1F2UB

Crystal structure of rad50 abc-atpase
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
145
structure length
145
Chain Sequence
ALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAADHVIRISLENGSSKVEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords RAD50 ABC-ATPASE
publication title Structural biology of Rad50 ATPase: ATP-driven conformational control in DNA double-strand break repair and the ABC-ATPase superfamily.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 35
structure length 145
sequence length 145
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1f2uB00
1XTSA 1V43A 2IYZA 2YNMA 4JT4A 5TY0A 3AVWA 2ZJ5A 3GD7A 4F92B 4M8NE 5G3YA 3NXSA 3FMPB 1MKYA 1XXHB 2WAYA 5DYGA 2J45A 2WJJA 4L9WA 1J8YF 3EIQA 4CEIB 4C7OB 1IN5A 3RRZA 1ZNWA 3FMFA 5KNBA 3CBQA 1G3QA 5KSOA 2L0XA 3QKRA 3GCGA 1N3BA 3EZ7A 2YHSA 1N6KA 3DZDA 4OQMA 3SBDA 1U9IC 3MWKA 3ZDQA 1W5SA 1VCMA 4TQAA 1F2TB 3CPHA 1SKQA 1QBKC 2JGNA 4Q4HB 4WXPA 3K09C 3VX3A 3V9PA 1VMAA 2TMKA 4GZMA 4BFXA 4DUGA 2ZM5A 4MITA 4FD2A 2ZEJA 1FP7A 1H8HA 3LO5A 2IHBA 4MGIR 4Q66C 1QHHB 5FFMA 1VKJA 3KZ1E 2FFQA 3LFUA 3SR0A 3NHAA 2J1LA 4H1VA 4IDQA 1JXOA 2AD5A 3GP8A 3GLHE 2YJTD 3MAAC 3CPJB 4XWAA 5J4HA 5JRZA 2OBNA 4LSGA 4B33A 3FMOB 2H16A 1A5TA 4MA4A 4EPRA 2MSEB 1ZU4A 2P2LA 1TTTA 1XD2A 1NBMD 3CRRA 4YMUA 1T5LA 4CEHA 4XD7D 4ZDIA 1E2LA 2FG5A 4A36A 1ZNYA 4A0GA 1E0JA 4UXJA 3SDZA 3MD0A 4IOKA 1XNJA 1E2FA 4MGKR 1EFCA 3SYKA 1Z83A 1AA9A 1U8ZA 4HDQB 2CCGA 3D31A 4DLYA 4ILEA 3U60B 2V4ZA 2ZSFA 3OHMA 4PQYA 5HZHA 4GMXA 4ON9A 1U94A 421PA 1OKKA 1W0JA 4GT1A 4NH0A 2ZE5A 1Z0DA 4HB0A 1XZQA 2NMVA 4H1UA 5DGXA 3HP1A 2IS2A 1J2JA 3HU3A 2ZRPA 3B85A 5E7IA 2VPPA 4DSTA 1I2DA 4KITB 1UBCA 4LUCA 1U81A 2H8KA 4DLUA 1LB1B 2HUPA 3ADCA 2PJRA 1E9CA 4EPVA 3MCAA 1KO8A 4IFEA 5DLQC 5H8WA 4KFSA 3EZFA 3UANA 2OLKA 3QJYA 1G64A 1IOZA 1XMJA 1R0XA 2QSZA 4BUJA 3ZVLA 2ERYA 4IXNA 4NHOA 3OF5A 1X8LA 2Q0HA 4S35A 4LYHA 1GILA 2Z83A 4I4LA 3NBYC 2NO7A 3K0AB 4QGGA 2PZEA 1FNNA 3RHFA 2CDNA 3EC2A 1E79D 5JWRA 3TUJC 2PJZA 5HE8A 3EWSA 4TL7A 1PUJA 2ZYTX 3W6OA 1KK1A 2YV5A 1CBUA 3I61A 2NTYC 4OHXA 4RZXA 4B34A 1Q1BA 2F9LA 4MUBA 5CYOA 2QTFA 3FFBA 2D4HA 1W36C 1WDTA 2HT6A 1O87A 1S0UA 4YXWA 2OFXA 4GMDA 5E7JA 1CULC 3TUIC 4D80A 3M1IA 3ASZA 4Q47A 2PLRA 3KJEA 1NBME 4KVAA 2HYDA 3RDPA 3TAUA 1N5KA 1ZAKA 3B6EA 2ZS8A 3IBGA 4KBFA 1CKEA 3R20A 1Q1EA 3PUXA 5G40A 1M8PA 5E7MA 3GJ4A 5JJLA 2C9OA 2ZQ5A 4PAMA 4TLCA 1GRNA 1KDPA 2C95A 1E2NA 1G3RA 3S1AB 2BIFA 3LWNA 3MG9A 4FI3C 4POAA 5DI3A 2G9NA 5JS7A 4Q01A 2D3WA 3DEFA 4X8OA 1D2MA 1QHGA 2VHQA 4C0JA 1CJTC 1H8ED 4JVMA 1CTQA 2QE7A 1KO1A 2Z43A 2QPAA 2A9KA 1NVXQ 3SHWA 1S3GA 1KY2A 4ZKDA 2P6NA 2QUZA 1G3MA 1W2HA 3HDTA 4PSKA 1YZLA 4UQOA 1GOTA 2NOAA 1K5GA 4MYCA 3CM0A 4G5OA 4NZYA 2HCJB 4DCVA 3E2IA 3ZD7A 4NP6A 1DAHA 1DTSA 3DOFA 2GJ9A 3X2SA 3OAAA 5H70A 1K5DA 1NMYA 4P4SA 3MFYA 1KHTA 2X2EA 1TU3A 3B1XA 2VSOA 3LW7A 4C0LA 3AUXA 5FTJA 3A6PC 1LS6A 1P3JA 2WJGA 2FN4A 4XWKA 2P3SA 2ZRIA 5C4GB 1PVOA 5L3RA 2IK8A 2QU8A 3TNFA 1BMFD 1CR4A 4KVGA 4UJ3A 2JLWA 2HF9A 1HQYE 2P5SA 1Z06A 4N3NA 1NMXA 3GEIA 1NN3A 4PHHA 2NZJA 4N1AA 4PTLA 5HTKA 1YHNA 1COWD 1KO7A 2EVWX 4TMTA 5LBIA 3T06B 1CJKC 1SXJC 4AI6A 4HAZA 5H68A 2QY9A 2FU5C 4B6EA 4KAXA 3IIJA 4B43A 3CRVA 2JJ2D 4JLPA 4RJLA 4PC2A 1DG1G 2GVDC 2W2TA 2AWOA 3DL0A 4HAXA 3CO5A 3EPJA 3IILA 3A1UA 4PXAA 1S4QA 2ANCA 1Z0AA 4ABYA 4I99A 3R8FA 2OILA 4CVNA 1YU9A 2QMUA 4GL2A 1U99A 2O0HA 2ZPTX 1ZP6A 4DB4A 4LPKA 3FDIA 1D9ZA 2F3RA 1TEXA 3A1SA 5JEEA 1A82A 1XMIA 3SJZA 3ZGXA 3CW2A 4A4DA 4PSVA 3ZVMA 2X19A 2DB3A 1MO5A 3PFIA 4B32A 1OIXA 5CM8B 5J4KA 2CL0X 1OIWA 1OXXK 1VYVA 4D81A 1VPLA 2QTHA 4ACBA 3QPUA 3B2EA 4ZKEA 1E99A 4DDVA 2V8OA 2XNDA 3BD9A 1DAEA 2O8EA 5CDFE 1SULA 1ZC4A 4MYUA 5KDOA 1E4VA 4EPWA 3B82A 3EXAA 1P62B 1E6CA 1WCV1 4F4CA 1OH6A 4PPNA 1PUIA 2QAGC 3TQCA 1TU4A 2DFKB 3FPAA 1AZSC 1F6BA 3TR5A 2C04A 5DIFA 1IN8A 2O8DB 2CXXA 1NY5A 2OAP1 1R5NA 1IY0A 1GAJA 4E07A 3DMDA 3RRYA 1CLUA 2D7CA 1KI8A 1RYHA 3GLGE 1NLFA 2O8EB 2PLFA 4HB4A 4ZCLA 4TTQA 1UBFA 2IUTA 4BEJA 4QC2A 2A5YB 2WZQA 1KI4A 1CJMA 5DNYB 4AKGA 3ADKA 2B7BA 4QHSA 5FUWA 1R7RA 1AS3A 2IHYA 3I3SR 4WA7A 3KTAA 5F2EA 4B6FA 4WBSA 3EA5A 1R5OA 1FTNA 1U8YA 1UPTA 3Q85A 3OEEA 4C0BA 4V0KA 2QG6A 2ZJOA 4M2LA 1JPJA 5EXXA 1NP6A 1U8AA 1ZIOA 4C0KA 1OFUX 2PEYA 4A2QA 3GLHA 1S1MA 5FOXA 3CKLA 3GEHA 2DHRA 2MSCB 1XCGB 2ZROA 3HJNA 4LZZA 1G6HA 4AURA 3LQRA 2QPOA 2XZLA 2DY1A 3OIWA 1DARA 2ATVA 4GZLA 4Q1CA 3T15A 4ASUD 4A9AA 2J7PA 3K0SA 3D7MA 3U7FB 2FFAA 1Z3IX 4M1SA 3DKVA 4LV6A 1MO3A 1VG8A 2LCFA 2OZEA 1XP8A 4LRWA 4HLUA 4E03A 4R2HA 2CE2X 1T9HA 2RGAA 4BZPA 4TL9A 3AVPA 3D3QA 3ND8A 3QKTA 4I81A 3GLHB 3U7GA 1OYYA 1G3UA 2WVJA 5HZKA 1GP2A 1QRAA 4WZ6A 3TE6A 3OESA 4BE7B 4US2R 4IXMA 4M9QA 1A4RA 2VTKA 1E94E 4JBYA 3REGA 3K9LA 821PA 4MRVA 3N2EA 2P65A 3BH0A 4BFTA 3NBZC 3W3ZB 1CJVC 1F60A 4V0NA 3U4QA 1XTKA 1DO0A 3K0CC 1PLKA 4NYJQ 2W6ID 1OXTA 3K70B 3RLFA 2VO1A 1TF7A 1U9IA 1SGWA 2QAJA 3B78A 4QJ4A 3TH5A 4FMDF 4YDHB 4BEBA 3WY9A 1ZD9A 4B3XA 2BMEA 2OCPA 1E9EA 4U7DA 4HI0E 4CIDA 4XVUA 2XB4A 3SFVA 3F8TA 1UKYA 2X77A 4TT3D 1AN0A 3E70C 1DAMA 3KDSE 3T5GA 3RABA 2BJWA 3QF7A 1Q3TA 1TAGA 3F3YA 5LDDC 4PO9A 5KTYA 3DMNA 3GJ7A 3VHLB 2QP3A 3QVUA 4JLMA 2GJKA 2F3TA 3TW4A 3CX8A 4PSAA 1SKYE 1X3SA 1OW3B 2ZRJA 5TMPA 4BFSA 4YMVA 1E3MA 1VHLA 1W4CA 3C41J 3MJRA 4P3YA 2CVHA 4TLDA 5JCPA 2ZANA 1NBMA 3HPQA 3LD9A 4XD7A 1ZC3A 1JPNA 4KO8A 2QZ4A 1IN6A 3FE2A 5FR1A 4IEIA 2E87A 3RYTC 2GA8A 3WYAA 2NO1A 2PZFA 2RHDA 4EPXA 1CP2A 2HEIA 3U61B 3BH7A 5FPTA 1YR7A 4EKDA 4M9XA 5CK5A 4DJTA 2KBFA 1UF9A 4LBYA 1WA5A 3WYGA 1KGDA 1FQJA 1W47A 5EE5B 3IO3A 5CJPA 1NIJA 4HUTA 3IGFA 1GDDA 3B9PA 2GK7A 4RY2A 1ZM3A 2P67A 2F1RA 1R0ZA 2BM0A 4OI2A 2NGRA 1G3IA 1R2QA 4AG6A 1QHNA 1N6LA 4B44A 3I8XA 4RD2A 1E0KA 1VIAA 4RD0A 1TQ2A 3TKLA 2WWIA 4JL5A 4GP6A 4OQNA 2BCJQ 1W48A 2Q9BA 2QGNA 3FMIA 3GFPA 5KO2A 1OFTA 2A5GA 2F9MA 2IYYA 1G17A 1IN4A 1EG7A 5UKDA 3EZ2A 1ZUHA 4G5RA 2W6JD 2XTZA 1KO5A 1E79A 1JAHA 1BIFA 4EQ6A 1G7CA 3BGWA 4Q7JB 2G0TA 2YWFA 2RGBA 2FZLA 3QNUA 4CRWB 2ODBA 1ZUIA 2G83A 5HKKD 2QMHA 1C1YA 1IJFA 2Q3HA 5JI2E 5FBRB 3H1TA 4Q02A 5JMTA 5DYIA 5KOYA 3LH5A 1IXSB 2G1KA 1N6IA 2AR7A 1G4AE 5CB8A 4EJSB 1US8A 2F43B 2RKOA 3AVYA 1JB1A 1KZGB 1OT3A 4HAWA 4LYJA 1KTVA 4EQ6B 2CK3D 4FWTA 3QUSA 5F98A 2UZIR 1VCNA 1XD9A 1AQYA 5KSZA 4G5GA 2ZR9A 1F2UA 2JJ8A 1G4UR 4Q9JA 4OHZA 5BN4A 4BLSA 4Q00A 3BAFA 1XDBA 1US8B 2O8BA 1TF5A 1XD8A 4E22A 1Z22A 2CE7A 4BZXA 1H8EA 4F7WA 5FPYA 4B75A 1EX7A 1Q20A 4YMSA 3EX7C 2CHGA 4KV9A 3NVAA 221PA 1O3YA 1E69A 1CRPA 2BM1A 1TL7C 1F2UB 5EP4A 3GEEA 1P73A 4KFTA 1BYIA 1EK0A 2BDTA 1HA3A 2F1IA 2GBLC 5C4MA 1KZ7B 2P5TB 3CF0A 3VU9B 5BW8A 2DCUA 4TMXA 4JBWA 3C4JA 2JDID 2ATXA 1NMZA 1G8FA 4C0QC 3CF6R 5EE0A 4EFNA 1NJFA 2IEYA 5CDFA 1II0A 4FMCF 4V0LA 3Q72A 2CCKA 1LF5A 3ETLA 1Z0JA 3PEYA 4MGZR 4NYIQ 1KI3A 1P5ZB 2H17A 4MRRA 4MRPA 4LI0A 4LHZA 3QXXA 1IXZA 1ZCBA 2X2FA 2XNSA 1AK2A 1BMFA 2D2FA 1HV8A 3I73A 3UIEA 1XB2A 3GLGA 4C3ZA 2QROA 1UBEA 4R9UC 1KK2A 4EUNA 2ZE6A 2R62A 1EFHA 5FUYA 5JS8A 2IBMA 5AK0A 1XCMA 3H0KA 4LX0A 1COWA 1UKVY 3LXXA 4OJKA 2CLDX 1E2GA 2VP4A 2V1XA 1QHIA 5HE9A 4DZZA 1KMQA 2EFCB 4TZ6A 4FXPA 1GKUB 4MRSA 2CLCX 1P2TA 1VG9B 2JJ2A 3BORA 2YINC 4I1UA 4RFSB 4IFBA 3GLGB 3X1ZA 2IS6A 3CB4A 3EZ6A 3TSWA 2IWHA 2G0NA 1G7TA 2ONKA 1X8JA 1KIMA 3LBNA 3RVBA 4AG5A 1XRJA 4HUQA 2YVUA 4Z8XA 2FA9A 1KO4A 4II7A 4DEXA 5JSZA 4B3DA 1XEXA 5AUOB 3IQWA 4D4MA 4ZV4A 4DCSA 4L9SA 1RFLA 4TQUS 2BBWA 2SHKA 3KUDA 1X1SA 4WZBE 4G5QA 4CYMA 1N2CE 4YLGA 4HAVA 1TQ6A 3TIFA 3CNOA 3QG1A 5D3QA 1N6RA 3VNUA 1AS2A 2WWXA 4JKIA 2RCNA 3NH9A 3DDCA 4ZI2A 2FF7A 1DG3A 4HUQB 5L3SB 4G01B 4IDOA 5DI9A 1YE8A 1ESMA 1RRPA 1N0WA 2DWOA 3PXGA 4IVQA 1H65A 5AUNB 2W00A 1JEDA 2EYUA 2NQ2C 1OB2A 1T0HB 5FI1B 1VHTA 3WBJA 1KI7A 1NF3A 1MO4A 2XXAA 2XAUA 1DAGA 4A8JB 4UNNA 2ERXA 1T91A 2ZAOA 4OK5A 4LOAA 2LKCA 4LHWA 1QZXA 5LB2A 4IDHA 1M7GA 4DSOA 2DR3A 4PQRA 3U3RA 2GILA 3BIFA 4G3XA 4IDNA 3O8DA 1ZM4A 4M9SA 4LBZA 2OM2A 4QHTA 2BCGY 1G8YA 2QMEA 3RC3A 2H1LA 5CB6A 1T3SA 2C78A 2FFHA 2ZU0C 4BLOA 4MGYR 2GAOA 5EE1A 1T3LA 1FNMA 3VKHA 4QHYA 5FOUA 4NPHA 1XMSA 2OO7A 1M74A 2G1JA 3PITA 1SHZA 3QXHA 5CIWA 5SZKB 1YRAA 4XH9B 1S1CA 4QBIA 4DLSA 1JAIA 2GEVA 3U44A 5DHAA 1Y63A 4G5SA 4W7SA 2IW3A 1M6NA 2AFHE 4JLVA 3K70C 2W58A 2O0KA 2Q6TA 3V4FA 2J9RA 3KQLA 1II8A 1UDWA 1KY3A 1N0UA 3O8RA 4TLBA 2BMJA 4TMZA 4ASUA 4TL8A 2GHIA 2JLUA 1K8RA 2GZHA 4IEEA 5TARA 4GOKA 4B47A 3FHTA 4DB2A 1TQ4A 3SJBA 3QKRB 3U44B 1XCPA 1IAQA 1R8QA 2WWHA 4MH0R 4PO8A 2NPIA 3FB4A 1A2BA 2IYRA 4MUAA 5JWOA 4QNMA 1QHYA 2ZAMA 3THWA 1T3HA 3R7WA 3TW8B 4NCNA 4Z1MD 2N46A 1W4RA 3Q5EA 1UADA 3I5XA 4OYHA 4W5JA 1WP9A 3U6BA 3TQFA 3L0IB 1RRCA 1Y3AA 4B76A 3AF4A 4JL8A 2QM7A 4NTZA 1UM8A 3IEVA 1G7SA 2V9PA 2W6IA 4Q1AA 5G53C 2O8FB 1VYUA 3RANA 3NWJA 1E1RD 3I92A 3AH8A 1JQLB 3R7WB 4TYYA 5FL3A 3IKJA 2CLSA 1G6OA 2QN6A 4OHYA 1MH1A 1XTJA 2VHTA 2WAXA 3LQQA 1P7CA 1Z6TA 3PR1A 2N42A 1WRBA 2GVZC 4YMWA 1XD2B 4JKYA 1E2EA 4KBGA 5FOWA 2ZIAA 3X1WA 4CEHB 2EWVA 3ZQJA 3AP3A 4GBMA 4TT3A 3QSYA 2YOHA 5E4FA 3ZVRA 5KDDA 2GXAA 1KDRA 1T5IA 1OSNA 4PQFA 3WP1B 2IYQA 4NYMR 2D2EA 4Q4AA 2BJVA 2KE5A 3VR1A 1JECA 4HB2A 5DSZA 4XTCS 1G7RA 4QRHA 4PFSA 3L0SA 3JVUA 1L8QA 4TLAA 1CEEA 2RGXA 4NE2A 3FVQA 4L15A 1W4BA 2ODNA 4OBEA 1G16A 2QBYA 2YKGA 3CWZA 4GP7A 3U3JA 2O52A 1N6NA 3KKOA 2J87A 1G5RA 2VQSA 4ZCIA 2YOGA 4BLQA 1Z5ZA 3BB1A 1UBGA 2NG1A 4LK2A 1HT2E 4M1MA 4DDTA 3EA0A 4Z54A 1WB9A 4Q1BA 1OH7A 2H18A 1NL3A 3IO5A 4M1YA 4JJZA 2WOJA 1S9HA 2ZYUX 4MRNA 1W36D 4BRWA 1YZQA 3M4YA 4PHFA 3OZXA 2AWNA 4FMCB 1N0VC 3RWOA 3THXA 4DDWA 4B35A 3C7KA 3BK7A 1XJCA 3C5HA 3FTQA 5BN5A 2QRZA 5BYKA 2HV8A 2RGGA 3CLVA 5K8TA 3TK1A 1NN0A 2WPDD 5EE9A 5CITA 1YZGA 2YC2C 3ZZUA 4A0FA 4OK6A 1PLJA 2N1BA 1E2IA 2ZYVX 5D3MA 3KFVA 4Z8YA 5GVSA 2V3CC 1YRBA 2XZOA 2JA1A 3EIEA 1GIAA 2O5VA 3HU1A 4Q9KA 2R6FA 4QGAA 3REFA 4Q21A 1W4AA 4QNRA 1RZ3A 4QM7A 3VMFA 4MKHA 2CVFA 2CBZA 2XX3A 3CZQA 3TR0A 1ZM7A 1S2MA 2B8TA 3R9WA 2W6JA 4AYXA 1X6VA 1J8MF 2DWQA 2XSZD 3C16C 4M22A 3UG7A 1D5CA 1GITA 3AV0B 4P32A 2H7VA 5F9HA 3RRNA 3HYTA 3TLXA 5TB5A 4HDCA 5L3VA 4TSFD 4MDFA 1G9XA 1LTQA 5HKKA 2C9YA 1YVDA 1W2GA 5DI3B 5AUQA 4U02A 4IKEA 1R6BX 3Q7PA 3TJZA 4C0HA 2J41A 2JLXA 4LHVA 3QBVA 2FGJA 3GQBA 2H5EA 3RS4A 2VRWA 3GFOA 4ZI3A 1Z2CA 5KSYA 1X86B 2IXGA 3AF0A 5A4JA 2CK3A 3WNDA 5FI0B 5KUTA 2C96A 2JLSA 4AD8A 3SN6A 4EPYA 1CF4A 4JL6A 3FGNA 1ANKA 1SVKA 1HURA 3CNLA 2ZR0A 2FSIA 5SZIA 3VFDA 1KSGA 4FCTA 1OFHA 2V54A 3NDBB 1NG1A 4P4SB 1S8FA 4C0SA 3C15C 4ESHA 1WBDA 4C2UA 1Z6AA 3OFND 1MABA 1N6OA 1JI0A 1BOFA 2IA5A 1GRQA 4PX9A 2FPMA 1P75A 1Q0UA 4QBFA 4DVGA 3KQKA 1Z07A 1U0JA 5AJYA 1Z08A 1SXJD 4PPGA 1LFDB 2W0SA 3KB1A 4I1OA 3BH6A 4EAQA 3EG5A 3LBHA 2GK6A 4NL4H 2EFGA 1MR3F 3X1XA 1AJEA 3QF4A 2JASA 1IY2A 3X1DA 3AKDA 1UKEA 3HR8A 3GPLA 4ARZA 2JDIA 2H92A 2ZSEA 1KI6A 3NG1A 1XTRA 2OCYC 3D6TB 4WXRA 1Q22A 3Q8XB 1DS6A 3P27A 2DWPA 2XB2A 2ZI3A 4L8GA 2FGKA 2QGZA 3G82C 4BFUA 3I72A 4B71A 2FE4A 4UNSA 4Q1EA 2OFWA 4WAUA 5CIQA 2BOVA 2IUSA 2QI9C 3T1OA 4DDUA 2P6RA 4FN5A 4HDOB 4ARZB 3QENA 1W0KD 5F9FA 4LJAA 4HZUA 4WVFA 1ZINA 2BBSA 2GCOA 2XOKD 3KL4A 3ND9A 2IF0A 1OHHD 1LVGA 3FHCB 4GFDA 4WIAA 2JATA 2PEZA 3QG5A 721PA 5JCZA 2O8CA 2IYVA 4LJ8A 4DLVA 1D2NA 4DIDA 3A36A 2WJIA 4DLXA 4AC9A 3ECCA 2R44A 3VAAA 4D4KA 1KSFX 5GJWC 1KI1A 3DM5A 4AYWA 4A2PA 2VP0A 2QP9X 4B3GA 4A8JC 2FPLA 1I4LD 2GXSA 3LA6A 3U3OA 3M6AA 4F91B 3K9HA 3AVOA 5P21A 2BEJA 2EU8A 2GCOB 4GRAA 1E9SA 1FTSA 5FBVB 5JBQA 3PJRA 1ZD1A 2O8CB 1FQKA 2ONJA 3EPHA 5LPNA 1NVVR 4LC0A 2CL6X 3QPVA 4LC1A 2V55B 4KSCA 4ZDKA 1SXJE 4PAQA 1KJYA 4DSUA 2ODWA 2Q21A 6Q21A 2OEPA 1T8UA 1TEVA 4Q9LA 5LB4A 3GFTA 3H86A 4G0NA 1N5LA 3LX5A 4JSTA 4CDGA 4Q4JA 4LV5B 3P26A 1AGPA 2IS4A 2X8AA 2ECKA 4ZDWA 3B1VA 2ZI9A 5BN3A 2QT0A 4JVNA 3AB3A 3GLFB 2CMKA 3AEZA 4EFMA 1KKMA 2QQEA 4LYAA 4OJQA 4HSEA 5IK2D 3QI2A 3LLUA 3KTAB 3ICEA 3SYNA 2A30A 3QKSA 3F5FA 1EFTA 4C9BA 2VP5A 2R8RA 2GZDA 4M21A 4Q4JB 3MWLA 4R98A 5AWFC 3WMEA 1XPRA 2CHVA 1SVIA 3FKSD 5DN6D 3H2YA 4RFVA 3K53A 1ZRHA 2ANBA 5JHHB 4GNKA 2VBCA 1JR3D 4WZAE 4LJYA 1DELA 1HEIA 2DFTA 4OQFA 1W1WA 4US1R 1S96A 5K8UA 4Z51A 2KBEA 2H57A 5C2JB 3NHBA 1WMSA 3JZMA 4RCZA 1YZUA 1RKBA 2ZRFA 4KCGA 1T0JB 3KKQA 2ZRHA 4OHVA 1TUEA 5TDHA 3FOZA 2JCSA 1D2EA 2GXQA 1L4YA 3KKNA 3W8RA 1G8GA 4O2RA 3QE0A 1ZUNB 3PENA 2ZJZA 1ZJ6A 4A2WA 2UKDA 2VP2A 3K09A 4HZIA 2J3EA 3U4QB 1Q57A 2ZRMA 1DO2A 3EC1A 1TNDA 2FZ4A 1ZW6A 2ZUCA 4ERNA 1VTKA 1RW4A 2WJHA 1VCOA 2EWWA 4PHTA 2ZVQX 1E9DA 5JFGA 1XPUA 1VDZA 2ORWA 2ZJ8A 4Z1MA 2DFLA 2PCJA 4WOPA 5SZJA 3K0FA 1YR6A 5EXSA 5FTNA 1D6JA 3NEYA 3E1SA 5JRJA 3EZ9A 3I62A 4K8OA 2MMGA 4TMVA 2UZ3A 4UNPA 3AF3A 4MDEA 4XIGS 4HAUA 4JJKA 1T4GA 2V1UA 3BFXA 1WBBA 4YONB 1NIPA 4W9MC 2WKQA 1E1RA 1KKLA 2ASEA 2GWHA 3EIHA 1J7KA 4UNQA 3BERA 1AIPA 3SOPA 1JR3E 1P61B 1G41A 1R0WA 3L8YA 4OKSA 1HY3A 2D7DA 2EFDB 3KQHA 2ZS9A 3SQXA 3KXKA 2OUKA 1Q12A 2PT5A 2Q3FA 2FSGA 1ESNA 3IIKA 3LRPA 2FPKA 2FNAA 2V7QD 2ZREA 3THYA 4HLQB 1R8SA 1Q1QA 4C4PA 5L8VA 3B13B 4CEJA 4L16A 3N70A 5IDVA 4P31A 4IRUB 2EQBA 5HR5A 1OIVA 4YDSA 2KI5A 3LVQE 3LX8A 1NG9A 4ESVA 1P9WA 1E2MA 1FFHA 2W0MA 2ZXUA 3IEUA 1YR9A 4NCHA 1LV7A 4CZ2A 2J0SA 5FPKA 2QL6A 3THYB 1PLLA 5FPHA 1DAIA 2XTNA 1OH5A 2OCAA 1VIYA 4I1VA 4CEJB 1P2SA 1ZM2A 1CR2A 3FKQA 3LBIA 3C14C 1G8PA 2B21A 3PUVA 3PV0A 1P72A 3FFAA 5AJWA 1XTQA 2BV3A 3I5YA 1EWRA 4OHWA 3P20A 4GOJA 4FCVA 3B7GA 4JMPA 4M1KA 5J4YA 4O2LA 2JIZD 1YR8A 2I1VB 2DYKA 1E2DA 4BLTA 3DVLA 4NKRA 4BLPA 3AP2A 1P4SA 4M4SA 1G291 5KSPA 5EJEA 4BFWA 3GLIE 2GAAA 5HPYB 2EW1A 2VIIA 2WWWA 2WPDA 3SJCA 3CIOA 1A7JA 4Q7KA 3B60A 2B8WA 3NC1C 1ZU5A 4GI7A 1ZIPA 3KXIA 4DCUA 2ZTSA 4QXAA 1ZMXA 4AY2A 2Q3MA 2J0UA 4US0R 1P60A 2IWRA 4DRZA 5CM9C 1M2OB 3UATA 4CW7A 2VSFA 3L82B 3AVTA 4AIIA 5JECA 3MUFA 2WTUA 2C99A 3DOEA 1CS4C 4FW9A 1HUQA 3ZZTA 1KK3A 4PC6A 5HCNA 2AXNA 2XSZA 3U3KA 3A4MA 2WIAA 5G3ZA 1IY1A 1DADA 1G5TA 4DBLC 3LLMA 1E2QA 4TSFA 3L0PA 1KNQA 2YWGA 1EWQA 4QBGB 2AN9A 4GPTA 2VF7A 2O8BB 1DEKA 2X1VA 3ZIAD 4EPTA 2QQ0A 2JJ1D 1AQUA 2QPTA 1HYQA 2IYLD 3PEWA 1J90A 3AF2A 1GKYA 5B57C 1E2HA 2RB4A 4PZLA 1E1QD 1TADA 3TSZA 4B3BA 3HR7A 2ZETA 3EWAA 2W2XA 1RIFA 2IX3A 2IUUA 1RRGA 5CLLA 2KSQA 5FBWB 4X8LA 4FIDA 3QXJA 2YWHA 2KB0A 2BC9A 3TVDA 2A78A 2AKYA 1J70A 5FUXA 4L5BA 1QVRA 3RRMA 4YMTA 4LJ7A 1G19A 1W44A 1XF9A 2KJQA 3OFNA 5AJVB 1GZSA 3BJIC 4LY6A 3K9GA 2RMKA 3A37A 1AGRA 4IOJA 2Y8EA 1E2KA 1RRFA 3O8BA 2IS1A 4URVR 4P33A 1SXJA 4LJ6A 3U3MA 4QL3A 2I3BA 5JJIA 4CF7A 2GTPA 3WNCA 3Q3JB 2OESA 3WNBA 3B8HA 2DPXA 1P9NA 2FH5B 4O3MA 1EFUA 1EFRD 4X8HA 2A2ZA 1G21E 3HU2A 4KLNA 2PMKA 3FWYA 1SXJB 1ZD8A 5AJXA 2ZR7A 1PV4A 1UEJA 2D62A 5ANRB 5DHFA 2JEOA 4DT1A 2P6UA 2QMOA 2GESA 3MJHA 1E96A 3RSLA 2F1JA 4M0LA 1W0KA 4IVRA 2W83A 3BXZA 4BFZA 2YOFA 3OIYA 3AUYA 5JI3E 2XOKA 5EQTA 5B58C 5GJVC 5JSZB 2XEXA 5BWMA 3N2IA 1OHHA 2FX3A 1XEXB 3KJGA 1EESA 1MRNA 3BFVA 3V00A 1EX6A 4RZ3A 1PJRA 4FMDB 1IN7A 1V5WA 1UAAA 3PCRB 1XPOA 2QAGA 5FH9A 4CGZA 2OBLA 3MWYW 1W5TA 4NBSA 4XVRA 1KAGA 1EXMA 2CNWD 5FOSA 4M9ZA 4NCJA 1NSTA 2OSBA 2ZI4A 4D2IA 2XTMA 4IOMA 4LJ4A 5LD2B 2XGJA 3UPUA 1Z6GA 5GVRA 2CL7X 2D06A 3KJIA 1GFIA 4NMMA 3AF1A 2C2HA 2E9SA 1UEIA 1S3SA 2MMCA 2FJUA 1E2PA 3CWQA 3GJ8A 3L43A 4QGHA 2QAGB 3OE7D 2ZJ2A 4ACAA 2XXAB 1QVAA 3LY5A 3OEHD 4LCBA 1GM5A 3CONA 4KODA 3SJAA 3R9IA 1N6PA 3W5IA 4DLTA 2GCNA 2YYZA 3LAWA 4D82A 4OI1A 3HWSA 4KU4A 4M1TA 3IPXA 1JALA 1WXQA 1E4YA 1EGAA 3JVVA 4HLUC 3RWMB 4CEIA 2WSMA 2PL3A 4EDHA 1RYFA 1GNRA 2ZRKA 1OXUA 3K70D 1BYUA 3CNNA 4LHYA 5EP1A 2HLDD 2R65A 2J0QA 1DPFA 3NDPA 3MSXA 2B92A 3PUZA 1K6MA 5IK2A 3SE0A 1F2TA 3VTKA 3AQ4A 4D25A 3U7EB 3WBKA 4Q4HA 4D0GA 1MOZA 1KI2A 5F3WB 3LXRA 5EUQB 1QHHA 2Q9CA 3FKSA 4PC1A 5DN6A 3ZVNA 1XBTA 4V0OA 1D8TA 2AHOA 1KSJA 2F6RA 2O0JA 1CR0A 3WHKA 5TV2A 2F7SA 1M7BA 5FUVA 1JR3A 1P2UA 2J7KA 2IYTA 1SKYB 4TL6A 1II8B 3W34A 1AKYA 1N25A 3UWOA 1AZTA 3N5CA 1BO6A 4I1SA 5DE3A 5J4VA 5IRCD 4TN1A 3T34A 3CZPA 4RCYA 5GADl 3KKMA 4RZUA 2LWIA 3LW8A 3CR8A 3K0CA 1L2TA 4HATA 3QY0A 2O8FA 5GJBA 1NKTA 3H4MA 4UXIA 4A0RA 2PMDA 2FMXA 1YZKA 2HT1A 1IONA 4XWOA 3THWB 3PEVA 2D74A 2IC5A 1KDOA 4F4IA 1CU1A 2ZUDA 3GJ6A 5FL7D 4QKQA 2GJ8A 3CF2A 2PZGA 1KAOA 1JJVA 1OV4A 2GEDA 2ZI5A 3SBEA 4JLOA 2R6AA 1OLOA 4NDZA 4AK9A 4IHQA 1RJ9A 4GSYA 4B2IA 5TVKA 2ZITA 4TQ9A 1KK0A 1CXZA 2ORVA 4CT5A 3AP1A 4Y0AA 1Z29A 2V6IA 2WOOA 1TF2A 2C8VA 2ZU6A 1Z0IA 4QG7A 2WWFA 3ZH9B 2OXCA 3GLIA 1XZPA 5HCIA 1BH2A 3K0AA 2JAQA 3VR6A 5FTLA 4JZKA 1Z6XA 4A1FA 4OK3A 4D0LB 1RJ9B 3BC1A 2WKRA 2OAQ1 4FCWA 4MKFA 4Q4AB 2ZJBA 1P6XA 3TSOA 1OJLA 5IT5A 2A5FA 1TPZA 3A1VA 2I4IA 5JWHA 4TZ0A 3UMRA 5ELXA 4FWIB 4TLEA 1F48A 2PCLA 3GLIB 1ZVQA 4JBXA 1BS1A 1ZNZA 1QG2A 1YQTA 2ZE8A 3K0EA 4LBWA 2QBYB 3I4LA 3ZD6A 4PC3A 5KU1A 4EJSC 5B30A 1LNZA 2XITA 2ZRLA 1LS1A 2V7QA 3BFKA 1NVUQ 2ZRCA 3L2OB 3QXCA 2B6HA 1NLZA 5EZ5A 2JLVA 4E5UA 1ZM9A 1FOEB 2Z0MA 3B5JA 4U5XA 1MRSA 1L7VC 1SZPA 1JNYA 2Z4SA 4HB3A 1OB5A 4HEJA 4DIEA 4TYWA 2ZSAA 5BYJA 3THXB 1G18A 3S1AA 3ZQ6A 1KYIA 2VF8A 4FMBB 4DCTA 1KOFA 1SVMA 4DLWA 3L8ZA 1XJ0A 4IDPA 4JSYA 2MSDB 1DVRA 3U5ZB 1HTWA 2ZI6A 2ZRAA 4LJ9A 2K5UA 5D3MB 3SI7A 4NU0A 3UK6A 2KWIA 3PUYA 1XX6A 3BS4A 3P4XA 1QDEA 5CLQA 1NNEA 3ADDA 2WJVA 2BEKA 3AKCA 5EZ6B 4Q7LA 2OT3B 3RAPR 2W2VA 2JIZA 4ZO4A 1IBRA 4A92A 3G0HA 2REOA 2F55A 3GJXC 2V6JA 3FYHA 1Q1ZA 4XVQA 2IYWA 2ZE7A 3IHLA 4MKGA 4S2EA 4KYUA 1GL6A 1SVLA 4LGMA 2OXRA 4PHGA 4KJZA 1Q21A 4Q4LA 1AKEA 4R7ZA 5FOVA 4K81B 1HH4A 1SQ5A 2GRJA 2IYSA 1HE1C 3UMSA 4F93B 1FUKA 2HXYA 2I1QA 1VECA 2WSSD 2YC4C 1FMLA 3BRWD 3IUYA 4LWZA 5JZVA 4QM6A 2WM9B 3A1TA 2IL1A 4URXR 4QGFA 4L4UA 4V02A 2RGDA 3A4LA 3O8CA 2QORA 2WIBA 3W5JA 3WHLA 5CK4A 3T1TA 2HDNB 4IOLA 3CX6A 1VCIA 521PA 1XJQA 3CUEF 3RS0A 3TGPA 2CEAA 2FWRA 5TXGA 4UXHA 1HE8B 3ASYA 4URWR 1P9RA 4JIMA 4Q7MB 4Q1DA 2RGNC 3PIRA 3U7HB 4NYJR 4DC9A 4QJ5A 2GBLA 3CRMA 3NBFA 1Z28A 4AKEA 2OBMA 4P4TA 1IHUA 1OYWA 1Z8FA 1FMJA 4TMWA 2BVNA 2GEUA 1MABB 1SVWA 3ZIAA 2JJ1A 5E3HA 3GLFE 1QHSA 4HLDA 3SFZA 4XSHA 2C03A 2ODEA 5FPSA 4C30A 4TWZA 5FOTA 1UDXA 2ZRGA 5EUMA 4HYYA 2QNRA 1RC8A 3TBKA 1E1QA 1NN1A 3VR4A 2PH1A 5CJ2A 5KPJA 3TUZC 1DBSA 3QF4B 1CJUC 1QHXA 4XTRA 1KNXA 3A8TA 4FINA 3IQXA 3OIVA 3W3AA 1M34E 5KYKA 1RVDA 1KI6B 4KFRA 4NYMQ 5BXQC 4LBVA 4LV8B 1E98A 5KNCA 2JLZA 2E1RA 3NH6A 3QBTA 1NY6A 4QJ3A 1SVSA 2VP9A 4PPFA 2WHXA 3T5DA 2DFNA 1X8KA 1U98A 3EPLA 4LPSA 3ICQB 1B23P 1VG1A 4HAYA 2VL7A 2YWEA 1OH8A 2REBA 1C9KA 1E0AA 4F4JA 3QQ5A 1TX4B 1YZTA 1GSIA 1ZYUA 1NI3A 3V4RA 5J40A 4EFLA 1DE0A 4PZZA 2O8DA 2OV2A 2BKUA 5EP3A 4PPQA 2J59A 3QEOA 4HZUB 4NCKA 1TQDA 2AXPA 2WJYA 3GJ5A 3IBYA 4DSNA 3C8UA 4B2PA 4JLKA 5LD2C 1EFRA 2JLQA 5AR1A 1QG4A 5GJCA 5G41A 3A4NA 4RKEA 2NZ8A 4M53A 3PEUA 4ZDJA 4KHZA 4NCIA 2J0VA 2GZAA 3X1YA 3TMKA 4PANA 1G20E 3A1WA 4BWYA 2PX3A 1MO6A 5B64A 4MYTA 5FR2A 1Z6YA 1WQ1R 3KFXA 2BKEA 3B1ZA 3O47A 3ZS9A 3EARA 1S9DA 3BWDD 3SZRA 2WKPA 4JLAA 2HF8A 3H84A 2XJ4A 3IHWA 5FBLB 4BFYA 3ZZ0A 3RC8A 4D0NA 4V0ME 3B9QA 3T12A 4MKIA 4KSBA 1U0HC 2ZUBA 4BASA 2OHFA 1X1RA 5KPDA 3VNVA 4A6PA 2G88A 1G5PA 1AM4D 3VR3A 1M1YE 3SNHA 4OL0A 2ZRDA 3GMTA 3RNLA 1N5JA 2FSHA 2R2AA 4Q9IA 1W49A 2CNWA 2RAPA 4JVSB 1Z63A 1J99A 1GWNA 3QPWA 1NVWQ 1LF0A 3AGQA 3MGCA 1NKSA 3BOSA 2CCJA 3AKYA 4BGDA 3AVUA 3GJ0A 4K46A 3VHXA 2R9VA 4IVPA 1KJWA 2FSFA 3PQCA 3OE7A 1FL9A 1IJEA 2QSYA 2WBLC 4NONA 1II9A 3OEHA 1IXRC 5M04A 4QBHA 1XFAA 2IT1A 2ZJYA 3QKSB 3T61A 4DUGD 1U0LA 1ELOA 2REXB 2UVQA 4F38A 3TVTA 2FV8A 2XJ9A 3QOFA 3UKDA 3VKWA 4DLRA 4BQSA 1W7AA 1N6HA 1H8HD 2CHQA 1RE0A 3EPKA 1VG0B 3MLEA 3P1JA 4TMKA 4A6XA 4Y0VA 2VHCA 1TMKA 2C9CA 2WICA 1IM2A 1XTIA 2XZPA 2EFEB 1YJ5A 3QVVA 4KFUA 1NRJB 2G77B 4BPBA 3K9NA 5IHPA 3MMPA 3DHWC 2VYFA 3NKVA 3B1YA 3DO6A 3K8YA 4B74A 1UKZA 1BKDR 3Q5DA 2HLDA 4OQLA 4PO1A 4GDFA 1OXVA 2AFIE 2R6CA 2BMDA 4LJ5A 4M1OA 5AJZA 5JJKA 2R6DA 4JS0A 3DZ8A 2QP4A 4PC7A 4W5HA 1YKSA 3MRSA 3HPRA 2QEQA 1SHKA 4DEYA 2ZI7A 2ZSBA 5L3QA 1XXHE 3FHOA 3L0OA 3Q7QA 3BE4A 2WMNB 3J81k 1R5BA 2NPFA 1GUAA 2WV9A 4AKIA 3SU8A 3AVXA 3WP0A 2ZRBA 1WF3A 5H1YA 1OKKD 3KB2A 1W0JD 3NC0C 3SHFA 2HJVA 4MYHA 4NYIR 4URYR 1FP6A 3PVSA 1OXSC 1ODFA 5K8IA 2GCPA 4JLBA 1D9XA 3EAQA 4URUR 5L3QB 2GXUA 3SC3A 3IIMA 2OG2A 2QTVB 1R0YA 5DISB 2GF0A 5KNDA 2A3RA 3B1WA 4DLZA 3KQNA 3OIUA 4IW3B 2ZSDA 1OF1A 3T1VA 1GG2A 4A15A 1KMHA 3UWKA 1HT1E 3TRFA 5JEDA 2WWGA 3KJHA 5CYPA 3F0TA 1CRQA 5EXTA 4Q9HA 2FOLA 3G5UA 3K0FB 1FUUA 1XMVA 1CIPA 1XWIA 4JVLA 1FW6A 1JR6A 1E32A 2AK2A 5FL7A 4TYPA 4JLJA 1FPMA 2J5XA 2VHUA 4DHEA 4AKHA 5E95A 4RSGA 1RPZA 5J5CA 2VP6A 1P2VA 3CRQA 3RS7A 1AS0A 3ZLJA 5B2ZA 4N0DA 1JXMA 4R2IA 1FX0A 1KMHB 2FEMA 2AD1A 3BB4A 3SS8A 3SQWA 4ZCMA 3PUWA 4KYIB 3NTUA 1I4TD 1MV5A 3SYLA 2B7CA 1M7HA 1PZNA 4RKFA 3ZS8A 4DXAA 1MT0A 2C77A 1ONBA 4YXWD 3ADBA 4D6PA 1ZCAA 1A2KC 1NVVQ 2GDJA 4JYCA 4W5WA 1NSFA 3W6PA 4ITRC 3LVRE 5JLJA 3JZAA 3AGPA 1FX0B 1XEFA 5AUPB 2AKAB 1VYTA 3Q9LA 4BZQA 3EW9A 3C5CA 5J47A 2Z4RA 4B3FX 2JLYA 3QIAA 3PG5A 5BQ5A 2R6GA 4QFMA 1DOAA 1KI9A 4RD4A 3T35A 2QT1A 4B48A 4D4JA 3CPEA 5EP2A 5C46F 2QE7D 1WE2A 1B0UA 2ZJAA 3ONWA 4EJSA 1JJ7A 2F43A 3T1QA 2FDCA 2BMFA 5FTKA 3U6KA 4TYNA 2GJAA 3QKUA 5J4LA 1FZQA 2AL7A 2PBRA 2VH5R 4TTPA 2HJGA 4OI4A 4RD6A 4X8MA 4YQFA 2IYXA 3I8SA 1F3OA 3WRXC 2HXSA 1W36B 1UFQA 2CJWA 621PA 1IQPA 4V03A 5FTMA 4B73A 3OAAD 3GLFA 3EASA 3LNCA 4HLCA 3THOA 1E9BA 1GKIA 4Q18A 1JEEA 4EIWA 1UJ2A 3WRYC 5DH9A 4D26A 4JT2A 2QM8A 3M0EA 1OPXA 2RGCA 4A0HA 1NJGA 1OFIA 4IJMA 3AVQA 2ZRNA 5JHGB 1T8TA 3NEJA 3DM9B 3QXSA 2J0UB 4Q03A 4R71A 2Z5FA 2Z6VA 4GOXA 3P4YA 4RVCA 4URZR 3VX4A 5C18A 4ZPXA 2IXFA 2CJWB 2OLJA 3K1JA 1I2MA 3VU9A 2A5DA 1OE0A 2LKDA 3SEAA 4JYBA 4M1WA 4D4LA 5A5GA 1T6NA 4J0QA 4UJ5A 1GTVA 2G6BA 2BHRA 1ETUA 4KI0A 3KXLA 4OI0A 1E9AA 1I4DD 2C98A 3KX2A 4LDJA 4A82A 4DWJA 2A5JA 2VSXA 4C2TA 4XJXA 3BBPA 2GF9A 3I32A 3CRW1 4Q5IA 4C0AC 1KSHA 4XOIA 1Z2AA 1U90A 3AVVA 1SVOA 4LHXA 4B2LA 3LV8A 2ORIA 3R9XA 2F1HA 2RGEA 2WSSA 5KDLA 1L4UA 4U00A 2HCBA 1JQJC 1XEWY 3WMGA 2VA8A 1YZNA 3KKPA 3W6NA 2QA5A 2EYQA 4E09A 4PZYA 4KXFB 4Q48A 1TUIA 3KUCA 4H9GA 3UMFA 3VQTA 1ZNXA 2RHMA 3ZYCA 4QOSA 3I1FA 2RGNA 2GJSA 3W9YA 4TYQA 1Z0FA 4O25A 3DKPA 4RD3A 4CT4B 3A58B 3HYRA 4PR0A 3CX7A 2IF2A 1U2RA 4ZIRA 1HQCA 1LY1A 4P0TA 2GNOA 1QF9A 2ZS7A 1Z0KA 2BBOA 1E9RA 4RFSA 4BECA 2FFBA 5DO9A 2Q9AA 4V0MA 4XSGA 3CH4B 5KHOC 2XNDD 2QRNA 3KQUA 4G1UC 3BB3A 1E2JA 4RD1A 3AM1A 1E9FA 4N0EA 3RS3A 3TAHA 3W8NA 1GNQA 2AX4A 4TTRA 4OQXA 1DAKA 2ZYWX 3IDQA 1GRRA 4RZ2A 3RS5A 5K8LA 1C4OA 8OHMA 3WMFA 4YC7A 3AKEA 4LYFA 4AYTA 4ZIRB 2JLRA 4B3CA 1XU4A 2NO9A 3P32A 2C5LA 2BWJA 2OE2A 1Z47A 4Q1FA 2YZ2A 3U2QA 4BLRA 3R8CA 3UXMA 4MQBA 2OCBA 3NIBA 1G8HA 2VHJA 2G3YA 3W90A 3DPUA 5L3SA 2FEOA 1LW7A 2WMOB 2A7QA 3VR5A 1XEWX 3E5HA 1G1MA 1R10A 1ZBDA 2QENA 3VKGA 3ZJYA 5IF9A 1KJZA 3CH5A 4UKDA 1E0SA 4DT1B 2PX0A 1N5IA 4JLDA 4BRUA 5EXPA 4A8JA 1W46A 3VR2A 2HYIC 1JBKA 1DAFA 3OEED 4JLNA 2DBYA 5SZHB 2P0EA 5A0FA 2VLIA 1A1VA 2AK3A 4PAOA 1Q44A 4UNRA 3NBXX 2IXEA 2IEZA 2EFHB 2NO0A 2NO6A 3WYFA 3CR7A 1R4AA 3MWJA 4KLZA 3D8BA 4O0MA 4WW0A 3QEJA 4DKXA 3UG6A 3RSOA 1GNPA 2NIPA 1CR1A 1F5NA 1GVNB 121PA 2BBTA 1GL7A 3LDAA 5EE3A 3WXMA 2GETA 2J7PD 2VEDA 4AWXA 5C1BA 1KDTA 1XXHA 2GKSA 2ZVPX 2PT7A 4DCNA 2OFOA 1Q3HA 1NLYA 3IPYA 4C7OA 4P4UA 3GJ3A 2J46A 2RH5A 4BFVA 5FBQB 3RS2A 2WWYA 1GL9B 1NN5A 4Q19A 2IYUA
chains in the Genus database with same CATH superfamily
1V71A 1R00A 2IYZA 5JDIA 2GD6A 4YCSA 4I1RA 5F5XA 4ZODA 2QDXA 1ZNQO 2PGDA 3IBFA 4ZOEA 1GTL1 1MKYA 3WMXA 1MTZA 2WAYA 1FFAA 4G1VA 2RSLA 2WJJA 1T4CB 1WULS 1F6WA 4BC0A 1U4NA 3EIQA 1NOIA 4JLWA 4C7OB 4IY1A 1IN5A 1AV7A 1E2UA 4U6QA 3J7AC 1ZNWA 4PTZA 4UEKA 4FQ5A 4Z4IA 2L0XA 3A9CA 4R6WA 1N3BA 3KPUA 3ZJTA 1N3YA 4QPPA 4LZLA 3TOCA 1I0LA 5AVZA 4RJTA 1D1QA 2Q07A 3K94A 3AERB 1F51E 2IKQA 1KEZA 1BXRA 2CXHA 1ECJA 1JR2A 2VNIA 1K5HA 4JDPA 5AIAA 5KC8A 3VPAA 4YROA 4Q4HB 3UW1A 1C8LA 4Y2JA 5LZ4A 1WZ2A 4HF7A 4ARVA 4XI9A 4MKXA 2IOYA 4GZMA 3WIEA 4AUKA 4K88A 4UQLA 5F76A 2UXDB 2BRUA 1G66A 2O8VA 2ZEJA 1MAAA 4FD2A 4MGIR 1GDTA 2IHBA 1XU9A 3WLQA 1QHHB 3KEQA 5HDQA 5BSHA 3KYDA 4E94A 2GZ2A 5AMXA 4JJ8A 1F0PA 3FYUB 3S6JA 3T5BA 2FSPA 2P6MA 5HDBB 1DIRA 4DBZA 1EHIA 1L5SA 3WLRA 2P2NA 4H1VA 1PL7A 1JXOA 3GP8A 2PYIA 3MAAC 3U80A 3SJUA 4K9QA 4BFLA 4HQOA 1BJKA 1JTFA 2QR5A 5EPEA 2FVXA 4LSGA 1ECGA 2FMUA 2G71A 2H16A 5D00A 4EA9A 4G37A 2NPOA 1C14A 3A6KA 4QFDA 5CA0B 1D07A 1BE1A 1NBMD 3CRRA 3CUWA 4RLFA 3OWHA 4ZDIA 4NE9A 4UDOA 2A9QA 4A0GA 1E0JA 3PX3A 4UXJA 2WIGA 3SDZA 1X2EA 1DT5A 2W2LD 1ZH6A 1MB0A 1RQPA 1AA9A 4HDQB 5F1KA 3LSTA 5CX4A 4ILEA 2W8BB 4AQDA 5JXWA 3G5AA 4PQYA 3OD1A 2V4UA 1UMDA 4W5NA 3D6HA 1F12A 4X85A 2EW2A 4Z3DA 1OKKA 2ISCA 2QX6A 1MIOB 4IDCA 2ZE5A 4NH0A 4F8EA 1T5BA 3DVRX 4KLAA 2Q0XA 5AKLA 4BGIA 1TCVA 5K0NA 5BNTA 2XKKA 3HADA 3EXHC 3Q15C 4TMFA 5DGXA 5DLPA 3KSDO 1F7VA 3DTTA 2ZRPA 1ESZA 3HU3A 4BUCA 4DSTA 2ZPAA 1I2DA 4Q05A 1UBCA 3B5EA 4HBZA 3Q9NA 3DMTC 2FP4A 1LB1B 1E9CA 5IAGA 2NN3C 2BFAA 2W6ZA 3TRKA 2K6GA 5H8WA 2C1XA 1IIBA 2OLKA 3QJYA 1KS9A 3EGOA 2GBCA 4BUJA 1QIKA 3JVDA 1ODJA 1GPDG 2OCXA 4NHOA 4MTCA 3B9BA 4MR8A 2FR1A 2VWHA 3JQ8A 5F7OA 4UQPA 2I3GA 5MN4A 1QTNA 2FG7C 2YVAA 1VE7A 1ZGCA 3N9IA 2VKQA 2WIJA 4JHLA 2NO7A 1I5EA 4UBLA 1OBHA 1CUVA 3V46A 3H87A 3ZK9A 4XUEA 1WXEA 4F1WA 3RHFA 3FCYA 1A27A 4JELA 4BATA 3H6GA 4H3KB 4COKA 2P75A 1PUJA 2ZYTX 4LF4B 1ZIXA 4FYYA 3UVEA 2YV5A 2NTYC 4KB5A 4OHXA 3TZBA 2JARA 3IV6A 1QP8A 1MD9A 4MS1B 1C7ZA 1PIWA 2CFOA 2Q6VA 4IYJA 3B6MA 3HZHA 5CYOA 1QQ7A 3WLEA 4C7KA 3FFBA 5TF4A 3CUVA 3L06A 1ZMTA 3H11B 3O3OB 5ICFA 4EKEA 1CJCA 3I52A 2BHSA 3BMNA 4UU7A 2X9VA 5DXFA 4FSDA 3TUIC 3GPDG 1CULC 4RK6A 4D80A 4BQEA 1HDRA 2PLRA 4KQJA 2AZDA 3TDNA 4YR9A 3AEYA 3VC7A 4NU6A 2HYDA 4Y2GA 2JB9A 3DE7X 3RDPA 4RHXA 1Y8AA 3TD9A 2H2FA 1RKVA 2WHPB 3KVOA 3O2JA 3TSAA 1UC4B 3GDHA 1Q1EA 4J76A 2Y93A 4N41A 4E4YA 2C9OA 2ZQ5A 5CCEA 2WUGA 3O8QA 5IP5A 4GGPA 1KAMA 4PBRA 5I7VA 4QLOA 1KDPA 1FRVA 3WK9A 1E2NA 4FJ1A 1G3RA 2Y1GA 3ZHRA 6GPBA 1LDYA 3HXTA 3LPDA 1NJ6A 3LWNA 5LXTB 5DI3A 2DJ5A 4XFDA 4HRYA 1WVMA 4D43A 2VF4X 4LCJA 3ETJA 3LVBA 4QXMA 1CTQA 1KO1A 1ZEJA 3D6NB 3P0JA 3I58A 1JLSA 2HBYA 3UXYA 1S3GA 4ZKDA 4ZJZA 2P6NA 2QUZA 7ABPA 3DB1A 3HDTA 4PSKA 4HTAA 4UQOA 2NOAA 4FJ0A 1K4MA 1ENZA 2Q49A 3RTEA 4Q3DA 1YDMA 1L7QA 1I51A 3OJ0A 4NZYA 5CB4A 2HCJB 5JNVA 4DCVA 5LYJB 1Z2EA 3AK4A 5IJXA 1V8FA 4EA6A 1YBAA 2P9JA 3HA2A 3AB7A 4NAHA 5ITZA 1SH7A 5HEKA 4BNIA 5NULA 2CYAA 3N6XA 4L07A 3IAS1 3PXAA 2Z30A 3MFYA 4UEQA 5EQFA 1Y4UA 3B1XA 1TU3A 1XGKA 4WDQA 1UZMA 1N36B 3L04A 1ND6A 1SBNE 4EF5A 1WUIS 4FD3A 1O6FA 2FN4A 4EVQA 1F9AA 4XWKA 4YX9A 2P3SA 4DM7A 2H4ZA 2ZRIA 3KZMA 4ILKA 3U0BA 5C4GB 5I5EA 1HX7A 5DTJA 4J0EA 4XR4A 4DQUA 1F0KA 1HYBA 1XRLA 4MQFB 4BQOA 2W22A 4KVGA 4D9GA 5BSGA 4UJ3A 4R2XA 4D3ZA 2C5FA 2CSUA 3M81A 5IJ0A 2HJSA 1G21B 4BTLA 1CSEE 5TGTA 5JAIA 1V3UA 1IRIA 2KX7A 4R0MA 3RSSA 3LY7A 4LRYA 5MF6A 4PTLA 3IX7A 1G5IA 1K3FA 1GR1A 4RHTA 4HCJA 5C53B 2EV9A 4IZOA 1WMBA 4JOSA 3FFXA 3HEBA 4GP9A 1PW5A 2BONA 4TMTA 4Y8VA 3T1YB 3T06B 1U2QA 3TX2A 1P0PA 2Q4EA 3IPRA 4HAZA 5J2TB 2PGIA 4MMZB 4B6EA 3HWRA 3LHIA 2JJ2D 3DF9A 5G1NA 1L9KA 2AR0A 3E0XA 5JOQA 1YQUA 2QXUA 4M49A 1N2SA 3E05A 2HO5A 2Y71A 3AB8A 1L1QA 1T6ZA 5B6IA 4KZKA 2YMMA 3IILA 4PXAA 1M54A 1S4QA 5DK6A 4ABYA 2WP0A 3QUBA 4I99A 5ARCA 3S0JA 4GSKA 5EWLA 4IIGA 4ZTUB 3QNMA 3RD5A 2XTJA 1FFSA 3DAHA 2IPMA 4HN9A 4UTZA 1CQXA 4XAQA 4XX0B 4YUXA 4DB4A 2GZ3A 5T4HA 4EGSA 1D9ZA 3A1SA 4HDMB 1NQXA 4ARAA 5JEEA 3KOXA 4NNOA 1RXIA 4UM8B 2R1ZA 1GQ2A 3UMJA 3CW2A 4GO1A 1C3OA 1V1MA 2GYYA 3PCTA 5CFZA 4DANA 3IA7A 3C24A 3HCBA 2CL0X 2R8PA 1VYVA 3R6WA 4D81A 4MV3A 2R7LA 2RHRA 2ZJ6A 2BGUA 4IMJB 4ACBA 1SIWA 3CFYA 4DDVA 2O14A 2V8OA 2VOEA 1FLNA 2XNDA 5BSVA 1P7WA 2ZSJA 5CDFE 3DZGA 2GFQA 2WUWE 4W9NC 4F3RA 1VL2A 4M8IA 5JAOA 2PY6A 4EPWA 5KDOA 3A3PA 3HDHA 2YW9A 3KNZA 2QAGC 1A2QA 2WFZA 2QD4A 4HWOA 2O8DB 4BMSA 1U0BB 3R3JA 1EDDA 4AZ0B 1NY5A 4AMYA 4PXYA 3VDXA 2IW1A 3NR2A 3PI7A 1ML4A 4ZAGA 4E07A 3DMDA 3A1FA 5EJGA 3RRYA 3IOEA 2IKSA 4LWPA 4DN6A 5CAEA 1CLUA 5AI8A 3GLGE 4D9CA 4DQKA 5T41A 4L0MA 2XHZA 5EJFA 1NVAA 2A14A 1JYFA 3DDOA 5TLSA 2D5CA 4YO7A 5CIYA 2PYDA 4BO2A 1ZIDA 4EYQA 2B7BA 3IAHA 2AE2A 4D02A 1ULAA 1R7RA 1RM3A 1BKSB 3GRUA 3I2YX 3O4RA 3SZMA 3S8EA 1Y7HA 2BKXA 1GPYA 2X22A 3KTAA 4HQKA 2FK8A 2KS6A 1C3LA 3GBVA 1FTNA 1UPTA 5LDHA 3Q85A 2AIRA 4NLLA 3IMKA 4G81A 4UCFA 2QIOA 5U4QA 3ZWYA 3CE6A 5KAPA 3LRTA 3E4DA 4CODB 3QFTA 2DQKA 1OFUX 2X86A 4G85A 1AD2A 5FOXA 2IYEA 3GWGA 4TLLB 3RVDA 2WM2A 2D1SA 3M34A 1XCGB 4E30A 1ZJYA 4LZZA 4Q15A 3EVFA 1SC9A 5F1OA 3CUYA 3LS2A 3ANYB 3PYLA 3DS8A 4Q1CA 5AHOA 3VUEA 4A9AA 1OAOA 2HA2A 3ABIA 4ZHSA 2OVFA 4M1SA 1V35A 2HPAA 1TECE 4FT2A 1TIBA 2C2WA 3G17A 3NGXA 1TUBB 1XP8A 3I3OA 3MWEB 2NQTA 4R2HA 3DXZA 4RGQA 3W8FA 3X2EA 4EHDA 4B84A 1T9HA 1R6VA 1DRVA 1O6ZA 3AVPA 3D3QA 4I81A 4I4NA 3V7UA 3E4CA 3GLHB 4YRGA 2RBEA 1OYYA 3KL2A 1JFTA 5IJ9A 5EERA 2ZSKA 1GP2A 2HQ1A 4B87A 4WZ6A 3F1LA 3NV7A 3OESA 2B83A 4IIJA 2C84A 4M9QA 1A4RA 2VTKA 3NYQA 1E94E 3UJ9A 1RAGA 2XA1A 2QZ9A 1EGVB 3AESB 3K9LA 3KLBA 3REGA 3TKAA 1XLWA 821PA 3SBOA 5EVJA 2XB6A 1IJBA 1CJVC 2AG5A 3FNFA 4QYIB 1P80A 3LBYA 1L5HB 2UZ0A 3U4QA 1H66A 1XTKA 3DV2A 2B2XA 2AA3A 3TEFA 3O38A 4DCMA 3K05A 5JDCA 5J23A 4NCBA 2P4EA 3MC1A 5H7XA 1P0IA 4QOFA 2GDZA 1GNSA 4Q39A 1BCSB 1CUEA 1UL1X 1UEXC 2VO1A 1TF7A 3ZY4A 1K7SN 1ODKA 4DAEA 4N0QA 1X1TA 2GH1A 4FMDF 3WY9A 1FTWA 1T2FA 1IPFA 4CFZA 4II3A 2OCPA 3MLAA 2VK1A 5T4BA 4FC6A 4BL5A 4MV4A 4BQIA 2RC6A 2WHQA 5JD5A 1QAMA 4R40A 4WXYB 4EJ0A 2CKMA 2PWBA 3F8TA 1UKYA 3FSJX 3G8BA 1YNSA 2CVPA 3NPMA 3QFHA 2QM3A 2YY5A 3AY3A 3E82A 1AN0A 1JXQA 1H05A 3DWGA 3E70C 4RVFA 4YNBA 3T5GA 1ST2A 4ZC1A 3UJPA 3LL4A 2XQGA 4P53A 2B20A 5LDDC 4PO9A 5KTYA 2VK4A 3QX8A 1ZUWA 1YUMA 3DZCA 4L0DA 4X6XA 1T43A 5K3CA 1BGVA 3TW0A 4BUZA 1J8QA 4JLMA 1RSZA 3K1YA 2IODA 2NZWA 3QI7A 1QGYA 3OQHA 4Y2XA 3TR6A 4DQVA 2AG0A 2NZUG 1H6DA 3WWPA 1Q0LA 3C41J 4B4KA 1E7YA 2R68A 1J7JA 1Y4SA 3GRAA 4I9GA 4QATA 5EKXA 3VU1A 3Q3CA 2OUIA 5CLHA 2HDHA 1JPNA 3OQIA 4GYKA 4EYOA 3FE2A 4GL4A 1K6JA 1KQFA 1PJBA 1EAYA 3V2UA 2E87A 3E22B 5E1OA 3WDLA 4E5DA 1A3CA 4LTMA 4N5IX 3C8MA 3OTQA 4JR0A 1XCBA 3WYAA 4K03A 2F9FA 4KH0A 1CR6A 3CLTD 2HEIA 3CLRD 3EG9B 5TJ9A 1F0NA 5AI4A 5CCDA 3BCSA 1V11B 4M9XA 1JSXA 5CK5A 1T8RA 1WA5A 1Y3DE 3DUFA 1EP1B 4YUVA 1TTPB 4ECAA 1QO7A 2V9ZA 3LCCA 3PF8A 3V7WA 5AVYA 2VP3A 4HUTA 2LTAA 5CP8A 4DG9A 4DV5B 4ZYZA 5MHTA 3AWDA 4FU0A 2IU6A 5M3BA 4RMJA 4UASA 3QK7A 3BCUA 2F1RA 3ACDA 3WL7A 3I34X 4OI2A 5C0OE 1R2QA 2V7XA 1JTVA 1TDJA 4FKMA 4NPAA 1RBMA 4TV9F 3UJDA 4KRFA 5K3SA 4CL0A 1TT5B 5EWJA 1VIAA 3VZQA 3CW9A 4LOLA 3KYIB 2XADA 4B3MB 4DR3B 3GFPA 4KRXA 5TR9A 1O6CA 4I08A 2PUFA 3WYBA 4K6MA 2IYYA 1M0WA 2UV8A 2B25A 3DNMA 1CUWA 2HQBA 3N0XA 2L17A 3RH0A 1YTUA 2JCXA 4Y6LA 2W6JD 1E79A 5GINE 1BIFA 3EXFB 4HH4A 2HU7A 4EQ6A 1IU9A 1G7CA 1UC8A 3H1BA 1NUQA 3BGWA 5IAOA 3QEAZ 1YHZA 2G0TA 5DVZA 4DGQA 4KFCA 5KSWB 1WKCA 1Y6RA 4CRWB 1TAUA 3UGKA 1ZUIA 3KYBA 1JFFA 4OA8A 4QQFA 3H5IA 1GPLA 1C1YA 1N33B 1H42A 1DDOA 1G8AA 1KQOA 2DPMA 4Q02A 5FBRB 1AQIA 1K4YA 3N8DA 4GLFA 3T8YA 2G1KA 3UWDA 4O4HB 4ZYVA 1LPAB 1ZBQA 5CB8A 3IE2A 4EMSA 1T9KA 1DEXA 1XUOA 1V8OA 4FGUA 1XQWA 3AR2A 1JB1A 3HGMA 1KZGB 5EUBA 4HAWA 1T9DA 2BISA 1V5GA 2AVNA 2PLNA 1UQTA 1C7JA 2YV1A 1C7IA 1NXOA 2O2DA 4J0JA 4L7QA 3DDWA 4MIYA 5DU2A 1XD9A 1YHYA 2BFCB 4OGFA 5KSZA 1K7EB 2FRVA 3ENNA 3RK0A 1BFDA 4QUKA 3PXCX 1F2UA 1E1YA 1G4UR 3FRJA 1NURA 1RVV1 3R7NA 1CS0A 4QTTB 4YT2A 5BN4A 1T24A 4BLSA 2JGJA 3GRFA 3AUTA 1FVFA 3U17A 1SKBA 4ZT2A 3H8WA 2H0AA 4Q00A 3ZW8A 1R0LA 4GLBA 1US8B 4D42A 1GA6A 3Q6IA 1RLUA 4ZV7A 2VQFB 4E22A 4M60A 3V6MA 1H8EA 5A3QA 4I4TA 3ZGVA 2B8NA 1W19A 2R25B 1V8BA 1ODIA 2CHGA 1OASA 3NVAA 1OI4A 1PSWA 1HYHA 4KDEA 1CRPA 1XRSB 4XDGA 2YYSA 4EDFA 1TL7C 3D3JA 5EP4A 4JI8B 2IYNA 3WLTA 1EK0A 3IKVA 3DQPA 1YC5A 3NHFA 4FKZA 1V4NA 4BC1A 1W59A 2GBLC 4D8WA 2YZNA 4O59O 3TDKA 5LR6A 5LCXA 4KH1A 4OHRA 3OT5A 5JY1A 2ATXA 2D0DA 3UMCA 2A0YA 3CF6R 6CHYA 2JGFA 2NUTB 3KOZA 2POQX 2QN2A 2WF9A 3OT1A 3ZR4B 2R87A 5JYBA 4UMVA 2QN1A 5CH3A 1CUFA 4CLDA 2WU4A 2FUG1 1STOA 3PHGA 1NMEA 4JGIA 1IEQA 2AW5A 3H6KA 4ZU1X 4XQ9A 5FPQA 1RKUA 5A9SA 3PEYA 1QBGA 4BNVA 3FR7A 2O54A 4MGZR 4OFZA 1M8FA 3MNFA 3CYFA 3ROMA 4C89A 4DY4A 4EP1A 4LHZA 5HJEA 5CVDA 3QXXA 4YI3A 1YCDA 2WUEA 2I3AA 2NP7A 3I76A 3U09A 1KERA 4P7KA 4LF6B 1MB9A 1YIOA 1XKXA 2P0AA 2GGSA 1CEXA 4ALKA 5AFSA 1PEKE 1AH2A 2QROA 3TXYA 4UPEA 2R5WA 3HUUA 2QLTA 4EI7A 4ZYXA 4EUNA 2R62A 1V7CA 2QN9A 1G9SA 1MENA 2GUGA 4S1WA 1SZCA 5AK0A 1T8YA 4LX0A 1ULBA 1COWA 3H1GA 1SUCA 1E2GA 1Z5PA 3ORQA 5H02A 4PGMA 2CC2A 2SKDA 4MW5A 1QHIA 3HN7A 2QJTA 3VSEA 4FXPA 3F7NA 5JV5A 4MRSA 3LT4A 3GA5A 1P2TA 5AM4A 1GZ7A 2HU8A 2RBGA 3UUFA 1RXEA 1BDMA 3TSWA 5IU6A 4MWOA 4FR5A 1DQSA 2ONKA 3MOGA 4YP5A 3CQ9A 1SC3A 2HQSA 2FA9A 1M1YB 2QLLA 2VHWA 4II7A 4Z8XA 4DEXA 5JSZA 2HWXA 3FXAA 2O48X 1MA3A 3HYCA 1W30A 4MPDA 1DG9A 2Q4RA 4RTJA 3MJTA 4J29A 4LZNA 4X1KB 4G5QA 4PYOA 2J8ZA 5EIHA 1Z4QA 3VNUA 1N6RA 1SC1A 2C2KA 3Q0IA 3DDCA 3HY6A 3N8NA 5BW6B 1GPBA 1WV1A 3WQSB 1JW9B 4MJLA 4RIIA 4FBLA 4G01B 2P3LA 5DI9A 2BFFB 1ESMA 2XT6A 4PWZA 1FFYA 1HNZB 4ZK2A 2H51A 2VEOA 4DCOA 3PXGA 1ADJA 4IVQA 2BSAA 4L3VA 3RYCB 3PRHA 1YB1A 1JILA 2W00A 2OBBA 3E1GA 2P9EA 4JP2A 3U81A 1T0HB 3D5TA 5FI1B 3ZK7A 4EL5A 1KI7A 3HBJA 3LUGA 5ER9A 5AW6A 1ISPA 4L22A 5JADA 4U2DA 4ZZ1A 4EY6A 3CE9A 3TPZA 3D4BA 4ZHQB 2CSXA 1QZXA 2A1TS 1M7GA 1UC9A 3DMGA 4G3XA 4B4WA 5LFAA 1P8AA 2HCRA 3VC1A 2C7RA 1U6JA 1ZM4A 1EVKA 3TZEA 5IF3A 3TTWA 1VL5A 4LBZA 4LZOA 2NU8B 2OM2A 2XQJA 3H4IA 1N4AA 1MX5A 2BCGY 5H80A 3W7VA 1EJ2A 1N1MA 1UFOA 1SC4A 4F11A 1C0IA 2Z8YM 4TOIA 4Y6OA 1P39A 3A6LA 3VOAA 1YUNA 4EY5A 2RH9B 3O8OA 5AHRA 4QHYA 2IPNA 3BN3A 4NPHA 5FOUA 4Z0PA 3V7FA 3X1JA 5LN1A 3LU1A 4M0DA 3PITA 4MO2A 3K4QA 4X7RA 1C7EA 1JS1X 3TLBA 3R5KA 3DLPX 1LW6E 4H0CA 3HV0A 4H08A 4IDFA 2G5PA 4Y2RA 4YDRA 2IE0A 2I62A 2RJNA 1O03A 1JAIA 3E9CA 2X23A 2VLBA 4A27A 3UAGA 3IBSA 3U4DA 4KQ1A 5GM2A 3WNQA 1RYZA 2HZBA 4QRIA 4IQFA 2ERCA 1A69A 3V4FA 1W581 2HIAA 1QMGA 2J9RA 1PT8A 3STVA 1F2VA 1H2WA 3EQ7A 2ZBRA 3KSZO 1AVTA 4NCAA 5EJMA 4TLBA 5BY2A 2YV4A 4X7PA 4ZT3A 2XYGA 3G9ZA 3T0GA 2O2JA 1EQAA 1K8RA 4F5YA 1G2OA 2GZHA 2GB4A 3KKEA 2G80A 3V4SA 3NYWA 4DB2A 1IWPB 1TQ4A 3KDPA 1FC0A 4DR5B 3PZRA 3QKRB 1MO2A 2H4JA 1JJAA 2P9GA 3LHFA 2FSSA 3DVAB 4RZSA 5E1DA 3FB4A 2HXGA 2YWBA 4BVLA 3KAPA 1AKUA 4MV9A 4E31A 2ZYGA 3DE0X 1QVVA 4GS5A 4NEQA 3R7WA 4P93A 1J06A 4AUNA 3SC4A 2W2OA 3CH7A 3SXPA 4MHTA 5HTOA 3EISA 1XWFA 4DMRA 1UADA 2BEVA 2FFRA 2O2ZA 4GYYA 3I5XA 4OYHA 2MYNA 4K0KB 2COUA 3U6BA 5JH7F 1F06A 1H6BA 1MEJA 1PEAA 2PV0A 4MIOA 2P79A 1RRCA 3FWHA 5CFMA 4KOAA 4F56A 1ONNA 4NTZA 2W9XA 3PQ7A 4N3CA 4ZVMA 4KQ2A 3C3WA 2WWVD 4Q1AA 1P7ZA 1X1CA 1PR6A 4JFRA 1L7RA 4ZVSA 3I92A 1QFMA 3KP1A 4AUMA 3K92A 5K0SA 2Q7XA 1GV1A 2FWIA 2GZSA 5KHAA 3DAFA 2FPRA 2UVPA 9ABPA 5KVQA 5GGXA 1MH1A 1V96A 1XTJA 2A9OA 4PYNA 3UK7A 4ZO8A 5BNIA 3LQQA 5G0WA 2N42A 3CU5A 5IAAA 4XGKA 4HVAA 1MEOA 1N0HA 1E2EA 1ORIA 3MM4A 1YONA 3OD5A 5FOWA 5KU7A 3L46A 3ZQJA 4CEHB 4NFYA 4GBMA 4RK5A 3LQ2A 2UYCA 5KDDA 3D7SA 1OSNA 3A3OA 3F9RA 2DQSA 3PC2A 2IYQA 3SZ3A 3H19A 4J3NA 1J5EB 1YJBA 3L40A 3Q40A 5B7PA 5FEUA 4OXNA 4HH0A 5L4NA 2C97A 1AKTA 2X41A 1U1CA 1WBJB 2OZLB 2Y0PA 4X1YA 2O05A 4JC8A 4HB2A 1DWUA 1Q7BA 1EVZA 1FNBA 1G7RA 3ONDA 1LA2A 4QRHA 2Z2XA 5IJ9B 3H17A 3EB9A 3JVUA 1L8QA 2PVCA 3GJQA 3WIOA 3N3AC 1O6BA 1BTOA 1NQOA 1CUUA 1PJSA 2NSDA 2Q2WA 1HG0A 2WA1A 3DV9A 3R3UA 1PG2A 1G6Q1 2QBYA 5K0JA 2FKAA 2YKGA 4XFJA 1T26A 1CEQA 3T9FA 3S99A 4EHNA 1PNTA 2WAOA 4GP7A 2AZXA 3H3JA 3CLHA 2CMDA 2YXNA 3PNQA 2VJKA 3V4PB 4JN6B 4ZCIA 2VAPA 1EJBA 1QH1A 2G40A 3TTVA 3BVPA 3E1KA 3QX7A 4YALA 1VPWA 4RL6A 4M7RA 4RULA 3EA4A 2WOJA 1S9HA 3CF4A 1RPTA 1W36D 2ZTVA 2A0FA 4YP6A 1YZQA 3GK3A 5HMMA 3SVTA 4FMCB 2AWNA 3OMXA 4AJNA 1XRMA 2ZWAA 3M83A 1GCUA 4DDWA 4B35A 3THXA 1U6IA 2HY7A 1GGHA 2CWDA 1XJCA 3FTQA 3PJFA 2Z8XA 4KACA 3LJKA 5BN5A 5TPWB 2D5IA 1P91A 4KX3A 1NN0A 3GAZA 2WPDD 4RVHA 5FF9A 1JDNA 4FLFA 1TKCA 1SCIA 3ZZUA 2NZVG 3EGDA 1L3IA 1WCIB 2ZYVX 3FDZB 1AMNA 3N8KA 3RHZA 4UW9A 4CM4A 1T25A 1YRBA 4RF3A 2JA1A 1FJXA 1DX6A 4L57A 4LEIA 4MUIA 2VPZA 4PBTA 5SY6A 2PGXA 4DNXA 1XDSA 1PUXA 1NUSA 2VNJA 2WMYA 1RZ3A 2IOFA 2VDMB 3DH0A 3KVRA 3WGYA 4AMVA 2GOYA 1SG0A 3FUVA 4CKCA 3VMFA 4QM7A 2HEGA 4NX2A 3CZQA 3N76A 2QGFA 4EUSA 1SJ9A 3IP7A 1XRNA 1X6VA 3C16C 1IMJA 4WKPA 1HETA 3KB6A 4M22A 4AYXA 1HLGA 4P32A 4TKUA 5EJ6A 3O4IA 5F9HA 3RRNA 3SDSA 1RYDA 2E21A 1KQPA 4JEHA 4KTVE 3RUAA 4HDCA 4GM0A 4UOEA 4J1NA 1E1NA 1S7GA 5L3VA 3QFSA 1UXHA 2VDLB 2Z8YA 1G9XA 5HKKA 3DE1X 4GBED 5TPZD 5C5CA 3WRXA 1YVDA 3IE1A 4RS3A 1R6BX 1M2HA 2DHDA 4UU0A 3RROA 3ZWNA 4ER3A 2RI6A 4QXQA 1RMTA 4LHVA 2PL9A 4DEYA 1BEUB 3PGLA 2FGJA 1YQXA 1XRRA 4HQ0A 2GPJA 2PQ2A 2BTEA 5DCYA 1IQRA 4XEUA 4F6RB 4QYMA 4U1RA 3WNDA 5H83A 5FI0B 5FXMA 2JLSA 4NEGA 3LXMA 2ADFA 2P2DA 1WHSB 2B37A 3JD3A 3MOIA 4FNMA 1TYEB 3VFDA 1Y80A 5EIEA 3QM1A 1T1JA 1PSZA 4YK7A 5E9WA 3PA8A 5FB3A 3ZJ4A 2XVXA 3RIXA 4DV0B 4R05A 3D6VA 3GJTA 3AEQB 4AM8A 1WBDA 1P6QA 1Z6AA 1VKHA 2J67A 1N6OA 4FE3A 3O1IC 4QYWA 3RVMA 3QU7A 5PNTA 4BO3A 5I01A 5GADl 4TPKA 1WABA 1P1IA 2GMWA 3AIKA 3CHYA 4TTVA 4MICA 1U0JA 1YH3A 3DYIA 5AJYA 1Z08A 3PHIA 3KE8A 4AG3A 3EJ6A 1R4NA 1LFDB 4PX3A 1RPAA 5DRTA 3ROKA 1N2CA 3EG5A 4AP5A 4NBLA 4C76A 4IV8A 1P7YA 2JD1A 1COZA 3QWAA 4NBUA 4IPTA 3UJNA 3X1DA 2G9ZA 2HSJA 2NT3A 1YD7A 4WKBA 4M37A 5BURA 2WR8A 3V1UA 2B34A 1PL6A 2BEWB 3C0KA 4RXUA 3K2QA 4YRZA 2ZUEA 2PD3A 1TW2A 4X7BA 3J80A 5JCOA 8AT1A 3Q88A 5DSXA 4X24A 3Q8XB 2RJ3A 5SY4A 1DS6A 3RJMA 2XB2A 4UBOA 2A9RA 1S6YA 4JA0A 2QGZA 4JUFA 4WGGA 2FE4A 4DTIA 4Q1EA 5CIQA 2H5JA 2QI9C 4DDUA 3EMDA 5CB4F 5T8KA 1H3NA 1WDLA 4ARZB 3WZ2A 2WM8A 4QU8A 1E4OA 2GAFA 1OLSB 4EHJA 2R6ZA 1CHNA 2L2QA 4HZUA 3UA3A 2ZJ7A 4NS1A 1ZINA 1A5ZA 4WVFA 4GUDA 5IYZB 1ZXLA 3KL4A 3ORHA 1TKRA 4OHKA 5DBIA 3FHCB 4QXPA 4WIAA 5TQ0A 3HTXA 1FNDA 2JATA 3QG5A 721PA 4ZO6A 3C45A 1A1SA 4C4TA 1P6UA 3KQSA 4PWYA 2JFWA 2E18A 2PO7A 1EI9A 1M67A 4PYLA 4Y1RA 1QG0A 1KSFX 2I76A 2PVPA 1KI1A 3E2PA 3MJ4A 3M6VA 3VR0A 3RNOA 3R3VA 4Q34A 4S04A 3HQ4O 3PQ8A 4A8JC 2FPLA 2GXSA 3K9HA 5DJ5A 2EU8A 4Z4EA 2I78A 3OE1A 5REQB 1YV9A 3ESBA 3ND6A 3VPHA 1FTSA 2WB4A 3G1WA 1ENPA 4YHBA 3BUSA 5BW5A 4QOEA 5LP6A 1MDFA 2VYVA 2YV3A 1ZD1A 4GX2A 1FQKA 4LDRA 1BX3A 3TTUA 1ORVA 4B5LA 5ABPA 2O8CB 3M3DA 3ER8A 1OLXB 4JEMA 5ALLA 2F1KA 3EXIB 1PO7A 1T0IA 3QPVA 2V55B 3DTVD 4CIAA 3I6QA 1FZTA 4MCAA 1KE1A 4D8XA 3ZDAA 1XU7A 16PKA 2OEPA 4IMIB 4QQRA 4BQFA 2J85A 3QVOA 1GZ6A 4FR0A 5AJUA 2BD0A 2DSNA 3MINB 4FDTA 3CBGA 4R3NA 4N5NA 1A97A 2BFEA 4G0NA 2JFUA 1N5LA 3LX5A 3OHPA 4AY4A 3N0RA 2GBFA 1BD4A 3I83A 3TQTA 3RAEC 5LLSA 2ECKA 2ZI9A 5BN3A 1GDHA 2VDJA 4JVNA 2V7VA 4U2CA 4UTPA 7MDHA 3GLFB 5JDIC 5I4IA 1KKMA 3A32A 3GZJA 4FCCA 4YXFA 3A3KA 5JCJD 4U7JA 2CLMB 5IK2D 1HZZA 2H1RA 5JE8A 1U5BA 5B4TA 5A5DA 3UMMA 2A30A 2NW6A 2Y1WA 4TWIA 2JAWA 1X1QA 3GJRA 4H59A 3KJQA 5B5SA 2IUEA 4M83A 3PUKA 2PZJA 2R8RA 4X61A 1D6NA 2GZDA 2JEZA 3PFKA 4Q4JB 2PN1A 3NDRA 4F2PA 3L6BA 3ER6A 4K5QA 3P8ZA 3H2YA 4RFVA 3BE5A 1SPBS 3BHJA 3KTOA 4CQLB 4KQKA 2Y6VA 3GG9A 4GNKA 4O2BA 1GTG1 2VBCA 5K0ZA 1N2BA 5C32A 1ZUNA 2DFTA 2GPWA 1ESEA 1VSBA 1JYEA 2DG2A 1D04A 4P35A 3BYZA 3JQ9A 1P18A 1M6VA 4US1R 2IVZA 4Y6QA 2W4IA 4ZOBA 3ZV4A 2H57A 2JW5A 3JZMA 3GMIA 1L0BA 5I3CA 2BRUC 4KCGA 4DE5A 3OPYA 3FOZA 2QRPA 3MRVA 3I2IA 1NBWB 4IJ5A 4ZI7B 5KOHB 2CLEB 1D2EA 1DINA 3EHEA 3PLNA 4BJ6A 4UFNA 4C7VA 1Q91A 4YJDA 5BOSB 3AL0C 5GPBA 3RBZA 4Z7JA 5EWMB 3PENA 2P4UA 4OXXA 3WJ2A 2OV6A 4P36A 3BF8A 5KNLA 1SD1A 4NG5A 5CG2A 2ACEA 1I9GA 1XLVA 3K7EA 2XB8A 4UUOA 3S3TA 1PYDA 3UHPA 3MQFA 1AO3A 3IRVA 3I30X 1DHRA 3ZWKA 3EC1A 1K75A 3HJUA 4BWGA 3PEFA 4GC5A 2J32A 1DKPA 2O5CA 4WCDA 2Z9DA 4HX9A 1HF3A 1YMUA 1Y98A 4CM9D 3MCUA 1YOVB 3JPWA 3WDSA 1KJ9A 1RW4A 1YUBA 2C2YA 3FI0A 4UUMA 4L8FA 1N5OX 1NXSA 4B8YA 4CR8A 1EQUA 1XPUA 3I6IA 1VDZA 4M1ZA 3VJRA 1DZIA 3T1NA 3M4NA 1YDHA 2ZJ8A 4PS0A 4A91A 2HWWA 1U11A 5I48A 4IH9A 2VAMA 2V6GA 3K0FA 5SZJA 2NNLD 4S1OA 3NEYA 4H7JA 4MVJH 4MVJD 1WU7A 4WCFC 3A25A 4H31A 2BCEA 4QDZA 5B4VA 2QYHA 5L51A 2B1JA 2C2XA 4HAUA 3ZN2A 3AX6A 3K15A 3MWFA 4TVSA 1T4GA 1NVDA 2WV7A 3SLKA 2P9FA 1J25A 4GUAA 3Q3GE 2MR6A 3NHLA 3LUCA 3K5PA 1E1RA 2QTRA 1JLHA 1HOXA 3EF1A 4X20A 1YBFA 1HL3A 2ASEA 3EIHA 4JGGA 2MTBA 1VIVA 2PAFA 3CJRA 4IYRA 2ZSIA 4LJSA 1J2TA 4UHFA 1TMYA 1JR3E 5KJCA 3DOUA 3ZXXA 1G41A 1R0WA 5K2OA 4OKSA 1T4DA 1NXXA 3LTEA 3PFWO 5B1HA 5L7WA 3IT3A 4P0PB 3HXPA 1IUOA 3CRNA 2PT5A 3TI7A 4FGKA 2FSGA 3H9CA 3EDMA 1BXGB 1PR3A 3A7DA 2V7QD 2ZREA 4NMHA 4AQ7A 2Z09A 5BNFA 1XMOB 1Q1QA 4RKRA 4WLUA 4CEJA 1IC6A 3F90A 1L5FA 1V9CA 2BEUA 4YDSA 4CV2A 1R74A 2J4CA 5I7AA 1NG9A 3FWZA 1P9WA 1V5IA 3RFTA 1D09A 4OMCA 1Q0PA 1Y7PA 1PQYA 5J2UB 3T7AA 3D9QX 3HXLA 1KF0A 1NVGA 1N7IA 1YI1A 1CFZA 2QL6A 3GY0A 4N49A 2OENG 2V0NA 2L19A 2GPSA 3RYFB 3OZBA 3GG2A 4AZ3A 1VIYA 1P2SA 1PT9A 2M32A 1G8PA 4QUEA 4X65B 4IILA 3QBEA 4ENRA 2BM8A 1P72A 3FFAA 2OM6A 1C3JA 2PM8A 4KKVA 1VRCA 1EWRA 1WUHS 3V7YA 5LQRA 4GX1A 4FCVA 3NT2A 2CXQA 1PNQA 4U9IS 2B78A 4IIUA 4M1KA 2XCIA 1RQNA 5J4YA 1YR8A 5F1YA 4BLTA 3FR8A 4NKRA 5T64A 4LYEA 3OC6A 1VDMA 2WYVA 3AUJB 4YRDA 1NP3A 3FCXA 1G291 5EJEA 5CA0F 3HE3A 1EFKA 3FNHA 3OBIA 3PIIA 4WTOA 4GKKB 1YR2A 3GNQA 4DG8A 1W75A 4DOMA 5E6SA 1FBNA 2EW1A 2VIIA 3CIOA 3HBFA 4Q7KA 4I1PA 3JAKA 1SWWA 3OCYA 1XMXA 2WT9A 3A2NA 1SUWA 2VR1A 4GI7A 3Q3VA 4KGZA 5D85A 4P7FA 1N5RA 1D2AA 1FQWA 1YS4A 2HA0A 2OWEA 4QOIA 5AKKA 4DCUA 4US0R 3EFOB 3FZNA 1BCRA 2E48A 1HGXA 4FFLA 2VSFA 4YCJA 3EULA 1MNQA 3IESA 4FP9A 4UM9D 4G26A 1YSCA 3EQ9A 4LDNA 5E