1F2UB

Crystal structure of rad50 abc-atpase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
145
Chain Sequence
b'ALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAD50 ABC-ATPASE
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
total genus 35
structure length 145
sequence length 145
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2uB00
3LD9A 4QJ3A 1TF7A 1FNNA 3TVTA 1KJYA 2VP6A 5ANRB 4DLRA 4EUNA 2ONKA 2GVDC 4IOMA 5TB5A 3RWMB 4DCNA 2GJ8A 2NO9A 3NBXX 2PLFA 4QBIA 2F7SA 3FYHA 2ZU0C 4GOJA 1CJTC 1D2MA 2V3CC 2V9PA 2GJ9A 1L2TA 5FI0B 1EK0A 3M6AA 4A6XA 1A5TA 5EE0A 3IQWA 4HB4A 4JLKA 2IXEA 4LX0A 1II0A 4LJ7A 4K81B 1GRNA 1W36B 4NCHA 2X1VA 2ZXUA 3F5FA 3THXB 2WHXA 4FMBB 1VG9B 1L8QA 2NGRA 5AJWA 5HE9A 5KUTA 1KDRA 2ZI5A 3L0IB 4PC3A 3KQKA 3GMTA 5J40A 5TXGA 3GLGE 2JA1A 5IHPA 1SVOA 4BLQA 4LV8B 3EWAA 3QBVA 1B0UA 2G0TA 4KJZA 4LY6A 3EPJA 4BFVA 2Q9CA 4LV5B 3K9HA 5JFGA 2JLQA 2FH5B 2KI5A 4Y0AA 1XP8A 4GBMA 3R8FA 3OAAA 2BEKA 4RZXA 2PCLA 3K8YA 3SYKA 1ZNZA 2C8VA 3I92A 3Q9LA 1R5OA 1XX6A 2YOGA 3AQ4A 1FX0A 4JJZA 5G41A 2ZI3A 4A8JC 3TAUA 2XSZD 3GLHE 4QBHA 5BQ5A 4JBWA 3W3ZB 4XWKA 4NMMA 4M1TA 3AM1A 1JQJC 1COWA 5B57C 1F2UA 1VCIA 2VP0A 5J4HA 5E3HA 1NKTA 5HKKA 2J5XA 2DFTA 4AWXA 2WSMA 4QGGA 1P2SA 2NTYC 3B9QA 3DL0A 4JSYA 1XEXB 4Q4HA 3NTUA 3IQXA 4OQFA 2VL7A 4HZIA 4QBGB 1I4LD 4M8NE 2AHOA 1PLJA 4RD0A 5EP4A 4NYIQ 4Q66C 5DO9A 2HEIA 2VH5R 3VKWA 3DOEA 2ORVA 2VHTA 1ZIPA 2AK2A 3QPWA 4HAXA 1M2OB 4US0R 3WYFA 3I8XA 3B60A 3BORA 4EJSB 4LBZA 3KQHA 5DN6D 1CXZA 2RGXA 4DDUA 3L82B 1P62B 1Z0FA 3EPLA 4EQ6B 2FPMA 5FBLB 1U9IA 4KHZA 2ZITA 2WPDD 3C5CA 2ONJA 2QENA 1ZP6A 4A15A 2PCJA 2ERYA 4LWZA 1NRJB 1FUKA 1D9ZA 1NN1A 3CUEF 1OXXK 1XZQA 4AYWA 3AVUA 3CRQA 1EFRD 3REGA 1E3MA 3LFUA 2VSFA 2DPXA 2J7PA 3O8RA 5A5GA 4IVPA 3U4QB 2W2TA 1P75A 1KK3A 2VHUA 2ZSEA 5FPYA 3UANA 4WW0A 2IT1A 5C18A 3TKLA 1E96A 3S1AA 3U3JA 3VKHA 2F55A 4RVCA 2PH1A 2ASEA 2RMKA 3Q7PA 4OI1A 2JDID 4WZBE 5FOWA 1DEKA 1XBTA 3OIYA 4LCBA 3K09C 3PUVA 1SVSA 5EXTA 3L43A 1NIJA 3VR5A 4A92A 1R10A 2DWQA 1FFHA 1Z08A 3T12A 3I73A 5KYKA 2GF0A 3VX4A 3VX3A 1OPXA 1Z0DA 2XTZA 3GJ4A 3LLMA 5F98A 4WXRA 1ETUA 3PJRA 2HYIC 3CX6A 5F9FA 1AA9A 2YWEA 3LBIA 4JYBA 2EFEB 3ND9A 1HH4A 4AKHA 2NO1A 2P65A 4U7DA 1X8KA 2ZJ8A 2IC5A 3BH7A 4O2LA 4HLUA 4MRVA 2RB4A 4IFBA 1NY5A 1KYIA 2WJVA 2I3BA 4BFXA 1TADA 3KUCA 2J7KA 2ZJ2A 3EZ2A 4Z1MD 4I1SA 4JJKA 2DFLA 1YHNA 1TQDA 1MR3F 4NPHA 5CB8A 1VG1A 4PR0A 4B73A 4DEXA 1EFCA 2QZ4A 4ZI2A 3AVTA 3QF4A 2CXXA 2YINC 3GFPA 3TUJC 1G1MA 1I4TD 4LJ4A 3C15C 4P4UA 4HZUA 3QKTA 2QAGA 4F93B 5HR5A 4OI0A 4C4PA 2D7CA 3QVVA 4ZO4A 2ZS9A 4YDHB 1VPLA 4EFNA 4KSCA 1G3QA 1NL3A 2ZVPX 4H1VA 2CJWB 3TBKA 3RVBA 3BFKA 3QQ5A 4PAQA 2ODNA 2K5UA 1T8TA 4D4MA 1KK0A 1NVXQ 5KU1A 2XXAB 5BWMA 2RGNC 2JLWA 4NCKA 4M1WA 3TMKA 3TR5A 1ELOA 4M1YA 1XPOA 3KQUA 3B1XA 3IBYA 2XZLA 1DAIA 5CITA 3IIKA 3P20A 2E1RA 3PEUA 3B1YA 3SJAA 4V0KA 3QOFA 1UM8A 4Q21A 2QP9X 1E79A 3IKJA 4CZ2A 4Q9JA 3NH9A 2BMEA 4C0BA 1LF5A 4JLPA 4MYCA 4V0NA 5CYOA 3BIFA 5GVSA 2C03A 3W8NA 1GTVA 3SYLA 2EFCB 3ADKA 2OLKA 4G01B 2CL7X 3UG7A 3RABA 4MDFA 3ZQJA 5FL3A 3AKDA 2J0VA 4Q7MB 5FPSA 5FUVA 3OEED 1AN0A 3ZIAD 1N0WA 3D6TB 3KJHA 5G40A 4DLSA 1SXJD 1KI9A 2CHGA 2CLCX 4PHTA 4U02A 2IYYA 3SHWA 2Z0MA 4PHFA 1AS0A 1KMQA 1FQKA 1H65A 1SVMA 1AGRA 1EGAA 1R4AA 4GZMA 1ZRHA 1MO3A 3WNCA 4B3BA 4EPWA 3SC3A 4FMCB 1YZTA 2R65A 4ZCMA 1G21E 4KAXA 2R6CA 2XSZA 5AWFC 4HLQB 5F3WB 1QHXA 2BMJA 4B43A 3PEYA 1CJUC 1RKBA 3LBNA 2P0EA 3VKGA 3RRYA 3SR0A 4B71A 1XD9A 1G16A 4NP6A 3RRNA 2CBZA 3ZD6A 4OYHA 1NF3A 3H86A 3NC0C 3TAHA 1K5GA 1SVLA 3FDIA 1XCPA 4MUAA 4PHGA 3VNVA 2ECKA 1M8PA 3ZQ6A 3PUZA 1M6NA 2FZ4A 2VRWA 3LO5A 4QG7A 3B82A 5P21A 4XVRA 5L3SB 1MKYA 3QXJA 2KBFA 4R98A 3PFIA 1AK2A 1TF2A 2AD1A 2YWFA 3FKSA 3K0SA 4PO1A 1GDDA 3WP0A 3A1UA 2R9VA 1WBBA 3ICQB 3W9YA 4QGAA 1CLUA 2VP2A 3KXKA 1WA5A 5TDHA 2GDJA 3U7HB 3EZ6A 2CE7A 5LD2B 1VTKA 1IHUA 4V02A 2G9NA 1ANKA 2GJAA 2O8DA 5G3ZA 1N0UA 3R8CA 1D8TA 1R0WA 4AKEA 1XDBA 1R6BX 4TMZA 2VIIA 4KXFB 2RH5A 2QQ0A 3BB1A 3ASYA 2IS4A 2EFDB 4Q9HA 2O5VA 1XFAA 4KFUA 1NN3A 3W6OA 1G3MA 5GJWC 4V03A 2R8RA 1EX6A 1MABA 2IYRA 1AQUA 2OM2A 4TZ6A 3OIUA 4RD6A 4F4JA 1GFIA 4QRHA 5JZVA 1DELA 1E1RD 1JI0A 2ZI7A 3AP3A 2QMUA 2PBRA 2ANCA 1HEIA 4UNQA 1G7RA 2JDIA 2ZRLA 3R7WA 2AXPA 2RGBA 3LXXA 1S3SA 2GESA 1R2QA 1Z6GA 1U8AA 1NN0A 1G4AE 3PUXA 3AB3A 1JEDA 3AGQA 5FL7A 2GCOB 3KJIA 1QBKC 1KJWA 1W48A 1FL9A 4AK9A 4UJ3A 1CF4A 3LX5A 3LRPA 3IILA 4OJKA 5FPTA 5DI9A 4Q9LA 2GCNA 3VNUA 1ZNYA 2CCJA 1G8GA 1DE0A 1DG1G 3IDQA 3QI2A 4RFSA 5EQTA 5J5CA 3HYTA 1HTWA 1JXOA 1CRQA 4OL0A 3KXLA 4NYIR 5DISB 1G20E 2OG2A 3G82C 2FA9A 5FI1B 2B7CA 4OJQA 2A30A 2WSSD 1D6JA 4NHOA 2FEOA 2GILA 4JLOA 2VBCA 4V0ME 3A4NA 4M9SA 2EYUA 4GP7A 2KSQA 3FWYA 3C41J 4IDQA 4B34A 4US1R 2HXSA 4UNPA 5DE3A 1XMVA 3SEAA 1RPZA 4LJ6A 3HU2A 1E1QA 1R8QA 4HDCA 3WBJA 5JEDA 2X19A 3WMFA 3MMPA 4M4SA 1J99A 2GBLC 1E9CA 3WP1B 2WVJA 1NIPA 1VHLA 2F9LA 3LDAA 3TGPA 1KI2A 3O8DA 4W5WA 3B7GA 2FE4A 5JCPA 5JS7A 1ESMA 2REXB 3D31A 2FGJA 2QMOA 5L3QB 3OEHA 1XXHA 4MQBA 2ZR7A 4CEJA 2WJIA 3CZQA 4UJ5A 4URZR 2O8BB 5JJLA 3H0KA 3M0EA 4OI4A 2GCPA 1SZPA 2ZRFA 1E2EA 4NTZA 2O8EA 1A4RA 1BS1A 3PV0A 3CKLA 2O0KA 2DR3A 1HUQA 2W58A 3JZAA 2IYSA 4M9XA 3LY5A 1W0JD 2OCYC 3IO3A 1OH6A 2MMGA 3JZMA 2F3TA 1JR3A 3OZXA 4C7OB 4Q4JA 5FTNA 2WKRA 1JAIA 1Q57A 3DHWC 4DLZA 4G5SA 4HAUA 5EXPA 3WHKA 2JASA 1JEEA 1JPJA 2PL3A 5FR1A 2FPKA 5FBQB 2IHBA 1JR6A 5FBRB 3OEEA 2IYZA 1OXUA 5JJKA 1SXJA 4HB2A 4QM7A 1Z22A 2WWIA 4WOPA 1KSGA 4BZXA 5GJBA 2RKOA 1UKEA 3WRYC 3VR1A 4XJXA 4XIGS 1TU4A 4QJ5A 3KXIA 1GKIA 3AEZA 4LYAA 4DSOA 1T3SA 1JALA 2H17A 3ZZ0A 4FIDA 2ZJ5A 1MV5A 4P32A 1YR6A 1KI6B 3BB3A 4LJ8A 4FCWA 3AF0A 1GNQA 2F1JA 2C9YA 4FMDF 1II9A 3GQBA 3K70C 1NLYA 1TQ4A 2HCJB 4X8OA 1KO1A 1IOZA 1HT2E 2QGNA 2ZSAA 3FMOB 2XJ4A 2CEAA 2QQEA 4B3FX 4BEJA 2P6UA 2W0SA 1CJKC 2R62A 1H8EA 3B85A 1ZUIA 2EYQA 2PEYA 3PENA 4EFLA 2IYXA 1G18A 2WWFA 5IK2D 4EJSC 1N6LA 5FPKA 3EA0A 4G5GA 3GJ0A 3DM5A 4OQNA 4LC0A 4RD1A 5DH9A 4E09A 2YHSA 1CR4A 3P27A 3OAAD 2VF8A 5DSZA 3ZS8A 5HCNA 2O0HA 2W00A 3MRSA 3EC2A 5D3QA 1L4UA 4AG5A 2GZAA 3AH8A 3A8TA 1A2KC 1P6XA 3BGWA 4KBGA 1JR3E 1GVNB 1NY6A 1KNQA 2C78A 3QKSA 4GFDA 4XSGA 2OEPA 4RJLA 4DHEA 2P6NA 5D3MB 1J7KA 1QRAA 4ZKDA 2YVUA 3ZS9A 1COWD 3AGPA 1OSNA 5GJCA 4F38A 3I32A 4B3DA 1CRPA 1GUAA 2XB2A 5HKKD 3UPUA 1E98A 1UDWA 2JLYA 1XD2B 2GZDA 4NCIA 3GJ8A 4G5RA 3T5GA 4CEIB 2ZYVX 2QRZA 1SVWA 3OF5A 5BW8A 3MCAA 4KITB 3KKOA 5B2ZA 5B64A 4KODA 721PA 1S3GA 4AG6A 3P4XA 1EX7A 1P3JA 2W6IA 2ZUBA 4PO8A 1Z83A 4Q1CA 5EP3A 5TARA 4C0SA 2JLSA 1Q1QA 4NDZA 1WMSA 4URWR 2XZPA 1E1RA 1FNMA 5CLLA 2YWGA 5J4LA 1XEFA 2DHRA 4JLVA 1EWRA 4KU4A 4MGKR 3EPHA 3FFBA 4R71A 4QM6A 1AJEA 1QHNA 4M2LA 5E7IA 1MRSA 4J0QA 4PSVA 2W2VA 2ZRNA 3TW4A 1D2EA 1IXZA 2AWOA 2WV9A 3DDCA 1UKYA 2PZFA 4FCTA 4GRAA 1LY1A 4LBWA 1KIMA 3DMNA 4HAWA 3CWZA 4TL7A 5CYPA 3RS5A 3KTAB 2OE2A 2ZSDA 4P33A 3VFDA 1OKKD 4CYMA 1NNEA 2BHRA 1RRPA 3FFAA 5DHAA 4HAZA 2FV8A 1NVVQ 1E9AA 2J7PD 3DMDA 4Z8XA 4A1FA 3I72A 2QG6A 1EESA 3NG1A 1KK2A 3AUXA 4AIIA 4V0OA 3U61B 4D0NA 3BD9A 1CR0A 4Q1DA 4KLZA 2NQ2C 4IXMA 3Q72A 1IBRA 3EC1A 1YVDA 4NE2A 1FTSA 4Q1FA 5EE3A 4TZ0A 5FFMA 4Q4AA 4HYYA 3BERA 3OFNA 2C96A 4DVGA 2HCBA 1Y3AA 4JKYA 4KYIB 4B32A 3QXXA 3M1IA 1XPRA 4Q02A 5H1YA 4EIWA 4B2PA 2C5LA 3KFXA 3E70C 1Z2AA 4W5HA 4XWAA 4PXAA 1ZW6A 1KI7A 4DB2A 2XEXA 5DGXA 1G9XA 4V0LA 1OLOA 2DB3A 4P4TA 4XTCS 2GK6A 3AVQA 4BRUA 1U0LA 3GLGA 3GLIE 3TJZA 4Q7LA 1S9DA 4LHYA 5DI3B 3SE0A 3V00A 3EA5A 5E7JA 1W0KD 2XX3A 3MAAC 1KKLA 2IYQA 1XJQA 2ZRBA 3QG1A 5BN5A 1W47A 2EW1A 2CDNA 4QKQA 1Q1BA 3CRVA 3IPYA 4QBFA 4ILEA 1IM2A 4II7A 4TQ9A 4X8HA 5HTKA 1QHHA 2R6GA 4NZYA 3SJCA 3E2IA 5AK0A 1FOEB 4YQFA 1OXSC 1VCOA 3GLHA 1JPNA 1T3HA 2WMOB 1S1MA 1GL7A 1N6KA 2HF8A 2VF7A 2AR7A 2ANBA 4TYPA 2W0MA 1E6CA 4TL9A 5EXXA 1FTNA 1YRAA 1NSFA 3CONA 3THWB 2QPOA 3CPJB 3CX8A 3GP8A 2JLXA 2LKDA 4PPQA 2KWIA 1NSTA 1BO6A 4QXAA 1TUEA 1XTIA 3QXHA 4AYTA 4A0FA 2RHDA 2J59A 1HT1E 2A5GA 2RAPA 2QP4A 2H7VA 1G5RA 1T6NA 2NO7A 3E1SA 1DO2A 4O3MA 3AVPA 1WB9A 4TYQA 3PVSA 1E2JA 4MDEA 1S8FA 1E79D 2P5SA 4DLXA 2FNAA 2NOAA 2WM9B 3PUYA 3AKEA 3CR7A 4LJYA 2V7QA 1L4YA 1PLLA 4IXNA 2D7DA 4IVRA 2VEDA 3ADCA 4IW3B 2P67A 1WBDA 2G3YA 2CCKA 2O8CB 2FFQA 1P2UA 1YJ5A 4L9SA 4BRWA 3H1TA 2HUPA 1W2HA 3FVQA 1FP7A 3ND8A 4OK6A 2JJ8A 3QPVA 2J0SA 3PIRA 4KBFA 4PC6A 3PITA 5AR1A 5IK2A 1DTSA 3SJZA 4IEIA 1S9HA 1IY2A 1TEXA 5GADl 3KQNA 4EPYA 5J4KA 1A2BA 5JWOA 3A6PC 1GRRA 2JEOA 3A58B 2BIFA 2QORA 5FTJA 5LD2C 4N3NA 3BRWD 2FJUA 4EQ6A 1PJRA 3ADBA 2J9RA 3THOA 1CS4C 1KMHA 2HT1A 1FQJA 1IXRC 2FX3A 4ZPXA 2WTUA 1IJFA 4L9WA 2RHMA 3PXGA 4DSUA 3SOPA 1VIAA 2ZRGA 3P1JA 4OHXA 4NKRA 2HJVA 2A5DA 3KQLA 4DLVA 1G64A 4JKIA 4JLNA 4TSFA 3WNDA 2VPPA 5BN3A 3W5JA 2FSHA 3Q3JB 4DIDA 1OXVA 2ZI9A 2WWXA 3K70B 3L2OB 3CW2A 4IKEA 1WCV1 1X86B 4MKGA 1N0VC 4FWIB 4OQXA 1DPFA 121PA 4C0JA 4DCUA 4MRNA 2X2FA 1OH7A 1E0KA 1QZXA 3T1OA 3FKSD 3RC3A 2OAP1 3O8BA 1KDTA 1BH2A 1DADA 3GCGA 1WDTA 4MRPA 5EXSA 2QY9A 4B75A 5IF9A 2GXSA 5F2EA 1HQYE 1SQ5A 4Q19A 1H8HD 1KOFA 4UXJA 2WJHA 1LF0A 4M1OA 1XJCA 3DZ8A 4F92B 5EJEA 821PA 3BB4A 2J41A 3EWSA 4NYJQ 1XTKA 4PX9A 1DO0A 3KJGA 5AUPB 1G7SA 2WIAA 1EFUA 1OKKA 3NXSA 5AUNB 1LTQA 1W4CA 2C98A 2JLRA 2YYZA 4X8MA 5EP2A 1E2HA 1TF5A 1WXQA 1S4QA 2R2AA 1G5TA 2GF9A 4JVNA 2BJVA 4DDTA 2ZRCA 4KO8A 4U5XA 4BLSA 1UDXA 4L4UA 1X8JA 5FOVA 2OZEA 4GMXA 4AKIA 3PUWA 3U3RA 2NPFA 2RGDA 3M4YA 3SZRA 2QE7A 3ZLJA 4DLWA 1FX0B 1P9WA 3LLUA 2ZJZA 3NVAA 1D9XA 2IBMA 2H16A 1ZM4A 2G1JA 3A1WA 5FL7D 1E9SA 2VSOA 4URYR 1F2UB 3GJXC 2W6JA 1YR9A 2XNDD 3CR8A 2FSGA 5IRCD 3LVQE 3I5XA 2F1RA 2RGGA 2XOKA 3EASA 4XTRA 4AKGA 5FUYA 3GJ3A 2WOJA 5KNBA 1G291 2XB4A 5JWRA 3X1DA 3U44A 4Q1AA 3MSXA 2I4IA 4B48A 1II8B 4Q4HB 1DARA 2ODWA 2ZRPA 3LBHA 4LBYA 1CJMA 521PA 2EQBA 1Z5ZA 1W0KA 2O8FA 4M1MA 4D25A 4LSGA 1M34E 1XTJA 2F6RA 3AF3A 3IEVA 1CP2A 2WBLC 4UXHA 1OJLA 2VP9A 4H9GA 1AKEA 4HAYA 1I2DA 1OF1A 3P4YA 3Q5EA 1OFTA 1Z0JA 1D5CA 3X1XA 3AVVA 4ZI3A 1VIYA 4GOKA 3ZD7A 4JT4A 1WE2A 2QBYA 2HDNB 2ZRAA 2ERXA 2QMHA 2ZM5A 2BJWA 1KTVA 1KAGA 2OCBA 3D7MA 3I3SR 2R6AA 4LHXA 2DCUA 1E1QD 1T5LA 3GEHA 1UKZA 3SQWA 4FWTA 3QXCA 1F2TB 1KO5A 4RKEA 2D3WA 3F3YA 1YRBA 4LZZA 1FP6A 1ZD8A 1Z28A 2X77A 4BFTA 1S0UA 5EUQB 5JRJA 3T1TA 3C8UA 1UEIA 3OEHD 4XD7A 5C4MA 2ZAOA 1RJ9B 4ASUA 2XZOA 5UKDA 4PPFA 5JSZA 3S1AB 1U0HC 4CF7A 2BM1A 3BK7A 2C2HA 3TR0A 4ZDIA 1T3LA 3MJRA 5JLJA 3FE2A 2CVHA 4YONB 2N46A 3I61A 4DJTA 2G83A 4AY2A 3CF0A 2NG1A 1SHZA 3Q7QA 1E9BA 2FZLA 4XH9B 2GETA 4Q9KA 2XAUA 1SKYB 2ZYWX 1JR3D 4P0TA 1U99A 1P9RA 2WAYA 3U3MA 3SJBA 3TSZA 2DY1A 5E4FA 2F43A 4BLRA 1Q12A 3SBEA 2FN4A 4HI0E 1KDOA 1F5NA 3TE6A 3WBKA 4CIDA 4DCSA 2OV2A 4DUGA 4MGZR 1K5DA 1V5WA 3CPHA 1EFTA 3W6PA 1E9EA 3RRZA 2BC9A 3ZZTA 2WAXA 4UXIA 2PJRA 3AP1A 4IHQA 3JVVA 1E94E 1X1SA 2HYDA 3QF4B 2ZR0A 3QKRB 3SDZA 3GLFB 4OK5A 1QHGA 4HZUB 2QAGB 3QNUA 1IN6A 1NMZA 1Z29A 4DZZA 2Q3FA 4CEHA 4BFYA 2OHFA 4G1UC 5EZ5A 2GK7A 2NO6A 3CWQA 4BGDA 3VR2A 1J8MF 4A8JA 3N70A 4G5QA 4CVNA 4KV9A 1E2FA 2GHIA 2Q21A 4LUCA 4WXPA 3T1QA 3ASZA 3VMFA 1RRCA 1ZC3A 3U2QA 2PX0A 3FKQA 2J46A 5FTLA 4BE7B 1GL9B 2A5YB 1OE0A 2DWOA 1D2NA 1JNYA 2Y8EA 2ZANA 1OV4A 1R0XA 1RE0A 3IGFA 1G8PA 3L8YA 1H8ED 2CL0X 3GJ6A 4CDGA 1GITA 4HUTA 1ZIOA 1NMXA 3G5UA 2XTNA 1KI4A 1KZGB 3CO5A 2Z4SA 1KSFX 3EIHA 5JECA 3I62A 2C04A 2BWJA 1G3RA 3VQTA 1I2MA 2ZROA 4HUQA 4D82A 5FOTA 1NG9A 4K8OA 1G6OA 2MSDB 3CH4B 1NJGA 1NMYA 4IVQA 2R44A 2MMCA 2D74A 4O25A 4JLJA 2Z43A 2GJKA 1TQ6A 2GTPA 4V0MA 5SZJA 5JI3E 3ADDA 1TX4B 1H8HA 2FFAA 3NKVA 4B2IA 4PPGA 1E9FA 1G8FA 5JCZA 1NLFA 3ZVNA 2BMDA 4TYWA 4LYHA 2RCNA 4LYFA 4QC2A 4D81A 2O0JA 1MO4A 3BAFA 5AUOB 3QG5A 4QNRA 2CNWA 4NU0A 3VAAA 3LAWA 2CE2X 5K8IA 4NL4H 2GAAA 1Z8FA 2H18A 2PMKA 3I1FA 5BXQC 4KCGA 3RDPA 3WMGA 4B74A 4E5UA 3UG6A 1NBMA 3R9XA 3PR1A 1E0SA 1YZKA 4QHYA 1G8YA 1Z0AA 2W6ID 1OHHD 4URUR 2V1XA 3QEJA 2QA5A 1ZM2A 4PTLA 5DNYB 1Z2CA 3NIBA 1S1CA 2IEYA 1VYTA 2RGCA 4AYXA 3LA6A 1N25A 1HE1C 621PA 3K09A 4M22A 4YMTA 3A36A 4YXWD 4DXAA 1A7JA 4UQOA 1K8RA 3HPRA 2GRJA 2XNDA 2OBLA 3RWOA 1O87A 2W2XA 5L3QA 1KZ7B 4LGMA 1DAFA 1XPUA 3EARA 4UNNA 5FOSA 3K1JA 3FMPB 1GNPA 1U0JA 4GOXA 4E07A 3EG5A 3AVXA 4DBLC 1KY2A 2LKCA 4OKSA 4TQUS 1MOZA 4JS0A 4B2LA 3FB4A 3WHLA 1AQYA 4RD3A 4DC9A 4HSEA 3VR6A 4MA4A 1UPTA 4EPXA 3ZVLA 4N1AA 3DVLA 1E9DA 1Z6YA 3K0CC 5DIFA 1KY3A 5DYIA 2A78A 1MT0A 4TTQA 2GWHA 4ARZA 2FMXA 3C16C 1CR2A 4ZIRB 2FEMA 2FSIA 3TK1A 3L0OA 5TVKA 4BASA 2BM0A 2MSEB 4UKDA 2IYWA 4GMDA 3OFND 3DOFA 3MWLA 1QG4A 1AIPA 1T91A 1Z6AA 1OT3A 2FFHA 3THYA 3FPAA 2O8DB 4ZDJA 2REBA 2C77A 1QG2A 5TY0A 4RY2A 3HDTA 1FW6A 3AF4A 1X1RA 2IS1A 5KSZA 5TMPA 3CNNA 1SHKA 2ZRJA 2ZPTX 4M9ZA 1HURA 1NBME 1RRGA 2ZJOA 3AF2A 3IHLA 1ZAKA 2RGNA 5FOXA 4MGYR 4C2TA 2NPIA 1RYFA 4MH0R 1JB1A 1NI3A 5KHOC 4DDWA 1XB2A 3R7WB 3UATA 2C9OA 2G1KA 4EPVA 1W36D 2AX4A 2UKDA 5EP1A 4D4KA 5FBVB 4KFTA 1HQCA 4K46A 4CW7A 1P2VA 3CRW1 1R7RA 2Q9AA 2QTFA 421PA 2E9SA 2HXYA 3L0PA 4B3GA 1ZVQA 4EPTA 3BBPA 4AI6A 2YC2C 4BFZA 3AVWA 3AV0B 3LH5A 3K0AB 1UF9A 1DBSA 4RFSB 2EWVA 5J47A 2BKUA 2OBNA 4A0RA 2ORIA 3RC8A 1UEJA 3V9PA 2WZQA 2WWHA 3HR7A 4LOAA 4TT3A 1KI8A 4TMXA 4KFSA 4LHVA 4BFSA 1E0AA 2Q3HA 1LVGA 5M04A 1J90A 1EFHA 1T9HA 3CIOA 4Q47A 1LV7A 4A2QA 5KNCA 2QEQA 2XTMA 3PEWA 1E4YA 1EXMA 4DEYA 3WMEA 3L0SA 4M1KA 2VQSA 5H70A 4DT1B 2HV8A 3ICEA 1W5SA 3WY9A 2CHQA 2HF9A 3TRFA 4MKIA 3RS4A 2ZJBA 5D3MA 2YV5A 2N42A 3EX7C 2NZ8A 4W9MC 1N6NA 4HAVA 2XGJA 4WZ6A 2Z83A 3H84A 1CIPA 1JAHA 2QROA 1MO6A 5E95A 2V7QD 4TLEA 3LWNA 4WZAE 4RKFA 5AJVB 3TQCA 2GEDA 3MD0A 3ONWA 3KB1A 3V4FA 1P72A 3T1VA 1FUUA 4YMUA 1F60A 1XXHB 3UWKA 4CEJB 3TQFA 1Y63A 1CEEA 5TV2A 3RS7A 3CB4A 2ZI4A 1OH8A 4OBEA 2BEJA 2A9KA 2O8EB 2B7BA 1R0YA 2ZEJA 4FXPA 2Q3MA 4EKDA 2AL7A 4HB3A 1P7CA 1NN5A 2J87A 2ZI6A 3UMFA 2GVZC 5EE5B 1OYYA 3A4MA 5SZKB 3QJYA 1OB2A 1YR8A 1F48A 5L8VA 3A4LA 3SNHA 1UFQA 2QTVB 3NWJA 2NMVA 4EPRA 3CNLA 3Q8XB 2DFKB 2ZRKA 3MLEA 3CRRA 2P5TB 4WAUA 3ZDQA 3K9GA 4TSFD 4KFRA 1E32A 1US8A 4Q03A 1SXJB 2DWPA 3HP1A 3L8ZA 4FINA 4JSTA 1XU4A 2JATA 2YWHA 3GLIA 1DOAA 1N5JA 2OXCA 1GG2A 4GP6A 5KSOA 4QHSA 1PV4A 4MUBA 3FGNA 1OHHA 2CMKA 2J0UA 2IUTA 3GFOA 5CIWA 3RANA 2A3RA 2L0XA 3X1WA 3I5YA 4BECA 3WXMA 2SHKA 2IS6A 1AS3A 2J3EA 4A2WA 1OH5A 3QPUA 2VO1A 3DKPA 3R20A 1VCMA 4P3YA 3ZVMA 5G53C 2IUUA 5B58C 4BPBA 3QXSA 4L5BA 2FFBA 4D80A 2H8KA 4Q1BA 5GJVC 5HZHA 1X6VA 2ATXA 2VSXA 2WKPA 2ZVQX 4TMVA 4BLPA 1N6RA 4YXWA 1CKEA 1IJEA 1A1VA 5CM8B 4A9AA 3QE0A 2WWGA 4PO9A 1RFLA 4TMKA 4QL3A 1P60A 5DI3A 4A0GA 3TSWA 1GRQA 1XTSA 1CULC 1UAAA 2FSFA 1VKJA 4CRWB 4BZPA 2UZ3A 1TTTA 5F9HA 3U6BA 4FMCF 3ZVRA 1QHYA 2RGAA 2ZRIA 1PUJA 1T4GA 2VHJA 2OAQ1 2FGKA 2H92A 4WA7A 1U9IC 2BBTA 1A82A 4PAOA 2IS2A 4MGIR 2AK3A 2QE7D 1KKMA 1AS2A 2C99A 4DB4A 4GDFA 1R5BA 2ZS7A 3CZPA 3GEEA 3VR3A 5K8UA 1RVDA 2GXUA 3QKSB 4NYMQ 4W7SA 4QHTA 4TN1A 3AKCA 3VU9B 3F8TA 2IXGA 3N2IA 2W6JD 4PAMA 1M7BA 4I1VA 2CL6X 2XOKD 1GSIA 4LHZA 2JLUA 3IEUA 1DAGA 1G8HA 1W44A 2PT7A 2JCSA 4YC7A 2G77B 4WVFA 2GBLA 2OFXA 1Z6TA 3SI7A 4GI7A 3C4JA 2CK3A 4GPTA 2XITA 1IONA 1Q1ZA 4R7ZA 5J4YA 2GAOA 3U5ZB 2JLVA 3EZ7A 4B6EA 1YZQA 1N5IA 1VECA 1GILA 5JS8A 1GM5A 1QHIA 4CGZA 2D2EA 2Z4RA 2ZETA 1ESNA 3CLVA 3QSYA 3LQQA 4Q7JB 1W5TA 5SZIA 3THXA 1AGPA 1G7CA 4HLUC 2NO0A 4PZYA 4YMWA 3B2EA 1OXTA 2EFGA 4KI0A 3DPUA 4A82A 3C5HA 4LC1A 4LHWA 2X2EA 1MH1A 2A5JA 4Q01A 1OFUX 1XCGB 1LW7A 1XZPA 3HU3A 5C2JB 5JHGB 1N5KA 2WWWA 2YC4C 4TYYA 4IOKA 1GKYA 4XD7D 5CLQA 1VG8A 4I1UA 4ASUD 4BFWA 1CR1A 4TQAA 3KL4A 2QAGC 2B8WA 4DRZA 3BJIC 4OQLA 3LXRA 3NBZC 4JT2A 5E7MA 221PA 4PC2A 1Z47A 2J1LA 2PMDA 1YR7A 3T06B 4D4LA 4Q4AB 1X8LA 3LNCA 4B35A 4Q9IA 2QU8A 1FMJA 1YE8A 1ZM9A 2IWRA 2KB0A 3VTKA 2C95A 3HR8A 5CJPA 3VHLB 3QF7A 3T35A 5KTYA 3F0TA 2FG5A 1M7HA 2OFOA 1BMFD 4WBSA 3BOSA 3C14C 3GFTA 1GOTA 5KO2A 1XEXA 3GLGB 4DUGD 1CJVC 2B8TA 4NCJA 4Q1EA 2IX3A 2IA5A 2PLRA 5C46F 1B23P 1E2NA 2FF7A 1BKDR 1YQTA 4ZCIA 2V6JA 2BOVA 2BVNA 3SYNA 3TLXA 3SS8A 4EJSA 4OQMA 1XRJA 3IBGA 3B1ZA 4RCZA 4I81A 1PVOA 3LW7A 3AKYA 1QHHB 2IUSA 3KKPA 2IYVA 5KDDA 4RCYA 5FOUA 4URVR 4QGHA 2IF0A 2QP3A 5LPNA 3KX2A 2ATVA 3GLHB 1GKUB 1GWNA 3K0FB 2YZ2A 4G0NA 4JVSB 4BFUA 1IN8A 4TTPA 5CDFA 5IDVA 2D2FA 4IDOA 4XSHA 4HDQB 2QSYA 3PQCA 2V8OA 4LRWA 3FHCB 4M53A 3U4QA 4PFSA 5JWHA 1Z07A 1UBFA 2AXNA 3P32A 3U6KA 2V55B 3JVUA 1ZC4A 2G0NA 2AFHE 1OYWA 3OE7A 4JL8A 3C7KA 4RZ2A 4F91B 2QM7A 2Z5FA 2F9MA 2V4ZA 2ZQ5A 3HU1A 4JLAA 2BKEA 1N6PA 1ZUNB 3RHFA 1E2IA 1SULA 3KFVA 2ZE6A 5DHFA 5H8WA 2ZSFA 3FHTA 3A37A 2IW3A 2D4HA 3B9PA 2ODBA 3WYAA 4PANA 2DFNA 3BH0A 3DKVA 5FTMA 1W4AA 5KOYA 3AP2A 2PEZA 4FN5A 3FHOA 8OHMA 3W6NA 4JVLA 4BQSA 4YMVA 5JJIA 1GP2A 2ZJYA 2FOLA 1II8A 1N5LA 1QHSA 4MYTA 2F1HA 1HA3A 2IYTA 1M1YE 4ZCLA 3TH5A 2CNWD 1P61B 5EUMA 2OBMA 4KVAA 3K9LA 3AUYA 4Q5IA 4TL6A 2H1LA 1U90A 4JYCA 3QKUA 1NBMD 2WICA 3QEOA 4XVQA 1ZD1A 4TLAA 4O0MA 5A4JA 2VA8A 4HLDA 1ZYUA 2EFHB 1KAOA 4L15A 4EFMA 1DAEA 3FTQA 4MKHA 5FUXA 2QPAA 1C1YA 1U98A 4KVGA 4TLBA 1KMHB 3R9IA 2A7QA 2QMEA 2B92A 2ZUDA 4JL6A 2QPTA 3A1TA 1G17A 4KSBA 1Q3HA 2CJWA 5CB6A 1F2TA 3T5DA 1G4UR 2ZREA 5HZKA 5CDFE 1YZGA 3TNFA 3UMSA 1JECA 2XXAA 1DAMA 5CM9C 1RJ9A 3D8BA 5HCIA 3BFVA 4IRUB 4ITRC 3OIVA 2JAQA 2PX3A 3CF2A 3SHFA 1UADA 3CM0A 5FUWA 2W83A 3ZYCA 2AD5A 3RNLA 1U2RA 1Q22A 3UIEA 4ABYA 1G5PA 2IK8A 4M1SA 1SGWA 2TMKA 4Z51A 1NP6A 3NBYC 4S35A 4A6PA 1VG0B 3OHMA 2CHVA 1P5ZB 3CBQA 5BN4A 3W5IA 4B76A 1ZCAA 1AZSC 1IN5A 1IN4A 1EG7A 2I1QA 2HT6A 2IYLD 3HPQA 3KKQA 4P4SB 4X8LA 1J2JA 1W2GA 4JMPA 1ZCBA 4N0DA 2ZE8A 3MFYA 4DIEA 5KDOA 3IPXA 1E0JA 2ZTSA 4RD4A 4FMDB 1NVVR 2JGNA 2OILA 1GAJA 1ZM3A 2OCPA 4URXR 3U60B 2VLIA 3RS3A 4PSAA 2AFIE 2CCGA 4EAQA 3QKRA 2AWNA 3A1SA 2G88A 4MYUA 3CH5A 3GLFA 1GNRA 4DDVA 1Z63A 2JIZA 4ZV4A 4XWOA 2XJ9A 3I8SA 1G19A 4GL2A 4KYUA 1P9NA 1JBKA 4ZDWA 4JBYA 1SVKA 4NYMR 2BCJQ 1XJ0A 4DSTA 2ZUCA 1BYIA 4GT1A 3B78A 1P2TA 1XF9A 1PLKA 4IOLA 3GJ7A 1ZU5A 4HLCA 3WNBA 1GIAA 1O3YA 2OO7A 2FDCA 3EIQA 4D0LB 3IIMA 2HLDA 4PC7A 3O47A 2QNRA 1DAKA 2YNMA 1OW3B 1BMFA 2KBEA 2Q0HA 2B6HA 4P4SA 4N0EA 4Q48A 1Z3IX 2IF2A 4I1OA 1E9RA 1KI1A 3TUZC 3U44B 4JLMA 3GJ5A 1NG1A 3VHXA 3QENA 3REFA 1TL7C 4TT3D 1M7GA 5FTKA 2GXAA 3V4RA 1E2DA 5L3SA 2O8FB 5AJZA 2AKAB 3IHWA 2WOOA 1G3UA 1LB1B 4RFVA 4M9QA 4YMSA 4HATA 4ERNA 1C9KA 4LPSA 4L16A 4Q00A 4TTRA 4AURA 1F3OA 1SKYE 3DM9B 3ZH9B 2QBYB 4LJ9A 1VCNA 2YJTD 4RD2A 3ECCA 4DWJA 2P2LA 1FPMA 3EW9A 4O2RA 3X1ZA 4TWZA 2PZEA 1VMAA 4FCVA 2H57A 1KSHA 4RSGA 3T34A 4C3ZA 1ZUHA 2BCGY 1SXJC 3RSLA 4OK3A 1C4OA 2GKSA 1T8UA 1NVUQ 4H1UA 3CX7A 1XMJA 1TNDA 5JSZB 1HYQA 4L8GA 5EE1A 2ZAMA 1XEWY 1JXMA 2WJGA 2R6FA 1I4DD 4C0QC 3O8CA 4Q7KA 3T61A 1F6BA 3GLFE 3DZDA 1QF9A 1LS6A 3SFZA 4C2UA 1E4VA 1E2GA 1ZBDA 2QSZA 4CT4B 4DKXA 2ZE5A 1HV8A 3BC1A 4C30A 1L7VC 4HEJA 4TL8A 4A36A 4UNRA 2GCOA 1YZUA 4QFMA 2UZIR 2QGZA 1W46A 4D0GA 4A4DA 4IJMA 2BV3A 1Q21A 4YDSA 3EPKA 2QRNA 2F43B 3BXZA 3PG5A 4DCVA 2IYUA 1ZNWA 2JJ1D 1TAGA 1CU1A 4FW9A 3KKMA 3SBDA 3H2YA 1WQ1R 3MWKA 2D62A 2UVQA 2MSCB 5BYJA 2FWRA 1OFIA 1OIVA 4ZIRA 3X2SA 1Z06A 5A0FA 2ORWA 2AN9A 5DN6A 1R0ZA 3B1WA 3W8RA 3EIEA 4C0HA 1VDZA 1ZNXA 2EWWA 4IOJA 5KPJA 4W5JA 4LYJA 3NEJA 4JLBA 4MRSA 1TMKA 4CEHB 2WPDA 3QUSA 1G7TA 3CRMA 4LK2A 3ZZUA 1M74A 2YOHA 1KSJA 2FPLA 5FBWB 3B8HA 1KGDA 4R9UC 4A8JB 4ACBA 3FOZA 3SQXA 2X8AA 1MO5A 1EFRA 5IT5A 4OHYA 1KNXA 1LS1A 1XMIA 1Q44A 2BBWA 4Y0VA 3NBFA 5JHHB 5JEEA 3NDPA 5DLQC 3D3QA 3BS4A 4JL5A 4BEBA 5CIQA 5H68A 1W7AA 2GNOA 1W49A 2Q9BA 5CJ2A 2O8BA 3ZGXA 3QBTA 1DAHA 1ZMXA 5GVRA 1E2QA 4DLYA 4NH0A 3RYTC 3GPLA 2JLZA 5LBIA 3IUYA 4HUQB 4IEEA 3TSOA 3LX8A 4DLUA 4LJ5A 1S96A 2ZJAA 4M0LA 3X1YA 1N6IA 1W1WA 3Q85A 5C1BA 2J0QA 1XNJA 1UKVY 1W4RA 2YOFA 4JIMA 4DSNA 4C7OA 5K8TA 5SZHB 3PEVA 5B30A 3E5HA 2ZRMA 3GEIA 3K0AA 1IY1A 2QUZA 1BOFA 2GEUA 4NYJR 1IN7A 2PZGA 3TVDA 1RIFA 2VHCA 1XEWX 1BIFA 1KJZA 4Z54A 4Z1MA 3NEYA 4MKFA 4IFEA 1S2MA 2CK3D 2WJYA 3MG9A 3W90A 5KSPA 2A5FA 3I4LA 4OHWA 1K6MA 1QDEA 1MABB 4DT1A 4XOIA 4JBXA 3QVUA 1G41A 1Z6XA 1DS6A 2ZR9A 3CNOA 1W4BA 3SFVA 4DCTA 1RC8A 1T0HB 5G3YA 2XNSA 3K0EA 2GA8A 4R2HA 1NKSA 4AC9A 2D06A 1DVRA 1KI6A 1HY3A 3MWYW 3NHBA 4NBSA 5BYKA 1RW4A 4B3CA 2A2ZA 4I99A 4IDHA 2REOA 1WP9A 2PJZA 1PZNA 1IQPA 4QNMA 5CK4A 2GZHA 2JJ2D 5K8LA 2GJSA 2PT5A 1XTRA 2QT1A 4U00A 2DBYA 3KZ1E 3NC1C 2KE5A 1Q3TA 1EWQA 2ZS8A 4TYNA 3IIJA 1Q20A 4MITA 5JBQA 1W36C 2I1VB 3RS0A 3KUDA 2IWHA 3NHAA 1G6HA 4QOSA 4B6FA 2VYFA 1OIXA 1RZ3A 2EU8A 1UBEA 4TMWA 1QVAA 4ARZB 2V6IA 4MRRA 4YLGA 2OFWA 4JLDA 4IDPA 1KI3A 2OESA 1E2KA 4PZZA 4C0KA 2BDTA 1XCMA 1GZSA 4GZLA 1TPZA 2WJJA 1CTQA 2NIPA 3SN6A 2R6DA 4POAA 3THYB 3A1VA 1CBUA 2OXRA 5AJXA 5AUQA 1PUIA 4OHVA 1IY0A 1ODFA 1XD2A 2IHYA 3ZIAA 1ZD9A 4CEIA 3KKNA 4PC1A 4HDOB 4TLCA 1E69A 3R9WA 2QTHA 1J8YF 3AF1A 4Q18A 3K70D 1ZU4A 3J81k 4HB0A 1NLZA 3AVYA 1T0JB 4BLOA 3DO6A 4QJ4A 4B44A 1Q0UA 1N6HA 1UBGA 1VYUA 4RZUA 4BZQA 4EDHA 4P31A 1E99A 1RRFA 2GXQA 3B5JA 2WMNB 3KJEA 3RAPR 5AJYA 2OCAA 3U3OA 1T5IA 1GL6A 4E22A 5DYGA 1UBCA 1XMSA 4D6PA 1G3IA 3UXMA 2QM8A 4R2IA 2B21A 2QN6A 4NONA 2WKQA 1SVIA 2ZYUX 2P3SA 4Q4JB 4F4CA 4JVMA 4ESVA 3B1VA 3KTAA 4C0LA 1AM4D 4PHHA 4FI3C 4PQFA 1TU3A 3N5CA 3PCRB 1XXHE 4OI2A 3SU8A 2JJ1A 4S2EA 2DYKA 1P4SA 2HJGA 4DLTA 4LV6A 3IO5A 4ON9A 2QL6A 2O52A 1X3SA 2FU5C 1KHTA 1YU9A 2LCFA 3FMIA 5EZ6B 4A2PA 3Q5DA 4B33A 4A0HA 2YKGA 3RRMA 3OE7D 3H4MA 2QI9C 5J4VA 1KDPA 4GNKA 2OSBA 2QAJA 4G3XA 4M21A 2KJQA 3RS2A 3QIAA 1U94A 2ZU6A 2NZJA 4TLDA 4Z8YA 2GEVA 2G6BA 3K53A 2LWIA 4Q4LA 5HE8A 3VU9A 1V43A 3BH6A 1AZTA 1KO8A 2ZRHA 1KO7A 1NVWQ 5HPYB 3EZ9A 3GD7A 1ZM7A 2V1UA 2WIBA 5JRZA 3NDBB 1SXJE 2QT0A 3U7FB 1TQ2A 3OESA 4PQYA 4B47A 4D4JA 1FMLA 1WRBA 4G5OA 3BWDD 3EAQA 2C9CA 1OB5A 4IDNA 1J70A 1MRNA 1JQLB 1OFHA 4PQRA 1Z0KA 5FPHA 3B6EA 5FR2A 1TUIA 3UKDA 1VHTA 1N2CE 4BUJA 2BBSA 4GSYA 1YZNA 1JJVA 3W34A 3N2EA 3OIWA 5KPDA 2AKYA 4ACAA 2Z6VA 4QGFA 1R5NA 1UJ2A 4D2IA 2OLJA 1U8ZA 1KO4A 1Q1EA 2N1BA 2ZRDA 3BFXA 3K0CA 4RZ3A 4LJAA 4PSKA 5JMTA 5CK5A 1E2MA 3EXAA 4I4LA 1HE8B 2IEZA 1FZQA 1ZINA 5JI2E 1WF3A 3MJHA 1IXSB 1U8YA 4TMTA 1XD8A 1JJ7A 2Q6TA 3HJNA 5EE9A 1YKSA 3QY0A 4LBVA 3P26A 4KLNA 3UK6A 4ZKEA 5L3VA 3THWA 3LV8A 1LNZA 1US8B 1E2LA 2VHQA 4AD8A 3MGCA 3W3AA 5LB2A 3U7EB 1VYVA 3GLIB 4PPNA 2CLDX 2WSSA 2EVWX 3DEFA 4MYHA 4PZLA 3T15A 2VTKA 1XTQA 1LFDB 3EZFA 1IAQA 2ZSBA 2J0UB 4BWYA 1ZJ6A 4JZKA 2BBOA 2ODEA 3MUFA 2F3RA 3LQRA 2OT3B 4F4IA 1Z0IA 2BMFA 3LVRE 1AKYA 5C4GB 1YZLA 3U3KA 3ZJYA 2OUKA 3MWJA 3UWOA 2J45A 2IXFA 1DG3A 3FMFA 3U7GA 2RGEA 1KK1A 3K9NA 2O8CA 3ETLA 2WWYA 1TEVA 3NH6A 2ZYTX 3WYGA 3KDSE 2E87A 2JJ2A 4CT5A 1QVRA 4LI0A 3TIFA 4B3XA 4XVUA 2H5EA 1N3BA 2ZE7A 5KSYA 4C0AC 3CF6R 4LDJA 1SKQA 4UNSA 5FH9A 4ZDKA 1RYHA 2V54A 4LPKA 1P73A 3KB2A 4E03A 2CVFA 2VP4A 2ZIAA 1BYUA 2F1IA 3HWSA 4ESHA 6Q21A 1U81A 3RSOA 2JIZD 5KDLA 3RLFA 3VR4A 5LDDC 3TW8B 3BE4A 3WRXC 1W0JA 3CPEA 3TUIC 2IL1A 1R8SA 4BLTA 5KNDA 4NCNA 1N6OA 1OIWA 4WIAA 3HYRA 5LB4A 4F7WA 3UMRA 3K0FA 5L3RA 4C9BA 4US2R 1XWIA 2P6RA 3AVOA 2CLSA 5ELXA 4D26A 3G0HA 3LW8A 1E2PA 1ONBA 1NJFA 4FD2A 4OHZA 3B13B 2VP5A 2HLDD
chains in the Genus database with same CATH superfamily
3I1YA 2Y1KA 4QJ3A 4GMKA 4M6WA 2VP6A 1XZHA 2JK0A 3UA4A 1K89A 2ZT6A 4QWMA 3WIVA 5ABPA 2GJ8A 1C4WA 1T6XA 4Y2RA 3AR6A 3NBXX 5CW1A 5HQJA 5E7QA 1XVUA 5J23A 4GOJA 4B3RB 2C2ZA 1UPCA 2XCUA 4R1QA 1ZUNA 3NFRA 5EVCA 1YF3A 3P5SA 2PAAA 2X1LA 2IP1A 3PQ4A 2J3LA 2A0KA 3C4QA 2P3OA 3M6AA 2YRXA 1C0IA 5EE0A 4F8YA 2ZUFA 2NNLD 2ZVJA 4L78A 2A8YA 3L7IA 3HXLA 3K05A 4LX0A 4LJ7A 1XZLA 3L6DA 1W36B 1TIPA 3IT3A 3OX3A 3V32A 1IUKA 1P4RA 3AWDA 4FMBB 1TECE 3ANXA 1O94D 3RAFC 2C58A 3T7JA 4M0MA 4QDXA 1L8QA 5AJWA 4MR9B 5GGYA 1U9ZA 3VH3A 1KDRA 4S1WA 5JJBA 4QASA 2EV9A 4UOZA 1ULHA 1DBQA 3OPYB 4XWTA 5FHRA 5TXGA 5IHPA 2ZBPA 4GVLA 4DR2B 5D00A 2JI7A 3EWAA 4WJLA 3QBVA 3NJRA 1B0UA 1QOQB 3BE8A 1IMJA 1Y4ZA 4KIFA 5H7XA 3N05A 4NULA 3EPJA 2NP7A 3I4CA 2WMDA 4CUZA 4D9HA 3IP6A 1MPXA 4GAEA 1GGNA 3FFXA 3JQAA 4FM9A 1FP4A 2ZTVA 5EKXA 1JLLA 2HC9A 2KI5A 1G4HA 1GZDA 4GBMA 3UAWA 5LP6B 3HBNA 3OAAA 5CEJA 2BEKA 4RZXA 3SYKA 4LN1A 4BP8A 1K4YA 5THXA 5CLFA 2C8VA 4G36A 4E21A 1TCBA 2P6PA 1FX0A 3N2ZB 4ZRDA 3HB4X 1DRJA 3F6CA 5G2OA 4P2BA 3S28A 4A8JC 5DF1A 4AY4A 4KFCA 3AJ8A 3MIZA 5A4IS 5CBKA 4S12A 5EQJB 2YN2A 5BQ5A 3INGA 4E33A 4C22A 5FLXA 1ADGA 5K01A 3AM1A 1GQSA 4JJ6A 5B57C 1F2UA 1JHYA 1B6GA 3PGKA 4FSHA 3WLRA 4EG5A 5J4HA 5ILOA 2GKGA 3ICVA 4UVGA 4YWHA 2RBGA 2PMCA 1I1QB 3KALA 1GJRA 2DFTA 2WWRA 2WSMA 2WA1A 3LPDA 4AWXA 1OZGA 2VF5X 2HAEA 4N3CA 1ISRA 1GQ2A 3DXZA 4BQFA 2NSJA 1CUIA 1EI9A 5FAKA 4MICA 1MGPA 3IQXA 2Z8ZA 4HZIA 4TWBA 1LEHA 8ABPA 4RD0A 5EP4A 3C3BA 1JEYA 5KOHA 2CJPA 1GLNA 2Y0BA 5DO9A 3FBTA 5AM4A 3DOEA 5IWCA 3KK0A 4YASA 3E8MA 3QPWA 4HAXA 3TLGA 3WYFA 2C2YA 3I8XA 3H9JA 1J21A 4KP7A 1A9RA 3B5EA 4JU8A 1T5TA 3HWWA 3AYZB 4YAFA 4DDUA 1JIUA 3L82B 3G9TA 2JFPA 9ATCA 4XWWA 3FNBA 3ND5A 1WCYA 3HFSA 1U9IA 3UV7A 2ZITA 2WPDD 1J8QA 4IDBA 1BRMA 1AY0A 2QENA 1U9JA 5IZCC 4BB6A 4JLUA 1F8FA 1W30A 5K0SA 1ZJ5A 3CH6A 3IQEA 1D9ZA 1NN1A 3DOIA 1ZD4A 2B20A 1K63A 1N1MA 3REGA 1E3MA 1CQJA 3SQNA 1O57A 3WV4A 1PHRA 1VBFA 3ED5A 2J7PA 5BV7A 3RSGA 3RU3A 1XZJA 3H5RA 2HDOA 3LC1O 5HJ5A 4NBKA 4OGFA 3BHJA 4WBNF 1PTKA 2VHUA 1SELA 2XUPA 1XDZA 4KIJA 1Z2OX 5FPYA 3PGXA 4O4IB 3RT1A 5FB3A 3TKLA 4JMLA 5C18A 4AULA 1WHTA 5D2CA 2F55A 4AJ9A 4CM4B 4RC9A 2JDID 3KZXA 3JXEA 6ABPA 4JFRA 1M34B 3ESZA 3OIYA 4HYTA 2HFJA 1W19A 2XNJA 3OZEA 1ND6A 1SVSA 3L43A 3P9ZA 1NMSA 1FDIA 5KYKA 2Z2KA 4YCDA 5JSUA 2HZ7A 5AVXA 1GQOA 3I73A 2M1XA 3DA8A 1G5QA 1U7TA 4JFAA 3VX4A 4E0BA 3PFHA 3CLSD 4OHPA 4PAGA 3ZW7A 3M6MD 4BIIA 5L95A 2VT6A 2HYIC 1QO9A 3LBIA 3OQNA 3ZJUA 1GYPA 1Z33A 3HDJA 3ND9A 1W76A 4R51A 1SWVA 3SZOA 1JBEA 2NO1A 1N0HA 1W35A 3OJCA 1X8KA 2WILA 3BH7A 4O2LA 5BN3A 1AKQA 1ZK2A 2PWZA 4MI6A 4RELA 5CUQA 3VC3A 1QXSA 3NPAA 1NY5A 1ST3A 3KE9A 1KYIA 2GCIA 2WJVA 5H9VA 2XVZA 5ICFA 3V8RA 4WUVA 1TADA 3OCVA 3KQOA 5DNCA 2AEJA 2C0PA 3HY6A 4H2DA 4MCHA 3DAPA 1MR3F 4NPHA 1VG1A 3CUKA 3LDUA 3K1ZA 1JQAA 4RESA 1WPGA 1EFCA 2QZ4A 4UOEA 3V55A 1GAXA 3AVTA 4CM9A 1JFVA 3MSCA 4WD3A 4CTKA 3KO8A 3TUJC 1G1MA 1W29A 1CC1S 3WQHA 2ZULA 1T3ZA 4LJ4A 3C15C 3HJCA 4DE5A 3QKTA 1XRLA 2QAGA 5HR5A 2NT4A 2ODQA 4OI0A 2ID8A 4C6TB 1SCDA 2D0OB 2R8ZA 3K5HA 4X0EA 1A7UA 1VPLA 4IIBA 4YT8A 4KSCA 1FS4A 3DUFB 3LVBA 4C78A 2E82A 1QB7A 1RYBA 4L0MA 2ODNA 2K5UA 4I55B 2PZLA 3MJ4A 4YJ2A 1CZUA 2ZUVA 1KK0A 1NVXQ 5KU1A 5CNIA 2X0JA 1JQ5A 2P9TA 2RGNC 4K6GA 1LDBA 1P39A 1A77A 1K2WA 3CURA 4KUHA 5B1SA 2UZ1B 3TR5A 3C85A 1FYXA 3H9BA 3Q2OA 1L5NA 3ROGA 3KQUA 3ZBUA 3B1XA 1O0CA 1UXHA 2I7VA 1L7PA 3P20A 5IN5A 3ZWYA 4AN0A 5B4TA 4KSYA 3LUJA 2PQ0A 2AEEA 1SG6A 1JA9A 3O2NA 3A04A 3VZPA 4GMHA 4N01A 1K6EA 1Z56C 4FDLA 2XB6A 4V0KA 1UM8A 2CXTA 1R64A 3IKJA 1V9LA 1IZZA 4EF4A 3HJAA 3H8SA 1V4VA 3N2NA 3MGBA 3NHJA 4L4RA 5BN4B 1YS6A 2WAMA 1DQZA 2IIBA 3ICCA 4V0NA 4JHLA 1U5BA 2C03A 2C83A 3MMXA 4YUXA 5C31A 2VJKA 3A06A 1JTVA 3D64A 2RKWA 3SYLA 4ATNA 2WZDA 2OLKA 2PH5A 4I4TF 4FEEA 1LNQA 1YMQA 3PNVA 5FL3A 4B7XA 3AKDA 4YRTA 4W5OA 3TRKA 3JS5A 1NHWA 1G2OA 1AN0A 3AILA 1NVKA 1MTZA 1SXJD 4FR2A 1TCCA 4L3OA 4PHTA 1UANA 5I9LA 1GPAA 1PEKE 2NV6A 2Z0MA 4A1OA 4UTVA 1FQKA 4FYHA 5EJMA 1EFAA 3UWSA 3NWOA 3BTUA 2C4UA 2Q49A 1U1DA 2YW2A 1ZRHA 3PQFA 3ULKA 3BRWA 3JWGA 2J3KA 4OB7A 1F6DA 1ORTA 4B3BA 1LBTA 5CDYA 5LM3A 5B1DA 3UHAA 1EP9A 2HM7A 3I9NA 2R65A 4FMCB 1H2FA 1Q7RA 4BWVA 2EKDA 3BGIA 4KAXA 1J1ZA 1NZJA 1UC9A 1P5FA 1WXEA 3MS2A 3R5FA 3KSMA 4TMFA 4DUZB 2BMJA 3PEYA 2R7LA 2C5FA 4F71A 3HRIA 1XD9A 4NP6A 3ZEIA 2QVZX 4MQFB 5E1DA 4S1NA 1LSOA 5IAEA 4CTMA 1YDHA 5B7GA 3G49A 6ADHA 2UYGA 1PFGA 1E92A 3SS7X 1YL7A 3GNSA 3W05A 4MUAA 4PHGA 3GDWA 4N76A 3VNVA 1QH9A 5DTQA 4NXNB 2FWMX 4Y1RA 1M6NA 2FZ4A 1BGWA 2YUTA 4MS1B 2E3JA 4R98A 4ZA2A 2P7HA 4NNOA 1O8CA 3SZ3A 2AD1A 5GM2A 2OVBA 3FKSA 3MTQA 4A5OA 3K0SA 3WP0A 1R4NA 3M3PA 2UZAA 3W9YA 4MB6A 2QQGA 1CLUA 3CY6A 5TDHA 3O5AA 3WB2A 4DJ5X 4RMIA 4D44A 2GDJA 1KBQA 1QYDA 5DM2A 3O91A 2ABWA 4V3BA 1EFPB 3EXHC 3FPSA 1L7XA 3KQVA 4HPJB 2EZ4A 4YJ3B 2FX5A 1BE1A 5LD2B 4DPLA 2Y68A 1B43A 1SUDA 2B98A 4ENUA 5AVSA 3U7JA 4F9EA 1MC1A 2DQZA 3LDGA 4UTXA 1R6BX 3QWHA 4TMZA 4X20B 2OC4A 3U19A 4FP9A 3DAOA 2R6HA 5THKA 3H2IA 2IS4A 3WYEA 3FZNA 3H9EO 4XQCA 1GSHA 1A4UA 1NN3A 3OVMA 4YROA 4V03A 5GJWC 2QM3A 1MABA 2IYRA 4CMEA 4TZ6A 1ETHA 1XDDA 2IKSA 1GA4A 1XF1A 1GFIA 2HRCA 5DP1A 1EB9A 4L5JA 1HEIA 1PQUA 1S2OA 4D8YA 2IBTA 1JWAB 3FMGA 4UBMA 3HGQA 2RJOA 2HLPA 3QV1A 1MDBA 2V97A 3OCJA 2JFWA 3K1YA 1JVSA 1JJAA 3AGQA 2HY7A 3HMQA 3NNDA 5FL7A 2V98A 3H3JA 4LOJA 5AVTA 1W48A 4AK9A 1FL9A 4UJ3A 2E5WA 3T3OA 1LD3A 5J9FA 3JQFA 3OCYA 3WL5A 2AZXA 4P2GA 2QD3A 3C97A 4G0XA 5DI9A 5C4IA 1HDIA 2FPOA 3TQIA 3Q11A 3QU5A 1RAIA 2OD2A 5BYBA 2P75A 5H82A 1MHTA 4BO3A 1Q0SA 1HTWA 5IWAB 3T0GA 3BA6A 1YS4A 4DCOA 3DF7A 3KXLA 4NYIR 4B80A 4H17A 2AVDA 2NM0A 3GFQA 3GG2A 4ND2A 3G82C 2IV2X 2OCDA 2ON6A 3A9RA 3EVBA 3VOBA 1Y1LA 2QYTA 2QNIA 4R01A 2PSHA 9LDBA 3UGKA 1IJBA 3FTDA 3NIGB 1MPTA 4P08A 2X76A 3D3WB 1UJ5A 2AMJA 2VXYA 3TZKA 4UMEA 3EQ8A 2BKAA 2FEOA 2GILA 2XVYA 4JROA 4L8VA 5KQPA 5JTUA 3RBAA 1M1NA 3A4NA 4ISCA 4MVYA 5KC9A 4IZ6A 3DXYA 2QHXA 3ZJVA 4XARA 4B34A 1JQ3A 1MIOA 1W8IA 4GICA 2ONCA 1HYGA 2HXSA 1BXRB 5BR7A 4B3IA 4YV7A 1R8QA 1D5WA 4HDCA 2YWBA 5JEDA 3WMFA 3MMPA 3NU1A 4LDZA 4JEMA 2GBLC 1E9CA 2WVJA 1NIPA 1VHLA 1VLVA 3UNXA 4UMDA 1V6SA 4Z9FA 2ZDGA 2RHTA 3OCCA 2FE4A 2J0EA 5DRTA 5EXDA 2IW1A 2XQIA 1I30A 2REXB 3GAMA 3D31A 5JS7A 3NIFB 3PZRA 4LKOA 1O0SA 2NU9B 4CEJA 3HMKA 3SKXA 2H31A 4JUIA 2QRMA 4PU0A 2BELA 4LSWA 3EODA 1K2VN 3H0KA 3AIKA 4IWYA 2C9MA 3HYSA 4KWCA 4WEQA 5E6UB 4KE7A 5DLYA 5EUBA 1A4RA 3PI6A 2VI5A 3COYA 4IS3A 4WSOA 1PX2A 2RB5A 5TPWB 4EEZA 4PG8A 3GLFA 3HADA 3MD9A 1PT8A 3A3YA 1E5LA 3LY5A 2JBAA 4MLZA 4QBKA 4UAGA 4CKCB 1Z4IA 3IO3A 1MTOA 4F85A 3MQ4A 3HB1A 4Q4JA 4LY3A 1PSWA 4RAQA 1JAIA 3KJFA 4GRIA 3L6EA 5BT9A 2Q5IA 4W9NA 4HADA 4QU9A 1V4BA 1XZBA 5EXPA 4TTAA 1UKCA 1W94A 5TGDA 3K5PA 1L7DA 1R6XA 4PFKA 3OTHA 4RAOA 4ZREA 1XNRB 5FR1A 3OTIA 2FPKA 5COQA 3VJRA 3ZY2A 3WQRA 2O9JA 2ZJ1A 4G0VA 2RGRA 1SC6A 1SIUA 3LX4A 4BQEA 1YV9A 1SD1A 3EQ7A 3F5SA 3TF5A 2W22A 5DK6A 4QM7A 5AOCA 4UFPA 1KSGA 3R9KA 1RYZA 4BZXA 4R2LA 3RI3A 5FCDA 1QQ7A 2AE1A 1OZFA 1AD2A 3VR1A 3NBAA 3D5QA 2ZWVA 4CNQA 3TW0A 1DV2A 2CBXA 2HJHA 3T3EA 1CUWA 4U2DA 1IBCA 4XIGS 3R76A 4DMLA 4QJ5A 4E3WA 1FFEA 3IAAA 5E9WA 1W4ZA 1GKIA 2FUG1 2ADMA 2XVAA 4G2NA 3ONNA 3PC2A 4X45A 4DSOA 2ZZMA 2C88A 2H17A 1V7QA 2XDAA 2ZJ5A 2UVPA 4U7HA 3HB9A 3MJEA 5GONB 5T8KA 1X7YB 3GXBA 3S81A 4MLDA 4YJDA 2Q07A 5KMGA 5ITSA 1GNQA 1EJ2A 2SCUA 3HLTA 3MIIA 4FMDF 4R3NA 1II9A 1D09A 1TYBE 1WPQA 2XODA 4X41A 1TZBA 3ANYB 3WA6A 2FW1A 1IOZA 1Q15A 1ZS9A 4MVJA 3L05A 2KMLA 4ZCSA 4B4KA 4Z0TA 3OM8A 3KOOA 1JIVA 2GHQA 3E7PA 2A5LA 4CIWA 3AINA 2WWFA 4L4SA 5IK2D 5EWLB 1R6UA 4R4JA 4WNIA 3DM5A 4O2AF 1ZGHA 3DAFA 3ZHOA 2FYTA 2HDWA 2YHSA 4AW9A 4EARA 5FBZA 3ZS8A 1J5XA 2O0HA 1QQ5A 2C59A 2W00A 3FPGA 2W70A 3UUGA 3I9MA 4BMSA 2BTOA 1MORA 2CY0A 1WTCA 3A8TA 5SYNA 4HYEA 3QOXA 1HL3A 4DHEA 2OV1A 4DV0B 2P6NA 1J7KA 4ZKDA 1WUKS 2FLWA 5BPFA 1COWD 1NOKA 1JEAA 1RADA 2Q5LA 7ADHA 5ISMA 3H2ZA 3LY9A 4ZVRA 4ESEA 2P2SA 1XD2B 3CCBA 4CEIB 4QAJA 3OF5A 5A3SA 4RDHA 5BW8A 3LTNC 4CCYB 4RKRA 5B2ZA 4O8ZA 1ZHHA 2XECA 4L6CA 4U5QA 4EGCB 1V6AA 4OY3A 4QT0A 1KR2A 4PO8A 4HZGA 4Q1CA 1TC1A 1JA1A 1RHMA 2H7XA 1PR4A 3SKYA 5F35A 2E4AA 1NJ1A 3NRCA 1G2QA 3UH1A 3Q0TA 1L5LA 4P3XA 3LQ2A 2X2OA 5FI3A 1USWA 3WLAA 5AICA 4DLBA 4DMCA 5EIAA 1OBHA 2C4NA 1HDGO 5EL0A 3C7CB 3D3KA 4KU4A 4XDZA 2PV7A 4WK4B 5FLKA 3J7TA 4M2LA 4J0QA 3L7YA 4QVGA 2ZRNA 1O1YA 1WULS 4UZFA 1TW3A 1NPDA 2ZT8A 3DMRA 4YWJA 3TVYA 1UKYA 2NYVA 4GRAA 3ZGZA 1HLPA 4WX2B 4HAWA 4Q93A 3RS5A 1YVEI 1V16A 3FYUA 4FDUA 5EMJA 2QUBA 1FMCA 5COAA 5A5VA 2BHRA 2WK1A 4BN5A 5E0OA 5KKCA 3QKWA 2Q4EA 3WI7A 4P8RA 3HWRA 4A1FA 1RXYA 1VXRA 5EMHA 5IFLA 4Y6SA 4D8WA 1A8PA 2VZLA 1KK2A 3PGJA 3K8OE 1L5FA 3NRJA 3BUSA 3Q6IA 4KRXA 4D0NA 1F9AA 2OY0A 3UB4A 4HV4A 1U0TA 4FBMA 2PKYX 2NQ2C 3ONEA 1MENA 4BVLA 3AMVA 1FTSA 4Q1FA 1RHKA 4D74A 2C4HA 4KDCA 4CV1A 4LOHA 1BOOA 1WZCA 4YJFA 3HLKA 5G0TA 4B32A 1Y7PA 2QV0A 4FGKA 4JKYA 4OM7A 3BT7A 4QEZA 3V48A 3FSGD 4Q02A 4A2CA 4JNKA 4B2PA 3KFXA 3E70C 4W5HA 2YZNA 2INGX 3UWPA 3GA5A 3P8ZA 2OGZA 4PXAA 1ZW6A 4RS3A 5KNBD 4BEWA 1V0JA 3HL4A 2O2YA 3W1VA 1MGOA 3ZTWA 4N18A 4O4HB 4BOYA 1HC7A 2NXEA 3AIMA 3KIPA 3TZLA 4KPYA 1U2EA 2ACEA 1JFRA 1U2QA 3EVDA 1YA6A 3E5NA 2NU7B 4CQLB 4FFRA 4RPGA 3V00A 3F4LA 4A4DA 5DOZA 3RVNA 1XZAA 1SU7A 2HX1A 5DCYA 2ZRBA 3F7NA 2B3TA 3P9QA 4HP8A 1LGYA 3NVDA 5C7IO 3LO8A 2B4TO 5B37A 5KTPA 4KR6A 2LCQA 2H65A 3UPDA 3ILYA 1Q1BA 3OWXA 2J6BA 3V5NA 4ILEA 4II7A 1W5BA 3DE3X 1JPVA 4CKXA 5IYZB 3ETEA 1HMYA 1FXUA 3ORHA 2ZBDA 1OAKA 3FMVA 1D1SA 1FOEB 3B38A 2BZ0A 2VDNB 4YQFA 3GPCA 3EEYA 1RXCA 2FR1A 1T3HA 4WDRA 5G4KB 5BWBA 1V8ZA 3DZFA 1TJ4A 2HF8A 3BIWA 3OU2A 4NS4A 2VF7A 4P93A 4WKGA 3ZXYA 2PGDA 1Y81A 3F3MA 2ANBA 3L18A 1MJFA 4MVJH 1DCKA 2JHPA 5FQOA 1FTNA 1XA4A 4QJIA 1JDPA 2FEAA 1ZCFA 3CONA 3CVJA 2X5NA 3IDOA 3L8DA 3GVIA 4FYIA 4LTDA 3SICE 4W7IA 4F5ZA 2A3NA 2JLXA 5CCDA 2B4RO 1OD6A 1TAHA 3L1IA 1OFUA 1RABA 2JAHA 4JUFA 2VJLA 5ALQA 3RT9A 3SSOA 4CKBB 4DKJA 4AYTA 4A0FA 2A5GA 3N07A 3IKLA 2QP4A 3WNZA 1T6NA 4KE9A 1UJ4A 1WKVA 3BSFA 1IEWA 2BEWB 3L7JA 3V8MA 1EM8B 4KQWA 1O97C 3SEFA 2P5SA 2JFFA 4MV1A 1C7IA 4U2GA 7ABPA 2WM9B 4DXHA 4DUYB 3ID6C 2OP0A 3FCOA 4YRFA 1YAHA 3ZLVA 4ZHQA 1D6NA 2D7DA 1ECJA 4N8SA 5DEIA 3SYRA 4LXUA 3GK3A 2VEDA 1RWVA 2P67A 4IIFA 1PYOA 2ZGVA 2F4VB 3L4JA 1U3DA 4UZEA 3GRZA 4BRWA 1CUYA 3QYAA 3H1TA 3LC7O 3ET5A 2HUPA 5E4JA 3NETA 1E1NA 1KYQA 2Q3JA 1Z5VA 3PXEA 3PWTA 4R5HA 5EJ2A 3N2GA 4Z3OA 2RGYA 4MRMB 5TQ0A 5IABA 1XN4A 1FYFA 5BQFA 3WL3A 5CX1B 1TJ5A 3BXHA 4M49A 3AEUA 4I36A 1V3VA 4EPYA 5J4KA 3K6SB 3HG7A 3NHLA 4MR7A 3PQ6A 1SH7A 2I6FA 2O1WA 3A6PC 1GRRA 2HKIA 3KZVA 5I4BA 4O1IA 3AR3A 5LD2C 3CF4G 3ZG6A 1ZICA 2AXQA 4N3NA 4EQ6A 1QCDA 3BMNB 4BJ3A 4FFSA 4RY9A 3UZUA 2BYTA 2HT1A 1FQJA 1IXRC 1HNNA 1MU0A 2IGTA 3G8BA 1R6VA 1JU9A 1SCNE 2WTBA 2X8LA 3HVUA 2JCXA 2Q6OA 3DAHA 3PFKA 5CP8A 4DSUA 2A0UA 1VIAA 5AI5A 4PX5A 2NZ2A 2FRDA 5ALLA 4B3HA 1D03A 2HJVA 2UVDA 3CVVA 2I22A 1AC5A 2AH5A 4DLVA 2Z04A 1U3TA 1BFKA 4JKIA 1JB9A 4YJKA 4KW7A 4EUHA 3K92A 4R40A 2PSFA 3A6FA 4WTOA 3BAZA 3A25A 1JTFA 3IVGA 1CUFA 3FIJA 5FIUA 1OXVA 2ZI9A 2OK7A 3Q8KA 3K70B 1WCV1 1X86B 1C7JA 4FWIB 2HA3A 1W85A 4YUWA 1FE8A 1UZAA 3C98A 3RHTA 1OH7A 1BD4A 3I05A 2OAP1 4GS5A 1HDCA 3BIJA 1OAOC 1KDTA 2O2HA 2NVUA 2AZTA 3EVCA 3A6KA 3VPAA 3X44A 3PVZA 4MVJI 4N03A 5IF9A 2GXSA 4ZMBA 3ZR4B 1UC8A 4LI3X 1H8HD 3GRYA 1JHMA 3VA7A 3J81A 1T9ZA 1XJCA 3DZ8A 3DEHA 4K5QA 1P4AA 3LZCA 2EJUA 3DZHA 2PSEA 4HPWA 1CE8A 4OYRA 4WPGA 1H3NA 3KJGA 5FUMA 4XB6B 2CLOB 1EFUA 1DXQA 1PJCA 2JLRA 1JXQA 3EGOA 3UOGA 4E2WA 2VDLB 1TF5A 3K9FC 3QTTA 2PWYA 2IHUA 1R12A 1G5TA 2F2TA 2ZYRA 2BI7A 4Q12A 2Y4OA 4KPUB 4QFBA 4R9NA 1GUYA 2IHZA 5KQSA 2OZEA 2NZVG 3PUWA 2IPNA 3BJEA 1DV1A 2NPFA 3RC1A 3DKIA 2RGDA 1B15A 1KVSA 1RRVA 2QE7A 3M4YA 2QR3A 3SZRA 4D8VA 4YT5A 2HJ9A 3AY0A 1Z18A 4ZTBA 1L7OA 1VKZA 1D9XA 1COZA 1DHRA 5KNDH 4X60A 4FYKA 1U7ZA 3T5GA 3A1WA 4RTNA 1T29A 2VSOA 4NOKA 3I2FA 4URYR 1Y80A 3NKFA 3BD6A 5JXGA 1FFGA 1V96A 4PLHA 2XNDD 4B85A 3PKZA 1Z2NX 2GO7A 1SEPA 4M7WA 3N39C 2F1RA 4IHAA 2XOKA 4IH4A 1K06A 3M5DA 3ST7A 3WRVA 4CR7A 1G6Q1 1XYYA 1G291 2R66A 2R1ZA 2YY5A 4OJMX 5JWRA 3U44A 1XRPA 4Q4HB 2FP3A 1T1RA 1JQBA 2G5PA 7REQB 2QZSA 521PA 3PXDA 5I7HA 1JF8A 3ABZA 1SBYA 3IEIA 3ISTA 3NVKI 4D25A 1SB9A 1T1EA 3JQ6A 2AFIB 2OFFA 5ESXA 2F6RA 3QMPA 4NNPA 1Z7BA 1SIOA 4EB6B 1OF1A 3T7EA 3LDHA 1D5CA 2VUIB 3AVVA 1LW6E 1Q83A 1SOWA 4GOKA 5ED0A 3L8CA 3ZD7A 4JT4A 3HBMA 4D3FA 1I3CA 5C1DA 1ZN9A 3PXAA 2ERXA 2QMHA 4TV8A 3UMVA 1G21A 4IMPA 4HSGA 3TEJA 4Z7NB 4IF4A 1NVGA 2OCBA 2H4ZA 3JU3A 4WL0A 5DXJA 2VRCD 4J2OA 3N2LA 2DCUA 5ECYA 1E1QD 4BQQA 4D4HA 4PYIA 2OM6A 1D0IA 1TVMA 1Y1TA 3QXCA 4C14A 4FWTA 3A1CA 4RKEA 4EFDA 4WINA 3F3YA 1PGPA 1CS0B 2V7EA 2YH2A 1A5SB 2X77A 4FLEA 4D3DA 1S0UA 4HFRA 2Z1NA 5IHXA 3R3ZA 5J5VA 3C8UA 1YRQA 2QIOA 5JRJA 1GAWA 1UEIA 4ASUA 4UHKA 4UU7A 1C3JA 5UKDA 3HXPA 4RA9A 3RVJA 5B2EA 2C3UA 5C5DA 3PDIB 3S1AB 2C2XA 5I9IA 1U0HC 1R6DA 2VUHB 3KZOA 1JDVA 3U7IA 4IH9A 3ZWVA 2CVQA 4YH1A 3J7AC 2FPXA 3OZDA 3FE2A 4DNFA 3BVPA 2IOFK 3I61A 1P5JA 4MGHA 3V42A 2FZGA 1GZVA 3I6QA 3IV9A 3ZJ5A 1LI5A 3GEMA 2BR5A 2NG1A 2NUPB 3P2EA 2M6KA 3R7LA 1CK4A 3CIFA 2JLAA 2JH9A 4YRMA 4KDRA 2GETA 4Q9KA 4GEKA 1SKYB 5IJXA 1F2VA 4M88A 1NBAA 2GM5A 4DJDC 4YAIA 4NCBA 1ACJA 1G8AA 1KQPA 3QI7A 1WSAA 1IWPB 1K9VF 3IP7A 2G1PA 3BMQA 3SBEA 2FN4A 2WHPA 3E22B 1YOVA 4CIDA 1AN9A 5FWDA 3PNOA 2OV2A 2JA2A 4GWLA 4AO8A 1H6DA 3A28A 4DUGA 3CPHA 3GUZA 5JATA 3ZZTA 2BC9A 3EISA 4RQBA 1VHDA 2AR9A 2QMYA 3FY4A 4UVDA 4B76A 2GDZA 5TMEA 3AP1A 1P1JA 5BUCA 3SYMA 3ETGA 2CFOA 2WF6A 1UXKA 1VLLA 1AKTA 1NWCA 1C3VA 2G1AA 4QUEA 2I55A 3IEKA 3WKCA 4XGRA 3WAGA 3K94A 2H2DA 4K9OA 3A05A 4D1YA 3LKBA 1SR8A 3QNUA 1IPEA 2Q3FA 4DRXA 2A6PA 4AKTA 1EX9A 2OHFA 4HDMB 1Z8HA 1N2BA 1KYVA 2ZUSA 4NZPA 1LK0A 3GI1A 5EZ5A 2GK7A 1AQNA 2NO6A 3VR2A 2FEPA 3EBPA 4KV9A 4LUCA 4E46A 4ZO7A 3BHMA 5A3VA 4ALJA 3P9IA 1JHRA 1E6UA 1EGMB 1ZC3A 1CJSA 3D7SA 1FLAA 2PX0A 3IHTA 3KQMA 3M82A 4H15A 3CLRC 1Q92A 3VZSA 4RPHA 2J46A 4TKVA 1H2XA 4BVHA 4ZVMA 3VU3A 4JT8A 5LCXA 2A5YB 1OE0A 1BE0A 1JNYA 1TMYA 4IR7A 4P4SB 5AOVA 5ER6A 1NQUA 2GD2A 3R41A 1H8ED 3DHNA 4J0DA 1ZIXA 4CDGA 1NM5A 2BSXA 3E35A 4HUTA 5JADA 4ENWA 4OIMA 4MAFA 1FTWA 1GFSA 1NMXA 3CZMA 4HXFB 1KZGB 3CO5A 4TWRA 5LA6A 4EW2A 5LQJA 2FRXA 3KE8A 3QNMA 3H17A 5G02A 3WGGA 5J2UA 4PZEA 1I2MA 2Q0SA 1XMOB 5AHRA 1KQNA 5SYMA 1W34A 5FOTA 1CDDA 4D82A 2G28A 4K8OA 3CH4B 1M2HA 1NJGA 5ECDA 2ZWAA 3CXRA 1RZUA 4IVQA 1GQFA 4JLJA 5BSFA 2GJKA 3P0JA 1IVYA 1XKXA 4ZOLF 5JI3E 3RSHA 5I8WA 1TX4B 4N0MA 3PJDA 3NKVA 3IUNA 1A8QA 4JYPA 2MINA 4KMSA 4P4GA 4PPGA 5JCZA 5AHWA 1SCUB 2ZQZA 4KG7A 2JFBA 5BVHA 4D81A 2VDPB 1N9KA 1F4PA 1QRRA 2EZ8A 3EF1A 5F7JA 5AUOB 4NU0A 3LT4A 2WG1A 2P0AA 2O0LA 2CE2X 1XQ6A 3PVCA 3KJXA 1X87A 2I1WA 4FUTA 1MAHA 4YO7A 3TFQA 3I0NA 2PMKA 2I6QA 3I1FA 4ND8B 1F7VA 4E5UA 2VDUE 3DEIA 2H59A 4LE2A 2ID9A 3B9BA 3LQKA 1OI4A 3O90A 3NB0A 5CVTA 2Z30A 5H4GA 1VHWA 1IATA 2QA5A 2XUAA 1Y98A 2X86A 3CVYA 4PTLA 4WLVA 5ERYA 4F72A 4LWPA 3AK4A 4FYXA 2CV2A 3B8EA 1ZPDA 4DAEA 1ZVJA 3WRWA 4OHUA 1RM3A 1DTWB 4RGBA 3KU4A 1MCZA 3LA6A 1IZ9A 1RJWA 3A0RB 3JALA 4OG2A 2HBRA 3JAKB 4ETIA 3EQ6A 1HWYA 1UMKA 3EAGA 4EG0A 5EERA 8ATCA 1CQIA 3OZUA 4ZTZB 3A36A 3CX4A 5KIAA 4UQOA 3GGOA 4MI1A 3ZXUB 5C51B 3HPRA 1DKPA 4JP8A 4HDRA 3RWOA 2W2XA 2ZRQA 1BC5A 1KZ7B 4LGMA 3BFJA 4XGKA 1XPUA 5A2GA 3EARA 4RHCA 2O5EA 1Y33E 4UNNA 1QUEA 1UT5A 1ZIDA 2ZSUA 3FMPB 3E2PA 1C3EA 5EHIA 3PFBA 1NC1A 3UY4A 4D41A 3EG5A 1ENZA 1G20B 3FPFA 4ZVOA 4H4CA 4B2LA 1MOZA 1NP7A 3FB4A 3CCFA 3FUVA 4RD3A 4DC9A 2B1GA 2NXNA 1VJ5A 2ZYAA 3VR6A 1UPTA 4EPXA 3OE1A 5CCBA 4N6NA 3K0CC 2VHVA 1Z6YA 3TOCA 3UT5A 4M0CA 2A78A 4WFKA 3DULA 2AOTA 4ZIRB 3ZGLA 3EG9B 2G9UA 2H4JA 2J4DA 1AXRA 2PBLA 4UBIA 5TVKA 4AJPA 5M29A 2DUMA 1HFJA 3IOEA 4DR3B 2MSEB 1HDOA 3OLVA 4OSPA 1JHQA 2H5LA 3AO0B 3DOFA 4JELA 2H4YA 3HO1A 4BX8A 1L5SA 3IRUA 3PSHA 3KXDA 4TRJA 4H31A 2FFHA 5HQ3B 2XIQA 3FPAA 4Y6LA 3WBFA 4RK6A 4AMZA 2REBA 4M0EA 1E2BA 2C77A 4CBVA 2JGFA 2FHPA 3WLEA 5HIIA 1WZEA 1FW6A 3PQDA 3AF4A 1XT6A 4REMA 1Z4LA 2O20A 3SZGA 3IPAA 3T1NA 1XHLA 4EEXA 5KSZA 4HN9A 2VQDA 4M9ZA 4Y2GA 3EUWA 3UMJA 5KYWB 1RRGA 3GA0A 1P33A 3LMKA 1KFJB 1RPTA 1ZAKA 5D87A 5FOXA 4IIGA 4ZODA 3TRIA 2D3TA 4UCQA 1XTVA 5DT2A 5KHOC 3JPYA 1FJHA 4PYOA 4DDWA 1LTHR 3V97A 4N82A 3WFZA 4GR9A 5EJ9A 1W36D 2G1KA 3JATA 2ACVA 5FBVB 3P7MA 1PWYE 3G02A 1Q2XA 1WHSA 4KFTA 1HQCA 4CW7A 5LLSA 1HSZA 1I1NA 3PJEA 3MYRA 4GQAA 1PHPA 5H0IA 1R7RA 2QTFA 3UJ6A 3L0PA 2JFZA 1QC5B 1KEUA 3BBPA 3U4DA 2CLMB 1GHTA 4IYJA 4BFZA 4C1BA 3IKVA 3IKTA 3VSEA 3S8MA 3LH5A 1QJ4A 1UF9A 1B2LA 4MPDA 3AVWA 3F1KA 3OCXA 2BKUA 5J47A 1PX0A 1Z12A 2OBNA 3HYCA 1KP3A 1UEJA 4A0RA 1W5AA 2WZQA 3ZW8A 4HVLA 1YFLA 3ZTYA 4EHKA 4OIFA 3DDHA 5BOSA 3QYJA 2WI8A 5ALWA 1LBIA 1J90A 2AI1A 1J5PA 3VPXA 1RAAA 3CIOA 4ZMSA 3WLSA 4TSKA 4YRKA 1E4YA 4UMFA 2W6OA 3E3OA 1VIVA 4FEGA 3TPFA 1IQRA 2JVJA 3CG4A 2HV8A 4F2HA 5BNWA 1R4MB 1U8EA 2HF9A 5FYQA 3TRFA 2HGZA 2WP0A 3RC9A 2CUNA 2IUEA 2NZ8A 4W9MC 1N6NA 3HDGA 4XDGA 2Z83A 3H84A 1X9IA 1SVNA 5E95A 2V7QD 2B4AA 3PPVA 3WK6A 3SGLA 1U0GA 4JOQA 3HJFA 1JWLA 3TQCA 3LBFA 3VC1A 3G5AA 4GEGA 3SVZA 1GTRA 1LBHA 3ONWA 4O4LF 5LLDA 3H8JA 3U7RA 4QQ8A 1EDZA 3V4FA 4BMXA 5GZ1A 2R7NA 3NJ8A 2COKA 4I50A 2V3WA 4MWTA 3PZBA 3UWKA 2IHKA 1ZO8A 3QELB 4GDMA 3RS7A 1QHEA 3I5AA 5KBYA 3WJAA 4F3YA 2BEJA 2A9KA 1THZA 3QX8A 5G1PA 6PFKA 5CXSA 1YBMA 4EKDA 4XRGA 2DHEA 2VWQA 1M0TA 2PUWA 3TLCA 5KVSA 3HUFA 1QH0A 2W2LA 5GIOE 3M9XA 4JH0A 4D3ZA 2AX3A 2I78A 2PGOA 2KPOA 1EWTA 1Y48E 2XMGA 1KS2A 3NHUA 3QWBA 4QUAA 5E4TA 3UFXB 1CEQA 3WOVA 4BZZA 3QHQA 5CLJA 1N75A 2AW3A 4X92A 4XQGA 5GV7A 1PI3A 2AG0A 4IHJF 4XB1A 1H0SA 2J9ZB 3WKEA 2XE4A 4EPRA 2M9MA 5PGMA 3TNLA 4EKNB 2PG3A 4U0KA 4JOCA 2P5TB 1SG9A 2CNOA 3ZHBA 3EHDA 2D8MA 4WAUA 1WSWA 5AKYA 4TSFD 4CF6A 1E32A 1KMIY 4LRXA 3TZHA 4L75A 5BVGA 4JSTA 2JATA 4OYYA 2GPSA 3RUDA 3GLIA 1ZX1A 3P9KA 3VR6H 1EWVA 2X22A 4GP6A 1YFZA 1PV4A 1FUYB 1MA3A 1V47A 4MO9A 3ZZNA 4H1WA 1OT5A 1VE1A 2OCIA 1RI5A 4M0KA 4C4OA 4YBZA 4R8SA 3ZQ4A 3I5YA 1UWKA 4GM0A 3UHPA 2ZBGA 1TVKA 3WXMA 2D54A 1YMVA 3ROZA 4L07A 1J56