1F2UB

Crystal structure of rad50 abc-atpase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
145
Chain Sequence
ALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAD50 ABC-ATPASE
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Replication
total genus 35
structure length 145
sequence length 145
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2uB00
2QN6A 5E4FA 2WTUA 4JT4A 1G5PA 1Q1QA 2UZ3A 3HWSA 4EJSB 1MRSA 4ZIRA 2W0SA 5AJWA 1NN3A 4N0EA 3B78A 1KY3A 1UBFA 2WHXA 3BB1A 4OQLA 1DVRA 1U8AA 3L0SA 3KX2A 2FA9A 2BVNA 1X8LA 2EVWX 2O8CB 3RANA 1GWNA 4DLTA 4EPVA 2PEZA 4DLWA 1KI6A 3KUCA 4HAYA 4KBFA 1IM2A 1ZVQA 3ZGXA 2QUZA 4LBWA 3CO5A 4QBHA 2ZJ8A 2J0SA 1KSGA 2AXPA 1Z6XA 3K1JA 1C4OA 2PZFA 2REXB 4Q1CA 3EIQA 3P27A 4UXIA 1CJMA 5H68A 4A8JC 4O3MA 4ZKDA 1QHYA 3VR6A 4MUBA 4NE2A 1GVNB 2HF8A 3JZMA 4FMDB 2VLIA 1PUJA 4RJLA 2ZAOA 5FH9A 5TDHA 2Z0MA 1G3IA 1RJ9B 1GFIA 1Y3AA 3OIVA 1RRGA 3QG1A 3UG7A 2WBLC 3IPYA 3DOFA 4QBIA 4LC0A 4YQFA 4CT5A 1SHZA 1KGDA 1Z5ZA 2MSCB 3I1FA 4OYHA 1E2EA 4TZ0A 3ZVRA 4KVGA 1AZTA 1OIWA 3AUYA 3TR5A 1Z0IA 4LYAA 1RRPA 2BEJA 2ZROA 1SVOA 3G5UA 1O3YA 1KZGB 3A4LA 3B9PA 4PZLA 1IN4A 1P7CA 2ODWA 3B1XA 4AKEA 4B43A 3AP2A 4PO1A 2DCUA 3MWJA 4CEHB 3H4MA 1OIVA 5F2EA 4QHTA 2IUSA 2QSZA 4WW0A 4QHSA 5CDFE 1G8FA 1LF5A 2FPKA 1G20E 3K53A 1OSNA 1AQYA 2G77B 4POAA 1YR9A 3Q5EA 2FGKA 3OAAA 3VFDA 3V4RA 1BH2A 4C4PA 3BWDD 2BC9A 3C4JA 3GJ4A 2PT7A 2ZYUX 3D7MA 4U02A 5JJKA 4LJAA 2ZYWX 1KI7A 2RGEA 1W36D 3C16C 1KO8A 5J4LA 5B58C 2WV9A 1YZQA 1DAFA 3VKGA 2IYUA 1MOZA 1QVAA 1VCMA 1QG2A 4DEYA 4DWJA 3B9QA 3G82C 5FBRB 4D82A 5KPJA 2NTYC 3QVUA 2GK7A 5E7IA 1J90A 2O8FA 1XMJA 3BFKA 3TIFA 2EQBA 1HY3A 1AJEA 1F2TA 3RS0A 4PC6A 3C7KA 5FBWB 4D25A 1HV8A 4DBLC 2BM0A 1BS1A 2ODEA 2QENA 4Q01A 3SFZA 1EESA 3FVQA 3KFVA 3GLFA 3PUWA 3RLFA 2D3WA 4PAMA 2DFKB 3LBIA 2F7SA 4J0QA 4JBWA 4F38A 2FPMA 2EU8A 3WMGA 5K8IA 2ZRBA 3QG5A 2BJWA 3U3OA 2CCKA 3B1VA 1XTRA 3DOEA 1UDXA 4MYTA 3OIUA 3QF4A 3C8UA 4C7OA 5LB4A 2H92A 1TL7C 4IXMA 4Z51A 2VRWA 3HR8A 1G5RA 1WE2A 4DRZA 4AKIA 2ZS8A 3EC2A 1G21E 4GT1A 3FHOA 1SULA 4US1R 4KSCA 4KO8A 3TW4A 3THXA 4GDFA 3VR4A 4F4CA 3TUIC 5KNDA 1W4BA 4DC9A 4JVLA 3EZ6A 4TL8A 3W5IA 4WBSA 1VDZA 1XFAA 4Q1FA 1OXVA 4DIEA 4NBSA 4FIDA 4EUNA 2QY9A 2BMJA 4KHZA 5EZ5A 2HYIC 1A4RA 4Q47A 2J7PA 2P5TB 4DT1B 2DFNA 3BFVA 4JJZA 2D4HA 3AVYA 3VNVA 2ZU0C 1E79A 3UK6A 4RCZA 4OI4A 2LWIA 4OHVA 1JEDA 1DPFA 1VYTA 4PR0A 1KI3A 2ZRPA 2XOKA 4A9AA 5BN5A 4LJ4A 2RGNA 3DO6A 4L4UA 3KXKA 4P4SB 4L16A 1N25A 2BBTA 4NYMQ 4QRHA 4D4MA 3C5CA 3KUDA 1P72A 2F55A 4NYJR 3PEUA 1Z63A 1PUIA 3MWYW 3NH9A 1H8ED 1E2IA 3CB4A 3RS7A 3ETLA 3ZS8A 1KDOA 1RE0A 2RGNC 1D9XA 4B76A 1NIJA 3RDPA 2ZI6A 3U5ZB 3S1AA 4MDEA 2H8KA 4K8OA 3KL4A 4ZCLA 2OFXA 2V55B 4LJ9A 3AVUA 3DMNA 4C0LA 3FOZA 4QHYA 1F3OA 3IIKA 5CK4A 3RVBA 4RZ3A 4C3ZA 2R6GA 1F6BA 5A5GA 1NBME 2CK3A 1BYIA 4Q1EA 5ANRB 1E2NA 1OFIA 3L2OB 4QM6A 4GP6A 5A0FA 2Y8EA 1AN0A 2WJYA 2RB4A 2QAJA 1S3SA 3GJ3A 2ERYA 1A2KC 2R6AA 2XXAA 2O5VA 1X6VA 1E9DA 2NGRA 2YC2C 4W7SA 4PTLA 3IO5A 4LPSA 4QM7A 1E1QA 1R0ZA 2ZRLA 3LX8A 2OCYC 1N6RA 4BEBA 5K8TA 2EWWA 1W0KD 2IYQA 5FOXA 2RGBA 2W6ID 3TQCA 4C9BA 1W48A 2P67A 5FOWA 4B3XA 2WVJA 2BMFA 1XP8A 4NDZA 5FTLA 2NZ8A 4QGHA 4TLAA 1Q1EA 1MO5A 4NCKA 3EZ9A 2C8VA 3K70B 4NMMA 3Q72A 4HAVA 2ZIAA 1F5NA 3GFTA 2VPPA 2NPIA 5LD2B 4CEIA 1US8B 1HURA 1JXMA 2YYZA 4BLOA 4DKXA 1IJFA 4B75A 1SKYB 1Z6AA 4IVPA 1HEIA 2GEUA 4NYIR 4B3BA 5BN4A 3CPJB 1GNRA 1GKIA 1NN1A 4R2IA 4TT3D 521PA 1P9RA 1DE0A 2ZRKA 4Q9IA 3TVDA 2WKPA 2ANBA 4WA7A 5J5CA 1YVDA 2IS6A 3MAAC 2WMNB 3NHAA 3VAAA 4ZIRB 2AFIE 1NVWQ 2OILA 3TAUA 3T1TA 3SZRA 2W83A 3QJYA 3EWAA 1MKYA 4M9QA 5BYJA 3FKSA 3PCRB 4BZXA 3WRYC 1WBBA 4H9GA 1II9A 1S1MA 3GJ8A 3I32A 1OXSC 2DBYA 2QBYB 4HZUA 2P6NA 3TSWA 3DVLA 3AF0A 3K8YA 1CR2A 4LHWA 3AKYA 2A5FA 1OHHA 1XCGB 1XMSA 4A8JB 5AJXA 821PA 1KI6B 4D80A 1KKMA 2J0QA 3EA5A 5EQTA 3WRXC 5JHHB 2FFAA 4LJ5A 2OHFA 2V54A 1E69A 3MUFA 4TL9A 4URZR 4BECA 1WA5A 5JEEA 4PQYA 3TR0A 1UKEA 2NZJA 2CE7A 2MSEB 5G3ZA 4PC1A 2Z5FA 1LS1A 4WOPA 2DB3A 3H1TA 4FCTA 3P20A 2W6JD 1AS2A 3A1WA 1MO4A 1YR8A 1Z06A 2WSMA 2NG1A 1GILA 4W5JA 2WWGA 2VP9A 4UXJA 3CNLA 3QXXA 2A9KA 2FFHA 4GOJA 3WBJA 1NLYA 1ESNA 1N6PA 4WZBE 2QAGC 4IHQA 1N3BA 2IHYA 4D0LB 2GXSA 3CZPA 3JVVA 3QSYA 3QENA 2IYTA 3KQHA 3IKJA 1IQPA 3IO3A 1W5SA 2QP3A 4G3XA 4K81B 1D2EA 1JAHA 1YHNA 1TEVA 2ZE8A 2W0MA 1W1WA 3KKMA 4OK6A 3U2QA 1Q3TA 2CHVA 1CBUA 4KCGA 4Z8XA 5ELXA 1KI8A 3PV0A 2IS1A 1JPJA 1NP6A 5FPYA 1CKEA 3QQ5A 1W2HA 1FFHA 1KJWA 2YOHA 3FMIA 2E1RA 4QBGB 3MD0A 3GLHE 4GBMA 2ATVA 2C9CA 3A4NA 3B2EA 3WP0A 2FZLA 2P6UA 3K9LA 2O8CA 3QEOA 1OFUX 1TQ6A 4FMBB 2NQ2C 4OHYA 1VG9B 2ZR0A 2A5JA 3RWMB 1OYWA 4JKYA 1Q21A 2ANCA 3DKPA 4PC3A 4LK2A 3LQRA 1TEXA 4I1VA 1W36C 2EYUA 1C1YA 4IDQA 5TY0A 1VPLA 1ZCBA 4W9MC 1NG1A 1G41A 4KSBA 1XJQA 3ADBA 1S0UA 5J4HA 1EFUA 4NHOA 4UNPA 1GNPA 3GJ7A 2GESA 4DB4A 3FMOB 1QF9A 2JJ2A 3IEVA 3T1VA 2ZSAA 1GL9B 3B8HA 1OE0A 4KFRA 1S2MA 3UANA 4MKFA 3SHWA 4C30A 2CVHA 1E9AA 2O8FB 4F4IA 1XZQA 1ZAKA 5FOSA 4A6XA 3UXMA 1F2TB 4KYUA 1RJ9A 4Q5IA 4ZPXA 5FL7D 3CF6R 4AWXA 3SJZA 2P3SA 2JLSA 2D2FA 1KDPA 4DLVA 1PLLA 2YWHA 3F0TA 4KFUA 4CW7A 1L8QA 5FBLB 3DMDA 4LZZA 4CZ2A 4URUR 2HT6A 3EZ7A 3IQXA 3GLFB 3Q7PA 2BJVA 2FV8A 4QL3A 3FHCB 3EPKA 1BKDR 4IOJA 2ZS7A 3MWKA 3RSOA 1E2QA 5HE8A 2ZYTX 3RRZA 5AWFC 3QF7A 3ND9A 3QKUA 4US0R 3I5YA 1KK2A 2WKRA 3QF4B 5AJYA 4AC9A 4C7OB 1P62B 3ZZ0A 5G53C 1R2QA 1WDTA 1FQKA 3CH4B 1KDRA 5LB2A 1CR4A 5FPKA 1SVIA 1R4AA 3OEED 4XWAA 3DM9B 1RKBA 4JLBA 3SHFA 3A6PC 1Z0DA 4B35A 1CJUC 2OZEA 4TYQA 2C04A 2HUPA 4ASUD 3I72A 1RW4A 5H8WA 2BCJQ 3G0HA 3THXB 1EK0A 2RHMA 3UPUA 2RAPA 2CBZA 5JCPA 5HE9A 2EWVA 1M74A 3K09C 3CF2A 4IVRA 3AM1A 3N2EA 4X8HA 2R65A 4RZ2A 4XSHA 3REFA 2WAYA 2G3YA 1IHUA 2WOOA 3OFND 4UNRA 4GZMA 1ODFA 3TAHA 2C95A 1E0AA 2OG2A 4KFSA 2JIZD 4M22A 2RH5A 4LBZA 2ZRCA 3MJRA 4Q03A 4Q48A 3PUYA 2JAQA 2WJVA 2R6DA 1H8EA 3L82B 2UZIR 1J7KA 1W46A 2N42A 3CNOA 1WCV1 3A37A 1Q44A 4IEIA 1PZNA 2E9SA 4GMXA 1F60A 2ZRNA 4HB4A 4WVFA 2IWHA 3IEUA 5K8LA 1EX7A 4ZDIA 5C18A 4JVMA 3ADCA 4IXNA 2HCJB 3KTAA 4B6FA 2VP4A 1A5TA 3EXAA 4BFWA 3TUJC 4DVGA 5FPSA 4ERNA 1XTJA 2YV5A 5TMPA 2O8BA 1QHNA 1GM5A 1HE1C 2PCJA 3RRMA 4U5XA 3S1AB 2HCBA 2ERXA 4OI2A 4MH0R 4Q66C 1S4QA 1X8KA 4JYBA 4B71A 3SYNA 3KXLA 4BZQA 5KOYA 4PSVA 2ZUDA 1KAGA 3ZDQA 3K0EA 2AN9A 1JR3A 2FG5A 2IW3A 3Q3JB 2CLCX 2OEPA 4S35A 4YMTA 4F93B 1A82A 2EYQA 4JT2A 2V7QA 2ORIA 4G5OA 1W0KA 4Z1MD 2W6IA 1XCMA 2PLFA 2IS4A 2OBLA 4OL0A 1S3GA 4C0QC 2WWWA 1RPZA 3X1YA 4B74A 5HR5A 2XXAB 1DAMA 1Q1BA 4FMCF 2KE5A 1FOEB 4XJXA 3ND8A 2Z4RA 2PZEA 2PX3A 4PC2A 1J8MF 3VHLB 3KKPA 2QMHA 4MRSA 1QHGA 1KMHB 1K5DA 4TYPA 3GQBA 2IUUA 4OI0A 5CLQA 3LLMA 1JBKA 4Q02A 4MRRA 3NG1A 2RKOA 2AKAB 3BD9A 2XJ9A 3U7HB 4TT3A 1RZ3A 3BRWD 2X8AA 3GJ0A 4V0ME 2IF2A 4WXPA 2GCNA 5SZJA 2Q6TA 3THWB 4Q4LA 3ADDA 4LGMA 3GJXC 4RZXA 3AUXA 3X2SA 4CEIB 1ZM3A 2VHCA 3HU1A 4B3GA 2W00A 1ZD8A 5C1BA 4D2IA 4LOAA 1NVVR 2KSQA 1YRAA 3W3AA 4GOXA 2F1JA 1W0JD 3KXIA 1ZNZA 3W9YA 1M1YE 3H2YA 4TQAA 2WSSD 3PQCA 4TLBA 1CEEA 3B1WA 4A82A 2VYFA 2IBMA 4M1YA 2PMDA 3VX4A 1UAAA 4IFEA 5CB6A 5CM8B 4DDWA 2AWOA 1XWIA 3T34A 2YOGA 5EE3A 4IOMA 5EXPA 1CR0A 2FJUA 4R7ZA 3GFOA 5DI9A 2CDNA 4HZUB 1L4YA 2ZJZA 3U61B 2ZSFA 4TYYA 4OI1A 1JR6A 2BKEA 2IC5A 2WM9B 2W6JA 4UJ5A 2IT1A 3ZH9B 4TMVA 1AGPA 5D3QA 2XZOA 4E03A 4B2IA 1E94E 3K0AA 5AJZA 5IT5A 3CUEF 2CHGA 1BOFA 5KSZA 4ARZA 2AX4A 3K9GA 1M6NA 4ZCMA 2YZ2A 5CJPA 3SYKA 2PZGA 2C98A 1EGAA 2C96A 2CVFA 3OF5A 3ZZTA 2QAGB 1FPMA 1XD2A 4HB3A 1QBKC 1G64A 1LTQA 4JLKA 2BIFA 4M4SA 2HXYA 4R2HA 4Q00A 2VHJA 3N5CA 1V5WA 4N1AA 5FBQB 4AYXA 2IXGA 3BH0A 3IILA 4X8MA 3LW8A 1ZINA 1NI3A 1UBEA 1PV4A 2ZR7A 4AY2A 1Z28A 2ZRDA 3R9XA 2QMEA 4WZAE 5AK0A 4A0GA 5HPYB 4AG5A 5F9FA 1GAJA 5JHGB 1Z29A 1ZP6A 2MSDB 3RNLA 1MV5A 4LV5B 1NMZA 2CL7X 2EW1A 4A2WA 5G41A 2CL6X 3SJBA 4E22A 3FHTA 3OEHD 1U2RA 3R20A 1UJ2A 3A36A 2YWFA 1ZJ6A 2JLZA 1W36B 4RD1A 3AVQA 1G4UR 4XTRA 2RCNA 3EPLA 1AGRA 3BJIC 4LYHA 3FDIA 5B2ZA 3U4QA 2QBYA 2BCGY 2PEYA 4QXAA 1PJRA 5KDOA 4OK3A 4AI6A 1FQJA 2J9RA 4TLEA 4FCWA 2REBA 4WIAA 1HE8B 1OFHA 4A8JA 1G3UA 1SXJD 4ZCIA 2NO9A 2ZVPX 2QT0A 4I1OA 3ZYCA 1UM8A 4LY6A 4PSKA 1FTSA 1LY1A 2ZSEA 1XXHA 1HH4A 1E3MA 3CZQA 4HAWA 3MSXA 4MRPA 3TK1A 3ADKA 4R98A 3N70A 4L5BA 2XSZD 1DAHA 3BAFA 2F3RA 4OQFA 1LFDB 2IXEA 1UADA 1G18A 2IF0A 4H1VA 4CGZA 2NO6A 1Z22A 2JA1A 1G7SA 2VO1A 3AH8A 2VA8A 1YZGA 2QTFA 3LV8A 4PAOA 4KVAA 4LYJA 1NLFA 3RHFA 1E99A 3SC3A 4W5HA 2REOA 4HDOB 3DDCA 1VIYA 4HB2A 2FWRA 4IDNA 2E87A 4URXR 1DO2A 3CNNA 4C0HA 1G6HA 3V00A 2G83A 3KZ1E 1KI4A 4B47A 1NKTA 3ONWA 3MMPA 5CIWA 3F5FA 4QFMA 1IJEA 2ZSBA 4MGYR 5BXQC 1X86B 1LNZA 4UNNA 2FSHA 4JL8A 4RKEA 3MWLA 1E0SA 1E98A 1WXQA 1OT3A 2WWHA 4XIGS 1JAIA 3QKTA 2DPXA 3QIAA 4CRWB 2ORVA 2VHUA 2CLDX 1GTVA 4G5RA 3DEFA 3OFNA 2JLQA 1NJGA 1M7BA 5JSZA 4BRWA 1UEIA 2XEXA 2VBCA 5B64A 3TKLA 5AUOB 2ZJYA 4RY2A 2JIZA 1VIAA 1ANKA 3I4LA 4KBGA 1UKVY 3CRMA 3GJ5A 1KDTA 1S96A 2WWXA 4O25A 1MRNA 2Q3MA 5EXXA 2GCPA 2H18A 4FD2A 4TYWA 1N6LA 3LA6A 4DB2A 4IW3B 3SFVA 1QDEA 2RGXA 1WF3A 1VG1A 3D6TB 2OV2A 4E5UA 3K0SA 3ZD7A 4YLGA 1NMYA 5KSYA 3KJIA 5AUPB 2RGAA 5L8VA 1OH6A 4LJ7A 3CRQA 4DJTA 2QL6A 5H1YA 2V9PA 4LSGA 1XEWX 4D4LA 3TUZC 3GCGA 4YMVA 1YZUA 2FF7A 3A1TA 5AJVB 2OSBA 1W4RA 1XRJA 2ZJ5A 4MITA 4IJMA 3KTAB 4OHWA 2XZLA 1MR3F 1XNJA 1G8GA 4MA4A 2QGZA 2J59A 3W6NA 3AKDA 2XTNA 4V03A 4ZDWA 2FSGA 3ZVNA 1SKYE 4LV6A 1VG0B 2JDID 3UMFA 2O8BB 1P9WA 3C41J 3P4XA 4Z1MA 4GRAA 3TW8B 2L0XA 5D3MA 2UVQA 4JZKA 1I4DD 3SEAA 4B73A 4HLQB 4B32A 5JFGA 4AKGA 1EWRA 4EIWA 1RIFA 2JJ8A 1KK3A 4HEJA 3GLIA 3FTQA 1H8HD 2GK6A 4FW9A 5BW8A 3B1YA 3WBKA 1Y63A 3U6KA 4I99A 3NIBA 2YWEA 1VHLA 2B92A 4KXFB 4A0FA 4DUGD 3BH6A 2XGJA 4LBYA 2FE4A 1CJKC 3FKQA 1R10A 4XVQA 1P73A 4PC7A 1W7AA 1XF9A 121PA 1IXRC 1T8TA 4GL2A 2QORA 1NIPA 4JLOA 2KBEA 3U3JA 3KKQA 4RVCA 1KSJA 2Q3HA 2ZI7A 1KTVA 4XD7D 1XD9A 1Z6YA 5GVRA 4BEJA 3KB2A 5DNYB 1HQCA 2BHRA 2JGNA 1XPRA 2HJVA 5KSPA 3U44A 2ZUBA 1E2PA 3U7FB 3LDAA 3KJGA 4PZYA 2PT5A 3IHWA 3AVVA 2JASA 1AZSC 2JJ1D 1W0JA 3P4YA 2H57A 4GPTA 4W5WA 3IGFA 4I1UA 2J0UB 3QXSA 4LJ8A 1ZUNB 2AKYA 2H1LA 5J40A 1YU9A 5FUWA 1ZD1A 2ZRMA 1XBTA 1YJ5A 4P33A 4II7A 5EUQB 4HAXA 2JATA 4C0JA 2AD1A 2IX3A 1K5GA 1RYHA 2Q3FA 3IDQA 3VNUA 2JLVA 221PA 4ABYA 1SQ5A 2H17A 2BWJA 4DCUA 1UKYA 4QJ5A 2CJWA 3I73A 1R0XA 4EPTA 1N5LA 4RSGA 2P6RA 1Z3IX 3JVUA 4TLDA 4RZUA 5HZKA 4TN1A 3EIHA 4M1OA 3PXGA 3R8CA 1JJ7A 1NVUQ 1I4TD 1KNQA 4DLYA 3NHBA 3N2IA 4XSGA 5E7MA 2ZJAA 3T15A 1YZNA 3D8BA 3RSLA 3MFYA 2V1UA 1TU4A 1SKQA 4TQUS 3U7EB 1FX0A 1U94A 2B8TA 2GHIA 3DZ8A 1K8RA 5IRCD 1TTTA 4R9UC 3Q9LA 3ZS9A 1QZXA 3K0AB 1FP6A 2H16A 4LHVA 1FTNA 4UXHA 4EPXA 4ARZB 4XVRA 1E2LA 5DN6D 5LDDC 1KI9A 4A36A 1SZPA 1QHXA 1KMHA 1QRAA 4YONB 3UG6A 1AM4D 1KI1A 2W2VA 1AS0A 2UKDA 1U9IA 4JLAA 3A1UA 1XD2B 4Z8YA 3AVPA 4FWIB 3THWA 2IUTA 2PLRA 5DO9A 4DCNA 3DL0A 3QPUA 1QHSA 4PHGA 4TSFD 5KUTA 4OBEA 2NO0A 1U9IC 4Y0AA 3OEHA 3ZVLA 1XZPA 4QNRA 2QSYA 4B48A 2V4ZA 1BIFA 3PR1A 2J46A 1KIMA 2VTKA 2RHDA 3GLFE 3PENA 1AKEA 2FU5C 2V6JA 3THOA 1N2CE 2IS2A 2A7QA 1CXZA 2X2FA 2ZE5A 4D0GA 3SBEA 5JWRA 4B3FX 1SXJA 1U0JA 2IEZA 1X1RA 4NCHA 3HR7A 4HLDA 4MQBA 5JRZA 4GZLA 4RFSA 1EFCA 1YR6A 1HTWA 4UKDA 3VR1A 1T3LA 5BN3A 1Z6GA 4GP7A 3K0FB 4DXAA 3U4QB 1OH8A 1TNDA 5CIQA 1JI0A 4BFSA 5FTKA 3EW9A 4YDSA 1SXJC 3BS4A 1ZC3A 1E2FA 2WIAA 1ZUHA 5EUMA 2C78A 3W34A 3RS2A 1CJVC 4I4LA 1ZUIA 4MKHA 3R9IA 2GBLA 3X1ZA 1FNMA 1E9CA 3UMRA 1A7JA 2K5UA 3HPRA 2RGDA 1ETUA 1XXHB 3AEZA 3LNCA 2W58A 4FXPA 2VSXA 2QAGA 4LHZA 1T3HA 1JJVA 1KI2A 3K9HA 1Z2CA 2PL3A 2QE7D 1Z0JA 3BB4A 1B23P 3AKEA 3LAWA 3R8FA 1D6JA 5KTYA 2YOFA 3NDBB 1Z47A 1ESMA 1GRQA 4PHHA 2GBLC 4Q19A 1ZM4A 2FMXA 4OQNA 4GI7A 5E3HA 2IL1A 1L2TA 5SZHB 3NXSA 2ZVQX 2V1XA 5GJVC 4JLPA 3SBDA 4US2R 1M2OB 1IAQA 2G88A 1Q57A 2VP2A 1F48A 4D81A 3ZVMA 2P5SA 2QZ4A 3K9NA 1D8TA 3GFPA 1TF2A 4M9ZA 3OHMA 3VKWA 2OCBA 1L4UA 2F1HA 2F1RA 3L0OA 2ZYVX 2F3TA 3MG9A 3NC0C 4DLSA 5KSOA 2IA5A 3SQXA 1ZCAA 1P2VA 3KJHA 4ACBA 4JIMA 4A0HA 2PJZA 2C77A 2B6HA 2A78A 2WICA 3KDSE 1X3SA 2GAAA 4RD4A 1C9KA 1IY0A 3OZXA 4V0NA 3CM0A 4QGFA 2GZHA 2Z6VA 3AP1A 5B57C 1T5LA 3SI7A 2JLWA 2QTVB 4URVR 3FMFA 4M53A 4BGDA 5JSZB 1TAGA 4URWR 2B21A 2ZU6A 2P65A 4BFXA 1E2JA 4M0LA 4ZO4A 1ZD9A 3LVRE 2IWRA 4C2TA 1UFQA 2BV3A 3LVQE 5TB5A 5CB8A 1NSFA 2D74A 3PUXA 1RC8A 5DHFA 4JL5A 1NLZA 2I1VB 1QVRA 5KDDA 1WP9A 1P2TA 1D9ZA 5C2JB 4WAUA 1A2BA 1F2UA 1Z0AA 1ONBA 2D7CA 3CIOA 3QPVA 4L8GA 1ZRHA 4PO9A 5FL3A 5SZKB 4JLNA 4G0NA 2QM7A 5EZ6B 5L3VA 4Q9KA 4CYMA 5HCNA 1VYVA 2B7CA 2KJQA 2KI5A 2V8OA 4Q9LA 1I4LD 4IEEA 3KKOA 2HJGA 2JDIA 4EJSC 4AIIA 3B85A 3M0EA 3NVAA 3QOFA 4JLJA 3LQQA 2GJAA 2GAOA 4AKHA 1KO1A 3KQLA 3W8RA 1CRPA 3LD9A 1IOZA 2MMCA 2ZE7A 4DDUA 4OJQA 1W4CA 1XEXB 1GSIA 3AGPA 4U7DA 2GF9A 2VIIA 5KPDA 3GLGA 3OESA 3ZLJA 1QHHA 2G0TA 2FSIA 5E7JA 3CX8A 4DCSA 1UPTA 3UATA 5B30A 5D3MB 3SJAA 2Q9BA 3K09A 4L15A 2DFTA 4MRVA 2IXFA 3AVOA 2WIBA 5FOTA 4WXRA 4BASA 4RD0A 3GLIB 1N5KA 2YJTD 2ORWA 1Q0UA 4XD7A 4MRNA 1O87A 1MO3A 3DZDA 3HU2A 4MKIA 5FR1A 3CRVA 4MYCA 1GUAA 1HA3A 2QPAA 4CIDA 3BXZA 2YHSA 3FPAA 1D2MA 2QGNA 2ZI5A 3MLEA 1E4VA 1ZNXA 4EDHA 2ATXA 2JJ1A 3LXXA 1KHTA 5LBIA 4QGAA 1L7VC 2J7KA 1Z6TA 5H70A 3CW2A 4EPRA 1E9FA 1ZC4A 3U44B 1JECA 3A8TA 3L0PA 5EP1A 3SNHA 2HLDD 4C0AC 4E09A 4BZPA 1OLOA 1UBCA 2HT1A 3QKSA 1NBMD 4HLCA 2Q21A 4D0NA 1M7HA 2O0HA 3ASZA 5EE5B 2OUKA 2QRNA 3NBYC 4DIDA 2ZPTX 3W90A 4TTPA 1NN5A 1JXOA 4JBXA 5JBQA 3ZQJA 3PFIA 1LVGA 4JKIA 2O0KA 1E2MA 4XOIA 3OAAD 1N0UA 5KHOC 1E9RA 3K0CC 5E95A 5HKKD 1DADA 4BRUA 3QBTA 4N0DA 1HUQA 3LBNA 1IBRA 2JLXA 3LW7A 4B3DA 2AHOA 2PH1A 2CJWB 1G7CA 3LO5A 5DH9A 5EJEA 4WZ6A 3RC3A 1OKKD 4BFTA 3U60B 2BBOA 4TTQA 1U98A 1ZNWA 3M1IA 3UIEA 2HDNB 1E2HA 1JQLB 4OHZA 1D5CA 1MH1A 3VMFA 5DN6A 4NYMR 3ZIAD 1E2GA 3T5GA 1E4YA 3IBGA 4IOLA 1U81A 4HLUC 2YKGA 3WP1B 4HAUA 3DHWC 5F98A 1GZSA 4FCVA 1FX0B 1GNQA 2DHRA 2Z4SA 4OKSA 3RAPR 3NDPA 2KWIA 1GL6A 1OH5A 1G1MA 4LRWA 2GXQA 1D2NA 1CS4C 5FTNA 1AIPA 2XNDD 2ZQ5A 3KFXA 3D31A 2F9LA 4M2LA 5JMTA 4GSYA 2FFQA 5GJWC 2HEIA 1SGWA 3F3YA 3VR2A 1FMLA 4PZZA 3VHXA 2VP5A 3BB3A 1R8SA 2GVDC 2J0UA 2GRJA 4Q1DA 3V9PA 1T6NA 2GKSA 4NYJQ 3LX5A 5JS8A 1CLUA 3GP8A 1ZNYA 2WPDD 3EZFA 4O2RA 2XITA 3WMFA 2GA8A 1UEJA 3M4YA 2Z83A 4X8LA 2XJ4A 3UMSA 1CF4A 1NG9A 1G8HA 2LCFA 4PPQA 4DLZA 4JMPA 2PJRA 1NL3A 4HYYA 4HATA 3WHLA 1HT1E 4UJ3A 1BYUA 2JEOA 2J45A 2VHTA 3AV0B 8OHMA 4NCNA 1IXSB 2OLKA 1SXJB 2J7PD 3Q5DA 3GD7A 1NVXQ 4BLTA 2QQEA 4UNSA 4C0KA 4A2PA 1E1RD 3IIMA 4RFSB 4FMDF 3B13B 1YRBA 1P2SA 5KNBA 3BGWA 3T1OA 3SS8A 3THYB 1B0UA 4X8OA 1Q3HA 2GNOA 4ON9A 4PQRA 4NCJA 1U8YA 1PLJA 3VR5A 5M04A 2NO1A 1G3QA 2ZTSA 4PPNA 1CULC 1E96A 1XEFA 1S1CA 3CKLA 5CDFA 2IYWA 3EASA 1VHTA 1ZW6A 4Q1AA 2I1QA 3AP3A 3AF2A 3CLVA 4UNQA 4EPYA 1Z0FA 4KLZA 1XEWY 4S2EA 1S9DA 3A4MA 3O47A 1DS6A 1Z07A 4Z54A 3MJHA 2BKUA 4IRUB 3KB1A 1W4AA 5DI3A 1CR1A 2CXXA 1TUEA 2ZANA 1OXUA 3CWQA 3EARA 1N6IA 1NJFA 2NO7A 3BERA 2EFEB 2OAQ1 3TNFA 4NYIQ 2CL0X 4G01B 2FOLA 5HTKA 1KMQA 2WMOB 4NONA 4PHFA 1J70A 2C5LA 5FI1B 3R7WA 4ITRC 5JS7A 3KJEA 4HDCA 4KITB 3U3KA 2ZRGA 2EFHB 3TSZA 4JSYA 1CJTC 4NP6A 3QBVA 4OQXA 3U7GA 4IOKA 4CEJB 4NZYA 4DLXA 4BPBA 1KY2A 3HPQA 4JLDA 4NU0A 1FNNA 1G19A 3T35A 2WJJA 5KDLA 2MMGA 5GVSA 3EA0A 3W6OA 2GEDA 2AR7A 1YZTA 3SN6A 4PANA 4IKEA 2Z43A 2YVUA 4KFTA 5DLQC 4BLPA 4KYIB 4FMCB 3X1DA 3LH5A 1IN7A 2JLYA 1GRRA 3K0FA 1VMAA 4EFMA 2XX3A 3BC1A 1GP2A 1JR3E 1KKLA 1NF3A 5FOVA 3B7GA 2FNAA 4ZI3A 4NKRA 2DWQA 1LF0A 2QM8A 2P0EA 5IF9A 5LD2C 2N1BA 3W8NA 1Z0KA 2AK3A 2IHBA 3R9WA 1TUIA 4EPWA 3VU9B 4RCYA 3QKRA 2DY1A 2O8DA 1TF5A 5KYKA 1G6OA 4C0SA 3SR0A 5FL7A 3M6AA 3GEEA 1Q1ZA 1G4AE 1OW3B 3ECCA 1F2UB 2AK2A 2PMKA 4BQSA 2R6FA 2B8WA 3EZ2A 2F6RA 1KZ7B 2VF8A 3TRFA 1H65A 2R9VA 3A1SA 4DCTA 1N0WA 1VYUA 2OCAA 4DZZA 2NIPA 2JLRA 3H0KA 3SJCA 1N6KA 3VX3A 1XPOA 2D7DA 4JS0A 1X8JA 1COWD 4M1SA 1N6HA 4PQFA 3B1ZA 4YXWD 4ESVA 1XPUA 3FKSD 2FH5B 2BM1A 5FR2A 2A30A 4LPKA 1LV7A 1UF9A 3OEEA 3KKNA 5FPHA 4ESHA 1YQTA 3GLGB 2ONKA 3I62A 1OHHD 3IIJA 4G1UC 2FDCA 3QXJA 1QHHB 4YMSA 3IHLA 2OESA 4ASUA 2GF0A 4BUJA 1R5OA 3P26A 3AGQA 3WYFA 3QXCA 2J87A 3GEHA 4ZKEA 1XTQA 2P2LA 4HAZA 1VKJA 4IDOA 4PXAA 1G3MA 3I3SR 3LLUA 1U8ZA 3T12A 5JZVA 2PCLA 3OE7D 4B2LA 2ZJBA 5EE9A 2Q9AA 2RMKA 3TBKA 2J1LA 4D6PA 3FFBA 1XTSA 2HXSA 1YR7A 1QG4A 2GCOA 2J5XA 2Q0HA 1P75A 4CDGA 3LY5A 3PITA 1KOFA 3PUZA 2IYLD 3SQWA 2HLDA 1AS3A 3WMEA 1NBMA 4A6PA 5TARA 4TMXA 5J47A 2R8RA 1Q22A 4PO8A 2XTZA 1AK2A 4QGGA 5GJCA 4Y0VA 2GEVA 5AUQA 1V43A 1WQ1R 3NC1C 3EPJA 1KSHA 2QROA 2ZI9A 1JNYA 4CVNA 4TYNA 2GZAA 3GMTA 4TL7A 5HKKA 1T3SA 3J81k 1R5NA 1CU1A 2GTPA 3QKSB 1VECA 2QU8A 2RGCA 2ZRHA 1IXZA 2VP6A 3E70C 3KQNA 5JJIA 2WWYA 1TF7A 5EE0A 4LDJA 2F43A 3D3QA 1P3JA 3B5JA 2FEOA 3ICEA 1WBDA 2EFDB 5BQ5A 1XEXA 2EFCB 1OKKA 1XX6A 4PX9A 5JLJA 3WNBA 1OJLA 4H1UA 3UKDA 2AFHE 5DYIA 1GDDA 2ODNA 3ZIAA 1DG3A 4FI3C 2VL7A 1UBGA 4GNKA 2XB4A 4TWZA 3RYTC 5HCIA 5J4VA 2IYYA 4LV8B 5L3QA 3LWNA 2ZI4A 3BOSA 3RRYA 4A2QA 1OPXA 1VG8A 4G5GA 4BFZA 4EKDA 3SU8A 2JJ2D 1YKSA 4HUQB 4Q18A 4MGKR 4PHTA 3JZAA 3PG5A 5K8UA 1NMXA 1NY6A 3QXHA 1I2MA 4Q21A 3T5DA 2XTMA 4JSTA 5IDVA 2HYDA 2QQ0A 4C0BA 1G9XA 1DBSA 2XNDA 2ZJOA 3L8YA 2OT3B 4QOSA 4V02A 1T91A 2C03A 4P31A 4V0KA 5SZIA 3DKVA 3TJZA 1JB1A 4B44A 4TZ6A 4OJKA 2H5EA 2A5DA 4HB0A 3HP1A 2ZREA 4JJKA 3CH5A 1EFTA 4Q4AB 2O52A 5DE3A 2R6CA 3EIEA 3NEJA 4M1MA 4KV9A 1CTQA 1CRQA 1QHIA 4ACAA 1EG7A 2DFLA 3WXMA 2WPDA 1P9NA 1N5JA 1TQ4A 5AR1A 5JJLA 2FZ4A 5TVKA 1XXHE 2BDTA 1XTIA 3T1QA 4D26A 4MYHA 3WYGA 1T8UA 2VSFA 4LC1A 1PVOA 1XB2A 3AF3A 3QVVA 3VQTA 1LS6A 4XTCS 3L0IB 1UKZA 4PPGA 3C14C 2WSSA 4PAQA 1RYFA 1XTKA 1R6BX 1SHKA 2VF7A 4N3NA 5C46F 1AA9A 1DEKA 1U0HC 4CT4B 3TQFA 4LHXA 4TL6A 3E1SA 1ZYUA 2D62A 1GKUB 2GZDA 2X2EA 1TQ2A 4NH0A 5EP4A 1E1RA 3AF1A 4F7WA 3NBXX 2CCJA 3CF0A 5EP3A 4DSNA 1N0VC 2QP9X 3I92A 2JLUA 1OFTA 3PIRA 3C15C 1RFLA 3FFAA 1E9EA 3PVSA 2A3RA 4AYTA 3U6BA 4G5QA 1Q12A 4RKFA 4QC2A 2GXAA 5CYPA 621PA 1NRJB 4Q9JA 2FN4A 5C4GB 5DHAA 1S8FA 1E9SA 5JWOA 3FMPB 4M1WA 2QPOA 3BK7A 2ODBA 3E2IA 2OCPA 5G40A 2GJ8A 4OK5A 4Q9HA 4LYFA 2IEYA 2QTHA 3VR3A 4PPFA 2X1VA 1W2GA 2J3EA 3PEYA 3ZZUA 4JVNA 1J8YF 1KSFX 4XWKA 4Q4JA 4BLRA 5JI3E 2PBRA 1DAKA 2QPTA 2ZRIA 2ZRFA 5EXSA 2DR3A 4JL6A 1OB2A 2N46A 3L43A 4PFSA 3U3MA 3BH7A 4LJYA 1R8QA 421PA 1LB1B 4EQ6A 1W49A 1DG1G 2FGJA 3GLHA 2IYVA 3FYHA 2BOVA 1ZM2A 4KAXA 2IK8A 3WHKA 3SOPA 1EXMA 1DOAA 1MABA 1DAEA 721PA 5JEDA 5JI2E 1KJYA 2EFGA 1AQUA 1JQJC 3A58B 4AG6A 1II8B 3HU3A 4Q7KA 1XD8A 1SVSA 4BLQA 5A4JA 5EE1A 5DI3B 5G3YA 2G1KA 3IBYA 4L9SA 1NVVQ 2QT1A 3EWSA 1IONA 1JR3D 2XZPA 2G6BA 4Q7JB 2FFBA 2GETA 5DGXA 1XCPA 3CRW1 4JBYA 2V7QD 2LKCA 2FSFA 3R7WB 4QJ3A 4Q7LA 3BIFA 2D06A 4EAQA 3ICQB 1NSTA 5CM9C 3NEYA 4MDFA 1UDWA 3CR8A 4A1FA 4IFBA 3CBQA 1JPNA 4JVSB 2GXUA 3I8SA 3X1WA 3RC8A 4EFLA 5IK2D 3FE2A 4MGZR 3SDZA 1EX6A 1NKSA 1ZM9A 1EFRD 1P2UA 1ZIOA 1XMIA 3GJ6A 1YZKA 1N6NA 1RRFA 4KJZA 3THYA 3GLIE 4FWTA 2OO7A 4DHEA 2O8EA 4QNMA 1A1VA 4B33A 1WB9A 1GITA 4RD2A 2XSZA 3I61A 1SVKA 1T0HB 2I3BA 2QI9C 3TLXA 1VCOA 2VHQA 4L9WA 3GPLA 5F9HA 1X1SA 5GJBA 3W5JA 1IN6A 1KYIA 3QKRB 3ZJYA 4ZDKA 2IYXA 2O8DB 1CIPA 1COWA 4YDHB 1P4SA 2IYRA 4YXWA 5BYKA 1U90A 2J0VA 1T4GA 2GJSA 1G7RA 2V3CC 3PEWA 1IY1A 4I1SA 3O8DA 1FZQA 1NNEA 1KO4A 2ZITA 1G17A 2OFOA 3RS5A 2GJ9A 4QG7A 4MGIR 1HYQA 2OXRA 3WNDA 1SVMA 3Q85A 2AD5A 2YINC 3L8ZA 1I2DA 5L3SA 4OQMA 2J41A 3CX6A 1KK0A 3TMKA 3QNUA 3W6PA 1U99A 2ASEA 5J4KA 2OAP1 3O8RA 1RVDA 4AD8A 4PSAA 5CLLA 4FN5A 4NL4H 4K46A 1VCNA 2C9OA 4DSUA 5KU1A 3CRRA 1XMVA 3OE7A 3RABA 4CEJA 3CR7A 4ZV4A 2ZXUA 2CNWD 1OV4A 3QUSA 3IPXA 2ZRAA 4Q7MB 3H86A 4ZDJA 3SYLA 1ZBDA 5JRJA 4JYCA 1P5ZB 1BMFD 4BLSA 2VEDA 1KAOA 5CJ2A 3PJRA 5JECA 1E0JA 2FPLA 3TSOA 2IYZA 2F1IA 4HDQB 3O8CA 1II0A 2VH5R 4OHXA 2ZUCA 4M1KA 4Q4HA 3K70D 2OFWA 3ZQ6A 3NTUA 2NMVA 1KO5A 1Z2AA 1M34E 2GCOB 2OBMA 3CPHA 4NPHA 4DDTA 2OBNA 4QKQA 1WMSA 5DIFA 3DM5A 3VU9A 4EJSA 1K6MA 3E5HA 3LBHA 2YNMA 2GVZC 3H84A 4AYWA 4LHYA 4LUCA 1M7GA 5FPTA 3TH5A 4P4UA 3WNCA 1R7RA 3OIYA 4AURA 2QMUA 2WJGA 4LI0A 2WZQA 4QBFA 4E07A 1ZIPA 4BWYA 3F8TA 1GKYA 2W2TA 4KLNA 1IN5A 1TQDA 4F92B 2AWNA 1OH7A 2O0JA 3BFXA 5BWMA 3GEIA 2FEMA 3Q7QA 3T06B 4C2UA 1OB5A 2F43B 3MRSA 3LRPA 2XB2A 1N5IA 5HZHA 1P60A 5IHPA 2QP4A 3EX7C 3NWJA 1TU3A 2DWPA 2QNRA 1H8HA 2C99A 1JEEA 1RRCA 2CLSA 3PUVA 1T0JB 4V0MA 3P32A 4LCBA 3OIWA 2ZEJA 4XVUA 2V6IA 2X77A 5CYOA 4DUGA 3MGCA 3TVTA 2QMOA 1MT0A 4LBVA 4B2PA 5L3QB 1FP7A 1OYYA 1ZU5A 4U00A 4P0TA 3TE6A 1IY2A 3B6EA 2DWOA 1SXJE 4GFDA 4P32A 4M8NE 2A2ZA 5FUXA 4R71A 5C4MA 2BEKA 2R62A 2PX0A 3A1VA 4P4TA 3I8XA 3NBZC 1VCIA 3RRNA 3ASYA 2AL7A 3AVXA 3B60A 2WAXA 5P21A 1E0KA 1E2KA 2BBSA 4MYUA 4TMZA 3FWYA 1BO6A 5EP2A 1P61B 3HYTA 3LFUA 4CEHA 4O2LA 2OLJA 3SE0A 4DEXA 1G5TA 1SVWA 3RS4A 1DO0A 3EAQA 3EG5A 1R5BA 3V4FA 2OXCA 1TPZA 1CP2A 4BFVA 2A5GA 5EXTA 3K0CA 1U0LA 1VTKA 3PEVA 4DSOA 5KO2A 1GG2A 3UWKA 4HSEA 1KK1A 3EC1A 4TMTA 4XH9B 2G9NA 4D4KA 1S9HA 3FGNA 3CONA 3HJNA 1G16A 2G0NA 1OXTA 4LX0A 3REGA 4HZIA 1GIAA 3UWOA 2ZRJA 5JWHA 3P1JA 4RFVA 4M9SA 2NOAA 5DSZA 2CE2X 1Z08A 1EWQA 2TMKA 2ZR9A 2WWIA 2ZETA 3B82A 2LKDA 3HYRA 3X1XA 1E2DA 3CWZA 4HLUA 4URYR 4GOKA 5F3WB 1AKYA 4RD3A 1DTSA 2X19A 5FBVB 1KNXA 1PLKA 4HUQA 5FTJA 2CMKA 1NY5A 2ONJA 1TMKA 4B6EA 2OM2A 1KJZA 1GOTA 2BMEA 3C5HA 3AVTA 4A15A 4DCVA 4BFYA 2QRZA 4Q4JB 2VP0A 3AQ4A 5J4YA 3MCAA 4KI0A 1G7TA 1HT2E 2HF9A 3CX7A 2G1JA 4Q4AA 4V0LA 4O0MA 4G5SA 1SVLA 2WKQA 1EFHA 4A92A 4EQ6B 1T5IA 3GLHB 5CK5A 2WJIA 5DYGA 4NCIA 2QA5A 4TSFA 2R44A 4Q1BA 3HDTA 1OIXA 1JALA 2Q9CA 4XWOA 3RS3A 1MABB 4LWZA 1YZLA 3RWOA 4A4DA 2GILA 2H7VA 1Q20A 3BBPA 3I5XA 1P6XA 4LJ6A 1E32A 4FINA 4RD6A 2W2XA 2ZE6A 2XNSA 3WY9A 2YC4C 1GL7A 3U3RA 1OF1A 1LW7A 1Z8FA 2IYSA 4BE7B 3QY0A 2YWGA 4F4JA 1M8PA 4TTRA 2ZSDA 5IK2A 4AK9A 3FB4A 4DT1A 2JCSA 4MKGA 3TGPA 5FOUA 2SHKA 4GMDA 1EFRA 1J2JA 3QPWA 5TXGA 1TADA 4JLVA 5L3RA 4DSTA 3GLGE 3IQWA 5DISB 2F9MA 1NN0A 5CITA 5FI0B 5AUNB 4NTZA 3KQKA 4P4SA 5FUYA 1R0YA 3QEJA 4CF7A 3QE0A 4EFNA 1E79D 1G8YA 1R0WA 4HUTA 5UKDA 4IVQA 2OE2A 4V0OA 2AXNA 2O8EB 2XOKD 3ZD6A 4ZI2A 1ELOA 1W44A 4QJ4A 1DELA 2QE7A 2CCGA 2VSOA 5FTMA 5TV2A 3T61A 1ZM7A 2KB0A 2QG6A 4IDHA 2VQSA 2ZAMA 1W47A 1XJ0A 2GWHA 4F91B 2ZJ2A 2GJKA 1GRNA 4D4JA 4DLRA 1Z83A 3NBFA 2FX3A 3BORA 4TQ9A 2WWFA 3AVWA 2ZS9A 2CEAA 4M21A 1J99A 3VTKA 1ZMXA 1E9BA 4UQOA 1T9HA 2I4IA 1II8A 5FUVA 3W3ZB 2NPFA 1N6OA 5JCZA 4KODA 2BBWA 1WRBA 2DYKA 1W5TA 2QEQA 3DPUA 5FFMA 1DAGA 1XJCA 1XU4A 1G291 3IUYA 4I81A 2KBFA 3NKVA 1HQYE 3VKHA 2A5YB 2CK3D 5L3SB 5GADl 2CNWA 3LXRA 4P3YA 4YMWA 1KO7A 4YC7A 1FUKA 2C9YA 3Q8XB 1FMJA 1XDBA 1G3RA 1BMFA 4JLMA 3AKCA 6Q21A 4M9XA 2GDJA 2R2AA 1E6CA 2BMDA 2C2HA 3BE4A 5KNCA 2B7BA 1FW6A 2XAUA 4B3CA 3AF4A 4IDPA 1E1QD 4TLCA 3KQUA 2D2EA 4B34A 4M1TA 3EPHA 1US8A 1OXXK 4TMWA 4BFUA 4ILEA 2ZM5A 2HV8A 1TX4B 2WOJA 1YE8A 1DAIA 5LPNA 2ZI3A 4HI0E 4MUAA 1ZU4A 2ECKA 4YMUA 1FUUA 3QI2A 1G8PA 3NH6A 3O8BA 3WYAA 4Q4HB 4TMKA 4A0RA 3K70C 3CPEA 1DARA 2RGGA 3AB3A 2CHQA 4DDVA 4DLUA 4KU4A 2WJHA 1IN8A 1FL9A 1MO6A
chains in the Genus database with same CATH superfamily
4PN7A 3HSYA 2C7GA 5E4FA 3QKWA 4JT4A 3WLFA 1G5PA 3VOAA 1VFNA 4EJSB 1V47A 4ZIRA 1AKUA 5T4EA 2GPNA 4FX5A 2YW2A 4I66A 4LW8A 4OQDA 3T3DA 1G0OA 3KJFA 2P9HA 2H0RA 3BB1A 4RH1A 3RBXA 4DIMA 2RHJA 3PWKA 2FA9A 1UAGA 2II6A 2R1UA 2C3OA 5KYXA 3HACA 3R5SA 2YZGA 4BXOB 3ZCQA 4FYJA 5K01A 3RANA 3KSUA 1XQ6A 3FI9A 3TCKA 4CLHA 2PEZA 3A31A 4DLWA 2I2FA 1KI6A 1NNUA 2E3JA 2HA2A 5TEWA 1NOIA 1YS9A 4QATA 4JUIA 1VJ0A 3OIGA 3KPYA 3NBAA 3I9LA 1NX6A 2Z2ZA 4FMPA 3CO5A 4QBHA 1URPA 5F3RA 2AXPA 2OOSA 1LQ2A 1VPEA 3QA9A 3KEQA 4Q1CA 3EIQA 5GZ1A 4RTMA 1CUDA 1UOOA 4OATA 1AMOA 4ZKDA 2NUPB 1TRKA 2BGLA 2HOQA 2IZ5A 3AFGA 1AUQA 4ZAWA 3ZG6A 2O5EA 1UWCA 2VLIA 1MPXA 4IIEA 3UAWA 3HJAA 2IVFA 3EB9A 5G1PA 4ZXPA 4Y6GB 5TDHA 5E6SB 1CCWA 1M1NA 5G1OA 5HA5A 3PCXA 3DXXA 1Y3AA 1DU4A 2Z09A 3NNNA 1U1CA 3EXG1 1RRGA 3KAQA 7AT1A 1Y4AE 2ZAYA 5T4BA 4I5FA 4XSVA 1YDHA 3K9BA 5E6RA 3PKZA 3Q2OA 1EVQA 4KYTA 4WCVA 5I9BA 4CT5A 5IKMA 1KGDA 2AI1A 2MSCB 4RC9A 2CYCA 1DC5A 3I1FA 3JQ9A 3K5PA 1NYLA 1FYFA 1OIWA 1Z0IA 4BU0A 2ZROA 1ZCFA 3CEHA 2D5IA 1E5TA 3NDJA 3OUTA 4BTVA 5JSYA 2ODWA 1YOBA 1QTNA 3FWNA 3HGTA 4LYEA 3HN6A 4CEHB 2XYQA 1N7JA 1L3BA 3LQ1A 5CT4A 1IG3A 2IUSA 2QSZA 4HEA1 5CDFE 3JQ9C 2FPKA 4Z1OA 4YJFB 1AQYA 5G0VA 1N34B 3OU6A 1WPQA 2P2GA 2C2KA 1XF1A 4O2AA 4ZV9A 2C7OA 3LGAA 4H17A 4A7PA 4C4PA 3NOQA 3C4JA 2OV8A 5LSAA 4JSRA 3ABSB 1QB7A 2GA9A 2X0RA 4LJAA 1O4WA 2ZYWX 5HRCA 5L4NA 3K1TA 2M6SA 3P5BA 1KO8A 1NW8A 2WV9A 2G4LA 1GFWA 4HRVA 4EMBA 3VKGA 5EGSA 2IYUA 5KTOA 3LWDA 3PSAA 2ODPA 3MA0A 4BMZA 2C7VA 3HM9A 4M46A 1NDQA 4BNTA 4DWJA 3OJOA 2JAUA 2PRIA 3DTNA 3OZSA 5ALEA 4DEYA 3G82C 5FBRB 4ZICA 1P77A 3PL1A 3I04M 3LKDA 4MW7A 4HNHA 3K16A 2PMFA 5E7IA 2Z30A 4DMUB 2JGJA 4Y7CA 4FFPA 2EQBA 1HY3A 2GRAA 3H99A 1F2TA 4HGYA 3OZIA 1Z13A 4I4IA 2JK0A 2LRHA 1U9YA 4X64B 2Z56A 2YRXA 1ODCA 1PR9A 1CRWG 1EESA 1CRLA 3FVQA 2BKLA 2XRMA 4JBGA 4EGAA 5IT4A 3RLFA 2D3WA 2OV4A 1GFSA 5LA6F 1YIDA 4JBWA 4TN5A 4ETWA 5I7EA 2EU8A 2GCGA 3WGNA 3DHEA 3WMGA 3QUQA 3TZ6A 5IDQA 2XCLA 3STTA 1SB8A 1XDGA 3QG5A 4E1AA 3GBPA 2JFFA 2TECE 3NWPA 4FZRA 1XTRA 3DOEA 3T95A 4YCNA 3U9TA 1C14A 1XLWA 1Z25A 3RJZA 2Q2QA 4EF6A 5LB4A 3HK2A 3ZDZB 2H92A 4IXMA 1ZOSA 5LOVB 3DBIA 2XOXA 5AIBA 3PXAA 3HR8A 3RIYA 3R4VA 1CJCA 3HBNA 1RQXA 3A9SA 3KHUA 1JSZA 3GFGA 3OJEA 5JT1A 1B73A 2PSJA 2F4NA 3ANYB 2O20A 3LECA 4AJ9A 1GQYA 2AG6A 3ITNA 4WK2B 4F4CA 1JLKA 1F17A 1WHSB 2QJRA 2Y1DA 2ZIEA 1ZJJA 1PL0A 4QUHA 4Q1FA 1X1AA 4CF6A 4NBSA 2DU8A 2TYSB 1HDGO 3H75A 4W8HA 4E5YA 5BWOA 3LC0A 3JQEA 1PSDA 3VSCA 4KPGA 3K0BA 2PGJA 3KZKA 2DBRA 4IQ4A 3QW4B 1D0SA 4Q47A 5HCUA 4E4TA 2W2LD 2FP3A 3BFVA 2VTBA 4C03A 2EX4A 1RXCA 3L8GA 4NS1A 1E79A 3IR5A 1FSZA 2FPPA 1QO9A 4J03A 4LDNA 4QO7A 3UK6A 3HA2A 4KR2A 4DPKA 1DPFA 5FKJA 3NAZA 5GV7A 4CMGA 1FBTA 1Z62A 2Q8NA 3OC6A 3QGMA 4IMIB 1ZR2A 3LVFO 1HKHA 1Y8QB 3B6JA 3CMCO 4P4SB 3ANSA 3PB3A 4QRHA 2Q3EA 4YLYA 3C5CA 1NDUA 3KUDA 2F55A 3PF8A 1EVEA 3I9FA 1IHYA 3P0FA 4FLEA 5I9NA 1PUIA 3CIFA 3NH9A 1H8ED 2ICAA 4W5RA 3EISA 1PVVA 1G1AA 1JR4A 2R1VA 3KQVA 1CZLA 1ZOIA 3F7MA 4M8LA 3RS7A 3SZMA 3TLAA 2NYAA 1KEVA 1GXSB 1KDOA 2AN1A 3HWX1 1RE0A 5DBEX 4MV4A 3S1AA 2Z2JA 2H8KA 2X41A 2XMBA 3A6FA 1KEUA 3KL4A 4I9GA 2OFXA 2V55B 2UVDA 4YRNA 3HVUA 4OU5A 1N2BA 3DMNA 4C0LA 3FOZA 4QHYA 3QWHA 4R0NA 4RZ3A 4EMSA 1QIEA 2JIPA 3O21A 1DX4A 4R8LA 5CGQB 4DM3A 3VH3A 4F46A 4Z4HA 2DSNA 2IYEA 4GAEA 3LY8A 2EKZA 3Q7IA 4MYRA 4H3SA 2X4IA 3RYIA 5ANRB 4N40A 5K0SA 2GEFA 4JI7B 1NKVA 1RAAA 4TWIA 1K9SA 4GP6A 3V3TA 2ENUA 4MJLA 4CIXA 2Y8EA 3EMKA 2DJIA 3GT3A 3RUAA 3GCXA 4CCAA 1T36A 3KKZA 2JG3A 1OTHA 3AESA 3DKKA 2HCTA 3S6JA 4WLEA 1EVYA 1E6KA 1F8YA 2YYYA 4ITVA 4MVJI 2PT6A 2NGRA 3MMNA 4P98A 1RRKA 1V2HE 2PRJA 3EULA 3RTBA 4H0FA 3ZHSA 2CHEA 2IHVA 1C30B 3LX8A 1TFRA 4K9SA 1LLUA 3MTEA 4MV3A 3VPGA 2ASVA 5K8TA 3OLQA 2W6ID 5DN9A 4C9BA 1V48A 1C2YA 1W48A 4A26A 4B3XA 3FCXA 4M49A 4F9EA 3TOVA 4JLUA 4DY4A 1UBJS 1JYFA 1XP8A 4UASA 4NBWA 3U4GA 1LSUA 4BBJA 2PX6A 4OKIA 5K4GA 5FWXA 1BS2A 4NCKA 2UYCA 2JFVA 1SZCA 2XKJE 3KOUA 1TPYA 4ZOLA 4HFMA 3GRPA 1PQPA 2C8VA 2P6PA 3OQMA 3PVZA 4U9HS 1DBRA 4FN4A 1RKQA 4Z53A 4BVJA 3WGIA 4CI0B 1XNGA 4CEIA 1US8B 1FZTA 3NZEA 1JDVA 2IHZA 2YYZA 3RC2A 3ZY2A 3S1SA 1U28A 1IJFA 4B75A 2VNSA 4K6MA 1Z6AA 3HSSA 1MENA 1L3IA 1MNQA 2GEUA 4DRXA 2JEZA 1XNQB 3N53A 3RK1A 2G7ZA 3QK7A 4MPPA 5BN4A 3DFFA 5T6MA 4HCJA 5FHQA 3GHHA 2CNKA 5E1BA 1NN1A 2Q5JA 2GEKA 1YOVA 2ZRKA 3U49A 3T4UA 1JJIA 2ANBA 3QWIA 4XASA 4OO3A 5GMOA 2H1WA 1H0RA 3JAMA 1YVDA 2C4UA 1Q92A 4W1QA 3MAAC 5ALZA 3RGWS 3NHAA 2AH5A 5LC1A 1U28C 2YX1A 4UEWA 3V3KA 3K1ZA 2OILA 2Y92A 1L0BA 2MINB 3D5QA 4HDNB 5KYWB 5MN4A 2W83A 3QJYA 3P2OA 4MVJP 3E7WA 4Y6PA 2ZBRA 1WXGA 5AM1A 1WBBA 3WRYC 5ED0A 2ALJA 1CIVA 2YV2A 4BBAA 3STUA 1KJNA 4H0NA 3IAAA 1FQWA 2VRNA 2DBYA 2J3LA 4HZUA 3B6ZA 3IA2A 4M87A 1R6VA 4O4IB 1CR2A 1DHTA 2AG5A 5DM70 2HRZA 4LHWA 1XCGB 2AA3A 2WZBA 5JU6A 4U6NA 4D80A 2JJQA 1MG5A 4RAOA 1KKMA 2RAFA 5SICE 4EZEA 2IP1A 2VWPA 1F8XA 2FFAA 4LJ5A 2OHFA 2V54A 3MUFA 4BV2A 4TL9A 5YASA 1WA5A 2XHZA 4L2IA 4M1QA 1Y5NA 1E5LA 2EZUA 3IX7A 1UKEA 2FW7A 2NZJA 3ZDXB 4QYTA 3QLEA 2MSEB 2I3AA 2ZBGA 3T41A 1QK3A 4PC1A 4U2GA 4DM7A 4WOPA 3H1TA 1ID8A 4X1KB 3GA0A 2JLBA 2W6JD 1AS2A 3ZI0A 1MO4A 2DWCA 3OICA 2EFJA 4DPLA 3ZBPA 4HGRA 1N8NA 2WWGA 4RH3A 4Q3DA 2C97A 4JOCA 4KR6A 3ZDCA 2AOTB 4ME6A 5CU7A 1IH8A 3UGKA 3CNLA 3QXXA 2ZXFA 4OMFG 4RMJA 2Q62A 3WBJA 4C3VA 1BEEA 1PJ3A 3T0GA 2Q6KA 4Z4QA 4K9MA 3R75A 2WP8J 1F6WA 2NTVA 3ELDA 4HDMB 4L4RA 2IHYA 4D0LB 3BZUA 5CNJA 3F74A 2G4CA 3BXOA 3EH2A 3JVVA 5IVDA 4X65B 4ZT2A 2CV0A 3QENA 5C35A 1HDIA 1MBZA 4YAWA 1T3TA 3ZLBA 1IQPA 2ECOA 5LM3A 4G3XA 4BB6A 5B2FA 4J7XA 2CLIB 1TKBA 3C6XA 1XDDA 3C3YA 3GV0A 1IMJA 2IQ5A 3KV3O 4LY0A 3SXUB 3U2QA 1Q3TA 2CHVA 1BQ4A 1CBUA 1XZDA 1YUMA 3E8MA 3QLUA 5CLIA 3UQZA 3PV0A 3AUFA 5ELXA 3HDYA 2IS1A 1JB9A 4HX2A 3LUCA 3IP1A 5FPYA 1CKEA 3QQ5A 1OLUA 2YOHA 1FFHA 2FTKE 3JQCA 1VB5A 1SUIA 1WKVA 5A5FA 1ACMA 3N1UA 3PE6A 3GLHE 3QH4A 2BI7A 4CG0A 2BEUB 3A4NA 1TZ2A 2FZLA 2XVZA 1TQ6A 4P7KA 4DIKA 4ER7A 2V58A 2VA9A 3QLUC 2Y2UA 1YFLA 1QGOA 5EJ7A 1MC5A 2YXEA 2GM4A 4LI3X 2ZR0A 1DXYA 2A5JA 3RWMB 2R5FA 4D79A 2ANCA 2RBGA 2VK4A 4I1VA 4ZOEA 3DMPA 4BO0A 1RTKA 1V0JA 2PLNA 4X45A 4GVLA 5TY0A 3BD7A 2QUAA 2EATA 2FR1A 3F6YA 3IBTA 2I3DA 3PDWA 3IDSA 1EFUA 3TZLA 2R97A 3GJ7A 4NNJA 1QF9A 2IP2A 5BMOA 2NN3C 2E5LB 3R7FA 2XT9A 1WZNA 3FYUA 1R9JA 3T1VA 3U9SA 2CDCA 1NWCA 1OE0A 1WKBA 2BT4A 3CKMA 3DTVD 3GY0A 1TUGA 3D3WB 4KFRA 4KIFA 2MDTA 1E9AA 3PU6A 2QW1A 3C4VA 4TKVA 5TQ2B 4F4IA 1DJOA 5FOSA 3OCVA 2EKPA 3V1KA 5FYDA 1A9PA 2JFOA 1TO2E 3GRFA 4KYUA 5T8KA 3RIHA 4Q5IA 3UA3A 3O2SB 3ZGYA 1XE3A 3EWNA 3CF6R 5ALJA 1P2DA 3SJZA 2FAXA 2CV2A 5BYAA 3I4FA 3OOYA 4KFUA 4XYMA 2FXIA 3DMDA 1ESCA 2QN8A 3FYUC 3JRNA 4LZZA 4URUR 4WMLA 3R7LA 3EZ7A 3SEQA 2EX1A 3Q7PA 4QL3A 3IQIX 2B3TA 4IUYA 1M54A 3UMBA 4F7DA 2ZS7A 4IZHA 4I5EA 1RBQA 3PRYA 3LYUA 2PBLA 4WV3A 3QF7A 3KSMA 4EBFA 4J1TA 3RHTA 2D1RA 3BD6A 2MSNA 5EZYA 3AUUA 2HMTA 4IAOA 2ZSHA 3MPOA 1TAHA 3FVRA 3NX4A 4RA9B 4E5SA 2EERA 2EKDA 3QU7A 4MROA 1CUZA 1JA0A 3NASA 3MRTA 4XUDA 1NC3A 3AOGA 5CFZA 2AMFA 3G2QA 4O4HB 1V1MA 2B9VA 2CXUA 1Q1AA 3EEQA 3SHFA 2WU3A 3DL7A 2FW9A 4B35A 1TYZA 4W5NA 1NW7A 1RJWA 3CC8A 4FUTA 3S2EA 1JDNA 1EXWA 4S1OA 4PCVA 1BS9A 1FSGA 4XB2A 7YASA 3THXB 2RHMA 4BO4A 3UPUA 4Z2YA 1HWYA 4UAGA 3CF2A 1P3DA 4JZYA 4L4ZA 3NHSA 4XSHA 2G3YA 3LUPA 3N9IA 2XVYA 3P0JA 4RMNA 2VK8A 4AO7A 4ZN6A 2XBLA 2XNHA 4LZNA 4GQBA 1VJ1A 2VAVA 3UUEA 1HDCA 4UNRA 1JDSA 2GFHA 1ODFA 3UW1A 4HVTA 2PY6A 4OM8A 5BMVF 2OR3A 4D8XA 4KFSA 2XT6A 5LZ5A 4LBZA 5CR9A 4CV3A 2DCMA 3VOTA 4YYEA 5JAHA 1ZGBA 2M1ZA 3OWHA 4BQNA 2JCGA 1J0DA 1OILA 1J7KA 1DJLA 5CLJA 5T67A 1WCV1 2H6EA 3A37A 5C5EA 1PZNA 2E9SA 2GLXA 3EUAA 4P1ZA 4JXZA 2QR2A 4AMUA 1Z7BA 5H3CA 1VKNA 4JVMA 5FBHA 1F8FA 1THMA 2J5BA 1XU7A 3CPSA 3LKVA 4IXNA 5EGNA 4F06A 4DGSA 1GVHA 5FBZA 3EGOA 4UU7A 2VP4A 2GPTA 1QIJA 2LDXA 1FEZA 2QYTA 2YV5A 4C07A 3TGLA 3R7AA 2A0XA 1WZCA 1T1IA 1BWSA 5LJIA 4NAVA 2O8BA 2JFYA 4RK4A 2WD8A 3K7EA 5FRDA 1GNTA 4GICA 1FJXA 3TW8A 3VH2A 2M9MA 3O3MB 4UTRA 3CNQS 3ZHRA 1WKCA 2ZJ1A 5FXMA 4UM9B 1I33A 1MAWA 1SWWA 4EW3A 1KP9A 2ZIZA 1X77A 4XIYA 5LZ4A 1E4OA 3LF1A 4MP8A 2R1TA 2CFSA 2B1QA 2CXTA 2PRZA 2RHLA 5KOYA 1RHQA 1KAGA 3PICA 4WESB 1ZWKA 2AN9A 2VJCA 4H3HB 1QE0A 2CLCX 3A04A 3ZGZA 2HU7A 3H5WA 5FIUA 1A82A 2EYQA 4F93B 1W0KA 2POQX 3DLAA 4Z1MD 1XCMA 4IHJF 1B14A 4OKNA 1QQTA 1AA6A 4WE3A 4UCFA 3RFVA 2Z1MA 2OHVA 4OJYA 1BA3A 1DEAA 1R6AA 1S3GA 1ND5A 1XAIA 4C0QC 1RPZA 1FU7A 3QTLA 3HGQA 1EBUA 3DOJA 3P5SA 3QLVC 4B74A 2EG9A 4FMCF 2HRRA 2Q6LA 4JOSA 2KE5A 1FOEB 3G9QA 1UBTS 4JJ6A 4KXYA 3ND8A 4XJXA 3IKTA 4PC2A 1ZGZA 1USVA 2BDUA 5BUSA 4I9FA 1J8MF 4XEUA 4J0IA 2QMHA 3VHLB 4WVLA 3I01A 1WJGA 2YWJA 4QO8A 3FJOA 4IGAA 1H4QA 4OI0A 5CLQA 5TGDA 3NHRA 3L40A 4MRRA 1ORHA 4LS3A 2RKOA 2AKAB 4LY3A 1LPMA 2XV1A 3U81A 1FYDA 1VBKA 1VRVA 5AVZA 1AX9A 1RZ3A 3G8DA 4NOKA 5REQA 5SZJA 4V0ME 2IF2A 4LRSB 3THWB 2Q6TA 2WWRA 3L79A 1J6UA 5CNIA 2JFZA 1T5HX 1RPJA 1ZM3A 2QV7A 2VHCA 3ED1A 1R4ZA 1LW6E 4K6CA 4IIJF 1Y6QA 3PDJA 4JYZA 2RHBA 4G97A 2QZ9A 1YRAA 4ZO8A 3N8DA 1ADFA 1U4NA 4QEZA 1AMNA 3H2YA 1VZ3A 2LUOA 1Z6PA 3HGMA 4TQAA 5B3JA 2ZAGA 3PQCA 5F64A 3TN7A 3IJPA 5BWNA 1JH8A 2IBMA 4M1YA 5KWEA 3N2LA 4IJ6A 1UAAA 4CMHA 1NVGA 4X44A 1NVAA 2G8LA 1OXMA 4DDWA 1B1AA 3DTYA 4YUYA 3F73A 1LCIA 3FUWA 1N3YA 1EHCA 3GLSA 1RLMA 1CS0A 1AU9A 3UAZA 1SEVA 3DE4X 3MAGA 4KQFA 4D6YA 2XCTB 2VJPA 5EWJB 2B82A 3JARB 1JKMA 1UBRS 3L6OO 1UPXA 4RVOA 3U1TA 5K45A 4Z9FA 4J3FA 5KKAA 1M1XB 1E94E 2B78A 3I28A 2Y1XA 3L8MA 3WVNA 4YDQA 3TG2A 3CUEF 5KSZA 1BOFA 2QRPA 4YJ3B 2AX4A 3K9GA 1ZD5A 4BQPA 4ZCMA 4FBMA 3OE1A 4IIGA 1MQSA 3SK0A 2HMSA 4HX9A 2J32A 1WXDA 4QPJC 3ZZTA 2QAGB 5IZCC 1FPMA 3PUHA 2ZWPA 3QE3A 2FJPA 2XCRB 2PA3A 4KI7A 4A2CA 2HPVA 1QBKC 3IMCA 4JLKA 4KMSA 4B85A 1RYYA 2A0FA 3GVIA 3ZI7A 4PX3A 4PN3A 1CRZA 2VHJA 1A4IA 2V59A 2ZK7A 3L77A 4I55A 5ARCA 2WQ7A 4IIUA 2ZSJA 4NENA 3VKUA 3GARA 1H2ZA 3NM6B 3TB4A 1H9AA 4D46A 2PJUA 3H9GA 2YTZA 4X8MA 1PS9A 1AHIA 1ZINA 1NI3A 3MILA 4I50B 1UBEA 1PV4A 4OHFA 4AY2A 4JI1B 1K4MA 2YIVX 4BVKA 3R9XA 2QMEA 4WZAE 2AYZA 5AK0A 1NVDA 3JQDA 1F6DA 1V9LA 3CLUC 3LGXA 4RGVA 4XQGA 3EXHC 1NXQA 5DK6A 4BJ1A 4YCCA 1CY8A 2W6QA 4AG5A 3R76A 1GAJA 1TGYA 1ZP6A 1Z4OA 1FE8A 1FA9A 2B1RA 3KSBC 1TTPB 1L7QA 4G84A 1M8KA 4OP2A 3F98A 4J43A 4PYOA 4GLOA 3RNLA 5F1KA 3IAXA 3CISA 5G41A 2IYNA 1YVUA 2FLVA 1E1YA 1HTBA 1PNOA 1SC6A 2V4MA 2JLZA 1W36B 1QP7A 3ICVA 5D3KA 2O7RA 3OQOA 1WD5A 2FZVA 5AM0A 1X74A 4XTRA 4YP6A 3EPLA 1MOSA 5DBFA 3BJIC 2G06A 5B2ZA 5KKNB 5L45A 3U4QA 5EUBA 4CM4B 2QBYA 3V48A 2PEYA 3WLRA 1PJRA 4OK3A 4U5QA 2BGKA 1A72A 2VRBA 1OFHA 2XUOA 2J67A 2I8LA 3GI1A 4YBZA 3DQZA 4X6YA 4A8JA 1E7SA 2AZDA 2X1MA 2V7VA 3H4VA 4DUPA 4ZCIA 3DO8A 1OC2A 4MLCA 5J1SB 1V3UA 3ZYCA 1GGEA 4WKOA 2V7BA 4OY3A 4DL9A 2PO5A 1DUSA 2AQKA 4C4TA 3NANA 4ZVKA 4L76A 4DV0B 1ACJA 1W25A 3QFSA 5KVAA 3MSXA 3D6VA 3TK1A 4R98A 3N70A 1N1GA 2X15A 1DAHA 3BAFA 2F3RA 3EF3A 1AGNA 2P4EA 2XHEA 3K6JA 2IF0A 4M38A 3EMBA 2JKVA 4TTIA 3DZGA 3L8FA 1G7SA 2XECA 1OZHA 2CLMB 2DM6A 1YZGA 3NBUA 3RU3A 3CZ5A 1L4BA 3OX2A 1L5YA 3RHFA 1E99A 3WKEA 4E5DA 3JVIA 4W5HA 2WZCA 3B3GA 3K73O 1NW9B 2D1FA 1SUWA 3DDCA 2PPVA 3CW8X 3EDYA 1TO1E 2HM7A 2WYUA 1M2OA 3KXDA 3R09A 4IDNA 4DNPA 4URXR 3B7WA 3Q7TA 4UTVA 4LQ4A 1H94A 3C6ZA 4XZ3A 1JU3A 2PV7A 4BGVA 2WYIA 1QCZA 1FYWA 4KO1S 4XWYA 5FWYA 1BXGA 1B3RA 4JROA 3HXPA 2BH2A 1VBMA 4ECEA 5MFZA 1W75A 4JL8A 4INJA 4CQMD 4RKEA 4BV3A 2HR1A 1F4PA 5LQSA 1DI0A 1AQNA 1E98A 1WXQA 1YCHA 2WWHA 4R8SA 4C76A 4K0RA 5A3QA 4XIGS 4EZBA 1JAIA 1V8ZA 4AJKA 2DPXA 2B4TO 5GONB 2GARA 3ZJ5A 2YN4A 4G5RA 2VJAA 5ULLA 1OI7A 3OFNA 3LX4A 1VMIA 1ISRA 1W34A 2XEXA 3IUPA 5B64A 1VCHA 4LGCA 4LEIA 5JS2A 5IJ9A 2B34A 2ZJYA 2JIZA 1EK6A 2XRYA 3NYQA 2YDXA 4EKYA 1JQ5A 2OZVA 4V2UA 3UHFA 4RZSA 4KBGA 2XIJA 4NVRA 3RU7A 1MX5A 4UW9A 3ETHA 3PEEA 2NU9B 3RFTA 3GJ5A 1WZUA 2WWXA 1J0CA 1S96A 1VBNA 1GT91 1MRNA 1UFOA 3A4YA 3KOXA 4O25A 3UMGA 1K8QA 1XA4A 5KSWB 4DB2A 1MX3A 3BEOA 3SFVA 1V5IA 1TM5E 4QBKA 4TT8A 3K0SA 2OV2A 3D9QX 3EY4A 3ZD7A 3HY4A 3FFTA 4WBXC 4WXYB 5DXFA 2F8TA 3S44A 2NXJA 1Z9BA 3SKVA 1AC5A 2B4KA 3EZYA 1OH6A 1I3MA 2RK4A 4LJ7A 4EY6A 3M6VA 2WYWA 2W2PA 4DJTA 1B8OA 2QL6A 3IQGX 4LSGA 3F1KA 5HF6A 3PNLA 3WSWA 4BP1A 2FF7A 2I76A 1C7EA 5KVSA 1NVKA 5FWDA 1CQJB 3FDFA 2AJBA 4ZYYA 2D5CA 3FR7A 3C6BA 1A98A 1DKLA 1ZKMA 2J59A 2XTNA 3K30A 1T9BA 1U4SA 4FFBA 4YS6A 4LV6A 4IMRA 5CXQA 1M1ZA 4BKQA 1FUIA 1SCNE 1VG0B 2JDID 3TMYA 1U3CA 3IVRA 4O1HA 1YR1A 2HPHA 3UJ3X 1I1HA 4RHEA 5CT9A 3V6LA 5D3MA 1TT5A 3PCTA 2B0CA 1K9VF 2DPLA 4K3VA 3IAUA 5IH3A 1C7QA 3JQPA 1R6XA 2HWYA 3SEAA 4ZK2A 1W30A 5BSWA 3UW3A 1XFDA 4ZVNA 1X13A 1V5EA 2ZG6A 3L0BA 1O9GA 4HEJA 1WG8A 3C6QA 1L4KA 3UUFA 2Q5IA 3JQGB 3FTQA 3EMVA 3KZNA 4HR7A 4JH0A 1D0VA 3BKWA 1RNLA 3KQYA 3U6KA 4I99A 4ARIA 1Z8DA 1RWBA 2B92A 2VT6A 4KXFB 4PV7A 2O3JA 4GMHA 2XBUA 4BWFB 1YAHA 2J5RA 3GN2A 4ZEOA 4C4XA 5KX5B 1QB8A 2GK4A 3FKQA 1CJKC 2OQ2A 4LBYA 1QE3A 2IZOA 2VZ9A 1KYZA 121PA 1IXRC 5FADA 1RZVA 5C52B 4RVCA 4R1MA 5F1YA 4ZVUA 2VHWA 4F2PA 1FIUA 3ONDA 1A7KA 3FSGA 3ILSA 1XD9A 1JTEA 4ECAA 3HEBA 3KB2A 1CB7A 4J76A 2ZBDA 2PMEA 2ZBUA 4Z0PA 5KSPA 2JCVA 3K6SA 1E2PA 4YJGA 2Y6UA 1TVKA 3K0HA 4ZVTA 3KJGA 2XA2A 3D7LA 2PT5A 1DCTA 3AVVA 3GVXA 2E4WA 1AZSC 4L95C 4G1CA 2FPGB 4WH0A 1W0JA 2HU8A 3P4YA 4NXMB 1T0BA 2I6UA 2AE2A 1XDZA 2RI1A 3KWMA 4GPTA 4I1UA 4U1RA 5GTDA 4RJIA 3VZDA 4K9KA 2IKQA 2HK8A 3PQ6A 2YHAA 5LQMA 3AB8A 3NGLA 2J4DA 5FUWA 2Q8QA 3BG5A 3NRBA 1YUBA 3D8HA 1GAEO 1MA3A 1YJ5A 3PC7A 4P33A 2Z8YA 3KSRA 2ZJ6A 4HAXA 4AG3A 5LYJF 5A4KA 2AD1A 1RQ2A 1XZJA 1K3FA 2DKOA 2AUTA 4AZ3A 3DXYA 1MB4A 1U9JA 3NV9A 4IFIA 3H13A 1V11A 1B3BA 1ULZA 1L5QA 3OPVA 4MWBA 1YI0A 4ZT6A 3WLIA 3ZW9A 1UKYA 1VHDA 4YALA 3SQOA 1UMBB 3WRWA 5J43A 3P2MA 2EW2A 3I73A 3LWZA 4G85A 4RIEA 1Q7BA 1OWPA 4RSGA 2GHRA 1JVSA 2A4MA 1FCJA 4TLDA 1EKXA 4BB9A 4UM8B 3DEZA 2WTNA 4NE7A 5H5JA 3X1KA 1YDEA 1GD1O 2QXYA 2WE8A 4M1OA 3OQ6A 4MQFB 3GDFA 4ZWNA 3R8CA 4DBZA 3L1HA 2FUEA 4ENQA 1JJ7A 1NVUQ 4EKGA 1KNQA 1HT0A 4DLYA 1JHUA 3CB2A 2I2WA 3WLQA 3T15A 2ZJAA 3K2QA 3EF1A 1VBFA 1D4OA 1YGYA 3QVOA 2ON6A 3VKFA 3RSCA 3RSLA 1CZRA 1SKQA 3OKPA 4B9AA 4CU2A 3U7EB 2XNJA 1WCXA 2HQRA 4GXQA 1CFJA 1OWMA 4W9NA 5IRCD 3DAFA 3DHYA 2X6TA 3ZS9A 5KB3A 1Z2PX 1QZXA 2R8ZA 1FP6A 4XRGA 2PMCA 4EPXA 1C3OA 5DN6D 4KPYA 5E38A 1KI9A 2F64A 1SZPA 1QHXA 1H6DA 1KMHA 3HB7A 4UFPA 1AM4D 2X76A 2W2VA 4DXHA 2NYUA 5C32A 2UKDA 1GT6A 3ACDA 5I7RA 4GPEA 5HJ7A 5KOHA 3TCNA 3ZNOA 4QPCA 2BFBB 3RSFA 5DTQA 1V6AA 2AJCA 4WXEA 3G2NA 3A11A 4XCQA 1SKBA 3AVPA 4GI5A 5F7ZA 1M2VB 1TQ8A 3O4FA 2YXLA 5ADVA 2PLRA 5DO9A 5DHPA 5DEOA 1QRSA 2PL9A 2NVUA 3DL0A 4PHGA 4DCNA 5BV0A 3GRKA 3Q40A 1RXIA 4HTFB 1GAQA 2X3YA 1UK7A 5C3UA 3P9PA 4EVIA 5JVDF 1GUDA 1T4BA 1KA9H 2OENG 1XZPA 1XXLA 1YRLA 2KHZA 4EHKA 1THGA 4ANFA 3PR1A 2J46A 1KIMA 4JEMA 2RHDA 4FOLA 5EJIA 1PV1A 2C4KA 2W8ZA 2OO3A 2ZB2A 3P0IA 4FYKA 1RVV1 3MT8A 2WINI 3GZJA 2FU5C 3RFUA 2LD4A 3FETA 2R8OA 2NXWA 2A7QA 1CXZA 4JJFA 1JZTA 2ZE5A 3HL0A 4D0GA 3LT4A 3JVDA 5JWRA 4B3FX 3D4LA 3ZLUA 4FM9A 1N7HA 2Q8PA 4IV5A 5B4UA 4I9UA 3WRXA 4RX1A 4EYQA 5ES4B 1KWKA 5T7BA 4KUHA 1HTWA 1NR5A 1GZVA 3OPQA 5BN3A 2Q5QA 1I8TA 1N1EA 2GN0A 1YQUA 1I6KA 3NTXA 4BVBA 1JI0A 1NQVA 2QL7A 3GDHA 3O1JC 5FTKA 1XRSB 3E15A 3SSMA 1JV2B 3HRHA 2I4MA 4TXLA 1TC1A 1E2FA 2WIAA 1ZUHA 2YBDA 4J0EA 2JGRA 2VPQA 2NSYA 5AW0A 1JEYB 3K94A 1KZ6A 5ABPA 2PAFA 5EJ8A 1E9CA 3T3HA 4UQLA 4L73A 1QH1A 3RVKA 4BVAA 1MXFA 2IX9A 3GR6A 1XXHB 5CNKA 3ZCTA 2NMVA 4N8EA 1UDBA 2VSXA 5H82A 2AZMA 1T3HA 5TVGA 1A7UA 3WYCA 2CMGA 3QYPA 3FUCA 5D86A 1B23P 3UJBA 1M83A 1TM3E 3ZR4B 1I9CA 1Z47A 2AOXA 4ZCQA 1LA2A 1E7RA 1HFEL 5HYVA 4MR9A 1J4AA 3AB7A 3TOCA 4OQNA 4ZZ0A 4F97A 4GI7A 5I51A 5E3HA 2IL1A 1NPTO 4RHXA 3HCOA 3ER6A 3VR0A 4I46A 1FTWA 4NNPA 2ZVQX 1OZFA 1V6SA 3PJFA 1LGYA 4J1SA 4QPPA 3W05A 3M5PA 1C5KA 1IAQA 3LPLA 2PD3A 3EAGA 2P5SA 3K9NA 1ZK0A 3E82A 2J9FB 3GFPA 3JPYA 3OHMA 4FYVA 5D6NA 3IVXA 3RRBA 5BR7A 3G9UA 1N78A 1Z0UA 4D9MA 2ZYVX 3MG9A 4P58A 3TEMA 2QM3A 3I0ZA 1JEOA 1P2VA 1PGNA 1TTQB 2ADFA 3LHIA 5HQJA 4A0HA 4C3UA 2B6HA 3RD5A 3GUUA 1YRYE 1BU5A 2G76A 3FPGA 3KDSE 1X3SA 3IESA 4PS1A 5KJCA 4RABA 5KTTA 4V0NA 3CM0A 4QGFA 1PTKA 2R5WA 3AP1A 5DLDA 5J58A 3EEYA 3BCRA 2A9QA 3SI7A 3S8EA 2QTVB 4BP8A 2ZSUA 1KJIA 4M53A 3UAOA 5JSZB 1A8PA 2AYXA 3KKLA 5AM5A 1DTWA 4OIMA 4RK6A 1OAOA 1T2NA 3LVRE 3OLZA 2WSIA 4CCWA 1BJTA 4EELA 4C2TA 2I4NA 4OSOA 5CA1F 1BXKA 1NSFA 4H7JA 4QFBA 5DWVA 4C4RA 1QVRA 3HLYA 1O2DA 1WP9A 2FDXA 3GUYA 2ZZNA 3IEMA 3R0XA 1A2BA 1UEXC 1OI2A 4AIIA 2FMTA 1SUDA 2I71A 3LQ4A 3GXBA 3WIDA 3OUZA 1OAOC 2FZKA 4ARAA 1NW5A 1RHMA 2O5CA 3IXLA 2Y9MB 2PS1A 3D7KA 4L6CA 5EIWA 2AFRA 2B7CA 4JB2A 2EKLA 4DMMA 2KJQA 3ANMA 4UCXA 2KI5A 2JGLA 2Y1WA 2DUWA 4WTOA 3QE4A 3REQB 1BDBA 3M0EA 2GH1A 5JALA 3LQQA 1PW7A 1ZA1A 2GJAA 1Y4ZA 2GAOA 5CH5A 3RSHA 2G5PA 4PICA 3T1NA 4AKHA 2Q27A 1CRPA 3LD9A 3GLTA 1PWZA 2GEJA 4E14A 1IOZA 3QEAZ 3FFXA 2PKRA 1XQYA 1KH2A 4BQRA 2FN8A 2CXQA 1N2HA 1XEXB 3OPYI 4BO7A 1PZGA 1GSIA 1XZGA 1AKVA 2GF9A 2JGIA 2NZVG 2PZMA 4L74A 1QH0A 4MPDA 4RK0A 5LZ8A 5GWXA 4BX9A 1VZ2A 1M6HA 5EXEA 4MHOA 1SBIA 2FSIA 3WBBA 3LPAA 3CX8A 1EMDA 3I58A 1R4NA 1UPTA 4JJ4A 4MEJA 4XX0A 3TOZA 1FYXA 1GPBA 2JAWA 1N4AA 1YZFA 4RSHA 2Q9BA 1XKXA 2J6CA 3KZOA 2DFTA 3CLTC 1WVMA 4YT8A 3TRDA 3TI7A 1A8QA 4WERA 3LZCA 3S55A 1G60A 4MQLA 1B0PA 5KC8A 3OM9A 2OD7A 3A6LA 4RD0A 3GLIB 2YJTD 1XVUA 1X0XA 2AR9A 2VP3A 4FIZA 2YHIB 2J4CA 4U2BA 4DE5A 1R4MB 2P2DA 1G8SA 1Q0UA 4XD7A 4Z4FA 1K27A 1O87A 3HYNA 1MO3A 1P0PA 3DGFC 4REQB 5IN5A 1L5KA 3S40A 2PYIA 2HMYB 1GUAA 1HA3A 2VDNB 2XA1A 3Q0EA 4R54A 3OE4A 4UREA 4CIDA 3ZDBA 2VDUE 1EP2B 1ZNXA 4FOSA 3T94A 4EDHA 3PSHA 3KZCA 4KIGA 4RIIA 3EG9A 1H2AS 1EGVB 1NULA 3H2IA 5PNTA 4AO6A 1MJFA 3WS7A 2AC4A 3CCBA 3LSTA 1MHTA 2AJ8A 4MARA 1R18A 5DTMA 1O9BA 4EPRA 1YNSA 1E5XA 5AKEA 3U44B 1JECA 1NNI1 2Q5OA 5LUAA 3A8TA 4BJHB 2MTBA 2HLDD 2BTOA 4ZAFA 4IKPA 4YP7A 4IIDA 4TVKA 3SNHA 3TZQA 2HT1A 3BMCA 3KU1A 3ZNPA 3WNZA 1SUEA 1NBMD 2Q21A 1XN1A 1NUTA 1B42A 1UJ4A 2O0HA 2D0OB 3EMDA 1SBYA 4IXWA 2QLLA 4AY6A 1AUPA 3O7MA 3NOOA 2AZXA 2QRNA 4E94A 4INAA 3W90A 1NN5A 1E8MA 1SXHA 5KQMA 5CHYA 3ZQJA 1QBGA 3KU4A