3U81A

Crystal structure of a sah-bound semi-holo form of rat catechol-o-methyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
218
structure length
218
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
total genus 74
structure length 218
sequence length 218
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2011-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3u81A00
1FJXA 2ZULA 3P2KA 4C06A 1NV8A 1U2ZA 1WXXA 3GRVA 2UZ4A 4HTFA 3UJ6A 1SUIA 4E33A 1R18A 4EKIA 8MHTA 1AF7A 3G89A 1WZNA 2EJUA 4YMHA 3K0BA 4LWPA 2FK8A 2XYRA 3DXZA 2G70A 3NTVA 2P3OA 4RTOA 2ONZA 3NVKI 3EVDA 2AOUB 3BGDA 2K4MA 2NXCA 1KXZA 3BKXA 2C7PA 4GQBA 2I62A 1D2HA 2CL5A 2B2CA 1XDZA 4RVDA 4RTSA 3GWZA 4KDCA 3AXSA 3OE5A 1R8YA 4KVZA 3UJBA 4YV2A 5KYGA 5E8RA 4EK9A 3HCBA 3ID6C 4P58A 2FK7A 4CKBA 5IKMA 2P3QA 3M6WA 5KS2A 5CVEA 1N2XA 2AVDA 2GPYA 4Z2YA 5EQJB 4F86A 3REOA 3LKZA 5F2NA 5K0EA 1KPHA 2B3TA 5LQAA 4KIFA 4R6XA 3KQWA 1RJEA 1G38A 3VYWA 3PLAE 2PGXA 4P7GA 5EMKA 4PCAA 4A6DA 2QE6A 3PX3A 2NP6A 3DR5A 5K05A 2GA9A 3E23A 2IBTA 3T7SA 4FP9A 3HCAA 3DXXA 3KU1A 2VDWA 4CXMA 1DCTA 3KQYA 2V74B 3PFHA 5C0OE 4GEKA 1EJ6A 3OCJA 3OZTA 3PB3A 4PYMA 2P7IA 1QAOA 5CVJA 4LWOA 5K0JA 3PT9A 1NW5A 2CWWA 4C03A 3ELYA 4QDKA 3QV2A 3FZGA 2IFTA 4GC5A 5EIFA 4BY9E 2AOTB 4KWCA 3DMFA 1FBNA 1L3IA 1QYRA 1RJFA 3EVZA 3M70A 3S68A 4C4AA 3IEIA 1R6AA 3KR9A 4ER5A 4M38A 2YR0A 3TQSA 4DZRA 4IWNA 2DULA 1NBHA 3ELWA 3FPEA 5DXJA 3GRYA 1RI1A 5LQUA 5FQOA 3D2LA 2P8JA 3SSNA 2B9EA 3GJYA 4RVFA 4X63A 5HIIA 3TR6A 2ZIEA 1XCLA 3OU2A 4QPPA 1AV6A 4F85A 4PYOA 5BXYA 2IH2A 2ONYA 2ZWVA 2AOUA 3NWBA 2PX8A 4FSXA 2Y1XA 3U81A 5FULA 1YF3A 1L3CA 1TPYA 4OQEA 5KQRA 5FHRA 1NV9A 2GS9A 1P1CA 3HVIA 4HC4A 5FQNA 1T43A 2OKCA 3OZRA 4IKPA 4PNEA 3ERCA 3G8BA 3RW9A 5FADA 2P35A 1UFKA 3ANXA 3FRHA 5GINE 5K09A 3BUSA 3A7EA 3KQQA 5FCDA 4DKJA 3UBTA 2H00A 4C04A 4X61A 2AVNA 4K6MA 2YQZA 3LHDA 2I6GA 3CGGA 3VC1A 5K0BA 5F2OA 3FTCA 2XYVA 3HCDA 2PKWA 1G55A 4PIMA 3M6XA 4R05A 5FWAA 5T67A 5T64A 4OA8A 1ZKDA 2XVMA 4RTMA 2ZBRA 3V97A 1B42A 5EZQA 2UYHA 2ZIFA 4DF3A 4PIPA 4XCXA 5EGSA 3G5LA 4E32A 2Z6QA 3P9KA 3IHTA 4MQ4A 3SR4A 3P2IA 1X1AA 4MWZA 4CKCA 3E7PA 5K0GA 5M5BA 9MHTA 2IIPA 2YTZA 2CKDA 3CJQA 4DQ0A 2ZBPA 2G8NA 3A25A 1VPTA 3GRZA 5H02A 1BKYA 4WVLA 2PWPA 4X60A 5DRTA 4BLVA 1NBIA 3G2PA 3EPPA 4U7TB 1UIRA 4E2XA 3PFGA 2PV0A 2ZZMA 4RTRA 3DP7A 2BR4A 4AUKA 5HZMA 3P9IA 2AOTA 3MCZA 1JQDA 1G8AA 3TOSA 4OA5A 2HNKA 4R8RA 4GOND 3FUUA 5E1OA 3FTEA 3GDHA 4FT4A 1M6YA 5K0LA 2OYRA 2OZVA 2QRVA 3HA7A 2PJDA 3HVHA 4E2YA 3UA3A 4PGHA 3KPVA 3THRA 3AY0A 3F4KA 2LD4A 3GRUA 2ZCJA 1P91A 3BWYA 1KHHA 2IH5A 1WY7A 2AN5A 2IP2A 2JH9A 2VDVE 3GXOA 3R3HA 1KPIA 4GF5A 5DM2A 4BP1A 2JJQA 3LDGA 1INLA 3K6RA 3NWEA 1QAQA 2H1RA 3GU3A 3TMAA 4RSRA 3FUWA 3G7UA 3LCVB 2ZWAA 5T6BA 3THSA 3LDFA 4XUCA 4RVGA 1ZHFA 1M6EX 3RIEA 3P9NA 1P39A 1R74A 5FUBA 3R0QA 1XXLA 3P8ZA 4AX8A 1NKVA 1V39A 1VE3A 3MQ2A 3UJDA 5FWDA 1L1EA 1JSXA 3NVMB 3MTIA 5D1HA 1F38A 3OU6A 5BW5A 5KQSA 1I9GA 3Q7EA 4OQDA 5U4XA 3A27A 3UJ7A 5ICGA 4CTKA 5K0FA 5E8JA 3LCCA 2Z6AA 1RJGA 3MCTA 2YXEA 1IXKA 4MTLA 2B25A 3TLJA 1FPQA 1SG9A 4PGGA 3HCCA 4X1OA 3RODA 3DXYA 3ELUA 2B78A 2BM8A 1AQJA 2QY6A 3M6VA 3SGLA 4E31A 1VQ1A 5E2BA 4RX1A 2PT9A 4B17A 5DRYA 4NECA 2BM9A 3KQTA 3GRRA 3UJ8A 5HIKA 2HR1A 5EEHA 3OPNA 1YB2A 3E8SA 5DT2A 5ICFA 2O06A 3FPHA 4C08A 2NXNA 3FRIA 3M33A 5K8VA 3JWIA 5GIPE 3JWHA 4HGZA 3HA5A 4AZSA 2NYUA 3ELDA 3EVEA 4YV1A 4FR0A 1KP9A 4KRGA 5C9ZA 3LDUA 3BT7A 1EJ0A 4DCGA 5K0CA 4KW7A 3PVCA 2BR3A 1G8SA 1ZGJA 4WXHA 4DM3A 4YUXA 1ZG3A 5EMLA 4EMSA 5HILA 4H0NA 2NNWB 3MTEA 4HGYA 5JR3A 3KPYA 3P97A 2PBFA 4ER7A 3MB5A 4GC9A 5DLYA 4PCLA 4GUAA 2ZTHA 1X1CA 1FP2A 2HTEA 2ZBQA 4RTQA 1XVAA 5CVDA 2I9KA 3SX0A 3IV6A 2KW5A 3BWBA 4PYIA 2OO3A 1SVUA 3DOUA 3KPWA 3R24A 1VBFA 2NXEA 10MHA 3UJCA 3NMUF 2FCAA 4ISCA 3KPUA 1RI5A 2C7QA 4R8SA 2VS1A 1XDUA 2AN4A 4HG2A 5DX1A 5GM2A 4ER6A 4OBWA 5DXAA 4RTLA 3KPJA 3CC8A 3UJAA 3G2QA 3M4XA 3UWPA 4PYJA 5KVAA 3CVOA 1VP3A 1BC5A 5DM4A 3VC2A 3DLIA 3CJRA 3TFWA 7MHTA 3HEMA 3I9FA 5HOQA 2YUIA 5EC8A 3DMHA 3C6KA 3EGEA 4PINA 2EX4A 4QTTB 4R6WA 1X19A 3CKKA 4IV0A 3HTXA 5EHGA 2ZIGA 1ZGAA 3OE4A 3LGAA 4V0QA 3MGGA 1YFJA 4GOOD 2IGTA 3I58A 4PWYA 2BR5A 2ZVJA 1VIDA 4QQKA 3FTDA 5CVUA 1NW6A 3A4TA 1JG4A 2NXJA 5LSAA 3EMBA 3I53A 1NW3A 3LBYA 3ER9A 2O0LA 3P2EA 2GH1A 3KR2A 4YUWA 5DSXA 1ZQ9A 3EVGA 4GOMD 4M37A 1JR4A 1MJFA 2PX4A 4FGZA 4GOLD 1SUSA 2FRXA 2ZZKA 5EHIA 1MHTA 2R6ZA 2EJTA 2GLUA 3PTAA 4P7FA 1P1BA 3C3PA 4DMGA 5GIOE 2YVLA 4YV0A 3DMGA 1Q0TA 5EVJA 4G56A 4L7VA 4KDRA 5DSTA 5GP1A 2P3LA 4BLUA 2FPOA 5FTWA 5BP7A 5E9WA 2BZGA 4C05A 3NDIA 3LBFA 3TPZA 1VLMA 2YX1A 5CUQA 1D2CA 3LKDA 1UWVA 1PJZA 3H2BA 3LECA 3LPMA 3AXTA 3O4FA 4HH4A 4OX9Y 1DUSA 3EGVA 2AR0A 1RI2A 3SM3A 5EIWA 4RYLA 1VL5A 5DM1A 2PLWA 2UYQA 4PYKA 5DX0A 4HSGA 3B3JA 3EEYA 3EVBA 2N47A 1TW3A 3KR1A 5FA5A 4QTUB 4RWZA 4HTFB 3C6MA 4XUDA 3OFKA 4V0RA 3UFBA 2Q41A 2CMHA 5DTRA 5P8WA 5HIJA 4QQNA 4M7RA 2JHCA 2AOWA 3HCEA 1RI3A 2JHPA 2XYQA 1NW7A 2DPMA 3FTFA 3ORHA 3TKAA 2P40A 2V7EA 4ZTBA 3TM4A 2G1PA 3G2MA 3SMQA 1YZHA 1L3BA 3ME5A 2JHAA 1JQ3A 3TM5A 2IDJA 2HWKA 3A7DA 3R6TA 3JWGA 3KHKA 2IDKA 1XTPA 3QOXA 2QM3A 3BGVA 2PXXA 4PYNA 1EIZA 5DPMA 4CKEA 1Z3CA 3G5TA 5DWQA 1JTFA 3B89A 3M6UA 3HM2A 1DL5A 2PWYA 3LCUA 3NW9A 4Y30A 2IPXA 5MHTA 3FPFA 4RTJA 2CMGA 3O31A 2O05A 3BXOA 1BOOA 4BLWA 5LQCA 3EMDA 2H11A 2C7OA 5EPEA 5GM1A 1YZ3A 4ATNA 3LX6A 5EMMA 1O54A 1TW2A 4O29A 4PYLA 2C7RA 4LG1A 3CCFA 3WSTA 3I5UA 1QANA 5ERGB 4EVIA 4RTPA 5GWXA 3BWMA 3FUTA 5LR6A 2WA2A 1Y8CA 1QZZA 2F8LA 3DUWA 4MIKA 3PS9A 5HIMA 4DA4A 1O9GA 4ER3A 1AQIA 2OB1A 2VP3A 5CCBA 2IH4A 1Q0SA 1N7IA 2UYOA 3V8VA 3GGDA 2YXDA 2HV9A 1O9HA 3HP7A 3MAGA 5EZSA 3FPGA 5CM2Z 4YUYA 2ZSUA 1RI4A 3NJRA 5EMJA 2OY0A 2YXLA 5ICCA 2FHPA 2ESRA 3T0IA 3KQPA 4P7KA 1G6Q1 2ORED 2OXTA 1RJDA 1NW8A 5CCXA 1WG8A 1FP1D 2O57A 3HA3A 4YUVA 3O7WA 4DCMA 4E2WA 5E1MA 4RVHA 1X1BA 5B1SA 3LSTA 2P41A 5LQRA 4JXJA 2PX2A 3DTNA 4GBED 5LQJA 3MHTA 1IY9A 4RV9A 4U7PB 3X0DA 3KQSA 2IBSA 1I1NA 3KQVA 3EGIA 1L9KA 5K0NA 3OU7A 3KKZA 4BP3A 1HMYA 3PX2A 5GOZA 5JUWA 5CD1A 1R00A 2R3SA 3MERA 3DH0A 2XBMA 2AOXA 3VSEA 1XDSA 3IYLW 1YFLA 3E05A 1SKMA 4FSDA 4F84A 1JG3A 4IV8A 5EG5A 1ORIA 2QRVB 1KYZA 2G71A 3NDJA 2WK1A 2NP7A 1JG1A 3DULA 3GIWA 3B3GA 3L8DA 1I4WA 4AZTA 3FYDA 1ORHA 5D1NA 4MHTA 2HMYB 2PSSA 3G88A 5F2KA 3GNLA 1QAMA 2GB4A 4AZWA 3C3YA 2PXCA 2QYOA 3HNRA 5HEKA 5EKUA 4E2ZA 5K03A 3G2OA 3A26A 3BZBA 3OFJA 2PVCA 5E9QA 1M0EA 3SSMA 1JTEA 3BGIA 3SSOA 2VZ9A 1EG2A 4PYQA 3B5IA 4OBXA 4PONA 5IH3A 4YMGA 1VP9A 2AN3A 2E5WA 5E1DA 1EQAA 2ZFUA 3LL7A 3Q87B 4KIGA 3BKWA 2AS0A 1KR5A 4FT2A 1JG2A 4HRAA 5EKXA 4RTNA 2ZZNA 4XUEA 5DTMA 5DM0A 1SQGA 3FPJA 2XVAA 3G8AA 1R8XA 5FHQA 1H1DA 1PRYA 4FZVA 3CJTA 4QVGA 4Y2HA 4AZVA 1BHJA 2VDUE 2FYTA 3FUVA 4QPNA 3UJ9A 4CTJA 4EQZA 5EOVA 4QDJA 4YUZA 2OBFA 4E30A 5LQKA 5CVVA 3CBGA 3EVFA 1OR8A 1XJ5A 4RTKA 3R9XB 4P7JA 1WXWA 3GO4A 1NE2A 3SXJA 2BH2A 5C1IA 1WS6A 1XCJA 4E70A 2O07A 2P7HA 4M36A 5FA8A 3C0KA 4X41A 4EKGA 1JQEA 1NT2A 1KIAA 2OB2A 2PT6A 3OZSA 3KQOA 3SVZA 3DLCA 4POOA 3T7TA 4A6EA 3KQMA 2A14A 2OPBA 3HCFA 1EAMA 3HVJA 1KPGA 1G60A 2PXAA 5K01A 2ZW9A 1HNNA 3TRKA 3EEOA 3ER8A 2WA1A 5E9JA 4UOEA 2I7CA 4ER0A 1JSZA 1X1DA 3GCZA 1KYWA 3JWJA 2ZLBA 5EEGA 3FUXA 2EFJA 5ICEA 3HVKA 3UA4A 2P1DA 1N7JA 5BW4A 3P9CA 2PX5A 1IM8A 1D2GA 3AJDA 2GAFA 2UYCA 5DTQA 4CWAA 5G02A 5E1BA 2EG5A 5CIYA 4LECA 3BWCA 5DX8A 2JH8A 2PY6A 5LQNA 3B7PA 3FYCA 2JG3A 2ERCA 4QVKA 2AOVA 3KR0A 5E2AA 2Z6UA 1SQFA 4FS8A 3UZUA 3P71T 1YUBA 3T7RA 2AZTA 3I64A 1F3LA 3EVCA 3AWIA 3B3FA 3EVAA 3TKYA 2G72A 2Y1WA 2ADMA 3QOWA 5HFJA 4C07A
chains in the Genus database with same CATH superfamily
2G04A 4CMEC 3K53A 4K6FA 5CB6A 2ZRBA 2Q3FA 4BZXA 2NZJA 3LY5A 1UJNA 4E33A 5C7YA 2C4HA 1N6PA 2Y2UA 3WRVA 1AF7A 1EG7A 2HNAA 5DB4A 1W6UA 3K6SB 5FF9A 3WIVA 4Y1FA 1DG1G 3B13B 1LB1B 1AOXA 4YPFA 1CEXA 3T3MB 5U9CA 3NTVA 2H4XA 4U8GA 3ZIDA 1JWBB 2FPMA 1MV5A 1ZHHA 2OD9A 2COKA 2AOUB 4FJ0A 3FH0A 1PDWA 2BMEA 4GSYA 1XDZA 2J08A 3PPXA 5ALQA 3LT1A 4JBWA 1T3GA 2P79A 4NICA 2PUDA 1XXHB 1QFZA 3KWMA 4OCZA 4C6SA 5FYDA 4YRGA 1Y80A 2IP4A 3QMMA 3AVTA 1OZAA 1O57A 5IKMA 4OXYA 4POAA 4AJKA 1RXUA 2W6JD 2QLNA 2ACWA 4Z2YA 1G2IA 3D5QA 4GWKA 4BV3A 3OECA 2HA5A 3L46A 4D2IA 2FQ1A 4HP8A 1GTL1 4B6PA 4XVCA 2ZIXB 5JZSA 1VE1A 5I9TA 2HA4A 4LHVA 3RT1A 3OJWA 5AICA 1O4VA 2XGJA 4KLRA 4UKDA 1W88B 1U3CA 4Q18A 2ZU6A 3CR3C 5LDDC 1H1TA 3CH7A 3H05A 3CX6A 3KVNA 6AT1A 4ZVQA 1IC6A 3U0BA 3PB3A 1WBBA 3KE9A 1T2NA 3IDFA 4B6FA 3NDRA 2VUHB 1ZIOA 4L76A 3EWNA 4Y7CA 5AJVB 4HH3C 3FZGA 2GZ1A 1R4MB 3IBSA 1J8DA 4EL5A 1FBNA 1L3IA 4HXYA 1T5SA 2OOKA 3WRYA 2F9FA 4ZCPA 4D8YA 1CS4C 2JAHA 2DULA 3HL4A 4R1QA 1ZLXA 1WCYA 1W4LA 1TKCA 2OMKA 3ZCUA 1RI1A 4AJ1A 1W0JD 5FQOA 1X7WA 3S70A 3VOBA 5FX2A 2ZG6A 3GJYA 3R2JA 3WWZA 1NN5A 3PHBE 1HYEA 2AFRA 3L93A 4N5HX 2LCQA 3VKVA 3BXGA 1HDCA 2H54A 2VP5A 2ZKIA 4DR4B 2Y1XA 3L01A 4MGZR 3D2AA 4H60A 3QW2A 1Z2NX 5KQRA 3H5TA 1DAKA 2G5CA 4RH3A 3N8KA 4F9GA 2Q4RA 3PD1A 4WZZA 1TCVA 5H70A 4MMZB 1G6KA 3OM1A 5B1IA 2BEUA 2LKDA 3STXA 2XX3A 1XN4A 2AWOA 2JIDA 4BO6A 1WF6A 2AVNA 3PDUA 3X2SA 2I6GA 4DDTA 2AG8A 4G01B 2XDQB 1GLVA 3AP2A 4WSOA 3IIMA 4ZQFA 3LTEA 4LE2A 3V4RA 4V38A 3RB8A 3MMPA 4EFKA 3FW1A 2CBGA 1GNPA 2D7CA 4HDMA 1NF9A 4Q3BA 2ISSD 2FUCA 2DOKA 4HDAA 4RPKA 5C1DA 1D03A 4OHUA 5C1OA 2FN8A 3DEHA 3MEQA 2FDXA 3P9PA 5FFFA 1L5ZA 2ORYA 3IPRA 1EE2A 4CKCA 5K0GA 2CKDA 2O3QA 4NBTA 3SDBA 2BTOA 2Z8ZA 1KFEB 3SJCA 1W4CA 2AG6A 3V4ZA 3ICOA 3BMQA 3NIGB 2QX6A 4W63A 1N57A 3ZHUA 4Z54A 1HNWB 1NU8A 1VJ5A 2A0FA 1A8PA 5HFAA 4AX4A 2O3TA 5TR9A 2GSDA 2PUEA 1QP0A 1IWOA 2E7ZA 4JUDX 3T15A 1U7UA 3CLTD 1YCGA 3ADOA 3KJEA 3IP3A 4R8RA 2NUAB 2AYYA 1M6YA 3NUGA 5B30A 1R8SA 1XTTA 1Y4ZA 2DQSA 4HGNA 5BT9A 3UA3A 3GL9A 5DV9A 4PRYA 2F1KA 3IMCA 3V8QA 4MQMA 1P91A 1Y4AE 4K7JA 1TD9A 1NVMB 4CN9A 2VDVE 1R9GA 5ALOA 4W5QA 3AFMA 1BMQA 1YS9A 5EWMA 1L7OA 4LCBA 1T34A 4F0JA 3I1YA 1HQDA 2KM1A 3VNSA 2HMWA 2R7LA 2J3KA 1VJ1A 3SI7A 2PL9A 1T91A 2FR0A 3N28A 4XB6B 1X8LA 4HX2A 3ZI7A 4BMVA 4K9PA 4N3NA 1SBCA 1Q7TA 5G4KA 3AY6A 4XIGS 1H2HA 3VKFA 1JHOA 2ZJ5A 3HADA 2FEXA 1TUGA 2HEIA 4KMOA 3OU6A 2VA9A 2NYRA 3VH4A 5EIBD 2B99A 1I9GA 1YZQA 3RGWS 1O6ZA 4TTTS 5FV4A 2A2ZA 1H0HA 1XAGA 1CKEA 1UPFA 2A9FA 2RGBA 4L02A 3LCCA 4BVEA 4DDKA 3KM0A 1E9CA 4Z0NA 5IU6A 3WK6A 1ORVA 5F3WB 2IV3A 1KO8A 1SXJB 3B70A 2XUDA 3C87A 5JS7A 4DA7A 1LI5A 1JJ7A 1E58A 2J5RA 3AP3A 1DEAA 2B78A 4OATA 2YYAA 4Y0VA 3K3PA 3W06A 1F8GA 1KJ9A 1A2BA 5JARA 3B85A 1SWVA 3ORQA 2PT9A 1K7SN 3MFYA 3PXGA 1LW7A 2GZ2A 3PWZA 4A8JB 3ACBA 3W9BA 1AKEA 4UAUA 2Y6UA 1LDEA 3PA6A 1DV2A 2OE2A 5HIAA 1J97A 5K8VA 1NQUA 1OD6A 2XTNA 4FFMA 5WRFA 4AZSA 5FI5A 1E9RA 2BGRA 4FI3C 4NCJA 3E7DA 4FR0A 3P0FA 3B9BA 2HA0A 2OHGA 1P9OA 1T6ZA 1E4VA 3TX2A 4CUKA 5DASA 1W19A 1R88A 3T94A 1TJYA 4FZ3A 2H2AA 5EJGA 1GGJA 3NIBA 3P97A 4V02A 4HI0E 3ZQJA 1A76A 4ER7A 2J4CA 2O8FA 3JASA 2CLMB 5DLDA 2XIQA 3B1KA 2OT3B 5I5GA 2HW8A 4R71A 1XX6A 3PUIA 1QTNA 3HJUA 4LRWA 2JFZA 2HIAA 2FR8C 4F45A 4JKYA 2OO3A 1R0XA 3ZGLA 2MR5A 3VI3B 4R2LA 1BN7A 2VWGA 2IYWA 1T29A 4FHEA 5BW8A 1K98A 1LNQA 1W85B 1RQPA 1I94B 6CHYA 3SEQA 3L77A 1T8UA 4JYAB 3PWSA 1NT4A 1Q1NA 4R8SA 4ZOAA 2ZOSA 3PDIB 1PJRA 4TL9A 3KPJA 3R6LA 4TM7A 1JZTA 3G2QA 5ED0A 1S8OA 1O3YA 1BC5A 2F8SA 5TT0A 3VYTB 4COKA 4C2AA 2A0UA 3ZU2A 2QLJA 3CPHA 2YUIA 1FP7A 4G9GA 1QHFA 2JLSA 3V7WA 5LXTA 1X19A 2CDBA 4PAOA 2Y67A 5D01A 1H2YA 2BJHA 4D9CA 1AKVA 3JV7A 1ZYUA 2A1UB 4B9EA 2CLHB 2QL5A 3K7EA 2AF3C 4IEFB 4PWYA 3KRTA 4WDRA 3BSYA 2Q5OA 4DDWA 2HSZA 2YQ4A 5MFPA 4YJHA 3U7QA 4JC5A 1C1DB 1QORA 4LE1A 1KEZA 3GMSA 3IPCA 3ZGNA 5F76A 1VDZA 1NDHA 3G5AA 5KYVA 5BVHB 1GPJA 1AGRA 1JR4A 3PGVA 3WMGA 1GVNB 1SUSA 3O7MA 2ZZKA 4LN1A 4ZK6A 3COVA 2AV6A 2W2NA 5DVZA 1M2FA 2IYXA 1R16A 4HPXB 4DMGA 5BMVA 2P77A 1RIIA 4R2KA 3IUJA 3RG8A 2ALJA 3RSLA 2DWOA 1EAYA 1FXWF 4JQYA 4AK9A 1CJCA 3B5JA 4WEQA 4RDCA 4C2TA 3NDIA 2FPPA 3PC7A 1J2YA 2LUOA 4QOFA 3Q7IA 1P44A 4F5WA 1UAYA 1PGOA 2EVWX 2B0CA 3EXEB 1GP2A 3LX8A 4QTZA 3T7CA 2ZQ5A 4ESOA 3HCOA 5KNBH 3TX6A 1V7ZA 1P0CA 1XZ8A 3I6YA 1BQ3A 1JEDA 3WAJA 2CHFA 1GZ5A 2HDWA 1PW5A 2WE7A 3ZR4B 1EFKA 2C3PA 1TW3A 4QU9A 4DZTA 4GPEA 1PWXA 4LZAA 1AA9A 1ZGCA 2X9LA 3NNSA 1P2TA 1U7PA 1ZNWA 3TZHA 4EHKA 4PQEA 2JEYA 4O8ZA 1RHKA 4DG8A 3KYDB 4MR7B 1VJDA 3C45A 3DW1X 1ZN2A 3ZG6A 1RYYA 4LDQA 1ORWA 3FTFA 2CLOB 3G2MA 2V6MA 2O7RA 3MWFA 3Q0EA 1VSUA 1A7AA 1OU4A 2JHAA 4TWBA 1YDEA 2QTGA 3A7DA 3W6PA 3JWGA 3WP1B 4O4LA 5CFNA 3VJRA 3ZNOA 1BGVA 5ICSA 3TAXA 1JHAA 5JZ9A 5DPMA 3LKVA 2LZ0A 4MWDA 4B40A 1R0LA 3FPBA 3MN1A 1THZA 2FY8A 5L3RA 2ZSJA 3BZUA 2C0QA 1G98A 1CF2O 3EZLA 4CLEA 3RJZA 2NOAA 1X13A 1YR1A 3TGPA 1JA0A 1MQAA 2GASA 3ECAA 4LJ4A 5TGDA 1X80B 1WNTA 3GPBA 5TQ0A 3RVPA 1PR4A 5HBGA 3EASA 3HYRA 5HJ2A 2AZMA 4ZJUA 3FOFC 2M98A 1P6UA 2BJVA 3QUTA 1DRJA 4CIWA 3WQBA 2J33A 4G5HA 3KTOA 1KYVA 2VYCA 3VGJA 4RTPA 3QVTA 2D06A 4J0GA 3SMVA 2DR2A 3A2KA 1UDAA 4NNOA 1QZZA 3UGKA 1GZHB 1SQ6A 2P8SA 4FFVA 4M9QA 2BKLA 1KSJA 2GN0A 2UYOA 5GONB 1TTQB 3ZDEA 4MV7A 4FXPA 3PNPA 4YT5A 1RAFA 5FXMA 1PCXA 5M29A 1NQVA 3RJ9A 3T1VA 2CLSA 1CULC 2FRDC 4OO3A 4LAFA 3FYTA 2CSXA 3IBFA 4QOHA 3T0IA 4RD3A 1XGKA 4BVJA 2OXTA 2DCUA 4TS1A 4D3DA 3H8SA 1T10A 2G5GX 3O7WA 2C7VA 3S2FA 3TEFA 1U2GA 1PLLA 2DHRA 1XWWA 1VL2A 2MSEB 4RVHA 5E1MA 5CK4A 1F8XA 5B1SA 2W6CX 5FUQA 1BXRA 2XXAB 4CF5A 4N0QA 2VDOB 3OKFA 1LPNA 3C3XA 4V24A 2BOVA 2C61A 4Q7EA 4R5MA 2R7NA 3U9SA 1TM5E 1NJFA 3CW8X 5AKYA 3J81A 3ED5A 4LBZA 1HDRA 3LY9A 2ZM5A 3DH0A 4JL8A 4FYPA 4UZSA 3ZHSA 1E9AA 3IUQA 3HBLA 1NRWA 2RCNA 1GTSA 1T9GR 3WMRA 1YQXA 4CQMB 4F84A 4D9NA 3GIDA 4GVLA 1CE8B 3DDNA 4A6XA 5DGDA 4J94A 1VGVA 3GIWA 3L9XA 3WGKA 4NV0A 3OLCX 1VM6A 3NASA 3O3NB 2G3YA 1Z4NA 2C82A 3CSSA 2ZUUA 3C3YA 1CF4A 5K03A 3NFYA 4ZOCA 2WUDA 3C1AA 1PR5A 1XF1A 2WB4A 1JSRA 3WQRA 4EIWA 5I7VA 4TUYB 1KTIA 1Y6GA 2FFRA 4PSUA 3KDSE 4YIHA 3I0ZA 3DTYA 3LL7A 4YPOA 4D96A 1Q57A 2GN9A 4N0EA 3MJSA 4H0FA 4PPFA 1P6XA 4ZAGA 4A82A 2P9CA 2EZ9A 4EFLA 5DTMA 1DRVA 2AT1A 2OSVA 3I9NA 3ZV6A 4B3JA 4PG8A 5CA0B 1I7NA 2HBRA 3EJWA 1NP7A 2JFWA 4FS3A 4RK0A 2C84A 4YRAA 1C0PA 2FWPA 3OOYA 4QUKA 4INPA 5D00A 5B12A 2I66A 2PS9A 4EYGA 2DUMA 3ND5A 2ZRJA 4IXWA 4XGKA 4YRMA 4PBTA 1ISHA 3LVFO 4Q00A 1QX3A 5ER9A 2B7LA 2SECE 1K3TA 3MJHA 4RLHA 3Q2KA 3T3DA 1QFJA 3EVFA 3TLGA 4MQFB 3UNXA 4OPMA 4ENUA 2G63A 3I0MA 3K0SA 1WM1A 3WG9A 2ZDQA 1M2KA 4LNUA 5JCJD 3GX1A 4GL2A 3AW9A 3KALA 2F1HA 1KIAA 3OZSA 4FZRA 4OXIA 2HJ9A 3QMVA 3BMCB 1ESMA 1MP0A 1RTKA 2VT7A 4B44A 4DV5B 1RMYA 3EULA 2YOGA 4MRMB 3VZSA 3UH1A 2B69A 5AVUA 3ZE1B 5E9JA 4IH9A 4Q1EA 2I7CA 1F5NA 4W99A 3K05A 1T15A 3K9BA 2MYUA 4XD7D 1OT3A 1RWNA 2FNAA 3SM9A 3V2GA 4DDVA 4KYUA 1WW2A 3LW8A 1ZM4A 1QB7A 2VZEA 2CV1A 5K8JB 5G02A 1F2TB 5FBRB 1JR3D 1QCCA 3AF1A 5FTJA 4EMTA 4N76A 2V3WA 2A3NA 2WYIA 1E7WA 5TQ2B 5K51A 4DAEA 3UHOA 5I48A 1ZBDA 2I7VA 4D4IA 1NQTA 3F1KA 4KO8A 4JQSA 2ZE7A 1K88A 3K9FC 2LCIA 3EVAA 3KFVA 1UMCB 3CONA 4YROA 1QG4A 3NGLA 5K0BA 1G20B 3VPHA 1W87A 1W29A 2AI1A 4ZFNA 4XWWA 3SXUA 1YQUA 4HTFA 3A6LA 3BWDD 8MHTA 2VNIA 5AKGA 3TZ6A 1UDXA 3BERA 4LF5B 3HBNA 1UMBB 5J43A 3PQ8A 1U0OC 4IOKA 5CK5A 3AZQA 5DBEX 4D6PA 4YJGB 1G16A 3H9BA 1BQEA 1Z4OA 3COSA 4TKMA 3VKHA 2WKQA 3MINB 4JJEA 2VT6A 1K9VF 3R5HA 5BRNA 4GQBA 3N8NA 4C14A 3K71B 4UM7A 1UANA 1RM0A 2RKBA 3WBFA 2H5LA 3TTYA 1HFEL 3ABSB 2WV9A 2NPOA 1DQSA 4JP1A 4NFLA 1V7QA 2XV1A 1E32A 1N2ZA 3NJ8A 2NVUB 5BVGA 1K0UA 4L0MA 3N8DA 4KR3A 2OD7A 3PUWA 5ALGA 4QPDA 3THXA 2ETVA 2QQGA 5EQJB 1XNGA 3E53A 3HI4A 3H2JA 5FPKA 1KZ4A 3K8YA 4LYYA 3KQWA 3FFAA 3HN6A 3WHIA 3NBAA 4MUMA 1P5FA 1G38A 2VQSA 1UJCA 1M1NB 1TLTA 3KUCA 2FPKA 4KQ9A 1IZ8A 4L78A 3R20A 3CHYA 2C04A 2EKQA 2HTFA 3BMOB 2UYGA 5B6PA 5DLQC 1XCOA 3E23A 1KJYA 3LBNA 2J0UA 1PWZA 5GJVC 3DV0A 3ZDZB 1E5DA 3DFZA 4W8HA 3ZOZA 3D31A 1AGPA 1DCTA 1BXKA 1Z2AA 4M0UA 2R0QC 3T7KA 1V11A 3OCJA 1P2DA 4UHEA 1QAOA 4CNQA 3EAFA 4Q3NA 1PK8A 2J6IA 5A6SA 4CQNA 4BFSA 3DHWC 3N05A 1SRRA 2C3YA 3EVZA 2O54A 3EYWA 1H2AS 1DQZA 3A36A 3ODGA 3FDJA 1QCDA 1XLVA 4J1TA 2QTVA 1VCMA 4WOPA 1QOPB 1Z28A 2GNOA 3IO3A 2IV2X 1G3QA 2IXEA 2AI2A 2BJWA 3HH8A 4E12A 3W7AA 1RAEA 1HEUA 4UU0A 3C3DA 3ZX5A 4YLYA 4CHTA 2HCFA 3QWHA 4PHFA 4FDAA 4I8IA 4JCCA 4KQJA 4N40A 4HOYA 1GZ3A 1K2WA 5GQSA 5GV7A 3U81A 1UKEA 3A6EA 2EL7A 3G1UA 4BGIA 4LDJA 1OGIA 1MIOB 2R6FA 3MUNA 3WL8A 1XYYA 2JIOA 2PL1A 1ZK1A 3HY4A 5KNCD 4ZU6X 4A23A 2Q3EA 2GK3A 3BUSA 2DT5A 3DOFA 1XIVA 4YO8A 1BHO1 1TJ5A 2H00A 2JA2A 2OBLA 3OMLA 4OQXA 1W0KD 1I1HA 2X2FA 1U99A 4GLLA 1CNEA 1XZKA 2YY5A 2R44A 3AB3A 3HNOA 3UG7A 3GROA 4B82A 3D6AA 4LW8A 2CEAA 3R3XA 1BE6A 1RYZA 2G40A 4OXXA 3DL7A 3CVUA 1IVYA 1GWNA 5TPWA 1RR6A 2ZIFA 1G64A 2GYWA 3CTMA 4HAWA 4PIPA 4V0NA 5DNDA 4ZCQA 5B2EA 4IIEA 1O4WA 4MHOA 1E99A 1U8YA 3LM8A 3RIYA 1JHPA 3SSAA 1UEXC 1FW6A 3EEFA 3EXG1 2J9GA 4OJQA 9MHTA 4CMHA 2ZVQX 4XFJA 4Z4QA 4CEJB 3FWPA 1UMDA 4BEBA 3SFTA 1GA6A 1HH4A 4CU2A 1CK4A 1Z0IA 2Y4NA 4OHOA 4IIFA 4W1RA 1W76A 2VWQA 1RRGA 1RKXA 1OZFA 4JB3A 1JQDA 1TZMA 4FEEA 5IH7A 1KK3A 4JL6A 5HGXA 4MWCA 5IK2A 5JG7A 4BNXA 3AUXA 5IDXA 1KQPA 1QGOA 4P3XA 1XRPA 1SUPA 4CCYA 2ZROA 3TJRA 5K01A 3WKDA 4PZDA 3QXXA 2CFIA 4WCFA 1KAEA 4GMDA 1XQXA 1CZOA 2W2OA 3SN6A 2JGDA 1X6VA 1OFIA 1G8MA 2Q6OA 4GL4A 4UQLA 2A0WA 4RIFA 3K6RA 1QIFA 1LX6A 5JZOA 2Q5LA 3TMAA 3UAZA 3FUWA 5EIEA 2EFHB 1AN0A 4RAOA 4R83A 3EDCA 2Z95A 1QMGA 4NV1A 5T6BA 3MBKA 3Q7RA 3ZEAA 1M6EX 1WO8A 2V6IA 4M9UA 4RACA 4UCFA 2FMXA 1JECA 1SKAA 5EPUA 1VGRA 1S5PA 1KBOA 4IQ4A 3TH5A 3ABQB 3P8ZA 1A9YA 3GFGA 5JS2A 3O8QB 5FWDA 4PBSA 1POWA 2IQ5A 4TWIA 3RK4A 5H5JA 4GYJA 2YBDA 3SYNA 4EI9A 3BC1A 1FIUA 4XGRA 1W2GA 1EA7A 1JXMA 2J3LA 2YXEA 4R2JA 5FYQA 1S1MA 2R8ZA 1OLUA 5IPFA 3M7IA 5A2QA 5KPJA 1TT5A 1RLJA 2AJDA 5IJZA 1SVNA 4FKBA 4PX3A 2QR3A 3H17A 3ZE9A 1UFRA 1FP4B 4UCXA 3B8EA 4H35A 1LRJA 1S3SA 1EGHA 3GRRA 4OYRA 5A1JA 5TVGA 3ZDAA 2X23A 5EUMA 5EEHA 1YO6A 4JYPA 4YXWA 1O8BA 2MOKA 4ZHSA 3NTOA 4WN9A 4R3NA 2WMNB 3ONWA 1ICIA 4CM4B 4F9EA 5LBIA 5BV2P 1M34B 1VB5A 1V5IA 3D54D 2CZGA 2HHJA 4KQFA 4PO8A 3C5WP 6REQB 4AT1A 5KB3A 3T7IA 2XZDA 3FHLA 3PVCA 4X5OA 3KVRA 3CEHA 3U4QB 4ZDJA 2V5UA 3D0KA 4RXUA 2M1XA 2O8DA 4X3OA 1ISJA 4R51A 1A2OA 4LI3X 3GRCA 3HG7A 2VCEA 5KO2A 1TIBA 3GJ5A 3BMOA 621PA 4CMAA 4GM4A 4TUYF 1WMAA 1NPDA 4WCVA 3NT5A 1OLUB 1P1KA 1ECLA 3OZFA 4GXRA 3T1QA 3VH3A 4AP6A 4DEVA 3SWWA 2G7MC 4II2A 4QBFA 5KQLA 3UJCA 4O25A 3OMWA 3O38A 3NLLA 4ZMRA 1CQZA 1GPMA 1OQAA 2X4IA 1RKUA 3BE6A 4HN9A 4O5OA 4PAGA 1TIKA 2NYAA 3NBYC 3URMA 3TW6A 3FNIA 3AM1A 3DYIA 4ZVOA 4ZV7A 1XDUA 1FSSA 3GLFE 1FS4A 5JQGA 3N2GB 2R66A 1VPDA 2MSKA 1N6NA 2REQA 4W9NA 1NJSA 2J0VA 2GXSA 4MZXA 2DH5A 3LBAA 3PFWO 4Q1BA 5AM0A 4E07A 3BRWD 4P1ZA 4HYEA 3R4VA 5DH9A 3FG9A 4EG6A 3KJNA 1D9XA 4H1HA 1K6JA 2WEKA 1OYVA 5HWSA 1P29A 4X7MA 1KSHA 4I1SA 1WPQA 2WVJA 2B21A 2WU4A 3H9CA 3QTTA 4UFNA 4L6IA 4N7BA 2JZOA 1JG4A 3VU0A 3HCPA 3PQDA 2JFQA 1GG8A 1UK8A 1WIWA 2GK6A 3JATB 3MRXA 2NO9A 1NHWA 4R84A 3CVVA 4QRHA 4FINA 4X97A 4UUAA 4LF9B 3L1IA 2OV1A 1KQFA 1G66A 3IAM6 4I19A 5EZYA 4NJEA 3H99A 4FGZA 4W1PA 4N8SA 3RANA 4ANFA 3U1TA 4WGGA 3JQ9C 3USCS 2W6ID 3ZVMA 5FBQB 5JVDF 4BWGA 3MMZA 2RHBA 3B2NA 2C3OA 2ZBFA 4O5AA 3H11A 4XCQA 4Y6SA 4LWQA 3I45A 4FGWA 3I04A 3NETA 1KARA 1VLMA 3EXFB 2BE9A 1H0RA 1P1JA 4TVSA 1KZ6A 3LKDA 4YAWA 3VSCA 3AXTA 1U0JA 2I2CA 3SQDA 3CF4G 1FQJA 2WU3A 2HZ7A 1RYMA 3PXUA 4TTQA 5K3SA 5EIWA 4YRFA 1DBSA 3UMMA 3DT6A 2UZAA 1QYVA 1VL5A 2I8CA 1RC8A 1YGYA 4MTCA 4LRUA 1N2OA 1D6JA 2GTIA 3OZWA 4MIEA 2J3JA 3TCXB 5EJ9A 2D2IA 2FQYA 2WJAA 4D81A 2P6MA 2C1ZA 2B8NA 4M8LA 2Q2QA 1WXHA 1VL6A 2J9RA 3E9NA 2G9NA 2B5WA 2H2FA 4CLDA 3VDRA 4UQPA 1I14A 3TQFA 4JJIA 2RGUA 3EFOB 2D3WA 3AY7A 1SVLA 4LNUB 4RZ2A 4ME6A 3K0CA 1WDWB 2QG9A 1P62B 4ZI5A 2OZKA 2GZSA 3H3FA 4BP8A 3KYJB 3IT0A 5JSUA 4DUZB 1ORTA 4YYEA 3RUPA 2GYVA 3FNEA 4E94A 1CUJA 1L5VA 2XUGA 1M83A 3SR3A 1E89A 4ZZ3A 3X1XA 1GZUA 1FNBA 1H2WA 1TGVA 1PS8A 2DY1A 4HDNA 4X20A 5DP1A 3ZJVA 1J4AA 2CGEA 4UQOA 1VLHA 2H29A 2VHXA 2ZBDA 1IOLA 4R98A 4Y30A 1HDOA 3UTDA 3P45A 1F2DA 1WCXA 2UVPA 3ETNA 2ZB3A 1NASA 1VLLA 3WGUA 1XG5A 2O2HA 4IDNA 3SKXA 5LIRA 2O8FB 2DU8A 1OXTA 1CJKC 3L6EA 5DGXA 5CVTA 4CDNA 4ZARA 3K70C 1Y3AA 5J5AA 3ZWMA 3VUEA 2DHDA 2OEPA 2ZXFA 4O2AF 1NOKA 2HF2A 1HORA 5A0VA 2WB2A 5JD6A 2PQ2A 1C1YA 1XI2A 2FQQA 3HACA 4TXJA 4AJEA 4H3HB 3PC4A 4BNLA 2PG3A 4PPQA 1F3OA 2QK4A 1JLMA 2H16A 3ONVA 5P21A 1CR2A 4I1OA 3TB4A 2YXLA 1OE0A 1ZW6A 3DPSA 3KC2A 5ICCA 5IULC 4D1YA 3HYTA 5CP8A 1G6Q1 4CBVA 5BN4A 4IDAA 1RAGA 2ZRKA 3MJEA 3MS2A 4DCMA 3SQWA 1XNJA 2B2NA 4DSTA 3NANA 2P41A 2ZR0A 1CXZA 2ZRCA 3LXXA 3LYHA 3M3HA 4KUHA 1J5EB 2DLCX 2ID9A 2Z98A 3PFIA 5LXTB 3VR6A 2JI6A 1KU0A 1EXWA 3TLXA 2RH8A 4DLPA 3KZNA 4QVIA 3GT7A 3ICWA 1GXSB 2DE0X 4FUQA 4LVNA 1EJBA 2R6DA 4BNUA 3KEQA 2FZGA 2XMRA 1KORA 3SZ3A 2UAGA 3ULKA 1Z5PA 3OQOA 4A26A 2AMYA 3CY6A 1J21A 4N0MA 2AOXA 3H8JA 4DIUA 3VSEA 5LKAA 1ZSYA 3IQDB 3E05A 4HQ0A 1QU3A 1UK7A 3N76A 3DMDA 1JG3A 1FDUA 3KEFA 4HLQB 3P2OA 4Y2TA 1Z29A 3OPYB 5JJ5A 3UYLA 1CVIA 4QGAA 3CB4A 2ORIA 5I01A 2NP7A 4AROA 2FFHA 1C2YA 1E8MA 1T35A 4AU1A 3KEGA 1V48A 3OIYA 4LY9A 2RH4A 5IYZA 2QU7A 2QLLA 3TINA 2A1IA 3ECCA 2YFHA 1JVBA 5IABA 1I8TA 1JTEA 3ZH2A 1Q15A 3IHLA 3PU6A 4QOJA 2ENWA 4X95A 4GWGA 2PZFA 4Z7OB 1VP9A 1SXQA 1EQAA 3T3NA 5L3VA 3BKWA 1KOJA 1JE0A 4FT2A 2WLSA 1PR1A 4Y67A 1DJPA 3NP7A 3WZLA 4XUEA 2JFXA 3EMVA 3OP4A 4C1BA 4ARSA 4EPXA 1IN6A 1TJ4A 4HGRA 2JRLA 2I8LA 2O3SA 2O3UA 4WK2B 3TLMA 2YJTD 3RV4A 2OZLB 4IOJA 2H31A 2IDZA 3A1CA 5L7YA 3WGQA 1S1CA 4HAIA 4C0JA 3MD0A 1X7ZA 2G4CA 3IPLA 4OYLA 1CEYA 2X22A 4UHDA 4O08A 3ZJ5A 5HQTA 3EFEA 1MRSA 1NSYA 2P5SA 3DV2A 4GR5A 3H1GA 4MR7A 5JYEA 2L2QA 2P7HA 2WWRA 1BE1A 3F3YA 4YN3A 3FVVA 1A50B 1KP2A 1QO7A 1GO2A 2F3UA 2JATA 2WSYB 4A36A 1XZHA 2XGGA 2NYVA 3EDOA 1ADBA 2ZE8A 1Z0SA 2CLEB 2O6HA 2XGSA 1COWD 3WGVA 3FSGD 4DS3A 3M3DA 4DCOA 1B3RA 1DLIA 4L4ZA 4ZI7A 3LO5A 2IZ0A 1NUQA 4AG6A 4X00A 3I0NA 4ARCA 4DLXA 1FUKA 2OXCA 2QORA 3DM5A 4XCVA 3VZPA 2ZYDA 3M6IA 5LZ7A 1QUEA 2NZWA 3LW7A 4DBLC 3TRFA 3LVQE 3QEOA 5JROA 4ZMBA 2XB2A 5ICEA 3B9QA 1DXYA 5FUXA 1KS9A 2WUGA 4C4OA 4M86A 4LVUA 2GAFA 3EGOA 2XI4A 1ZONA 4OEHA 2EG5A 3M2TA 1QGUA 3CZRA 1VBNA 5ILOA 4P4UA 3UAVA 2JH8A 4F6CA 2O23A 5ITZA 4N41A 1BRMA 4ZGWA 5FEUA 3AF2A 1TVEA 2WF9A 4FOSA 2VJAA 4QUBA 3W34A 1MC4A 5DSZA 2HO5A 2G06A 3HV0A 5A6VA 1CZRA 1SULA 3H5VA 2XHZA 1HTTA 2FPGA 2RGYA 1OTXA 2Y1WA 3H19A 3IELA 1WD5A 3A1EA 3HI6A 1DEHA 1MV8A 1EE9A 2ZUBA 4IX9A 2V7UA 1JJFA 3EPRA 4Q3EA 4MYDA 3AH8A 3FMOB 3H42B 3VOAA 4QZVA 1NV8A 1WXXA 4L5CA 2RHTA 3K96A 5IAAA 1X1EA 3UXEA 4EKIA 3MWEB 2IYPA 1NUAA 3WIDA 2B1QA 3O8BA 2ZK7A 4FNAA 2FZKA 1SOUA 1VHQA 1KKUA 1PR9A 4PG6A 1ZHOA 2WW8A 1MEJA 4H7IA 4UREA 3PIIA 5L40A 3Q3EA 5BQOA 2C0PA 3U4DA 1W25A 1FMFA 3UW3A 1KBZA 5KMGB 3W3AH 1XEWY 2C7PA 5F51A 4AF7A 3VNUA 1JKJA 1R0ZA 4RTSA 2YIDA 4EAQA 3AXSA 3B36A 3IUBA 4JX8A 2RIRA 3BRWA 4O3FA 3K9CA 1C0EA 3CRRA 3K9QO 2ZJ1A 4UTZA 1M0SA 4ZVRA 5LP6F 3S3TA 1DCKA 1I13A 3NKLA 3PK0A 2MSCB 4QEDA 5G4KB 3RD5A 3KE8A 1DAIA 4PC1A 4URYR 2JGFA 4ZV4A 1Q1QA 4P4TA 3QIVA 4U1RA 2QQEA 2Z5GA 4V2UA 2AEMA 3CN7A 2YN0A 4GDFA 2HCTA 2HOQA 2M9MA 3ZWVA 2PK3A 3L5OA 3TMKA 4AN1A 1K08A 4NU0A 5K05A 1DBQA 2VH1A 3DZHA 3O5AA 4EJSA 4I9NA 4QBTA 4W1QA 3RARA 4NPAA 1SCNE 1TF7A 4HMOA 4MKRA 2FR1A 2GFIA 1AURA 1WCV1 3K20A 4OFXA 3TTUA 4FYVA 5H16A 1I3LA 3IJEB 3QJGA 1UZNA 1NW5A 4LWZA 4LWOA 4BQRA 4C03A 4C9BA 4UTPA 3GFQA 5F52A 3A1FA 4FPXA 7MDHA 5K4HA 1YIOA 1MW9X 2YASA 3RBVA 4MPRA 4L8WB 5AH0A 4QNNA 4B6RA 1DOHA 4DZRA 2FAXA 4I1YA 2OBMA 1WU7A 5A7FA 3IA2A 4HLCA 3A10A 3H4VA 4F9TA 2P78A 2R8YA 3KU4A 4L8VA 4TKUB 3UUGA 3WNZA 3NIDB 2KQUA 2V5VA 4HMQA 1QVAA 4QPPA 1ODTC 5DCUA 3CCBA 3U7QB 4FR5A 3CE9A 1T36B 4TLMB 4OI4A 2NW6A 1GLGA 3S1SA 2A1UA 4N03A 2ATCA 3NWJA 5IWAB 2GETA 4JGBA 5A0FA 4QGSA 2ZXUA 4OQEA 1BFKA 2W37A 4Q34A 3S99A 4PNEA 4E4YA 1RLOA 3LNCA 3DA8A 3P0HA 4RA6B 4LHZA 4U2CA 1UBSB 3QFFA 1IG0A 5JADA 3P9SA 2P2GA 4YRSA 2Q2OA 1OT5A 1JKMA 4HLDA 3TQCA 1QHGA 4A3SA 4OGGA 3IV9A 1TKBA 2V7GA 2DUNA 1QZTA 3MXOA 1QDEA 4UHFA 2BFMA 3KVVA 4X8OA 1Y6FA 4PIMA 1ZGHA 2IBTA 4PLZA 3OG9A 1M10A 5BN5A 3AYXB 2M6KA 4KO3S 3V97A 1DHTA 1NRIA 2RHWA 1RRCA 4ZDIA 2GWHA 4O59O 3FI0A 4L3VA 4YHBA 4CF6A 4YCNA 4K40A 1ZI8A 3ZDDA 1OZ0A 4OUKX 3SR4A 1U8UA 1X77A 4EAAA 3CG4A 1RLUA 4EYQA 4H2DA 1P17A 2GTPA 4IJ6A 1U28C 4CM3A 4DL9A 4DOMA 5I7HA 2OUIA 1AUPA 1YCDA 2OZLA 2R60A 1TI7A 3CLRC 4DLLA 4CL0A 2QYTA 4BB5A 1K4YA 4JT9A 2OPHA 1C3LA 4C0KA 1APBA 1E79D 2X5XA 1OKKD 4DM7A 1QQBA 2GERA 3M5PA 1I24A 4DLWA 4RTRA 1EK0A 1L8QA 3E4DA 4N82A 5BWCA 3GLIE 5A9RA 3ANNA 4NU5A 1QX4A 1VFNA 4E6EA 4N6NA 1XK7A 1PT6A 3V7UA 1QYDA 3AF5A 3KTFA 4PGHA 1B41A 5LOVF 2PIDA 2Q7XA 2A67A 3TLEA 3Q2IA 1LK7A 2Y05A 4C6HA 4AJJA 4ML3A 1MAVA 1SEVA 4ZT7A 3H16A 2IH5A 3P9ZA 2NTJA 4BP1A 4JXZA 1T3TA 1I5RA 5K8UA 4M22A 1SPXA 2QW1A 2X3YA 3LDGA 4U7HA 2F3PA 3KP1A 5T8KC 4CMIA 3GZNA 2ZJZA 3V9PA 2BMAA 3KZCA 1L7EA 4KXXA 2FSUA 2BMWA 1E2JA 3LDFA 4GT1A 1XP5A 4H7PA 4HMPA 3IQWA 3QU2A 4MUKA 2VRCD 2FUG6 1EP2B 4A2WA 2VPPA 5AYVA 2ZUEA 5BXQC 3W9SA 4BLOA 5HUHA 5F12A 4DCJA 1KI6B 1EUDB 5KOJB 1VE3A 3A58B 4EI7A 4L3OA 1A71A 1M72A 4WN3A 4ALLA 1R6TA 4C5BA 3M81A 1COZA 3UJ7A 4RLSA 4EZIA 4EW1A 1C5KA 2YDYA 4S04A 3T52A 1LK0A 1ZLYA 2B25A 2A0XA 3KHTA 3G9TA 4L1KA 1QK3A 4L57A 4Y2UA 3RC9A 1I2CA 4D8XA 3LBIA 3OD5A 3WC4A 1ZD5A 2RE8A 2XUFA 4JT2A 2V4MA 3AONB 3OLZA 3NHLA 1PNTA 4MYUA 5E2BA 4EMBA 1YCHA 1X74A 4TV8F 1UC9A 2OO5C 4U2GA 1LTHR 4DIBA 2QWXA 1DAFA 1SXJE 4ND3A 2IZ1A 2G9QA 2OLKA 3IP1A 4D44A 5ICFA 1M6WA 1UEJA 3RRXA 5BNWA 4DRZA 4RK7A 1U63A 2MYPA 2NZYA 3BL5A 4RIEA 3GEMA 3SYMA 5AVQA 3THWA 2I4MA 3NBXX 3MHPA 3AUUA 3GUVA 1R4AA 3N70A 5K0CA 3GNSA 4KQ2A 4B3CA 1RHRA 3PE4A 2EJBA 3OIUA 1ZJJA 2AFHE 4EJ6A 2PO5A 4NTZA 5NLLA 1T4MA 1I4DD 2BVNA 5AVRA 4YJ2F 4DBZA 2PQ6A 1J5PA 1R0YA 2YHAA 1LDBA 3ZY6A 3O3CA 2FPGB 2NZXA 3BWBA 4BZQA 4C7KA 2GCGA 4LJ6A 5AXAA 1SXJA 4MYSA 4V0ME 4YVFA 1PG5A 4UPEA 4YJFB 1JR2A 3BWVA 4HAYA 4NZPA 5CB4A 4YDHB 1XRRA 2IIBA 4Z1OA 5ES4B 3PG5A 5ERYA 1UXIA 2HPVA 1GUFA 1HOTA 4HVAA 3BCRA 1YVDA 4H59A 2EARA 4MW9A 3IJ5A 4UFPA 1ULBA 3EA4A 4B85A 3L40A 4R1UA 4YQEA 3QPWA 1MKYA 2BGUA 2C94A 3M4XA 1TA0A 4ITVA 1ZU5A 3A4YA 1JA9A 2MJLA 2OO7A 4R0NA 4CIVA 1IQUA 2NUBA 4HDRB 5HOQA 1A9SA 1XWFA 4K6HA 3AKCA 4CKWB 1VI6A 3BN3A 5AO9A 1KYTA 2EBHX 2XTJA 1U31A 4CT0A 3HTXA 1UDRA 4J0HA 3WBKA 3F5MA 3MT9A 5DISB 1YFJA 3WL5A 3OSZA 4CEHA 3GZTB 2A0YA 1EZZA 4IVPA 2LKCA 1B43A 2JFBA 2ZDGA 3HV2A 1C7IA 5GVSA 4X45A 4YWJA 2BSXA 5TMBA 5CVCA 3VHXB 3PDCA 4JDUA 4YUWA 5K3EA 1IM5A 1KP3A 1Q0PA 4NG4A 2IX3A 1D0SA 5M7EA 5J4HA 1V1JA 3EQZA 3GLHB 3QE9Y 4M1OA 2MYTA 1EQ2A 2CD7A 1U0FA 3GJ4A 3OTIA 3E7FA 3RI3A 1RJ9B 4XD2A 5G3ZA 1YS6A 3VYUB 3WIEA 3GAMA 4YRCA 3ZBPA 4BQFA 3LP5A 1Z5GA 1FYEA 2GUWA 2A7QA 4KMRA 4CMJA 4DLYA 5J2TA 3WK7A 3IKMB 1VKHA 3WR5A 1L6IA 1ZESA 4NQZA 1QIMA 4B2PA 2HBQA 4JUIA 4DJDC 1FJHA 5CUQA 5AJYA 2RI1A 2GF0A 1SGWA 2Q8PA 1RWPA 1YWGO 2R6AA 4Z86A 3U40A 1Y7LA 2G4VA 3PEVA 1RI2A 4HFJA 1DZ3A 4EATA 2IXAA 4X44A 2DP4E 3U5ZB 4R69A 4YBRA 4XR9A 4PYKA 4Z3DA 3BXXA 3NVAA 2QP3A 1TYDE 1TEVA 2W2TA 3PI7A 1XLTA 5LWHA 2WSSD 2D1SA 3QNUA 2E21A 1T2DA 1CNMA 2YHIA 4NENB 1B8UA 1DOAA 2WNHA 5EFZA 3RNLA 4BAUA 1OBOA 3C3EA 3PE3A 4HATA 1A95A 4C4PA 1U7XA 1TEHA 5JLJA 1UJ5A 5DU2A 4JP2A 4QUAA 3IDSA 2POCA 1YRWA 1USVA 2AOWA 1RQRA 3EF0A 3O1HB 5FD8A 3RS3A 2XYQA 3L1VA 3NATA 3WLAA 1UJMA 4E6PA 2J32A 3JQAA 1T5LA 3CB2A 1QOQB 4YCDA 2X0EA 4UMVA 5EWLA 2V7QD 1ZJ4A 2EFYA 2HWKA 1SB9A 2JLQA 2VKTA 4UXHA 1SVSA 4RA6A 4KVGA 3C6YA 4URFA 3S2EA 3MT8A 1U7OA 3PRYA 3CX4A 4BJ5A 3X1JA 2IHVA 3EGWA 3U4QA 4CKCB 2QUHA 2GILA 1LU9A 2HSGA 2I7DA 2IXTA 2EX1A 1HDXA 2F9MA 2WVAA 1SHKA 3O1JC 1Q1AA 3DB2A 1J33A 1BD3A 1KBQA 4RE5A 1MB9A 4GLJA 2LR0A 3I39X 4I5IA 4ZEWA 2NSHA 3IHWA 3PUYA 4K6KA 3WFJA 1RWOA 4MW1A 4PNZA 4X85A 2IF2A 2C7RA 3K5IA 5IM5A 1WZUA 4TL6A 5BW6B 5C3UA 3BWMA 5CFZA 1KWGA 3VJLA 1TNDA 3DUWA 2CXSA 4MIKA 3PS9A 4TLEA 2OB1A 4QBKA 3I42A 2IEZA 5B6JA 2ZB8A 2VHTA 3QXSA 1L7MA 2LV8A 3D59A 3T9FA 2F7SA 3D02A 2JRCA 2XMZA 1P7ZA 2WIGA 4NBSA 3ROQA 3M49A 4QDOA 2VQEB 2Z8YA 3KXKA 1UBFA 4IZHA 1T4CA 1T4DA 1TF2A 1TB4A 2BFCB 2NO6A 1VI2A 1AN9A 2RB5A 2B1GA 5ALIA 4E51A 3W1EA 1HTWA 4E2WA 1JIUA 4KPFC 3SBXA 2YIMA 4B71A 1L4MA 4HD8A 1FYXA 4OL9A 2JKZA 4C3ZA 2O0KA 1X3LA 1IUNA 2HK6A 5JAIA 2CB9A 2IYOA 4LZNA 4D9JA 2KBFA 4DQUA 1Z17A 4RKWA 2GBFA 2Q5IA 2VJDA 2OXFA 1FFXB 1HQYE 1ODJA 2QR2A 1BCSB 4WXYB 4PRLA 2GYUA 2HK7A 3EQ6A 3FN4A 2VLIA 4UTVA 1BGWA 3NOXA 4R1SA 5HCIA 1II8A 5JCOA 2QMOA 4JC4A 4LC1A 1D1SA 1KIMA 3L49A 3ABRB 4L6CA 1JKJB 1NW9B 3K0AA 5ALXA 4PY2A 5GVRA 1FDOA 4F6LA 5JWOA 1DE0A 3ED1A 2XMPA 3ICCA 2GNPA 3GUUA 1B8PA 1NF8A 2WYHA 4NHOA 5K3FA 1H69A 1SBIA 4B3GA 4UTXA 5CCXA 5T4FA 3I92A 2BEJA 3TO5A 1FDIA 1QV9A 2OQVA 1KI3A 3A05A 4YDSA 1T2AA 4LSMA 4BO0A 1GZSA 3LE8A 1EG2A 3TNLA 3RJMA 1H2RS 1QYXA 3HN7A 4U7FA 3ORYA 5K8LA 1QRRA 1KR5A 4OLFA 2RJNA 3BOSA 1PJ4A 5AKXA 4K9DA 3T9DA 4B3DA 1AMOA 4RKFA 4XQGA 3RBAA 3EPLA 1A2KC 3M4NA 3QXHA 4EGAA 1YACA 2MINA 4AS3A 5KTMA 3SYRA 1Z35A 2B0JA 4FZVA 4AQYB 2VDUE 2YZKA 5D6NA 1KEVA 2HXYA 1F8UA 5EIAA 3V5NA 1SRQA 3L41A 4MQEB 4MVJA 4L5YA 2J3QA 3GUHA 4QT0A 1E7QA 2E55A 3ZJYA 4B8WA 5LFAA 3WGJA 3GO4A 4FKZA 5A7GA 3RRFA 4RV5A 3U48A 3ILXA 4I0WB 1FUIA 1S8FA 1ND6A 4MRRA 1MAHA 3ZWKA 1TADA 1FSFA 2Z1MA 4OSOA 4D9FA 3FWZA 1RXVA 3DLCA 4POOA 5T4EA 2Q0SA 1E1LA 1W34A 3FCCA 5T4HA 3BJZA 4PLGA 3SLKA 3GPCA 2L17A 1PJSA 2NGRA 2W98A 3NBKA 4NZNA 2JLVA 1PG0A 5JPDA 1P4GA 2V7PA 3EZ7A 1YTLA 4D74A 3MWDA 1JSZA 4MQ6A 5L3ZA 2CVFA 3JWJA 3KDAA 3MWDB 4E5MA 1N0VC 4GM0A 2C9YA 4OAQA 3ZX4A 1TKAA 4EITA 5D3KA 3U5TA 1NR1A 2CHGA 2EOAA 4YCAA 5IUKC 1PKEA 3FPSA 4JC0A 2P5UA 1D2GA 5TSDA 3E15A 3A3PA 4LQ4A 1N75A 3LQQA 5AK0A 4MI6A 3SZRA 1YZFA 4LYAA 2ZAMA 4MLZA 4FFRA 4BL5A 1R6DA 3FYCA 4HR7A 3QVVA 4Y2RA 4YQZA 5SZIA 5HHTA 3DL2A 1T2CA 4UEKA 3OA2A 3OBBA 4HNHA 4S24A 3M6FA 3ESZA 2AQHA 4NY1A 4QDXA 1CS0A 4LJ9A 3TYXA 1QTQA 2AFIE 3QY0A 3AINA 3OM0A 5L3SA 4LXXA 3EXAA 4Y1RB 1IAQA 2OWDA 2WD8A 1B7GO 3MUOA 5AR1A 2ZULA 3RS2A 2AZDA 2UZ4A 2YXBA 3A6FA 1C4XA 5IC5A 5A6SB 5F1PA 3DEAA 2AQ8A 1E6EA 1WZNA 5CG1A 1WW3A 1KDTA 2C54A 4LWPA 4F8YA 3CZ5A 4D4HA 1MX1A 4U63A 3VV3A 1MXFA 3SEFA 2HI0A 2E4XA 1SBQA 3BGDA 2PANA 4MB2A 4MGKR 4TLLB 3QEAZ 4QBGB 3HC7A 2VQFB 4B46A 1F7VA 2W2KA 3OZEA 3PICA 4G41A 3O4RA 2WHQA 5EXXA 4YV2A 3WBBA 2VI5A 2WJYA 4DLSA 1N5IA 3NG1A 4HLNA 3LLCA 2G7ZA 1ZPDA 4MKIA 3BHNA 2X5KO 1ONOA 2BGIA 3UAXA 4DLTA 1ZSNA 4U0JA 1K92A 4N7JA 3OUZA 5JCXA 2EC5A 5JSFA 1E18A 2PX0A 4MEJA 1SHTX 4R7ZA 5AJHA 4JVOA 3G0OA 2Q7OE 4AIRA 4ZI7B 1NKSA 5AK5A 1GPKA 3MAJA 4XDHA 3O4HA 2FFBA 4FUTA 5DI3A 3PLAE 4WE3A 5EPOA 1Z37A 1LEHA 1JLRA 2XE7A 3K4QA 4CLOB 1S7CA 2WFLB 3KYBA 4IYRA 2QD5A 2Y76A 5BUCA 1XRQA 4KR6A 1X92A 2PAAA 2E6UX 5DBGA 1EJ6A 1DAOA 2P30A 2VG8A 4HDKB 4PYMA 2BF7A 1DBPA 2Q29A 2O2ZA 3NAZA 4FYXA 3STUA 4GC5A 5CDTA 5EIFA 2QZJA 1ZGBA 3CUSA 2G9VA 3MOGA 1XZJA 4C4AA 3SIRA 2BT4A 2V3VA 4KR7A 4GXQA 3KR9A 4M38A 3TQSA 1P2GA 4IWNA 3CW9A 5FFMA 2DSTA 2OL4A 2RHHA 1EX1A 1SG0A 5DXJA 2P8JA 3R7BA 1YDHA 2R1VA 2WZCA 2XADA 3E9DA 1J0DA 2D1RA 2ZIEA 1HDYA 1QPGA 3EIQA 3UJNA 2XKKA 2X0FA 2Y1DA 2H4HA 1E0JA 2QTZA 2WAOA 2NUAA 4FHDA 2P91A 2I3DA 1JEJA 3LOPA 1MDBA 4WPGA 4EJFA 5JS1A 4I50A 1Z4LA 1EVLA 1ZN9A 1NG1A 2Q4DA 5EERA 5ERXA 5LNK6 1T2EA 3QEBZ 2Q07A 4KREA 3LJKA 2R6R1 3ZWNA 3ZCPA 3E70C 1OBCA 4L9WA 4C20A 2C92A 3AM5A 4ERNA 3EOBI 5FWNA 2J0QA 1YONA 3JTMA 3OWXA 2IS2A 2B1JA 1Y8RA 3ROEA 3T9AA 3RKRA 3D7KA 4LJSA 2IXGA 3MRTA 2QUBA 2X9GA 5KJFA 1SD5A 2YY6A 1E2PA 2Z9DA 4GI3A 4OUDA 5HDBB 4N3GA 1QNLA 2WWGA 3U1BA 3HUTA 2VDWB 3BWEA 3OIVA 4Z4GA 1V9LA 3GLSA 5K3FB 3FTCA 3ETHA 5FWAA 5H3CA 4WLNA 4AWAA 4BC1A 1TVKA 1V2HE 2XVMA 2B7CA 3KQNA 3COWA 1K5DA 4BRUA 3VZQA 1B42A 1IBMB 5C7OO 3UN1A 1M9NA 4PBRA 1DI0A 4TLAA 1NXTA 4XSGA 3G23A 3ZD7A 1M6HA 3RREA 1T6NA 4E32A 1JHQA 3NKFA 4HWPA 1BN6A 3FVTA 3OQ6A 3IDQA 3C24A 4PV7A 4TOIA 2R7MA 3TQRA 2OQ2A 3TLGB 3ZWAA 5HW0A 2DEUA 1J2TA 3TN7A 1QK5A 2ZRGA 3AZPA 4BGUA 4IDQA 2PS3A 2ZU0C 3RIXA 1SXPA 1AK9A 2G8NA 2X8JA 5E9AA 5EQDA 5ECWA 4ZK2A 5IS2A 2IW1A 2G1KA 3CGWA 4LGCA 5H02A 1CUZA 1XDBA 1ISGA 1V16A 1KETA 2JK1A 4E2XA 5E38A 1KNQA 1GM5A 1EP9A 3DWGA 1FTQA 1NBMA 4JITA 3U44A 1N5LA 5FNVB 4DDHA 4GKVA 1Z6TA 2WIFA 3O91A 4BEWA 1WPGA 2BC9A 2X1VA 3ONFA 1KVSA 3FNGA 1M2VB 4XFKA 1SIUA 2SCUB 5K0LA 1VLVA 4C22A 2QRVA 3UICA 4M0FA 3EFHA 4MMYB 1XMJA 2PUHA 4EHNA 1TMOA 3QKIA 3WYGA 3IUMA 2WM8A 4N01A 3DNPA 2AN5A 1QXSA 3L8HA 3GXOA 4KE6A 1JH8A 2M2IA 4AY3A 1MOQA 1EFUA 2XLCA 4YLGA 3U61B 4PG7A 1INLA 1CE8A 1EDOA 5LYJA 4CCYB 4H0CA 4WBNF 1QWOA 1OUMA 1UKAA 1NN0A 2V9ZA 1SMKA 2GHQA 5BYAA 1XRMA 4XUCA 4G8CA 4I5DA 5HYVA 4CLHA 2G0TA 1P39A 3MWGA 2P90A 3NGMA 4FFBA 1H66A 3K35A 3OPYA 5FUBA 4ZC8A 1ADJA 3NTXA 1BDBA 3R77A 4PHHA 1E2BA 1F2TA 3NBZC 1NZDA 1EMDA 3L0CA 4O02B 3NVMB 1IEQA 4FHCA 3VR1A 4YRBA 4W5TA 2BI4A 5F98A 3V1LA 4FILA 4IDPA 2O8NA 2GKOA 2I2WA 1G3IA 2QP4A 4FNGA 1P6QA 4IWXA 3SZLA 5FPQA 2VDRB 2V1UA 4WOJA 4LTNA 1SXGA 4RQAA 4AWBA 3OTGA 3P96A 2Z6AA 3EG9A 1S2NA 3FOCA 5B4TA 1M1YA 3CLSD 2JBWA 3EQ2A 4IF6A 4UBMA 1CUYA 1P3JA 2W2QA 1OFUA 16PKA 4G5GA 3ZD6A 2NTNA 4PAMA 3ZGOA 2EZTA 5E4JA 3GDOA 3SGLA 3AKZA 4E31A 1HC7A 3CRVA 3KKMA 4P4SB 2JFPA 5AOCA 2W83A 4RX1A 5BQPA 3NQ41 3VSAA 2HCBA 4EKEA 1N0IA 3WGZA 2BM9A 2XNCA 3DS8A 4HEA6 4KPGA 2XRZA 1H4VB 3EDQA 5SYNA 1U2QA 3ICPA 3P2JA 3JR3A 1LH0A 3I72A 4TLDA 1TEXA 3PNSA 4XWGA 3R3WA 1IUKA 3ELDA 3L1UA 1KP9A 3Q8WA 4DIKA 1PWEA 3LDUA 1TO1E 2V9CA 4LOHA 1KVQA 1ZGJA 2ZE6A 3DPUA 3DQQA 3JU3A 4YIKA 5FWYA 2P27A 3PGA1 1P5RA 4NH4A 4B3MB 5AW4A 4EMSA 4CM4A 4HGYA 5HR5A 2CXOA 1VG0B 3TQOA 1DARA 1UXGA 2PFGA 4EF6A 5DLYA 4MPDA 1NP6A 4NYJQ 5FH9A 2FG6C 1X1CA 4JXKA 5JAOA 2HTEA 3O8OB 1E2EA 1B8NA 1H1LA 3TNFA 2JJ8A 2D8AA 4MIOA 3C8UA 2QT1A 4C7OA 4ED9A 5C1BA 1OLSA 1XHFA 3A3KA 3DDZX 1NIJA 2QAGA 4F7DA 4HLUC 3RKSA 4TYNA 3Q2OA 1ZM2A 2YWBA 3OWOA 4UE2A 4AMZA 3CRZA 4B76A 4EP1A 5DHPA 1L5HB 4QHYA 4AJ4A 2G9UA 2OA0A 3U7HB 3IAS6 2RK3A 4OGFA 1PF7E 4ZCLA 1W5SA 3N59A 3HN2A 1RS0A 3S44A 3CMMA 4OBWA 4LCEA 3TRHA 3CC8A 4G8DA 1BMTA 1TYEB 5LQDA 4B6EA 5JW6A 1OTYA 4KRFA 2H6EA 5L53A 3ZNNA 5KNDA 1NIPA 2JW5A 1SD2A 4CDMA 3CJRA 7MHTA 1EE1A 3DMHA 1E6MA 1K8XB 3BL8A 3MVEA 3IR7A 4BMXA 2NQ2C 1T1SA 3DVQX 2GYYA 5K99A 2OFOA 1NBEA 3H5LA 1V7PC 3MGGA 2V7TA 4O4IA 1A4UA 3FTDA 1NP3A 3R5TA 4WGFA 3RSZA 1YS7A 3A4TA 3F5SA 5LSAA 4BTLA 1KMHA 2O0MA 5BVGB 4BWVA 3JAMA 2HSEA 3HJFA 4OIMA 3PP8A 4QU5A 5LYJF 3R3YA 4AG5A 3KKNA 1ZJWA 4UU7A 2BF4A 4EY7A 1PG2A 4YR9A 3DO6A 4JELA 1VXOA 1T8RA 1Y7TA 4NE2A 4EKDA 5AW1A 2R1ZA 3DE1X 3MCAA 1SZPA 3GZNB 4BNJA 3ESAA 3W04A 4DUPA 1P1BA 2H7CA 3OF3A 1VL8A 4G8JA 1HA3A 1V1MB 1H2BA 2Q4TA 2VQ3A 4JLUA 3I1FA 2QBYA 1DKRA 1WZCA 1E2QA 4I9GA 2P3LA 1JJVA 4PPNA 5SZKB 4EM6A 2WJHA 4I46A 3Q40A 3Q4GA 2W0MA 2BZGA 1LBTA 4TL7A 1U0BB 5JAMA 2VHCA 3HU2A 3H2BA 5JHGB 2E1RA 1E7RA 2PGIA 5CNIA 2CSUA 4WD3A 3EF3A 1ONPA 4BX9A 5HKOA 1S2IA 2WJGA 4OAOA 3VO2A 3WL3A 5I3CA 3CNBA 2XCLA 1CZLA 3TJZA 4FWIB 5DM1A 1XAIA 4G0PA 1RLIA 4JEIA 4AMYA 3B3JA 3I05A 4HBZA 2WWWA 3EVBA 1HLGA 2GDJA 1CTQA 3ZI4A 2K6GA 1IN1A 4E13A 2XCUA 3ITNA 5LZ2A 3LIPA 2QD1A 2P2NA 1Y9ZA 1M3SA 1Q50A 4Y0NA 1IY0A 3R0XA 1XA4A 3HJBA 2ODTX 3R41A 2DM6A 4WBXC 4FE7A 3T5PA 2WSMA 2Q5QA 1EVIA 3FKSA 3TKAA 3D8TA 4NMHA 1N32B 1JQLB 3BXFA 3GLGA 2BRUA 4L5AA 3TOZA 2XUHA 3N7TA 1OASA 1CPYA 1DCFA 1JQ3A 3R6TA 3P2YA 2CFTA 5F77A 3KHKA 3W3AA 3SOPA 2VCYA 1ENOA 4DV4B 4R9SA 5CLIA 4BPBA 4EGCB 3INYA 1Z3CA 5TVKA 3RRNA 2C9OA 4QECA 3ZCVA 1ZO8A 3RRMA 3F97A 1G4AE 2PZMA 3E2PA 2C99A 3NM5A 4CM9D 4DDMA 3BXOA 1ITZA 2A58A 2CJFA 5DYIA 5EPEA 4C76A 4KX5A 4DM4A 1Q0LA 2DPHA 2J9YB 3LX6A 3ZV7A 4H7KA 4LG1A 3R8XA 2QVZX 4BPRA 3MUEA 3G59A 4I2VA 5FRDA 3UIEA 1PVDA 5HK9A 1KSFX 3FYSA 3HRIA 3OHPA 3WHKA 4BNWA 3HB5X 1BVHA 1T9CA 2ZRQA 1FPMA 3V32A 3OOSA 3DF9A 1JDNA 2DKOA 1N7IA 5CH3A 1F14A 1N9GB 2PZLA 1PEDA 1DXHA 3DE4X 3K0KA 3VMMA 4EENA 1TYZA 4YT2A 1C9JA 2X42A 1UR5A 3D8SA 2OCKA 2C5FA 4TKVA 4KR2A 1SKQA 1WV0A 1KK0A 2CFSA 3SFVA 2DAPA 2WJ4A 4QGBA 3GLRA 5HA5A 4GH5A 3DBHB 4ZEVA 3KWLA 5AI8A 3LK6A 2R8OA 2PMFA 5TMDA 4GX1A 1QG2A 2FN9A 2J4DA 2FLKA 4C21A 2CK3A 4U7PB 4EFDA 1CUAA 1J2EA 3IKVA 2VC2B 5FTMA 1L9KA 2FTKE 3SC6A 1B1AA 3TECE 2UUPA 5CD1A 1Z4IA 1GTRA 4XD7A 1SIWA 3WGOA 2JCSA 2QRUA 4I4LA 2BMDA 1W59A 2IZZA 2RG7A 1JIVA 3UW1A 4YYZA 3FHTA 2QRKA 2PVPA 4XQ9A 2YHBA 4PS1A 3H2YA 3W8NA 4DWOA 1OF1A 1R0SA 2ASEA 4MCIA 2IVFA 4FEGA 5AOBA 3NHKA 1RACA 2PZAA 3NUZA 1V4NA 3E1GA 3UHJA 4FFWA 2O19A 1C14A 2QT9A 5DI3B 2QENA 4AF8A 4URXR 1FNDA 2GJ4A 4HAOA 3WLHA 3NO4A 4AZWA 5CT8A 3LUPA 3FFWA 4EUFA 1ZH2A 1OLSB 1QKIA 2BI7A 4B3FX 3IKTA 2UU9B 1YQGA 2CNOA 1AT1A 2V1XA 1B2RA 5AQEA 4HWGA 1VPVA 5D84A 1H6AA 1JDUA 1WB6A 1YJXA 2WQ7A 2UUBB 4D9HA 1XR3A 1JR3E 3JQDA 3H1BA 5KX5B 1PI3A 4R1LA 3CJTA 4FOOA 2C4KA 5FOUA 4ETWA 4CGZA 3QU5A 1KIFA 4CV2A 2D2XA 1IZYA 3BTVA 4J7CA 4LS3A 2HAEA 1ZR4A 3C98A 4HQOA 4ND8A 5AK3A 5EOVA 4BGEA 1I7DA 2BLNA 3HKDA 4GGMX 4M8NE 4BLSA 3FOEC 4MITA 3E82A 5JI2E 2P9HA 3LP8A 1F06A 1LTKA 1VRWA 3OCXA 4LZLA 4LXGA 3Q3JB 1RKVA 4EZEA 3A11A 3UB4A 2PSEA 5CT4A 2O2EA 4U3JA 1NX6A 2EGHA 3OC6A 3DMYA 3X43A 1JQEA 4NAHA 4GI5A 3N3BC 1QS0A 1GV1A 3W5IA 5H68A 2G0NA 3Q9UA 1P5JA 3WIUA 3ZXIA 2XUOA 1YJCA 2A5FA 4P3YA 3KQMA 3DVSX 2P1ZA 3PQ4A 4TYMA 3HCFA 4Y2QA 3KSAC 1TU0A 2QTRA 1FRZA 4LHSA 1NY5A 1HNNA 1ZXLA 4LJ8A 3VC7A 2Q3LA 1E1CB 4BNMA 4UOEA 4X62B 1Z36A 2YVAA 3HMQA 3ACDA 3KHSA 4FGKA 1W36B 3PUXA 3SJBA 3JQFA 5IJ0B 1ZMXA 3OJOA 1QNFA 5CU7A 5GADl 2YH2A 3FCYA 4KO2S 2YIVX 3AJDA 5H7XA 1CEEA 1SVOA 2NZ8A 4RVOA 4A0RA 1T0BA 4WLVA 4LSGA 3R75A 4P3NA 2FZWA 3RVNA 3UEOA 3ZU5A 4AMVA 1ZUNA 2VK8A 1LLCA 4LRQA 1RLTA 2W70A 1KRXA 5EP2A 3TTVA 3FLBA 1O6BA 3Q8LA 5EJ6A 3RSOA 4CV0A 3T7RA 3OZ7A 3U3DA 4NEHB 3T3EA 4YP5A 3LUJA 2CFRA 5GONF 3H6GA 5HFJA 1Y8QA 2R1TB 2ZRMA 3EGXA 5F35A 3UK2A 2D74A 8GPBA 4E09A 2OV8A 1QRAA 2ZI5A 1FJXA 4QHTA 3A1TA 2BFCA 5LMNB 4NEGA 2EQ5A 2Y71A 1OPXA 1Y3IA 2H1OA 4D97A 4LE0A 4KQ6A 3THWB 3G89A 2Q3CA 1GNTA 2OGWA 4IUDS 2FK8A 1H4SA 4J49A 2G70A 1E79A 5K6AC 5TS2A 4FM9A 1J9GA 1HYBA 3QTBA 4MQEA 2A3RA 1RYFA 4DILA 1BA3A 4MRAA 3G8YA 1W4RA 1FLDA 1VOTA 1LNSA 1NQAO 2G0AA 2UVPB 1Z15A 2HV8A 3IRVA 4NZOA 4TV9A 1DTSA 3K9WA 3GLUA 4LF4B 2O59A 3B7GA 3CEJA 3QI2A 1C1DA 1DPGA 1CEQA 1PFVA 1QQ7A 1NVTA 2M6SA 4IKOA 3EC1A 1JU3A 4RC9A 4CKBA 3CSDA 1BNCA 4BLRA 3EXHA 2I87A 2P3QA 4M1TA 4QPZA 3FSEA 5J1TB 2BE7A 4CFZA 4E1BA 2VIIA 3A9RA 2GPYA 2XGMA 3T0GA 4BVKA 3B1YA 4B47A 1E0AA 3ASYA 2XZTA 3C7KA 4JU9A 5DBIA 2OCBA 1NQXA 2G82A 2VP2A 3VYWA 1CRPA 3JD3A 1G19A 5KYUA 4A6DA 2QE6A 2JJMA 4CETA 4TMTA 4F3RA 3X3HA 3PGXA 3T7JA 4X94A 2DHQA 4LDZA 2PLRA 4QE3A 1JMKC 4CR7A 3DDUA 2BL4A 3H4MA 5CB4B 3KQYA 1Z68A 4S2UA 2AUMA 3Q7PA 2QGNA 1FQWA 5A4MS 1EK2A 1E3WA 2YJ3A 2HU7A 3LV8A 1JIXA 4ND4A 1EYZA 2GPTA 3TLCA 4H9GA 3AKEA 1TAHA 2QRGA 2OCXA 2XNSA 3NHAA 2IA5A 4PFQA 2OUKA 1ZWKA 1T6XA 2AYXA 3F6BX 4W9NC 3LQ2A 1JUDA 1O95A 3SE0A 2ORVA 1HDZA 2WWTA 3ZJ4A 2LVBA 1AHNA 3KWJA 4WECA 1NBHA 3DDCA 2JLCA 2OAEA 2ASVA 3ZXYA 4RCVA 1NG9A 2ZYUX 4WNIA 1C4OA 3SSNA 3CUTA 2CUZA 3RUDA 3PRJA 4B0OA 5C35A 4LF6B 2WMOB 3RNOA 4HQKA 2H4YA 3D6UA 4M9SA 2XOKA 3T95A 2ZWVA 2QN9A 1J8FA 1CJUC 1BJRE 1NPYA 4LV6A 4D98A 2FPUA 3AETB 1WQ4A 4I9UA 1OSNA 2VDKB 4BGVA 4YR7A 1LSUA 2FZ4A 1AX9A 2WHPA 4P36A 2J5BA 3QG1A 3VX4A 4DVJA 3PR2B 1YBAA 2AQKA 2QDKA 3FRHA 4KRXA 2O8CA 1E1RD 1VSTA 2FFJA 1BZYA 1U3VA 3KQQA 4ZGGA 4WKNA 2ISQA 3RFXA 4U7GA 4JI2B 3GLHA 2BKVA 3FWNA 3PTZA 1FZTA 1QQ5A 3VI4B 1CY6A 1CUBA 1YMQA 1HY3A 4MEBA 2GAAA 1MQ9A 4ZREA 4BN0A 4EGQA 5JD5A 4B48A 5ECGC 4YCBA 1QC5A 2RC5A 3RWOA 1XCMA 4MIYA 5BYJA 1Z08A 3TSOA 1ZINA 3RK0A 1FTWA 3UGQA 2Z43A 5BO5A 3W4JA 4M76B 5EGSA 1FNCA 3S2SA 1PFWA 3BK2A 3HGTA 4EHIA 2AK2A 2EKDA 2VP6A 5KJEA 4PTZA 3P9KA 2V98A 1Q7GA 3I37X 5EAIA 3AR2A 4RF3A 1Q3HA 2FDRA 3QJYA 5BV0A 1TAQA 2Y1GA 4DSAA 3IAUA 3VNRA 2I7XA 3OT4A 2J7PA 1DLJA 1PYOA 2NADA 4EPYA 1ZD9A 3GYBA 3JS5A 3DFKA 1PJ3A 3UHPA 1LPBB 3DP7A 4H7DA 1IXRC 1L7QA 4HDQB 4AUKA 3R4CA 5IT5A 2LCFA 1KFKB 3TVTA 5T7BA 2FZCA 1XRSB 4DV3B 2OCLA 4EL0A 1U5CA 4AXBA 4GSKA 2I3AA 3GDHA 2KMLA 1C9KA 4FT4A 1XQ9A 3WISA 3HA7A 2IU6A 3AV3A 3I9OA 4PG4A 3VO1A 4Y2JA 4YO7A 1P77A 1NJ5A 3INNA 1JKXA 1WNFA 1ZRHA 2E4UA 2ZCJA 5AKLA 5EJ4A 2AKEA 4IPTA 3QLTA 4FJ2A 4MWSA 4Y2YA 5C7LO 3IT1A 5BYBA 4H1UA 2VWHA 4CMGA 5AUPB 2RJOA 1KJZA 4RK5A 5DCYA 1ZGGA 2PWBA 4OHYA 1QAQA 3A1DA 4RPLA 1XEXA 3GAAA 5GMOA 3EPHA 4JZKA 3GJZA 1F12A 1U94A 2ZRFA 4PFJA 4B3SB 2P2DA 1X2EA 1T0UA 1TO2E 1WY5A 3E0XA 3RR2A 5H9VA 2Q4BA 4NPHA 1GTG1 5HCNA 4U2FA 2YMQA 4GMFA 2GI4A 1ES9A 1WB5A 5JCZA 1DFHA 2WG2A 5B3JA 4CQMD 5EKDA 1DUVG 2BGMA 4JP5A 4KZKA 2JZCA 1RYEA 5GY7A 2YFYA 2FP4A 1PSDA 3CUYA 1JSXA 4O6VA 5KKAA 3R9IA 3SEZA 3ZI0A 1PR6A 2IJGX 3OLYA 4ZO7A 3ZS8A 4TTPA 1A9PA 2UV8A 1K06A 3P9XA 4MA5A 4R2MA 1P4JA 1QF7A 3AESA 1KQNA 3DDOA 1DIOB 2BN4A 4MI1A 4CUJA 1Y1QA 5JAPA 3TLJA 2CDRA 3NHUA 1H0SA 5AJZA 2ODWA 2Z83A 1T9HA 4LPSA 4D9EA 4DR1B 1HGXA 1RDFA 4PXYA 3KQHA 3UK7A 1GQRA 1NXWA 2FSSA 3V00A 4BV8A 1UWKA 1I2BA 2C2HA 4P3KA 5EUQB 1VQ1A 5G0UA 2AIRA 2OMEA 3FKQA 2F48A 3SYLA 3PEFA 1XAHA 4GOJA 3QX3A 1GEGA 2L19A 2WAMA 4KIWA 2BGLA 3BHMA 5EQTA 2GM5A 4YP9A 4D0GA 3FNHA 3N74A 3SBEA 4CF3A 5A62A 4UAGA 5HRAA 2HK9A 1YOBA 4TS3A 4DREA 3H9QA 9GPBA 5JTTA 3AV0B 4O2AB 4CIBA 2HH9A 2W8ZA 3FRIA