2EFCB

Ara7-gdp/atvps9a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
165
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 51
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efcB00
5KTYA 2OBNA 1WBDA 1LV7A 2QMHA 2QTVB 2ZEJA 2YJTD 2ZRLA 4ACBA 4AD8A 3KKOA 2V1UA 1U0HC 2X19A 3OAAD 3TE6A 4MUAA 1CR0A 4M0LA 4BFUA 4NCKA 1XTKA 4A9AA 2OUKA 1N5KA 2H16A 2JCSA 2Q6TA 3DZ8A 3K0AB 4UKDA 4OBEA 421PA 1DTSA 1XEWX 4N3NA 3VR6A 5F9FA 2ZYWX 4GNKA 3FKSA 4TMKA 4NCJA 3P27A 2ZRIA 2GNOA 4M4SA 4Z51A 4KO8A 1G5PA 2QU8A 2N1BA 1TEVA 3L8ZA 3UMFA 4EQ6B 4DLVA 4D26A 2CVFA 2WWWA 5CIWA 4FCVA 4OJKA 3E70C 2OT3B 4OHVA 2B7CA 1E79A 2ZU0C 2IK8A 3K09A 4D81A 1UBFA 2A5YB 4YXWD 3LRPA 4DWJA 4KSCA 3GLGB 1MRSA 4WA7A 2ZRAA 4HAYA 3BWDD 3KQLA 1AS3A 1DE0A 3Q8XB 1L4YA 1QHXA 1ZM7A 1ZYUA 1OFTA 1T6NA 4KFTA 4LV5B 4A0FA 3K70C 4BEBA 1KI3A 3KL4A 5H1YA 4HLCA 1OYWA 1QRAA 1MO5A 1Z63A 3KFVA 2CE7A 4OJQA 3H84A 5K8LA 3T1VA 3OIVA 4D0LB 5HCNA 2HF8A 1PJRA 3QXCA 4MGYR 2HXSA 1KDRA 2VH5R 2ZS8A 3KB1A 5HKKA 5J4LA 1UDXA 4MYUA 1XEXB 4RD3A 4UXHA 3CX8A 1JEEA 5CDFA 4PTLA 4Q4HA 2QQEA 1EK0A 3RAPR 1JJ7A 1CTQA 3QPUA 4N0EA 2PX3A 3ZQ6A 2A2ZA 1UBCA 5L3QA 5CK4A 3NVAA 1G3RA 3PQCA 1T8UA 2GEUA 2ZRCA 4F7WA 2AXNA 3LAWA 3IEUA 2RMKA 3B82A 3MD0A 3EZFA 4IDQA 1PVOA 2FEMA 3AGQA 3GJ3A 3N5CA 4R7ZA 2YOHA 4MRVA 2KB0A 4Y0AA 1D8TA 3KQUA 2IL1A 3VHLB 1HH4A 2ZE7A 3OIYA 3UKDA 4FWTA 1OE0A 3W3ZB 1KSFX 1S1CA 1VDZA 1MKYA 2G0NA 1GSIA 1VHTA 4BFSA 2HF9A 1E9DA 1SVWA 2ATVA 1W0KA 5DN6A 4BGDA 2WHXA 3GFTA 3VR4A 4GT1A 4TWZA 2WJJA 4G5SA 1E2HA 4QC2A 1XEFA 3ZZUA 1UDWA 2VP4A 4OI4A 1D5CA 2OEPA 2X77A 1S1MA 2V8OA 1R8SA 3OE7D 4LYAA 4LJ8A 2CLSA 3DZDA 2IUTA 4A0RA 2ZITA 2P5SA 3K8YA 4G5OA 1RPZA 5JS8A 1ZUHA 2WMOB 1DELA 2FFAA 4WW0A 3ZD7A 4WZAE 4CEHB 1G291 2V54A 3I4LA 5KSZA 2RB4A 1KI9A 1E2QA 1TUIA 3BE4A 3AVYA 1CF4A 5CLQA 3N2IA 4WZ6A 1AGPA 2F1HA 2WWYA 1VG0B 2QP9X 2GAOA 2MMCA 3U44B 4LV8B 1TF7A 4U5XA 4R71A 1S9DA 2PMKA 1OV4A 2BM1A 2GXUA 2FSIA 1YZQA 1G8PA 2CK3A 2D74A 5FUYA 1KSGA 3WMEA 3WYFA 4JL5A 5BN5A 1AJEA 1TQ2A 3K53A 4TYWA 1ZP6A 2ZRFA 1XU4A 2YWHA 3TBKA 2ZVPX 2AL7A 4US0R 2WJYA 3Q5DA 4OQLA 2ZXUA 4F91B 1NIPA 2F43B 3UK6A 1D6JA 2QAGB 3GLFB 1Z6YA 2D2FA 2H5EA 3EPHA 1YZNA 2WSSD 5EXTA 4KVAA 4R2IA 1EFRD 4IVRA 2CCJA 4IW3B 3K0SA 4V0KA 1XMIA 1T8TA 4WXRA 5HR5A 2F3RA 2J5XA 1ZD1A 1Z22A 4OQXA 4FXPA 3O8CA 2JLSA 3Q7PA 5SZIA 3B5JA 2F43A 2REOA 2EFDB 4WIAA 3SEAA 4FMCB 1C1YA 2GZAA 2FOLA 4CZ2A 3Q3JB 3GLFA 1ZVQA 4LY6A 1IXSB 1KO1A 3QEOA 4LWZA 1DADA 1KO4A 1BMFD 4ZI2A 1KSHA 4RFSB 3RYTC 4BPBA 4AKHA 2VBCA 4LHWA 2PMDA 3B1YA 1II9A 4BLPA 3SQXA 2HCBA 3GFPA 3W9YA 3AKDA 2C8VA 1KO5A 3CLVA 2JASA 3LV8A 3QNUA 2QBYB 4QHYA 4L8GA 5JWHA 1E9FA 3IQXA 4RFSA 3QKUA 1P2UA 1FX0B 1P72A 3QBTA 1SXJB 3F0TA 2OG2A 1KDOA 4BZQA 1WCV1 3WYGA 1VHLA 2GWHA 1GKYA 1OIVA 3PFIA 2Q9BA 2XB2A 4DRZA 4HB3A 2X2FA 1ODFA 2GDJA 4PO1A 2QBYA 3ZS9A 2Q21A 1DAGA 1RYFA 2ZE5A 3NDBB 4JMPA 4LPKA 2ZPTX 1SXJA 1E0AA 3PITA 5BW8A 1HA3A 1IOZA 3NEJA 1A1VA 1UBEA 4PXAA 3FPAA 3BGWA 2CL6X 2QA5A 3RVBA 2VYFA 4HB0A 3R7WB 3AP2A 3TNFA 3CH4B 3OEEA 3NBFA 1YR8A 2FEOA 5FBVB 3A36A 3R20A 5EZ5A 4D6PA 2XSZA 4TT3D 3KTAB 4DC9A 4DBLC 1DO0A 2A30A 4C7OB 2R6FA 1AK2A 1BO6A 3KJGA 1OKKD 1IXRC 2OESA 2PH1A 1J8MF 1FP6A 1OB5A 2CJWB 4YMUA 1NG1A 1KI2A 2ZUDA 4TLAA 5JEDA 4I1OA 4CEIB 1LNZA 1WDTA 4NU0A 5D3MB 4B73A 5HTKA 3F8TA 4IXNA 4OQMA 4DLRA 3DOEA 2CNWD 5GVRA 4GOKA 3CNNA 4DIEA 4KSBA 4XD7D 5FOSA 3ZZ0A 1AS0A 1E1RA 3EC1A 3KQKA 5KDLA 2CJWA 2VEDA 1E9EA 3MWYW 4B71A 4CEIA 1N6OA 3EWSA 4CF7A 2DB3A 4KYIB 1BYUA 3FB4A 2G77B 1MO4A 3R9XA 1QVRA 2QNRA 4WVFA 3RNLA 4PHTA 1XTSA 2REXB 1UKVY 4NYMQ 4G5GA 3U6KA 2IF0A 4Q4AA 4I99A 4PZZA 4BQSA 4TMTA 3QENA 3W6OA 2QGNA 5HCIA 4CEJA 3MJRA 5JLJA 1DAIA 2LKCA 2GF9A 5GJBA 5FTJA 1EFCA 3T1QA 3MJHA 4JLBA 1XP8A 2GRJA 2JJ1A 2W6ID 2D4HA 2ZSAA 1S4QA 1EXMA 5AR1A 1U94A 4D0NA 1G20E 1K5GA 1R8QA 3SYLA 4F92B 1KZ7B 1QZXA 2J41A 1G18A 3BAFA 5DYIA 1LF5A 5FL7D 3IO5A 4A1FA 4BFWA 1RC8A 3KKPA 4O0MA 3RS7A 2C9CA 1W5SA 2QORA 3CX7A 3C4JA 4A92A 5BQ5A 4KITB 1Q44A 1Q3HA 3M6AA 2NPFA 1IJEA 1J7KA 4GMXA 2ZUCA 4P3YA 5K8TA 2ZETA 4GMDA 1W0JA 2RHDA 3SYKA 4W5JA 2X2EA 3NC1C 4PPGA 3LA6A 1ZIOA 3M1IA 4L9SA 2IYVA 3WP1B 2OBLA 4BLTA 2DFTA 2YYZA 4BWYA 2QAGC 1KI1A 2R6AA 3A1WA 1CRQA 1AZSC 1E2JA 2DBYA 2ZIAA 3MLEA 4JLAA 3THXB 4BEJA 1N6NA 1Q12A 2ANBA 3KKQA 1ZJ6A 2AKAB 1F3OA 1JR3A 2CHVA 3C16C 4FD2A 1H65A 1XD2A 3OESA 5E7MA 5EP3A 2R6DA 2V1XA 1OXSC 1KJYA 1P73A 2AX4A 4KLZA 3ZS8A 2ZM5A 3SS8A 4LHVA 3LDAA 2KI5A 1YRBA 2ZYTX 3WBKA 1W44A 3LBNA 3THXA 1GIAA 3A6PC 1F48A 1GRRA 2J46A 4QGHA 4HAWA 1GL7A 4QBIA 3HU3A 4TTPA 3SJZA 2W2TA 4NKRA 2WIBA 1M7GA 1G7RA 4A0HA 1M7BA 5KU1A 1E9AA 3EW9A 4FN5A 4C3ZA 1XPUA 2YVUA 3HPRA 5KNDA 4U02A 4XVQA 4EPWA 4FW9A 3GLHA 4D4JA 1AKEA 2VPPA 4KCGA 4E22A 1Q21A 1NVXQ 2GJSA 3HYTA 5J4VA 1NSTA 3R9IA 4HB4A 1ETUA 3P4YA 3S1AB 1P7CA 3I73A 3U7HB 4M1SA 4WBSA 3L0SA 3RS5A 5C1BA 2C9YA 4KODA 4KV9A 3BORA 3T1TA 3DL0A 1J8YF 3H1TA 3AP1A 1JXMA 2FGJA 2B21A 1PV4A 2GJAA 3FFAA 1YZGA 3GJ8A 3U7EB 3OEHA 4YDSA 4URXR 3X1ZA 3I62A 4DEYA 3ZYCA 1KTVA 4HAZA 3S1AA 1KO8A 4IOMA 2H1LA 2IS4A 3R8CA 1XD8A 1TX4B 1A7JA 2A5FA 2H57A 1P75A 3CZPA 3TRFA 121PA 3CRRA 3WRXC 2E1RA 2BBOA 4Q48A 2JIZD 5TARA 3MWJA 3REGA 2XOKA 3PEUA 2ODNA 1C4OA 3BBPA 4ZKEA 4UNQA 2PZGA 4ZCMA 3DEFA 4OHXA 4QNMA 4OQNA 2C2HA 1I4TD 5KDOA 2BBSA 4P4UA 2JGNA 4OHYA 1Q0UA 4CRWB 4X8HA 1E9CA 3SR0A 3CKLA 5FBQB 1U90A 2F55A 1F2UB 1E4VA 3B60A 4CW7A 1E2DA 4LHXA 4HUTA 4B47A 4GOJA 1KSJA 4TYPA 4ZKDA 3AV0B 1NRJB 3BJIC 5L3VA 4J0QA 2ASEA 2J3EA 2FSFA 2VF8A 2Z6VA 1XTQA 3IO3A 3LLUA 5DO9A 1M1YE 4DLXA 3O8BA 1WXQA 2ECKA 5G40A 4NZYA 3CBQA 1R5OA 1ZC4A 2B92A 2C77A 3IILA 2X8AA 1NN5A 5FBWB 5FOUA 4MGKR 1H8HD 3EARA 1Q20A 4YMSA 2VO1A 4HZIA 3EPLA 2Q9CA 2YC2C 3CWZA 5B30A 4EPRA 4KXFB 1E9SA 2ZJZA 2P65A 3H0KA 5HPYB 3QF7A 1UBGA 3PIRA 1Z3IX 2ZU6A 1WBBA 2BWJA 1GNRA 3U3KA 1YU9A 1KAOA 1Z2AA 5J4HA 4E03A 2C95A 2I1VB 4JSYA 3WNDA 1HEIA 2FDCA 3KXKA 1QF9A 1VPLA 5IDVA 4QHTA 2AK3A 1R10A 4FMDB 1US8B 4NDZA 3U3OA 2A78A 3RDPA 4RKFA 1FFHA 2XTMA 2HUPA 2BBWA 2NZJA 2GBLC 1XTRA 2QUZA 2HT1A 2N42A 4US1R 2ZRJA 1PZNA 1PLKA 1NJFA 2VA8A 1I4LD 1E2GA 3B1WA 3RC3A 3TIFA 3CRMA 4AYWA 4A8JA 3BXZA 5FPKA 2KE5A 2NO6A 4HDOB 4PZYA 2QROA 3NBYC 3VU9B 5HZHA 3ADBA 1XFAA 1C9KA 2VHUA 1ESNA 1FL9A 3CM0A 3L8YA 5FBLB 3ZVRA 1GRNA 2I1QA 1KMQA 2FH5B 3FWYA 4WAUA 4AYTA 3NKVA 1KI6B 4R98A 2JATA 1A82A 4M22A 1GOTA 5CITA 4LHZA 2C78A 2FE4A 4FINA 5CB6A 3QF4B 1DAMA 1QG2A 1TEXA 2ZS9A 4LDJA 3SJCA 2AD5A 3VU9A 1H8EA 3RSOA 3FKSD 4MUBA 3CR7A 3BD9A 2MSDB 5JSZB 2JA1A 3ZGXA 2VSXA 1R0WA 1AKYA 3U6BA 5EE0A 4DB2A 1ZRHA 4D4LA 1W2GA 4OI1A 5SZJA 1CBUA 2ZRBA 1DARA 1IN5A 2N46A 4PX9A 2FPMA 2VRWA 1P2VA 1E79D 1NSFA 1OFUX 3QPVA 4FCWA 2QP3A 4OHWA 5JSZA 1E3MA 4Q7JB 2IT1A 4EPVA 2VQSA 1Z29A 2G1KA 1AN0A 1AZTA 3I8SA 2BM0A 2GXSA 4M1WA 2ZVQX 1Z6GA 4MYTA 1SULA 5UKDA 1YZKA 2ZE6A 5H8WA 4GZMA 5F3WB 1CJKC 4ZPXA 2OBMA 2W0MA 2ZI9A 3SHWA 4QBHA 3TGPA 1T4GA 4MGZR 3IIJA 2MSEB 5AJVB 3K9LA 3ADDA 1GITA 1JNYA 5DIFA 4C4PA 5FFMA 5K8UA 1QHGA 1XCPA 3LWNA 1WB9A 1UAAA 1NVVR 1EWRA 5HKKD 1T5LA 3QPWA 3R8FA 1UEJA 4RD6A 3K9NA 2C99A 4JVNA 1RZ3A 2V55B 2EQBA 4HLDA 4HZUA 2XZPA 3RLFA 3GMTA 4QJ3A 5J4KA 3BFKA 2WTUA 3EPKA 1VG8A 2GJ8A 2DY1A 3O47A 5BN4A 3W6PA 3VFDA 1Z47A 4AKIA 1DAKA 1KO7A 3DKPA 1OHHA 4L16A 4A6XA 5DLQC 4RZ2A 3GLIB 1CS4C 5CJPA 1COWA 1G8FA 1SKYB 3GLGE 1X6VA 2HXYA 2Y8EA 4GPTA 1U9IA 1XRJA 4P0TA 4X8MA 1T9HA 1U81A 3I5XA 4TTRA 3IPXA 1N6RA 1KI7A 5BYJA 3FKQA 2WJIA 1MABB 4NMMA 4E07A 3QKSA 1QHIA 3AVQA 2RGAA 3VX3A 4TYYA 1YQTA 1VKJA 3ASYA 3RRNA 3GLIA 5KO2A 1GTVA 3GP8A 5LBIA 4ZDIA 2BV3A 2D62A 721PA 2PBRA 3A58B 5CDFE 1ZIPA 3DO6A 2PCJA 1W0KD 4LJAA 4PPFA 2XEXA 4JS0A 5DN6D 2OCBA 1DOAA 3VR5A 1DEKA 5FR2A 1MABA 2A7QA 1QBKC 3ND8A 4ITRC 4BLOA 4EPYA 1OIWA 2ZYUX 5CM8B 3GJ4A 3VTKA 4DDTA 1CR1A 3K0CC 2MSCB 1VYTA 2AWNA 4XWKA 1DAHA 2GESA 3QEJA 2GJ9A 2J0SA 3TSOA 2IYLD 4EDHA 1KY2A 3HR8A 1ZNZA 5JHHB 2HLDA 4CDGA 5EXSA 3PUYA 4B3XA 1OIXA 2RHMA 4QNRA 4DSTA 5C18A 4C2UA 1A4RA 3TVTA 4QBGB 4F4IA 1I2DA 2IYQA 3KUDA 4Q9KA 1E9BA 4ZIRB 3RC8A 3NHAA 3U4QB 3DMDA 1SVMA 1YRAA 5JRJA 5KOYA 1KDPA 3TQFA 5AUPB 1T3HA 4TLDA 2J45A 4W7SA 1JPNA 3B7GA 3IHLA 4XVUA 2NO1A 4LYFA 1WF3A 1G4AE 1GM5A 4Q4HB 2OM2A 3RS3A 4M1TA 2CK3D 4ZIRA 3CRQA 2QPTA 4JT4A 3U4QA 2E9SA 5L3QB 1T0HB 4NYIQ 4ESHA 1U8AA 2DFKB 2HYDA 4NHOA 5GJCA 3IIMA 3WNCA 1W5TA 5H70A 1DG3A 4A36A 3T12A 4A82A 2Q3MA 4TMZA 1OH8A 2SHKA 2TMKA 2CHQA 4IVQA 3EZ7A 1XWIA 4MH0R 3T35A 2RGXA 4DDUA 2O8FA 2CBZA 3PUZA 2Q0HA 1NVUQ 3NDPA 2G83A 4PAOA 1X1RA 4ASUA 2ZI5A 1KGDA 4KFSA 3EG5A 2JLZA 1N5IA 4QM6A 5KPJA 2BIFA 1W4BA 1P5ZB 4QL3A 2JEOA 3NC0C 1NY5A 3BC1A 4Q9LA 1FMJA 1LS6A 1E2LA 4M1MA 3AM1A 1IY2A 1NI3A 3NWJA 4POAA 2WBLC 1Z83A 1G7CA 3RRZA 1KK2A 1RRPA 5C4MA 2ZI3A 2ZSFA 1VIYA 5CYOA 1HUQA 1E2PA 2J0QA 1AGRA 3NBXX 1K8RA 3RWMB 4C30A 1SVIA 2WWIA 3THYA 3FHCB 3TUZC 1ONBA 2R9VA 4C0AC 1TQDA 3QIAA 4C0BA 4KBFA 2KJQA 5LPNA 2V6IA 1NKSA 1AS2A 4KAXA 2C9OA 1NLYA 3EZ6A 1Z8FA 3I1FA 1IJFA 5B64A 1W7AA 3OIWA 4LGMA 3GLFE 3KDSE 4GRAA 4JLNA 5TB5A 3SC3A 2CCGA 4IDPA 3X1DA 2X1VA 1Y63A 5FUXA 2DFLA 3U3RA 4CT5A 1GWNA 1L8QA 3QJYA 1YHNA 4LV6A 4PC7A 1HT2E 5B2ZA 2YV5A 4KFUA 5A4JA 2A5JA 1SXJD 2ZRHA 5HE9A 1K5DA 4OK5A 2WPDA 4M8NE 4D25A 3KUCA 1UEIA 3V4FA 1QHHA 4MITA 1IQPA 4UXIA 4TMVA 3FMOB 4IFBA 3QXHA 2ZREA 3B1ZA 2OCPA 4HAVA 4IOJA 3IDQA 4EFLA 5IK2A 1Z0AA 4P33A 1R2QA 5JWOA 2H7VA 2NGRA 3X1YA 2GK7A 4IJMA 4C0KA 4BLQA 3OEED 3BFVA 5DI3A 2XNDA 1HTWA 1X8LA 3HU1A 3AEZA 4PC1A 2RGGA 2WWGA 4XVRA 3ADCA 3QXXA 2XSZD 2DFNA 3TW8B 3U5ZB 4MYHA 4B3BA 3I72A 1SXJE 4URWR 5GJVC 1JQJC 1XDBA 2AN9A 3UWKA 4MQBA 1D2MA 3AH8A 4YDHB 5EP4A 4ZCLA 5LDDC 2AKYA 4GFDA 4URZR 1RRFA 2VHCA 1MO6A 1Q22A 2IF2A 4BLRA 4GSYA 4JBWA 4TZ6A 1XTJA 4FMBB 2JDIA 2PT5A 4LC1A 3T5DA 4DB4A 3W3AA 3EC2A 4ZO4A 1OH6A 1E1RD 4I1SA 4RY2A 1WMSA 3D31A 4GDFA 1II8A 1ZU4A 4DLZA 4LJYA 3DKVA 5AJWA 2GJKA 5C2JB 3EIHA 3K09C 3A1UA 3U61B 1JB1A 1JJVA 4GI7A 3AF1A 4QGFA 4DJTA 2ZANA 2BKUA 4G3XA 4IEEA 3GD7A 4EAQA 1U99A 4JLMA 2P6UA 1OXXK 4JKIA 3TW4A 4EKDA 1OPXA 5HZKA 4GBMA 1N2CE 2H17A 1FZQA 2EFEB 4FWIB 5JCZA 1MT0A 2OFXA 4G0NA 3SZRA 3DVLA 1YZTA 3LW7A 1Z08A 1WQ1R 4JKYA 3Q85A 3EA5A 1TMKA 3AUYA 2JJ1D 3RS0A 4DCSA 3B9PA 4PHGA 4RD2A 4H1VA 4Y0VA 3IHWA 5KPDA 4EFNA 3KFXA 2W6JA 4HYYA 2XXAA 3GQBA 1TNDA 1SZPA 3LX8A 4EIWA 4TSFA 4XSGA 2C98A 1XNJA 5M04A 1XEWY 4MKFA 2WZQA 1XMSA 5FUWA 4A4DA 3A1SA 3BH6A 4AC9A 3B85A 3A4LA 5JEEA 3PUVA 1CULC 4N1AA 1HV8A 1W0JD 3M0EA 1JR6A 1BS1A 2OXCA 2AFHE 4DDWA 3I61A 5FBRB 1IN8A 2R65A 1XJCA 1CLUA 3FMFA 4OYHA 3DMNA 4URYR 1CIPA 3PEYA 1CP2A 4KHZA 3UMRA 4ON9A 5TXGA 5BN3A 2GK6A 3V00A 3GEIA 1JR3D 2LCFA 3DM9B 3UIEA 4AY2A 3AF2A 4ERNA 2GEDA 4BFXA 2QI9C 5G41A 4DHEA 1KKMA 3UG6A 2BMJA 2ZSBA 8OHMA 4RZUA 3CPEA 4WZBE 2GHIA 3RHFA 3RABA 2ZI7A 4B2IA 4PSKA 4DSUA 5EXXA 4TL8A 1PUIA 3LO5A 3PEWA 4JJKA 4JBXA 4JIMA 5LB2A 3QSYA 3TKLA 1ZM3A 1JEDA 4GL2A 4Z8XA 3LNCA 2W58A 1JR3E 1G9XA 3E2IA 2XITA 1NG9A 1LFDB 1YJ5A 4LYJA 4Q4AB 4QFMA 1M2OB 2OILA 4JL8A 3CUEF 2QSZA 2QRZA 3CB4A 1ZAKA 4CEJB 1N0VC 2CVHA 2IXFA 3EZ9A 1T91A 2J7KA 4L4UA 3JZAA 4LZZA 4UNSA 3ZVLA 3VHXA 3VNVA 4DSOA 2IYSA 2IYYA 2ATXA 2QZ4A 3MRSA 4DDVA 3B1XA 2FA9A 3ZD6A 4V0LA 1L2TA 3QOFA 4JVMA 4MRRA 3CX6A 1E0KA 3SI7A 1GDDA 2VL7A 1XZQA 4IVPA 2EVWX 3AKEA 1U8ZA 3OEHD 3Q72A 1D9XA 5DISB 3EIQA 2OLKA 4PZLA 2GVDC 2J7PA 2G88A 4DUGA 2OCYC 4UNRA 1ZNWA 1EWQA 4QOSA 3X1WA 1IY1A 2FN4A 4RD4A 3DOFA 2AFIE 4Q5IA 2FZLA 2XOKD 1CJMA 1VG9B 1XMVA 2P5TB 3C7KA 3IBGA 3A8TA 4HEJA 2GCOB 3FMPB 2ONKA 1N3BA 1G7TA 1N5LA 3NH9A 4NONA 5EE9A 3AVVA 4M9QA 1MV5A 1HURA 3IIKA 3NHBA 4TQ9A 2Z4RA 1X8JA 4EPXA 1E1QA 2FG5A 4MDFA 4HATA 2R2AA 4PSVA 2JLQA 3B8HA 3P1JA 4KYUA 4GOXA 3Q5EA 4YLGA 1D2NA 2IYXA 2LWIA 3UXMA 1NLFA 2J59A 4Q4JA 1XD2B 4OK6A 4RSGA 5JECA 1GVNB 5FOTA 3FMIA 2GCOA 4NYMR 4DCNA 5C46F 3KJHA 2UZIR 4JYBA 4PHHA 3SJBA 1Q3TA 3FHTA 4JLPA 2C5LA 4TMWA 4A2PA 4IDNA 2RGNA 2B8TA 3HDTA 1GRQA 4OI2A 3JVVA 1FNMA 4P32A 5AJXA 3SFVA 2BHRA 4B44A 4M9ZA 2W83A 4GP7A 3VR2A 1II0A 3IQWA 2FJUA 2GTPA 1ZU5A 1Q1EA 1SVSA 2J87A 4HLQB 4JLOA 4NCHA 4YMWA 5KSYA 2F7SA 4LOAA 2QMOA 4D0GA 1VIAA 2QPOA 1Z0KA 2HCJB 3GPLA 2ZRNA 3LQRA 4XTCS 5SZKB 1NNEA 3GLHB 4G5RA 4NH0A 1WE2A 4B43A 3KQHA 1YKSA 2QG6A 1DAEA 1IAQA 4H9GA 2BVNA 2BJWA 1JI0A 2REBA 4NBSA 4Q47A 2EFHB 1G1MA 1TTTA 3HU2A 2G3YA 1UADA 2F1IA 2WM9B 4DIDA 1CR4A 2IUSA 4PHFA 2OAQ1 2ERXA 1ZMXA 3FGNA 3PEVA 5JBQA 1SXJC 4QHSA 5IRCD 1BKDR 1JPJA 1ZUNB 2QM8A 3AQ4A 3HPQA 3FHOA 2O0KA 4HLUA 5FTMA 5SZHB 1N6PA 1CJUC 1WA5A 4LX0A 1M6NA 5E7IA 5JJLA 3CF2A 1IHUA 4MYCA 2YZ2A 1FUKA 1J70A 4M1OA 4RFVA 2D2EA 5D3QA 4B3CA 1NMZA 3E1SA 2FWRA 2RGBA 3SYNA 2R44A 2FV8A 1IY0A 4NCNA 1IM2A 3U7FB 4LCBA 2JLUA 3HP1A 2O8EA 1A2BA 5DSZA 3EA0A 3VR3A 2IYTA 3TR0A 1ZW6A 5L3SB 1XB2A 3B6EA 1HQCA 4NE2A 1E2FA 1NIJA 5CYPA 2AXPA 2QGZA 4XH9B 621PA 1MO3A 2ZJ5A 4X8OA 2AD1A 4DLUA 1VECA 5TV2A 3VQTA 4XIGS 3F3YA 4I1VA 3SE0A 4UNNA 4NCIA 1E2EA 1Z0IA 5L3SA 1YR7A 1SVOA 2O5VA 3IPYA 1H8ED 3C5CA 4RZ3A 4JLKA 2F3TA 4N0DA 1GG2A 3JVUA 2A5GA 1IN6A 4L15A 4NYJR 1ZM4A 1RJ9A 3ECCA 3ZH9B 2E87A 4RCZA 2NO7A 3A1TA 4XJXA 5JJIA 2ZAMA 1BYIA 4UJ3A 2XGJA 1N5JA 1LB1B 1G17A 4DSNA 1JBKA 2VF7A 1JQLB 3K0EA 4G5QA 4ILEA 2YOGA 3LXXA 1IXZA 4IOKA 5E3HA 2WWHA 2ZSDA 3QUSA 3BFXA 4AKGA 4B74A 1F2TA 1EX7A 221PA 4JLDA 4D2IA 1W4RA 1K6MA 1P60A 4RCYA 5FPSA 2G6BA 5FI1B 1CEEA 4LJ7A 2Q3FA 2JJ2A 1G21E 2WKPA 3KJIA 1XBTA 2EFCB 4MRNA 2WOOA 4Q01A 5FPTA 3PUWA 3X1XA 2A3RA 5JHGB 3IEVA 4EJSA 1DVRA 1YR9A 1SHKA 4URVR 1DO2A 1N6LA 3C5HA 5DE3A 4ZI3A 4PQYA 5EE3A 2RGCA 2ZI4A 4ARZB 1W4AA 3DHWC 2YWGA 4ZDJA 5CM9C 2I3BA 2NG1A 1PLLA 4MRSA 1KJZA 3KZ1E 4Q21A 5KNBA 2QY9A 3W8NA 2CMKA 5EZ6B 5EUMA 3RRYA 2P3SA 3UMSA 4Q9IA 2OFOA 5F98A 2QTHA 1TF5A 3FVQA 2O8DB 3JZMA 4ARZA 3BS4A 3QKRB 1L4UA 4DCTA 4A8JB 1P9WA 1P2SA 1EESA 1OHHD 2NIPA 3MSXA 2IW3A 4KFRA 4P4TA 1P3JA 4Q1CA 3T61A 1COWD 1CJTC 3C8UA 3LH5A 3THOA 1Q1ZA 1KJWA 2Z83A 5FOWA 1X1SA 2RGDA 2O8DA 4B33A 4O25A 1OXUA 2CE2X 3QXJA 5P21A 3QKRA 5JRZA 1U98A 2NO0A 4B34A 4DLWA 1VG1A 1NMXA 2ZR9A 1UF9A 4DVGA 2J9RA 4PR0A 2XJ9A 4YONB 3G0HA 4B3GA 1U2RA 1R0YA 4LJ4A 5CIQA 1ZNXA 2OO7A 4B6FA 3AP3A 1YE8A 1NLZA 1NP6A 1S0UA 1W48A 2RCNA 2JLRA 2W00A 3K70B 3TUIC 4B32A 4TL7A 3VNUA 4MA4A 5L3RA 2VHTA 5KYKA 1Q57A 4YMVA 1TUEA 3MUFA 2GEVA 4FCTA 3ZVMA 1AM4D 1DG1G 4WXPA 1G8HA 5DHAA 2GKSA 4M9XA 2P0EA 2PX0A 3I3SR 3B9QA 1YZUA 3RS4A 4Q9HA 1SVLA 3P4XA 3CR8A 2VIIA 4HLUC 4B75A 3GLIE 4V03A 1SKYE 1ZCBA 2IEYA 1E69A 4MKGA 1TQ4A 1ZC3A 2BKEA 2IUUA 1RRGA 2WJGA 3TJZA 4US2R 2HLDD 3PJRA 1BH2A 1SVKA 4Q1FA 2C03A 821PA 4OHZA 3GCGA 2PZFA 3EIEA 3OIUA 4DLTA 4BFZA 4II7A 2DR3A 2PLRA 2WV9A 3W5IA 4AWXA 5KNCA 3TMKA 5DI9A 3SFZA 1GL9B 4B48A 1Z0DA 2CL0X 2OXRA 1ELOA 1FPMA 1G4UR 3TVDA 3WBJA 1S3SA 4JYCA 4O3MA 2FFHA 1QDEA 1OW3B 5G3ZA 3BRWD 4HZUB 5G53C 1N0WA 3ICQB 1V5WA 3ND9A 5TY0A 4CT4B 2QRNA 2EU8A 5CK5A 1G7SA 1W1WA 3L0PA 2HJGA 2O8CA 5BWMA 1Z5ZA 4B76A 1BOFA 4PO9A 1XXHA 4U00A 2RAPA 2PJRA 1NN3A 1KK1A 3CNOA 4KBGA 1TF2A 1XCMA 2ODBA 3ZIAA 2NOAA 2A9KA 1Z28A 1UKEA 1AQUA 1CU1A 1JALA 1L7VC 1OF1A 5JJKA 4TZ0A 2XB4A 1ZD8A 4Q4LA 4JVSB 2OAP1 2JAQA 3BB1A 2OHFA 2Z5FA 3QKSB 2EWVA 3U7GA 4ASUD 2ZSEA 3BH0A 2W2XA 4DXAA 1RRCA 1GKIA 1OJLA 2R62A 3K0FB 4M1KA 4DT1A 3U60B 2YKGA 3GEEA 5AK0A 2HT6A 2UVQA 3CPHA 2BBTA 1P61B 5IHPA 5J4YA 3OFNA 4EFMA 4Q66C 5JFGA 3HJNA 4MKHA 2XNSA 1G5TA 4L5BA 3VKWA 2WIAA 1MOZA 3G82C 1M7HA 2GA8A 3SJAA 4IXMA 2NQ2C 2QE7A 3K0FA 3CNLA 3DPUA 4LPSA 4S35A 2QPAA 4AK9A 2JLWA 4Q1DA 5FH9A 3EX7C 1KK3A 4HAUA 1HYQA 4D82A 4AKEA 4F38A 1NBMA 3KJEA 3UG7A 3W34A 1OH7A 3WYAA 2KBEA 1G3IA 3ZVNA 2QN6A 3MWLA 3P26A 5GVSA 1Z6XA 3WP0A 5E7JA 1KK0A 2H92A 4XWOA 5HE8A 1IBRA 3HR7A 3MGCA 4PC2A 3TUJC 3QVVA 1GNQA 5FTNA 2R8RA 2XAUA 1PUJA 2YINC 3B13B 1Z06A 2CCKA 4QBFA 2FMXA 2PEZA 4TQAA 2IWRA 1W46A 4MDEA 2CDNA 1I2MA 2XTNA 3R9WA 3AB3A 3L43A 5FOXA 3UANA 3OHMA 4JVLA 1XJQA 2WPDD 4AYXA 1TU4A 3PG5A 3BB3A 1ZM9A 5KSOA 2ZJ2A 3C14C 2Z43A 2FF7A 4E5UA 1EFUA 2ZRKA 1KIMA 2GAAA 3TQCA 5IK2D 1GAJA 2FX3A 1E2IA 4A8JC 5AUNB 1FUUA 3K0AA 2GCNA 3UWOA 3BIFA 4LJ9A 3D6TB 2XNDD 3IBYA 5DHFA 1W2HA 4QG7A 4LBZA 4ZV4A 1KI8A 4Q1EA 4KLNA 2W2VA 4V0MA 1OXTA 1IN4A 2HJVA 3NBZC 5J40A 2ZROA 2O8FB 2DWPA 2ZJ8A 4Z1MA 4EQ6A 1T3LA 2JLXA 4M53A 4P4SB 2AHOA 1IONA 3TR5A 1TQ6A 2DYKA 2C04A 2QM7A 4QXAA 5DNYB 3E5HA 2JDID 2QEQA 2VP0A 3SOPA 2ZJOA 4B3FX 3QI2A 2KSQA 3AUXA 2XZOA 2WICA 1LTQA 1M8PA 3MG9A 5A0FA 2IX3A 1FP7A 1J2JA 1RW4A 2GETA 3IGFA 3GLGA 1E2MA 3BERA 4HDQB 3AGPA 3N2EA 1DAFA 4P4SA 2QL6A 4ACAA 4KI0A 3OZXA 1FTSA 3WHLA 5AUOB 2O0JA 1S3GA 1R0XA 5CB8A 1T5IA 4UXJA 1TADA 3C41J 3THYB 1W49A 4C2TA 2BOVA 2ZQ5A 2V7QA 3EASA 1FOEB 1U0LA 1NF3A 2J0VA 1G3QA 4PO8A 3REFA 3FE2A 1P2TA 3CF6R 2J0UB 3WXMA 4TQUS 4OL0A 2OLJA 4NYIR 1BIFA 2EFGA 1XEXA 3BB4A 3EAQA 4ZDWA 4LC0A 2AK2A 2D7DA 2GCPA 3PUXA 3LLMA 2EWWA 1KI4A 3PR1A 3GFOA 2UZ3A 2GVZC 4ZCIA 2NZ8A 3FTQA 5BYKA 2J0UA 2W6JD 1QHHB 4BRWA 4TSFD 3SNHA 1FNNA 1T3SA 2GF0A 3OAAA 2ZYVX 4YMTA 2IS1A 3QKTA 1KMHB 3HWSA 3MCAA 3FDIA 4TYQA 4U7DA 3T5GA 3SHFA 4C9BA 2VP2A 2WOJA 1UKZA 3LD9A 4IFEA 5DI3B 5IT5A 5B58C 2FSHA 3AVOA 1LS1A 2ERYA 1U9IC 1ZCAA 3O8DA 2OCAA 2V3CC 2CL7X 1KMHA 2V9PA 4BUJA 1YZLA 1UFQA 2IYUA 4LJ5A 4QJ4A 1FMLA 2NMVA 4AIIA 1KNXA 2HEIA 2DWQA 1GZSA 4K46A 4BZXA 4OI0A 3GJ7A 5EE5B 1R5NA 3CH5A 1XPRA 1HQYE 3GEHA 3A37A 4LSGA 5FL3A 1KOFA 5J5CA 1P6XA 2GXAA 4YXWA 4HDCA 2ZR0A 1B23P 1ZUIA 3KXIA 1XMJA 2FPKA 1OT3A 1O87A 3CRW1 4X8LA 1II8B 1GL6A 5E4FA 3W90A 1VCIA 3SDZA 2DCUA 4YQFA 5J47A 1ESMA 3B1VA 1X3SA 2FSGA 2CLCX 1KKLA 3MAAC 4IDHA 4PAQA 1G5RA 2GZHA 4Q7LA 4RKEA 5DH9A 4LI0A 4A2WA 4CEHA 3H86A 3LX5A 3PXGA 5FPHA 1TL7C 2R6GA 2V4ZA 2VLIA 3GJ0A 1FQJA 3MMPA 2VSFA 2YNMA 2ZRDA 3UATA 1KNQA 2IS6A 3AVTA 1R0ZA 4H1UA 1OLOA 5LD2B 4KVGA 2DPXA 3U44A 1JXOA 3FFBA 3FYHA 3NEYA 1Z2CA 4C0JA 1EGAA 1D2EA 5B57C 2EYUA 1G8GA 1Z0FA 3VKGA 3GJ5A 1XF9A 4M21A 2XXAB 1W36D 2WJHA 3EPJA 2V6JA 4QM7A 4XSHA 3CIOA 4FMCF 1R5BA 1G3MA 1GUAA 2J7PD 4DUGD 1CRPA 4JLVA 3RS2A 2QMUA 4PQRA 4PSAA 2QAGA 5ELXA 1JECA 3AVUA 3AVWA 4R9UC 5LB4A 1JAHA 1Z07A 3H4MA 1FW6A 4V0OA 1NJGA 3K9GA 2J1LA 3MWKA 3Q7QA 4M1YA 5AJYA 3B2EA 3VAAA 4IHQA 1E1QD 2FNAA 4DLYA 2NTYC 2VP9A 2VSOA 2LKDA 2HYIC 3DDCA 3OF5A 1GP2A 3GJ6A 1F5NA 3SN6A 3AVPA 2ORWA 1E32A 4TL6A 2IYWA 2KWIA 5L8VA 4BE7B 3I8XA 1G64A 3OE7A 5H68A 5EE1A 2YWFA 1JAIA 4V0NA 4LRWA 1ZINA 1AIPA 2ODWA 3QE0A 5FOVA 3CO5A 4AG5A 4DKXA 1FX0A 2G0TA 1OFHA 4AURA 3UPUA 1EFTA 1KYIA 1CXZA 1RE0A 1ZD9A 2BMFA 4TLBA 2IEZA 3SBDA 4ZDKA 2PZEA 4I1UA 2VHQA 4Q1BA 1NVWQ 4QRHA 2OE2A 3P20A 1AA9A 1U0JA 2RKOA 1UKYA 2HDNB 4W9MC 3I32A 5JCPA 2WWXA 1N0UA 1KHTA 2C96A 4LYHA 4RJLA 3KQNA 5FR1A 2I4IA 5G3YA 1G8YA 3R7WA 1WRBA 1GFIA 2FU5C 2WAXA 4W5WA 4BFVA 3QQ5A 3HYRA 2YC4C 1W36B 1E96A 2JJ8A 3AKYA 3ZLJA 4ABYA 3H2YA 3KKMA 2XZLA 1TAGA 1F6BA 2G9NA 3KTAA 5TMPA 1ZBDA 4BRUA 1OH5A 2ZRGA 4UJ5A 4C7OA 3V9PA 4JSTA 2GXQA 2WKQA 2WSSA 1FTNA 3PCRB 1EFRA 3N70A 1TPZA 3WMFA 2RGEA 4IOLA 2YOFA 4L9WA 1VYUA 2BCJQ 4D80A 4QGAA 2P67A 3EZ2A 4NL4H 4QGGA 2BEKA 5GJWC 4B3DA 5D3MA 4C0QC 1GILA 4RVCA 3THWB 1P9NA 4Q18A 1MR3F 3NIBA 5EQTA 1RYHA 3GLHE 4ESVA 2F1RA 2Z4SA 2XJ4A 4LHYA 2BDTA 1F60A 1LW7A 3ZQJA 4KJZA 1BMFA 1Z6TA 4Q4JB 1U8YA 1WP9A 5C4GB 1QVAA 4Z54A 3THWA 3WMGA 3LY5A 1N25A 3CONA 2F1JA 4V02A 1A2KC 4R2HA 1Z0JA 1AQYA 3NXSA 2ZUBA 4A6PA 3G5UA 1UM8A 2ZTSA 2B8WA 4TLEA 2VP5A 1YR6A 3SBEA 2IS2A 4F4CA 1E94E 4LUCA 2IYZA 1XTIA 3WHKA 3SQWA 1OB2A 4Z8YA 3SU8A 2XTZA 2YWEA 5JZVA 2QMEA 4P31A 3VMFA 2PLFA 2QENA 1G3UA 4M2LA 3PVSA 4TYNA 4LBVA 1E2KA 4F4JA 4EUNA 1MH1A 4JJZA 2DHRA 2H8KA 5DGXA 4TLCA 4GP6A 1Q1BA 2JJ2D 4TMXA 4C0LA 3CZQA 3T15A 4HSEA 2P2LA 5LD2C 1NN0A 5JMTA 3IKJA 1RIFA 4PC6A 1S9HA 1HY3A 3D3QA 2GBLA 4DLSA 1DPFA 5AUQA 5EP1A 3VX4A 1TU3A 1SKQA 3BH7A 1ZM2A 3L0IB 1KAGA 4I4LA 4PAMA 2QP4A 3KX2A 2D7CA 3I5YA 1XJ0A 3EWAA 4HAXA 4TT3A 1XX6A 1G6HA 2PEYA 1UPTA 3QVUA 2ONJA 2QT1A 1QHYA 3QXSA 3B78A 1OKKA 4RD1A 2BCGY 3AF4A 2O8EB 4Q9JA 3T06B 2O0HA 4QJ5A 2VP6A 4CIDA 2ORIA 2F9LA 5JWRA 1CKEA 2BJVA 3KKNA 3VKHA 2WSMA 2MMGA 2WWFA 4K8OA 2CNWA 4IKEA 4BASA 2PJZA 1CJVC 2ZE8A 1GNPA 4XD7A 1XZPA 5EXPA 4Q7KA 2ODEA 2WKRA 3NG1A 4BFYA 1E6CA 1GKUB 2WJVA 2G1JA 4IEIA 1E99A 1XPOA 1NMYA 2OFWA 2ZJBA 4W5HA 4JT2A 1W47A 4HI0E 4DZZA 4FI3C 5JI3E 3AKCA 3CW2A 3RSLA 2EYQA 3V4RA 1EG7A 521PA 3FOZA 4NYJQ 2FPLA 1LY1A 1RJ9B 4O2LA 4PANA 3LFUA 2GZDA 1Z6AA 3ETLA 5IF9A 4TTQA 2PL3A 1Y3AA 5KHOC 2Z0MA 3PV0A 4OKSA 2IHYA 2OZEA 1VYVA 2IHBA 3T34A 4PPNA 2IYRA 4BZPA 4XTRA 1S96A 2P6NA 2PCLA 1X86B 2CLDX 2W6IA 6Q21A 2ZR7A 3DM5A 2VTKA 2A5DA 3NTUA 4G1UC 3K9HA 4M9SA 4Q00A 3U2QA 1E4YA 3ZDQA 4BFTA 3VR1A 1G19A 3K70D 1F2TB 4OQFA 2XX3A 3I92A 4I81A 3ADKA 5CLLA 3BOSA 5FL7A 4O2RA 2IC5A 1PLJA 3A4NA 4PQFA 4B6EA 3D8BA 3K1JA 4YC7A 5FI0B 5EUQB 2CHGA 2YHSA 4EJSB 1MRNA 1W4CA 2F6RA 2QSYA 5KSPA 5F2EA 5GADl 1QG4A 4CVNA 1W36C 4MGIR 2ZAOA 4KU4A 1RVDA 4PFSA 5F9HA 2QT0A 4PC3A 3TAUA 1E0JA 5AJZA 4XWAA 1V43A 4DCUA 3IUYA 5JI2E 1NKTA 3GJXC 1NL3A 1QHSA 2ZI6A 1N6HA 4HUQB 5KDDA 1DS6A 1G41A 1N6KA 3TLXA 3WY9A 3AVXA 4RZXA 4IDOA 4A0GA 4DEXA 3A1VA 3D7MA 2HV8A 2ZJAA 1F2UA 2WAYA 3AF0A 2WVJA 4URUR 4C0HA 2AWOA 4JL6A 1OYYA 4XOIA 2IA5A 3ZIAD 4HUQA 1OXVA 2L0XA 3NH6A 1T0JB 1J99A 1VCNA 1E9RA 4G01B 3AF3A 2OV2A 2DWOA 3EXAA 3U3JA 4BECA 1B0UA 1E0SA 3J81k 1P9RA 5FTKA 3ASZA 2RGNC 4JLJA 3LQQA 2JLYA 4LBWA 2QTFA 3TSWA 3W6NA 2KBFA 4EPTA 3OFND 4FMDF 5BXQC 3PENA 1LVGA 1E2NA 1XXHE 4MKIA 2O8BB 4B2LA 3O8RA 4Q02A 1IN7A 2FFQA 3K0CA 1HT1E 1YVDA 1ANKA 4D4MA 3U3MA 2QE7D 1VTKA 5TVKA 2BC9A 4GZLA 4C0SA 3QY0A 1HE8B 1RFLA 3ONWA 1KY3A 1NBMD 4HB2A 4UNPA 3W8RA 1R6BX 4CGZA 4B35A 5A5GA 2O8BA 1P4SA 2UKDA 3QG1A 3BK7A 4K81B 1O3YA 1VCMA 1QHNA 4D4KA 1Q1QA 2F9MA 4AI6A 3LVRE 3TH5A 1R4AA 1N6IA 3TK1A 1US8A 4E09A 2BMDA 2ORVA 3WRYC 3LW8A 1OSNA 5E95A 3ICEA 2BEJA 1SQ5A 3W5JA 4DCVA 5KUTA 1XCGB 1M34E 4JBYA 3KXLA 1DBSA 3RWOA 4QKQA 5K8IA 3C15C 2JIZA 3LBIA 1G6OA 2Q9AA 2FZ4A 5TDHA 1KDTA 2Q3HA 4S2EA 2PT7A 3L0OA 1J90A 1NBME 2NO9A 4MRPA 4UQOA 4A2QA 4Q19A 1D9ZA 2VHJA 1S8FA 1RKBA 2CEAA 5ANRB 4A15A 1S2MA 3QBVA 1LF0A 3M4YA 1NVVQ 1KI6A 2O8CB 2FGKA 3MFYA 2AR7A 4Q03A 1FQKA 1XXHB 4FIDA 2H18A 2FFBA 2EW1A 2QAJA 3QF4A 4NTZA 3TAHA 1X8KA 5EJEA 4PPQA 1ZNYA 3LVQE 3CWQA 4BLSA 3TSZA 3ZZTA 1EX6A 2D3WA 2WMNB 4Z1MD 1UJ2A 2IWHA 2BMEA 2ZRMA 4TL9A 1I4DD 2RH5A 2QQ0A 4IRUB 1VCOA 5FTLA 4DT1B 1KZGB 2GILA 1H8HA 2ZRPA 3L2OB 4F93B 3WNBA 3A4MA 5DYGA 5EP2A 5AWFC 2K5UA 4NPHA 1M74A 1CR2A 4WOPA 3P32A 2JLVA 1A5TA 2P6RA 3Q9LA 4NP6A 3T1OA 1VMAA 4Q7MB 2O52A 3LBHA 4JZKA 1NN1A 1R7RA 1SHZA 4V0ME 3RRMA 5JS7A 4B2PA 2NPIA 5CJ2A 3ZJYA 5FUVA 3X2SA 4TN1A 2B6HA 4LK2A 4Q1AA 1E98A 4LJ6A 1OFIA 2IXEA 2IBMA 4LBYA 4RD0A 2V7QD 2CXXA 3LXRA 1SGWA 2ZJYA 3CRVA 2D06A 4CYMA 2B7BA 2IXGA 3L82B 4OK3A 3CPJB 4EJSC 3CF0A 1HE1C 1XD9A 1EFHA 1P62B 1G16A 5FPYA 3RANA 2W0SA 3KB2A 3QG5A 2ZS7A 2R6CA 2ANCA 1NY6A 4AG6A 2OSBA 3F5FA
chains in the Genus database with same CATH superfamily
1A9TA 1MENA 4FR5A 3WGIA 4DR7B 3GMIA 3CN7A 1LV7A 2QMHA 2VJDA 1GLVA 1ISHA 3KKOA 5CM2Z 3R3HA 5J1TB 3S40A 4BGVA 1Z6QA 1VGVA 2Q46A 3JQFA 3K2IA 5JS2A 3ZCXA 4C6TB 1CR0A 1WUJS 2QTWB 1XTKA 4BFTA 1VL5A 4HGNA 1N5KA 1Z4QA 4NFYA 2Q6TA 3LCVB 4II2A 5B12A 3W78A 3I0ZA 4YP0A 5I8ZA 4NV3A 1NXWA 421PA 5DBFA 1BJKA 3H11B 4G4SP 5TX7A 1SUSA 1GG9A 2WT9A 3CKKA 3ISTA 4M0KA 4QU9A 4I5EA 2IHTA 4G25A 3F5MA 5I4BA 3MJTA 2GNOA 3IV6A 4G2TA 2XUAA 3ZBPA 4Z51A 3GT7A 2QU8A 1NNUA 5CT4A 3KZCA 4LF8B 4X3PA 1MU0A 5AKLA 4KVZA 2AZDA 1Q0HA 1R5JA 4RVUA 5HIJA 3V6MA 4DLVA 3N8NA 4EQ6B 2GH1A 2ETXA 4KI7A 1DTEA 1XA4A 3NUGA 1HNWB 4FCVA 1JXQA 3GCDA 3E70C 4XPIB 2OZPA 3JQ7A 1QYWA 1ZUD1 4PZAA 1DBRA 2Y66A 2ZU0C 4D81A 4DBLE 1NUHA 3F5DA 5G0TA 4D97A 2X40A 2GERA 3AEXA 2A5YB 4JP3A 1EUDB 1WETA 4B6OA 1HFWA 3LRPA 1X7ZA 4DWJA 4JB3A 3KIPA 2CDBA 4KSCA 4U7WA 1MRSA 3GLGB 1UMDB 3HVRA 5DNCA 4BDSA 3EF1A 1LPBB 5EIWA 4OIFA 3UWPA 3OZIA 1DE0A 2GN9A 5E3IA 1Y3BE 4ZGBA 3KR1A 5KTSA 1ZYUA 1ZM7A 2QM3A 4JUBA 4O4HA 3VHRA 1T6NA 2D54A 3K70C 2VOEA 2VJYA 2VUUA 4YEDA 1KI3A 1ATZA 3R1IA 3L8FA 4IKPA 1QRAA 2JL1A 1MO5A 3QVSA 2DQYA 1KYZA 2GYWA 2NYRA 2YJNA 3KFVA 4OJQA 5K8LA 1HEUA 1HYBA 3FSGD 4MVYA 1PL7A 4PTYA 1T6ZA 2JW5A 5HCNA 5DBGA 3F9IA 3SIXA 4IO1A 4LTNA 5F33A 4BQIA 2H1WA 4MMZB 3E03A 1WCXA 3P45A 2RI1A 2W4QA 3MOGA 4ONEA 4WBXC 5HG0A 2ENWA 1N77A 1U4NA 3H4IA 4GGMX 3PCXA 3QNMA 1JEEA 2RHOA 5CDFA 4Q4HA 1M2NA 4H7KA 1UDBA 2GOYA 3IBTA 3RAPR 3NDIA 1LU9A 1G38A 1JJ7A 1T25A 1HEYA 2BI8A 3SHOA 2I80A 3H19A 1G3RA 2P90A 3PQCA 5CVDA 3UA4A 5I7FA 4D96A 3LAWA 4TXJA 1FFSA 3HFSA 3MD0A 3A3YA 4MW9A 2VNSA 5KNCH 3EDMA 1EG2A 3N5CA 4LOKA 3SF8B 1O9BA 4NCBA 1PVOA 4MRVA 3RRBA 4LA4A 4GE3A 3ECAA 4A2CA 5FORA 4OYLA 5A4MS 2OHXA 3S8YA 1MQ8B 4GLLA 1TFRA 3OH8A 5J2UB 4DBZA 2MTBA 4HXGA 3JSXA 3NASA 1FEZA 3GRVA 2Z56A 1HH4A 2P4HX 4BNFA 2IGTA 1YDFA 1YE5A 3W3ZB 2A4KA 1G2PA 1VDZA 1MKYA 4PQGA 4YDQA 4JITA 5EFZA 1ND6A 3I9JA 3MTAA 1E9DA 1SVWA 2O19A 5AOCA 1J42A 2Z9DA 3IJPA 3UMCA 1SUPA 1D4ZA 3D8NA 4WECA 3E9YA 3EFHA 4IDDA 4ZQBA 4GI3A 3VR4A 3I9NA 2JIBA 4L0MA 4TWZA 4G5SA 1E2HA 4QC2A 3K9WA 1NW9B 3E3AA 3ZZUA 2I1WA 2VXYA 1ZFNA 1UDWA 3CKYA 1Q7EA 5FD8A 5JH7A 5LSAA 4OI4A 1I0ZA 3K7EA 3STYA 2V8OA 3GXBA 3TECE 3L46A 2XKKA 1YCFA 1RE1A 1NQ5A 2QY6A 4O4JA 3MM4A 3LL7A 2G08A 3OE7D 4LVOA 3G9XA 2BFAA 4LNAA 4BWFB 1NPDA 2VLBA 2IUTA 2Y0BA 2ZITA 2NYVA 5JPDA 1QCZA 4X3CA 1XLUA 1H2FA 2Z4TA 4R05A 4FEYA 2HBZA 2OYSA 4M0MA 5E1BA 1BTOA 1UBMS 2XDYA 3OEWA 5JS8A 1NW4A 1XVIA 5KJ1A 1BX0A 2E49A 4WZAE 4RU1A 4CEHB 1G291 2V54A 3I4LA 5KSZA 1SMKA 2R7MA 2RB4A 1IZ8A 3OE5A 3JPYA 1E2QA 1IXYA 2GEJA 5YASA 2JFZA 3HV0A 3AVYA 5DASA 5HKLA 3U7IA 1Z2OX 4MLZA 1AGPA 1J0CA 4CLRA 1IK6A 5CW1A 2Q9UA 5GINE 4A0SA 2SECE 4FU0A 2HQOA 1UXKA 2A88A 4AWBA 3ROTA 2PMWB 2JGIA 1S9DA 3TI9A 2BM1A 2YYYA 1P5JA 1GZ7A 4FC6A 4KLCA 4J4TA 1YZQA 2D74A 2QDXA 4JL5A 1XU9A 2ZRFA 1XU4A 4FYYA 1IOVA 4YS6A 2R97A 3IDFA 4WK4B 4CL0A 1TKCA 2RBKA 2C8JA 3PGMA 3PNKA 3T52A 2BUCA 3KOWA 3H5RA 3R0XA 2CF6A 1YI0A 3ZY5A 2XWJI 1J33A 3GRYA 3H05A 3GLFB 1FTYA 3QVOA 2D2FA 1KRWA 2IZ5A 4KVAA 1BRMA 2YBDA 4D99A 4IVRA 3K0SA 2AXQA 2X7HA 4HP8A 3T38A 1SHJA 4WXRA 2IU6A 5HM8A 4H7PA 3WRVA 1X7XB 2F3RA 2J5XA 2NNLD 3V1UA 3FCSB 3S2GA 4RESA 1KRHA 3OA2A 1DLIA 3NO4A 3SEAA 1A69A 5C4IA 4FMCB 2FOLA 4QJBA 1I1NA 3NHFA 3H18A 4MW7A 2NUPB 1ZRSA 4HWPA 3L41A 3ZQUA 3TQIA 1DADA 2CXSA 3F7MA 1EGHA 4AN4A 3D6AA 4ZOBA 4ZI2A 5EKXA 5CD1A 3NR2A 3RYTC 2WFLB 2V4MA 2ZR8A 3EHDA 2VBCA 1QLJA 4RBNA 2VYQA 2HCBA 1RI1A 4F1KA 3SX0A 1O8CA 3F97A 1OBOA 3IXLA 4RS4A 1SY7A 2PR7A 2O54A 1GY8A 2R8EA 4KRFA 3VH1A 3C3PA 4TOIA 4NEGA 4XIYA 4G0WA 1E6KA 4L8GA 4DW8A 2PLWA 1YBAA 4CQNA 1FX0B 2XUGA 1SXJB 4QPPA 3ZHUA 4BZQA 1WCV1 3LX4A 2HFKA 1Z7BA 3PFIA 1GKYA 3DMHA 4M6WB 4YNBA 1QLWA 1N57A 1DCKA 5DW3A 4AM8A 4QG3A 4AS1A 2O8NA 4IUCS 1LC3A 3ZS9A 1RYFA 1Q7RA 3JVIA 3SP1A 4DV6B 1POXA 1LDYA 1GUYA 2JIDA 4TLLB 4LPKA 2WD7B 2ZPTX 2VSYA 4XFDA 5CXSA 2EGGA 4AY6A 3MGAA 3E7FA 3HM2A 4BO8A 5HUJA 2Z8YM 3OSZA 2HDHA 1EQUA 3D9QX 2BSQA 3HTXA 1J5PA 4X1OA 2C3YA 3FPAA 3HWX1 1NJ2A 3TL3A 4H7HA 1W94A 3BGWA 4BNIA 2CL6X 3RVBA 1V8BA 2PUWA 1GGKA 3AP2A 4WKPA 5BRNA 2XLBA 3HNPA 1NXPA 3KXPA 1MMFB 3TM5A 5MHTA 3D2LA 4XAQA 1OASA 3JV7A 2CNKA 1DEAA 2E5FA 2ADFA 5F1KA 1B16A 5AW1A 1SJ9A 1DRKA 5ALOA 5EZ5A 4CLOB 3Q3HA 4TT3D 3KTAB 2VPZA 3Q3VA 3CW9A 4F4FA 2D7JA 2R6FA 1N5MA 3KJGA 3BD8A 1IXRC 2HQSA 1SN7A 3D2AA 3QOXA 1FIUA 1N2CA 4IHAA 1OB5A 5BNTA 1GT91 2PAFA 2G5CA 2ZUDA 1QO7A 3QBDA 4DM7A 3AK4A 4S24A 3NHRA 3R3WA 3P0EA 5HTKA 2QNBA 1VBKA 4DLRA 2ZULA 1AUVA 2EEPA 4L73A 1BX3A 4ICIA 5CH5A 3C6XA 4NZPA 1FK8A 1RP7A 3F1LA 3CNNA 3L02A 4TTAA 2H3HA 3RODA 5A62A 2GUWA 4XD7D 5FOSA 3SEFA 4MCAA 4DA0A 1E1RA 3AI3A 4B09A 2UZ0A 4JR2A 5KDLA 3PQ6A 2CJWA 2VEDA 4HAOA 3HC7A 4ARVA 3C4VA 4B71A 1I6KA 5CA0A 1MC5A 4EYGA 3TINA 3EWSA 4HRYA 4CF7A 2EZUA 3BSFA 3OZAA 4HPXB 4KYIB 3HZOA 3WQSB 5GGXA 3PS9A 1MO4A 2GHQA 3OUZA 1PNQA 2WYWA 1GXSA 4D41A 1XRLA 2AFHB 3FNHA 4GD3Q 1PZFA 1SXPA 4TWJA 2WQ7A 2XNJA 1KDYA 1L5LA 3AT1A 1JXAA 3CNQS 2IOFK 4RV4A 5KQPA 2Y1CA 4EO9A 5LP6A 1TK2A 2YJGA 3PQ3A 4IZ6A 5A1JA 4HYEA 4G5GA 4NYMQ 3H3JA 5DM4A 1RPTA 3OLCX 2IF0A 1J1ZA 1XMPA 4J03A 5EGSA 5BO5A 5IJZA 4BQSA 1GQ2A 1M2OA 4FNGA 2O50A 1HTBA 5HCIA 4BZZA 2X1HA 3FHLA 4W8HA 4IF6A 2GF9A 5EMNA 1EFCA 3WJ2A 3HP4A 4JLBA 1I3CA 2RK6A 2GRJA 2JJ1A 4FQ8A 4RK6A 4MGHA 5BMVA 3NMUF 1Z4PX 2Y0CA 2FMIA 1UC8A 4HD8A 2YL2A 3MBOA 4F92B 1KEZA 3U16A 5JCJA 1QZXA 2J41A 1G18A 4RPJA 2R6JA 5DYIA 2J9FA 5KOJA 1Q0RA 4R1SA 5F7ZA 5DCUA 2NVUB 2QTCA 4LAFA 3RK0A 1QYRA 1T4DA 1X19A 1V9SA 1XTUA 1ZL2A 4J7UA 4N5HX 3CX7A 1CRWG 1KVQA 3C4JA 4JELA 3FDJA 4ZP1A 4A92A 5BQ5A 1Z6ZA 1SIOA 2BZGA 1RADA 4HDSB 1J7KA 1L6IA 1W88B 2Q41A 2ZUCA 3B2QA 1Q11A 2EKDA 3P9KA 1Z4OA 4L8LA 2GN8A 2YVKA 3P8ZA 1PDVA 3ZHOA 5IS2A 3NC1C 3F6EX 4PPGA 3O95A 3CZRA 3EYWA 1V2HE 4YQYA 2OBLA 1T3TA 4H6XA 4BOYA 2EOAA 2WNHA 3BKWA 1GUZA 3V2GA 3NDRA 5F5LA 1M67A 1CQIB 3A1WA 3FN4A 2UVPB 2PZAA 3HY6A 2KM1A 1AZSC 2ZIAA 2SNIE 2WUWE 4BEJA 1K4KA 4FDLA 5CFQA 3THXB 4TKVB 5BSEA 5JFOA 1G4HA 2HLPA 1JR3A 2Y0PA 3C16C 1H65A 3RQIA 1U7OA 4QYIA 2EZ9A 4D9CA 1KAEA 2OL4A 1OXSC 1JIIA 3LLSA 3ZS8A 4OGLA 4OXXA 4TX1A 1Y7LA 3STVA 5L7YA 4YV1A 2KI5A 2PSSA 4JYAB 3PR3A 2ZYTX 4W9RA 3H42B 5E4TA 2C9DA 1FDVA 3IPAA 1ZIXA 1GRRA 4JLSA 1WZCA 4CM3A 2TSYB 3HS3A 4RMNA 2Y99A 3DT6A 4BVAA 4XKJA 3IQGX 2ZP1A 5JS6A 5CHEA 5A3JA 3W1EA 2WA2A 4MHSA 1TLTA 2JBHA 2NTVA 2UYQA 1YMVA 1QIEA 3CHYA 3N05A 3N39C 2OA0A 1GPDG 4RJTA 2WFZA 1Y1PA 4MB0A 2CJPA 3JX9A 5PNTA 2J09A 5KCZA 4NATA 4G5FA 5KNDA 4U8GA 4HQFA 3DWIA 4QTUB 3DHVA 4EPWA 3T5CA 3I53A 1TZ2A 1IEQA 4D9MA 4K5QA 4YWHA 4A27A 2HPAA 3SC2A 4KCGA 1OVMA 4BS9A 3B89A 4K40A 1D6MA 2AFIA 4MV3A 3JYLA 2GJSA 1WQ3A 3IKTA 2Z8ZA 1AE1A 2X6RA 1K2WA 1EHCA 5KI6A 1DKLA 5DXAA 1P0FA 5G2OA 5EA2A 3A3OA 4M1SA 1KWGA 5EPOA 4KUGA 2FQYA 1HDEA 2AI2A 5LNK6 1YIAA 4KODA 2YZNA 1RKQA 1FNSA 1VL8A 1J8YF 2H8GA 3JQ6A 3L8MA 3U0BA 3K15A 2FGJA 3CWCA 3WWOA 3WWYA 5C81A 2C2ZA 4JXXA 3FFAA 4HJRA 1VYHA 4I5FA 4LNUA 1L7RA 4ZT3A 5LQDA 2J3JA 3GJ8A 3IS3A 3I62A 2QRQA 3BTUA 4DEYA 1KTVA 3T7TA 2P1ZA 4G85A 1KO8A 4QUJA 1Z75A 3DPIA 1VJ1A 2H4FA 1A7JA 3T7JA 4RTOA 3CRRA 2E1RA 4OB8A 2BBOA 1SPBS 2CT8A 1LDGA 5FEUA 1QIMA 2BFPA 3REGA 1DPGA 2P9EA 1B43A 2PX4A 2FR1A 2HK7A 3AYXB 1JZSA 2ODNA 2HJWA 3PFCA 4PLYA 3ROGA 1W581 3DEHA 4EY5A 3ML1A 1QMGA 1JE0A 2PZGA 2ZIFA 2V97A 3CINA 3HJUA 5TMDA 3Q8MA 4KNWA 5KWJA 4KACA 1GZ6A 2VXOA 1BN7A 1I4TD 3IR6A 4P4UA 3M5WA 4OHYA 1E9CA 4H6PA 1UBRS 4OL9A 2J6BA 3P0RA 1Z0SA 3DDUA 3C3AA 4QYWA 4G2NA 4ZCQA 2HJHA 2Q2QA 4EHAA 1UUFA 2WJAA 3F9CA 4ZVOA 4DBVO 3HADA 4YRSA 4YY3B 3KAJA 4TYPA 1Y3IA 3GCWA 3KLMX 3RC7A 4L3WA 1W5AA 5AOVA 2W11A 3E22A 5HKAA 4KPEC 2E4XA 2VF8A 1Y8AA 1UEXC 3AW8A 1N2XA 1KQNA 3VC7A 5H3HA 4YRGA 3WLMA 4N5LA 5HUQA 1HYEA 1KPHA 2GKGA 3D2BA 2ZIUB 4M8LA 5FOUA 2X8AA 4X1YB 1BEUB 4PVCA 4CM4B 1YWGO 3J80A 1C1XA 3M6LA 4Y18A 2JFNA 2VO1A 3EDCA 5E8JA 5IAGA 4R1PA 4ZJZA 3EPLA 2R5NA 1PK8A 2ZFUA 1E9SA 1C3OA 4GYJA 1MUUA 1DXHA 4RLSA 2P65A 3PIRA 1Y33E 1Z3IX 4DCPA 4YWJA 1G63A 1HRKA 5ITVA 1GNRA 4DLPA 4I1IA 1GRCA 1E1KA 1YU9A 3FFWA 3GB9A 1JDPA 3IOBA 1E3EA 4DXDA 5J4HA 3A11A 2C95A 3I2KA 3DC7A 3OURA 1U1IA 4MR7B 4RHXA 2FDCA 2BTEA 1IM8A 1QF9A 4H2DA 4MUGA 4TSKA 4Z0TA 6ADHA 1YFJA 3BCUA 2VHWA 5L6MB 3MUOA 4FMDB 1DDIA 3F3MA 1VL0A 3UHOA 3VH4A 4BU0A 4JXZA 4J0DA 4L4XA 1SKUA 1REQA 2HK9A 1SK8A 1FFHA 2KMLA 1JDTA 3MIZA 1M66A 1PWHA 1Y3HA 4G9EA 4UCFA 5GY7A 3T4UA 4KKXB 4CDMA 1KAHA 1XTRA 2GBLC 4DDMA 2NZWA 2J08A 1EP3B 3WLIA 1XQYA 5IULC 2BAGA 2MR6A 4IIYA 1PZNA 3ZU2A 3TIFA 2R7AA 2X8JB 3AV3A 2NVOA 3CRMA 1VE5A 3H2ZA 5KYUB 2HUNA 4MP6A 1M1YB 1ONNA 3BXZA 3NTRA 4A8JA 2KE5A 4CFSA 3RSGA 5A3QA 7GPBA 1OPRA 2NO6A 3IEKA 2QROA 3NBYC 1JJFA 4OHOA 3ST7A 4P93A 1XFAA 3VPBA 1YSCA 4EMBA 1FL9A 1P0CA 4AJKA 1RLUA 4U9UA 3ZVRA 3FWYA 4FD3A 3DEKA 3GRAA 3LKZA 4CBVA 2OAEA 1XQ9A 2LDXA 1E7YA 1CZLA 1EGMB 2H2AA 2WJ3A 3EFBA 4CCAA 3Q8KA 5LMCA 4E33A 2FE4A 4FINA 4J76A 1DAMA 1QG2A 2XQIA 2AD5A 4JEIA 3UBMA 3RSOA 2WWRA 4DQ0A 3FKSD 4U7FA 1GA1A 1UZMA 3P9SA 4GBGA 1C14A 3CR7A 2MSDB 3FCAA 1QYIA 4ETWA 1GL3A 5LMZA 1FS4A 4HH3C 5DLPA 1VBNA 5FBZA 1TT5B 2ZJ1A 1J2TA 3R4CA 1GPKA 1A8QA 2PKEA 2XE8A 4ITVA 4R51A 5THQA 1OROA 3SZOA 4LMRA 1N7IA 4FYIA 2PTGA 4OI1A 2IZ7A 2IEIA 1CBUA 1JLLA 1ES9A 1FFCA 2L19A 4ZC8A 5DOZA 5SZJA 3ZWBA 1YXMA 3T7CA 2IELA 4XLZA 2QMQA 3QPVA 3C87A 3HJFA 2Y2VA 1VA5A 2X76A 3HGQA 2IT1A 4Q7JB 2VQSA 3T3NA 3N3AC 1ZISA 2ZIWB 1ZL0A 3G17A 4GLFA 4ND4A 1A8UA 2AJ8A 2ZVQX 3PHIA 4EY4A 4MYTA 1LLCA 2FVXA 3NHSA 1I33A 2YV2A 4EKGA 1H0KA 3DPSA 4G07A 1EE9A 1UC4B 1FFXA 4B6JA 4YAJA 4UEOA 4D8YA 3C6KA 3QE2A 1NM5A 2CFRA 5C7OO 3AHEA 4DV0B 4AVYA 1EXVA 1MJGM 3JWJA 3N9IA 1D4AA 1GITA 1Q19A 1Y7IA 1EUZA 1BG6A 1JNYA 1IATA 3BUSA 2GAFA 2XD4A 1D09A 3LWNA 2P2YA 4FCCA 4B45A 4DJDC 5KQLA 1SKMA 1NVVR 3O3CA 3FTPA 2BFCB 3I37X 1KKUA 4I3HA 3TDNA 3WIVA 5HKKD 3R7BA 4HX9A 4OXIA 1UEJA 2YYSA 4R6WA 4C87A 3K9NA 4F3CA 1GCGA 1ECPA 1A7KA 2EQBA 3ID6C 4HLDA 5ALFA 4HTFB 1LBEA 3DT9A 2OAGA 1WU7A 3DF9A 2C0CA 1GTG1 4BGIA 1AMUA 3CLHA 2WTUA 4UEJA 3EPKA 2RI6A 3O47A 2DY1A 3OX1A 4QASA 3R75A 4RQBA 3VFDA 1VRVA 1SUCA 2BEUA 5JC1A 2Q5LA 4E5NA 2FK8A 2Y9MB 5DLQC 5KJEA 3HDYA 4EF6A 1Z2DA 1COWA 2Z95A 2PTHA 2J30A 3KCNA 1KZYC 1MDFA 3WQHA 3GLGE 1U0FA 4LY0A 3VVMA 1JG3A 3G0IA 1WV1A 1A5SB 1KJ8A 3P9PA 4FFOA 4RPKA 3LT4A 4E5KA 1PUXA 3JCZA 3WFJA 4NMMA 1K8XB 1QHIA 4GGPA 1YQTA 4TKZA 3T4EA 2E7ZA 1QH8A 1GTVA 2W2NA 3R0IA 4LDAA 4YGXB 1I1QB 3ZV7A 2BV3A 1A2QA 2PBRA 3A58B 4K9LA 4I1YA 4O2AB 1RBYA 5FIUA 2PCJA 3AEQA 4PPFA 3FPKA 1K3FA 5D3KA 5DN6D 4PNHA 4YI5A 3RJTA 5CP8A 4KO3S 2GBPA 4TGLA 1EIZA 2ONYA 1Q92A 4RK4A 3U26A 4DLKA 2AZMA 2JGRA 1PT7A 3L0ZA 2Z2ZA 3N2NA 4OJMX 1N2GA 3KT8A 4EPYA 2IPNA 3NHKA 5ECWA 5F76A 4YLYA 3JXEA 1OGJA 3JAWA 1ADJA 3EBPA 4FZ5A 4XQEA 2JF0A 3L7IA 1HDIA 1JQ3A 4LQCA 3BWVA 4OAPA 5CM8B 4TKUB 4DDTA 3A05A 1CR1A 3EXG2 4DM4A 3K0CC 4A26A 4ZJUA 1C2TA 5CD9A 2J9XB 4F1WA 3WL6A 1UOEA 3SKYA 2IYLD 4V1CI 2I3AA 5GP1A 1F2DA 1WD7A 5JHHB 2HLDA 3P97A 1G98A 2WHRA 4QQRA 2IDMA 2QF7A 1RI2A 3FM9A 3HA5A 2UYGA 4HBGA 5DGHA 1HR0B 2V45A 3K9FC 3N6VA 1XL0A 1PEKE 1K6EA 4FXOA 5ISMA 4O1MA 3MRTA 5C1PA 1UPUA 4KSYA 5IF3A 4BO2A 3LK6A 3ANYB 3WQRA 4A91A 5BY2A 2ZOSA 3N2YA 3UXEA 4QDOA 4EM6A 1FVOA 5EJIA 5JRJA 5KOYA 1C7JA 1E7SA 3PPVA 4B4DA 4XVCA 2ODPA 3CVUA 1ZGHA 2QOEA 4RWEA 1N9GA 3H1EA 1G4AE 2GO1A 4YRQA 4L6CA 5CNJA 2AEMA 1D2CA 4WLNA 4LWPA 1PP4A 4M1TA 2TYSB 3KPWA 1H42A 1L7QA 2QTNA 1RXIA 1QE3A 3WBFA 5ED4A 4GOOD 4ESHA 1PKEA 1DJQA 1Z4KA 2HYDA 2VF4X 4IBOA 1KEVA 1V7QA 2ISCA 2YWRA 4NHOA 4Y9SA 3IIMA 5I5EA 1W5TA 1U04A 4CF5A 5H70A 1L5VA 1JQAA 1O95C 1MO2A 4NNOA 2SHKA 2TMKA 3FG9A 4CKEA 2CHQA 3KKZA 3TZKA 7MDHA 3DDSA 3I6ZA 4IVQA 1JDSA 1P0MA 2E3JA 4MH0R 3T35A 2O8FA 4IQ4A 2CBZA 3QMPA 2YFYA 4UVHA 3EG5A 3JWPA 3BQNB 2NPFA 1T5BA 2JEOA 3IH5A 1K6XA 1SD5A 1NY5A 1CSEE 1X92A 4FYJA 4KXWA 4Q9LA 2H1RA 2QGFA 4L78A 1E2LA 5D6OA 2YV4A 1SHTX 4RENA 2ZB7A 3NWJA 2PVSA 2VHYA 1T9BA 1CDOA 2WBLC 3PPWA 4HEA6 4QICA 1Z56C 4WE3A 1K3UB 1ZOSA 1KH2A 1RRPA 2O5EA 2I03A 5C4MA 1MX3A 1V7CA 3E8SA 1LNQA 3I2HA 1AQIA 1E2PA 2P27A 5IJ0B 3RWMB 1L4LA 1SVIA 2W2OA 1NUTA 3QBEA 4IIJB 1DDOA 2V7BA 1CPYA 2Z98A 1F06A 4NRDA 2X23A 3FHCB 3QUBA 3RIYA 2X9QA 3TUZC 1SBTA 3OOHA 1R6AA 1OTHA 1UKCA 4KBFA 2UAGA 3N0VA 3KLOA 1ACJA 1AC5A 1ZGAA 4JOSA 2D2XA 1UK6A 3TLZA 1W7AA 1B2RA 1JFVA 2XW6A 3UJ3X 1U2EA 5K3OA 3OTOB 1PR2A 1F0YA 3GLFE 4GRAA 5D01A 3AKZA 4ND3A 3X1DA 2X1VA 3TRDA 2JS7A 3RE1A 4CF4A 1L8QA 5D84A 4JU8A 2E4AA 3BMCB 1YHNA 2JI6A 4IWNA 1HT2E 2PV0A 4JXKA 1NLMA 4PC7A 1TZBA 5B2ZA 3KQSA 4D9BA 5JZOA 1UXHA 5HE9A 4F21A 4LXTA 4DNOA 4BQPA 3Q5GA 2CZCA 1ADFA 2I6TA 3RVLA 3DZFA 1ZITA 4CLHA 1VLJA 2ID9A 5COBA 3U1TA 1T1SA 1TZMA 2BGIA 3FMOB 3KU1A 3N2GA 2IV7A 4BXOA 3B1ZA 4EFLA 2C4NA 4RCVA 5BN5B 2H7YA 4P33A 1PYGA 1N2SA 5JWOA 1TCUA 2H7VA 3H2KA 4EUKA 4MR8A 5KHLB 3QTLA 4CMGA 3BFVA 2O6HA 2QX8A 2RHTA 4S1NA 1TECE 4BL5A 2XNDA 4XX0B 1HTWA 3HU1A 4B5KA 2WWTA 3WGZA 3R3UA 4P86A 1R4MB 1SXHA 2RGGA 4FUQA 1QH0A 5A6SB 3RAJA 3USZA 2DFNA 1DWQA 4KNVA 4WGGA 3D1LA 3AX6A 1NZFA 2G9ZA 3UQYS 4BWGA 4Y0NA 1SXJE 4URWR 3U4HA 3U3XA 5DSXA 2GTIA 1PW5A 2AN9A 4RY0A 4XWYA 3R7AA 2PKQP 3AH8A 3G23A 1JAXA 1DTWA 1DRUA 3GRCA 3P5BA 3QX9A 4ZK2A 5J2TF 4Y3UA 4UATA 2I5PO 2AKYA 3IRVA 3NBUA 5DP2A 4BKOA 3AOGA 4DJAA 5LDDC 2J31A 1R00A 1RRFA 2VHCA 3F6PA 1W9MA 4QUAA 5D7BA 3WL4A 1P0IA 4BLWA 5KVAA 3TW8A 4FMBB 2JDIA 2RC6A 4LC1A 4FKZA 4ZOAA 3QX7A 5BQFA 2B4TO 3VR5H 4ZO4A 3RYCB 3N0WA 1CVIA 1QU2A 4P36A 2R86A 1MNAA 3DHNA 4PIMA 2GJKA 2C5BA 4FSXA 3UMBA 5C2JB 1YF3A 1R0LA 1RWKA 5EKUA 1IZ0A 3HFJA 1MV8A 5KYVA 3T5BA 1FLAA 5FPQA 5BQPA 4OATA 3JAKB 4IS2A 5BRJA 4OLBA 2P6UA 1OXXK 3TW4A 3OLYA 5JSKA 4LISA 4EHBA 4HMQA 4MS4A 1NTOA 4K87A 2QRMA 3PFFA 1A72A 1FZQA 2MR5A 4FWIB 5AW5A 5B6JA 4EMUA 5D1NA 1W96A 3KP1A 1QP0A 4MLPA 3SZMA 3DVLA 1IEVA 1WXHA 2FHPA 3F78A 3F8SA 2GN2A 4J07A 3A4VA 1NMQA 1R6DA 3Q85A 4YJ3F 2VDKB 3D3KA 4FR2A 3U7QB 1Y3CE 1I3NA 1QQ6A 4MROA 3VNAA 2EZTA 1I3OA 3FPFA 1ZJWA 5G4LA 3ZHXA 4MARA 4RD2A 5E6UB 1KR2A 1U80A 1ZK1A 1TVCA 5EIBC 1V5FA 1KU6A 1YASA 1CX9B 2PK3A 3IHWA 2NO4A 5KX5A 2F90A 4V2IA 2F64A 3O8LA 2DMRA 1TNDA 1L9XA 1UDRA 1SZPA 4D6YA 4EIWA 4UM9B 1EUCA 3AFHA 4XSGA 1FDIA 3OCVA 4CTNA 4DRYA 5BSGA 1Y6FA 4FOLA 4MKFA 2WZQA 1XMSA 5FUWA 3A3NA 1YB7A 4FFNA 5FWYB 3UWDA 4A4DA 3A1SA 3BH6A 2EBFX 2NACA 3JQPA 3B85A 4CU2A 2CD7A 2AI3A 3SLKA 3GOQA 1XNRB 1CULC 1QCDA 1HV8A 3MWGA 4OMCA 1W0JD 4FI3F 1PFQA 4ZFNA 2ZZMA 2NLOA 3EGOA 2R1VA 2OXCA 2AFHE 4DDWA 1JR6A 5FBRB 4OA5A 4QULA 4CR6A 2A0UA 1LD3A 1ZG3A 5CHYA 4RETA 2HJSA 3ZDBA 3FMFA 5DGDA 1P6QA 3VO1A 3K6JA 2I6QA 1OOEA 1P29A 2EX1A 4OYHA 2CKDA 2BMAA 1H2BA 4U7HA 4B87A 4C1NA 4DLNA 1CP2A 1CY0A 6LDHA 4KHZA 2ZW9A 4MINA 4PHCA 1LRLA 2JAWA 1MB0A 4FOTA 1W87A 1ZH6A 3PZRA 3JQQA 3OY2A 4Q9DA 4C21A 2V6GA 3AHJA 4FDAA 3PHGA 2O1WA 2LCFA 1OX4B 4PX3A 1T8WA 3FYSA 4UM7A 4BFLA 4RDXA 5LLTA 2P2ZA 3ZDYB 4AJIA 3SNKA 1NAHA 2GVNA 3G89A 5C8DA 1JFLA 4WINA 2DX7A 4C43A 4DHEA 1GPNA 2WF9A 5L45A 2GRUA 1Z68A 2X9NA 3KV3O 3FOAA 1ZN9A 4HGYA 3BJZA 3QNWA 3UAGA 2VAWA 2TECE 2GHIA 2PHZA 2B4RO 3LPLA 3RHFA 1D4OA 2IE0A 1QE5A 1RQ7A 2HSJA 1BDHA 2NUAB 2QRHA 4JA2A 3GFQA 5E38A 1PUIA 2VDQB 3PC2A 3LO5A 2DUJA 4IMIB 2V5UA 5EQFA 1SBNE 2I3ZA 1E3QA 4JIMA 1W76A 4NU5A 3EMDA 2ZIGA 3UOAB 3GAFA 3IQZA 2D1SA 3TKLA 3VR4H 5C1DA 2HZBA 2HWYA 1G8AA 2GLUA 3DVRX 5DYNA 2X4DA 3A2LA 1M0WA 3TD2A 5A0VA 3OLXA 3B7PA 1J23A 2P2DA 4MV0A 4CUKA 3ZBQA 4D74A 1NT2A 4JL8A 5CJJA 4HVTA 4RMHA 1RYZA 2FW6A 1VZ2A 3FZNA 3LGAA 1MX1A 2CVHA 2IXFA 4LSWA 7ADHA 3QW4B 4UNSA 3ZVLA 1WXEA 4LKOA 2UUPA 5H83A 4C4SA 2ATXA 5EUCA 5FFFA 3F6SA 2ICAA 3OX4A 3MRSA 4DDVA 1GZVA 2O59A 3O75A 2OK7A 1IBCA 5AP9A 3L7JA 2ZB3A 2IBTA 1USKA 2VS1A 4XASA 4NJMB 5C3UA 3PD0A 1CB7A 1GDDA 2VL7A 2WUGA 1XZQA 3AHCA 3CUWA 4JIGA 3SI7A 3VO8A 2IKSA 3QK7A 3AKEA 3ZHZA 1HOXA 3OEHD 3GDOA 4RTLA 3LPMA 5DISB 2OZLA 3V7FA 2C3OA 4PZLA 3O9VA 3W5VA 1TMYA 1QH1B 2NUBA 1OGIA 4F11A 1T2AA 3HO1A 4QBTA 4MXDA 2WYIA 4L8WB 4L6AA 3E1KA 1NWHA 3H97A 3PQEA 1IY1A 2EJTA 2FN4A 3FOCA 3TIGA 5DW0A 3TPZA 2XOKD 1YNOA 5AW0A 4GMFA 1NR5A 3C7KA 1TYCA 1YS1X 3DT8A 3IBGA 3Q10A 4HEJA 2ONKA 4NONA 4NX2A 5EE9A 3BGOS 3SEQA 3V3TA 2ETVA 4M9QA 4WCVA 3D4IA 3IIKA 4TQ9A 3W79A 1X8JA 4DL9A 1V7PC 3L93A 4MDFA 4HATA 3OWHA 5FQNA 4Z3KA 3B8HA 3P1JA 4KYUA 4LN1A 1ENOA 3I64A 3Q5EA 4GOXA 3UCFA 1N0IA 3QBJA 3LWDA 5EIFA 3NIGB 3UXMA 1B41A 2J59A 2EBWA 1H2AS 3M6UA 4MUNA 4RSGA 4UE6A 2XQVA 1T9GS 5FOTA 1B14A 1RBMA 2IOQA 2QQGA 2XE4A 1LXCA 4DRXA 3VM6A 1VE9A 5KVVA 3PHHA 4C1BA 2P3OA 4B7UA 1Q3TA 2E55A 4JLPA 4PCVA 5FJIA 5AUNB 3ENWA 3P0FA 3KSAC 3JZIA 1MX9A 3W5CA 2ZBPA 5DK6A 2DOKA 3UJ9A 1DJPA 5K8VA 3T1YB 3GRKA 1HLPA 4FDTA 2W83A 4GP7A 5JAQA 4X54A 1PQPA 2PMEA 1IZZA 3IQWA 3I1YA 4JBLA 2BGLA 1IUOA 1TKAA 2FRVA 5HBRA 4CQMA 1NDQA 3DUFA 3JD3A 5JASA 3FR8A 4YUYA 1ZU5A 2RG1A 1SVSA 3E3LA 3FSJX 3ZHBA 3H83A 4NCHA 2XOEA 1D0SA 1CJCA 3JD1A 4IQ8A 4CMAA 4TKMA 4V3CA 1K9SA 5E2AA 3LQRA 5C1OA 1MZPA 1QMPA 3BJRA 3KPUA 4KKVA 3GLHB 1NNEA 4NH0A 1A88A 1IIBA 1WE2A 2H07A 3A9CA 3AR5A 3RVDA 1FNBA 3CF4A 3MN1A 3RYFB 3TX6A 3JS5A 1JVNA 2BVNA 4G5XA 5DOVA 2ZJ0A 4Q47A 3KEQA 3TPCA 1C81A 3HSKA 4UHKA 1SK9A 1TTTA 1CIJA 1UADA 2QTZA 4FFWA 4DIDA 5B7QA 3MB5A 3A2KA 2OAQ1 3WRYA 3FGNA 3SKVA 3WZLA 2CXUA 4G8DA 3NDJA 3QVJA 4XW2A 4BNDA 1RLOA 1YHZA 1Z5OA 4Q15A 3SHVA 3W5AA 4HNRA 2BGNA 5SZHB 3KLNA 2C7GA 1Y37A 1JNXX 3EUAA 3WV4A 3NONA 2NW6A 1YDMA 1GTMA 1IHUA 4MYCA 3WR5A 5C37A 1FDOA 3U7RA 5IMBA 1PU2A 1D3AA 2PVCA 4EUFA 2D2EA 2SKDA 3QU2A 1U8XX 5D3QA 3WBBA 4A16A 3NC4A 1JL3A 1O94A 1PJ2A 2FWRA 2R6ZA 2RGBA 1N36B 4Y2YA 4NBRA 3FHJA 4H27A 4LCBA 1VXRA 2DJIA 5H02A 3GVXA 3RM3A 4C3UA 3PXCX 3U7FB 1LDBA 1U7PA 3KQMA 1B42A 1XWWA 2IYTA 4Z4GA 2YVQA 1A98A 1TKRA 2DUWA 4B9AA 3ZCTA 4NZZA 1L7MA 4RIIA 2P9FA 1VBFA 4MDEA 4OHUA 1S4MA 1B15A 1BS2A 1ZS9A 2AD1A 4WL0A 4Q3NA 3C70A 1X1QA 2V7GA 3SE0A 5K51A 4I9FA 5JZ9A 5F9MA 1USGA 2O5VA 4M9UA 1L0BA 4RZ3A 5ESRA 4BO4A 2W22A 2F3TA 2CFTA 3GNQA 4OTZA 5JZSA 2A5GA 4EOGA 4G86A 5LXTB 3BN3A 3IP5A 4KV7A 4AJ9A 2W70A 2NO7A 1N7HA 2GASA 3LF1A 3OQJA 5A4IS