2EFCB

Ara7-gdp/atvps9a
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
165
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 51
structure length 165
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efcB00
4BUJA 4LJYA 3VR3A 5KOYA 3VHLB 1GZSA 1KMHB 4TT3A 5F2EA 3VAAA 5G3YA 2ODWA 3KQNA 2Q21A 4K46A 3GLGE 1CP2A 1NMZA 1GP2A 1SULA 2G83A 4BPBA 1EX7A 3QJYA 1NJFA 1ZC4A 4RY2A 4EPRA 4KFRA 4RKFA 5EE9A 1E2KA 2YOHA 4A2PA 4MYCA 1C4OA 2D7CA 3IILA 1G8GA 2FSHA 2B92A 2JJ2D 3DL0A 1SKYE 3BAFA 2A5DA 4OQMA 3ND9A 2O5VA 3CPJB 3U4QB 3TR0A 4M53A 1MABA 2PCLA 2ZE6A 4L16A 1OFHA 4LV6A 4ON9A 5CIWA 3TAHA 2W83A 3LAWA 2N1BA 3E70C 2ATXA 3TVDA 4C9BA 3K9NA 3OF5A 3U2QA 3CRMA 3HR7A 1F60A 1J2JA 2ORIA 1P5ZB 2GJ8A 1RW4A 3GJXC 3ZVNA 2ZETA 1TEVA 2V1XA 4V0NA 4M9ZA 1B23P 4O3MA 3EW9A 2C99A 1C1YA 4MA4A 1JPJA 1RVDA 3M0EA 1UBCA 1KI7A 2Q3FA 1NSTA 4LJAA 1E9DA 2G6BA 2O0JA 4Z1MD 4A36A 2HYDA 4QOSA 1FW6A 2G88A 3SFVA 4B73A 2Z83A 4AD8A 1IONA 2ZRCA 1E2HA 4GMDA 2CBZA 2PZFA 1NG1A 4OHYA 3FKSD 3KB1A 2G0TA 3VU9B 5EQTA 4E07A 2IC5A 4EFMA 4FCVA 4LJ4A 4MITA 1KI9A 4OI4A 221PA 1PLKA 1HURA 2Q3MA 3CRQA 1W0JA 3ND8A 4NCKA 5BW8A 2D2FA 4EPYA 1WF3A 4HSEA 3TRFA 3H84A 2OM2A 1NVUQ 1XPRA 4QXAA 3RABA 1KI6B 4B74A 4X8LA 4ZIRA 3RS0A 1XRJA 3TW8B 2XTZA 1G3IA 2QMOA 2CK3A 3BGWA 2V3CC 3WYAA 4C0KA 4RFSB 3SDZA 3LQRA 1IN4A 3L0IB 4LDJA 1G5TA 3OAAD 1YRAA 4QJ3A 2OESA 3FKQA 4HUTA 2RGGA 1CR1A 2IXGA 2MSEB 1VHTA 5TV2A 2WMOB 4Q4HA 4N1AA 5IF9A 5LBIA 2FPMA 3W3ZB 4N0DA 2ZRBA 2HCJB 1JJVA 3PV0A 4QBFA 4UKDA 5D3MB 4G0NA 1HQYE 3RWOA 2GF0A 4BRUA 4XIGS 4R7ZA 3NBYC 4F4JA 2KWIA 3SBEA 4A9AA 1WRBA 2BHRA 2FGKA 1KAOA 1E0SA 3GFOA 2IK8A 4FMCF 4XD7D 2ZANA 2VP5A 4D82A 4OQFA 3EASA 4FWIB 2QPOA 2J0UA 1NI3A 3N5CA 2NTYC 4R9UC 1D5CA 1UJ2A 5J47A 1E9RA 1M6NA 3BB1A 4IFBA 4PSAA 5E7MA 1QDEA 2ANBA 3L2OB 5J4LA 3V9PA 2QMHA 2C95A 3GMTA 1JR3A 1Z0AA 3RNLA 521PA 4DDTA 1PZNA 5CIQA 3OIVA 4PQYA 4DCSA 4EPTA 4ITRC 1G3MA 1L4YA 4LC0A 3K0CC 3O8BA 2G9NA 3PEVA 1O87A 3VKHA 1VIAA 1FUUA 2DWPA 2FE4A 5FOWA 1A2KC 1ZUNB 2F3RA 4LZZA 4A0HA 4RD0A 4C0BA 3DEFA 1IN7A 4XWOA 2OG2A 3NVAA 2ZRNA 4JKYA 2QE7A 1RIFA 2REBA 1XCGB 1XEXB 4JLJA 4HZUB 4JL5A 2AD1A 2QMUA 3OEHA 1AIPA 2CLSA 2Q9AA 5GJCA 3BE4A 2RCNA 4LPSA 4P0TA 1LNZA 5AK0A 2ZU6A 2WWGA 1US8B 1Z0KA 3IQXA 2PBRA 1OHHD 2J7PD 2A30A 2N42A 1X8KA 3VX4A 1UPTA 2HJGA 1AQYA 3HJNA 3B85A 1TPZA 1FTNA 3K0AA 4WZ6A 5EP3A 4I1VA 1YR9A 5FOXA 2WZQA 1D8TA 1JI0A 1XZQA 2WIAA 4GOXA 5AUNB 1R5OA 3NEYA 4US2R 1YZQA 1K5GA 5TMPA 3EG5A 1U8ZA 1ZM7A 2VSFA 2J59A 1EFUA 2OO7A 3L0OA 1TX4B 2RGCA 4TT3D 1ZIPA 3AF1A 2VH5R 5B2ZA 2IWRA 4CYMA 5JJLA 4DIEA 3SEAA 1G6HA 5HZKA 2VF8A 1IOZA 2QA5A 3ECCA 4E22A 1DAFA 4TTQA 5AJXA 4DEXA 3BH7A 2GXUA 1T4GA 4DVGA 3KKMA 3A1TA 4OK6A 1OPXA 4JBWA 2X8AA 3BBPA 1LS1A 3G5UA 1GRRA 1IJEA 4Q47A 4UXHA 2CL0X 4DSTA 3EC2A 4AG5A 2PT5A 1ZAKA 4TMWA 5KHOC 1G3UA 5GVRA 1GRQA 4ZCIA 1E2EA 3H4MA 1E6CA 2GXAA 1Z06A 3FHCB 2OV2A 2QT1A 1IXZA 1YR7A 2DCUA 2JLSA 1HH4A 2P0EA 1ZCAA 3BERA 2ZRGA 3AVQA 3T61A 3TKLA 2J0QA 1J8YF 3AKEA 3KFXA 1ZBDA 3BIFA 2J41A 3TR5A 1RPZA 4P3YA 2RH5A 1EFRD 3THXA 5FR2A 4AC9A 3WP0A 2H17A 2FZLA 2DWQA 4HAYA 4B43A 3I5YA 2JLRA 2CVFA 2JATA 2QM7A 3I32A 1KI3A 1U99A 3ZGXA 3PXGA 3THWA 1PUJA 2BCGY 3HPQA 1AS0A 1P3JA 1DARA 1XMVA 1KMQA 4LOAA 3A4LA 1P9RA 4NZYA 4HLUA 2XB4A 3SHFA 3TSOA 2JIZD 1UKYA 1ONBA 621PA 1DBSA 2OUKA 2BBSA 4AI6A 1NMXA 4U02A 3CIOA 5JCPA 2UZ3A 4GZLA 4TYYA 2GNOA 3F0TA 2BKEA 2HV8A 3GJ3A 4DLYA 1W0JD 2IF2A 2ODNA 4B44A 2ZYWX 5CLLA 3B1XA 3K8YA 3QKUA 3QXSA 5JEDA 2HJVA 3DM5A 4DLWA 1Z5ZA 4HDOB 3T06B 2W0SA 1W5SA 3WMGA 2CHQA 3LWNA 1SGWA 1UEIA 3SC3A 1IQPA 5IT5A 2QGNA 1KI8A 4Q9KA 4P32A 1ZYUA 3QY0A 4IEIA 2CK3D 4ZPXA 2XB2A 3WP1B 1XJQA 4ZI3A 1EG7A 1PV4A 1CULC 2ZSBA 4TMKA 1O3YA 2QGZA 1F6BA 1HV8A 2VHUA 1Z47A 2DFNA 1IY0A 4LX0A 5HE8A 3AH8A 1GRNA 2VLIA 3L8YA 3K0FA 4IHQA 4QGFA 2WTUA 3QXCA 1FNNA 4DCUA 2O8CA 1IY1A 3CX8A 1E94E 1IM2A 3RC8A 2X77A 2KBEA 3AKYA 3GFPA 4TWZA 5KYKA 4MKGA 5EP1A 4YQFA 3AKDA 4KO8A 5H68A 2RB4A 3Q7QA 3EZ9A 1N6IA 3KQUA 1PLLA 2CXXA 4BRWA 2WAXA 2GCOA 3SYKA 5EE0A 5KPDA 2V9PA 5A0FA 3VHXA 2AKYA 3MGCA 1N0WA 1H8HA 4FCTA 4HDCA 2BEJA 1YR8A 1XD2A 5AJYA 3AVWA 1SHZA 1T0JB 2VHCA 4AURA 2F1RA 4HLCA 5FUXA 2AXPA 2V6IA 1RZ3A 4FIDA 2XXAA 4NYIQ 3AVTA 1JR3D 4V0MA 4TN1A 2A5JA 2GXSA 2WPDA 1OXTA 4L4UA 3VNVA 3QUSA 2JGNA 4US0R 1IAQA 2EVWX 2QQEA 4B3BA 4AKIA 5E95A 5AUPB 3RS5A 4NYJQ 5L3QB 1DO2A 3SJZA 1XEFA 2DWOA 5KSYA 3BB3A 2JAQA 1KKMA 1N6PA 1N6LA 2Q0HA 2CE2X 4NYIR 1Z29A 4IJMA 4EUNA 2YHSA 3LH5A 2ZU0C 1HQCA 3OEHD 1NJGA 3KTAB 3VR1A 2FSGA 4C0QC 4JLMA 5KNBA 1JR3E 2ZM5A 2B7CA 3ZDQA 3KQKA 4KLZA 1UAAA 1TUIA 3CRRA 4NYJR 2LKCA 2WJHA 5FTJA 4D0NA 5FBVB 1GG2A 2FH5B 2YYZA 1I2DA 3PG5A 4AKEA 4YXWD 2ZS8A 3PR1A 1MO4A 2G3YA 3A6PC 4M1WA 1SVMA 4DB2A 5JJKA 2C03A 4PSKA 3WYFA 4IOJA 4MDEA 1CS4C 5J4HA 1DAGA 4URVR 2ASEA 3SU8A 1X8JA 4IDNA 4NE2A 1OFUX 4X8OA 1KI2A 1MT0A 3JZAA 4HUQA 4IDPA 3BC1A 2ZI9A 4OHXA 3SYNA 2NG1A 2ERXA 4HB4A 2RHDA 2DFLA 2QMEA 3F5FA 1N0UA 1G18A 5B30A 1GIAA 4RZXA 1EFTA 4W9MC 1LS6A 2EU8A 3NBZC 3HYRA 4CIDA 4IDHA 1M7GA 4Q1CA 3CF2A 5DI3A 3THYA 2O8FB 4M1OA 4TLCA 1I2MA 4CEJA 1YZNA 3FOZA 4DUGA 2W00A 1OF1A 5JCZA 3NEJA 2C5LA 5H1YA 4KLNA 2I4IA 4ZKDA 1MV5A 3K70D 3MUFA 5F9HA 1GSIA 1P73A 2PMDA 2QROA 4GP6A 3CB4A 4JBXA 1GKYA 1G5RA 1KI1A 1KY2A 2ZPTX 2AFHE 1OFIA 4QGHA 3R7WA 4LJ8A 1F2UB 3SFZA 4URWR 1DAKA 3SNHA 1MOZA 3DO6A 1WQ1R 4P33A 4I4LA 1NF3A 2B8TA 3SOPA 2JJ2A 4CT4B 2F55A 2GZAA 1P2UA 4M4SA 3Q8XB 1T0HB 1XEWX 4B3GA 5SZIA 3KL4A 1NKTA 1MKYA 2KBFA 3UWOA 2WICA 2QORA 2IYXA 4JMPA 4TYPA 4UXJA 5FTNA 3UMSA 3BORA 3DZDA 2NGRA 1SXJB 3RS4A 1AQUA 1VG9B 3WY9A 4EAQA 1YHNA 1GKIA 2WWIA 4A8JA 2ZROA 3GLFA 1VECA 2IUTA 5AUOB 3I72A 4Q1FA 2I1VB 3RRYA 4WAUA 1T3SA 3B13B 4PANA 2PH1A 2QM8A 2ZRHA 3LNCA 1LF5A 1ESNA 5KUTA 1XF9A 2ZEJA 4OQLA 5FOUA 1UDXA 2P5TB 3L8ZA 1B0UA 2GDJA 4LSGA 1ZM9A 2IYQA 2JASA 2ZRFA 3T35A 1S1CA 3I92A 1NVXQ 5FUYA 2JLUA 3U7GA 3D31A 3LVQE 2ORWA 1E9CA 4V03A 1YE8A 2WKRA 3LV8A 5K8IA 4KFSA 4V0OA 2AXNA 2W2VA 3UKDA 5EUQB 3U7HB 1LF0A 2OXCA 4DHEA 2A5YB 4QGGA 2IS1A 3O8DA 4RCZA 1X6VA 5HCIA 5JRJA 1II8A 1JECA 2GK6A 3U3MA 2PX3A 1BOFA 1KK1A 3EZ2A 3BFVA 5TXGA 1F48A 5CDFA 1D9ZA 3QNUA 4CVNA 1FTSA 3TNFA 2WKQA 4Q7LA 1G3QA 1XU4A 1D6JA 1Q12A 1E0KA 3A36A 5FTMA 1AJEA 1M1YE 3IBYA 2YC4C 1ETUA 1M8PA 2YKGA 2QBYB 4NYMQ 2VF7A 4HAWA 1R6BX 3Q72A 4A6PA 1JALA 5KPJA 3GLHA 1MO3A 8OHMA 4MGZR 2QAGA 4TL7A 3D3QA 3T1TA 4B6FA 2XSZA 1H8HD 1BH2A 1CTQA 1E9FA 1EWRA 3EAQA 3CZQA 1DELA 4B3DA 3NBFA 1U2RA 1YZUA 2R9VA 3GLIA 1DEKA 1N5KA 2QPTA 3K9GA 3QBVA 1G1MA 2DFKB 1Q3TA 3BS4A 1SVKA 1Z6GA 2WMNB 4NYMR 3IHLA 1NG9A 2C78A 2WPDD 4O25A 4OQNA 4Q48A 1XTSA 4LBVA 4NBSA 3TIFA 4EIWA 4Q9LA 3SJAA 3VR4A 1E4VA 1NLYA 1DVRA 4LRWA 4B35A 3JVUA 3IO3A 3S1AA 2YWGA 3ICEA 2K5UA 4DDVA 3NH6A 2WM9B 3W6NA 1E98A 4QHSA 5JZVA 4URXR 5B64A 4WXRA 3P4XA 2OHFA 3K9LA 3PIRA 4ESHA 2VSXA 2BC9A 4LBZA 2AN9A 5HTKA 1OH7A 1Q20A 3NXSA 2FEOA 4RD2A 4JS0A 3W3AA 2B6HA 1BO6A 4FI3C 4ABYA 4D0GA 1W36B 4V0ME 1GTVA 3LD9A 3BB4A 2BM0A 3ADCA 4PC3A 3RVBA 1OJLA 3J81k 2GWHA 4QGAA 2OE2A 3C4JA 1XXHA 4LUCA 2CHVA 4O0MA 3QE0A 5SZHB 4TQAA 3RYTC 1SXJC 2BM1A 2ZE8A 3B9QA 4HLUC 4JVLA 1P2VA 4XVQA 1E3MA 2G77B 4PO9A 2QTVB 3LW8A 2L0XA 2Z5FA 1IXSB 4UNRA 2HT6A 2CL7X 4C30A 3K09A 3A1UA 3E5HA 4CT5A 4DWJA 5L3VA 3GLGB 1YU9A 3HU1A 4KBGA 3EPHA 2F7SA 3NG1A 4LYFA 4CW7A 2DB3A 2RHMA 4M9XA 1LTQA 3QPUA 1CU1A 1X3SA 1AKYA 1QVAA 2J7PA 3F8TA 5FI0B 5FUWA 5JSZB 1JAHA 2OBLA 1N6OA 3TK1A 1MR3F 1EFCA 1G8YA 1SKYB 1QHSA 2AK2A 1KNQA 2C98A 2QEQA 2IYUA 1EX6A 1JXMA 4DUGD 5IDVA 1D2EA 2QENA 3LY5A 4J0QA 3PEWA 2GEVA 1KK3A 4Q01A 4PQRA 3SJCA 3RRZA 2G0NA 1OKKA 3AKCA 3QKSA 2CVHA 2H1LA 2GBLA 2ZJYA 1RRCA 3X1WA 4KVGA 4PZLA 1PVOA 5CB6A 3REGA 3FPAA 2O8EA 4H1UA 2DYKA 3TUZC 3CLVA 3A1WA 4PC2A 3LW7A 4NH0A 4D26A 3H0KA 1KI4A 3ZZUA 3B60A 2J7KA 2ZJ5A 4HAUA 1W49A 2Q9CA 3HDTA 1JEEA 3F3YA 3EIEA 4Q4AA 2ODEA 3PVSA 2OAP1 3QEOA 4OK3A 1NN0A 3A4MA 2EQBA 5TY0A 2X19A 3TAUA 3RHFA 4LYAA 4TLBA 3GD7A 3FTQA 1QHHB 2ZAMA 4ZDIA 5J40A 5JLJA 2P6UA 2WOJA 1EFRA 3KFVA 2PL3A 1J99A 3LDAA 1PJRA 1W4AA 2VYFA 1AZSC 2JCSA 3GJ8A 2GEDA 3CNNA 3N70A 4IVQA 2YOGA 2FZ4A 3CM0A 2ONJA 3R20A 1VCOA 4OKSA 5CJPA 1W48A 3NC1C 3NKVA 1NRJB 3P32A 1W46A 5EE1A 3TE6A 4AWXA 2ZS7A 4QM7A 2JIZA 2P6NA 3KXKA 3X2SA 2D7DA 1N0VC 4HAXA 2ZSFA 3PITA 3GLFE 1ZRHA 3B1YA 4RD1A 4DT1B 1NNEA 1TQ2A 5BN3A 1W2HA 2WWFA 4S2EA 3ZS9A 2DY1A 5KSOA 4ZDKA 1W0KA 4PC1A 3UG6A 1J70A 1LB1B 3A8TA 4H1VA 3AVYA 1W36C 2ZI5A 3U7FB 1D2MA 1J7KA 1ZM2A 1N6HA 1W7AA 2WJYA 2ZRJA 5DISB 1KO4A 2JLQA 2DPXA 1FFHA 2ZJOA 1NLZA 4DC9A 1II9A 2ZITA 2YZ2A 5HPYB 5E7IA 2R6GA 4A0RA 4BFWA 2E87A 3P20A 4ZCMA 1Z0FA 2XSZD 3QVVA 5JS7A 1GOTA 4JLVA 4RD4A 3NC0C 4D81A 3ZQJA 4EPXA 2D74A 4M1SA 2F9MA 4M1TA 4BWYA 3VKGA 4BE7B 1NP6A 2GJAA 2O52A 5TB5A 3A58B 2LCFA 4KJZA 1Z22A 1S0UA 1Z8FA 5CDFE 1JNYA 3W6OA 1IHUA 5FL7A 4F91B 2GXQA 3I73A 3PEUA 2ECKA 3TVTA 4DRZA 3EZFA 1IN8A 2GZDA 1XP8A 2C96A 3CUEF 1CBUA 5J5CA 2AWOA 2O8EB 1XD9A 2D4HA 1ZVQA 3N2IA 3GQBA 4YC7A 5EZ5A 4CZ2A 4ACBA 5KSZA 1CF4A 1CJKC 2FG5A 3RS3A 3GLHE 4PC7A 2RMKA 3U44A 3I1FA 1W4BA 1UKVY 3MWLA 4IW3B 2W6IA 3IPYA 3AP1A 4BEBA 1E79A 1ZU5A 2QU8A 3H86A 2ZJZA 3BH6A 4KSCA 5J4KA 3GLIE 1HT2E 5FFMA 5C2JB 4UJ3A 3MG9A 4KVAA 3LVRE 4EQ6B 1VMAA 3M4YA 4DB4A 5CLQA 4ARZA 2HF8A 2YWHA 2CJWB 2GEUA 4AK9A 3I8SA 1SVWA 3SHWA 1N5LA 1G291 4B3FX 1NKSA 4MGYR 1HY3A 4XVRA 4RZ3A 5A5GA 2GJ9A 4Q4JB 3GEHA 1DAEA 3TH5A 5H8WA 1U0JA 1FQKA 1T8UA 3KKNA 3QXJA 4JLPA 2O8DA 1M2OB 4PPQA 3N2EA 2BIFA 1C9KA 2EFGA 2PCJA 3FDIA 4MRVA 2QN6A 4NCNA 1WP9A 2VQSA 3ZYCA 1NN1A 1ZNZA 4CEIA 1H8EA 4HLQB 2XZLA 2F1HA 1Q3HA 3QKTA 4C2UA 5KNCA 1OH6A 3T1OA 1R0WA 4OI2A 2OZEA 4E5UA 3R9IA 3NDBB 3CBQA 2B7BA 2YOFA 1KK2A 4MRSA 2YWEA 4Z8YA 5FI1B 3TSWA 1RJ9A 3X1XA 3V4FA 2WKPA 2EYQA 1GL7A 4EJSA 1NN5A 3BD9A 1XXHE 4Q1AA 4YXWA 3X1YA 3EPLA 1RRGA 4URUR 2VHQA 1KNXA 1R8QA 4I81A 2C9YA 2G1KA 4ASUA 1Z63A 2WHXA 3IDQA 2J3EA 2NZ8A 3FB4A 3CR8A 2NO7A 1TMKA 3RSLA 3CRW1 3EA5A 4JYBA 4D25A 3AP3A 1OKKD 2IEYA 4XWKA 2ZRDA 4Y0AA 1UEJA 2VP0A 2NQ2C 5FTKA 1CJMA 2IBMA 3T1VA 4G5OA 2RGNA 3VR2A 5DSZA 4FN5A 5C4MA 4BLOA 2V6JA 3WBJA 4LK2A 1FX0A 3B78A 3B7GA 2F6RA 3OZXA 4X8MA 2NMVA 4N3NA 2GA8A 1GL6A 2WOOA 2OCBA 3WHLA 1MO6A 1T91A 5C46F 4DCTA 4Q66C 3IPXA 2IYZA 3B1WA 1G16A 1UADA 1Z08A 5L8VA 5AJZA 1N2CE 1NLFA 2NPIA 2FWRA 2GCPA 5HE9A 3CH4B 4BFTA 2QAGC 4MYHA 4BFZA 1MABB 4PPNA 2W2TA 1P6XA 4WOPA 4BEJA 1SQ5A 3BXZA 5TDHA 3K9HA 2WSMA 3HU3A 3A4NA 3JZMA 2PX0A 5EXTA 2BMFA 3W5JA 3GJ7A 5JHHB 2GHIA 3ZH9B 4IOKA 3K0SA 4D4LA 2R65A 3DPUA 2MMCA 2UZIR 5FPSA 3EX7C 3VR5A 2O8FA 2ZJAA 3QPWA 2C9OA 3CPHA 4LJ7A 4RZUA 1OLOA 4RKEA 1W47A 3IKJA 1SVSA 5C1BA 4B32A 1R0XA 1FOEB 1GL9B 2R6DA 3QVUA 4GBMA 5DYGA 3RS7A 4OYHA 2GKSA 3AF3A 4C0AC 5EJEA 2OFWA 2VO1A 4LHYA 1XBTA 1E69A 3CWQA 3KKOA 2OILA 2EFCB 4US1R 5HR5A 1DS6A 2JLYA 121PA 1Q0UA 1XFAA 1JPNA 2A5GA 2I1QA 2AR7A 5FBLB 1DOAA 2CCGA 2KI5A 4TL9A 3OIUA 1CLUA 5L3SA 1L4UA 3PUYA 4DDWA 4JLBA 1W0KD 3DOFA 4OHZA 4Q9IA 1S1MA 2I3BA 3ONWA 3UANA 1FNMA 5C4GB 2JJ1A 4IXMA 2BV3A 3QF4A 4V0KA 3QKRA 4Q7KA 2QZ4A 1QVRA 1ZU4A 2Z4RA 1X1RA 5CK5A 1NIPA 4ZIRB 1OFTA 2WWYA 2VSOA 1ZJ6A 4PHGA 4LCBA 1XB2A 1NBMA 3AVOA 4HI0E 4BLQA 2ZREA 2VPPA 3LXRA 5KTYA 1ZMXA 3ZJYA 2ANCA 2D3WA 4QHTA 4DJTA 1Y3AA 3KJGA 3GJ0A 5FTLA 2N46A 2HUPA 1CRPA 2ZRLA 2IS6A 2ZTSA 3K09C 4NDZA 5FL7D 1WB9A 5DHAA 2RGBA 2ZRMA 1J8MF 1GILA 1VG1A 4YDSA 2UVQA 1KYIA 4DLTA 5F98A 3IQWA 5JFGA 4LGMA 2WSSA 3EZ7A 1HEIA 1OT3A 3RWMB 1OIWA 5KU1A 1JQJC 3RAPR 3GP8A 2AFIE 4YMUA 4C0HA 1FZQA 3AQ4A 3QIAA 4KODA 4NTZA 3MRSA 4GOJA 5SZJA 4I1SA 3B82A 2W6ID 2KJQA 2J0UB 1P2TA 3AUXA 4PPFA 4W5HA 1E79D 1Q1ZA 5DIFA 3ZZ0A 1CR2A 4JKIA 1FL9A 2HDNB 4P31A 1FP6A 4B2PA 1EXMA 4C0SA 4LBWA 1BKDR 1G21E 3MLEA 5JBQA 3MWYW 4A2QA 1L7VC 3DM9B 4C0LA 1E1RA 4MRNA 3RS2A 1Q21A 4IEEA 1F5NA 3EARA 4YONB 4DZZA 1KJWA 2QSZA 1YZLA 5AR1A 4Q9HA 1DAIA 2V54A 2CCKA 1IN5A 2GJKA 5JJIA 4HYYA 2JEOA 4P4SA 2FFQA 1AKEA 5FOVA 1UKZA 3UXMA 1W2GA 2DFTA 1U90A 5HCNA 2UKDA 5E7JA 2CL6X 5CM9C 3SE0A 4JIMA 2XEXA 4KYUA 4U5XA 4DBLC 5CJ2A 2Y8EA 4WVFA 1S9HA 3TBKA 2NOAA 2VIIA 1XTKA 1R0YA 2XGJA 2BBOA 1G5PA 2OFXA 1H8ED 2ZUCA 3IIKA 3UMFA 1VKJA 3CKLA 1XMSA 2E1RA 2MSCB 3IBGA 1ZUIA 3K53A 4KHZA 3L43A 4TZ6A 5DNYB 3AVPA 4W7SA 4FW9A 1IXRC 1YR6A 3K0EA 3E1SA 1MH1A 2WWWA 2AHOA 1M7HA 1A5TA 2F9LA 4WZBE 3K0AB 2ZI7A 4TL6A 1OE0A 3AF0A 2CHGA 1XCMA 1D2NA 2PZGA 2CMKA 2J1LA 3KKPA 3AEZA 4HATA 1NSFA 2ZXUA 4CEHA 3WHKA 2OCAA 4ASUD 2XJ4A 1I4DD 4Q1EA 4JT2A 4Q4LA 1NY5A 2J0SA 2ZSDA 2OBNA 5CB8A 5EP4A 2NPFA 2F43A 4GMXA 1OIVA 4FWTA 1T6NA 2IT1A 2E9SA 4TL8A 4UXIA 2PMKA 1GM5A 1JQLB 4HDQB 5FR1A 3ADKA 1WE2A 1CKEA 1FMLA 2HEIA 3U6BA 2BWJA 1F2TA 2VA8A 3AGPA 3QBTA 4LJ6A 1CRQA 5L3RA 2O8BA 4HB3A 2CDNA 1CJUC 4C7OA 2HCBA 2IYVA 3NWJA 2GJSA 4F93B 1VTKA 4XH9B 1KO7A 1ODFA 4UNSA 1S3GA 1XDBA 1IN6A 5IHPA 4A92A 4XSHA 1AM4D 4HB2A 1RRPA 5DO9A 3B5JA 2ZE5A 2XNSA 5EZ6B 1S4QA 1MO5A 1GITA 4EKDA 2ATVA 3U60B 4IDQA 3NDPA 3QXHA 4IXNA 3K70B 1X86B 1XNJA 4QBHA 2BMJA 3P1JA 2V8OA 4DKXA 2OLJA 1NVVQ 2FGJA 2WV9A 1V43A 3HWSA 4OBEA 4OL0A 4FMDF 4L15A 2IUSA 1XWIA 2EWVA 2V7QA 2J45A 2A9KA 3ZZTA 3DKPA 1YRBA 2F1JA 2GZHA 5FH9A 3THXB 1NVWQ 3ZS8A 2FJUA 2ZSAA 1GAJA 1M7BA 4URYR 1XMJA 2MSDB 1KMHA 4OQXA 3THWB 2EW1A 1P9NA 3WNDA 4DLZA 2FFAA 4XTRA 1NVVR 3A1SA 3W8RA 4G3XA 1KSHA 1KKLA 4Q1BA 5FPTA 4PXAA 1XX6A 1HT1E 4U7DA 4RZ2A 4LJ5A 1U81A 2QNRA 3L82B 3LX5A 1Q1QA 4W5JA 1CR4A 4HAVA 1HE1C 4JJZA 3O8CA 4QM6A 3D8BA 2QG6A 1OIXA 2AWNA 1DTSA 2GRJA 3U3KA 2DR3A 2W58A 3KX2A 1TU3A 2JJ1D 3T5DA 4NU0A 1TAGA 1CJTC 3U4QA 4LYJA 4Z8XA 421PA 4F4CA 2P2LA 2AD5A 4EPWA 3UMRA 1SKQA 2WWXA 1KY3A 1S3SA 3LX8A 4YMWA 1P7CA 3AF2A 1NMYA 2R6FA 1KHTA 1G8HA 4FMDB 2ZRAA 3Q5EA 1DADA 5G3ZA 5KSPA 5JS8A 1NBMD 4JVNA 1CJVC 4FCWA 2IEZA 721PA 1WBBA 1ZM3A 3KJEA 1P60A 3BRWD 2EFEB 1UBFA 4A4DA 4MH0R 1K5DA 1QRAA 2WJVA 4G5RA 5DGXA 1XTRA 2O8CB 3U3OA 1R0ZA 5JI2E 1SHKA 3LBIA 2YVUA 2W0MA 2QRZA 2XTNA 4LI0A 2XZOA 4O2LA 3TGPA 1TQ6A 2JLWA 2VHJA 4B2LA 3KQHA 4Q19A 1GNQA 4C3ZA 2YINC 1G7RA 5LDDC 4MRPA 1KGDA 2WSSD 3VU9A 1G64A 2PJZA 4DT1A 4EJSC 3RSOA 2HXYA 3REFA 4MQBA 2GCOB 2NO1A 1PUIA 4ZDWA 5EP2A 1QHNA 4NCIA 5GADl 4TSFA 3LO5A 3WRXC 1NBME 2CEAA 3OIWA 1ZW6A 1RC8A 1XD2B 2JLZA 4PC6A 4YMSA 1KAGA 1SZPA 2CNWA 1JXOA 2BJVA 5JI3E 1J90A 3ZVRA 1SVOA 3U5ZB 1T5LA 3KXLA 1KI6A 3L0PA 2VP4A 3NTUA 4D0LB 2X2FA 4UJ5A 3U7EB 2C8VA 4XWAA 3LXXA 2XXAB 5KNDA 2QSYA 1T5IA 1E1RD 2OSBA 3VNUA 2GCNA 3Q9LA 3C8UA 4TYWA 4RFSA 4GFDA 5JEEA 4PAOA 4TQ9A 1N5JA 4V02A 2KB0A 2BMEA 4RD6A 2JJ8A 1ZD9A 2JLXA 4HLDA 2BEKA 3L0SA 1UBGA 3PFIA 2PLRA 3BH0A 5DN6A 4KXFB 1K6MA 3P26A 3Q3JB 1VCMA 4B33A 3K70C 4GL2A 3OIYA 4XVUA 1EWQA 1ZCBA 1U9IA 5D3MA 2DHRA 1M34E 2V55B 4B48A 3FMPB 3SBDA 1E9EA 1WDTA 2FU5C 1VIYA 2C2HA 1VPLA 1YVDA 3ADDA 2REOA 2QRNA 4C4PA 1L8QA 2BVNA 1E32A 4POAA 3AVVA 5LD2B 2ZUDA 1RE0A 4M1YA 4OHWA 1VHLA 5FBQB 5GJWC 1Q22A 2BBTA 2BMDA 3SJBA 1QHGA 4D2IA 1U98A 1R2QA 3G0HA 1G9XA 4R2IA 2P6RA 3TUJC 3AP2A 4BASA 4L8GA 4AG6A 4JLKA 4R98A 2RAPA 3ZIAA 4M22A 3ASYA 5JMTA 1KO5A 1E0JA 1U8YA 5IK2A 2X2EA 1RYHA 2DBYA 2OCPA 1PLJA 4HUQB 2IYTA 1Q57A 1X8LA 4M9SA 2VBCA 2VRWA 3GEEA 1TTTA 4D4KA 4QKQA 2V1UA 5BYKA 2ZI3A 4KU4A 1G8FA 1RFLA 2ZIAA 4LPKA 2R6AA 2EFDB 1UKEA 1OB2A 2ZE7A 4ACAA 4G5QA 1XEXA 2H5EA 2NO9A 2RKOA 3BK7A 4HZUA 4LC1A 5DI3B 3ZVLA 4QHYA 3THYB 4CEJB 5BXQC 2ZQ5A 2XOKA 2IL1A 1KDOA 4D80A 3CO5A 1AS2A 2FV8A 4EPVA 3KDSE 1TU4A 1US8A 2GETA 4Q9JA 2P3SA 4Q00A 4Z54A 4WIAA 2QUZA 2V7QD 3AM1A 4BFSA 3KJIA 3R7WB 1HYQA 2HT1A 4QL3A 1E2JA 1BMFA 1DPFA 5M04A 3CF0A 4HZIA 2ZR7A 1KDTA 3NHBA 2FFBA 2YV5A 3IO5A 4JJKA 4IOLA 1GFIA 4R71A 2FPKA 1P2SA 1COWA 1KZGB 4QG7A 1JJ7A 1U94A 4RD3A 1OXVA 1T9HA 5GJVC 2WWHA 3SQWA 2LWIA 3B2EA 4F4IA 1E9BA 1UM8A 4W5WA 4A8JB 3EIQA 5CK4A 5EXPA 2H18A 2NZJA 4UQOA 3MD0A 3GLFB 4XSGA 4C2TA 3R9XA 2R62A 4IFEA 3TQCA 4A2WA 4OK5A 1L2TA 2YC2C 1E2QA 2GK7A 2CE7A 4G1UC 4A1FA 2V4ZA 3CR7A 1YZGA 4KYIB 3A37A 1E9SA 3PENA 2R6CA 2VP6A 3MFYA 2A5FA 3QI2A 5FBWB 1QHXA 3T1QA 1W44A 2FFHA 3AUYA 3DKVA 4ZKEA 3HU2A 2GAAA 2O0HA 2QTFA 5KO2A 3OFND 3QENA 4IRUB 1QHYA 2BOVA 1MRSA 5H70A 1KTVA 1Z3IX 4NP6A 1WCV1 2RGAA 2Q3HA 5FOTA 3ETLA 3SR0A 1YJ5A 3TQFA 4Q03A 1E2FA 4TMTA 1II8B 3AB3A 5E4FA 4BECA 2XITA 3DDCA 5EE5B 2OAQ1 3FMIA 4TYNA 2ZJ8A 1XJ0A 3NBXX 3P4YA 4PSVA 4JBYA 5FPKA 3FHOA 2FX3A 2KSQA 1WBDA 2F3TA 3CPEA 1AGRA 3AV0B 4PQFA 1G7TA 5LD2C 1E1QA 2VP2A 5FUVA 3EC1A 2G1JA 3GLHB 4S35A 1I4LD 2GF9A 2ORVA 4TSFD 2QAGB 4U00A 3EZ6A 4G5SA 3CW2A 2RGDA 3H2YA 4QNRA 4TMXA 5LPNA 2IYWA 1UFQA 3CRVA 4JLOA 3VQTA 1R5BA 2CNWD 4Z51A 1OXSC 4PO8A 5EE3A 2CLDX 1N5IA 2ZS9A 4KI0A 3GLIB 4UNPA 3IGFA 3PUWA 3PUZA 5AUQA 3I3SR 3VMFA 1H65A 5DYIA 3WBKA 2ONKA 3WRYC 2BKUA 2P67A 3C15C 3EIHA 1T3HA 3P27A 1E2PA 1CEEA 2XAUA 1N6KA 2X1VA 2IF0A 5K8UA 3RANA 5J4VA 4B47A 2ZR0A 3CX7A 1N25A 2IYYA 3CZPA 3S1AB 1LV7A 3FE2A 2XX3A 2EWWA 4BZQA 5DN6D 2OLKA 4HAZA 5CITA 3SQXA 4LV8B 4M1MA 1A82A 2H57A 1JBKA 3IIJA 4PAQA 1HUQA 4TTRA 3PEYA 2PLFA 1Z2AA 4BQSA 3EPJA 3KUCA 3C7KA 3OE7A 4JLNA 3R9WA 1KJYA 2BCJQ 5GVSA 4DLVA 4TLEA 4KITB 1G41A 1G19A 3MWJA 1VYVA 3I61A 2HLDA 4PZZA 5EUMA 1XXHB 1K8RA 3T15A 4A0GA 4BLSA 2ZI6A 3V00A 5FBRB 1EK0A 1R4AA 4MUAA 1FP7A 2VHTA 3ZIAD 4A8JC 1OH5A 4JLAA 1ZD8A 5IK2D 2Z0MA 3ZD6A 5P21A 1R10A 4MKFA 3M1IA 1MRNA 5BN5A 1ELOA 1WXQA 1UDWA 1TF7A 1NN3A 3CX6A 5L3QA 2QP9X 1XTQA 5LB4A 3O47A 3MJRA 4DEYA 1G4AE 4B76A 1G4UR 4MDFA 4RSGA 1Z6YA 3FFBA 2TMKA 3GJ5A 4E09A 1KSFX 4TMVA 3QG5A 1EFHA 1YQTA 1M74A 1D9XA 5BWMA 3KTAA 2YJTD 2IYRA 1EGAA 3EXAA 4DLRA 2XOKD 1KIMA 5TARA 3MWKA 4IVRA 5B58C 4M2LA 1HE8B 1A4RA 4QBIA 1ZP6A 4LHZA 4Q7MB 4Q18A 4AYXA 3CH5A 4DCNA 3G82C 4E03A 5A4JA 5AWFC 4FMCB 4L5BA 3QKSB 2ZRIA 1WMSA 2QI9C 5BN4A 1SVIA 3FHTA 1N6NA 3HP1A 3E2IA 1Y63A 3LBHA 4MRRA 5E3HA 1R5NA 1BMFD 2FSFA 1QG2A 3VR6A 2FEMA 3HYTA 4IVPA 3WNCA 3Q5DA 2IA5A 4F7WA 1OW3B 2ERYA 4ZDJA 4GNKA 3H1TA 1OV4A 1XEWY 3GPLA 5JRZA 4DIDA 1COWD 2KE5A 2FOLA 1BIFA 3U6KA 3KZ1E 4GPTA 4Q4AB 5FPYA 1F3OA 3CONA 4LBYA 3V4RA 4NMMA 3ZQ6A 4QJ4A 1S8FA 4YLGA 1XZPA 4BLTA 4L9SA 4RFVA 4WW0A 1A2BA 2HYIC 1OB5A 5CYOA 3FYHA 4PHTA 4JSTA 4LV5B 3T5GA 2IUUA 3WYGA 3VTKA 1E9AA 4WA7A 1LVGA 4IKEA 4JZKA 3BOSA 4BZPA 1E2GA 4M1KA 4A6XA 4CDGA 4K8OA 1IBRA 2OFOA 2JLVA 2ZVPX 1Z6XA 1LW7A 2B8WA 2BDTA 2SHKA 3NIBA 1P62B 1HTWA 2FA9A 3QQ5A 3TLXA 1OYWA 4OHVA 1F2UA 2YNMA 4G01B 1TQDA 2PZEA 5AJWA 1IJFA 4BZXA 2QPAA 1AZTA 2ZYTX 4DLXA 2FPLA 1VDZA 2OEPA 2FF7A 1U9IC 2HXSA 2ZYUX 4JL8A 4PHFA 4A15A 3MJHA 3C14C 2B21A 1LY1A 1ANKA 1SXJA 5F3WB 1XCPA 4YMVA 3RRMA 1E1QD 4D4JA 4JVSB 3UK6A 2J0VA 4FMBB 1E4YA 2AX4A 2WVJA 1ZC3A 4TMZA 5F9FA 2XNDA 2H7VA 4MYUA 3NH9A 3IEUA 1G17A 4TLDA 3FVQA 3DVLA 2D2EA 4PPGA 3C16C 2Z43A 3UG7A 3UIEA 3I4LA 2IWHA 2Q9BA 4LWZA 1JB1A 1E2LA 3QEJA 1ZNYA 2EFHB 2H92A 3DZ8A 4I99A 3CNOA 3AVXA 1GNRA 1RRFA 4MKIA 4Q4HB 4XOIA 1Z28A 4FINA 2OBMA 2JDIA 4GZMA 5JHGB 1KO8A 2RGEA 2GILA 1QG4A 3D7MA 3W34A 3SYLA 3KXIA 3NHAA 4NCJA 3W8NA 2QAJA 1OXUA 3FGNA 4TTPA 4AIIA 5CYPA 2C9CA 1YKSA 3EA0A 3LBNA 2IS4A 1E0AA 3U44B 3X1DA 2LKDA 3ICQB 1DAMA 1FPMA 2PT7A 3W6PA 3ZLJA 5AJVB 2P5SA 5BQ5A 1YZKA 4IDOA 2GAOA 1AGPA 2J5XA 4Q1DA 3OEEA 2WJJA 2VEDA 4K81B 4NPHA 1UBEA 5FOSA 2QBYA 2QL6A 2GBLC 4OJKA 1U8AA 4X8HA 4OI0A 3C5HA 3OE7D 4LY6A 1GDDA 4GRAA 3UWKA 4Q5IA 2IW3A 2QQ0A 1W1WA 4ARZB 4GI7A 4AYWA 1OYYA 2PEYA 1XJCA 2AK3A 1VYUA 4M8NE 2Q6TA 2HLDD 2XTMA 1CIPA 4LYHA 3FMOB 4B71A 1CR0A 1G7CA 5FL3A 4O2RA 3R8CA 4MYTA 2IX3A 3QXXA 2ODBA 3SI7A 4ZV4A 2J9RA 2AL7A 4A82A 4DCVA 2R8RA 4P4TA 2CLCX 3TJZA 3MAAC 4QRHA 2O8DB 5CM8B 3PQCA 3WMEA 1VCNA 4CGZA 4CEIB 5HZHA 1I4TD 4KV9A 1DAHA 1W4CA 2GVZC 2GTPA 3KKQA 2D62A 1TF5A 3R8FA 3GJ6A 4ILEA 5HKKA 4A0FA 4TQUS 2H16A 3OESA 4PR0A 5LB2A 5EXSA 1RJ9B 3W90A 2EYUA 2QE7D 2W6JA 3A1VA 4KFTA 4EJSB 3PUXA 5G41A 1JR6A 4JLDA 3DMNA 3LA6A 1VG8A 3Q85A 4PZYA 5JWOA 5KDLA 2J46A 4OJQA 1GKUB 2A2ZA 2WAYA 5SZKB 1NIJA 3DOEA 3K1JA 5DLQC 3C41J 2R44A 1RKBA 3MCAA 1VCIA 1ZUHA 4JVMA 1TADA 2WIBA 1G6OA 2NO6A 4CF7A 3I62A 3JVVA 3EWSA 4NCHA 3IIMA 4R2HA 4UNQA 1KSGA 4XJXA 4H9GA 4GP7A 2WBLC 4BFXA 3TMKA 3M6AA 5G53C 4ZCLA 1KSJA 1XPOA 1E2MA 1S96A 1FX0B 1Z83A 3IUYA 5JWRA 3QF7A 4URZR 2BBWA 2ZVQX 1P75A 1WA5A 4OI1A 2ZJ2A 2MMGA 1KJZA 1JAIA 1N6RA 1A1VA 4M21A 3TW4A 1T8TA 1XTJA 3FMFA 4I1OA 3T34A 1Z07A 2XZPA 3GLGA 1E2DA 1Q1EA 4LHWA 5UKDA 2NIPA 4HEJA 2ZR9A 1E2NA 5JWHA 4IOMA 1AA9A 1N3BA 2PEZA 1CXZA 2HF9A 2A78A 1HA3A 2OCYC 2YWFA 4GSYA 4QFMA 5DI9A 4FXPA 5JSZA 1A7JA 1AK2A 3KUDA 1XPUA 4M9QA 4M0LA 3CNLA 4MKHA 3VX3A 2IS2A 2W2XA 1Q1BA 4DLSA 2OXRA 1TNDA 3GJ4A 4N0EA 1ESMA 4TLAA 3LQQA 1S9DA 4WZAE 3TSZA 4NKRA 4Q02A 2XJ9A 1ZINA 3MMPA 2WJGA 3LFUA 1NY6A 5G40A 3RRNA 4Q21A 4EDHA 2ZUBA 3CWZA 2R2AA 3PCRB 3W9YA 6Q21A 4JSYA 5GJBA 2VTKA 3BJIC 1T3LA 3O8RA 4Y0VA 4RCYA 1Z2CA 1TF2A 4PX9A 5L3SB 3K0CA 4YMTA 1DG3A 4B75A 3ZD7A 1ZNXA 2WJIA 3LLUA 4JL6A 1DG1G 3QF4B 3QKRB 3I8XA 2QP3A 1G8PA 3ASZA 4WXPA 3RDPA 1SXJD 4LHVA 1KZ7B 2IYSA 1FUKA 3DHWC 5ELXA 4ZO4A 1W4RA 1XD8A 4PFSA 3U3RA 4AYTA 4ZI2A 2Z6VA 4KSBA 4MGKR 4CRWB 3OFNA 1AS3A 4JYCA 4GDFA 2XNDD 1QHHA 4BFUA 1P9WA 1XMIA 4BFYA 1Q44A 1TEXA 3HR8A 4B2IA 4TYQA 2ZI4A 4KFUA 1QBKC 1E99A 2ZRPA 1BS1A 1GNPA 1P61B 1Z0IA 3ADBA 3K0FB 3D6TB 1G3RA 4JT4A 4LHXA 3UATA 4DDUA 2GESA 4AY2A 5D3QA 2JDID 4Z1MA 3DMDA 4WBSA 3RC3A 2FMXA 4PHHA 2A3RA 4G5GA 1LFDB 1SXJE 4P4UA 3T12A 4DSNA 5K8LA 1OSNA 4GT1A 2PJRA 1ZM4A 1AN0A 3IHWA 4XTCS 1W5TA 3FKSA 4QBGB 1Z6TA 2C77A 2RGXA 1OXXK 2QT0A 3C5CA 4YDHB 4ERNA 5IRCD 3QPVA 3QSYA 4RJLA 3IEVA 4KAXA 1QHIA 4KBFA 1KDPA 1RYFA 1KDRA 1YZTA 4NHOA 4B6EA 1GWNA 1X1SA 3GCGA 5KDOA 1OH8A 3PJRA 1Z0DA 3PUVA 1NL3A 3OEED 2IXFA 4PO1A 4B3CA 4B3XA 2D06A 5BYJA 4RVCA 3SN6A 2RGNC 1G7SA 2J87A 3GFTA 4FD2A 3TUIC 5JECA 3AGQA 2Z4SA 2ZYVX 3B6EA 3AF4A 1R7RA 1R8SA 3QG1A 4P4SB 3B1VA 3OAAA 3AVUA 3VFDA 4I1UA 4QJ5A 3FFAA 5EXXA 1QZXA 3U3JA 2IYLD 2OT3B 3CF6R 3HPRA 1BYIA 3GEIA 2BJWA 1V5WA 5FPHA 4PAMA 4QC2A 5K8TA 1E96A 2JA1A 5DE3A 1SVLA 1ZD1A 3X1ZA 1U0HC 2FN4A 4AKHA 3VKWA 1FMJA 2H8KA 1IY2A 3B1ZA 2ZRKA 1KO1A 1S2MA 4L9WA 1E2IA 2FDCA 1GVNB 4D6PA 3LRPA 5HKKD 4C0JA 4PTLA 4BLRA 4XD7A 4BFVA 1U0LA 2ZJBA 2ZAOA 1II0A 4F38A 3FWYA 4Q7JB 5TVKA 3RLFA 2CCJA 4NONA 2W6JD 4GOKA 4AKGA 3LLMA 3W5IA 1QF9A 3EWAA 4CEHB 3OHMA 2GVDC 4TZ0A 5DH9A 4BGDA 1TL7C 4EQ6A 1ZNWA 3Q7PA 1P72A 1W36D 5C18A 3EPKA 2F43B 2F1IA 5KDDA 4MUBA 1EESA 2QTHA 1TQ4A 2O0KA 2CJWA 3WMFA 4DSUA 5J4YA 1Z6AA 1P4SA 3U61B 1F2TB 2VP9A 1VYTA 3WNBA 4BLPA 2QP4A 1ZIOA 2QY9A 3KB2A 3B8HA 3B9PA 1GUAA 2O8BB 1FQJA 2A7QA 2IHYA 4C7OB 4Q4JA 5ANRB 3SZRA 3THOA 3KQLA 3BWDD 2IXEA 4EFLA 4B34A 1TUEA 2FSIA 5B57C 4DXAA 4F92B 4KCGA 5DHFA 2VL7A 2AKAB 2NO0A 3ZVMA 821PA 1Z0JA 4EFNA 2C04A 2REXB 3QOFA 1DE0A 4DSOA 3BFKA 1BYUA 3BFXA 1UF9A 1JEDA 3I5XA 2FNAA 4DLUA 1OHHA 1VG0B 3UPUA 4ESVA 4QNMA 4NL4H 2ZSEA 2P65A 4MGIR 4UNNA 3KJHA 1KOFA 1XTIA 4V0LA 3SS8A 1G20E 3MSXA 4D4MA 3WXMA 2IHBA 4II7A 4HB0A 1KK0A 4LJ9A 1DO0A
chains in the Genus database with same CATH superfamily
1XL0A 3FTPA 4HD8A 3OOYA 2Z57A 3U26A 3BWVA 2W6MA 4HG2A 3AEYA 3VR3A 1MHTA 3VHLB 1K2WA 4A91A 2LR0A 3KQNA 4K46A 4L07A 2FX5A 1PNOA 2IHVA 1I4OA 1YJCA 1EX7A 3QJYA 1LPPA 1ZC4A 5A5VA 5IAJA 4JYAB 1SOAA 3C3JA 3EGXA 4A2PA 2YOHA 4LMRA 5HWSA 1OAAA 3VZPA 1KVRA 4N8DA 3FCYA 4MVJF 1R66A 1TCCA 4KXUA 4S0ZA 2F8SA 3RYIA 4BX0A 1JHPA 4LNAA 5A6SA 1BRMA 1T0BA 2ZYDA 4M53A 2FW0A 1D2CA 2B1QA 3M81A 4LV6A 1X70A 1QUEA 3QBVA 3ROMA 2DKFA 3L7NA 2W83A 3AONB 5B4UA 5HYVA 3CA8A 5CX1B 1NM5A 3BGDA 2PVPA 3DCIA 1A8QA 3KIPA 4EG3A 3HLYA 2N3ZA 3AY0A 3BXFA 3OF5A 3QZUA 1MNQA 4P4NA 3LC2O 3TVDA 3HR7A 1J2JA 4Y2SA 4IVNA 1RW4A 4YAJA 5D5HA 1PQ4A 1Q92A 1U5AA 1V4VA 3KJNA 4PRLA 5CW1A 4YP7A 3SSOA 3OPNA 4M9ZA 3N0TA 1Z4MA 2M6LA 1W5FA 2DT5A 4LQ4A 5H7XA 2GA9A 5HRUA 1PN3A 1SU7A 4NMLA 1IHDA 1KI7A 3BZBA 5L6LB 1RYDA 1U28C 1PR4A 2WG2A 3HU5A 4ZOLA 3UYLA 3I2FA 4M54A 2HSEA 3ZW9A 2EZUA 3TG2A 3MJFA 1YVUA 4ZZ3A 2QTTA 3TM5A 1E1DA 2G88A 4HS4A 5A4IS 3D4BA 4WHMA 3SFVA 2ZYIA 1OZGA 1M3SA 1F5SA 5I7RA 2FP3A 4XR9A 3WIDA 3L1IA 2K6GA 1E66A 1NG1A 3FKSD 1J49A 2G0TA 5C31A 5T8KC 4EFMA 1RWXA 1SA0B 2LV8A 3AZOA 2BH9A 3H9UA 3NPAA 2XDYA 3RWBA 3MYYA 5C37A 1KI9A 5DRTA 4EA6A 3EIOA 3QLUA 5H81A 1W0JA 4NSNA 5BSUA 1RXVA 5C81A 3TL3A 4EPYA 4M0UA 3DHEA 1WF3A 3T52A 3MHPA 3MYRA 3ZUPA 3H84A 4DM7A 4YRSA 5T4FA 4OXYA 4H1WA 2REQB 5K0ZA 4TQGA 1XPRA 3Q0EA 4QXAA 1KI6B 3F49S 3CG4A 2X6TA 2RAFA 4X8LA 4ZIRA 3NP7A 2IEDA 3RS0A 4WFJA 4EJ0A 3LVFO 3K0BA 2HLPA 3BGWA 5ICSA 3BSFA 4MV7A 4BNJA 5D6OA 4DIBA 2BISA 4RFSB 2XQIA 2O5RA 3SDZA 5CCEA 3OJLA 2E5FA 2NM0A 2QR5A 4MWTA 4FGJA 1SM4A 1MIHA 1QOZA 1YRAA 3C8DA 4BATA 5JZBA 2GGSA 4WUVA 2OESA 2P4UA 1A9PA 3FKQA 1D09A 1TJ4A 1U2EA 4PAWA 2RGGA 3WLNA 4RF2A 5FNZA 1QH1A 2MSEB 2V7TA 2UZ1A 2EC5A 4XM0A 5TV2A 3ZXUB 4XIJA 2JL1A 4IR7A 1LSOA 2FPMA 3TRHA 3LUPA 4BVGA 3N3BC 4UKDA 2GN8A 3TLZA 2FN9A 4BP9A 1TK2A 3E48A 4G0NA 4ZMSA 4BRUA 4RO0A 4XIGS 4ZQCB 3G2HA 3OU7A 3FI0A 3SBEA 2XGMA 1WRBA 3NRJA 4H6VA 2HAEA 2PX5A 3KTFA 4OB7A 3TGWA 4A9AA 4X3CA 4W9NC 5HBGA 4G1FA 5THKA 5C52B 4JODA 3TLEA 2Z3ZA 1W4LA 2B83A 1HYHA 3L1HA 4HGOA 1NI3A 4JEUA 5J2UA 1PZFA 4MW7A 1UJ2A 1JIJA 4HY3A 1E9RA 3RCBA 3BB1A 5CX4A 3S68A 4CG3A 5J47A 3L4JA 3IP8A 3KYDB 1C3EA 1QDEA 3CN7A 3L2OB 1SH7A 4MUXA 4PSAA 3V4SA 1I2ZA 1J0AA 4AM8A 2XE7A 3PR2B 1K4KA 3E9CA 2QMHA 5E9JA 3INGA 5J4LA 2AI3A 1WDWB 2IKQA 3ONNA 4RTMA 2PXXA 3KD2A 4LIPD 4UU8A 2F8LA 2WABA 4OMUA 3WLKX 4H7DA 1Y8RB 3I6IA 2X1MA 2UVDA 5FHQA 1JDBC 3O8BA 3RPEA 3PEVA 1JH8A 1Z7YA 3BMNB 3PS9A 3CPSA 4IPTA 4L3VA 3ZY5A 1VIAA 4OEHA 2FE4A 4A0HA 3A3YA 3DEFA 3HDGA 1TKRA 4PIVA 2BEWA 4XWOA 2XKKA 2O2XA 2FE1A 1ATZA 2YWJA 5KB3A 3A9VA 4JKYA 1TJNA 2QE7A 4ZFNA 3WGZA 1XCGB 1JDUA 2GHQA 3ZGNA 1J2UA 1XEXB 4JLJA 4HKTA 2P9QA 4KQFA 1M0WA 4NEQA 1VA4A 3D3WA 3ZWBA 1QQAA 1JFVA 4OH7A 5A9RA 1ZJ5A 1HTBA 4GKAA 1J5XA 1JIVA 1N2ZA 4GNRA 1A3CA 4ZTBA 2P9CA 5DYYA 1Z0KA 2D1FA 5HJ7A 4LYEA 2J7PD 1XKLA 1A7AA 4JI4B 4W1SA 4RA6B 1L5ZA 1AQYA 1HMYA 2C5AA 3HJNA 1TPZA 5EP3A 4RX1A 1YR9A 2WIAA 1LDYA 1U2GA 2OL4A 3MGKA 4LY9A 1YC5A 2V7VA 5AUNB 3GAAA 4US2R 2PMEA 4IAOA 2R8BA 4BB0A 3EG5A 2Q3EA 1B3BA 4GMKA 4FLFA 4CM8A 4CM4A 5C7IO 3L0OA 3OTHA 2VPZA 3G0GA 1XR3A 2RGCA 4TT3D 3WJ1A 5SY9A 2IWRA 4P22A 4C7XA 2Q46A 5LJIA 5HUQA 3TKAA 3MBKA 3SEAA 4REMA 2J30A 1F4PA 4FBGA 1IOZA 3G8DA 4RYLA 4Y0NA 3R7NA 3ECCA 1P4JA 3H2JA 5TQ0A 3IP9A 4CBVA 2KYRA 1AV6A 4TTQA 4MHSA 2J0EA 3TWOA 3A1TA 4OK6A 5KTNA 1AU9A 4S0XA 3VRHA 2GNPA 3BBPA 4JJ8A 4F1WA 1GRRA 4UUOA 1IJEA 1TVEA 4DPMA 4YJFA 2YRXA 4AG5A 2Q27A 3WWZA 1A96A 3ZLUA 2PT5A 4ZRMA 3GPBA 5KHOC 3SHQA 4E4YA 5JOQA 1CUHA 3PP8A 3D59A 5I5GA 3WGGA 3D0QA 5C8YF 2VZEA 1GRQA 2J48A 4BXOB 1E2EA 1RAIA 1WF6A 3WGOA 3FHCB 1YR7A 2DCUA 4N5MA 1HH4A 4FLEA 1ZCAA 3BERA 4MR9A 4OHMA 3K35A 1J8YF 1C41A 1UZLA 1SQSA 1JJFA 2QPLA 5FO0A 5BURA 5CDTA 4NAHA 1HL3A 3Q9NA 4YHHB 1ES9A 1RPZA 3M4ZA 3PZRA 3RNOA 3HP4A 4O2AA 1EFRD 3ZDBA 2C5HA 1JXQA 5FFNA 2PRKA 1NE7A 1SD1A 4DM3A 3I5YA 2JLRA 2QHXA 6CHYA 1AVTA 1I1QB 2PZ8A 1DUIA 2QM7A 5KKAA 3S27A 1CSEE 1U99A 3EF0A 3SBOA 3ZGXA 1PUJA 4IINA 2E1PA 1Z62A 1XMVA 3ZR4B 2CMGA 4W5QA 4KLCA 4RQTA 2XWJI 3ZTWA 1WSWA 2DWCA 1UKYA 1O97D 1ONBA 3FTCA 4S2UA 621PA 1APBA 1YZVA 1HLFA 2BBSA 4AI6A 3HO8A 4U02A 1OI3A 4KN6A 2UZ3A 2I7CA 4GZLA 4Y2PA 2GNOA 2QMZA 2R1ZA 1T8SA 3F0TA 2E6UX 2ZB3A 5CVVA 3R0IA 1GPBA 4HH4A 3ICOA 3ZCVA 3CG0A 4UEWA 4B44A 4JB8A 4QBKA 4EK9A 4U9UA 5JEDA 1Z18A 3IMEA 2YIJA 2NYUA 3DM5A 4C7BA 1W76A 2D4AA 1VL1A 2RHRA 2EATA 2W0SA 3AL2A 3MN1A 1EA5A 3JAMA 2O2SA 3S5JA 4ED9A 2NU8B 1LK0A 1IQPA 2AN1A 2JF0A 2QGFA 2QGNA 5IJAA 5LXTB 3RV3A 4NX2A 1XQWA 4WN9B 4HQRA 5FA8A 4DOMA 4UTPA 4P9NA 3QWIA 4EM6A 4F4UA 1ZFNA 1EG7A 1DKNA 1TYDE 1X13A 2Q5JA 4GR4A 3D5QA 3IIEA 4RENA 2V6GA 1GA6A 4Z0PA 5BMOA 4LHSA 2OV8A 1Z47A 2DFNA 3IALA 4LX0A 2AG8A 2HPHA 1GRNA 5IJXA 2A86A 4QWWA 3H5OA 2FI1A 1LA2A 2WINI 3C6MA 3K0FA 1AKQA 2WAOA 3NJRA 4QGFA 5ADWA 3LS2A 3ZQKA 1IM2A 3RC8A 1OWPA 1ZISA 5E9WA 1R00A 5ALHA 2YUTA 3AYXB 1CUJA 5EP1A 2QDXA 3D2LA 3ZY4A 2L2QA 2SKDA 4PE5B 3EZ9A 2ZSUA 4HYTA 1PLLA 4XKJA 2WM3A 5U4QA 3SYKA 2F4VB 3TM4A 2YJGA 3DKKA 4YJHB 1QO0D 3COYA 1N0WA 3K0KA 3ZJUA 1H8HA 1K5HA 1R9GA 4OFXA 5KYGA 2A9VA 2HPAA 1IZYA 4HDCA 1YR8A 1XD2A 3FDFA 2YTZA 1QONA 1WDMA 3NWPA 3IT1A 2VHCA 3O4JA 1PTJA 4UU0A 4IG4A 2FSVA 1SUCA 3SY8A 5CCDA 4HLCA 1WW3A 1GPJA 3NGLA 1SWWA 3DMTC 2BGRA 5A0VA 4X7RA 3JV7A 1RKVA 4FIDA 1FUYB 2PD3A 4BGVA 3GHYA 2R8EA 3I09A 3DYIA 5K03A 5IT0A 3AV3A 1JR3D 3JWJA 5KBYA 3W5BA 2GXSA 4R41A 4UE6A 1OXTA 3H1BA 5C34B 1E4OA 1SJ9A 2YYSA 3JQ7B 4L4UA 1DNPA 1Z38A 3CE9A 3DTVA 3TQTA 3EQ9A 3WLTA 3TI9A 4ZODA 4JI6B 4L6CA 3VPDA 4US0R 3JS5A 4JC8A 4N4AA 1Z33A 4HBZA 2UU9B 1KYXA 3N9IA 1AUXA 4KGVA 1HNWB 5EXDA 1JWBB 2L42A 3NVDA 2QB5A 3V8NA 5EFOA 3RD5A 5K0GA 6PFKA 4E7PA 3P9CA 4NZZA 2B5OA 4G89A 1DRJA 3RKSA 3LY9A 4IQGA 4B7UA 2Q0HA 3CVOA 3ESRA 5GWXA 2TRSB 4YIKA 3JWEA 4A16A 2YFYA 4W4TA 1GU1A 1ZXBA 3OEHD 4WASA 1NJGA 4H7HA 4ROTA 4JJFA 5JD5A 2F8TA 5FFFA 4GICA 1Q14A 1JGTA 3N0VA 4P4LA 1E58A 3VGPA 2ZM5A 1VPTA 5LOVA 4KG7A 1BXKA 3KQKA 4KLZA 4P2GA 1FSGA 1T25A 4MB0A 1TUIA 5TF4A 3KQSA 3CRRA 3X3HA 1X7WA 2MWMA 5NLLA 2IZ7A 1GG2A 3FSEA 5JQGB 4Y2HA 4HTFA 1T9ZA 3H2GA 1YS2X 4ME6A 4AKEA 4NZOA 4YWJA 5GZ1A 4MAMA 4FFOA 2EJUA 2ZS8A 1SPXA 3A6PC 1SVMA 4DB2A 5FQOA 4M0DA 3UMJA 4ALJA 4IOJA 4KV7A 4ZO8A 1DAGA 4ZI5A 1QLWA 3ZGOA 3SXUA 2FHSA 4FR5A 4BO5A 3AETB 5FLEX 1UMBA 3AIKA 4CKWB 1MT0A 1SD5A 1BD4A 2DM6A 1Z4QA 3HB9A 4JD5A 3SKXA 3SYNA 4QJBA 3RW9A 4C14A 2I4NA 4HB4A 4P5PA 4Z7OB 4YROA 3FFWA 1PWEA 1GYPA 2QYHA 4ZOBA 3WRYA 1C9DB 1G18A 3GDWA 1K0FA 2R85A 3BG5A 4RZXA 2BAGA 4CETA 1KIFA 3ECAA 2QTMA 2PX8A 3WWYA 1E6MA 4QVGA 4MYDA 1VJTA 3O73A 2QRLA 4RA9A 2OFPA 4F4FA 3IAUA 3R0XA 1FDUA 4HGPA 4WNCA 3THYA 3LT2A 2O8FB 1I2MA 8ABPA 4CEJA 2J9XB 5IVPA 4IH1A 1ZGCA 3I1JA 5HF8A 3RJZA 4EHJA 3BX1A 1S8NA 2I4IA 1OBHA 3HCCA 1S8OA 4MS1A 5F9HA 1KEZA 2VNAA 3B48A 4GP6A 1R4NA 4Q4CA 1GJRA 4JOBA 3ED5A 1GKYA 1W52X 3IAM6 1G5RA 3QJGA 4RTLA 3J7AC 3NWBA 1L3IA 5LUBA 4KR7A 4MEJA 4DJEC 4W9RA 1VGRA 1A77A 2AFHE 3M6VA 1ISHA 1F2UB 4URWR 4UW9A 2VSQA 2ZAGA 2QM3A 3SNHA 1WQ1R 2Z30A 3MCVA 5ECWA 2H07A 3RUDA 2B8TA 2XR1A 4X63A 4RORA 5JS6A 2HLHA 1L7AA 4MX8A 2JZOA 3AOEA 1WQ4A 4AMGA 4EATA 4JOQA 3NOXA 4TYPA 4TVSA 2HNAA 3DZGA 4P7JA 1UBLS 1Y4DE 3ODGA 3WY9A 1AQUA 4GIBA 4UEJA 3UGKA 1Q7RA 1J9GA 2DLDA 3GLFA 1GNVA 2CVPA 2OP1A 2HNKA 1CUWA 4MWEA 4EF5A 3OKAA 4BO1A 3I72A 3TPFA 1JPUA 1VI5A 2CFIA 4YJGB 4KQ9A 1F8XA 3FIJA 2QM8A 2ZRHA 2HMYB 2Y67A 2MYNA 2EEZA 4QXQA 5KUTA 1HR0B 2PL5A 2AT1A 4GWGA 2JFHA 2BKVA 2YCBA 2P5TB 2ZIXA 1UBNA 2BR4A 3EXEA 1PR6A 5FOUA 3L8ZA 1RJEA 1BG6A 5AOVA 3T35A 4EO4A 2VTBB 4Z4FA 3HHPA 3F6SA 2IHZA 2HIAA 2X1LA 3QITA 4U5QA 2JLUA 3U7GA 1RZRD 3H2KA 2QYSA 5AD1A 4V03A 2HWWA 4E5KA 1WMFA 5JH7A 4EP1A 5DXAA 1P81A 2FPGB 3OMWA 4CMGA 5SYAA 3VO1A 2OXCA 2Z98A 1UZNA 3AI7A 2A5YB 2FSPA 1C14A 3RVQA 1WMEA 4K6KA 3NNSA 1ZXLA 4I36A 5HCIA 3AI3A 2B78A 5BWBA 2GK6A 2C3OA 3U3MA 5JRJA 1BOFA 1V8DA 4UUMA 5CA0B 1KK1A 3L8DA 1BFUA 4EW2A 1F48A 4OGWA 5CDFA 4GF5A 2C7VA 1DRVA 3TNFA 3GN2A 2VDKB 5JAMA 2WKQA 2VXBA 1V3QE 1DDIA 16PKA 3ESCA 2ONYA 2PV7A 3KK0A 2UZAA 3A6FA 3A36A 5ALOA 2NVBA 4R7TA 2CLOB 1CF2O 5ICFA 1M1YE 3D6NB 4MMYB 1AJEA 3IVMA 4RHTA 1ETUA 3H04A 3HM2A 3ID6C 4IO0A 5IEJA 2VF7A 2TMGA 4G26A 1SIWA 4YAUA 1JKXA 5K3SA 4DREA 2HRBA 1JALA 1U2GC 1Q16A 3BMCA 3GLHA 4N8EA 4TXHA 2AE2A 3SZMA 3PQDA 1QNFA 1D1SA 2QAGA 3D3QA 4HC4A 4F84A 4LYYA 4BMYA 3K15A 2XSZA 1VKZA 1BH2A 3UHFA 3AR4A 1ZLXA 4BWFB 2DOKA 4C7VA 2V7EA 1EWRA 2NSHA 3C87A 5EHIA 5HGJA 3QPDA 1TYEB 2C2OA 4ZYLA 1U2RA 1FRZA 1BJTA 5FLYA 4YAOA 4YDQA 3FLEA 4KB5A 5ICEA 1DEKA 1L7DA 2QPTA 3BD6A 5DMHA 2VJMB 1G1MA 2KHZA 4BP1A 1Q3TA 4O2BF 5J2TB 3UWSA 1OI4A 1ZIYA 3M3DA 5IX8A 2C78A 5JO0A 4O25A 4NMWA 1OBOA 4Q48A 5EJ8A 4LBVA 3PWSA 3TIFA 4EIWA 2IW1A 1HTTA 1U1DA 2OP0A 3SJAA 4N01A 4D0SA 3B52X 3U62A 4LVNA 1E4VA 1EK1A 3O4VA 2VSNA 3OIGA 4XWTA 4AMUA 2Y1XA 4ADSG 2PZMA 4RNDB 2B99A 3S1AA 2YWGA 3PD1A 4UM9D 4IM7A 3VHRA 1HPLA 1WSAA 5K0SA 1W96A 4DDVA 3NH6A 4QQFA 1FYVA 1E98A 3MWGA 4QHSA 1V11B 1PG2A 3MJCA 5B64A 5H4GA 5JZVA 2B0CA 2OHFA 3K9LA 3A6KA 3M9LA 3OU6A 3PIRA 4Q82A 5DMXA 1BAPA 1GPDG 5HTKA 3T7TA 5CEFA 5LP6A 3AXTA 2F48A 1GUDA 1WDKA 2JLCA 1RRKA 1Y7LA 1O96A 2VDWB 4HXFB 4PS0A 1NV9A 3X1MA 4B4UA 5TQ2B 4F6RB 5AVTA 1W36B 2DEUA 3HNOA 3ADCA 3IVRA 3UPDA 3MOIA 2WZBA 3RVBA 3TIXB 5JRDS 3F9CA 5JAQA 3BTUA 1N78A 3WGTA 2INGX 4I5DA 4XUEA 4KWHA 3LSTA 4TXNA 2QL9A 3HKBA 3PB3A 4IXDA 4LUCA 1Z2OX 2AOVA 3IQDB 4O0MA 5EHXA 1GZDA 1N9KA 3F9IA 4QTYA 2F3PA 4Y6OA 4JVLA 2WIKA 4DBZA 2OWEA 4ZCSA 1BTOA 4PO9A 5I9LA 3RJTA 4EKYA 2Z5FA 4Q3LA 1IXSB 1P17A 1UXIA 2CL7X 1FP2A 5ICGA 3GLGB 2QW1A 3IQFA 1YU9A 1KQPA 1L7XA 4KBGA 4O4LB 1ODJA 1ZITA 3LOPA 4LYFA 2PNJA 4CW7A 2RHMA 2DB3A 1J2YA 1MNAA 1HI9A 1CU1A 1AKYA 3F8TA 3UJ6A 5JSZB 2J9YB 3V9AA 2OBLA 3TK1A 1MR3F 1KXJA 3EE6A 1P3DA 1NT2A 4M0FA 4ZC1A 1KNQA 3EWNA 2OO5C 4OAOA 1M2GA 1P1KA 1EQAA 5EKTA 2IYUA 1EYZA 2CUNA 1EX6A 1JXMA 4RW0A 1Y9DA 3ABIA 1YB2A 3EDCA 2CDCA 3LY5A 4CR6A 3S8MA 2GEVA 1MN6A 3M3PA 3HSYA 3L8GA 1BDHA 4NV3A 2GCEA 4IIFA 2G0NA 1FRQA 1MEEA 4MVJG 4RHFA 3AKCA 4OX9Y 2P1RA 3QKSA 3WGNA 3KDAA 4ER6A 3N6XA 2H1LA 3H19A 1RRCA 2O9JA 2WVGA 3VI4B 4PZLA 4Z4GA 1PVOA 1VPDA 4RMIA 4Z0HO 1MHPA 3FPAA 3HVUA 2O8EA 4H1UA 1KZ4A 2DYKA 1CHDA 3OSUA 4F86A 5LQCA 1HDYA 1ND6A 3JQAB 2XE8A 1IHPA 2WHPB 2ODAA 3PQFA 4DLNA 4NH0A 3B5EA 3L4EA 4V0RA 4RTRA 2NP6A 3NC4A 3TSCA 4WKOA 2FPXA 3BTOA 2Q9CA 3HDTA 2IU6A 4MR7A 3F3YA 2FN7A 1OBFO 2A4KA 3AESB 3PVSA 2L17A 2OAP1 2ZGVA 4YWHA 3ZGVA 1KARA 5CFRA 3DPSA 2V45A 1VMEA 1KS2A 4MS3A 4LZLA 3K96A 1SCNE 1UL1X 3GD7A 1QHHB 4EGJA 3F78A 1V1MB 2EBUA 5E2IA 1EE9A 1U0BB 2FP4A 3V80A 1TCAA 4CFYA 4F46A 1U0EA 4D4HA 3SM9A 2XCQA 3JPWA 1PFWA 3A2MA 4FKBA 5ADVA 3HSKA 3VR4H 3GJ8A 2GEDA 3N70A 4MVXA 3TZHA 1Z4LA 5E2AA 2FZ4A 1CVRA 1AUOA 3R20A 3KVOA 4OKSA 5H3LA 2FMHA 4PZ9A 3NKVA 3O1JC 3D7KA 5C9ZA 3IL2A 1D4ZA 4QM7A 2XMGA 2SBTA 4K8RB 3X2SA 1VE3A 1PBNA 3Q2KA 4HAXA 5I8WA 3PITA 4NLLA 3ZV4A 4RD1A 3NCHA 1TQ2A 3HV0A 5I9NA 4BJ1A 2IZ6A 1MGOA 1V47A 1JHVA 5F5XA 3EB9A 2P69A 5KYVA 1QJCA 2ZBPA 1UH5A 4YB8A 2ORED 3L7CA 1QIHA 3E8XA 4YRGA 1UWLA 2WJYA 2ZRJA 3QLEA 1QQ5A 2DPXA 1FFHA 1SC4A 2ZJOA 4DC9A 4Y9TA 2X15A 1EWTA 5B37A 4PO3X 1JNXX 4JI7B 5HPYB 4RANA 2R6GA 5BY2A 3L6BA 1X3LA 2HBYA 4ZCMA 1EGHA 1Z0FA 1Z4PX 3QX7A 4FZ5A 4Y1RA 3ZHVA 3ZCQA 3F6RA 3QVVA 2CC2A 2H1WA 4MVJD 4I50A 4UCWA 4ENVA 1OJ7A 2JFQA 1Z82A 4EPXA 4M1SA 4K05A 3MM4A 3E7WA 4M1TA 2NU7B 4KDCA 4QX6A 3L4BA 4Y2JA 1L1RA 3KT0A 4BGIA 1TOAA 3OH8A 5TB5A 2WA1A 1KYVA 3KYJB 1N9ZA 3L8EA 2RGRA 2FPUA 1TCVA 4QDUA 3T5PA 2QRGA 1L4KA 2ECKA 5CU7A 2AR0A 2BFBB 2CFCA 4RDHA 3FRIA 2GZDA 4JJ6A 4UFPA 1JJIA 4B8WA 5C3MA 1CBUA 4K40A 3K6SA 1XKXA 2BDUA 2OWDA 4GBED 4MCIA 3RFCA 3VKVA 3ZOZA 1HRDA 1DX9A 3GQBA 3VM6A 1M2JA 5LKRA 3IP5A 4UDXX 4W6ZA 2EHDA 3V8RA 1B6GA 1JG4A 4GLLA 3VR4D 4TKVA 3OLXA 3RS3A 4ZQBA 1J20A 2R11A 2PIDA 3FSGA 4PC7A 2VUHB 1C1DB 4MEBA 5DCWA 2RMKA 2Y0CA 1I1NA 1RIIA 1RQ7A 2ZB2A 3I1FA 3E35A 1UKVY 1ZH2A 3MWLA 1L4GA 4Y6LA 2W6IA 3H9EO 4BEBA 1Q91A 2QU8A 3A6HA 3VJMA 2ZJZA 1XLTC 4FFSA 1TW2A 2ZT8A 1CQJA 2BMWA 1QE3A 3EVDA 3GV0A 3EVFA 3ISTA 3L7IA 4KVAA 4WUTA 3JALB 1VMAA 3RIHA 1BEUB 5CAEA 5L4NA 3DLCA 4IHJA 4J9VA 4ZCPA 4B83A 1GM5A 2CJWB 3NANA 3RUCA 1MTOA 2GEUA 3ETJA 5E6UA 1RM4A 2JI6A 1SVWA 4DA8A 4BB6A 2PLAA 3K4QA 4UTXA 3ZWWA 5C51B 2CNNA 5K2OA 4U6NA 1V1RA 1LU9A 1SELA 2ZKIA 3AOEC 1KEVA 4IGKA 1EBFA 5A5GA 2QMQA 1Q6YA 3PNMA 1I3KA 3FJYA 1I6KA 2NU9A 1J9EA 1FQKA 1PS9A 1T8UA 1U0JA 8ATCA 4LJLA 2VEOA 2NAFA 1K8XB 1M2OB 3SVZA 2VKTA 3TBFA 3FDIA 2AX3A 5BUSA 4FCCA 3RR2A 4YCMA 1NN1A 1ZNZA 3I37X 2JFWA 1VIVA 3BRCA 3MJ4A 1AF7A 2O4CA 3D64A 2DGDA 1F17A 4C2UA 4HCJA 3UM9A 1OX4A 3SQXA 3DL4A 4H6PA 3NNDA 4OI2A 4R8VA 2R6ZA 1M6VA 3Q8LA 1H4VB 1VMKA 4ENTA 2YOFA 2GM9A 1B00A 3E8SA 2YWEA 4H4EA 4MRSA 5FI1B 4QE3A 3S2FA 3Q9UA 2I2BA 4LQDA 2EYQA 3KM0A 3ORQA 3BD9A 1XXHE 1RLTA 3CLHA 2CJXA 3EZXA 4Q1AA 4R1SA 4DQDA 3EPLA 1PYDA 2VHQA 3OO0A 3MMNA 1CFZA 4I81A 2C9YA 3WRXA 5CFNA 2WHXA 2L82A 2J3EA 4F11A 5LMCA 3ADPA 3CR8A 1NNSA 4TMFA 5K8LA 4QT4A 1EI9A 3CRW1 3EA5A 4YUVA 1WCIA 3AP3A 4ARSA 1LFAA 1N5OX 3HCFA 3P45A 1PDOA 1U1EA 3S28A 2QTRA 3F6YA 1P1CA 3FNRA 4BVAA 1UEJA 4G5FA 3T1VA 1EFPA 4NHEA 1I1HA 1OILA 3KCQA 4PSCA 5B12A 4N54A 4FN5A 1EU1A 1Y34E 5HILA 5C4MA 3PWTA 2V6JA 1N8NA 5GY7A 3WBJA 5LLTA 4LMPA 2AZTA 2F6RA 3OZXA 3EGXB 4N3NA 2GA8A 4TWAA 4AY4A 1GDTA 3C39A 1MO6A 4DCTA 3U9SA 1S6YA 3GI1A 3KPUA 3RYIB 2WJWA 3COWA 1BQ4A 2DETA 4MVJP 1V16A 5A6SB 1ZK4A 2VR1A 2QAGC 3P9QA 2WFLA 4PPNA 2V9ZA 4YA6A 5LXTF 2PZAA 3PUHA 1P6XA 4P3XA 2JFUA 1SQ5A 3T99A 2M98A 3K6KA 3KR9A 3WK6A 4BX9A 1YQXA 3LUGA 3U7QA 3W2TA 4ENUA 1QSGA 2PX0A 4J0JA 2BMFA 5ARDA 3GJ7A 1FP4A 2GHIA 4JASB 3ZH9B 1AKVA 1YMUA 4NDAA 3NDRA 5AHWA 4F9FA 3EX7C 5ALZA 2D5LA 2B7LA 1MXFA 3MBOA 4GX1A 1QFSA 2HK6A 4U7WA 1NOKA 2RC6A 4EYOA 1HDEA 2I4RA 1W30A 3AUSA 4RKEA 3VKFA 4B32A 1CDDA 3TX2A 4GBMA 5DYGA 1VFNA 3DQZA 1XNHA 3RS7A 4OYHA 2GKSA 4FSXA 3RSZA 3L3BA 4I7EA 4ZOLB 3L05A 1YA8A 1XBTA 3V1TC 3GU3A 4FHEA 4DBLE 4WFQA 1XF1A 5LZ7A 3UK2A 5H4HA 4DUPA 5KSWB 1PW5A 1QZ3A 2FQWA 3R23A 4US1R 4Q9DA 5ITZA 4G9BA 2JLYA 3STTA 3GGJA 2ECFA 3FX2A 2YMQA 2A5GA 3PFGA 4LYGA 2HCTA 4RVUA 3W2HA 4AP5A 4BNHA 3ER8A 2KI5A 4FE3A 3RK1A 3OIUA 4ZT5A 2DWUA 1U04A 1IQ0A 2H29A 5FPQA 3ZLBA 2YJ4A 2G28A 2RH8A 1FFAA 3CZ4A 4B6QA 1U6KA 3UV7A 1DJMA 1G66A 3AR3A 3DLHA 4RY8A 2BV3A 1LI4A 5JSHA 1ZG3A 1BX3A 1N7IA 1QE5A 2G09A 3QF4A 1BA3A 2BF7A 1ZNQO 4W1PA 3PQ5A 1N2BA 2R97A 5K0LA 3T4UA 3BL8A 3HDYA 4JYPA 3ECSA 2J33A 1VKHA 2G5GX 4EEZA 2BI8A 2Z4RA 1X1RA 3FLAA 1USIA 4ZIRB 2WWYA 1EUQA 3ZWMA 2VSOA 3H6KA 1ZJ6A 1BVHA 4CLEA 4PHGA 5IT4A 5G1PA 1U1CA 1TYBE 1CETA 3V34A 4HI0E 2GZ3A 2ZREA 1E7YA 1POXA 1ZMXA 2BR5A 2J9ZB 3ETDA 4YK7A 3ROXA 3ZJYA 1KWKA 2P6OA 2QU7A 1TZCA 2O23A 1H69A 2E0IA 2VOEA 3LT5A 4UAUA 2BFAA 4DJTA 4IICA 2BTQA 3GJ0A 3H1EA 2N46A 3KJGA 4JEHA 4A8TA 5KNCH 1WR8A 4OO3A 2WT9A 2ZTHA 2EOAA 3LLSA 3DBIA 3M6IA 1QH1B 4CQMD 4EH1A 2UZ1B 2RGBA 4KUGA 4J0FA 3GC6A 5EMHA 5I47A 1SIBE 2HK8A 1SBHA 5KWJA 1KYIA 5F98A 1QS0A 1RHQA 1I5RA 1C9EA 1N2HA 2P2GA 3E9DA 3T7AA 5JFGA 1A7KA 3GFGA 1EQ2A 4UU7A 2X6RA 5KU1A 4DJAA 2I7VA 3GP8A 4KO1S 2OGSA 4O63O 1EP2B 1C8LA 2OPHA 2B4AA 1IC6A 3RYFA 5JQGF 3C70A 5SZJA 5T5QA 3QVLA 1V7QA 4PPFA 3EHDA 1F8YA 1TZBA 3V3KA 2J09A 1CR2A 1V2HE 4OGLA 1FK8A 5J2UB 1H2YA 1TI7A 5C7OO 1L5YA 1FP6A 2XBLA 4C6SA 5IZ4A 2YN0A 4K87A 1YKFA 1T1JA 2YS7A 4XEHA 3LT4A 5D6NA 3MWYW 2HWXA 2E21A 1L7VC 1R50A 4A2QA 2Q2NA 1SG9A 1N92A 3NBAA 2WDPA 1UPAA 1E1RA 3TLBA 2IY8A 3VDQA 3OOEA 4IFTA 3RS2A 1QP7A 2XTJA 3EARA 4G4GA 4JK3A 2HNBA 2NZYA 1KJWA 2XHEA 5DV9A 5AR1A 4D92A 4Q9HA 1DAIA 1TEHA 3GFBA 4ROSA 2JEOA 3F6EX 1X9IA 4JQSA 5JBIA 1Z2EA 1W2GA 3MJVA 2RI6A 2ZUVA 4CMAA 2B8EA 2BEWB 3GLTA 1ZI6A 4YO8A 3UO8B 3G0CA 2Y8EA 4KRYA 3V1UA 1Q7BA 1W6UA 3V1MA 3ZCTA 5KNBD 4H7KA 1A0OA 2QTNA 3TBKA 4IJ6A 1FFWA 1R0YA 13PKA 3DVQX 1DC3A 3HVHA 3MRTA 3ADOA 4M7WA 1ORIA 4YMGA 2ZUCA 3D3WB 3DOOA 3IBGA 1ZUIA 2HXGA 3ZWPA 3L43A 4R1LA 4C3VA 4IDEA 3AVPA 4GM1A 4FW9A 1QANA 4GQAA 3RBAA 3K0EA 3ZTTA 5L95A 4GXRA 3G0OA 2ZT7A 2C1ZA 2PT9A 1M7HA 1A5TA 4YYZA 5DGTA 4AQYB 3GJRA 1FLNA 1H4SA 2OCLA 3UPTA 5H83A 1XCMA 3GEMA 5JD3A 3AEZA 4HATA 4U9HS 2QN8A 3U4HA 4D8VA 2QN2A 2ZXUA 4CEHA 2OCAA 1KE1A 2QJFA 5E4JA 1PWHA 4JR2A 5C0OE 5I4IA 4PFKA 3NMUF 5LR6A 3AIOA 2GYYA 3ANTA 1CUUA 4CM8B 4CM4B 2F43A 1VSBA 1A9ZA 1J07A 2BFCA 1NF9A 1T6NA 2IT1A 1L5RA 2SNIE 3KKZA 3ND5A 1JQLB 4GX5A 4XRRA 1S8AA 5EWMB 5A4DA 3ZXSA 1FMLA 3GT7A 1E6EA 2BWJA 4LJ6A 4MP6A 2WTAA 3VR2D 1VHDA 3LQFA 3OM1A 1RNLA 5TQ0B 2Q6VA 2CDNA 1L5HA 4YT2A 4PXYA 1JQBA 2JFOA 2EBWA 2R6HA 4F3RA 1KAHA 2PD6A 1VTKA 3AJ8A 4DFDA 3PCTA 1DUSA 4F97A 4UNSA 3L18A 4EG1A 3N2KA 4G4SO 2X0DA 1E7WA 3VZSA 1DSSG 1UEXC 1I7QB 2AMLA 4MUFA 5DO9A 3B5JA 4YJFB 1GNLA 2W71A 3ZHSA 2EKQA 2ZJFA 3OPYI 4MQLA 2Q99A 1EZZA 4OXRA 5F33A 3STHA 2OAEA 1MO5A 4FGLA 1GITA 4J43A 4TKZA 2O59A 3K5WA 1SBZA 3NDPA 1ADYA 3QXHA 1IZ9A 3CFYA 2OYCA 5DM60 2IZZA 1KJNA 1X86B 4GI1A 1JKIA 1LK7A 4QBHA 2BMJA 4B6SA 2I1LA 4MR9B 2OLJA 3L4BC 4ER3A 2DKNA 1V43A 4KE7A 3QP9A 1ZICA 2PUDA 3AJEA 1L1FA 2DBRA 4MV6A 1XRSB 3K0HA 4PLHA 4CGYA 2WSLA 2QS9A 4G0MA 4PNZA 3N8HA 4EG7A 5BR1A 2NYRA 3KHTA 3DV0A 4MR8A 3VR5D 2GZHA 4O2AB 2PFSA 3ZWVA 4C2BA 4E5DA 2Q2OA 1UBRS 3TZEA 1C7JA 1S3IA 5AOAA 4V1CI 2ZSAA 3BRQA 2PL9A 1GAJA 2BMAA 4L8FA 3L4SO 2MSDB 3LQYA 5LWQA 3RKRA 2OZKA 5JVDA 5FBZA 2AEJA 3SYTA 3RT1A 2FFAA 4DLZA 3FETA 1WMBA 4BMSA 5E2BA 1VL5A 2OQRA 3RVNA 3A1SA 4BCDA 5BVGA 4PCAA 3KLOA 1KSHA 3OQBA 2XOXA 1JEAA 1HT1E 1TTHA 4LJ5A 4BJ6A 3TFOA 1TM3E 1T1IA 4OYRA 1ZVVA 4H3HB 4EG8A 4U3JA 1HE1C 1AKNA 3RV4A 4JJZA 3O8CA 4QM6A 1KY5A 2O8NA 2P27A 3DL2A 1H6DA 1WMAA 1RKXA 1V7ZA 2HQ1A 1YCGA 3OKFA 3D8RA 4YNBA 1R5JA 5AI5A 4F4JA 4LYJA 5BUZA 3T9EA 3NJ8A 4Z8XA 5BOVA 3O3NB 2A1TS 421PA 1ODSA 2P2LA 3N8DA 3QQPA 3T9DA 1ISRA 2AD5A 1YFJA 1RCFA 4D9IA 4DLLA 1XNQB 3IA2A 2RG7A 4EPWA 3B6MA 2AUNA 3DMGA 1E59A 5F4ZA 3PFNA 5J2TF 3KP1A 3RT9A 1R9JA 5EJ4A 1HLPA 1DG9A 1P7CA 1VBNA 4N49A 4X6LA 5ALWA 1KHTA 3EXHA 1E2BA 1N3LA 1I10A 3Q5EA 1GTG1 5LZ8A