHA 3AVWA 5EZYB 1OC4A 3SE0A 4NS1A 1ZMBA 2I6TA 1C2YA 4WK0B 4XLZA 3AV3A 3G2JA 2ZM5A 1EFUA 1NAHA 2AXNA 4HGYA 1HH4A 5F7OA 3RS4A 1A0OA 2IP2A 2QV7A 3BJMA 3EIWA 4LF6B 4BP1A 1QO9A 4RS3A 2AN1A 4XASA 3RYHB 1BRTA 3C8HA 3A1WA 2IZOA 4Q3NA 3LXXA 1VGQA 2WYUA 2EWMA 4I4TA 3RRXA 3FKSD 3SXJA 2IS2A 3B5IA 5C7YA 2P3OA 3STTA 1CSEE 3OWOA 3CC8A 3HFGA 4HFMA 3V6LA 1SBIA 3KYIB 4RPJA 3CB2A 1TQ8A 3EIXA 2FPOA 4BZZA 4F1KA 3H4TA 2JHGA 2ZAYA 2Z98A 1KO8A 3H7IA 2XR1A 2O8CA 5FQOA 4NPCA 1QOPB 3U7EB 1GKYA 4FHFA 4CKXA 1LDEA 2QG6A 2XOXA 1FRFS 1L5KA 4KQMA 1NZJA 2GTHA 2RIRA 3WYNA 1JT9A 4K6CA 5EXSA 2VXOA 3H6KA 4JI5B 2NV0A 3FLBA 4GG1A 2PWBA 2DCUA 4WOBA 4L74A 3NUZA 4PAOA 1ZCZA 2VBIA 1Z2DA 1I2DA 1H0SA 4DTCA 3BH7A 1CUYA 3WNBA 3UC5A 1SXJD 2JVJA 1OBHA 2PMDA 2JIDA 4QOGA 3ANLA 4B3GA 2ZRDA 2JKZA 3N0TA 5AKHA 3O84A 1N3IA 4MI1A 1XTQA 1LB1B 1WS6A 2JD1A 2WM9B 3NR2A 3QHQA 5AW9A 1TCBA 1LI4A 4C4YA 2G40A 3RUHA 1L7DA 2AFRA 4AK9A 4HATA 3JWPA 2A4KA 1OAOA 2ZKIA 1KMHB 3GFTA 4L1KA 1YNSA 1MW9X 1VJTA 1RFLA 4DJJA 4LOIA 1X77A 2ZUFA 1FSSA 1TO2E 2WWGA 1QKKA 3P0FA 3IVGA 4J3NA 4ZIRB 2QX6A 5LIRA 5ILOA 3THSA 1T1JA 3RC3A 3TL2A 5H8WA 1YGPA 3A6ZA 4GECA 4MV1A 2ACKA 3ZDFA 3W06A 2BGUA 4II2A 5T5QA 3TGWA 4FQ7A 1C50A 4IUBS 3ZHUA 5JXHA 2FSFA 3WGZA 4QOIA 2MCFA 1FX0A 5JY6A 3RBZA 4MPPA 1CR1A 2OZLB 3X0DA 4D56A 1OAOC 3F8SA 1E2HA 3UMGA 1GUDA 2K4MA 2HWUA 1BHO1 1RYHA 2ILTA 2FX3A 4RPHA 1QHYA 1GZ7A 1JNYA 1Z3CA 2EFEB 2CXNA 2OR3A 5GOTA 3RYFA 3LQ1A 3W3ZB 5EXXA 1R1DA 4JI3B 4DT1B 4B75A 1IG0A 3G7SA 5A3RA 5EJEA 2FR0A 4IXMA 2F3UA 2X2FA 4X1IB 3H4VA 5DGIA 3R74A 3RRZA 2KM1A 2HHLA 2PS0A 3P9XA 1QG6A 4UM7A 3QX3A 4KREA 1B6SA 1PZEA 1PJTA 1SCIA 1NQWA 4OB8A 2YXDA 2MMCA 3G17A 4V03A 4Z3OA 2BY4A 3RNLA 1OCEA 2YRWA 3TTXA 4RVCA 2I2FA 3KEQA 4FN5A 2PLNA 1INLA 2N46A 4OGKA 4CZ2A 4TKUA 5AJHA 5ALHA 3DZIA 4ESVA 3Q7IA 5GV7A 2G70A 1PQUA 1IXSB 4HBZA 1X1DA 2C9MA 2BKUA 3C1OA 3HXLA 1JQ3A 2H7XA 3DOIA 3QG1A 4R1MA 1QSGA 1QH8B 4MHSA 1BX3A 1V1RA 1ZOPA 2GKGA 1ZU4A 2V6JA 2ZU6A 1J5PA 3W9BA 4LMRA 5IXJA 1NC3A 4Q19A 2WEKA 9MHTA 2H1IA 3AOGA 3HXTA 5DN9A 3HJBA 2BMEA 4J3FA 4ND6A 2FK7A 3ZH9B 2I1VB 2GBGA 1SGWA 4XH9B 1JKIA 1RXCA 2DSTA 1HE2A 2JW5A 3NHUA 1EVQA 3O4GA 4CWAA 3VR4A 5AUPB 2VYFA 3LUPA 3PNQA 4BX3A 4C78A 3TINA 1COZA 3DPUA 1TUEA 2OYRA 2FQWA 2Q9BA 3N8KA 4L51A 5GVRA 4IZHA 2XRYA 1Z63A 3PF8A 2JLCA 2CJXA 2QX8A 2EAUA 1XNHA 1QQ7A 1C4WA 1VJ1A 4PYLA 5DDIP 1RQXA 5EINA 5I5EA 3KQTA 4Y1RA 1RLIA 2F3QA 1S5PA 1DUSA 4W8HA 2XXJA 2ZT7A 3ON5A 4WVFA 4QX6A 1XAJA 4EKGA 5BSFA 3KSZO 3NIWA 4I81A 4HDOB 1KEKA 5JYBA 1UJNA 4HWPA 4X00A 5A06A 4JP5A 3IE0A 2PLWA 3A4LA 4ON9A 3SZ3A 3H2IA 2B9EA 2E9SA 5IDQA 3TUZC 1J2TA 4CQMB 4HXGA 3PXXA 1FW8A 3MWKA 1G20A 4TV8A 4GU5A 3AEKB 1PUJA 1PX0A 5FAXA 3WWYA 4C5BA 3IUPA 4CQLA 4DFDA 1PV4A 1G6HA 1XWIA 1G2IA 1XKQA 4NKRA 5AW1A 4YHHB 2ONKA 3MJCA 1A8QA 1QVAA 2Y93A 4G0OA 4PHGA 1NVFA 4F1JA 1ECLA 3OOWA 4FS3A 5K3FB 1UJMA 2GAIA 2IHJA 4FZVA 2RGCA 3OWHA 4HH3C 3RSHA 1P0MA 3T5BA 3QMMA 1V8FA 1VL5A 2QI9F 1VP3A 3EOBI 4W63A 4JJEA 5IWCA 2FZ5A 1SXPA 5DISB 1U2EA 3PWTA 4D9GA 1REQB 1U8YA 4EKYA 4M1MA 3DQPA 1H5NA 3ILSA 3UOWA 4R9VA 4M2LA 1KAEA 4R6XA 4YDRA 2J6BA 3RYIB 1TKBA 2MSLA 1PR0A 1Z0DA 4WZBB 2HC9A 1N6IA 3B1VA 721PA 3A26A 4BRWA 2HN9A 4IJUA 2PHZA 5KOIA 5B6PA 5JANA 3I6MA 4O2LA 5FBQB 2AEJA 5LM3A 5JJLA 1IZ0A 2XYHA 4B4VA 2FMKA 3R5TA 3NWOA 4IWYA 1FRVA 3OD1A 4QDJA 3LK7A 1ONPA 2VSFA 3S8YA 3KBBA 5CVVA 5DK4A 1YJ8A 3MAAC 2NXWA 3HXQA 2NP7A 2ZRKA 3B6ZA 1DJLA 1C7ZA 2M32A 1EA7A 4YRFA 5KVCA 2XZDA 4Z4GA 2HMYB 1I24A 1CUJA 1I3CA 2ON6A 2P9HA 4KB5A 1G5TA 2WSSD 1XEWX 3EFEA 5H82A 4V1CA 1TYDE 3WL5A 4Q7QA 1BW9A 1VHDA 2UVPB 1D2RA 1XZFA 3H2KA 3K96A 4IFBA 3SQOA 5ISMA 3I4FA 2XDWA 1AQNA 3A1CA 3T95A 2FGJA 4FHEA 2WOJA 4CIWA 1YQEA 2OORA 5CB4B 5I7OA 1RBZA 3LHSA 1TX4B 1MENA 1Q6YA 3TAUA 5I7RA 1K06A 2GASA 2OZPA 3I1IA 4KLZA 4KO8A 4EVQA 2IPNA 5G3YA 3V1MA 5KVAA 1T9KA 5FTKA 4FHZA 1X92A 1V96A 1XJ5A 1TL7C 4WCDA 5ENDA 1NVMB 1CQIA 2C2XA 5H02A 5TQ0A 3C98A 4WESA 3BMOA 1EXDA 2ECPA 2QGZA 5J2TA 1N2IA 4MEBA 1L5LA 1J0XO 4I6JA 2ZSDA 1HWYA 3Q8MA 1Z2EA 1UJCA 2J85A 2PMEA 2HEIA 2OORC 2VAVA 4B4DA 4M6WB 2B9VA 2Q6VA 1XN1A 3I58A 1YUMA 2CJPA 3L5KA 4CMEA 2WW8A 4NAVA 4KIGA 3CZ9A 2TMKA 1O4WA 3WMGA 3M1LA 1Z5UA 2AGVA 4U00A 4A73A 4AKTA 4HI0E 5E4FA 4RZSA 3KR0A 2JHPA 3NOQA 3N59A 1GVNB 2VZEA 5DX0A 1T35A 2PE5A 2JGDB 3DULA 3DWGA 1QBKC 3ESDA 4N6NA 4C9BA 5K03A 5KWEA 2D2FA 3INYA 1SBCA 4M36A 1ZGJA 5EFOA 3K7EA 4BFVA 1M1NB 3GNTA 2G5GX 3NM6B 1OX4A 2H1VA 5FBKA 3RSGA 4GBMA 2ZBUA 2D2VA 3F6PA 4PWZA 5EESA 4CMEC 4JVSB 2BHTA 5IUJC 1GJRA 2FG5A 1JMVA 2BKEA 2GJSA 1N4AA 1NU8A 2MINB 1H0HA 3WJ2A 1R8SA 4RTLA 1DX4A 1OVMA 4IM7A 4EMBA 2Q3FA 3L49A 5LZ8A 4RTMA 1ULUA 1T3HA 2Q7OE 4IIUA 5DLQC 5BQ3A 2QRUA 1E9RA 3UGQA 3B3QA 4GQIA 2EGGA 4CKWB 2WJHA 4RDHA 2VHUA 4P5EA 3S70A 3G7NA 4DPKA 1JIXA 4YIKA 2FLVA 2ZUCA 3QI7A 2P4UA 1VL0A 1VFNA 3IBCA 3L7DA 1FBNA 4WSOA 3TM5A 5BSKA 5F7XA 3PKIA 5HFAA 3U4AA 1D2NA 4MV8A 4WNYA 3H9JA 1EFPB 3GG9A 1JHAA 3I53A 1LBIA 4KPUB 4QXPA 2AG0A 3GFRA 3HCRA 3FPBA 4GX1A 2NXJA 3DC2A 4E7PA 3AKZA 1M54A 2CHUA 4WJLA 5ER9A 1ORWA 3NZEA 4IJVA 4ZOAA 4QUHA 1K6XA 3FPSA 3GEPA 1DUVG 1WMEA 4WLUA 5ALNA 4DDWA 3B13B 3DD5A 3KJXA 2HNBA 1RYZA 1VYUA 1TU4A 3EXHA 3OY7A 4DV6B 3L7AA 3A25A 4ND1A 4J7UA 4MX8A 3BSWA 4I1VA 1B0PA 3OU2A 2V6IA 2WTXA 4HGZA 3FX2A 2DC1A 3TAHA 4G1UC 5IAGA 1K2WA 3IPAA 4NYMQ 3M6AA 3RWBA 3KKLA 1N9GB 3PHGA 3WL4A 4B0OA 2UXCB 4B3BA 1IY0A 1MPTA 2ZRGA 3T1VA 1J23A 4C0AC 3C7TA 3OJWA 4EG4A 3NOXA 5CB8A 1XMSA 4W5HA 5ARDA 1AQLA 2JJYA 1SUBA 2ZBDA 1E3LA 2ZB8A 3Q8LA 1XKTA 4J07A 13PKA 3QENA 4TWIA 2FPUA 3UMRA 5BNTA 4K40A 1AQYA 3VNRA 2B1RA 3EXHC 4BNFA 5B4VA 1Y6QA 3RSCA 1T24A 2O6HA 3GLGA 3W7VA 4QPZA 1JG6A 1KP2A 1H22A 2P9TA 4ZOEA 4OMFG 1EDEA 1ZHOA 3B9PA 3NWPA 1E9SA 1Z22A 2OD7A 3R7NA 4R5MA 3ZZ0A 5KQRA 1L7MA 4BJ1A 2Z6VA 3KZCA 4P4UA 1X9GA 5FTJA 4F84A 1SB8A 3LMKA 2G76A 1IHUA 3T7JA 4F2WA 1SZPA 5JCZA 2AV6A 2CL5A 1EX9A 3IA7A 2OVBA 4I4IA 1HDOA 3U39A 1P1JA 2FUG1 4GWLA 4OQYA 4KTTE 3WKEA 3ZCXA 3VISA 4I1OA 2OLKA 2PSEA 4CE6A 5B64A 3PT5A 1D1PA 4WOJA 3UMJA 3WK5A 5CITA 1Z4KA 2CUKA 1MJHA 1QIHA 5KYVA 5CFLA 1ISGA 4WFKA 1F7VA 1W5SA 1ESNA 2ZRQA 5T41A 4U2GA 1TDJA 2H1RA 4B3JA 1TVKB 1GAQA 3V1KA 2RGUA 2ZYHA 4ZVUA 5TJHA 3RAPR 3BZBA 1E6UA 3IVXA 3EF1A 2IXBA 5AJYA 3U7JA 3JD1A 3FWPA 1WHSA 4YONB 4NMXB 4JL8A 4OFWA 4PSUA 3FIUA 4W8OA 3DEYX 1CDZA 1LTQA 1OLOA 1PDWA 1XWWA 4JBIA 5EQJB 3EMKA 2AOUB 5G4LA 4R1SA 5IKPA 1HETA 3B60A 1V7ZA 1E1KA 4DR3B 3UT6A 5FBRB 2SCUA 4F2GA 1RRPA 2JCYA 2Q1YA 4HXYA 3PC3A 1A7JA 2WJJA 2C3MA 2J5XA 1WEKA 3P5SA 3CH7A 3WGTA 1UMDA 2QM8A 1CFJA 1IJEA 2AK2A 2Q28A 3QBTA 5FA6A 3UK6A 3LX4A 3RR2A 3MCZA 3UM9A 5BMVA 5CD9A 3OO1A 3CVUA 5DXJA 1EU1A 4JL5A 3WVNA 1WXQA 3ANXA 1Y42X 3A3KA 4K9PA 1JZSA 1VHQA 3QBVA 4GM0A 4H1VA 4AICA 3UMSA 5I51A 3OC0A 3T5AA 2B0CA 3ZVNA 2O57A 5ADVA 3IAXA 1ORVA 4CQNA 3WIVA 1DC6A 3C1UA 4YCNA 1G19A 1HBJA 4MQBA 2IUYA 1XJCA 2GYWA 1T5OA 2WV7A 1VKNA 4RETA 4IILA 2ALJA 3SEAA 5I7VA 3QI2A 3OCUA 3B38A 2W6ZA 1TU0A 2LDXA 3GGDA 4Q1DA 4HUQB 1LI7A 1T5SA 1GPDG 3EBLA 2PX5A 1HEUA 4HDAA 3WYEA 4EO4A 5CBPA 5DI3B 1M6WA 3UAOA 4YRCA 2VUUA 2Y1FA 3HA7A 4J2HA 3VO1A 4CDMA 2OSVA 5HIKA 1J90A 1DZ3A 2CXXA 3H05A 7REQA 1XCJA 3N6RA 4POAA 1Y0BA 2FEAA 4C7JA 1PJBA 1ADCA 1ISRA 1O9GA 3PRYA 1IOWA 1OB2A 4QQFA 5LJLA 1YE3A 4FDAA 5CT9A 5H70A 2EHJA 3AFHA 3WYFA 1T0UA 3MPOA 5I9SA 1VBMA 2PGIA 3KB2A 3WMFA 4K9KA 2O8VA 1NW3A 2O7VA 1CUFA 1X3SA 1ZIYA 1MVNA 1FVHA 5F2EA 2F7SA 4W5WA 5ETJA 4FILA 2C2OA 2H65A 4P3PA 1OI4A 4CNQA 3BXOA 3RSOA 5CLLA 3BHJA 3LIIA 3VR6H 2A4MA 5LD2B 2C54A 4HQNA 3GJSA 4FFVA 2CKMA 3ZWAA 4TL9A 4E5DA 1NYQA 3A32A 2NU9A 3AETA 2X15A 4IDOA 4HD8A 4K9SA 3P97A 2XWJI 4QYIA 2OWEA 3U9TA 4A82A 1AS3A 1OGYA 1E7QA 4NZMA 3X1WA 4JGBA 4HLCA 2VJKA 4CN9A 3T38A 4AUMA 5JNUA 2AXPA 4QA9A 2C82A 3I04M 3AVPA 4JYCA 1ZINA 3FRHA 1ZR2A 4BV3A 2R5NA 5H83A 4HH4A 1GRQA 4KC0A 3QBDA 1OLSA 4C4SA 1X42A 4HO1X 5HRAA 1KA9H 2R86A 4EARA 3UH0A 5KSOA 4EX6A 1TB4A 3DE4X 3NAQA 1IH8A 1FDWA 1O0SA 1P29A 1R7RA 3D0RA 3T4XA 1TQ4A 2VTBB 2NYAA 2GWRA 1WEHA 4WDRA 1OE0A 1JPNA 2AC2A 3ONFA 4RFSA 1TM3E 1BN7A 2VHJA 3EBOA 1ZD8A 4JJFA 1TZ2A 2HA2A 2GM9A 1RS0A 3F78A 4GH5A 5T4BA 3P32A 1WX1A 2Z6UA 1PZXA 4I9FA 1I13A 1VCOA 3HKEB 1N33B 4X3OA 5DTEA 4HWRA 1TAHA 1U63A 4P1ZA 2UZIR 2V9CA 1RFGE 1RVV1 4IDQA 1QG2A 2FZ4A 1AZSC 1QTRA 2D2XA 3KSAC 3QTTA 2VP9A 3DAGA 2ZFUA 4HKTA 4TQAA 1HT2E 5FV7A 3HEMA 1Z8HA 4QODA 2OGWA 2CXPA 1N6HA 3F1KA 4M53A 1PJLA 3MFYA 4FJ1A 4EWLA 2YUTA 3OE4A 4U7HA 4K1XA 4R9RA 1HDEA 2BE7A 3FMOB 1TI7A 3OHMA 4MVWA 1N2CE 1V45E 2IF0A 3MJRA 4PNEA 4DCNA 5F78A 3IXLA 4DMMA 4YY3B 3K0AA 4KPYA 1ODJA 3PC7A 4Q4HA 3NPAA 3HVUA 3FF1A 4MIKA 4B2YA 2QTVA 2ZWOA 1PZMA 5HX7A 3PU6A 3I2HA 2BISA 2DFDA 1NG1A 1V35A 5B58C 4AUNA 3DMFA 1RQ2A 1TRHA 1G2OA 3HHEA 3L02A 4ZZ3A 1DZIA 4LFCB 1Z36A 4MK4A 4EZBA 1FDSA 5GOZA 1GA6A 2EQ5A 4M0UA 1JF8A 3EXFB 3COWA 1QIDA 5KNBH 3KJIA 3KFVA 4WACA 1W30A 3U3XA 3GNQA 1JDUA 4BWVA 1XEXA 1XZJA 1DWPA 1SU4A 1XRRA 3BB3A 4RZUA 5CCBA 4B6PA 3EGXA 1DCFA 1OXSC 1WJGA 521PA 4BP9A 4DDVA 3AUXA 3QFRA 4RK5A 5K0GA 1S9DA 2FH5B 2I4LA 1WMBA 3DP9A 3LTNC 3E2IA 4UUBA 5TMEA 3VYVA 2VDWB 3L43A 4BECA 1O87A 2Z9BA 4NCKA 4FFLA 1GNPA 4MRMA 5IKEA 1ID1A 3GQVA 4UCXA 4BFCA 4E30A 3CW2A 4AYXA 3G2IA 4GOXA 4ESOA 1DX6A 3L0SA 3FVVA 5BRJA 4XPIB 1E5LA 3EA4A 2JLAA 4BTVA 4FCTA 3LLMA 5C4GB 2GZHA 2RKBA 3K0HA 3HXOA 4PQGA 1HDIA 1LUAA 1MIOA 1Y9JA 2C61A 1H93A 2B8JA 4RE6A 5JNRA 4EL5A 1RI2A 1F3OA 3AYZB 4Q15A 5JQGF 2GT1A 2Y99A 3VH3A 4KPGA 3VKHA 4J0IA 2DP4E 5BYBA 3TIFA 3RJZA 1HFJA 4R98A 4BEJA 1UWCA 1KHHA 5FXMA 4N8SA 1WB5A 3DL0A 4P5PA 3RODA 5CTAA 4NCAA 1KMCA 3B7WA 2OCKA 1WQ4A 1R00A 2A59A 2W0MA 3EFBA 2OWDA 3HJUA 4ZKDA 2PSJA 4DUPA 1THZA 4QO7A 2Z57A 3GDOA 9GPBA 1K7FB 3KPUA 3B2EA 4I66A 3WLPA 4DW8A 4JXZA 1FQKA 2FMFA 3OQIA 3PNBA 5IZ4A 4GVLA 3HKBA 1HG0A 3ROEA 3K0FB 3MMNA 4JLBA 5IANA 4X65B 1TD1A 4FOLA 2WJYA 3BEDA 1GZ3A 2R87A 4UVDA 1TYEB 1U31A 2YXEA 3RV4A 3ZGOA 4DZTA 4TRNA 4Z4IA 4ZZ0A 2Y77A 1L4BA 1D8AA 5EMJA 5FPPA 4D9NA 3QMVA 5JUWA 3QNWA 1U7ZA 5F1PA 3EA5A 2GXSA 2E6UX 4DEXA 1XDGA 4TL7A 1H9CA 1X2EA 2FZKA 3ORQA 4PSDA 2C4WA 5E7JA 4LE0A 4HAZA 4X61A 3SZUA 2XUHA 3C43A 4UM9B 4LQLA 5AICA 4OUDB 2CYAA 4C4TA 1YQGA 1LDBA 2FP4A 2GLTA 4A3SA 3LP5A 4GGOA 5H4GA 1CULC 5L8VA 3HNOA 4B3FX 2I99A 2VF5X 4EFMA 2CCKA 1L8XA 2FPIB 4YT5A 1C3OA 3LLSA 3WNZA 4IEFB 3LQKA 3CNNA 1MT3A 3B1YA 3THRA 3M2PA 5B6JA 1UM8A 2FPSA 2XVXA 2EJTA 4PAGA 1E2DA 4P53A 3W04A 3GB9A 4KO4S 4HAYA 5CDTA 1P5HA 2Y0EA 3I1YA 1JHVA 1SJ9A 2AN3A 2MSCB 3WZLA 5ELXA 1BZYA 1KO4A 2ZZKA 4Y6PA 1ZKDA 2WJZB 3F5DA 3REQA 4TKVB 2QW0X 2W83A 4FC7A 3W6PA 3WLQA 5CFMA 2PJDA 3I12A 3UMBA 1F6BA 2FW1A 3MBIA 2YDYA 2HZBA 4UCQA 3UK1A 3ZW8A 3BTOA 2QVXX 3T3GA 1QQBA 1QIGA 2VN8A 3E3LA 3TN7A 3UWPA 3S0JA 1NI4B 2Z2YA 3EK2A 1E79A 5AHOA 4DC1A 1G8YA 1NUQA 3K9NA 3MYRA 3QFCA 1ZRMA 2JFXA 3AW8A 1UCFA 3L9WA 4OLFA 1E4VA 1I6MA 1KIAA 2C3UA 3VKWA 4BEWA 1M0TA 4MS4B 4FOPA 1QRRA 1RMYA 3L07A 2PH7A 3CHYA 2NXEA 2QQFA 4MAMA 2VDJA 2PV0A 5FOUA 1X80A 2IL1A 2MWMA 1SUIA 2V03A 4RU1A 4BMPB 1GRRA 2B4TO 4DLKA 2W6OA 3OETA 5CEJA 2HR1A 1DKLA 3DB1A 4I4LA 2AFHA 3IEPA 2ZITA 4GAEA 2WIBA 2YMLA 2CHQA 3USZA 2A5FA 4PHTA 1M2WA 3GEEA 4M1OA 2FHPA 1WD7A 1W36C 4H4DA 1OIWA 1AKEA 2OK8A 4W9RA 1FQWA 3DKPA 1UXJA 1FS6A 4LHYA 4EJSA 3TDKA 2GARA 3AFOA 4BAGA 2BD0A 3QM1A 1N2CB 3F3YA 1EGQA 2FPGB 3GROA 4K81B 2GUGA 2FJ0A 4XVQA 5FBLB 2AZMA 1PVDA 1F2UB 2CLKB 5DBIA 4ATNA 1THGA 4C4ZA 1W4BA 3RRYA 5C52B 4ZMSA 1T15A 1GILA 4G4IA 4LN1A 3IFSA 3N39C 2DERA 3BKWA 2ORWA 4ZT7A 1AHNA 2W2MA 4RPGA 4G0MA 4XYBA 4HNTA 4CM1A 3BMQA 4AQ7A 2NLOA 1Q1ZA 1UEXC 1UH5A 2ZBVA 4EDFA 5FTNA 2E82A 1JA9A 5B3KA 5BSGA 1IBKB 3ER8A 3RIYA 4OHRA 1T9GS 3ZIAD 4EJSC 2ZBEA 3HJAA 4Y6LA 4YJ3B 5TJ9A 1X7XA 1Y3BE 2VSXA 5EIHA 3CO0S 2P9EA 1U7OA 1GFIA 5MGBA 3JQ7B 3PDWA 3PQFA 5DEOA 4DVGA 2XODA 5FOTA 3N07A 4CL3A 1SKQA 2PEZA 1U8XX 1ZOSA 2WUEA 3SZGA 3ZIAA 1OVGA 2ZBPA 5LYJA 1M66A 2A94A 2HF8A 4UUOA 1ZBDA 3MOSA 3BXEA 4AN1A 4YUXA 5F23A 3K30A 1SCDA 2VZ0A 4TN1A 1T36A 1IQUA 2V6BA 3O47A 3T3PB 3RVBA 2CB0A 4JJ7A 4B3HA 4BVLA 1YZFA 4U3JB 4ZAXA 3BWDD 1RBQA 4LZPA 4EITA 3CIOA 2JI4A 5TQVA 3RHZA 2YXNA 4PCAA 2WSYB 2H2GA 3HY6A 1PZHA 4EF4A 4GICA 4ZDJA 4DKXA 5FDFA 4F4CA 3LDGA 1FP2A 2CMHA 1P1IA 2R6AA 2F17A 4N3AA 1GKIA 1RHKA 1VA5A 4PG8A 2XMCA 3KOYA 2XKKA 4EUFA 2QW1A 1YZ3A 4LJ5A 4L15A 5DM0A 3CCCA 1T6ZA 1L5NA 3WYAA 2Z6AA 4TQ9A 3BIWA 2QD3A 1PEDA 2E0IA 3L7KA 4BO9A 1Z29A 1AM4D 1BS2A 2H1SA 4GMHA 3W4JA 2GSDA 4YK7A 2O2ZA 1XRLA 4JR0A 2V7GA 3O83A 3R2JA 3WWDA 3BSYA 5DM2A 1SB9A 4B82A 4F8YA 5FUBA 2F9LA 2MR6A 4XTCS 1X7YA 4BNUA 2HJRA 2KHZA 2M1XA 1Q74A 3K8QA 2F62A 4PSAA 5AKIA 4WAUA 3UJAA 1S7CA 4M49A 2CXQA 2QK4A 4LVUA 2B7BA 1J39A 1PJ4A 1SCJA 4P86A 1G5RA 4QHSA 1QWOA 2FW0A 4CI9A 4HCJA 2ZGVA 3VDRA 2A7QA 3LVBA 4RVUA 5BT8A 3M1YA 1TEZA 1QGDA 3FI9A 3IAAA 1P0CA 2CBXA 4RHYA 2VSOA 1LY1A 3I9OA 2KBEA 3WL3A 2NSLA 4C7KA 3IAS6 4OKSA 5E6RB 4A2PA 3KWJA 5HIIA 4D9BA 2G4VA 2B3DA 1PAUA 4Q6BA 1WDTA 2F3RA 3TKLA 1PWXA 2YIJA 3TSAA 4BNXA 5M04A 1SRRA 2CLFB 1L5HA 2ECQA 3CNQS 4NAUA 5AP9A 4CTOA 5BXQC 3U4MA 5EP2A 2C84A 3HLYA 1HKUA 5HWSA 1VPTA 5EYPB 2AEMA 2FFRA 3YASA 2TMGA 5JTUA 4EG8A 2F43B 2GXUA 4FZ5A 1BQ3A 3EA0A 5FBZA 1E58A 2GJAA 3ITEA 1FUUA 2H59A 1SCAA 4RTKA 3H1AA 2NUAA 1KU6A 3TQRA 4XLLA 5BORA 4CQJA 3KKOA 1S3GA 4G5XA 3UAVA 2G25A 4KLAA 4MV0A 1YHYA 3AH8A 3KZOA 4Q39A 1J33A 5K0FA 5T3UA 2BGIA 2VDLB 3OZFA 3FPEA 1K4MA 4H7FA 5I01A 1R4NA 3UQZA 5ALSA 5KHLB 3EMVA 2HSGA 3JX9A 1Z5ZA 4HAIA 3D8UA 4NOKA 1CNEA 1ANKA 3CEHA 3PV0A 3QVGA 4DS3A 4W7SA 1VSQA 1KKLA 3GJYA 4DBZA 2V45A 4YV2A 2AH5A 1SA0A 1ULAA 3F7TA 3ZNQA 2KLHA 4JWTA 4MWTA 5KU1A 4C0HA 5C8ZA 1IK4A 2ZI6A 3HJHA 1NVWQ 2IGTA 3FKQA 3L4SO 5F2NA 1I2BA 1WLYA 1IQ0A 4IXDA 3B1WA 3G85A 3M49A 1F0KA 3ZW7A 1DIGA 2ZJ0A 3W2EA 1PS9A 4CIYA 4BZWA 1UPUA 1KMMA 1E5QA 1YDMA 4MEJA 4CFZA 2DCMA 4EI7A 4E14A 1GV0A 1J25A 3TRFA 4BGVA 4MHOA 1VL6A 3WADA 1ZESA 3A6LA 5K9ZA 5J5CA 2PUEA 2WZBA 2DRIA 2Y2VA 5REQB 5DRTA 3UW1A 2DE0X 3P26A 4I4NA 1G4HA 4GYKA 4ZAFA 1KSFX 4Q93A 3QY0A 1RXVA 3RF7A 5DB4A 2OD2A 3DYBA 4IIHA 4FC6A 3TBKA 5U9CA 3P52A 4G2TA 4Y2YA 1LRLA 3H5NA 4Q00A 4E2WA 2BM0A 5SYMA 4TROA 1O6BA 1WULS 1NPDA 3LQ4A 3IEKA 4DIUA 1YZVA 2FZWA 5K3OA 1WXHA 1RACA 3AW9A 4HNAB 4Q9KA 5BOSB 1Y3FE 2AYYA 1ZRHA 1CS0A 1WCIB 3H18A 4IO1A 3U3OA 4ZI7F 4OJTA 2X19A 4LI0A 4OXXA 4Y2SA 3UT5A 1EBFA 3VR6A 4DSUA 1JILA 3CRMA 3RQIA 4H4EA 4LHZA 4X8HA 4MIYA 2QI9C 1C1DA 2ZWIA 3DF7A 4NG5A 1NX9A 5IJAA 4KDFA 1UXKA 2YN0A 2V7XA 1M7HA 3D59A 4FKZA 4HAOA 5KSPA 4FSHA 3RFTA 5JAUA 4INZA 4YCCA 4CGZA 2Y1EA 4A27A 2D0OB 1OB5A 3FTEA 4D3FA 4WJZA 3A1TA 2K7FA 4JYZA 2QL5A 4P58A 3ZJVA 1I4OA 2VTDA 2C92A 4JP1A 3SI7A 1AURA 3WMEA 2H2HA 1M7GA 3BREA 2KPOA 2ENUA 3LA8A 3M89A 5JI2E 4F56A 5FI1B 2IU0A 4D81A 2C42A 1VGVA 2G9VA 3DEJA 5ALXA 5JLJA 5L3SA 2YJNA 3I9MA 4KWCA 4G8JA 3KFXA 5JS2A 3TR5A 4QZVA 4YXWD 3THXB 1Z6QA 2ZEJA 4LNUA 2DULA 4TYQA 3D8TA 3KV3O 4F45A 4IFTA 1RI4A 3C3BA 4KZKA 2XNDA 2XZPA 4MUXA 1LBQA 4N3BA 4LCJA 4YACA 5HBGA 3S5UA 1LBTA 2ID9A 1NNI1 2XAUA 1JR3D 3EGDB 4ENQA 1XPOA 2OV6A 4UUPA 3RRNA 1GU1A 3HXKA 4HZIA 4ZYVA 4ARCA 2FMHA 4PNHA 1QIEA 2B30A 3IX7A 4X6LA 2M6RA 1WUKS 4QUIA 5A3SA 4I08A 3KWMA 3WICA 5FUVA 1Z06A 2NAPA 1NLMA 1Q1GA 1RAGA 3UPDA 5ALVA 4ZVQA 4KITB 1I0IA 4D42A 2BTQA 2J67A 4EA8A 1DINA 3RTGA 3EIHA 3TLXA 4ZFNA 5HF9A 1BDHA 2GVNA 4MLPA 4QUDA 4WRRA 4YUWA 4RTQA 3IYLW 1NF8A 3LNCA 1CFZA 1GQ2A 1P6UA 3B1JA 1TK3A 2CF5A 5HFJA 8LDHA 1OFUA 1EINA 2OC4A 3EDCA 2XMSA 5HOQA 3NBXX 1Z6XA 3ZIUA 2P7HA 3CCFA 5DN6D 1XQ6A 1BDMA 2MYUA 1ZD2P 3JYHA 4QL3A 4TWJA 2VSYA 3DOEA 3T1NA 4KR3A 3NIFB 4OH7A 2PAAA 4C6SA 3MUEA 2XOKA 5EWJB 4EPYA 3MWDA 4HWKA 1P2DA 3TFOA 3RJ9A 1LK7A 5KNBA 1YB6A 2ESRA 2M9MA 3TUIC 2ID7A 4CKEB 3THWB 1YCFA 2GBCA 5DN6A 1JA0A 1HMPA 3C3YA 1FDVA 3IAS1 2P77A 4PFKA 2HGZA 2HPVA 3R6WA 1W5TA 2EOAA 1XMJA 1KYWA 4P31A 4G23A 5CIQA 3K9LA 1ZUD1 5DT2A 4YPFA 4E1BA 1M2EA 4XQEA 4RKFA 4MUAA 4CM9D 2CNNA 3CPSA 4ZANA 3SICE 1HO3A 1ND5A 4IHJA 2ZIXA 2YASA 1YRWA 1ZM2A 2PJUA 2JJMA 2HXYA 4JGGA 1TF2A 4D6YA 5BN3A 3K31A 1FS4A 2LBPA 3IT1A 3SK0A 3TKYA 5AUOB 3ROFA 4AKGA 1YA4A 4QDUA 3GCZA 3L8GA 1MXHA 4R1TA 3DMGA 3ECCA 2O5CA 4WZ6A 2CT8A 5JBNA 4AB1A 3IL2A 5C7LO 1URPA 4QG7A 1QFMA 3UENA 4BO6A 1XWFA 1PG0A 2XGSA 3ASYA 1XDDA 3SYRA 5ICEA 2RGGA 4O4HB 1AHIA 2ZSJA 3KB6A 3ROGA 4C7XA 4AWAA 4RTOA 4DLLA 2PSDA 4QDOA 1DARA 5JD3A 5HCUA 1D7AA 3QU4A 2G8LA 3HL0A 1Y4UA 1IY8A 2HA3A 2B5VA 1O6ZA 2GCIA 3BE5A 3DMTA 3OJCA 5KSWB 2AJLI 1EXNA 1ODTC 4RV9A 3M34A 1MN6A 2VAWA 3D5QA 2WFZA 3K1AA 2GD0A 3G9TA 4LWQA 3ZHRA 1DU4A 3FGNA 1R6XA 1II0A 2C2MA 1J4AA 1MR3F 2JFQA 5DJ5A 3IOCA 1W88A 5AHWA 2IXTA 3INRA 4GP7A 4KAAA 4MVJI 3AYXB 8GPBA 1B6GA 2GZ3A 5DNWA 5KOHB 2Q3JA 3JPWA 3JYNA 1Y5LA 2QVZX 2EW2A 2ZUSA 1EBBA 1LLFA 3GP5A 1DWQA 4GYYA 4YJGA 1LPAB 3QYAA 2H16A 2QX7A 4D4KA 3E9NA 2B21A 1A69A 2YWRA 2NIPA 4M0LA 4UBKA 4BWYA 4RAOA 1GRNA 3FB4A 3JD4A 3DMTC 4B48A 1YDFA 4EK9A 1JBEA 1XMXA 1R9MA 3PFGA 3VTFA 2AFIA 3N2LA 4DCJA 5CJJA 2ORYA 2ZPUA 3LT4A 2W58A 4TGLA 3L40A 2ZCVA 3ZJYA 2DYKA 3ELYA 2WNHA 1A9YA 4FI3C 1DTWB 1NAIA 2BEJA 2PZGA 1U2PA 4C05A 3V8NA 1CUBA 3E82A 3MRXA 5A4IS 3O0TA 4JGIA 1ZX1A 5ICSA 3N70A 1QYDA 5AJZA 3K9BA 4MMZB 4D8XA 1GTMA 1JHPA 2E37A 3M4JA 1P31A 3QEMB 2V97A 3D4LA 1AUVA 4ZOQI 4NMWA 3L0BA 4CIDA 3FNFA 4AJ4A 3OVMA 2EERA 2QUIA 1K3UB 5GM1A 4PONA 1SXQA 3CX3A 3MC1A 1OGIA 2HKIA 2HIHA 3FCEA 4JJ6A 5DGDA 3ND7A 3SSNA 3VTAA 2KI5A 1PQ4A 2E85A 4LQDA 4UTNA 1P60A 1YR7A 2A88A 1ZUNB 3PRHA 4MYTA 2R6CA 4NYIR 5EE0A 1OMOA 2JFPA 2EEZA 2Q3LA 5G0TA 3QOWA 1AN0A 3IAEA 3UUGA 4DQUA 4RVHA 2XLCA 3EXIB 1OLXA 4RWEA 1PYDA 1A1VA 2FVYA 5LB4A 3EDYA 3WLIA 2DY0A 1JUDA 3KPYA 2QRGA 3TZLA 4CIAA 1KTIA 3FJYA 4K28A 2TECE 2RG1A 1O8BA 4BV8A 1OH6A 3A28A 4WY5A 4UBJA 3VPCA 4AKSA 5B53A 2BGKA 1IEWA 1BXRB 1KXZA 1Z17A 3LZCA 2I65A 5G1OA 3T1OA 1QRTA 5M7EA 5IKXA 3DV2A 5GONB 3X2FA 1FTNA 5ED4A 1AUQA 1BJRE 2B61A 3HB0A 1ENPA 2G88A 3R3WA 1A8IA 2XJ4A 1RZ3A 3W7BA 4B87A 3DFMA 3JZFA 4WNCA 4YGXB 5EIBC 4CLOA 1FDOA 2PVSA 1SMKA 2ZBFA 4W1SA 2ATXA 2X8JA 3OECA 1MO4A 3JQ8B 2AEFA 4CMHA 3G2PA 5JDIA 2UU9B 1F20A 2WA1A 3KSRA 4ZEMA 5KX5B 1S8FA 3TW6A 4JI4B 4DUGA 2RAUA 1OXXK 1VMDA 2YRFA 2ZTSA 2JD2A 2PCLA 4B4OA 1V0JA 4PLYA 3GMTA 5BVGA 2VCYA 3C8DA 1SD5A 3ENVA 1OWMA 1UBMS 2AVNA 1W73A 2MU1A 2DPGA 3ZWNA 5MHTA 2O8DB 5DI9A 1E3EA 3OJFA 4X1YA 5C2JB 1IEXA 1YB5A 3KDPA 1P5RA 4TMFA 3OPVA 1U11A 3FDZB 1VKZA 4GKVA 4TSFD 3RQSA 4R16A 4DZZA 4M60A 2Q07A 1N8TA 1UZAA 3IBFA 4OEHA 1K7EB 1RJEA 3GZJA 4E13A 5JDIC 3EEBA 2HSWA 2D4HA 2CLEB 1LKZA 4U8GA 2BTEA 1JU3A 4RY8A 1OGJA 4AIIA 4Q9DA 4N0PA 5KNDD 1QS0A 1RLMA 1S2GA 1NVUQ 3VR5H 4R2LA 5C1OA 1W5EA 3E9DA 4P84A 2D5CA 3ZHBA 1Q0SA 2ZJOA 3FPLA 3JRXA 4NDAA 4KO1S 4TVKA 5IC6A 3UWMA 3Q88A 3G5UA 3KS9A 2R8EA 3M4XA 1LDMA 1F17A 1S6YA 5BOVA 4M9XA 1QF7A 5LP6B 1MJ5A 4JKYA 3NTLA 4OREX 3QWIA 2X5JO 3EQ8A 4MQ4A 4RZXA 3ZWYA 4MJ3A 3O26A 1OZFA 4X7RA 2GD2A 2R65A 4DQ0A 3SQLA 4EPRA 1Q16A 3JPYA 4KWEA 4QLOA 3RC8A 4XYEA 3NG1A 4IMIB 2PKQP 4OA5A 4PS1A 1FFXA 5CT5A 3PQ7A 4UC0A 1SQFA 2Q41A 2ZB2A 4GIBA 2ZCUA 5AJVB 1L7VC 4E7OA 4Q01A 3IV9A 3CUTA 2LR0A 4LXIA 4ZGWA 3KQQA 3DE2X 4YCAA 3L8CA 4A2QA 4BQIA 4EJ0A 4DADA 5KYNA 1UANA 3R5JA 2D00A 1KI9A 4Y7DA 2CY0A 2W71A 4DLZA 1XLTA 4LDQA 3GN1A 1DI0A 2JGEA 3PYMA 3JVEA 4NL4H 3NYRA 2HFJA 1A4UA 4BFTA 3GC6A 2HSZA 4IY1A 4I3HA 3TZQA 4RTSA 4WL0A 421PA 4BFLA 3L6UA 1W5FA 2RK4A 3LM8A 1BH2A 2R1TB 3WKCA 5B4TA 1NT4A 2DR3A 3QE0A 4IYJA 5A1TA 1C1XB 2BSQA 2F8TA 1R0ZA 4XFKA 4XJSA 3TRKA 1N6RA 1ENZA 2QAGB 1WUIS 2WMOB 4AZSA 2PUGA 1H3EA 4WUTA 2F48A 221PA 3A4IA 3SWWA 4RHTA 1IMOA 2XHZA 1C1YA 3WK8A 3ZXYA 1K08A 3D8HA 1XLTC 5CA0B 4F38A 4DIDA 4LAFA 2OE2A 1NXWA 2A3RA 1YK0A 4P5DA 4XIGS 4UULA 4E4TA 2IEGA 3EY9A 3TLGB 3TQCA 2D5IA 1L9XA 1DT3A 4LZJA 3F71A 5BW6B 1NR5A 1Q22A 4NZNA 5J1TB 5BWNA 4UM5A 3AJ8A 3EAFA 1GZUA 4O5AA 2C83A 2H8KA 2NXNA 3EG9A 2F1RA 3LF1A 4R7ZA 1JAHA 3KJZA 5G0UA 1LCIA 2PUJA 2XKAA 1EKXA 2G5CA 3A8TA 5C1DA 1LVUA 4BTLA 5DNUA 2J3JA 2PD3A 3GQBA 3T5PA 2F3SA 3ORSA 5L45A 2IEIA 3RPEA 4E22A 1OUMA 4CEIA 4QXOA 1EP1B 2CZCA 3KZMA 2J46A 3I6YA 3SOPA 3R0ZA 4DWVA 3KQHA 1KAMA 2N0SA 1H6CA 1W2WB 1KEEA 1YFKA 4FQ5A 4CIXA 1HT3A 5CPFA 2XADA 3HACA 4JBGA 4IAOA 3UNXA 1EM8B 2I29A 2PQ0A 3L0PA 4DA6A 2V4ZA 2WTUA 2R751 3NQ41 4GR9A 1RXWA 1E0AA 4S1OA 4M37A 3QYJA 1GL6A 3LUBA 3CTPA 3T3NA 3GU3A 1JEYB 3E7XA 3SZRA 3VJRA 3B6KA 1N5RA 1IVNA 3H1BA 1XSEA 1UQRA 4YALA 3UQYS 4IQ8A 5M29A 2AW5A 3P2IA 3J80A 2PZFA 4GP6A 2UYOA 3E81A 2WU4A 2XQIA 3R7AA 2WTAA 3LNTA 1QMGA 2AZTA 3H42B 3LW8A 3WA7A 2CNWD 1SUAA 4DIFA 2GLUA 3FTDA 1PT5A 4RF2A 3KZXA 3V7NA 2ZS8A 4S3MA 5ICMA 2CLLB 5DXAA 3E22B 4LTMA 4C2AA 1Z4IA 1WPQA 2NVUA 4BNIA 1V6SA 3JQ9A 3H5WA 4Y6RA 3VNQA 4GS5A 5JSZA 3OQJA 5DCUA 1V3QE 3Q3CA 5DGXA 3VGPA 1YI8A 3AJEA 4PBRA 3KXIA 5JQGA 2VRCD 2D7CA 3CISA 1E2IA 4O1HA 2HSEA 4C20A 1MRZA 4FT4A 1GQFA 3ZVLA 2R47A 4D0LB 4JH0A 2VHWA 3EDQA 1QAMA 3FOAA 4IMJB 1P2TA 1ZAYA 3EMDA 4IF6A 2W2VA 1IQRA 5C1IA 3R4VA 3JAKA 4JSYA 2ORED 2MMGA 3KJEA 4KYVA 1JWBB 1A95A 2WUDA 3B8HA 2G6BA 4KHZA 4L0DA 5TEWA 2I3BA 1KS9A 5EUCA 2NZ2A 3SP1A 5JZOA 3TLYA 4AURA 3E3NA 4GUAA 4O2AF 5B1EA 3ICOA 2ZJYA 4LJAA 1N5IA 1U9ZA 4FWIB 3JQ9C 2OA0A 1O0BA 1NXSA 5C8XA 1VZ3A 3RBAA 3MRVA 2WHXA 4IINA 4CHTA 1KYQA 4D99A 1DO0A 1V1JA 1CJSA 3GT0A 4AM8A 3GGSA 3H5TA 4UFPA 1IXKA 3EODA 1FJHA 2DBZA 4X91A 2J41A 4O8ZA 3W5CA 2F8MA 5G4KA 1IXRC 2HDWA 4OI1A 1ZA2A 2ONJA 4M21A 4QEDA 2VPPA 2H4FA 4B9AA 3VPGA 3BX1A 5IM5A 5K09A 2V7VA 1JPUA 1O95A 2D74A 4TZ6A 1XQ1A 1M75A 2YZMA 1QJ4A 1BKYA 1GN8A 4OXIA 3V48A 1NQVA 1I7DA 2WUGA 4I5DA 4RL6A 2P91A 2XUOA 2AE1A 1KC1A 4MV4A 3WO0A 2ZJFA 3AF1A 3HUTA 1N2XA 1N92A 3AGPA 1U28A 2QUBA 3L6DA 3ZEIA 3BZWA 2A67A 4RM3A 2FDCA 3LU1A 3FN4A 1P7WA 2QJWA 1PJZA 5IT9A 4NI5A 5K8UA 1E1QD 2ZT8A 4MKXA 2JFBA 4P2BA 4R1UA 2VNIA 1H9BA 3N2KA 3HZHA 4XD7D 2DQYA 3NT4A 1DSSG 4YPVA 1PFGA 1O95C 1G5FA 2POQX 3PE4A 3SJCA 4A4DA 1KIMA 4FFDA 4L9RA 1SZCA 2Z04A 1RWBA 2CLOB 3FFBA 4B43A 1S3SA 4JEHA 1I3LA 2EG5A 4J0QA 5G1PA 5JALA 2JFZA 1TKRA 3ZWPA 3FB1A 3MTDA 4V24A 4Y18A 1U28C 3DYIA 3IO5A 4H0CA 4ETIA 3SN6A 1C7QA 2CJWA 2HCTA 1M2FA 2Q4DA 3ZWBA 4BNZA 4ZI3A 4YJ2B 4DR6B 3RAGA 5JU6A 1VPDA 3SJZA 5IJ9B 4DF3A 5KYYA 2HBQA 2PA3A 4XGKA 3VI4B 1NXXA 3AQ4A 5CVEA 3ACDA 3R9XB 3QVLA 4OLHA 5JZVA 2BR3A 4RMIA 4AULA 2LCIA 1EFVA 2D7JA 1DWUA 4CL8A 2PKEA 1IUNA 4G1VA 4RYDA 4PLPA 5L3ZA 1T8PA 2Y1WA 3A4VA 1UP6A 1U8ZA 4JNKA 4ED9A 1FW6A 3AR6A 3DNPA 1USUA 3N2EA 3OEED 1RPZA 1DAGA 3EJWA 2PKRA 3EQ6A 4ITRC 3JS5A 3PTZA 1NF9A 4PCLA 3RUFA 5FLXA 1ZXBA 3DFUA 3JQCA 3W2IA 3GJXC 3EFOA 3PDIB 5CFRA 4J8PA 1AIPA 3EDOA 3IDOA 4Q47A 2VLIA 1Y1RA 1T0JB 1GLVA 4ZVRA 2VDMB 4MA0A 3RIXA 2FFJA 2FUCA 4MR7B 3U9SA 4EMTA 4YS6A 5BWLA 3Q3VA 5IT0A 1NUSA 1T4MA 1X8LA 3FNHA 4HADA 4DBVO 1FNNA 4EFDA 3WGKA 1OX5A 2O3UA 2Q50A 5FULA 3LT2A 2AHRA 4D0RA 3UY4A 2LCFA 5BWOA 5J5VA 3RK4A 2B8TA 4L6CA 3UOGA 2KE5A 2J9FB 3SU8A 1W25A 1IUKA 3G0CA 1RYBA 4OB7A 1Q0TA 1A98A 2WJVA 2GN2A 3NHKA 4X1OA 1GFSA 3P96A 4PQFA 4LA4A 3E1SA 5B1YA 2AS0A 3SJUA 3KJFA 4AROA 4QOSA 1F38A 3KHKA 3C15C 5IVDA 5IEJA 1LWOA 1VE1A 3ED1A 1Y3AA 3IJPA 1E2LA 2UZ1B 4NYJR 1Y98A 2QUHA 3OH8A 3RFCA 2V3WA 4RD3A 4H17A 1ZJYA 4QU8A 4ZCLA 2W11A 3FHJA 4IH9A 3JASB 4REQB 3O4HA 2P35A 1QO0D 3LQ2A 3P9IA 5DWVA 2O5VA 2CUTA 2ZVDA 3H8VA 4O2BB 4A2WA 3DTVB 1DHTA 1N1MA 3QUBA 5JZSA 2EKLA 2XEXA 3PFKA 1JG4A 3KOOA 1XVAA 1E69A 1TMGE 3KPWA 4RIGA 2VPQA 4R81A 5DWDA 1ZJWA 1JXAA 3HBMA 3OX3A 1QO0A 3DLBA 4BVFA 4J7AA 3UANA 2IZ5A 4EGCB 3V2HA 4L72A 1CB0A 2VJMB 4IGFA 4Q34A 4N5IX 5EJ2A 1SCQA 1H65A 4KRFA 1HE5A 4I5FA 1X14A 2I7CA 2A2ZA 1J06A 3TD6A 3OUZA 1H42A 1U3TA 1J0AA 3IUEA 2RHHA 3UN1A 4EW2A 3MQ2A 3NAGA 2NQ8A 2GFQA 3OWXA 5BQPA 4AN0A 4D43A 5FEMA 5C3MA 5IDWA 1ZH4A 4CF4A 3E8SA 1DAMA 2AZDA 1GT91 1LNQA 3OU6A 1RYDA 2EZ9A 4KXWA 4KGVA 5ERXA 4D4LA 4RMGA 4E33A 1H66A 5BWMA 4TLMB 4E70A 3WZ2A 2B6NA 1W85B 2Z9CA 4HZUB 4C6TB 5LMCA 1MG0A 3M4ZA 2PD4A 2WKSA 3O1JC 3A9SA 5KYKA 4ILEA 4I50F 1L5GB 1ZD9A 1R6DA 4G0PA 2PZAA 4RAQA 3T3EA 1KI6A 4U6SA 2BCGY 2HD4A 4GLOA 3EH1A 4LISA 1TEHA 3HYLA 1V5WA 2NZJA 4RGVA 5CGQB 4ZQEA 5BSUA 1QHSA 3IP1A 4AF8A 1AG9A 1P4GA 1MDBA 3FBTA 4GOOD 3BL6A 1Q91A 2DBYA 3AFMA 3P0HA 4WXMA 2P78A 3NBYC 3IDFA 3PITA 3B3FA 3D5EA 5HJEA 2PUVA 4OQEA 2R4TA 3RT9A 2PH1A 2AWOA 2CFIA 2ERYA 3V33A 2RAVA 1EK1A 1CJVC 1PJ3A 4BYGA 4ZGBA 2BEUA 3RIEA 4BKUA 3BGOS 5JJCA 2ZDGA 4BMNA 2G67A 1WRBA 3E05A 1KI4A 4OBBA 5HCIA 4LJ8A 3O82A 4ZK2A 1KYVA 1V95A 2OOSA 2GPJA 1HGXA 3N8IA 2C2HA 2VQDA 3WDLA 3O74A 4BAZA 4ARZB 3KB1A 3IOBA 5A03A 5TPZD 5IULC 4Y2XA 1KQ3A 1VXRA 1SC3A 4I0WB 4YQFA 4ALJA 1M2HA 4D0NA 1SFRA 1KVUA 2Q1SA 1YZKA 4D4IA 2Q4EA 4YPOA 1UDXA 2RH5A 3KQYA 1C0KA 4XIIA 1Q17A 4JI7B 1UAAA 3WWPA 2FK8A 1DXOA 3IS3A 4GSYA 5TPZA 3VR5A 5CUQA 3DBLA 1CW2B 1T3SA 5TMDA 1HR0B 3DVAA 3ONVA 1XPUA 2BM9A 4DR4B 2KMLA 3A0RB 3BRWD 3SQMA 4K9OA 2PT7A 4MW6A 2IDZA 3USCS 2JRLA 3N5CA 3VX3A 3UZUA 2HCJB 3TMKA 5BYAA 4QBTA 3BTSA 5F2OA 4DLNA 4MRSA 3O7MA 4LOLA 2EFGA 4NV0A 4MW4A 4JQOA 4HSEA 2J3EA 2H2DA 3BRWA 2H4WA 1IWPB 5JAQA 2PUAA 1YB2A 3OLVA 3GIWA 3KT6A 3R6DA 5AW5A 1I3OA 1CVIA 2W2KB 3KVRA 3BK1A 3LCUA 4X6YA 5AOAA 3TQTA 4F3RA 1D4OA 1U1FA 3DZDA 4BXOA 3PIRA 1KJWA 4Y0NA 4XYLA 1FPQA 1I6WA 3LUGA 2YKGA 1VMEA 1KH1A 3CNOA 4D74A 1I7SB 2BUCA 5FORA 5KC9A 1NURA 4DLYA 3WBFA 3ZDCA 3V8PA 1EIWA 4LVCA 4MRPA 3ZHSA 4XVCA 1DLJA 1P75A 4EG5A 5A7FA 4UCWA 2HLPA 1U9IA 1XP5A 4QVKA 1WTCA 2X6TA 4RMNA 5IMBA 1W35A 4M76B 2VNKA 1XP8A 3S1AA 1NKTA 4JJ4A 1A04A 1AKRA 4YAKA 1DOAA 4GMXA 3DBRB 2N1MA 1Z2OX 2ZJAA 3VNSA 1ORTA 2Q0HA 2MJLA 1B0UA 3TZHA 4ENWA 4LOHA 4QEKA 4BNDA 1E7YA 4PCUA 4HYQA 3O8LA 1TAGA 1Y4ZA 4UREA 3CNLA 1SG6A 1F2TA 4DWJA 5JPDA 2BHNA 3BE6A 2YV4A 4MYUA 5JFGA 2OUKA 4HOYA 4R1PA 3BSSA 5I4IA 4TXJA 4B7UA 1MX9A 5AXBA 1U9IC 4Y9UA 3N8NA 1XD9A 3CNEA 3FWZA 5IS2A 1YRYE 1PS0A 4HTAA 2Y1GA 3TZEA 4RTJA 4NZYA 1N3BA 1YZHA 1CETA 2C4TA 3GDGA 4IFEA 3TX6A 4MTLA 3ZD8A 4ASUD 4H60A 5ECGC 3L4KA 5FF9A 2HCRA 2V55B 1K0FA 4B83A 2QX4A 3WJ7A 1CY6A 1SNYA 3NVAA 1XHEA 3QK7A 4O1IA 3D0OA 4HRAA 5KTRA 3ELWA 1DJMA 4Q7KA 4B5LA 3QE3A 4FJ0A 1Q0QA 3UWOA 1O08A 1YC5A 1H4VB 4DIEA 1NDUA 7YASA 1FRQA 4J3JA 3RWMB 4A23A 2BGTA 2CLIB 1D1TA 3H9EO 1X1RA 2GAOA 2ONZA 1QDUA 1WXIA 2CFTA 1MMFB 5AVVA 1M1UA 2PN1A 3MSXA 5KKNB 3I8OA 4AD8A 2C7RA 2JVKA 2XIQA 5ALPA 2Z2XA 1O6GA 2RBEA 3HJNA 3U37A 1EUDB 3FR7A 1KERA 1KKUA 3T35A 5G1NA 1QU2A 2EWWA 3PL1A 4DC0A 4NG4A 5TSDA 4B6OA 5KNLA 5FNZA 1DCKA 4D41A 3KETA 3BXFA 3V2GA 4DJAA 1GRCA 1W46A 1LPNA 1O94A 1QANA 3LG2A 3AXTA 2Q0SA 5C18A 1ZH2A 1E1CA 1QHIA 2R62A 5ECDA 3R0XA 1T2NA 3LVFO 3H5OA 3OQHA 4LHWA 4WKOA 1R6BX 5TARA 1IPEA 4LBYA 4AXXA 3F7NA 4M1WA 2HLDD 3OCYA 3HBFA 3KSDO 3OZXA 4P38A 1V7CA 3E9CA 1QIFA 1H6BA 4YCSA 2DWOA 3ID6C 4HEA6 1XTZA 4N8DA 1EWQA 3W2HA 2JKVA 3K1TA 1Q57A 2PQ2A 3GO4A 2WTNA 4NDNE 5LUBA 2W6CX 4R41A 1O94C 3N1UA 4V0NA 3AU8A 2WHYA 3OE7D 4JBHA 5EZSA 2XNKA 3VAZA 2VHCA 3H1TA 3VNAA 5K8VA 1SK9A 1Q1BA 4CCAA 4HDRA 2G1JA 2GZMA 2JIMA 1XVTA 3KT8A 3T3HA 1GTSA 3P9RA 4LK3A 1J22A 3DSRA 3O8CA 3PFFA 3H6GA 3W8RA 3F96A 4JYMA 4C04A 8ADHA 3CUYA 1MU0A 3ZW9A 1DKUA 4XDGA 2FAXA 1PK7A 3B2QA 3JAWB 1IJFA 1P1FA 4L4ZA 2WD7A 2IOQA 1ZOOA 4IVQA 1YJQA 1VE3A 1VJCA 1FSFA 2WU0A 2YS6A 3UAYA 3C5VA 2QTBA 4NMHA 2WUWE 4P4GA 5ALEA 2Y1CA 5B30A 1TO6A 2FEWB 3ZWVA 1NOIA 4IR7A 2C4MA 4LOJA 2J9ZB 1OH5A 5KWJA 3UJHA 3N6VA 1JEAA 4D8YA 2REXB 2IJGX 1E6CA 1M10A 1EQ2A 4PXAA 4Q3DA 1ZSVA 1ZBQA 3IR7A 5I3ZA 4LSWA 4OG2A 1D0SA 1X8XA 3AEYA 3L82B 4X6XA 3C7CB 5CLFA 3C6KA 1KZ6A 5LXTF 3VVCA 4ES6A 2B1JA 5K0CA 2AG5A 4NJMA 1K86A 1GYRA 4TM8A 4JXXA 2QYOA 3T7AA 3G1UA 3N7AA 3NAMA 2PUFA 4URWR 1QK4A 5DP2A 4HQFA 4K8RB 1VL8A 1V25A 1XZDA 3AX6A 3ZE2B 3K4HA 4PNPA 4RNDB 1XDSA 1PT6A 2CXOA 1YVPA 3DOFA 3R75A 1EHCA 4K26A 1L7EA 3MT9A 3CWQA 4WY2A 2IXFA 2RDMA 1E3WB 3QYPA 2WKQA 3PRJA 1IHOA 1XD2A 1YRLA 3T9DA 3X1JA 4CPDA 5BUSA 3GUZA 5CTJA 3P9PA 1RLOA 2B83A 2IEYA 2UYGA 4UFNA 3DDNA 1K1EA 4QJ5A 2EBWA 4KMMA 5E0KB 1AKMA 5P21A 1Q15A 5ALZA 5LOVB 4TYMA 1TMYA 3G2HA 3HFSA 2Y2UA 3GPCA 5C8YB 2Y92A 3B9QA 3CRZA 3HB9A 4DAEA 3ET4A 1N8KA 2RGEA 2OCYC 3EGCA 4F7DA 4IZIA 3VVBA 1DRKA 3SNHA 3DG9A 1BFKA 1T10A 5FQNA 5BSHA 2BUAA 3GI1A 1PFQA 2BFEB 2Z8YA 5ESRA 4CEJA 1GQQA 4LIPD 4YMGA 3FAZA 1T8SA 3MAGA 1VECA 1JKXA 3R3UA 5IBRA 3SIWA 4OBXA 3CY6A 3HDGA 4LJLA 5B1HA 4BASA 3GLIA 4DNXA 1FF9A 2NUBA 1VE5A 2ZJZA 4IZ6A 4KAFA 1JYEA 3HLKA 4NZPA 1KEVA 3A27A 3EPJA 3E2MA 2AW3A 4P81A 1BEEA 4UXJA 4IOKA 3ZI0A 4KR2A 1BEUB 3E5RA 3JSAA 1RJ9B 2Z8XA 1Y6FA 3I3SR 1AF4A 2WWVD 1SEPA 3AR5A 4RULA 5EIOA 3W5UA 4BUZA 4NBUA 2QP9X 3PQ4A 3UGJA 1JFSA 3E61A 1Q2XA 5EUMA 4WNIA 4CMJA 3OP1A 4C5AA 3BWCA 3LBAA 4K2HA 3FPJA 2NUPA 5JYCA 4BBJA 3I01M 2Z3WA 3TWOA 5AI5A 3SC2A 1TM7E 3FPFA 2WU1A 2XUFA 3IVRA 4K6FA 3EZLA 1WPRA 2E49A 8OHMA 2PQ6A 2X42A 4WCFB 3K0BA 4BNWA 3MVEA 2A1UB 1EP2B 4OXNA 3QEAZ 4BVAA 4NMMA 1G55A 3L7NA 4MWGA 2I1QA 3FYTA 4RPIA 2FPPA 3BIXA 1Y81A 3D3JA 2QKYA 3U7IA 4AZTA 3O8RA 4IRUB 1Y1TA 3HYSA 1RZUA 5CB4F 5KTNA 1QYVA 4KUHA 3OIUA 2WD8A 1OAAA 4RK1A 1CZRA 1UZNA 2AB0A 4IPTA 5I47A 5B7NA 2P62A 1C7FA 3FKJA 5AVQA 4Q1FA 4C7OB 2Y27A 2O3SA 1Y9EA 4KQ2A 2O7SA 1IJBA 1G17A 1AZLA 1P2SA 1PGQA 3ANYB 5JIBA 2D06A 3HBAA 4PGMA 3AUFA 2BPOA 3I61A 1TJ5A 1DBRA 1Z34A 2AMJA 2FQXA 3L46A 1U1EA 2QT1A 2SKDA 4NE9A 3SQWA 1XR3A 3GRFA 4C0LA 4M7WA 4BEVA 1P81A 1U90A 2IODA 5DHFA 4EENA 4DUZB 1NMXA 2H1OA 3F74A 4FEGA 4Q4LA 1CVRA 5E6UB 1ZVKA 3CA8A 3IDSA 1M83A 5K51A 2JLRA 3B5JA 1AQJA 4I1RA 3W3AH 2JGMA 2AN5A 5F9FA 5KCMA 3ILXA 3TNLA 3V8VA 4R05A 4I1UA 1LNSA 2CUZA 3H1FA 1DKOA 1XHLA 3BHMA 2FR8A 4HEA1 3UKOA 1NT2A 4OX9Y 4ILKA 4WLNA 4BBZA 1BMFA 4D8WA 5HHTA 1A5SB 1E3JA 1R27A 1WTAA 1YJCA 2HDOA 5D5QA 3WBKA 1NP3A 5AKXA 5KS2A 1Q7RA 5HP4A 2VAXA 1U02A 2QMHA 4FE3A 1M33A 3M5CA 4CTJA 2QJFA 2C96A 3EFHA 4RACA 4UQPA 3L0CA 2F59A 2OEPA 3L0IB 4FYWA 4WCVA 3H9QA 3R9KA 2A14A 1N5DA 5J4LA 1IIBA 1GGHA 4JOSA 1CQJA 1K9SA 1PGPA 1RE0A 2EIHA 2P8JA 3JATB 3N3BC 1BDJA 4U2BA 1C41A 2X4GA 4CL2A 3TOXA 3GRVA 3N8GA 2IY9A 3O5AA 3QKRB 3CVYA 3GRUA 1KO5A 2FR8C 2IE8A 3EZNA 4HWTA 4FGWA 2C1ZA 4WXEA 3VTZA 3ZY2A 4C0JA 3EUFA 4DLWA 1SULA 2D8MA 2DAPA 3CV3A 3IJEB 2OFPA 3LZDA 4N7JA 1JG2A 2D62A 2EFCB 1XYYA 5E0OA 1GWNA 3IHKA 4IXTA 5LZ5A 5LQUA 1G6Q1 4DG5A 2JHCA 3DE3X 3K05A 3PXDA 4JI8B 3LC2O 2BMFA 1WQ1R