2EFCB

Ara7-gdp/atvps9a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
165
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
total genus 51
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efcB00
1A4RA 3TW8B 5JSZB 2VP4A 4V0OA 3QKSB 4KFUA 3N5CA 3WY9A 1AKYA 5F9HA 2G6BA 3RANA 4B6FA 4JVSB 1CEEA 4NYJR 2D2EA 4EPYA 4JYCA 4LK2A 3WNCA 2EFEB 1DAIA 2CCJA 3CPEA 4HDOB 2A30A 4B43A 1QF9A 4LOAA 5C18A 2P5SA 2J0SA 3FMFA 2A2ZA 2KJQA 1KI4A 2NPIA 2ZYUX 1E2IA 5HCNA 4BFYA 4JLVA 1G3RA 3E5HA 3EXAA 2NZ8A 1QG4A 2OCPA 1FZQA 3GLHE 5EXSA 4MGKR 1IN8A 3NBFA 1FX0A 1H8HD 3NBZC 4GT1A 4M9QA 1FW6A 4RZ3A 4RD1A 5J4VA 2CNWA 2VHCA 1NVXQ 1QG2A 2I1VB 1G7CA 2ZAOA 3CWZA 4IOKA 4M1MA 2E9SA 4B6EA 2IS6A 2QENA 2XNDD 2AD5A 5B30A 2D2FA 3NTUA 4FN5A 4X8MA 2P67A 2IYUA 3A37A 5FL3A 3C16C 3RSOA 4LV5B 1F2TB 4GFDA 3TNFA 4OHZA 4BFZA 2LCFA 1E9FA 3LX8A 5KNDA 2GA8A 4C0AC 5FI0B 4LJ8A 2B7CA 1IN5A 4HAUA 1OV4A 3DDCA 3IEUA 1PUIA 2AR7A 3CRRA 4MH0R 1ZW6A 5G3ZA 3IGFA 5L3RA 2CVFA 2GCNA 2ZE7A 4D81A 1E69A 4KVGA 5DI3A 1GP2A 1AS2A 4LUCA 2WVJA 3M6AA 1XD9A 1AGPA 2RHDA 3B9PA 4CEHA 4DRZA 5L3SB 1LVGA 4NCNA 1Y3AA 2R6GA 2O8CA 3ZJYA 3NXSA 3BORA 1E2GA 4O25A 3TSZA 4JLPA 2ECKA 2AHOA 3BB1A 1Z08A 3QUSA 1XCGB 2Z4SA 1GVNB 5KYKA 2R9VA 1RYFA 2W58A 4K46A 3HWSA 2WWYA 3X1ZA 2W0MA 2XOKA 4G5RA 2DCUA 2J9RA 2QMEA 3DVLA 2GKSA 2Q9BA 4NYIR 1IBRA 4PAOA 2CK3D 2YWFA 2JLSA 3QEOA 2BVNA 2GAOA 1J8YF 3UKDA 4LYFA 3CB4A 1JXMA 2W6JA 2Z83A 4LJ9A 3S1AA 1OXVA 1XEWY 1W47A 3KFXA 4HB0A 4DLTA 4OL0A 4EPVA 3CR7A 3K8YA 1T5IA 1YKSA 2BBWA 1P2VA 5SZIA 5KTYA 3O8RA 3PEUA 4LV6A 1FP7A 1U0HC 3ZIAA 1HE8B 1T3HA 4GPTA 3KDSE 2ERYA 4GBMA 4DDUA 2QP9X 5EP4A 2AK3A 2QG6A 1DAMA 4TSFD 4D4KA 3BRWD 3LBHA 1KTVA 2IYSA 1G3IA 3NG1A 1US8A 2WTUA 5JRZA 2W0SA 4QJ3A 3K09C 4US1R 2F6RA 3T06B 2ZRBA 2XTZA 2QAJA 4KYIB 1Q12A 4TN1A 4XOIA 1P2TA 1Z83A 3W8NA 5TVKA 1CJVC 3REFA 3T1QA 2W2VA 3AKCA 4RD2A 4AKGA 5D3MB 1YZQA 5EE9A 1XNJA 4HUQA 1N6PA 1NNEA 5EE3A 4B35A 1TQ4A 4LJ4A 1AA9A 4WAUA 4TYQA 3NBXX 2RGNA 5E7JA 3TBKA 3CBQA 3K70C 4NTZA 3THWB 1R5NA 3AP1A 3VX3A 4G3XA 4OQXA 2ANBA 3QF7A 2V8OA 1GRRA 2A5FA 1H8ED 1E2JA 2Q3MA 5EE0A 3UMFA 1D2MA 3LBNA 4YMUA 1TL7C 4ASUA 4LJ7A 1RVDA 5FFMA 4BFUA 4TZ0A 2BV3A 2OBNA 1W44A 1ZYUA 3RRMA 3M0EA 4EPRA 1R0YA 2QRZA 1JEDA 2P65A 4WXRA 3AUYA 3CRMA 2O52A 3QF4B 2JLXA 4BLTA 2WJVA 3W9YA 1TNDA 3ADCA 2JJ1A 3RABA 4G01B 1GRQA 3EIEA 1IJEA 1QHYA 1E32A 1TQ6A 2C77A 2GJKA 4BLQA 4Q4HB 1ZM4A 4XJXA 2ZRMA 1OHHD 2NIPA 1KDOA 2LKCA 4KXFB 3U6KA 2WAXA 4DKXA 5TMPA 4DIEA 4P0TA 4BECA 1L8QA 5AUPB 3AVYA 1K5DA 2J46A 2C03A 4UXJA 1G291 1X8LA 1WB9A 2EYUA 2GXSA 4KAXA 2IF2A 2R6AA 2V4ZA 1EG7A 1M2OB 1GRNA 4GI7A 3QPUA 1R8SA 3PFIA 4Q4HA 1XTRA 2QGNA 1MO6A 5J4KA 4JZKA 5CYPA 2IYXA 4NL4H 5E4FA 5FOXA 1NG1A 3QKUA 1G5RA 3L8ZA 4B76A 5ELXA 5JJIA 4EPTA 5FOSA 4KBFA 3ADKA 2QQ0A 2QORA 4BFSA 4DEXA 4OK5A 5HR5A 2ZS8A 3IPXA 3K9LA 1OKKA 2W83A 2GCOA 4XTRA 1R10A 421PA 3RDPA 4CEJB 2QBYB 4TTPA 1ELOA 1UBGA 3O47A 3X1WA 3SBEA 1BS1A 2H18A 4I1UA 4TQAA 1UDXA 4TT3D 4XTCS 3REGA 4UNQA 3B1YA 2DY1A 4BFTA 3EPHA 4V0ME 3F0TA 5GJWC 4B73A 1YR9A 221PA 2P6NA 4E22A 1N6NA 1JR6A 2ZREA 2NO9A 4B3BA 1BMFA 2FSIA 2OV2A 3GJ4A 1KI9A 5AJXA 4JLAA 3Q5DA 3WBKA 5J4LA 4JBXA 1W36C 3QXHA 4PPQA 1ZRHA 3OE7D 3NHBA 4QL3A 1KIMA 1NN3A 4JLDA 4JL5A 2GXQA 4JT4A 2F43A 3TLXA 1UAAA 3AF3A 4Q00A 1FUUA 3BIFA 4TQUS 4D0NA 3RNLA 2IXGA 4BE7B 3O8DA 1Z28A 1GZSA 4OI1A 3T5DA 1XWIA 2UKDA 5HE9A 2IA5A 4QBHA 3AEZA 1KI7A 2XXAA 2ZETA 2C2HA 1XDBA 3AVVA 2V6IA 1SVLA 3VR2A 1U98A 1KO8A 2FMXA 4TL8A 4HAVA 4D80A 4OQLA 3N2IA 3EZ2A 2VP6A 2FZ4A 5FBWB 1P9NA 1FUKA 2EU8A 2BM1A 2JASA 3X1DA 1SQ5A 1UKVY 3WP0A 3LLUA 3SQXA 1T5LA 4Q7MB 3RSLA 4EPWA 4B3GA 4PX9A 1Y63A 2B21A 1JECA 2BWJA 1LFDB 3IUYA 3NDPA 4IVRA 3MJRA 2MMGA 4UJ3A 1G8YA 2QN6A 4F91B 4WA7A 4MQBA 2VYFA 3EPJA 1KMQA 3NC1C 3B7GA 1KDTA 4ESVA 3ZVNA 2NGRA 3QEJA 3P26A 4NU0A 2D74A 4Q01A 3U2QA 1A2BA 4UNPA 4TYPA 2I1QA 3FKQA 2J41A 2XSZD 5DYIA 1NMZA 1WP9A 3K9GA 3ZVRA 5KU1A 4FWIB 4PC1A 3BH6A 1X86B 1D9XA 2QSZA 1DO0A 1N5LA 1TAGA 1CBUA 4PAMA 4JL6A 4TMTA 5FBLB 4DEYA 4D4JA 3RS0A 4PO9A 1RIFA 3GJ3A 4NPHA 3FMOB 1C9KA 1K8RA 1JEEA 3ZH9B 1U0LA 2FFBA 1Z3IX 1KJZA 4UJ5A 3KQLA 2G3YA 1BOFA 1RRPA 3K0CC 4DLXA 3U3RA 4G1UC 4HZUA 1NY5A 3D6TB 4QGHA 2JLZA 4EQ6A 1OB5A 3R9WA 3EW9A 3K70B 4A0FA 1EFTA 2AFIE 1OT3A 1SXJE 2ZRNA 2AXPA 4GNKA 2HT6A 2L0XA 4M1WA 4MGZR 3RS5A 2CE2X 1NBMD 3UANA 4FINA 5FUVA 5E7IA 2ZSAA 4UNNA 1HV8A 1JJ7A 5CK5A 4A15A 1DTSA 1FX0B 2IT1A 3MLEA 3CR8A 4DLRA 2ZSBA 1XPUA 2JJ2A 5GVSA 1HUQA 1HQYE 2FSGA 4BEJA 3PEYA 1GTVA 1DG3A 3SYKA 2VP2A 2VHUA 2ZYVX 3RRZA 2ZRCA 3NEYA 4Q1AA 3QIAA 2ZJ8A 1E1QD 2F9MA 5E3HA 4C0JA 1U94A 4RKFA 2OXCA 1VTKA 5H8WA 2D3WA 1JAHA 2O0JA 4URUR 5JWRA 4URYR 1AS0A 3L0OA 2J7KA 1Q57A 2RGEA 3CZQA 1E2KA 4QBIA 3SJCA 1YZLA 3TAUA 2NZJA 3S1AB 2GVDC 2JA1A 3PR1A 5FPSA 5L3VA 4ZCLA 2EFDB 1NVWQ 2WIBA 4ABYA 4JVMA 2QEQA 2X2FA 4MDFA 4U5XA 4JLOA 4JMPA 3FGNA 4I1OA 3LRPA 3SJZA 4ZI3A 1TQ2A 3I3SR 4O0MA 3AVQA 3CLVA 4PHGA 4A4DA 1AN0A 2GEVA 4PC6A 5G3YA 4BLOA 4XWKA 4MKHA 3AVUA 4DB2A 4C0BA 2OG2A 5LB4A 2Q21A 121PA 3KQHA 4CRWB 4DJTA 3K1JA 1OYWA 4CT5A 5P21A 4AY2A 3OEHA 2ZJOA 3TJZA 3U7HB 2CNWD 3KJGA 4M1SA 4F4JA 1XMVA 1TUIA 4FMCB 4LHWA 3KTAB 1EK0A 1CJKC 1GILA 4QRHA 1E99A 1YJ5A 3R8FA 1XJQA 721PA 4JT2A 4G5QA 1IOZA 1QHHA 3I1FA 4F4CA 1DAFA 3UG7A 1ZMXA 4ZIRB 2W6ID 4OK3A 5CB8A 2CHVA 4BEBA 3TQCA 1E4VA 2B92A 1OH6A 1QHGA 4UNRA 3C7KA 4IXNA 2FEOA 1UM8A 5FBVB 4M0LA 4YONB 2ZSEA 3CKLA 2GZAA 5DISB 2IL1A 1XXHE 1YRBA 4B34A 1E9SA 1VIYA 4LPSA 3UPUA 5TARA 1IONA 2R6CA 4PANA 1JQJC 1G6OA 2NQ2C 1H65A 2DBYA 2QMHA 1TUEA 5G53C 5IK2A 1X8KA 2QA5A 4HSEA 4NMMA 3U4QB 1AKEA 4TMKA 1LNZA 1PUJA 5KHOC 2ZVPX 2WWIA 3LV8A 2F9LA 3RC3A 3VFDA 3H86A 4K81B 2OBLA 2G88A 4N0DA 1P3JA 3U3MA 2QTFA 2OXRA 1P4SA 2QM8A 4OI2A 4PSVA 4X8LA 4CEJA 5AJVB 2QTVB 4JL8A 4Q4LA 4LHYA 5JJKA 1U90A 1P73A 1OXTA 4WXPA 1ZU4A 3QBTA 4LYHA 2ZJZA 4M1TA 1IXSB 2F55A 2ZR0A 3KUDA 2V54A 3Q85A 4JSTA 3NIBA 3VQTA 1XPOA 2QP3A 1W5TA 3PCRB 5FTNA 4PSAA 2W6JD 3H1TA 4FMDF 1SVIA 3K0FB 2RGNC 1D8TA 1ZIPA 5C2JB 3GFTA 2SHKA 1B0UA 3KKNA 3RS2A 4MYHA 2ZJAA 2XB4A 4KLNA 4R98A 3ICQB 1SXJD 4XVRA 3SDZA 3ZIAD 4C0HA 2WIAA 1ZNWA 2FWRA 1ZC3A 2IHBA 1OXSC 3LQRA 4XVUA 1Z29A 2PEZA 4LDJA 1KGDA 2ZRIA 1JJVA 1R6BX 3P1JA 4XVQA 3N2EA 4B47A 2DFNA 4WOPA 4BPBA 4C2TA 2DWQA 3TGPA 4OQNA 2YYZA 5DN6D 4PC7A 2XZOA 5FR2A 5A0FA 2MSDB 3BH7A 3L0SA 1Z0FA 2Q3HA 2RB4A 4MRRA 1R4AA 4W5HA 3QXSA 1DAEA 3N70A 1N0UA 4W7SA 2WKPA 2JIZA 1R5BA 5BYKA 821PA 2NO7A 2C78A 4FD2A 4LJ6A 1X8JA 1XZQA 3THYB 1E9DA 1GOTA 2C04A 3I5YA 4HUTA 4XD7D 3FWYA 1G19A 1XJ0A 1F2TA 2HXYA 2WSMA 2YOFA 4PFSA 4ZCMA 2MSCB 5GADl 4MKGA 4EPXA 4IDPA 3RVBA 3LA6A 1RJ9A 2FGJA 2QPOA 1E2PA 2BCGY 3P4XA 1CRPA 4D0LB 1U2RA 4JSYA 2PT7A 5EXPA 5HZKA 1W2GA 2QI9C 3PUZA 1AIPA 3CONA 3GJ8A 2HYIC 4HAYA 2JGNA 5KPJA 3CF6R 3VHXA 3MMPA 4A1FA 2IYZA 4LJYA 5JCPA 2VH5R 3LXRA 4NDZA 4PO1A 5DO9A 4QBGB 3TE6A 3SI7A 4KHZA 4D4LA 1KO4A 3MUFA 1KZ7B 2GESA 5B2ZA 3D8BA 4GP7A 4HATA 4O3MA 3DO6A 1SVOA 4EQ6B 2CCKA 4BFXA 4RD6A 1E94E 3DL0A 1Z0KA 4TLBA 4KFRA 1RRGA 1MRSA 2F7SA 3KQKA 1N5KA 4JLBA 1UEIA 4NCIA 2D06A 3BAFA 5JSZA 1N5IA 3B6EA 3KTAA 3MG9A 4A0RA 4GMXA 3BXZA 3UWOA 4B3XA 3Q5EA 1LS1A 3DHWC 1OSNA 4ARZB 3EC2A 5AUNB 2YZ2A 3EA5A 5FR1A 3LW7A 1E98A 2PBRA 4HAZA 1ZUIA 2QMUA 3KXLA 4TTRA 8OHMA 4MDEA 3PUXA 1GL6A 4JKYA 3QE0A 1HYQA 2CL7X 4U00A 4QNRA 3G0HA 4TLEA 3PIRA 1PLKA 4KO8A 2KWIA 2OCBA 5FPHA 1XCPA 1KOFA 2PLRA 1M34E 1A2KC 1S9DA 3VX4A 4ACAA 1TEVA 3EG5A 1P75A 1Q1ZA 1ZAKA 2KI5A 2GF9A 2WAYA 5CLLA 4YMSA 3FPAA 3WMEA 1S3GA 2Q9CA 1OKKD 5F3WB 2FU5C 3ZZUA 4ACBA 4EUNA 3HR7A 4QOSA 1SHKA 4WIAA 3SEAA 2OEPA 3B1WA 3EZ7A 1KK1A 2C99A 4OKSA 4ZDKA 2WSSA 3GJ6A 5E7MA 2CJWB 4Q21A 2A78A 1KSHA 4MYCA 3LW8A 3IHWA 4KVAA 3NH9A 3I32A 3DOFA 4NYMR 4UKDA 2ZSFA 3MWLA 3KKPA 3ZVMA 3NKVA 1FOEB 5H68A 3C14C 1VYVA 1M7HA 4OYHA 1DAKA 1DS6A 4L9SA 2QAGB 1ZCBA 3MWYW 1D9ZA 2GDJA 5AK0A 4PTLA 2DFKB 1S2MA 2IUTA 3U4QA 1N2CE 2ONKA 1R5OA 4RZUA 4MGIR 2ZE6A 2ZROA 1QZXA 2BKEA 4V02A 1NN0A 4D0GA 2HF8A 4F7WA 4GZLA 1G64A 5JS8A 2C9YA 3I8XA 2RGAA 2FJUA 2F43B 4HLUA 2IHYA 4DLZA 1G8GA 4LBYA 1SVKA 2B6HA 1Z06A 3FE2A 3FKSA 4HLCA 3T15A 2XAUA 4BZQA 3ZS9A 5B57C 5C46F 4IFBA 4I4LA 2EQBA 4B44A 1L2TA 3K0AB 3QKRA 4C9BA 1MO3A 2BEKA 3ZLJA 3H84A 4QGFA 1Z22A 4WZBE 3L43A 2JLRA 3FDIA 3JZAA 1EWRA 3HYTA 1QHIA 1BIFA 5CITA 3SJBA 1V5WA 4FMBB 1UEJA 1IY1A 1XTJA 4MRSA 4GP6A 5FUXA 4B2PA 1Z2AA 2OCYC 1M7BA 3ZVLA 3OEED 1HE1C 3I73A 3W5JA 4KFSA 4A92A 1FNNA 1P62B 3LFUA 1YZKA 2ZI3A 4OJKA 5M04A 2O8EA 2BJWA 3VKHA 2O5VA 1UKEA 1Z47A 2CLSA 2PX3A 3ZZTA 2XSZA 3BD9A 1YRAA 2KB0A 3V9PA 2WZQA 3BC1A 3W6OA 4DDWA 3U44A 2PCLA 4HLQB 2PT5A 2YJTD 4M2LA 1G6HA 2RKOA 3QI2A 3R7WB 2HCJB 1B23P 2HUPA 1JR3A 1SVMA 1WF3A 2KBFA 2NG1A 3U6BA 1CF4A 1MKYA 3SC3A 4QJ4A 2Q3FA 2BMEA 3WXMA 4BLPA 4C0QC 3PUYA 2PJZA 2HXSA 3OAAA 1Z0JA 5LPNA 4LV8B 1G3MA 3DOEA 1ZUNB 3B8HA 3VNVA 1H8EA 3AH8A 2O8DB 1U8YA 2J0UB 3BB3A 5FPKA 1Z2CA 3L0IB 2FFHA 3UIEA 5CJPA 2IF0A 1EXMA 1LB1B 2OILA 4Y0VA 4B75A 3THWA 2WM9B 4D25A 1XMIA 4CGZA 1NBMA 1JALA 5TB5A 3P32A 1XD2A 2ZJBA 3OFND 1OFHA 5JCZA 1KO5A 5DSZA 2D4HA 1QDEA 4HAXA 5LBIA 1Q0UA 4AKIA 5DGXA 2AFHE 2NO0A 1W49A 4B32A 4C4PA 4URVR 1YHNA 2D7CA 3LBIA 3QQ5A 2HYDA 2NOAA 2QGZA 2JJ2D 3TUZC 4Q4AA 4E5UA 1KI3A 1AZSC 2GK7A 4ARZA 4KLZA 1SGWA 3ZZ0A 2J59A 5KUTA 1GG2A 3B1XA 3IPYA 4Q9LA 5AJYA 2CDNA 1E2EA 2AWNA 2IYWA 3U60B 2GXAA 1DAGA 3EZ9A 2VLIA 2FGKA 2DPXA 1A5TA 4Q19A 2IYRA 2TMKA 4OQMA 5BN4A 4BRUA 3VKWA 5HTKA 3TAHA 1F3OA 1KSFX 4G0NA 4PR0A 2ZS7A 4JBWA 2QM7A 4NZYA 1CIPA 2ZRKA 5FL7A 2OZEA 4EFMA 1KI2A 3DMNA 2JJ8A 4WZAE 3NBYC 5L3QB 1UADA 1S9HA 2AK2A 2G9NA 4DCNA 5CDFE 4WZ6A 1SZPA 3GLFA 1VG1A 2O8BB 1Q22A 3UXMA 4TMZA 1G17A 1W46A 3DPUA 3KJIA 3QG5A 4TMXA 4Z1MA 3UK6A 3TUJC 3GLGA 5SZHB 3OEHD 4Q4JB 3K0CA 2B8TA 4RZ2A 5JS7A 5KDOA 2FPMA 3WYAA 4M4SA 1YZNA 4OI4A 4KITB 2IYLD 1BMFD 4M22A 1OE0A 4GOXA 1VCNA 2PH1A 1EFRD 3CRQA 4LGMA 1FNMA 2WWXA 2IYYA 2D7DA 4MUBA 5L8VA 3O8CA 2XEXA 1WMSA 1LY1A 2ZI4A 1XPRA 1S3SA 4DLWA 1QVRA 5FH9A 1DPFA 1KK3A 1F2UA 1E9BA 3AP3A 1OB2A 1SVSA 4FW9A 4HI0E 3VR5A 2GCPA 5EJEA 3B82A 1F60A 2FN4A 3TQFA 1T4GA 2QUZA 3GJXC 4MKIA 2BKUA 5TXGA 5KO2A 3QBVA 4FCVA 2WHXA 1GITA 3MWKA 2FV8A 5JWHA 1X1SA 1W0JD 4FCWA 1E4YA 5IK2D 1G7TA 1EWQA 2QAGC 3OZXA 2AX4A 4RFVA 3THXB 2AL7A 3BE4A 3AF1A 5EE5B 4MA4A 3BOSA 1ZNZA 4RFSA 2RHMA 2WPDD 3BK7A 1QHXA 5EP2A 2ZUBA 4ILEA 1JPNA 3SR0A 4Q1FA 1X6VA 1IM2A 3EIQA 4L15A 1UPTA 1ZU5A 3DKPA 4L5BA 2I3BA 3K9HA 2WJHA 4IDNA 4Q1EA 3GCGA 3TW4A 4EFLA 2OM2A 3PITA 3K09A 4TL7A 5C4MA 4NKRA 1WXQA 1XXHA 4O2LA 3IQXA 4CW7A 1NI3A 2W2XA 5AUQA 2UVQA 1WCV1 3IQWA 2CVHA 4BUJA 1U9IC 3SS8A 2QE7D 3B1ZA 3OF5A 3THYA 2VSOA 2ZITA 4NHOA 3A1UA 4QHSA 5FI1B 1US8B 4N0EA 2F3RA 1UFQA 3AF0A 2AXNA 5BYJA 5BQ5A 2J3EA 3R20A 3I4LA 4NBSA 1HY3A 4QHYA 1KYIA 2Q9AA 5TDHA 4GL2A 4H1VA 1DARA 2A9KA 4OHXA 4EIWA 1SKYE 5AR1A 3WMFA 4Z8YA 4Q9JA 2IW3A 2WOJA 1Z5ZA 2PZEA 3GJ7A 3SYLA 5F2EA 1N25A 1UKZA 1UKYA 5H70A 3E70C 2O0HA 3I5XA 2VL7A 2JIZD 1PVOA 4OJQA 3MFYA 2RGDA 3OHMA 1IXZA 1OJLA 5F98A 4NYMQ 3EIHA 1S0UA 2R62A 2Z43A 4LSGA 1KNXA 2VP0A 3C8UA 3A4LA 2XJ4A 1P6XA 4BASA 1P60A 3Q72A 2AD1A 1XBTA 521PA 4DXAA 4AI6A 2CHGA 2J0UA 4LX0A 1IN6A 5IRCD 3QPVA 3BFXA 4DLVA 3RAPR 1CJTC 3LY5A 1VPLA 1XB2A 3LX5A 4AIIA 1YR7A 3AGQA 4CT4B 2ZM5A 5LD2C 4V0KA 1XEFA 5EUQB 1RRFA 3CRW1 4M21A 2B8WA 4BLRA 5KOYA 1A7JA 3CRVA 4PQFA 4UXIA 3V4RA 1CLUA 1QVAA 1IN7A 3PXGA 1E1RD 3V4FA 1KHTA 3DM9B 4PHHA 3K53A 2FPKA 1CU1A 4C7OA 3AKEA 4AK9A 1J70A 5KNBA 1NN1A 1WA5A 1BKDR 2H57A 2V1UA 4YQFA 1ZNXA 4YMVA 5FTMA 4C3ZA 2V7QD 4DT1B 4URWR 3MD0A 2Z0MA 5EXTA 3EX7C 1TTTA 1ZNYA 4ZDIA 2OLKA 1MT0A 1JXOA 1T8TA 3AKDA 4RY2A 1FFHA 4TLAA 5CIQA 1Z6TA 2A5DA 4QHTA 1NJFA 3GLFE 2FZLA 1VYTA 3IIMA 3ASZA 4M1YA 2F1JA 2GZDA 2OFWA 3C5CA 1DE0A 1YZTA 5EZ5A 4YXWD 1KI1A 3LH5A 2Z5FA 3GJ5A 2P6UA 5JJLA 4UQOA 3WNBA 2VEDA 3FHOA 4NP6A 2F1IA 1AJEA 1JPJA 3GD7A 1CR4A 2GRJA 2O8FB 3ASYA 1KO1A 3DM5A 1GL9B 3A58B 5HKKD 3L82B 3LWNA 3WRYC 1HEIA 1G4AE 4IOLA 3H0KA 2W6IA 2CEAA 2VQSA 4IDOA 1NKSA 2GWHA 4W9MC 4OI0A 1NSTA 2FSFA 3VR4A 2CL0X 1Z6AA 1OH5A 1W4RA 5CJ2A 2REOA 4DSUA 1JNYA 1VHLA 1S1CA 2XTNA 4E07A 3KKQA 1E0AA 1GDDA 2ZYWX 2CLDX 1PJRA 4HDCA 1E0SA 1LS6A 3I61A 1SVWA 3DZDA 4NYIQ 1W5SA 3TSOA 1Z6GA 3WNDA 2P5TB 4DIDA 1U99A 4BRWA 2P6RA 3L0PA 1L4UA 3EPLA 1BYUA 2J0QA 1JB1A 4KCGA 2ZANA 1VCIA 3CUEF 1G21E 5JMTA 2OLJA 1G7RA 1MABB 3NEJA 4Q4JA 1AZTA 1DOAA 2ZEJA 1U8AA 3R9IA 5LD2B 4DC9A 3U44B 5A4JA 2CHQA 2CXXA 2FPLA 3Q8XB 3VNUA 4ZPXA 3B78A 4EJSA 1GKUB 3AVOA 3G82C 2ZRHA 4II7A 3GQBA 2FH5B 2KBEA 3ECCA 4Y0AA 1KO7A 4PPFA 1OIXA 2IEYA 3VR3A 3PQCA 4F93B 1G16A 4BWYA 2YWGA 2YINC 4PQRA 2V1XA 1NJGA 1PLLA 2AN9A 1DADA 4P32A 1WDTA 4S35A 1TF5A 1E2FA 4M53A 2BMJA 5ANRB 4U7DA 2O8EB 1XU4A 1J99A 1TU3A 4YLGA 2VRWA 2D62A 1WRBA 2QNRA 1G8FA 1SXJA 1VIAA 1A1VA 3TR0A 2BBTA 5DHAA 1IJFA 1SKQA 3MAAC 1ZM3A 4KYUA 1NMYA 4Q9HA 2H7VA 3E1SA 1TX4B 4JIMA 4RZXA 1ZUHA 2J87A 4QBFA 4I99A 1CJUC 4IEIA 3PUVA 3K0AA 3QKRB 4ON9A 3VU9B 2H8KA 1COWD 1E6CA 4LHZA 5DLQC 5DN6A 4LI0A 1Z0AA 3MRSA 2ZAMA 3BFVA 2JDIA 4PZZA 1D5CA 1Q1QA 4UNSA 1GM5A 3RRNA 4DLSA 2GNOA 3JZMA 2WWGA 3EAQA 3B60A 2F1RA 4W5JA 1F5NA 2RMKA 3LLMA 4DT1A 1OFIA 4XD7A 3VU9A 2NMVA 1JR3D 5JLJA 4PQYA 1X1RA 4IEEA 1W1WA 2QRNA 1ZINA 3AUXA 3OIYA 3HP1A 4GRAA 4LJAA 3QOFA 4NYJQ 1R2QA 4YDSA 1R0WA 2OFXA 1XZPA 1FTNA 3KKMA 3OAAD 1K5GA 2GF0A 3LXXA 4PAQA 3QG1A 4FIDA 1WBDA 5FPTA 3EASA 1I4TD 4LHXA 3J81k 2QAGA 1Z8FA 1OH8A 5FBRB 4KI0A 1EFHA 3RRYA 3TRFA 3M4YA 2IX3A 1XX6A 1EGAA 1SKYB 2JLUA 2FNAA 2YC4C 4DVGA 3DMDA 4E03A 4C0SA 5DYGA 4MRVA 2O8CB 3CF0A 3TH5A 3RS3A 2QPAA 1E96A 1II0A 2BBSA 1ZD8A 1IY2A 2DYKA 1E2DA 3T1TA 5KNCA 5EQTA 3SN6A 3BERA 1XEXB 3CPHA 1XTQA 2NPFA 1ZJ6A 3KUCA 1FL9A 4Q9KA 1KK0A 1UBCA 1WE2A 5J4HA 1NVVR 2IUSA 1O3YA 3X2SA 1U0JA 1W4CA 4IRUB 1FQJA 2AWOA 3H2YA 2JLVA 3DEFA 4A6XA 2GEUA 3R8CA 1P9RA 4A2WA 5CK4A 1XTKA 3ZS8A 4DUGD 4Q1CA 1E9RA 3ZGXA 3U3OA 2X2EA 3BS4A 1S96A 1HH4A 3P27A 1W48A 3GP8A 1QHNA 2E1RA 4TMVA 3CH5A 4A8JA 4MGYR 2PLFA 2QU8A 3SHWA 4OHVA 4PO8A 4WVFA 4EAQA 3BJIC 4KSCA 2ZUDA 4E09A 1E9AA 3A8TA 3PJRA 4QM7A 3Q7PA 1KI8A 2VO1A 3H4MA 3KXIA 4LCBA 5CYOA 4TZ6A 3WMGA 3R9XA 2DFTA 1LW7A 5FL7D 3OIUA 4ZV4A 2VP9A 4FCTA 4RSGA 2ZI6A 2WWHA 2CE7A 1TF2A 1W0KD 4HUQB 4I1SA 5GJBA 3W90A 3GMTA 1KJYA 2EWVA 1ZBDA 1GAJA 2ZS9A 1TF7A 2DWPA 2ZRJA 3IIKA 1M1YE 2ODBA 2ZRPA 4TQ9A 1GNPA 1BYIA 2WSSD 3EC1A 1IHUA 3UMRA 1TPZA 4Q1DA 1ESNA 4Z1MD 4N3NA 4LC1A 2ZXUA 2J1LA 3FOZA 4BQSA 3LDAA 5JHGB 4L4UA 1XTIA 4O2RA 2YV5A 2C95A 3W5IA 4DCVA 2Z4RA 3L2OB 1CJMA 1DBSA 4Q7LA 4JVLA 1RC8A 5BN3A 3CM0A 3AV0B 3E2IA 3IHLA 4JLJA 1E2QA 1I4LD 3GLIB 2LKDA 3GPLA 1XMJA 2OO7A 2QSYA 5FOUA 4P3YA 4LBWA 1JAIA 3L8YA 5HE8A 2RGGA 3W34A 3SYNA 1EX7A 5DNYB 3TK1A 3AVPA 1P2UA 3PVSA 2G1KA 2XB2A 2EYQA 4QJ5A 4TYWA 2YWEA 2H17A 5CM8B 3SHFA 1OPXA 5CB6A 1VCOA 3FKSD 2BM0A 5JI3E 3JVVA 1W0JA 3F3YA 4RFSB 2PMDA 3T34A 4F92B 1VG0B 3GEEA 3WP1B 5FTLA 2DFLA 1AK2A 3FB4A 4LWZA 1HURA 3SNHA 4YMTA 5AUOB 4G5GA 2ORIA 3EZFA 4PZYA 2WKRA 5AJZA 4DLYA 1XMSA 4AKHA 2PCJA 3B85A 1QBKC 1P9WA 2GHIA 3A4NA 1ZIOA 4DCSA 5UKDA 4M1OA 4DZZA 1NKTA 1YVDA 1N6RA 1JR3E 1XEWX 3I8SA 4K8OA 4QFMA 4A6PA 1CP2A 5JEDA 1G5PA 2IYTA 2WKQA 1IY0A 3ND9A 4QG7A 4R7ZA 3A1TA 1ONBA 1Z0IA 4LPKA 4R2IA 2XITA 3OEEA 3QJYA 1Q1EA 3FHCB 1CULC 3CZPA 3WRXC 2WMNB 1R0ZA 3ZD6A 1NLYA 2C96A 2F3TA 4AG6A 5SZJA 2QY9A 1KNQA 2GILA 2QZ4A 1M6NA 1XFAA 2QE7A 2R8RA 3FTQA 4IVPA 4FI3C 1U8ZA 3U7FB 1O87A 1GNRA 3ZD7A 1P61B 1SXJC 1NSFA 3DZ8A 1YQTA 1DVRA 2G0NA 1XXHB 1GWNA 3QENA 2WWFA 2O0KA 4R71A 4KFTA 2GBLA 2H1LA 3RWMB 3BFKA 3C5HA 4RJLA 4AYTA 4HZUB 5E95A 4FWTA 2WV9A 1G9XA 1Z0DA 3SZRA 2BOVA 5CM9C 1W7AA 2YNMA 4EDHA 2OHFA 1IQPA 1TEXA 3QKTA 1OFTA 1W4AA 1G4UR 3GLHA 4A0HA 1J90A 1U81A 1Z07A 3QPWA 4EJSC 2FX3A 4YMWA 2GETA 2JCSA 3F5FA 1NY6A 1Z6YA 2HLDD 1NIPA 1NL3A 4QXAA 4IOJA 2W2TA 5DI9A 4HDQB 4DHEA 2FEMA 1Q20A 3AVWA 1OFUX 4PZLA 3MJHA 1U9IA 3HYRA 1E0JA 2WMOB 4IOMA 3OFNA 4FMCF 3FFBA 621PA 3IIJA 3K9NA 2PL3A 4Q66C 3NVAA 1MO5A 3A6PC 1KDRA 4ZKEA 4FXPA 4TTQA 2RCNA 4TYYA 1P2SA 5K8UA 3SJAA 2QT1A 2PZFA 2ZYTX 5AWFC 3B5JA 2ASEA 3KX2A 1II8A 4Q48A 2JLYA 1NVVQ 1T0HB 3AF2A 2EWWA 2XTMA 4Q7JB 2EFGA 2JAQA 2BMDA 3LVQE 4OK6A 4BLSA 1G3QA 2ZU6A 4LYJA 3A4MA 4D6PA 4MKFA 2ZRLA 1VG8A 3PV0A 4A8JC 2BDTA 2GJ9A 2YOHA 2ORVA 1CR1A 4XH9B 3GFPA 4L9WA 3F8TA 4KODA 5L3SA 1FPMA 1HT2E 3HJNA 5SZKB 2HEIA 1KMHA 2X1VA 1GNQA 4A9AA 5J47A 1KY3A 2IWHA 3TSWA 3U61B 1RRCA 4Z8XA 1AGRA 5FOTA 2WJIA 4OHWA 4HB2A 5L3QA 1ETUA 3QXXA 1XF9A 3NC0C 2OAP1 5IF9A 4CVNA 2ZRAA 1L4YA 2PEYA 4US2R 5BWMA 3AVTA 3CNLA 2FF7A 1VCMA 1NLZA 4R9UC 1NVUQ 1T0JB 4F4IA 4B3DA 3VR1A 1NRJB 3NWJA 1H8HA 2BJVA 2QL6A 2V9PA 2C9OA 3KB2A 5IT5A 2YC2C 2XZPA 4Q18A 1KI6B 4AD8A 1GSIA 1KJWA 1Q21A 1N0VC 2RGBA 2XNDA 4LC0A 4Z51A 2CLCX 4JJZA 4DSTA 2JATA 1BO6A 3AQ4A 3GFOA 3LAWA 5HKKA 2G1JA 1EFRA 3AKYA 3QVUA 4HB3A 3V00A 3TKLA 5TY0A 2OUKA 3WHLA 2YHSA 2FOLA 5FOVA 3WYFA 2IWRA 2FFAA 2GJ8A 4JVNA 4X8HA 4BZPA 1IN4A 3VAAA 2RGXA 3RHFA 5D3MA 1F6BA 3IILA 2BEJA 2J7PA 4TL9A 2O8FA 4BFVA 4YDHB 4ZCIA 5KSYA 2VP5A 2C98A 1Z6XA 2REBA 4TWZA 3T5GA 3VMFA 1J2JA 1E2LA 2ZJ2A 4IDHA 4V0NA 4HAWA 2HJVA 5DHFA 3CNOA 1E2HA 3G5UA 3AVXA 3QY0A 1E9CA 3FVQA 3U7EB 3B2EA 4V03A 1OIVA 3X1YA 5KDLA 2WPDA 4DBLC 4S2EA 5FUYA 1EFCA 4KJZA 2GJAA 4UXHA 4QNMA 1SXJB 1GKIA 2WBLC 4QGAA 3W6NA 4A0GA 1MO4A 3SBDA 4LY6A 3SE0A 2PZGA 4ZKDA 3LO5A 3KQUA 2FG5A 2CL6X 1G8PA 5BXQC 2F1HA 2CK3A 2Z6VA 1KSGA 4MUAA 6Q21A 1QHHB 2A3RA 1DELA 2K5UA 2QP4A 5DH9A 1TU4A 2J5XA 3K70D 4C7OB 2JLQA 3LNCA 5KPDA 1JBKA 4GMDA 4EJSB 5JZVA 1T8UA 2HJGA 1XEXA 2IYVA 3UWKA 2HCBA 2W00A 1UJ2A 3C4JA 5HZHA 4P4TA 4A8JB 4ZDJA 1XD8A 1A82A 1T6NA 2VBCA 4HLUC 1W4BA 3MGCA 1E0KA 2V3CC 1HA3A 3LQQA 4DCUA 2R65A 2ZRFA 1MABA 3AGPA 4JLKA 3Q9LA 4Z54A 2ZI7A 1M7GA 4DLUA 3W3ZB 4JLMA 3ADDA 2ZRDA 1XP8A 1YZUA 4A2PA 4D82A 2YOGA 1COWA 3VTKA 4X8OA 5KSZA 2NTYC 3I62A 3CNNA 4TLCA 2XJ9A 5KDDA 2G77B 1RFLA 5FTKA 1D2NA 1GKYA 3RWOA 4B48A 4DCTA 1MRNA 1N6KA 1P5ZB 4JBYA 1PLJA 1MR3F 3CWQA 1E79D 4IDQA 2WJYA 2EFCB 3QVVA 3WHKA 1RE0A 1G5TA 2VIIA 1N3BA 2ODNA 2P0EA 4CEIB 3FFAA 3RLFA 5JRJA 4KU4A 4IXMA 4LYAA 2A5YB 4PHFA 1JQLB 1VHTA 5B58C 3SU8A 3QXJA 4KV9A 3RS4A 3W6PA 1GFIA 1W2HA 1YR6A 2Q0HA 3ZDQA 4HZIA 5TV2A 5FTJA 2CMKA 3RC8A 3CX6A 1GIAA 3GLIA 5JHHB 4TL6A 3QSYA 3KL4A 4ASUD 4WBSA 1NMXA 2IK8A 1KK2A 1NF3A 4QM6A 1X3SA 2RH5A 1IXRC 5GJCA 1E1RA 2GZHA 5BN5A 2P3SA 5J4YA 1FMLA 4P33A 4CYMA 4TYNA 2DHRA 3B9QA 4MITA 5LDDC 1II9A 3A1WA 4WW0A 3IBYA 4PPNA 3T61A 1ZP6A 3ONWA 3ND8A 4M1KA 1UDWA 2ZTSA 1S1MA 4P4UA 1OXXK 4EFNA 1AS3A 3TUIC 1NP6A 3VR6A 2WOOA 2GCOB 3OIVA 2V7QA 1OYYA 4ZIRA 4CEIA 3AF4A 4H9GA 4RCZA 3FMIA 4OBEA 1OHHA 5C1BA 1UBEA 2HDNB 3D3QA 2KSQA 2RAPA 4AURA 4MYUA 4DUGA 4IHQA 5CIWA 3NHAA 1KI6A 1ZD9A 4RD0A 4DDVA 2HF9A 3KFVA 3THXA 4XWAA 2ZQ5A 2ERXA 4Q4AB 4RD3A 5JFGA 1OF1A 4F38A 2N1BA 2VPPA 4HEJA 3ZYCA 4YXWA 2YVUA 1ZVQA 4XSHA 2ZJYA 5G41A 3BH0A 3FMPB 1S4QA 2ANCA 4U02A 2IUUA 1P7CA 1N0WA 3EA0A 2OESA 3IDQA 3VKGA 1Q3TA 1PV4A 3MSXA 1T3SA 4RCYA 2NO1A 4CF7A 4DSNA 2G83A 3GLFB 1F2UB 2MSEB 4B71A 1N6OA 4PXAA 4RKEA 4MRPA 4G5OA 3QF4A 3PUWA 5JI2E 4NCJA 2ORWA 3A1VA 2HV8A 3C15C 4HYYA 3IEVA 3C41J 2C5LA 2O8DA 3UG6A 1Q3HA 5HPYB 5EUMA 2C9CA 1I4DD 3HR8A 5JEEA 3GJ0A 5EP1A 1SULA 1CS4C 2ZR7A 2ZE5A 4V0LA 1M8PA 1VDZA 3UATA 5IHPA 3AB3A 5D3QA 1TMKA 2ZSDA 3B1VA 1E2NA 1R0XA 4IFEA 2QPTA 2GEDA 3BGWA 1D6JA 3PG5A 3OE7A 1KSJA 2BIFA 2P2LA 2MMCA 4ZO4A 2FE4A 4HB4A 2XXAB 2YKGA 5F9FA 2EFHB 4AYXA 1DAHA 1I2MA 1HT1E 5J40A 1VMAA 2PMKA 4GDFA 4ZI2A 1NLFA 4OHYA 4P4SB 2XOKD 2VA8A 4MYTA 4RVCA 4KBGA 2RGCA 5A5GA 1FP6A 1NIJA 2XNSA 2G0TA 4AKEA 3QXCA 2ZUCA 1KKMA 2QTHA 3CIOA 3BBPA 4PSKA 3PENA 2GBLC 2QMOA 2VHQA 2OCAA 5GVRA 1NN5A 5CLQA 4D4MA 4IJMA 5FUWA 1CR0A 4Q5IA 3WBJA 4DWJA 4NCHA 1UBFA 5EE1A 2X19A 4ESHA 2ZR9A 4FMDB 5G40A 2V6JA 2X8AA 1T9HA 4M9SA 3PEWA 4TSFA 2A5GA 1NG9A 4LBVA 3SFVA 2BBOA 1G20E 1MV5A 4JS0A 2I4IA 3TR5A 4B74A 1XCMA 2XGJA 1V43A 4JKIA 3CO5A 1FMJA 3T12A 3K0EA 2JDID 3GEHA 1YR8A 2CJWA 1WBBA 1VG9B 3R7WA 2XZLA 1KKLA 4C2UA 1VKJA 3HDTA 3CH4B 1J7KA 1DO2A 2OBMA 1XTSA 2LWIA 3P20A 3T1VA 3LVRE 4NH0A 4QC2A 4NE2A 4BFWA 4LRWA 3HU3A 1ZD1A 1RZ3A 3KJHA 1ZM2A 3U3KA 3ICEA 2BC9A 1QHSA 2ONJA 3U3JA 3NH6A 5GJVC 1W36D 1CR2A 2GTPA 4QKQA 3DKVA 4Q9IA 1G7SA 2UZ3A 4AWXA 3K0SA 4P31A 4QGGA 2ZVQX 3EZ6A 4Q02A 3GLGB 2IS2A 1LV7A 4RD4A 2HLDA 4TMWA 4CEHB 5C4GB 5FBQB 1RW4A 5K8TA 2GAAA 3MWJA 5FPYA 1N6HA 1UF9A 2IC5A 1ODFA 3BB4A 1XRJA 3D7MA 4URXR 1KMHB 1KAOA 4EKDA 1MH1A 2JJ1D 1E3MA 1LF5A 4PC2A 1KDPA 2IS4A 1HQCA 1VECA 3IO3A 3X1XA 3ZQ6A 2NO6A 1VYUA 3GLGE 1ZM9A 4CDGA 2FA9A 4DDTA 4ITRC 1RYHA 2VSXA 1ZC4A 1ZCAA 2YWHA 3U7GA 3AM1A 2IXFA 3EWSA 2WJGA 2EVWX 3FYHA 4GSYA 3GEIA 1ANKA 3W3AA 4IVQA 1LTQA 5JWOA 5EZ6B 3MCAA 1LF0A 1OIWA 1C1YA 3CF2A 1OXUA 3OESA 1SHZA 3KZ1E 1HTWA 3LD9A 2BMFA 2Y8EA 2WWWA 3T1OA 1T3LA 4Q03A 5IDVA 1W36B 2QQEA 4A36A 2EW1A 2GVZC 2QBYA 1C4OA 1CXZA 1Q1BA 2CBZA 3Q3JB 5FOWA 1OLOA 4CIDA 4OQFA 2REXB 1R8QA 1G3UA 3P4YA 4P4SA 2HT1A 4LBZA 2JLWA 3IBGA 1TADA 5J5CA 2B7BA 2CCGA 1W0KA 5BW8A 4I1VA 3D31A 3W8RA 2R44A 5AJWA 1JI0A 4AC9A 2J45A 3OIWA 1YU9A 3EWAA 4AYWA 3HU2A 2KE5A 2R6FA 3T35A 1E9EA 3IKJA 4M9XA 1AM4D 1RJ9B 4TT3A 2DR3A 4LJ5A 4L8GA 2ODWA 5KSOA 5KSPA 1EFUA 1OW3B 3TMKA 4B2IA 2WICA 2BCJQ 1XJCA 2JEOA 2VHTA 2A5JA 2ZJ5A 1K6MA 2AKAB 3CX8A 1KAGA 4C0KA 2VTKA 1M74A 4J0QA 1TQDA 4B33A 4XIGS 2QT0A 2C8VA 4M8NE 2IBMA 4US0R 3FHTA 2X77A 4B2LA 4M9ZA 1II8B 4GOJA 4NONA 2VF7A 4YC7A 4CZ2A 1YZGA 3SQWA 4BGDA 2N42A 1N5JA 2J7PD 1CRQA 2QROA 5K8LA 3K0FA 2H92A 1E2MA 2VF8A 3EARA 5LB2A 2DB3A 4JJKA 1IAQA 1RPZA 1DEKA 2VHJA 2DWOA 3HPQA 4POAA 4R2HA 1D2EA 3HU1A 5JBQA 3CX7A 3GLIE 3EPKA 2H16A 3CW2A 3RYTC 5EP3A 3TVTA 4URZR 3SOPA 3A36A 2FSHA 1PZNA 1YE8A 4IKEA 4DSOA 3GLHB 2O8BA 1G8HA 1BH2A 2ZIAA 5DI3B 2GJSA 3KJEA 1OH7A 2FFQA 3JVUA 2OE2A 4H1UA 2OT3B 4HLDA 3TVDA 1G18A 2ZI9A 4Q1BA 3SFZA 1P72A 5H1YA 2R6DA 3M1IA 4D26A 2XX3A 5K8IA 2ODEA 2V55B 3IO5A 3KKOA 3ADBA 1GL7A 4IW3B 4TLDA 3O8BA 3A1SA 2OSBA 4B3FX 3ZQJA 2E87A 3CPJB 4D2IA 3NDBB 2BHRA 1NBME 3QKSA 3KQNA 4ERNA 2IS1A 5HCIA 1AQUA 1J8MF 2OFOA 1CKEA 2J0VA 3I92A 5DE3A 3B13B 1EX6A 4I81A 2VSFA 2GXUA 3VHLB 4B3CA 1F48A 2ZPTX 1GUAA 1QRAA 3KB1A 1Q44A 1G41A 3UMSA 1AQYA 4BZXA 3HPRA 4KSBA 4ZDWA 1N6LA 2ATVA 4A2QA 3RS7A 1R7RA 1L7VC 4PHTA 1G1MA 1FQKA 5JECA 1E79A 1MOZA 1XD2B 4Q7KA 4C30A 5B64A 2IYQA 3AP2A 4L16A 3WYGA 1ESMA 2GK6A 4C0LA 1DG1G 1ZM7A 3ETLA 4W5WA 4DB4A 2Q6TA 4PPGA 3BWDD 1S8FA 4LZZA 4N1AA 3Q7QA 4GOKA 3I72A 2N46A 1FTSA 4LHVA 3THOA 1RKBA 1T91A 3QNUA 2A7QA 4JYBA 5CDFA 2WJJA 2IXEA 4V0MA 3U5ZB 4XWOA 1CTQA 2PX0A 2ZRGA 2AKYA 2ZU0C 2ATXA 2R2AA 4G5SA 1EESA 5DIFA 3PEVA 4Q47A 4NCKA 4XSGA 5EXXA 2PJRA 2H5EA 1I2DA 2OAQ1 4JLNA 2FDCA 4GZMA 4MRNA 1Z63A 1E1QA 2UZIR 3TIFA 3KXKA 1KZGB 1KY2A 1WQ1R 1N6IA 2IEZA 2ZE8A 2ZI5A 4AG5A 4A82A 4PC3A
chains in the Genus database with same CATH superfamily
2I9KA 3LHIA 3DZKA 5JSZB 3WA7A 3IKLA 3QKSB 1J2YA 3GGOA 1M6WA 3F8WA 4D9FA 4KPUB 1AKYA 3T52A 3RANA 2B2CA 2DT8A 1U6KA 1BAPA 3LIPA 2ZBVA 4G4JA 1GTJ1 1IJKA 4JVSB 4NYJR 4QDKA 5THKA 4EPYA 3G9UA 1L7NA 3FRJA 1D0IA 4HDOB 5E3JA 3FR7A 1WNTA 4HEA1 4QDXA 2CYBA 4B43A 4EZEA 5C18A 2Z5GA 5AVWA 2WYIA 1U0TA 1ZI9A 4P92A 2J0SA 5C7IO 1REQB 2KJQA 3E9ZA 4X5OA 4XCQA 5NLLA 2B4TO 3E5HA 3EXAA 4DR5B 4NSNA 4I4TA 1N3IA 4J1TA 4CV3A 3GLHE 4B80A 4DC0A 4WI1A 3CW8X 4ZI7B 1OA0A 2AEFA 2PY6A 3C3JA 4E33A 4WBNB 5IJ0A 1NJ6A 4RD1A 2AF4C 2VHCA 1SG6A 1NVXQ 2ZAOA 2CFOA 3COSA 3EUFA 4S1NA 5LQAA 5HGXA 4JC4A 4B6EA 3FTFA 1M2HA 1W34A 1FB5A 2PRKA 4G0VA 2FG7C 5B30A 3OTOB 2D2FA 3PBKA 4AMVA 4FN5A 3ZWCA 2P67A 4HQLA 4YAEA 3C16C 1QU3A 4RAOA 2D0IA 1F2TB 2DM6A 1B8OA 3EG9B 4GFDA 3QFHA 2LCFA 5GONA 3EQ9A 3CF4G 3K0BA 2HMVA 2R68A 4KKXB 1IN5A 1E3MA 2ZUEA 3IEUA 2AR7A 1EIWA 5C5DA 5G3ZA 3IGFA 4LKRA 4PXYA 1JLHA 4KEAA 1SC3A 2FWAA 1E69A 3KVRA 5DI3A 3OJ0A 3LG2A 3LBFA 4LUCA 1KVUA 3H1PA 3O31A 2RHDA 1EUDB 1I6KA 1LBSA 2QG4A 1VE9A 2IOQA 2I9PA 4QEZA 2PWAA 2PAFA 3LX6A 4TTIA 3TRDA 5L3SB 2VYNA 2JVJA 3AEKB 4B3JA 2WF5A 1L7XA 3DXZA 4I4NA 2YXEA 1SUEA 3FETA 4UZSA 4RQTA 3LT0A 4BMDA 2HRQA 3RUDA 4WESA 2FEPA 2YQ4A 2AHOA 3O93A 4S24A 1NRWA 4X20B 1J25A 3QUSA 3BWBA 4DILA 5ERYA 1E5TA 5KYKA 2R9VA 1RYFA 2IVFA 2VHEA 2W58A 3BFPA 5CU7A 5LA6B 4C7JA 5BSRA 3X1ZA 2XOKA 4FZVA 2DCUA 4ZZ1A 4IIVA 4RS4A 4NXNB 4ZARA 4OFZA 4Y6SA 4TZTA 2HGZA 1P2BA 3OG9A 2OZVA 5LP6C 2IOHA 4OMFG 1VE1A 2Z83A 2W6JA 4B0OA 1TKBA 2PS9A 4X90A 2AUTA 3BZWA 5IAJA 2CUKA 3C5EA 4HFRA 2HHJA 5BMVF 5J9FA 2ADOA 2UUPA 1ST3A 2C7RA 5E38A 1CQPA 5ECYA 3MEQA 1K8QA 3K8YA 1T5IA 1P2VA 3PEUA 1CDEA 4LV6A 3V7NA 5E7QA 3LYLA 4B6JA 1RCTE 1V39A 4O8CA 1MQAA 3JQAD 1EP1B 3LFTA 3QMPA 4HQ6A 2ERYA 3ENQA 3HUEA 4GBMA 4DFDA 3I9MA 4OLFA 4XI9A 2BF4A 4BNYA 1JA0A 1F06A 4D3ZA 3O26A 3V4VB 2LXNA 4PG7A 5G4KA 4DIUA 3UHFA 4BMPB 4LDAA 1EM6A 2C8LA 1ZZEA 4P9NA 1LX6A 5TQJA 2BI7A 4WDQA 4XLLA 4US1R 1BCSB 3D6AA 5EJFA 3T06B 5HKOA 2QLJA 2XTZA 2PUFA 1XTZA 1Q12A 2D1TA 4A5OA 2ZTMA 2QN1A 3RAGA 3DOIA 3W8NA 3N6XA 3A9CA 3PJDA 1ECLA 1OXMA 3L04A 1T5TA 3T1QA 1XVLA 2X0NA 3E7WA 2D00A 4HNGA 4HTFB 4WTOA 3H2ZA 1U5CA 1D7AA 3FA2A 5FFNA 3RHZA 3T7RA 2C4MA 4QDUA 4D3DA 1L5RA 5H4HA 2ASVA 1BMQA 1P5RA 2MJLA 1GDTA 4RHEA 3QPDA 2I91A 2WFLA 5EQFA 3CBQA 1K4YA 1HEYA 2XXBA 1R5NA 5AOAA 3PNMA 2C3YA 2QU7A 3HCWA 2HMSA 1P0QA 1KYXA 5EA2A 1BDHA 1GRRA 2C4HA 2G28A 2BN4A 2Q3MA 2Y0EA 3I28A 1C7EA 3LBNA 4M7OA 2FSPA 3GDGA 2J5BA 2X40A 2P4UA 1PX0A 1RVDA 3CQ9A 4BFUA 3K05A 2OBNA 1AHHA 3I2IA 1ZX1A 3ANSA 1THZA 1YASA 1S7GA 2HFKA 4G97A 4HNAA 4M83A 4N6NA 4XFDA 4DREA 2QRZA 1BHQ1 3IBCA 2CDBA 4R54A 1L5VA 7MDHA 1T25A 2GYWA 2ZIUB 1PNOA 3CRMA 3GQBB 4WA8A 3QF4B 5CFOA 5EHZA 4BLTA 2HA7A 1NNLA 1VHDA 1X70A 3HRKA 1RWVA 2WQZA 4FJ2A 4C6TA 3RABA 1E6LA 4G01B 2OLEA 5ADVA 3IR5A 4FBLA 3A7EA 1QHYA 1RYDA 1IM5A 4JENA 3VR6D 4L3VA 5L51A 1L7RA 4HD8A 1L1EA 2VDVE 3M2TA 4Q4HB 4XJXA 1W5EA 2VJLA 2CV1A 1NGSA 1NTOA 3QOYA 3VNAA 2H9AA 1XMQB 4TM8A 2O5RA 1C5KA 1SK9A 2O50A 2Q4EA 2WAXA 3BJZA 4KNWA 1KE2A 2ROQA 3JQQA 4P0TA 3G0GA 1K5DA 3MN1A 5F51A 3CNQS 3DO5A 4J29A 4P54A 1TQ8A 3PQ2A 4J1TC 5K6AC 2GXSA 3WOVA 3IPLA 1ZD2P 2PLWA 1SHJA 2ATIA 2V4ZA 2AE1A 2QT9A 3HKCB 2EJUA 3IEKA 1W94A 1Z2DA 4IUYA 3V48A 4GI1A 5J4KA 3VZQA 1YB6A 3LP6A 4MXDA 1UOQA 4JZKA 2E5LB 1Q6YA 4NL4H 1TECE 5E4FA 5IF3A 3VPFA 4JJGA 5FOXA 4J6EA 4L6CA 2AV6A 4B76A 3TLYA 2NTNA 5AP9A 1N33B 2J4DA 4RW0A 3RSGA 5JJIA 3A6LA 3BGDA 4MUYA 4QU0A 4BO3A 1Z25A 3R75A 2QQ0A 3RSZA 2DHQA 3HUDA 4OK5A 3ZWDA 4BFSA 3LXUX 4PX3A 5HR5A 2ZS8A 3PT5A 3IPXA 2NZVG 3HJGA 2W83A 3CLRC 421PA 4ZP1A 1K9SA 2JA2A 2JK0A 2WU4A 2A9RA 3R3JA 4CEJB 2HA4A 4BKMA 5B5SA 3O47A 3SBEA 3WIVA 1UZNA 2SKCA 4Z4IA 2H18A 5DGCA 5CCXA 1CHNA 3R77A 5K3AA 5AHRA 4FHEA 3MTDA 1QFJA 1EGMB 1N1GA 4UNQA 4HGPA 3B1YA 1HQDA 4XIFA 2QRPA 3TLZA 1V3VA 3KXDA 2R6R1 3WADA 4CM4B 1I14A 3BIXA 3F0TA 4B73A 221PA 2P6NA 1BFKA 4E22A 2XODA 2W6OA 4ENWA 4EL5A 2NO9A 4B3BA 1BMFA 5T41A 2R7MA 2GPNA 2HJSA 4JLAA 1KRHA 2J6HA 4JBXA 3QXHA 5FDFA 2XA1A 1ZRHA 1BN6A 1SUSA 1T6ZA 1VMDA 2A14A 1L6IA 2JFZA 3HXLA 4GC5A 4LFBB 1N78A 4JL5A 4K9QA 4IUCS 2DQYA 1BX0A 1CCWA 2RCYA 1MJ5A 4KWHA 2WF9A 3BIFA 4ZA2A 5IZ4A 4RHXA 4RGBA 2IXGA 4BQIA 3O8DA 4OI1A 2WJWA 4MI6A 3BDVA 3T5DA 2JVKA 5IZCA 1XWIA 2CDCA 2XZTA 3H5NA 5JAHA 2FX2A 4QBHA 2XXAA 2WIDA 1XDBA 2GO1A 3KYDB 2ACKA 1SVLA 3LM8A 3VR2A 4OX9B 3ETJA 4D80A 5DASA 4EB0A 4K6CA 3IQDB 2H5JA 4FKBA 2AFIB 3UMBA 2PXCA 4LZWA 1PGQA 4CM9A 5D6OA 4YRZA 1HT0A 4HPXB 2FKAA 1JDSA 1ZXBA 2ZSKA 2DLNA 1AUOA 1UKVY 4JR0A 3V6MA 4UMVA 3Q15C 1T5LA 1AQJA 2HRDA 1G9SA 1UP6A 3NONA 1Y37A 4PX9A 4IZIA 1JECA 2BWJA 3CA8A 2P90A 2A1IA 2VDWA 2HDHA 1T2NA 5EC8A 5AOVA 3K31A 4UVDA 3TNJA 3NDPA 3UHOA 1Q5PA 2BISA 4IVRA 4KG7A 1J9GA 4UJ3A 3V4OA 1MB3A 1G8YA 3OQPA 4OUDB 4JC5A 4KR0A 3GFSA 4IKOA 4F91B 4QX6A 1B4DA 4E46A 2DETA 3EPJA 2DQSA 2YHIA 5JNWA 5KNDH 2GD2A 1WVGA 1RDFA 1W6UA 5K51A 2V7GA 2P8JA 4BMOB 3IXLA 1VB3A 3JZFA 4ESVA 3AIMA 3G1WA 2FZCA 1Y6ZA 4P22A 1TKCA 2QL9A 3IESA 1EIZA 2VDOB 5FNZA 2D74A 4NZPA 2RK6A 1Q7EA 2GZMA 1A2BA 4Q01A 2AOUA 3NYQA 3U2QA 3WR5A 3NM5A 2J41A 2H59A 4J03A 3SSNA 1FF9A 1Z18A 2R8XA 3KQQA 5JTTA 2PRSA 1VKOA 4PC1A 1W581 2GN0A 2H4XA 1KQFA 2GLXA 4G67A 2FW1A 5FBLB 5JALA 2DXIA 3DG9A 5DNWA 4LDQA 3GJ3A 3N2ZB 3HP7A 3FMOB 1C9KA 4F9TA 1YOVB 1H3EA 1JEEA 1R8JA 2E4YA 3H2BA 3LUFA 3CS3A 4RVUA 1KJZA 2AOTA 4LVUA 5F3DA 4EHFA 4BP9A 2N3ZA 3PHIA 5JJCA 1U1CA 1RRPA 3ANNA 2B34A 5HFAA 5JNSA 1J20A 4QGHA 5I9MA 1KOJA 2H7YA 3O4FA 5WRFA 2JLZA 3DBHA 1JHQA 1E1DA 4ZJYA 3K70B 2XUAA 4A0FA 1EFTA 2AFIE 2HNAA 1OT3A 4U6QA 3V80A 4WDRA 2C61A 2X13A 3COWA 1T6YA 2XRZA 2HT6A 4M1WA 4MLZA 2VF2A 1JMYA 5DT9A 5LUBA 3AKZA 4G09A 4B4VA 1ISGA 4QVGA 1J33A 1G5QA 3KAJA 3LY8A 4UAGA 1ZCJA 3UANA 3DOOA 5LL6P 4QE3A 1IU9A 1S2GA 2VYCA 4FYWA 5H16A 2Y67A 3CO0S 1JILA 4QUEA 3VBCA 2C7VA 3OHSX 3EDCA 3HI4A 1WQ4A 1J8QA 4J90A 5CK5A 5K0SA 1WIWA 4NU6A 4U7JA 5JQGF 4P53A 1IOLA 5CXXA 4ZQGA 5I9BA 1EB8A 5HILA 1XPUA 3F49S 5TEVA 4PLYA 2F3UA 3BMNA 3DAGA 4FS3A 4QU8A 2ZYVX 2ZRCA 4JI1B 1C8BA 3I2YX 4A6DA 2XD4A 2ZWIA 5E3HA 1CF4A 4ZQHA 1KYWA 3FM9A 5D5HA 1TO6A 3MINA 3WLSA 5BORA 1V1MB 1AS0A 2J7KA 3SYTA 4U7GA 1LC0A 2AGVA 3CZQA 4QBIA 3SJCA 1VFNA 1XA0A 1N8TA 3PL1A 2G6TA 1JIJA 3AEKA 4L8WB 1AO3A 1DLIA 2C4NA 2GVDC 4QODA 4I8DA 3U3XA 4BWVA 5JCOA 3BTVA 4DEVA 8ATCA 3KHUA 5EJ6A 1G0OA 1GA4A 3CN7A 5LOVF 1U2DA 4KDFA 1GARA 2O2JA 3RTEA 2B0JA 1J2RA 4U5XA 4JLOA 2WUFA 1UMDA 4GG1A 1JFLA 3ZW9A 4O59O 1PAUA 4NLLA 4OATA 3FGNA 3IEIA 3UN1A 4CCSA 4EO7A 1TQ2A 1JQKA 3KVOA 4WX2B 5E9AA 3AR2A 3AR4A 1M2NA 3I3SR 2LZ0A 4GI5A 3CLVA 4PHGA 2OFFA 1Z5UA 2WD7A 2HF2A 3D3WB 4CCWA 1DTWA 3LQFA 4KO2S 2GEVA 1TW2A 1IRIA 4PNPA 3VXKA 1PZHA 4KN5A 3FNGA 4XWKA 5AVRA 3C43A 3AVUA 4MWGA 1QU2A 4G07A 1ZMTA 4WY2A 4XARA 5GY7A 5P21A 4LCEA 3OZUA 4PRZA 1KWKA 1Z0UA 2ZJOA 2CNWD 1KAHA 4DS3A 1ZIXA 3JRWA 3OHPA 3QXGA 3KTAB 1X7DA 3H99A 3GFFA 4Y2YA 3RU9A 5CFRA 1E99A 3AIIA 4KPGA 5G0UA 721PA 4ROSA 1RHRA 3ZWWA 4G5QA 1BE0A 1QHHA 3ESAA 1DAFA 3OPYA 4ZIRB 1BGWA 2HSEA 3O21A 4WLOA 3D5TA 4ZRDA 4I14A 1IUKA 3KSRA 1UT6A 4LRQA 2OYCA 1R66A 1EP2B 1NQXA 5IH7A 3O82A 1RXWA 3L1IA 2Z3WA 1IMJA 1YQGA 3WWEA 5DX1A 4YONB 5ICMA 1SOAA 2ECPA 2ZSEA 3LSYA 3UOAB 2FP4B 2PYIA 3BGSA 4RK4A 1XXHE 1BWQA 2DPYA 5EGNA 2EIXA 1PTJA 1I3MA 4MPTA 5JDCC 4KVZA 5DW0A 4BWFB 1JQJC 2IPAB 4HGYA 3A3OA 1G6OA 2QMHA 1H65A 3W2IA 2DUJA 5G53C 3EGDA 1ODKA 3FYUA 1I24A 1AKEA 4FILA 2K4MA 3U4QB 4W5OA 4N82A 1K8YB 1GO2A 2ZVPX 4CM3A 3CUWA 2F9LA 1XPJA 3B2QA 5EZSA 3H86A 3QU9A 4G81A 3VFDA 3R44A 4BVBA 5CBPB 4G24A 2OXRA 4G8JA 2QM8A 2XNKA 3DNFA 4OI2A 4KAJA 4BNDA 4CEJA 4F0JA 3EDQA 5AJVB 3I6BA 2Q5HA 2P1DA 4TV9B 3ANMA 2C00A 2LDXA 3N7AA 2HLPA 4HX2A 2AX3A 2ZJZA 4M1TA 3JW8A 3VJLA 3ZJ5A 2CNBA 3K5HA 3CT4A 1ACLA 2PJUA 3VQTA 2GTIA 4H1WA 3NIBA 5F73A 4JGIA 4FNMA 2V5AA 4YTEA 3R3SA 3SEFA 2D0DA 3CSSA 4EL0A 1YL7A 3ZWNA 5B4TA 4MOWA 5C2JB 5C7OO 5JANA 3QH4A 4MWSA 2SHKA 1B0UA 3UJ9A 1NNUA 2KHZA 1K0FA 1GYRA 1QO0A 4ROTA 9MHTA 4MQEA 4L4XA 3ICQB 4XVRA 3E35A 5DNEA 4D99A 1O9HA 4EARA 1ZC3A 3CZ9A 2X8WA 2BD0A 2C2BA 1AGXA 2IZ6A 5ALHA 2XYPA 1IZYA 3IALA 4FHDA 4LDJA 4PICA 3TPFA 1U31A 3BRWA 2ZRIA 4MV3A 3VAYA 1JJVA 4QO8A 4XVQA 3ZC3A 5C80A 4OM8A 2DFNA 2OUIA 5FRDA 1MHPA 2DWQA 5BSWA 1AKQA 1X92A 4PC7A 2XZOA 5A0FA 2B98A 1PSZA 2BFFA 3BH7A 3L0SA 2RB4A 4MRRA 1UANA 4BGIA 3KYDA 4RV5A 4W5HA 4GC9A 3JYQA 3N70A 1NXTA 5E1DA 3ESYA 4UUNA 4B2YA 3A70A 1GT6A 5B36A 3D1JA 1QZUA 1IMOA 1YRWA 3IQGX 4QJIA 3PGJA 4OCZA 1R5BA 4YJ2B 4D5GA 1HORA 1WZEA 2C78A 4FD2A 1YL5A 2JLBA 3IJ5A 3PNYA 1YBFA 2RGWA 2VDRB 4M55A 3I5YA 4HUTA 1U65A 2GFHA 3PIIA 3E03A 3FCXA 1RHKA 4GMKA 5A5FA 3AK4A 3DCIA 4G8CA 1G19A 1XJ0A 2NUPB 4LNUB 5L4NA 3M6WA 4ZAXA 2WT9A 2XT9A 2MSCB 3ZXSA 5GADl 1EXWA 4MKGA 5E0OA 2XUDA 3SC2A 1MOSA 1QFSA 1L1FA 1CRLA 3TQSA 3OETA 4G1MB 3P4XA 3OE4A 2JLAA 1UCFA 4ESOA 5HZKA 1W2GA 3U81A 3FOBA 2WFLB 1ZJ5A 3GJ8A 1HKHA 2ZBDA 1YXMA 4L07A 5U9CA 4RGYA 4TVBA 3FGOA 1GADO 3P45A 3UICA 4PYQA 3CF6R 4MIYA 5L7TA 4LJYA 4QUIA 3LXRA 4X91A 1JDZA 2VNKA 3PFKA 3UJCA 3H7AA 1D1QA 1KZ7B 1MO2A 1VXRA 3D8BA 2CL5A 2JCVA 2PSSA 2EG9A 3F9IA 4GP7A 5TQ2B 1SEVA 5BRNA 1LBQA 5C5CA 2IHUA 5F33A 1YR1A 3PX3A 4BFXA 1E94E 4B5LA 3FMGA 4HCJA 4Z53A 1RRGA 1MRSA 3KQKA 1N5KA 3D3NA 4EB6A 3KSAC 1EE9A 4BU1A 2NUAA 1JHAA 1N5IA 1RJEA 3B6EA 3KTAA 3IR6A 3P0RA 4A0RA 4HEA6 2LNDA 3VC2A 1DDGA 1YA8A 2IEBA 5IKEA 3KT0A 3Q0IA 1D0SA 1CE8A 3FCCA 1J0DA 2XBUA 3OQNA 3LW7A 2FPGB 1GD1O 4MDEA 2FQXA 3RIXA 3PFHA 1RFGE 3PUXA 1XN4A 2O3TA 2XWBF 3HGTA 4JKYA 1C3OB 5GGXA 3PNBA 2CXSA 4G4SO 3SKVA 5L45A 2XCTB 2WP0A 1AKNA 1PO7A 2DBRA 2NU9A 1KKUA 4MVJH 2C31A 4TLEA 3PIRA 2YVLA 3SSMA 4R0MA 4KO8A 2KWIA 1N34B 1KOFA 4ARBA 2XB9A 5TJHA 3G2IA 1GPBA 1A2KC 1AMNA 1Z13A 3STWA 1S9DA 2GBCA 3VX4A 2B78A 2EKBA 4ACAA 5LJLA 4M8IA 1SKAA 2HWKA 3BF8A 2C4TA 1Q1ZA 3O90A 3V8MA 1SIBE 2GF9A 2R60A 2NXJA 2WAYA 1QANA 3GO4A 2HBYA 3PDCA 4MA0A 4R4JA 3T0IA 3WMEA 3ZOKA 2W8BB 4B7AA 5J1SB 4DIBA 2A9PA 3I05A 4LYDA 4Z7OB 5I7RA 5LZ4A 2NXCA 4COOA 2HJHA 1H2YA 4ZO6A 4QOSA 3TWOA 1P29A 3GVXA 5EQJB 3TQOA 4I50A 3WQQA 4QGBA 4X3OA 2CJWB 1IB0A 4BNTA 3DAYA 3U1BA 4MYCA 2QV0A 3IHWA 3KTOA 3CPSA 3LW8A 4KVAA 3TZLA 1JT9A 4ZYXA 3DOFA 1Y9EA 4R9RA 4R84A 5DYTA 5CT8A 1XELA 4QLOA 1CF9A 4YPFA 2O57A 3VNQA 3ZU2A 4LQ4A 1QKIA 1LSUA 4G4GA 2IZ1A 2PD4A 4GX2A 5LQDA 3KPJA 1V1RA 3HN2A 1VYVA 5H80A 1N7GA 1M7HA 4JFRA 1FS6A 2X0JA 4OYHA 5BQPA 1V5IA 2I4OA 4Q7QA 6ABPA 3RVLA 3MWYW 2P5UA 4QYSA 4KQ2A 3WKDA 2IUTA 3C3XA 3DJFA 4EYGA 2PKRA 1GZUA 1VI6A 1R5OA 2WMDA 4M86A 3EFBA 4RZUA 1Y8AA 3OICA 2X3YA 4TN5A 4TUYB 3TI7A 1BU5A 2FPIB 5JXWA 1QZXA 2DX7A 1YQEA 2GZSA 4TS1A 3UAXA 4LF5B 1GZ4A 4AZ0A 2HF8A 1WP4A 4D0GA 2KM1A 2YJ5A 5KBYA 2RGAA 2FJUA 2VBFA 1HG1A 2VTVA 3EMDA 4HLUA 1MG5A 4XLTA 4LBYA 3ZNQA 3D4IA 2YHAA 4CHGA 1NUQA 1RBZA 2CBGA 1LA2A 1BHSA 1O95C 2XAUA 3F5DA 3T15A 3ZS9A 3ZGVA 1F4LA 4AY4A 4E21A 3RVDA 1RP7A 2G9RA 4C9BA 4RZHA 5F64A 2Y77A 3ONDA 1BQ4A 1XDZA 1BZYA 1YS1X 4OXYA 4GUAA 4BMZA 1TYZA 5IAEA 3OLWA 4Z0HO 2JLRA 1CLEA 3FDIA 4J7AA 1TO2E 2YY7A 3BMCA 4WAUA 1VBFA 4XASA 1EWRA 1DBQA 3DQPA 1QHIA 1O96A 1WUKS 1XNGA 2F17A 5BPFA 5E0KB 3AT1A 1GG5A 5FX2A 4GX0A 1UEJA 1DHRA 1XTJA 1H9BA 2I8AA 2NU7A 1XNHA 4J6FA 4GP6A 4ZN6A 3CVYA 1F7UA 3QLTA 1M7BA 4H6PA 3ERCA 5K6RA 3DOUA 3KP1A 3RSFA 3OEED 1U7PA 2IIBA 2H2WA 2XCLA 3W5JA 5B6IA 2OXFA 3FVWA 3HBLA 2QW8A 4KFSA 1YZKA 4OJKA 2I66A 2QB5A 3BEOA 2C0CA 1QWOA 4QYIB 1K63A 2C2ZA 1YE3A 2PMFA 3FCSB 5HA5A 4YR9A 2G8LA 4JQSA 4QXRA 3I6YA 2XSZA 4UCFA 4XXHA 1FLVA 2GRUA 4ZQFA 3BC1A 3CH6A 3TLGB 1QH8A 2QJOA 4RTMA 1DQZA 3U44A 1M54A 2YHUA 1VLJA 5FUQA 5E6UB 2QVBA 1RACA 4MQFB 3T7DA 4NRDA 2YJTD 3UMCA 1ONSA 3GI1A 3R7WB 5KKNB 1IBKB 3LIIA 4I3HA 3ZQUA 5J3JA 4FKZA 1WF3A 2O3JA 2WDPA 1RC1A 3EXHB 3SC3A 3RKRA 4HS4A 4CG2A 1NR5A 2JBAB 2ZIEA 3WXMA 4E5KA 3NJ8A 4M0PA 2HXSA 4W63A 4PLHA 3ZV7A 3MTIA 5K0FA 2OENG 1FFDA 3IVMA 4G0OA 1QE0A 1RXEA 4S05A 2G17A 1EUQA 3ZVKA 2J0UB 1SOVA 1JE1A 2B4RO 3L0IB 1TO1E 1JEOA 3UIEA 4N7BA 3K6KA 2C1XA 1V95A 1EXMA 4B85A 1LB1B 2L2QA 2OILA 4UUPA 4Y0VA 4B75A 4IQ0A 3HZRA 4IBOA 5H3LA 5ABPA 1P0IA 3TQIA 1N2EA 1B14A 4CG1A 3IIEA 1EVQA 1NBMA 2R1VB 1JALA 1PQUA 2UUAB 5CJJA 1N2CA 2GHTA 2E21A 4PVCA 4F46A 4PIPA 3IMEA 1SQSA 4CQMB 2FG6C 4UW9A 3L8HA 1JSCA 1PDWA 3G88A 2ZJ1A 5LBIA 5BQ3A 3KC2A 5BVHB 3PPYA 2NO0A 2VXYA 4GKAA 5ITVA 2FZEA 2VJAA 3IP7A 3LGSA 2D7CA 4KQJA 3QV2A 1SHLA 2QGZA 2JJ2D 4OTZA 5A9TA 4O4LB 4L0CA 4ZK6A 3TUZC 1HI9A 1XRMA 2W2KB 4E5UA 1AZSC 5JS6A 2GK7A 4NZ9A 3NLLA 4CM8A 3GW8A 4G0PA 3H65A 4DSZA 1G0NA 4RH1A 4ONEA 3F73A 2NSLA 3B1XA 3DVSX 3IPYA 4H15A 3RYFB 1KZHA 4UEJA 2AWNA 4F72A 1RYBA 3A31A 3EZ9A 2PGJA 1Q83A 3Q8LA 1D5WA 3FBGA 2HK8A 1QP7A 2A4MA 1WEHA 5DMHA 1T24A 1C30B 3DKKA 4BRUA 5BN4A 3E23A 5ARBA 4TMFA 4MUGA 1KSFX 2JGRA 2FUEA 1U2QA 3N0WA 3BG5A 1DMSA 1JIVA 4MO2A 1DC3A 1LXCA 1W88B 2GLUA 1UFKA 2ZS7A 4NE9A 4UBKA 4K9MA 5IAGA 3R8XA 4KIGA 3IMKA 2MIIA 2QTAA 4JJ4A 4EFMA 1KI2A 2RH9B 3OFSA 4RDCA 1AQ6A 4YACA 1R3DA 4Z9XA 5C1PA 2D1QA 4RIEA 5BR4A 3IOCA 4F7DA 4LXUA 3KPYA 1S9HA 2POQX 3P97A 2G9NA 4BFLA 3E22A 1SQFA 3JQFA 3ZWQA 4NMWA 1VA4A 1VG1A 2O8BB 1UH5A 1TB4A 3VAZA 3CU5A 1M72A 3KOUA 4Z1MA 3QG5A 3KJIA 1G59A 1Z37A 3TUJC 3OEHD 5A6VA 3SHOA 3K0CA 4C6HA 3GF4A 3M4NA 3SF8A 1KERA 2B8TA 4ZOLF 5KDOA 2FPMA 2C3UA 4NICA 1ZS9A 1FXWF 1MU0A 1NXQA 1P39A 2DRIA 4GP9A 2E3JA 1BMFD 3KQWA 1T26A 3KJNA 3D3EA 1OE0A 5DHTA 2CVOA 2Q4DA 1VCNA 4LGMA 4E5PA 2AFHB 3T6KA 3RRBA 2NSJA 4MUBA 5L8VA 4KH1A 3KLNA 3OZEA 1TMYA 1PX2A 1DXHA 2OAEA 2ZI4A 4IV8A 1BXRA 1JPUA 4AW9A 1ZL0A 1F2UA 1E9BA 4Q7EA 1RHQA 1OB2A 1Y3FE 2FDRA 4MRAA 1XWWA 4HI0E 3W0LB 3WFIA 1XDDA 2GCPA 5D5PA 2G9ZA 1VDMA 3I64A 3I9V1 4DR3B 1W6RA 3TQFA 5FWNA 1SCBA 3V2HA 1SOWA 2BKUA 5FEUA 4UEOA 3K9FC 4RA9A 2H85A 3AY0A 2D54A 2V65A 3QBVA 4FCVA 2F4VB 4OLBA 4FVTA 3T94A 3AHDA 3CLKA 5DOVA 1EX9A 4CDNA 2OZKA 1Y5NA 2QAGC 3B53X 2AX4A 1F8UA 4HQRA 4K1XA 4RFVA 1EMDA 2WG2A 2AL7A 2WNIA 3BE4A 5EE5B 1CUZA 4MA4A 5C35A 3BOSA 2XT0A 3DLIA 1ZNZA 3R23A 4RFSA 1XTUA 2RHMA 3NATA 3WS7A 4L8YA 5AIAA 2WPDD 3BK7A 4LVCA 3WGKA 3N7UA 4YFYA 2APJA 5EP2A 5TNXA 3SR0A 3UHJA 1QP8A 4DR1B 3UCXA 4RYLA 1EQUA 1ZU5A 1Q1GA 1G1AA 3C5VA 4IDNA 2GFIA 5JYDA 3ED1A 4Q1EA 4QRDA 2FZVA 2OM2A 3ABQB 3INYA 3KWLA 3OU6A 3E0XA 3KSUA 2YDYA 3PITA 2XEDA 4NKRA 5F52A 5T4EA 5CVDA 1WXQA 4O2LA 1MJFA 3ORQA 2FPWA 3B9RA 3LC1O 3NOQA 5AUQA 1Y8RB 3CKYA 1HYHA 3W2GA 2YIVX 4EMBA 2Q2NA 3E3MA 3TLJA 5A4DA 4ZEOA 1YAJA 4BUJA 2EKPA 1S01A 1U9IC 2QE7D 4I46A 2NO5A 1NQTA 3THYA 2B4YA 4JKOA 4AS1A 4N76A 5FI1B 1M33A 4X54A 5JZ9A 1US8B 1Q0SA 2OV8A 3LPAA 2F3RA 4TS3A 4TV8B 3OPYB 1SC1A 4RTJA 4GR9A 4CM4A 2AXNA 3RC9A 4JIGA 1YRHA 3IAM6 1BOOA 3RT9A 5BQ5A 4R16A 3VI3B 5KYYB 1HY3A 4MS1B 1WB9A 1JTEA 4BO6A 3K72B 3AETA 1NP3A 2ZTUA 4UTVA 5BV2P 2A9KA 5IU6A 3V7UA 3GP5A 4L73A 3BSSA 3QMVA 1Y5RA 1LBTA 3RIYA 4X64B 4CMBA 4IIEA 2MT9A 1QAOA 2WOJA 3AI1A 2PZEA 5GZ6A 5A3SA 4LWQA 1N2ZA 3PC2A 1N25A 1H2ZA 2RBGA 4Z4GA 2O0HA 3I5XA 2JH9A 1Z4JA 3GP3A 1G5FA 1VJTA 3RIEA 5CCEA 1YF3A 4XA8A 1LDMA 1RXIA 3PUIA 1CFJA 2RGDA 3GARA 4OQEA 3GT3A 1FRZA 2P9CA 3A6FA 2R62A 3COPA 3NIDB 1KNXA 1AXGA 2XB8A 2ZIGA 3A4LA 3C8UA 5E2AA 2XJ4A 5TPWA 1I0ZA 1QIKA 4EM6A 4K2AA 4R1QA 1X1QA 2H54A 4IH9A 4DMCA 1BG6A 4F5WA 3O92A 1YBHA 1XB2A 1QIHA 1WXFA 4CT4B 1AE1A 4Y6OA 5AVSA 5LD2C 1XT6A 1RLTA 5EUQB 4K88A 1VBNA 3IHTA 3ZHOA 3WWOA 1A7JA 2L17A 4H7JA 1LI7A 3ABIA 3FCYA 1T1RA 4PQFA 3ZY6A 1K0UA 4JI8B 3PNOA 5DYNA 1LU9A 1CVIA 1KHTA 1Y81A 1ZBQA 3O4GA 4PHHA 4ZO8A 4BP1A 1CU1A 1X0VA 4C7OA 2NYAA 3ZD9A 1H2FA 2XOEA 5B1YA 4MULA 1PYGA 2BFEB 2BEVB 3DDHA 3GX1A 4JV5B 1JHMA 1SCIA 1RPJA 2V1UA 2BW0A 1VGRA 3JVDA 4H3HB 4U0JA 2HSGA 3RU7A 3VR4H 4QXOA 1C8VB 3HWX1 3KU1A 3G9TA 5EXTA 2J31A 4ZDIA 5AI5A 3LCMA 1Z5VA 2OQIA 1JXOA 3AKDA 3AU9A 4K9DA 4O2AB 4A73A 4HVLA 1FA9A 1I4WA 3BL6A 2PKQO 3WQHA 4TLAA 4UUBA 1U3GA 4EI8A 1QQ5A 5EGSA 3GLFE 1YR3A 3IIMA 4C05A 5B3JC 4OGLA 4TVKA 1JHZA 2BGMA 3OEWA 3G5AA 4JA0A 1DBRA 1KR5A 2BE9A 4MMYB 2RHLA 1YZTA 3FF1A 4FFWA 2I3GA 1KI1A 1IBSA 5B3JA 3RGWS 2P6UA 4BZZA 4ZU1X 5KTOA 4TXHA 1Z82A 1U04A 3FHOA 3I4FA 4WLEA 2CXOA 1M83A 1N2GA 5JS1A 2O8FB 1RABA 4H7FA 4AZTA 1W4LA 1GL9B 2X76A 1N7HA 3L82B 3G2QA 1G4AE 4HDNA 4L9RA 1H5QA 2VQSA 3Q6NA 1JLLB 2LDBA 5EG5A 4FM9A 4MV5A 3VR4A 3WK4A 4ZOQI 1T6XA 1NULA 3NOVA 4FZ5A 4M7RA 4LF9B 1OH5A 3ETHA 3R6GA 5CD9A 1A8QA 3ZW7A 3OU7A 1SCUB 2M1XA 3PEFA 2PT9A 2YXNA 1XE3A 1Z15A 4LDNA 1S1CA 3GYGA 1WVIA 2W8BA 3KFLA 2E4VA 4IVNA 4JBGA 4L3WA 5ENDA 3CJQA 4DAEA 2GO7A 7REQA 5CA1A 5HJEA 1Q0HA 1TT7A 3BMQA 1E0SA 1NUAA 3OJCA 4O4HA 4LGYA 2W6QA 2C7GA 3MUEA 2PO5A 1W5SA 3MJSA 2RKWA 3BE5A 1Z6GA 4HEHA 4B82A 1U99A 5AJHA 3R4CA 3U7QA 1VL5A 4CMEA 4INOA 2J0QA 2H4HA 2NSYA 3DVQX 5DRYA 1L4MA 3A0RB 4O8ZA 7GPBA 5F1PA 1G21E 4JBIA 5JMTA 1CJCA 3N2YA 5KWJA 3U1TA 1DOAA 3A4TA 1A76A 1KY5A 3EVNA 3PVZA 3KQYA 5LD2B 2JGJA 4R81A 4PFQA 3Q8XB 2FPLA 3IE0A 1U1EA 3NVMB 3K1AB 1OWLA 4BCCA 1EDEA 4L76A 3B78A 1O57A 3G82C 1ZISA 5LZ8A 1TCUA 4C20A 2D1FA 3GQBA 3I9FA 4FOLA 3ECCA 4Y0AA 1WU7A 1KO7A 4B4WA 4F93B 1QBGA 2YWGA 3LDGA 3ND6A 1F51E 3WRXC 1PLLA 1L8LA 3BXHA 4P32A 4M53A 4JI4B 2O8NA 3GLKA 2FPOA 1J23A 4C5CA 1FK8A 4ANFA 2VRWA 1E7RA 2QNRA 5FF9A 3KTDA 2IPMA 2C7OA 1DINA 3ICVA 5BYBA 1QAQA 2BBTA 4R2MA 4O4JA 5DHAA 5DM0A 4ZYYA 1XHFA 1WXEA 1L4KA 1UXHA 4KYUA 1P91A 1P1IA 3VPDA 1PZXA 4CKXA 4QBFA 3FCEA 2VH1A 2R4TA 3EEYA 4QQRA 1CJUC 5LP6A 3B89A 3QKRB 4PGFA 4RLSA 1TZKA 1E6CA 1F0NA 2A0KA 4LHZA 2HWYA 1W85A 2GB4A 3RPEA 3MRSA 3ZZ1A 1PUXA 3QHAA 1QGUB 3BFVA 4HH0A 3EVDA 2VKQA 4C4SA 3ZWAA 4C5AA 2XLBA 1PFVA 1ZW1A 4ZK2A 4U7PB 3EXIB 1CUWA 3IXMA 1TJ3A 3EAQA 1G21A 4W5JA 4MYSA 2UZ1B 4GPIB 1U1DA 3LLMA 1YCDA 4E5NA 2P2NA 4EG4A 2FR8C 1X1RA 4UBIA 1W1WA 3CZAA 3OIYA 2O2SA 3G8DA 3HP1A 4LSMA 2XA9A 1R2QA 2NU6A 4MQUA 2EC5A 3KKMA 2GF0A 4R3NA 3UJ6A 3CN9A 3QG1A 4M0MA 1A5BB 1WBDA 3BRQA 1KP3A 5CT4A 4D4JA 1I4TD 4HGOA 1J8VA 2XKJE 3CX4A 1M2FA 5ERXA 1KYZA 5AVOA 5JNUA 1EFHA 1DXOA 4IIJB 3FCUB 5DNUA 1D6SA 5ALWA 2ZBPA 1SKYB 1AHIA 2FNAA 5PNTA 1T15A 4GEGA 3SZ3A 5DYGA 5JS2A 2J3QA 3FWZA 4MRVA 4AP9A 2O8CB 3ZEIA 3PYXA 1E96