3U81A

Crystal structure of a sah-bound semi-holo form of rat catechol-o-methyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
218
structure length
218
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 218
sequence length 218
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2011-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3u81A00
3FYDA 3C3PA 3CCFA 3KKZA 4HH4A 3TRKA 2HWKA 1M6EX 5LQRA 1VIDA 1KPIA 1UWVA 3V97A 1IXKA 3QOWA 4MTLA 4E30A 4EMSA 2IH4A 4HC4A 5HFJA 2CMHA 3CBGA 3LHDA 2FCAA 2GB4A 3G2MA 5EZQA 5CM2Z 4OA5A 5DWQA 1AQJA 1YB2A 3OFJA 1O9HA 1QAQA 2AN5A 1EAMA 2P7HA 4YUVA 4L7VA 4PIPA 3HCDA 4CTJA 4E32A 2BH2A 5EMKA 5BXYA 3KQYA 3KR1A 1O54A 3EEYA 4QVKA 2IFTA 3ELWA 4OQEA 1QAOA 5CVDA 5LQKA 2PXAA 3GRVA 4FP9A 3C6KA 2JHCA 2WA2A 1NE2A 4KRGA 4R05A 4PYKA 5K0GA 2HR1A 1XDUA 3NW9A 5DRTA 5E8JA 3B7PA 3ORHA 3P2KA 1N7IA 5EKUA 3LECA 4QQNA 3MQ2A 5GP1A 3GU3A 4F84A 3FTCA 2Z6UA 2Q41A 2IP2A 4RVHA 3EGVA 4PGGA 3GRZA 5K0NA 3SX0A 3HTXA 3PX2A 2BM9A 3RW9A 4NECA 2C7RA 5DT2A 2EG5A 2QYOA 4OA8A 1AF7A 3DXZA 3EMDA 3UJ7A 2AR0A 2ZIFA 2ORED 5EQJB 3REOA 3B3GA 1EJ0A 1ORHA 3MCTA 3AXTA 2NXCA 3HVHA 3KR0A 2IGTA 3MTEA 4WXHA 5KS2A 1YFLA 4KWCA 3PLAE 2ZWAA 3R9XB 5CVJA 4RTJA 3P9NA 1EIZA 2PY6A 3O7WA 4C04A 4RVFA 4C07A 1RI5A 1L3BA 2PGXA 4PWYA 5K8VA 4C08A 4X61A 1EJ6A 4IV8A 1RI3A 2K4MA 3KQPA 1IY9A 2YR0A 4M38A 3UJ9A 4C05A 2AOUB 2IBSA 3M6VA 4MHTA 2FYTA 2Y1WA 3SXJA 1TPYA 1G8AA 1VP9A 3PB3A 5EG5A 4GC5A 3EGIA 5EC8A 3SGLA 4YMGA 3JWHA 4FS8A 1NT2A 3FRIA 5EEHA 2C7OA 4X1OA 2ZBQA 4QPNA 5C9ZA 1NW3A 2NNWB 4HSGA 4RTSA 4GQBA 3E23A 1JG1A 3BGDA 3HCCA 3IHTA 4DM3A 2B2CA 3FYCA 5K01A 3C0KA 4MQ4A 2AOVA 3THSA 2OO3A 1JQ3A 2ZZKA 3OE5A 4WVLA 4F85A 4RTPA 3ME5A 3O4FA 3KQQA 5DM0A 5LSAA 4LWOA 5M5BA 5HIMA 3EVZA 4FT2A 2B3TA 1Y8CA 5T6BA 4KIGA 1L3IA 1UFKA 1VE3A 2Y1XA 4EKIA 1G8SA 3FUXA 1ZKDA 3EVBA 4IWNA 4QDKA 4PYNA 2OY0A 3EVAA 3G2QA 5DTMA 4ZTBA 2PJDA 3NDIA 4CKEA 4KW7A 5CVEA 2PWYA 3B89A 4GF5A 3FTFA 4P7KA 3BWBA 3HCFA 3E8SA 4PYLA 1P91A 2ERCA 1BC5A 2VS1A 3KQSA 5DM2A 2Z6QA 5K05A 2PXXA 3ELDA 2OB2A 3FRHA 2I62A 1DL5A 5KQSA 2CWWA 5E9WA 1O9GA 2O07A 5KQRA 3OCJA 3DR5A 2F8LA 1YZHA 2HMYB 2NXJA 4HGZA 4X41A 1RI2A 1R00A 1QYRA 5E2AA 3OZRA 1RI4A 3P2EA 5FADA 2GAFA 3G7UA 5ICGA 1G38A 3NMUF 2DPMA 4DCMA 2YUIA 1KP9A 3OU6A 5CVVA 1NKVA 5DX1A 1INLA 3P71T 3PFGA 5FWAA 5DXJA 4P7FA 3TOSA 2P3LA 4C4AA 1SG9A 4A6DA 3G8BA 2B9EA 5F2NA 4JXJA 1RI1A 3LL7A 2YX1A 3BZBA 1B42A 2ZULA 1NW7A 1ZG3A 3M70A 3KQWA 3PS9A 1VPTA 1YUBA 1RJDA 3A7DA 3CKKA 1YZ3A 1BOOA 4OBXA 5FA5A 5BP7A 3NVKI 3A7EA 3DMGA 3M6WA 2UYQA 4BP1A 1UIRA 5HIKA 4E2WA 4RYLA 2DULA 1JG3A 2XVAA 4PYMA 1FJXA 1H1DA 2R3SA 2ZLBA 4KDRA 1N2XA 3GJYA 4BLVA 5CCXA 2UZ4A 2GLUA 3FPFA 4KVZA 3G5LA 2EJUA 3HNRA 2PV0A 5K0CA 5KYGA 3C6MA 1G60A 5HIIA 1KXZA 5GWXA 1F38A 2OYRA 3T7RA 3A26A 3BKXA 1I1NA 2IDKA 1ZGAA 2AVDA 2OZVA 2AOTA 3S68A 2QM3A 4B17A 3MTIA 3BWYA 4E2YA 5GOZA 5DM4A 3UJ6A 1Q0SA 4ATNA 3EVDA 4PYJA 1SQGA 1XXLA 3AY0A 3FUUA 2ZZMA 2EJTA 3LDUA 2G70A 3E7PA 2ZFUA 3G8AA 4Y2HA 2NP6A 7MHTA 2BZGA 2CL5A 2ZZNA 2IIPA 2O05A 3NTVA 4DF3A 4EVIA 1AV6A 3PFHA 5EZSA 2YXEA 3PT9A 2YVLA 1Z3CA 1D2CA 2JHAA 3DOUA 3MGGA 2Z6AA 3UZUA 5G02A 4C06A 5MHTA 2GS9A 2JH8A 3DULA 3KQVA 3NWBA 4LWPA 3CJQA 4HG2A 1WG8A 2P3OA 3GDHA 3FUTA 2GPYA 3GNLA 3JWGA 5GM2A 2ZBPA 2QRVA 1VL5A 1X1CA 1ZHFA 2ZTHA 4V0QA 2G1PA 3EVGA 4C03A 2B25A 2PKWA 3DUWA 4G56A 3GO4A 2XYRA 3FPGA 1BHJA 2OBFA 2YXDA 3BUSA 5FUBA 5JUWA 10MHA 4GOLD 3ERCA 2R6ZA 4OX9Y 5DX8A 2ZWVA 2XVMA 1T43A 5DX0A 4ER5A 2FPOA 3B5IA 4XUCA 3GIWA 5EIFA 3BT7A 3EVEA 3HA3A 3IV6A 1JTFA 1Q0TA 3AJDA 3P9KA 4V0RA 5DXAA 4F86A 1QZZA 2BR5A 1V39A 1SUIA 1R6AA 2ONZA 3A25A 3T7SA 4R8RA 4PINA 1L9KA 2G71A 4ER0A 3UWPA 4Y30A 4PCLA 3CJTA 3KPUA 5U4XA 2YQZA 5DLYA 1KPGA 1R74A 2BM8A 4K6MA 3OPNA 4X63A 1NV9A 2ZSUA 2AOXA 1XJ5A 1KHHA 5T64A 3SSOA 3TKYA 3FPJA 3P97A 2UYCA 4YUWA 1R8XA 3HA5A 4RVGA 4LECA 5CCBA 2PWPA 5FQOA 3NJRA 2QE6A 5FHRA 3HCAA 4POOA 4CKCA 2C7QA 4RV9A 5EHIA 1QAMA 5HILA 3M6UA 4LG1A 1KR5A 1X1AA 2FRXA 2ONYA 3B3FA 1N7JA 2JJQA 4AZWA 3EEOA 3DMFA 3OU7A 3I5UA 3Q87B 2EX4A 2AS0A 2PLWA 5B1SA 3AXSA 5ICEA 4PYOA 5E9JA 2OKCA 5EMJA 3UJCA 1JR4A 2NXNA 3FPEA 3R6TA 1DUSA 5E1DA 3GRRA 2HNKA 3HA7A 4XUEA 3G89A 4HRAA 3DXXA 3TQSA 1SKMA 5FHQA 3PX3A 3MCZA 3KQTA 5IH3A 1SVUA 4E2ZA 4EK9A 2P40A 1TW2A 1FBNA 2BR4A 3LCUA 1ORIA 2P41A 5DTQA 2GH1A 3C3YA 3MAGA 4RTRA 2PBFA 2C7PA 1FP1D 5EEGA 4E2XA 3I64A 4UOEA 3UJBA 4CKBA 1NBHA 3FUWA 3CGGA 1RJFA 3TKAA 3HVKA 3CC8A 4PONA 5ICFA 3HP7A 3OZSA 5DPMA 3GRYA 4HTFA 3SM3A 1FPQA 4EQZA 4H0NA 3ER9A 1HMYA 2OPBA 2AOUA 2P8JA 3SMQA 2LD4A 5K0JA 3ELYA 3F4KA 3LBYA 5EMMA 4DKJA 1AQIA 5CVUA 4BY9E 4FGZA 3DP7A 2A14A 1M6YA 2FK8A 3LKDA 5DRYA 5T67A 2OXTA 4PYQA 5K0LA 1I4WA 2IH2A 5LQCA 2AN3A 4MIKA 4YV1A 3QV2A 1KYZA 1MJFA 1VP3A 1YF3A 3TR6A 2PX5A 3K0BA 5EVJA 5DSXA 2PX8A 5JR3A 3HEMA 3KR9A 3HM2A 5HIJA 4AUKA 1R8YA 2GA9A 3D2LA 3L8DA 1R18A 4PCAA 2CMGA 4IKPA 5FA8A 3BGVA 2I7CA 3U81A 2PX2A 1EG2A 3KU1A 3LSTA 3UJDA 1XVAA 3OE4A 2P7IA 1BKYA 1PRYA 4XCXA 5FQNA 4RTOA 1JQEA 3TM4A 4YUYA 3DXYA 3ER8A 4FSDA 2QRVB 4CTKA 4EKGA 1WXWA 1HNNA 4GOND 4YV2A 1YFJA 4GEKA 3SSMA 5D1HA 3TPZA 1JQDA 3VC2A 1RJEA 3FTDA 4KDCA 3KQOA 5ICCA 5GIPE 4P58A 3O31A 4CXMA 5GINE 3ANXA 2IDJA 3M6XA 1XDZA 5E9QA 4M7RA 4RVDA 5EIWA 3TFWA 5LQNA 1L3CA 3GCZA 3B3JA 3GWZA 3THRA 2YXLA 2ZCJA 2IBTA 3NDJA 4ISCA 5HOQA 5E1MA 1TW3A 5HEKA 2PVCA 4DMGA 1NW6A 2VDVE 3KHKA 3M4XA 3UJ8A 5E1BA 3DTNA 1NW8A 5EKXA 5P8WA 3EPPA 2ZVJA 4E33A 4QQKA 1I9GA 1NBIA 2KW5A 2XYVA 4FR0A 5CIYA 4GOMD 5F2KA 4A6EA 2BR3A 2O0LA 4FSXA 4DA4A 2CKDA 3CVOA 1P1BA 3TM5A 1WS6A 3R24A 4ER3A 2PT9A 3NVMB 2P35A 4U7PB 1NV8A 3A27A 4RTNA 2NP7A 2I9KA 2NXEA 2JH9A 2VDUE 3EVCA 4RTMA 5K03A 1KYWA 1ZQ9A 1VLMA 3AWIA 3JWJA 4HGYA 3LCVB 3T0IA 3HVIA 1L1EA 3SR4A 4DCGA 4RTLA 9MHTA 3ID6C 3MERA 1WY7A 1JG2A 2H1RA 5C1IA 1VQ1A 4M36A 5FTWA 5F2OA 5DTRA 2UYOA 3SSNA 2FHPA 5KVAA 2XBMA 1P39A 2ZIGA 4GUAA 5E1OA 3SVZA 4P7JA 3CJRA 3DLIA 2VDWA 3OFKA 5DSTA 4YUZA 3BWMA 3KPYA 3BKWA 2AN4A 3HCBA 5EPEA 5EMLA 4BLWA 3VYWA 1P1CA 3UBTA 1RJGA 3I9FA 5DM1A 3TMAA 3LCCA 2JG3A 3PVCA 3V8VA 3G88A 1OR8A 4QTUB 4PGHA 2WA1A 4Z2YA 4RX1A 1WXXA 2ZW9A 3R0QA 5HZMA 2NYUA 5H02A 3MHTA 5E8RA 1D2GA 2YTZA 1XDSA 3G5TA 2AVNA 3GRUA 3M33A 4IV0A 4BP3A 3OU2A 2PT6A 3UA4A 4DQ0A 4PNEA 3HCEA 3DLCA 2V74B 5EGSA 2O57A 4YV0A 4HTFB 5CUQA 2ESRA 3K6RA 5C0OE 2HV9A 1JSXA 4RWZA 2ADMA 3BWCA 1ZGJA 3LBFA 2ZBRA 2QY6A 4MWZA 2UYHA 4QPPA 5IKMA 3DMHA 2VZ9A 3P2IA 5E2BA 2OB1A 4U7TB 4ER6A 2FK7A 2P3QA 1X1DA 4E31A 5K0FA 3OZTA 5BW4A 4QTTB 4O29A 1X1BA 3X0DA 4FZVA 5K09A 4YMHA 5K0BA 3P9CA 1M0EA 1KIAA 3FUVA 3I53A 1XTPA 4GBED 4AZTA 4GC9A 4RTQA 5BW5A 5LR6A 3DH0A 3I58A 3UA3A 2VP3A 1F3LA 3IYLW 3E05A 3HVJA 4AZSA 4R6WA 2I6GA 3P8ZA 4PYIA 5CD1A 1D2HA 2E5WA 3QOXA 4BLUA 1NW5A 4P7GA 1JSZA 1U2ZA 3A4TA 1DCTA 5LQAA 3P9IA 1MHTA 3KPJA 3BGIA 5ERGB 1XCLA 2AOTB 1G6Q1 1KPHA 5EHGA 3EMBA 3R3HA 3VC1A 4ER7A 2PXCA 3G2PA 3LDGA 3IEIA 1VBFA 3LKZA 4OQDA 4RSRA 2IH5A 2EFJA 4E70A 2AOWA 5FULA 3LGAA 2H11A 2JHPA 5K0EA 5FWDA 4CWAA 4DZRA 1FP2A 1XCJA 3GXOA 5LQUA 4R8SA 1IM8A 4KIFA 2PX4A 2V7EA 1JTEA 3MB5A 3FTEA 4OBWA 2WK1A 4X60A 3KPVA 4QDJA 4RTKA 3UFBA 4YUXA 2O06A 4GOOD 3FZGA 1X19A 5D1NA 3RIEA 8MHTA 2B78A 3BXOA 3EGEA 3NWEA 3LDFA 1SQFA 2G8NA 3TLJA 4M37A 1SUSA 4R6XA 2PSSA 1JG4A 3RODA 5LQJA 2G72A 2N47A 3ELUA 4AX8A 3FPHA 3PTAA 2H00A 2HTEA 2IPXA 4PIMA 3GGDA 3LPMA 5GM1A 2AZTA 4QVGA 1WZNA 3KR2A 3LX6A 3G2OA 3KQMA 3VSEA 3H2BA 3Q7EA 2P1DA 3JWIA 1QANA 5FCDA 4FT4A 1EQAA 3T7TA 5GIOE 4AZVA 3EVFA 4XUDA 1G55A 3KPWA 2XYQA 5EOVA 3WSTA 3UJAA 2ZIEA 1PJZA
chains in the Genus database with same CATH superfamily
4C20A 1ZK0A 5L53A 4HYYA 3HL0A 4F71A 1SHKA 2H92A 2ORYA 3B1VA 4CKZA 2ZM6B 2DWPA 1GNVA 1NWHA 5I6DA 4Y1EA 1DLIA 4DR4B 1EAYA 1UQRA 3L06A 3O1HB 2H2GA 5CLLA 5SYAA 1SUPA 1FSFA 1R16A 1YMQA 2ZQYA 5EZQA 3PXGA 4TVSA 1JMKC 2FJUA 3OIFA 2FGJA 1FU7A 1N1DA 2W6IA 2XUPA 4L7VA 3VDRA 5KU7A 5ABPA 1O6FA 3ZY6A 5HA5A 3EF1A 4WLVA 1P2SA 2IYZA 4UAUA 3ACBA 1HUQA 2H1FA 2C1EA 4CIVA 3RFUA 1IM2A 4RY2A 1PSWA 4KPFC 3W4JA 1EXDA 4GM1A 1RQGA 4D80A 4R05A 5B30A 4LF8B 4JB3A 1PEKE 1ENOA 3IULA 1PWZA 4LVUA 1FFYA 4MS1B 3IBYA 4OKNA 4OLJA 2HADA 2F1IA 3AETB 4L28A 4P80A 3GNQA 1T6XA 4OFBA 4RFVA 3COPA 4DNOA 4Y2RA 3OT5A 3WKAA 5DNYB 3PUVA 3QTBA 3G0CA 1AUOA 1JQ5A 4K9OA 1ZDMA 1ZSVA 5HCIA 3H8WA 3U3ZA 4CNBA 3C3EA 4I5GA 5K3OA 2AR0A 2HHJA 2REOA 1W34A 1HDZA 4R1OA 4XIYA 5DDIP 5EY5B 4A0QA 1F2UA 2EHJA 3A6GA 1PHPA 1U4NA 1LDGA 2VSOA 1XZEA 2IY8A 2IZ5A 3QI7A 4FCVA 2YBDA 4W6ZA 2RG1A 3ZVRA 4F6RB 5LNK1 2YXBA 2OXRA 1G9TA 1NG1A 2C0CA 2P91A 2OD2A 2PGJA 1R3DA 1TCCA 1MR3F 1W5BA 1L3BA 1LNSA 2CCGA 1XELA 2WV7A 1PW5A 1TECE 3FB4A 3LQQA 4DLPA 3ZBQA 1Y6GA 5EWJA 3UJ9A 4HZIA 1WX1A 5F78A 1KYVA 5CNMA 5BWLA 1QHSA 2HK6A 2C97A 3PJRA 1L7MA 1NVDA 1XGKA 4U7GA 3W8NA 3VR5H 3O92A 2OQIA 3GFTA 3RQSA 2TMDA 4BFVA 1J42A 2G8LA 1IXZA 4GW3A 2XDWA 2W8ZA 1EMDA 2D2EA 3LWNA 4LTNA 2CBXA 3GLFE 1TZKA 3O0TA 1UKBA 4TV9F 2Z3ZA 1XTZA 1LDEA 4RE6A 3D2AA 2NZVG 3TEJA 2LGJA 4DM4A 5IM5A 2OZLB 3FYCA 4WINA 1K7CA 4QZVA 1U8AA 4KE7A 2CJXA 4N5HX 2AOVA 2WSMA 1C0EA 5KYNA 4JOQA 2H08A 4JFAA 3RUEA 4C4XA 2DJ5A 1NQAO 2CB9A 4L8FA 3O73A 1RBMA 1S01A 1UDBA 2YW2A 5EPUA 3KZMA 2C31A 2DQKA 4JI7B 2A1TR 3H9BA 1DBRA 1GLGA 4KXMA 2FSVC 2ZSJA 3A6EA 4IFIA 4PPGA 1CJTC 3JQAD 4QTZA 4BUCA 1YR1A 4D9JA 2R0QC 3CISA 1VHWA 3CT6A 3LD9A 3PENA 4MEJA 4JI3B 1X8LA 4XD2A 4AO7A 3BJRA 4U2GA 2VAVA 1AS3A 1QDEA 4LPKA 5GJCA 3HUFA 5DM2A 2PKEA 2X3YA 2YOGA 1W75A 2UVPA 3PPWA 2DOKA 1UR5A 4IUYA 2GEDA 4XD7A 2B1JA 4C6RA 9LDTA 3MS2A 3FUCA 1QYRA 2FKNA 2W5UA 1LLUA 1RI4A 3IKTA 4EAAA 2OCBA 1JPJA 1P74A 2DWCA 3TH5A 5FH9A 4RMGA 1AUXA 3F96A 1H4VB 2P3LA 1PX2A 3ZEAA 3CVWA 2YHIB 5TMDA 5K8IA 3WGLA 1GVHA 2C2HA 3LL7A 2YX1A 5FIUA 3SYRA 2XODA 1LW7A 4EZIA 1P2DA 3KJGA 1R0WA 3L4EA 1NUTA 1VL8A 2BFOA 5DGHA 5C7LO 1DO0A 3KYDA 8GPBA 3TG2A 1FJXA 3F7MA 5BY2A 3Q72A 4S1OA 2PSHA 3GJYA 2NO7A 3CT4A 1WXEA 3D0OA 4TZTA 5IDXA 3C6MA 5HIIA 2O9JA 2R86A 2YUTA 3OECA 3PL5A 3PVSA 4Q4LA 2OBLA 5GWXA 3AVWA 4UZSA 5LMCA 1HMPA 3OQIB 4FBMA 3VHQA 3V1LA 4IEEA 3BWYA 1C81A 2ZP1A 1I1HA 2EBWA 5KYYB 1JQBA 1GV1A 2FE4A 1GT91 1GNRA 2C7GA 2JAHA 3B2NA 4QDTA 3WMRA 3LV8A 2O1WA 3RS3A 4L0DA 2ZFUA 2WU1A 5I7OA 2XCLA 4QHYA 4MR8A 2I4IA 3T7DA 4BBJA 5KCMA 3HB4X 1A96A 5JSZA 1KZGB 1AQNA 4LTDA 3WNVA 1SOAA 3BRSA 2QTVB 3C3DA 4J29A 2YVLA 3TLAA 3TQIA 2F59A 3R4VA 4QBFA 4EENA 1FDUA 4IY1A 1VBNA 1KC3A 3UZUA 2XVYA 2BM0A 1RZVA 4I9FA 4YRKA 3S2UA 1GKLA 2GBCA 4GYWA 4F21A 1TGYA 2CLMB 2EFYA 3BE8A 3ZWMA 3DEFA 1CUSA 3AOEA 1ES9A 3NOOA 2EW2A 2NADA 2WF6A 3IKVA 4IJVA 5EESA 3DMNA 5T8KA 4ZI3A 5C4IA 3FPGA 2PL5A 4BUZA 3LPNA 2ZWVA 3ZNNA 4I66A 5JRZA 1DRUA 4HHEA 3OC6A 5HBRA 4IMIB 1NE7A 1UJ2A 1REQB 2VBGA 3CLVA 4URWR 3RI3A 2FN4A 1C7IA 5E4YA 1EM8B 1PVVA 4L4ZA 1A0OA 3FCSB 4MAFA 2HDNB 1KJWA 5A4MS 1Y8ZA 2RG7A 5KMGB 4L4UA 4I46A 4B79A 4ER0A 4ZJPA 3IR6A 3PDUA 3R5KA 4BRZA 3WB9A 3TDMA 3JQFA 1ZL2A 4KQWA 3DJFA 4Z51A 4MLPA 1L2TA 4OLHA 1WETA 5ILOA 1R74A 2IVFA 2YINC 3D6FA 2V7QA 1AG9A 3IDZA 3N70A 4FU0A 4RVSA 1P4RA 5DB4A 5A0VA 4LHXA 3IP6A 5TVKA 3R7WA 4B3SB 4P8RA 1QUFA 3OQVA 4V1CB 1P8AA 2Q1TA 1GZ3A 4HEQA 3A6ZA 2DBQA 2QQEA 2IYSA 2HU7A 2JKZA 1ORWA 4N82A 3RKUA 3EQZA 3QVMA 2GT1A 4U7JA 1U81A 4D9NA 4DCCA 2JCYA 4J91A 5A1JA 2JJQA 3EG9B 3FVWA 4Y6RA 5F64A 3ZK8A 2HEIA 1TC2A 4G24A 3AGPA 4OUDA 1WW3A 5F4ZA 3HJNA 2OAGA 1FFCA 4RL6A 4EX6A 3IO5A 1XTIA 3I9OA 2XD4A 3JALA 2RHHA 3D7LA 4HYEA 4NBNA 4NPCA 3V1NA 2O48X 2FXVA 1JYSA 2R87A 4RFLA 3A1VA 4IOMA 2ADOA 1AKRA 2P2NA 3LY9A 3ETLA 3BD8A 1E7WA 5A4DA 2P40A 2Z0MA 3NRCA 3WQHA 3QX9A 3TFQA 1ZUD1 1JU4A 4CMEC 2XGOA 1FP1D 4FFMA 3HDTA 2O3TA 2GK7A 1T6ZA 3F8TA 2FN8A 3N6VA 1W30A 4MV8A 3KOOA 2UYGA 2X6TA 3R9XA 1QG2A 4G0YA 1GU1A 1W4LA 3NJ8A 3OCUA 2CLIB 3OAAD 3M6FA 3LXUX 3STUA 2J7KA 2R85A 3I4CA 1FPQA 3Q88A 3NX4A 1FFGA 2CK3A 3EYAA 3ER9A 3THWB 1A5ZA 4LE2A 1SVOA 3CR3C 2X8WA 3GFBA 3GV0A 5FB3A 9LDBA 1Z0IA 1KP3A 4RK0A 1LPAB 3OZ7A 4EB0A 3T5BA 4O1MA 5C46F 3CTPA 4D96A 1M1YA 4I1PA 1JEJA 1G1MA 3HADA 3QLEA 2WKWA 1DTWA 1MNAA 1VP3A 2FW6A 4HH3C 5IARA 3UWDA 4KLCA 5DSXA 5E6RA 1EH5A 2QL7A 4YP7A 5KVQA 5I7RA 4FB5A 3NB0A 3LXRA 1EXWA 4OYYA 2XQIA 2FMFA 1J2EA 4DMCA 1Q12A 1BKYA 4INZA 3QBEA 5CK4A 3RJZA 2Q8NA 1NF8A 3TM4A 4YXWD 1NDHA 3V34A 3ER8A 3ADCA 1XYYA 2YJNA 3N05A 1HNNA 3ANMA 2XZOA 2GHTA 3HJRA 3CPSA 3E7DA 3Q1KA 5EAIA 1E18A 3ZD7A 5TQ2B 1RCTE 4CTNA 1D9ZA 3M6XA 2JFGA 4RVDA 4DYDA 1O97D 2Q2WA 3SHTA 1KA9H 3G59A 1GG2A 4HX5A 4LRYA 2J6CA 5DOVA 3REGA 3SEQA 3JAWB 3KSUA 4RORA 1TEVA 3KOMA 4LNUB 1IPEA 4KQHA 3VO8A 3B53X 3HKDB 5M29A 4WBSA 2R84A 1NBIA 2OM2A 1U0JA 3O93A 4IZIA 5L45A 5E38A 3DPIA 2MHCA 4NZNA 4I4IA 3DOOA 3VAYA 3ZPXA 1SHZA 2XE8A 1MOSA 4H4CA 5BYJA 1QF9A 2VHEA 3AUKA 1HYHA 1WDWB 4FILA 2AUMA 3EYWA 2PA3A 3CLTC 2GXUA 1FP4A 4BNUA 1RQRA 1J0BA 1AUPA 1TA9A 3ECAA 1S8OA 3OX3A 1ZH6A 2NUPA 4KRXA 3H65A 1EGVB 4PSKA 2JH9A 2P0YA 4QU5A 5AUPB 3T0IA 2A78A 4XARA 4D5GA 4RDIA 1ZAKA 4DV0B 5WRFA 4RVCA 2KM1A 1WHSA 3RG8A 2R97A 3A3OA 4KLNA 1DZ3A 2C99A 1TT5B 4M9ZA 3GLQA 4RF5A 1LJUA 5BT9A 1I6MA 1TCAA 1XMSA 2A3NA 3QU7A 5KYTA 3A37A 3IGFA 2V6BA 4DNPA 1XD8A 3R7NA 5KYXB 3SLKA 1F9AA 1KYQA 4DSTA 2UYOA 1NWCA 3NEPX 5K6RA 4GUAA 1X0VA 1QHIA 1W5EA 2DFPA 2RHDA 3E3LA 1CQIA 4IJUA 4RHEA 5HCNA 3E81A 5LLTA 1I3OA 1H2WA 5K3FA 2GN2A 3OM9A 1KKLA 4AMYA 3VYWA 1ACLA 2R4QA 4EKYA 5IBCA 7REQB 3LCCA 4DAEA 2XJ9A 5BRAA 2AJCA 1RFLA 3DBRA 2BMAA 3FPKA 1DOZA 4AULA 1FE8A 4IXMA 5TEVA 2YZKA 4GPTA 1OLUB 2RKWA 3VDMA 4IHAA 2NYUA 1G21B 1NJ8A 5H02A 4MX8A 5IMSA 3AWDA 5FX2A 4BKUA 3GRUA 1IPFA 2I5PO 4DA8A 4G1VA 4MQLA 2V74B 3RARA 5H4GA 2FLWA 5C0OE 1GTG1 3KSAC 1NKTA 5DHQA 1YJCA 3DMPA 4TV8F 2NT4A 2X5XA 2IE0A 2P6UA 4LJ4A 1O8CA 5D7NA 2XD9A 1S2GA 3Q2OA 5C5CA 5JSUA 3TQQA 1SUCA 3UAVA 4DIUA 2GZ2A 1EZ1A 1IH8A 3N8NA 4IMJB 3OOJA 4FDLA 3FDZA 5K0FA 2H18A 3HJFA 3G2IA 3K8QA 1ONBA 1CQJB 3L18A 3DNMA 2FF7A 4Y2UA 1CE8B 2VF5X 4NYMQ 3WWCA 1AY0A 2IZOA 1YS2X 1JPUA 1QORA 2CNOA 2E55A 3MCWA 4IQ0A 3ZYCA 3H87A 2OCYC 4YO8A 1T0HB 4MGYR 1XI2A 4F3RA 1Z5VA 1RM3A 3NJ4A 2VFAA 3B85A 2HWYA 1LV7A 3P9ZA 1QHNA 3HDGA 3QMVA 3IV7A 3QOXA 1E1YA 2C2MA 1MJ5A 1U2ZA 3I28A 1HNWB 3P9IA 1QHXA 3DV9A 4ZPXA 3G5MA 2VF8A 2DT8A 2WJJA 5BN5B 3TE6A 1P1HA 4A6XA 1JHXA 4JELA 1GARA 3UICA 1ESNA 1WUYA 3KYCA 1NNUA 4ABYA 4E5NA 3E2PA 3KXKA 5BSTA 2I2DA 3S5UA 1GYQA 3EMVA 1PF7E 3LKBA 5KNLA 4REMA 1K92A 3UUFA 4OYRA 4MGZR 4DZRA 1M7GA 3M82A 1UT6A 5DHTA 1OASA 1G5QA 3SDZA 1YRYE 3JQAA 1JTEA 3G0DA 2ZSKA 4D9BA 3VBCA 1FY2A 1E1NA 4ML3A 3DZJA 2QUJA 4NL4H 2ZRPA 4YAUA 5LFAA 5CEEA 2PD3A 2Q9CA 2JD2A 5CVCA 4QNNA 3M4ZA 5EIBD 2G8NA 3T5MA 4JB0A 2R48A 3DE3X 3N2ZB 2QTTA 2XTZA 3K16A 1AGYA 1MXFA 3N59A 2ETVA 3MOSA 1G41A 4BBZA 4ES6A 5JSFA 4QDUA 1ORRA 2OBYA 2PPLA 4QRIA 2H16A 4HYTA 5GM1A 4FLMA 3TRJA 1OAKA 2PRYA 3IELA 1GL9B 1LK5A 4LHEA 3RVNA 3UAWA 3THYA 1SWVA 2XITA 3KQMA 5F51A 3PWTA 3VSEA 2WJYA 1PX0A 3JWIA 1AQYA 1EWVA 5JMOA 2NQTA 1IEVA 2JAPA 3QVXA 4M88A 2PMDA 4BNIA 2OR3A 3BHIA 2O1SA 5GY7A 1IZ8A 1OIXA 3MS4A 1XVVA 1NIPA 1R7RA 1K98A 2AE1A 4FGWA 4DA6A 3E22B 5K8TA 1HSOA 2FZ5A 1PZGA 1U0OC 2QRUA 5LJIA 3ZVKA 4JL5A 1JHYA 3FD8A 3ABZA 3PNQA 4N5MA 4IOLA 4Y6GB 1QS0A 2C94A 4OHBA 4EMSA 4KAAA 2Z43A 4ZXPA 1SKUA 1XDBA 1KDTA 3GY0A 4MS4A 3DMTC 1JIJA 1NULA 5KNCD 4NCNA 3VA7A 3G2MA 2ZRHA 3FSJX 3DHWC 3N2GB 3NKVA 5DWQA 3WBJA 3CCCA 3HRHA 1ILWA 2ZTMA 2YYYA 4G01B 4KPGA 4H31A 4U4AA 3IQXA 4UNPA 1O1YA 3ESDA 4DV3B 2VJYA 1JJFA 3FETA 4P1ZA 4YROA 3DZ8A 5ERXA 4E32A 1LEHA 2LVBA 5BSUA 3D1JA 3GN1A 4RD0A 3ZY2A 4BXOB 4NE2A 3AR9A 3EEYA 1NXXA 2GHIA 1WTCA 4KQMA 5TT1A 4LZWA 3T5TA 2O2YA 3OCXA 5IJ0B 2AKEA 3FCAA 2V7WA 3KDSE 4L50A 2RGNA 4MCJA 2QT1A 1Y3CE 3QLTA 1H6BA 4OI4A 4TXMA 5LLSA 3O8NA 3RS5A 3HCWA 2RGYA 2II6A 1RLMA 1V0JA 4Q3LA 3WYFA 3GU3A 4F84A 1QQTA 1GM5A 4YQEA 2DFVA 3AINA 1L9XA 4NBKA 4LV6A 4PGGA 4RVHA 3WFJA 2JL1A 5IYZA 1CJSA 2CXUA 1TEZA 3QHAA 1NMZA 1LY1A 2BVNA 2EWWA 3PX2A 4GKVA 4OGLA 3FSGA 3RVPA 1XMQB 3TECE 3E9EA 4O4JF 5M34A 3F5MA 4C6TB 721PA 1FZQA 3TI9A 4R2MA 1B0ZA 1FFXA 1PR5A 2DB3A 3GAMA 2H17A 3HU3A 4MWOA 3PDIB 3RLIA 4PLVA 3UY4A 1IZ9A 2IGTA 5AK4A 5HWSA 3S3TA 3I2IA 3BSWA 4YGYA 2Z8XA 3VH1A 1AS0A 2Z2JA 1TO1E 2W2OA 3K71B 3QX3A 3NBXX 2NYAA 3VI4B 2MSEB 2A67A 4RVFA 1KI8A 4RSMA 5ERYA 4C04A 3DT8A 2WB2A 1TQ4A 2DJIA 3CLRD 2JFOA 4GI7A 5C1BA 4XM0A 1KE1A 2PH5A 1NF2A 4IIJA 4NONA 4ENRA 5B4UA 3BCSA 3O3NB 6ABPA 5LDGA 3VI3B 1DBIA 1YR8A 3DA8A 4KQIA 4B75A 5ECDA 2Y1WA 1BN6A 2Y4NA 3FMOB 1E1CB 4H60A 4CKWB 4CEHA 1VP9A 1RVDA 1HE8B 1KKMA 4RCVA 3RWBA 1CQZA 1QE0A 1NL3A 2IPAB 3JQEA 4UULA 4UVHA 1QIEA 5ECYA 3UENA 2BSQA 4HO1X 1V6CA 3GLFB 1GEGA 1RYFA 1W73A 2EQAA 1PZMA 2XT6A 4JNKA 4TZKA 4EWLA 3U16A 3HGQA 1RJWA 1E3TA 3FOCA 4CV1A 1UBKS 3ZQKA 3EUFA 1SBNE 1G18A 2YMLA 1TU3A 2X0JA 3VNVA 1D5CA 3TVTA 3R6LA 3O2SB 1NA5A 1PFKA 4ZWNA 2C4KA 1K7SN 3HEBA 3GW8A 1CEEA 3FPLA 3GT7A 4JT2A 2GN8A 2CHEA 4MR9B 4X3OA 3FR7A 4NE9A 4RADA 1N2CA 3UHJA 4AMGA 2IYYA 2FJPA 4MKIA 4BIMA 2ORIA 3R1IA 1PGQA 1BMFD 1I1OA 4PYNA 4FFBB 1E4EB 2GN1A 1BO6A 2EU8A 4U9IS 4BVGA 2V1UA 3PNYA 4CKEA 4P35A 3T1OA 4BO0A 4DSNA 4ZVUA 3RC9A 3HV2A 4FFNA 4CF4A 4D25A 1ULUA 1W4AA 3E2IA 3R20A 1Q7GA 4PPQA 5J2UA 4H7KA 3VPSA 5KQSA 3K9NA 1C1DA 1VSBA 3A3YA 1MC5A 1NRWA 4Q18A 1YS1X 3I9KA 4NOKA 1QZTA 4NI5A 4NZYA 4RJIA 4Q4JA 2XKKA 2HMYB 3L7CA 4RQAA 5LOVF 1IPHA 4JLAA 1CIVA 3OZRA 2ZBEA 3OTQA 3U4CA 2JF0A 1JNXX 2PLRA 2ZXFA 3K7EA 4CQMB 1C14A 3T3GA 5JFGA 3FVTA 4MI3A 4W5JA 5DX1A 1YZYA 3UGKA 1R27A 2XMQA 3LG2A 4G0QA 1BH6A 2A30A 2J0EA 1VPWA 2JGDA 4B76A 3EZ6A 2FW8A 2VNHA 4QREA 5F73A 3RBAA 5AKYA 3OAAA 2D7JA 1AUQA 1LBSA 4LSMA 3T1VA 5C4MA 2X4IA 3EODA 1ZG3A 3QMPA 4D9KA 3UJCA 3RYCB 1RJDA 2W4QA 4M60A 5AOAA 1PIWA 2J45A 2UUAB 2B20A 2I33A 2X6RA 3ASVA 2VF4X 4PHCA 2UYQA 1GPWB 3MMXA 3T61A 3DC2A 3STHA 1HRKA 4RA9B 1SQSA 1CJMA 3A28A 3RNOA 2ZLBA 3MCAA 1T4MA 1U7DA 1WB9A 5K2OA 3OPXA 3MILA 3WNBA 5JPIA 2SKCA 1KXZA 1AXRA 1D1SA 1ZL0A 2XF8A 5HTKA 4FMDB 1L7QA 4C2AA 4AY2A 1FS4A 1MUUA 3EBLA 4CLOB 1PQWA 1E5XA 1PVDA 2BJWA 3L93A 3PUJA 4JJKA 5LP6C 4WUVA 1M7BA 1T1SA 1U3TA 2JLBA 1F8FA 5DGDA 4U8GA 2AF4C 3RC2A 1WD5A 5F3WB 2CL6X 4XEHA 1XZMA 3BFKA 4Q9NA 2WG2A 2YJ3A 4YXWA 4B4OA 2CVFA 2OM6A 2QL5A 4F2GA 1Y5IA 3G8AA 4UM7A 1IMJA 2GX6A 3JD2A 2VZEA 2BUBA 4M9CA 2BFDA 4I4TF 2YXEA 3E9MA 3HBNA 3OIGA 4OCZA 4B3XA 4W1RA 1CRQA 5FPHA 4EATA 1Y4AE 4KE8A 3ZDYB 3RVBA 2V0NA 1FUUA 2WU0A 3MJRA 5MHTA 3CMCO 1U8TA 2X4GA 2ZIXA 3NWBA 2HYIC 3OC0A 3K2IA 1VCOA 3CB4A 1A9SA 4NEQA 3FR8A 3MBKA 7YASA 3HJAA 5GOTA 2X22A 4NYJQ 4V0QA 3CLHA 1FVXA 3TWOA 4C0KA 2WIKA 3K4PA 4V0KA 3GMSA 3PE3A 3GGPA 1WL8A 2AXNA 4TLAA 4DBVO 1RYHA 5JVDA 1QVVA 5KDDA 2W2LD 4QXPA 2QVCA 2X0IA 5BVGA 5EJ4A 3I5YA 5IULC 2CV1A 2HA0A 5GJBA 1E0DA 2IEDA 3FYUC 4E22A 3E3NA 5B1HA 3FXAA 4AM8A 3QH4A 4JYAB 3TGWA 2WSSD 3MYYA 4A8PA 1Y4SA 4ACAA 2EVWX 5BUQA 1EFKA 1GZ4A 1SVSA 2W48A 3ND8A 4PZ9A 3MRTA 1RC8A 3SBDA 1MP0A 1R6AA 1SUIA 3FKJA 2C95A 2VP0A 5DH9A 4D0LB 3VSAA 1MX5A 2HGZA 3WIBA 1T6BY 2Q6LA 3S8YA 3GK3A 3A1NA 4AJKA 2MR5A 3VTAA 3IJ5A 3TDKA 5ARDA 4BCCA 2BD0A 5AI9A 3GJTA 4RJKA 2AOXA 4PNZA 2HBQA 4GDFA 1VJCA 3SN6A 1GPKA 1PEYA 1RYDA 4O2AF 3PC3A 1ND6A 2GEFA 4ARSA 4PFKA 3HXMA 4YPFA 2A3RA 1RQPA 1Z74A 2EX0A 2I7VA 3FWHA 3LBNA 5FQOA 3N2LA 1E1KA 4ZV4A 3OTIA 4YEDA 5EYPB 4ZTUB 2YNMC 3LGSA 3OU7A 4KGXA 4BZWA 4DMLA 5I51A 4MS1A 1E7RA 2BEVA 1PD0A 2OKCA 3L41A 3QLVC 4YRGA 4O4JB 4AK9A 1UBCA 3AETA 4OHVA 2IY7A 1L5NA 1CKEA 3AVTA 1ZJYA 2P9QA 2XAUA 2PR2A 2GAAA 5CJPA 5FUMA 2Z57A 1WSAA 2B1QA 2AWNA 1IQPA 2HQ1A 2HCFA 3ABOB 1FBNA 4UARA 1JNYA 3B3QA 4LXTA 2BEWB 3F6YA 4JVSB 5FL3A 3CNLA 4C7VA 2O2IA 3QV1A 1G8HA 1KOJA 1BJKA 4F6RA 5B6IA 4ZDWA 4ZOBA 2HDOA 1E2LA 3A9RA 1O95D 3G6KA 4GVXA 3EW9A 1EGQA 1P29A 1XTUA 4X45A 1NMEA 1G20B 1LPPA 2VK4A 3H0KA 3V32A 3IIJA 4ZJUA 3H7IA 3H5AA 2COKA 3C4JA 1RLUA 3EIQA 3NH9A 2GDJA 3O8LA 4NQRA 1LFAA 1OV4A 3GAZA 3BGOS 3SIXA 2OP0A 1D5WA 1OZ0A 2J0UB 2XI4A 2FWMX 3SOPA 1D2AA 4IGEA 4BVEA 3ELYA 3I2HA 3LIPA 1ZH0A 1PR1A 2CKMA 5FOTA 4DIDA 5CVUA 2BUCA 3KQLA 5A3SA 5JE8A 3AOEC 1VGRA 3AJ9A 2PANA 3UXMA 2P78A 1A9YA 3N7UA 3VHLB 2IPNA 4C1BA 2OQVA 1AU9A 3OA2A 4FYYA 2XGMA 4OQYA 1X9GA 4IFTA 2P77A 4OJKA 5ALFA 3OURA 1RAIA 3JWEA 3MOIA 1PWXA 2LUOA 1UBNA 3IDQA 3UAOA 1QV7A 3TR6A 4FBLA 2OZLA 4GAEA 3T34A 4M53A 1HDRA 1R8YA 1WMDA 2D0OB 4U3JB 2BMFA 1M66A 2YVKA 3R7LA 2PX2A 2XMRA 4REQB 5EMNA 4CIWA 4BLTA 3D31A 3E7XA 3W4IA 4XIGS 2QP9X 3DDOA 5L7TA 4XCXA 4N5IX 3D2CA 4EY7A 1X0XA 5K3SA 5KKAA 3D8UA 3O4RA 2FPXA 2O3QA 3IQIX 1MJNA 1WXWA 3K5WA 4GOND 2FLVA 4R68A 4UTXA 5CPFA 4YVFA 3SF0A 3T3IA 3VC2A 2Y76A 1WE2A 4D8VA 1UK6A 1ZW6A 3ADPA 3HB0A 1B6GA 2P68A 5E9QA 1VHLA 1IOVA 4LJKA 4Q3BA 3NVDA 1TLTA 1MZVA 3TRDA 2VHUA 5A9RA 1BG6A 3N0XA 1FFWA 2C77A 2KHZA 2ZT8A 5FOSA 3KFLA 4S0XA 3SXUB 4EPRA 5HOQA 1A8HA 2G88A 2G9QA 4JVLA 5MFZA 3L6DA 5EKXA 2JI6A 4ZVVA 5CDYA 1WNFA 4YA6A 2OBBA 5KTRA 4WNAA 1IBRA 1S0UA 1F0PA 1GCAA 3AHJA 4MKGA 2O0LA 4J43A 3CVOA 1C80A 1ZM7A 4A1FA 2YHIA 2ZIUB 2I87A 1C7QA 1E2PA 1KY5A 2HSZA 4YRLA 1DPGA 3O9ZA 5D3MA 3CZPA 1CVIA 3A27A 1KZ4A 1H66A 1GQRA 1K27A 3IBFA 3IDFA 2DFDA 3EGWA 2VDUE 4NAVA 4MV3A 4YI3A 3NBQA 5KNCA 1N2EA 3MPUA 2UXCB 3GT0A 3P0HA 3UPTA 1RW4A 2BMVA 3T3HA 3NUZA 3MERA 5HX7A 1E2UA 1V1MB 2NO4A 3KKKA 2F1JA 2VQ6A 1R6TA 2PRSA 1XK7A 1W88A 2XUHA 2L18A 5C1IA 3W8RA 3M7IA 1JXMA 4GXTA 2GERA 4IIBA 1P39A 2WD9A 1YOBA 3DB1A 2QAIA 1JEDA 2Y1EA 1EGHA 3OQIA 3PGMA 1V1JA 2EBFX 1EGAA 1SD5A 2VC2B 5EMLA 4WZAE 5CGQB 3PGXA 1Z6YA 4TTQA 5C3UA 5DM1A 5KYYA 2X2PA 2G08A 2AZDA 1OWMA 1D0SA 2YWHA 1CEXA 3G2KA 3MTDA 4G5XA 1L5HB 1NF3A 4HQFA 4JLMA 3T15A 5MGBA 4E0BA 3KUCA 4LF7B 5H3CA 3B2QA 1ZR2A 1WXXA 4XYBA 4C88A 2J3LA 1Q91A 2PQ0A 3NXKA 2IKQA 5FOQA 1P6UA 1NVWQ 2QTVA 2AVNA 4BOYA 4GVLA 1GFIA 4HDCA 2FQYA 1A3CA 1JJVA 3DLCA 3E5RA 1L6IA 3G02A 4YV0A 2XIQA 4GQIA 1P33A 1L0BA 4HPWA 3SJAA 2I2FA 3X1DA 2HIAA 1XE3A 4UNSA 4WT7A 1ZCFA 4MDYA 3S0JA 1JBEA 3V7NA 4YDHB 4G1UC 5AVOA 3ET4A 3SC6A 4EW1A 3NHMA 4QARA 4G67A 3UMRA 5E2BA 4UCXA 1RBYA 2CXXA 2I2AA 2IP1A 3F98A 4UFPA 1SURA 3ZWBA 3GFPA 4KN8A 1RR6A 4WJZA 1UDWA 1A4XA 2AG0A 2W2PA 3X0DA 1GV0A 3RVQA 2X0KA 1YOVB 2QE7D 1REQA 4TS1A 3U4AA 4BVLA 4C4SA 3PX7A 4AMUA 1FXSA 5AVQA 1EM8A 4UEQA 5LR6A 3B20A 3EEQA 4GLLA 2OV3A 2PFKA 3HVUA 4O02B 4XM2A 2NUAB 1J24A 1GNQA 4FMCF 3HY6A 3CBQA 4PR0A 4ACBA 4YT2A 5KMGA 5T7BA 4N3AA 2QMUA 1ZMTA 1M1ZA 1KAEA 2BFCA 3WHPA 4GMDA 1FNDA 2Y1CA 1B16A 4WKCA 4AKEA 1GO2A 3D3KA 4O2AB 1KH2A 4RPLA 1DEOA 1XCLA 3IUMA 2PGNA 5LZ5A 5EIOA 3RJMA 1QGOA 1CUBA 2FPGB 1KPHA 2J3HA 2C0QA 1X74A 2XQKA 4WDQA 3DONA 2VZ8A 1Y33E 3PFNA 2RAPA 4LYEA 3K2QA 5LDDC 4V1CA 1QMGA 1GCGA 4LCJA 1DJQA 5FULA 1VXOA 4FEYA 1J0EA 4RIHA 2R8EA 3GFRA 4IO1A 5L4NA 3AOGA 1L4MA 3H8JA 2C42A 2QP4A 4KSYA 3K05A 3QVWA 2BFBB 2ZS9A 1XCJA 3GXOA 4O8ZA 5FXMA 1BMFA 1LWOA 3E9YA 3NHKA 5C5EA 2PX4A 2X4LA 3ZS9A 2I7TA 3L1IA 3DDHA 3EG9A 3O21A 4ND5A 3ZIDA 2O06A 3FZGA 2VWGA 1RM4A 2YXPX 1E63A 1NOJA 2P11A 1G6OA 2ZKLA 3A1UA 3BXOA 3D3QA 3GRKA 4G25A 3URMA 4A10A 2F3QA 1TMKA 3O90A 1I9CA 1J56A 1YJAA 2P79A 4WDRA 4KVFA 3TB4A 3TOZA 1YR9A 5J58A 3FX2A 4RWEA 5DCWA 5CURA 1VHQA 2V65A 1P1KA 2PQ2A 1YRHA 2XDAA 4J8PA 5JAHA 2IPXA 2ZRQA 3H9QA 4ZVQA 5JNUA 2C0PA 2PZGA 2QI9C 3ETDA 2HK8A 2GBFA 2OHGA 4K88A 1H69A 3UMGA 5B7QA 4B0PA 1JKIA 3ED1A 4CQMD 2EW8A 4YASA 1QANA 3JS5A 3R3VA 4RK7A 2WJ6A 3H2GA 4K0KB 3LBHA 4AVYA 2GCOB 1G55A 2AMFA 1HEIA 1OXSC 2BFPA 2GETA 2GZSA 5FBZA 1WQ4A 4HQRA 5FBHA 3AM4A 1PJZA 4G5RA 1AVTA 1QRDA 1ZNWA 5EP4A 3OQOA 5BR7A 1NU8A 3GHYA 4CKYA 4CGZA 2QV7A 2HWKA 2WE8A 4HX2A 4RXTA 1LQ2A 4ON9A 4YUAA 5CHYA 5JARA 2Y2UA 3THWA 2JEZA 2DQYA 2H9YA 5CH8A 3HRIA 5M04A 1C8KA 3PJGA 5CAEB 5B7PA 4D3DA 2J4CA 2JIPA 1D2RA 2OFPA 2JIRA 3EEBA 1HO3A 4PNPA 4EP1A 3K9GA 2C3OA 1VC2A 2X0RA 4J0KA 5TVGA 5IJWA 3P0JA 2QWXA 4BS9A 2QR2A 3HXLA 3ULKA 1EWRA 2A84A 3SZLA 2XLCA 3DNPA 4BZQA 2X1VA 1V11B 4LHYA 5IBQA 3RANA 2WHPB 4M1KA 2MYPA 4YGXB 1CEQA 1UMCB 3QIAA 2WICA 3SC4A 3F3MA 2P62A 4D0RA 4OXRA 2ZI5A 4ZVTA 4JVNA 3FOEC 2Q5LA 1UAGA 3DFKA 1ZY2A 2DXIA 1L4GA 3DOEA 2LW7A 3Q0TA 4MQBA 4PYKA 5LDHA 2HLNA 4QBGB 2GOYA 4UOZA 3HVRA 3NP9A 2QR3A 4RD4A 1H85A 5LC1A 3C5VA 2UUPA 2VCYA 1VKOA 3FTCA 1PQYA 1X2BA 1OC2A 2ZSFA 4JR0A 3SX0A 2HGSA 2CJPA 1VE7A 2QN9A 1B41A 1A69A 1HT2E 4CG1A 2BMWA 4P38A 3V4SA 3LXMA 4MPDA 5L4SA 2K7FA 3IKMB 5TQ2A 1DKPA 2BONA 1N5JA 1SVNA 2BGUA 1CCWA 3AV3A 1NUAA 3NM5A 2DF8A 3B9QA 1FYWA 4KE6A 3SBOA 1L4BA 2ISCA 4DCPA 2B69A 5DF1A 1LX7A 1QHYA 1NJ5A 2H52A 2YVUA 3INTA 3WGKA 1Z16A 4GX0A 5IDQA 4RTJA 3JAWA 3MUEA 5UKDA 3WYCA 1NN1A 4OL0A 2C03A 3HKDA 4DE5A 5C35A 1U2EA 1U2GA 1T0JB 1HG1A 4X61A 5KJEA 1BYUA 1BDIA 3T9AA 1YAHA 3VDNB 4ALMA 4V0NA 4KE9A 1J5PA 1Z29A 3D0KA 4C05A 1GKKA 4PG6A 4KFSA 2ZWMA 2ZCUA 3GBVA 3ZWYA 4C0QC 1TQDA 1X7XA 1DELA 1V6AA 1ZI8A 2XGGA 3RYFB 3VOBA 3K31A 4FUTA 3RCBA 3IL2A 1GPMA 1NPYA 1P2GA 3EGIA 2KS6A 1N1MA 1OKKD 1GLVA 2W43A 3L77A 4LZAA 4TXNA 3RSQA 3ZOKA 3QEJA 1VB3A 3NDRA 4ITRC 4CKXA 1P0CA 2D1TA 4N54A 4MB0A 3CF6R 3KC2A 2HUNA 1HM5A 3LUBA 3SVZA 2WC1A 2XT9A 5JYEA 4XGKA 3B9PA 3D7SA 1TT5A 3NIGB 5BVHB 2FWRA 4CVNA 3FVQA 4C3VA 2PZKA 2YOHA 4NNJA 2FFAA 4MUBA 1MV8A 2B6HA 3OE5A 4E3ZA 5KYXA 3EE6A 1XPRA 3Q98A 4K6CA 5M5BA 2GJAA 1WCXA 3WGHA 2PNFA 2ZRBA 2O0JA 3VMMA 1DQPA 2Y0PA 2H7XA 1ICEA 4HAXA 2VG8A 1DAGA 4L08A 4Q39A 4PO9A 3OKAA 4UU1A 3DF9A 5GJWC 2IZZA 5JAZA 3COYA 3TFOA 4OYLA 2V5UA 2OCDA 1EDBA 3EARA 3IAFA 4C7MA 1T26A 4BN0A 5F9FA 1CR1A 4JGBA 4BX0A 1RLOA 1QO0A 4HN9A 1EWQA 2ADFA 5BNZA 1MX1A 1OLUA 3OESA 3ZIUA 4JQCA 2HO4A 3ESCA 3JQBA 4KTTE 1G21A 3ZDEA 1XU9A 3L9XA 3MYRA 1ZRSA 4LHZA 4A03A 4C4PA 3V4VB 4M4SA 1NF9A 1W8IA 4ZO9A 4WN3A 1U31A 1P19A 4EMBA 2ZRKA 4HVLA 1BRTA 2B0JA 4X41A 3L7JA 1DV2A 1GUBA 2HJSA 3ASUA 1TZJA 1MIOB 1Q95A 3K1ZA 1VLHA 3KZKA 4Q9JA 4F6LA 3VTKA 4RKYA 3WK9A 2XX3A 3KKPA 4TMXA 1UWKA 2YMQA 2NU9B 1Q84A 1T8WA 1SZCA 3PGKA 4O2BB 1CP3A 4JI0B 2QU8A 2ZWIA 4L9SA 4O5OA 2CL0X 3CRZA 1JJBA 2VJLA 4RDHA 3EC2A 5ALYA 1CQJA 1VPTA 1Q22A 3CKKA 5ESXA 3RB8A 3TUIC 4S24A 3PXAA 3QJGA 4IDPA 3H05A 1L4LA 4IINA 3NAZA 3S2FA 5IUJC 1H1DA 1CR0A 1I3CA 1DLJA 5F1PA 1JLSA 5H82A 3ABQB 3NCTA 4BP9A 2VDNB 3IP1A 3PUXA 4EB3A 3H18A 1G60A 1XLWA 2COUA 2ODAA 4Q7EA 2IUUA 1JS1X 2D0PB 4IHJF 3ZNQA 3EZ2A 4PLHA 1EWTA 3MWDB 3C41J 3DQQA 2IYQA 3MWJA 5AK6A 4EKEA 1HKHA 5BN5A 3E0XA 3MTIA 5DLPA 3UOWA 1RRCA 4J2OA 1CUAA 2NG1A 2RK3A 2WR8A 3D6HA 1LDMA 2HJRA 4ZV7A 5IKXA 1MAVA 1VLZA 821PA 3PJDA 4CMGA 4OKIA 2W2KA 2I4RA 2O05A 3DW3X 3QMWA 3X44A 3V7UA 1QHGA 2A9JA 4NJMA 2DPHA 4DTIA 5JWHA 1X9IA 4ZVPA 5LZ7A 1WDKA 3K2EA 1Z6ZA 3P2YA 4YAGA 1HE4A 3U17A 4A0RA 4F60A 1QU3A 1DFGA 1SAYA 1QZXA 3Q7SA 1VDMA 3GNLA 1X9HA 1I7LA 4TMKA 1YC2A 2PG3A 5C7YA 2QRVA 2Q1UA 1X1CA 2JLSA 2RHBA 4LJSA 1FQWA 3QM1A 1JA9A 4ZOAA 1JALA 2ZIWB 1RYEA 2CLHB 3GGGA 2OGSA 3NEJA 1CY6A 2Y1DA 4FYIA 3BA6A 2XYRA 5HKBA 5KCZA 1KEKA 1K3FA 1QRRA 1ZZEA 3PVZA 4IJ6A 4PFQA 5HF9A 1ZONA 5LM3A 2YMMA 2FSUA 4FX2A 2X40A 3WL7A 3IA2A 2VPYA 3HHPA 4ABTA 2Z04A 1U7UA 4ND1A 1TQHA 2PX3A 3QMMA 1YZLA 3P9KA 1C9DB 4OHFA 3E22A 1I6WA 1VIMA 2GZ3A 5C5DA 2BCEA 1O0SA 1V39A 1CV2A 2ONZA 1HQKA 4R9RA 1H2FA 4NZPA 5D01A 4BO5A 5IUNC 2FETA 5AHKA 3KJXA 1XZPA 3C3XA 3PQDA 1VHDA 1KAHA 4IEIA 4JP3A 4PC6A 4RHTA 3WR5A 5BSKA 1MPTA 1SHUX 3C39A 1PYGA 2XB6A 2GAJA 3N2GA 2RJNA 3KTFA 3S29A 1Q0ZA 3SSOA 1QK3A 3P97A 5PNTA 1EP1B 1GZHB 4Z9XA 3UPUA 2IRWA 4HVAA 3RS4A 1RWOA 3JZAA 3VR3D 1K8XB 3KB6A 4BXOA 2ACKA 4CUKA 3IX7A 3LT1A 1APBA 2X77A 2HWWA 2P27A 4QELA 5IBRA 5IJ0A 4NZMA 3M6UA 2ZOSA 5TXGA 1Y6JA 1D4ZA 3Q87B 3E5HA 1FC0A 2ORVA 2H4HA 1RWQA 4I1RA 4XRRA 1KVTA 4DSOA 3PDHA 1AMNA 1PDVA 1TJ5A 1QOPB 5TY0A 5MN5A 4HRAA 1Y1SA 3I2YX 2NU7A 4DXHA 1Q19A 4ZYZA 1LBQA 2YFHA 3AK4A 4NFYA 4KZKA 3SBXA 1IFXA 1CP2A 2ZUSA 2WYOA 4YCLA 4LFCB 2VWPA 2VJOA 1XPJA 3PDIA 4JGIA 2JIQA 4WY2A 3GCDA 2X9VA 2BMDA 2GVNA 3KT8A 4FDMA 4C0WA 1M8GA 1TKCA 4ECEA 5HXAA 1ZMOA 2ATXA 3CGGA 2CYCA 3H16A 1MVNA 1OPXA 1SBQA 4BFTA 3C2QA 4DJJA 4F9TA 3T1HB 1C3OA 3KEOA 1IEXA 3PBKA 2AA3A 3EQ9A 4HTFA 3N8DA 1O97C 3DLAA 1YQEA 4IV5A 3W06A 2V4UA 4D45A 3I9LA 4E51A 1P1RA 2RIPA 4QGSA 1CFZA 1LA2A 2FSPA 3H3JA 4L0QA 2VDOB 1UJNA 1AQIA 1E1CA 2AG5A 2I66A 3BH7A 4CKWA 2OORA 4NK4A 4I1VA 3TPFA 3LQRA 5EJAA 3GLFA 4PYRA 2TYSB 3KSZO 1JB1A 4M0LA 5CT5A 4J4TA 4I55F 2O8EB 1B76A 3G5UA 2QVBA 3WC4A 1YIAA 3E84A 2VHJA 2GNPA 4KUGA 3U3DA 1OBOA 1U3GA 3AF5A 5AKGA 3N6RA 5KBYA 3RAEC 4QXAA 4CZ2A 2V9CA 5KWEA 4L74A 2X42A 5K8JB 4CV2A 1DP4A 3N75A 2REXB 4NJOA 4V03A 2GCNA 4EFNA 2IW3A 2C3YA 4MJ3A 4N18A 2ID4A 4ZU1X 4ZIRB 1KOGA 4MR9A 3FAZA 1JQEA 4QQ8A 1KAMA 1UF9A 5CFNA 5JMTA 3W5BA 1T2AA 1KYXA 1PT8A 4YV2A 1PK7A 3BL5A 3WNQA 2GM4A 1N0WA 5D1HA 2D5IA 1COZA 5EIXA 1TB4A 2WIJA 1E4EA 1P7PA 4FFBA 3QUTA 2JAOA 3H1GA 3RFXA 1XDGA 3I37X 421PA 3E15A 2M1XA 3ELBA 4IR7A 3RTDA 3I92A 1TEHA 3RYTC 3SFZA 3WZMA 4DLNA 1Z8FA 3IMKA 2JD0A 5LQNA 2JFWA 3GCZA 1IEWA 1Z13A 2MINB 4YRTA 4AYXA 2YXLA 4V0OA 1AIPA 5LYJF 2GCPA 4MGIR 4E6EA 5JYDA 4WA8A 1NW6A 3B1KA 1ESCA 2RB4A 2N42A 2L82A 4W8OA 1NW8A 1T3ZA 3KZ1E 3LT4A 5P8WA 2V54A 4EJMA 2FP4B 4IDGA 3MUFA 4CQMA 4GOMD 2ZJ7A 4P3PA 4UHDA 2H1OA 5AKXA 1N6KA 4LF4B 2BR3A 2JC3A 1N6IA 4FE3A 4JI6B 2EFEB 3PEYA 3GGCA 1KQGA 4JN6B 4Q3NA 1FCJA 3K0AB 5DWDA 2FOLA 3SLRA 3UWSA 3HFSA 3VR4H 5C1DA 3RYCA 1U1FA 2J4DA 2HH9A 3VZSA 3QYPA 1NMQA 3QVKA 5AW6A 2Q5QA 5AW7A 2O3JA 1J22A 1VLMA 3DDWA 3QFHA 3G79A 2R7MA 3C16C 2A6PA 4RA9A 2PYIA 4PEVA 2LP4Y 2ZB4A 2BYTA 4L5JA 4IHJB 5CFPA 4MCHA 5JY1A 3JRWA 2WF9A 1NXPA 4N7MA 4RF3A 4XRGA 4NMXB 4ZICA 1ZUNB 3HDVA 4ZD6A 2Q0XA 1A8QA 1QKKA 2FHPA 3M6MD 2WSIA 2XBMA 4S2EA 2O1XA 2H2IA 5GMOA 1Y48E 3W77A 4CLOA 4YUZA 4NIMA 4H08A 5T4HA 3ISVA 3NZEA 2VUHB 2HTFA 3HBJA 2Q29A 3I2KA 2F8MA 2PGAA 3PE6A 3ROQA 3W2TA 1I2CA 2FE1A 1MC8A 4INJA 2VAPA 3ENKA 2YC2C 1ORTA 3GARA 4NDNE 5D1NA 5KNBH 4D8UA 2OCIA 1BZYA 3UHPA 2C2GA 4G65A 4P33A 5IT0A 1G8JA 4XASA 5HZMA 1VI2A 1I51A 1SC3A 2ZTUA 2HNBA 1CZNA 2OBXA 1JDSA 2IHBA 1CY4A 4BNTA 1X15A 4DQ0A 2JFUA 3LUHA 4AD8A 1PWYE 6REQB 2H06A 1ZP6A 1SQ0A 3ESYA 5E4TA 2ADMA 2ZAGA 5FUYA 1E2IA 2JLAA 4RPIA 4D3FA 2HD4A 3COWA 4DWWA 4LJ7A 2YIMA 2WDPA 3AKDA 1M67A 2EGUA 2H29A 3HRKA 2A5FA 4HDNA 4YREA 2X9LA 3HQ4O 1O4WA 2RH8A 5FBWB 4KOEC 2DFNA 2W70A 4DEYA 5JD6A 5TPZD 3UT6A 5LN1A 2M6RA 2OCLA 1OXXK 1E9BA 3R77A 4RNDB 2AUTA 1H2XA 1L5GB 1Z0UA 2E6UX 2R62A 4FZ5A 1FS5A 2AQKA 3A6PC 3H17A 4HPXB 2EBUA 1R9NA 3BJIC 5TRTA 1L8OA 2ZU0C 3WHIA 2GESA 2PZJA 4DVJA 4AQ7A 2MWMA 2IK8A 2WRZA 3HDQA 4DKXA 1RLIA 1MKYA 4I6GA 1F5SA 4Q4HB 4CM1A 3LO5A 4KPYA 4OLAA 2E5WA 4MKHA 2C2KA 2JGJA 3EF0A 3DO6A 3KPJA 5HKAA 4ZCLA 1WUJS 4BN4A 2XUGA 4XDYA 4ZI2A 1GVNB 4NMHA 2G76A 3IEIA 4ZRNA 1AQLA 1LWNA 1VLLA 2X19A 2YICA 3EOZA 5T3UA 2AOWA 2PGOA 3AR8A 3GLRA 4WSOA 3T5DA 4LCBA 5F98A 2B5WA 5H3LA 2Z2IA 4IS3A 5KSZA 3ZK7A 2UYYA 4QRDA 3VVCA 5T6MA 4R8SA 1HYQA 1ZXXA 1EHCA 3RSGA 1NIJA 4J0JA 1RE0A 5EYPA 3UB2A 3DVLA 1T2UA 3KPVA 1U0BB 1TT7A 1RLTA 1ZSNA 3BRQA 1FX0B 3SX4A 4IIVA 2C4VA 2N46A 4Y98A 4NEGA 3ZW8A 4YUXA 2G5GX 3WO0A 4B5KA 1HK7A 1YVEI 3LUJA 1UKYA 3S2SA 2BEUB 4MUFA 3RWMB 1MOQA 5FL7A 1U1EA 3ELUA 4JHLA 4R2XA 4OI0A 4TSFD 1M8FA 4J90A 4BZXA 4QA9A 5L3SB 2A9VA 4KXLA 3JD1A 1ADJA 3OWHA 4LAFA 4QDXA 1K0FA 4QVGA 4WERA 3VJMA 3F3SA 1EFCA 1JDPA 3EBPA 2BEWA 2IEAA 3AIOA 4LZPA 3GWGA 2HJWA 3Q7QA 2BDUA 5I9IA 1E69A 2IYEA 2C5GA 1EQAA 3T99A 1B3BA 1OA0A 4UBMA 2TS1A 3P20A 2AKYA 2FJ0A 2MTBA 2ZIEA 3CO5A 1G20A 1AKQA 3CLSC 3DLBA 1OV6A 2XDQB 3Q3CA 4K2HA 3AVQA 4URUR 1M6EX 2JI7A 2JIZA 3K0HA 4I50B 2J0UA 3HB7A 1KBQA 3K3PA 3HYCA 1OC4A 2PD4A 3B6EA 2H57A 4HC4A 4RETA 4PGAA 4I55B 3E1KA 1T5TA 1JR6A 2JRLA 5K4AA 4QRHA 1JN0A 2PUDA 1EAMA 3SKVA 3AZOA 5TB5A 1T1IA 4B6QA 3DZIA 2C78A 1WIWA 2WIFA 3KR1A 1O54A 1LJ8A 3L5OA 1EFRD 3ZDCA 3G8DA 1EVQA 3TNYA 3EDMA 2TRSB 1ZH4A 4U3JA 4L6AA 1BS9A 4Z4CA 3DCJA 1VJRA 4REQA 2H1HA 3IDSA 4MVCA 1Z5WA 5AO9A 1A9OA 1JFVA 2QUKA 1AK2A 1ZHHA 2WFLB 5KSWB 3NIWA 3Q7RA 4CG0A 4S1PA 1VCHA 1T0PA 4ZKDA 4BRWA 1RNLA 3TXXA 2JKYA 2W2NA 3FHLA 1AA9A 1U94A 3HJGA 1RRFA 4I8DA 5LA6F 1H5UA 3UJ7A 3DFFA 5ENDA 5LYJB 3W05A 2ORED 3EFEA 4OUKX 4Q7QA 4CL2A 1T9GR 3B3GA 1JYEA 5KS2A 1YBVA 2P9FA 3SPXA 1XUOA 4MCAA 3EPJA 2CHQA 1YL6A 3AJRA 3GF4A 3P9NA 4AJ1A 3G7NA 3VRHA 3O7WA 3I5XA 1AN9A 3U7QA 5CP8A 2FWPA 4C07A 1E5TA 5I7SA 1QVRA 3Q15C 4ZQCB 1XHEA 3OHPA 3PWZA 5GAJA 3ZS8A 4EHFA 9ABPA 3MC1A 1IY9A 4I8XA 3JZIA 2FQXA 1EE9A 4DV7B 3EA5A 5EJ2A 2XUFA 3B78A 2B4QA 3AF4A 3K8YA 4AS2A 1H4QA 1DTSA 1XMIA 2DECA 4E4TA 5JDIA 1L7DA 1OUMA 3HI6A 4GC5A 3SFVA 1OROA 1L8AA 1PZNA 4EFLA 2DERA 2IEYA 2I78A 3TRFA 2OE2A 2PUJA 3BXHA 4WXPA 3FWPA 2ZBQA 2OFOA 4QPNA 2OT3B 5EXSA 4ZT4A 4B8YA 5JWOA 1NW3A 4PRZA 2B4AA 1CF2O 2VTBB 1J49A 4EBFA 2OXCA 4R7ZA 3AL3A 3ZOZA 1UAAA 2G83A 1H2AS 1V1MA 2ECKA 1XZFA 1PS9A 4OMFG 4GLOA 5BR8B 4RTPA 1YGPA 1WPXA 4W5HA 5DYNA 5G0UA 2P2LA 4OQZA 5IX8A 4QJIA 3WXMA 3GEBA 2Y1XA 4AP9A 1X38A 2QNRA 3CEAA 2WMYA 3TLBA 2WKQA 4AKSA 4B46A 1FRVA 1N0VC 1OAOA 1YU6A 4L3OA 4F4JA 4HV4A 4X85A 2B82A 3S7ZA 1L5HA 3OTOB 1UBOS 3PWKA 2V4ZA 3G0GA 1NMYA 4MLDA 4I8IA 1BC5A 4WEQA 4XAQA 2QD1A 3FRHA 2CNWA 3BJEA 3H5VA 5GIPE 4ZN6A 1OZFA 2H9AA 2PMEA 1WUTA 5A4FS 3JYHA 2PQ6A 3I3OA 1TVMA 1ST2A 2R6FA 1ZESA 4WOJA 3NMUF 4GG1A 1HTBA 4EI7A 4DLWA 2P6PA 5CVVA 1O7JA 4TWZA 5AP9A 1NLFA 4UUOA 2IQ5A 3BSSA 1JZSA 3CX8A 1U7OA 3LC0A 2XQGA 3QK7A 3L6EA 4REOA 3PGJA 3CF4G 3B1JA 4INOA 1PLLA 1FS6A 2HQSA 3WKDA 4FQ8A 1G3IA 4EO7A 4OV6B 5ALLA 5ELXA 5FA5A 4GWKA 2F9FA 2YWFA 4MRAA 1YOVA 2RJOA 2Y0CA 4BQNA 2W93A 3E1SA 5C7OO 4KK4A 4D7AA 5CNJA 5CITA 3RF7A 2NUAA 2WG1A 2R3SA 2H8KA 1JAZA 2VAMA 1B6SA 3TJZA 3SF8A 3VPBA 4A36A 2BN4A 1WUIS 3OE7D 4GE0A 4KVZA 2XUAA 4Q93A 2B8TA 3R3UA 4OIMA 1Z6XA 3I9NA 3P26A 1MO4A 4HDKB 1YU9A 2QSYA 4HWTA 2OZEA 5JV5A 4P5EA 1F38A 3PF9A 2QYTA 3ACDA 4O2AA 4INAA 4G89A 1BHQ1 1ZCZA 4EG5A 2FPGA 2EJWA 4JP1A 3M1IA 1OIVA 1VXRA 4J1SA 4UFOA 4WJKB 3NHAA 1PNQA 3S5JA 3UOGA 4B3JA 3FJYA 2DBYA 3FI9A 2VPXA 3ITEA 1BGXT 4Y2HA 2GTIA 4XYEA 3DXFA 2FSHA 5TIIA 3ZC3A 1M76A 4CMIB 1Q0PA 3TPCA 1YDMA 2A4MA 2IVZA 4PLZA 2JHAA 1RJ9B 3U4GA 1OFUA 4R9VA 1S2LA 1SOUA 3KRTA 3STVA 5AYVA 4DILA 3DAFA 4YH1A 4RE5A 2YOFA 3H1PA 2AJ8A 1EEXB 5DNUA 3DCIA 4W5OA 1YL7A 2GCIA 1JVNA 4HNGA 1ZHFA 2DFKB 1WXFA 1G2IA 3AFNA 4XDHA 1ZOLA 2PS9A 2RONA 1ECLA 2VT3A 3HSKA 2E4UA 3CV3A 4LFBB 2E4WA 2XE7A 2PS0A 2GXSA 2XWQA 1YJ5A 1BKDR 2CFTA 1JDTA 2QM8A 4JZYA 4OTZA 3OBBA 1WOYA 1Z0ZA 3K30A 5HDBB 4Q16A 4YALA 4A16A 3OEED 4UUQA 4DV6B 3QVLA 3L7NA 3GI1A 3VPCA 3ABIA 3O03A 2ZJ8A 2YHBA 4KJZA 4BDTA 4DB4A 2XGJA 3C7TA 3MK31 5HF6A 4DQVA 5JXHA 4KMRA 2BRUA 4AO8A 3A25A 5JW6A 1H23A 2XLBA 2JBWA 1ZIOA 3E9DA 4V2UA 3UMCA 1DVRA 5EJEA 1WDMA 2NSJA 3ZH9B 1O57A 3H1FA 3I23A 1O95C 2CMKA 4LY9A 1SM4A 4OMDA 2Y8EA 2C9DA 5G1PA 8ATCA 4L73A 1V11A 3F8SA 3EJ6A 1ZO8A 2DYKA 2QN8A 2WHPA 2WHQA 5JZMA 1CFJA 4YCNA 5CCBA 1UMCA 4QDZA 1EK5A 2YV5A 1VFNA 5CM8B 1B0UA 1VECA 2Q4TA 3PDCA 3KL4A 5KI6A 4XWAA 3WKCA 1HDGO 3EOBI 3GEPA 2R8XA 2Q0HA 2C5SA 1CDDA 3B3FA 4M0MA 4OATA 1N7JA 4XVRA 5B53A 1CZKA 4M1OA 2W37A 2BEKA 4LYAA 3QE9Y 1SXGA 1TM5E 2XA2A 4QBIA 1PWHA 4QFBA 3F7OA 3EAQA 1PL6A 3MBOA 1UKCA 2PD6A 2J9RA 4MHSA 4E1VA 2GD6A 2G6BA 1GADO 4OKSA 4WBNF 5B4VA 5DBGA 1ZD1A 4JGGA 4EI8A 1JHOA 3PQ8A 4R1UA 1F14A 1PJAA 1ODKA 3DFUA 3WLFA 5BQ5A 2YZ2A 5JI3E 3O5AA 1HPLA 1D09A 3V1YA 1TX4B 4EK9A 4LY3A 3R4CA 2WU3A 4J1TC 3U13A 1XCBA 2VL7A 2FPUA 5FJJA 3E4CA 3M5DA 2FWIA 3W2IA 5B3JC 1JAYA 4D56A 2SCUB 5EEGA 2E18A 3LHSA 5DNDA 3ZZMA 2O8BB 1QQ6A 2YRWA 3UJBA 4CKBA 1J2RA 2C4NA 2RHWA 5A3RA 1RJFA 2D1SA 5TPZA 3CC8A 3LU1A 2OP1A 4U7WA 4HQ0A 3TNLA 2EKZA 2OVBA 3BOSA 1UEXC 2XQJA 5AM5A 1ZIXA 4C3OB 3D7KA 1D6MA 1W1WA 3A4VA 2FN3A 1OVMA 3HU1A 4H7HA 2C1ZA 13PKA 3F4KA 1GPJA 2X7HA 4L8YA 1W52X 4XR9A 3RYFA 3TF5A 3C5EA 1UMDA 2WI8A 1GSHA 4I9UA 4RD3A 1FNBA 1Y1KE 5K0LA 1SC9A 4R1NA 3OQ1A 3ZYZA 2F9MA 3CRRA 4HADA 2RHLA 1RKQA 2NU6B 3HJUA 3QV2A 3QWBA 4I1IA 3ZE7A 5CBKA 5JOQA 4B3CA 1ZK3A 3AVVA 3HM2A 5EE3A 5BVHA 2FDRA 1DQNA 4U5QA 4IKPA 4GOJA 1EUYA 3HU5A 2ZYWX 5ALXA 1JECA 2D0IA 4AY3A 1YGYA 3IS3A 2K5UA 2XNKA 3WOVA 2OO5C 2JVIA 1DAEA 3EY9A 2ZTLA 4IICA 1H0KA 2ZDQA 3UXHA 5JECA 3IXMA 3UCFA 4EKGA 2X15A 2ZR8A 1O6BA 4PPFA 2DWUA 4YJ2F 1BQEA 1CNFA 4KMSA 4ENWA 2A5GA 5AI6A 5FI0B 3GUYA 4GNKA 4DLAA 5AKEA 3EZFA 1Z12A 2A9PA 1KARA 3MWFA 2B5OA 4JBHA 3T52A 1DBQA 1J2JA 1Q21A 1SC6A 3IQWA 3AHIA 1QONA 3BIFA 1UOEA 2HSGA 4OOEA 4TTIA 5EE1A 4PLWA 3RTGA 3SYNA 3OPMA 1OI2A 1ZVVA 4N3CA 1QWSA 5E1MA 4TSFA 5IZ4A 3K4HA 1B3RA 1ENZA 1V4BA 3KHKA 4PN7A 1XZQA 3DTNA 4TMYA 4CFSA 1Z6QA 1FLNA 3LRXA 5DN9A 1NBME 2X2OA 4QQKA 4BTVA 5B3KA 1MIOA 3AJAA 3IHLA 2ENWA 1KOLA 2N75A 1TAHA 4UBLA 5KTNA 4CT0A 4EG3A 2F90A 5DTEA 1GZDA 5TJ9A 4DG9A 1JKJB 1M3SA 4ZQGA 2UKDA 4WN9B 1QHHB 4LFAB 4FSXA 2CKDA 1E6UA 2NU9A 1TFUA 1VIVA 1E58A 2ZXEA 3CN9A 3FMVA 4O2BA 2IHVA 3M0EA 4TS4A 5DFAA 4IQGA 3K09C 5EUCA 2QZZA 4JC8A 1K63A 1NV8A 5SZIA 3OF5A 2G0AA 1KJIA 3I0NA 4HGYA 4F7DA 1L7OA 4QEKA 1RYNA 3W5HA 3HMQA 5HNKA 4N0QA 1QV9A 4RTLA 3SZMA 2PZLA 3A1SA 1KQFA 4YS6A 5CM9C 4MWCA 4FHDA 4GSLA 3ZV4A 3RGWS 3G8CA 4MO9A 4J1NA 4N3BA 3NIFB 3K73O 4AYTA 6CHYA 1TJNA 1W9MA 3AKEA 3W6OA 1Y7LA 4ZI5A 4MVJE 3TSYA 1XEWY 1EFRA 3F6EX 3QPDA 3MWDA 5ALOA 1SXPA 3CJRA 3DLIA 2FPPB 2R2AA 3GEEA 3EXHB 5GONF 1KMNA 4C22A 2QOEA 2H2HA 1IRIA 3W3AA 2PPVA 3WQRA 4CCYB 2QRHA 4L27A 4HGPA 4BWYA 2YWGA 3W9UA 4ZANA 2IV7A 2JLYA 1KEZA 1D4OA 1SFRA 1R0KA 3G88A 4IDHA 4L3VA 4EEKA 1GRCA 4R40A 4Z2YA 1LPBB 3R7FA 5BWBA 5G0WA 3VKVA 4FYHA 2D1FA 2YH2A 2V7XA 4Q1VA 2HN9A 5E4FA 4L9AA 3X2EA 1DE0A 4DR3B 3UG6A 1T2EA 1F2VA 2ESRA 2Q99A 2OV1A 4NENA 1ONPA 1Q0RA 1DU4A 1H2EA 3FF4A 3DVAB 1VE6A 3WA6A 4OQLA 4DLLA 1X8XA 3DO8A 1T9BA 4W9RA 4BEWA 3AUJB 1OXUA 3PXBA 2BI8A 3FHOA 5IFKA 5LQDA 3GUHA 2ZWOA 3RS0A 1V8BA 2JJYA 3SC2B 5IKMA 3PEWA 2V8OA 2CE2X 5EMHA 1W29A 5GV7A 1GSIA 3ZJTA 1QDUA 2FK7A 2Y92A 3KSDO 4UU8A 2VHVA 2ZIAA 2I91A 2IXDA 2FSIA 2VYVA 3G0OA 3QG1A 3WA7A 3UHFA 3P9CA 3AYXB 1KJYA 1M0EA 4MWGA 3TRIA 3C6BA 4YHHB 4KWIA 3U3JA 4U0KA 4N8DA 2PJRA 3K0SA 3DH0A 2VH2A 3F71A 4UPVA 3IUSA 3HVJA 1XTQA 1ABEA 1O08A 4OFZA 5COBA 3GVXA 1ND5A 3GPDG 3NBFA 4DG8A 4DDVA 4UTNA 2BCJQ 2HKIA 4TYQA 5GVRA 2AFIE 2A0YA 3A1EA 3EIXA 3ZXYA 2VSYA 3KL2A 4FB4A 3G0HA 2QORA 4DA0A 1WLSA 3DOCA 2GFQA 4IWYA 2DP4E 2EKBA 1W5TA 3EDRA 1F0KA 4CF5A 1PEAA 1A2QA 5FLEX 4OREX 3PQ6A 3B6MA 4TZ6A 2OQRA 1YB4A 1ODSA 3P9YA 5HG0A 2RI1A 4PG8A 1J8FA 1FJGB 3VQTA 2HEGA 1QG0A 3H83A 3TK1A 2YWXA 1MAHA 3EW7A 1MB9A 1U28A 2W83A 4RGBA 1X19A 5E0OA 8MHTA 3PUYA 5FPQA 1S4MA 4QBKA 5K8UA 1E2BA 3N0VA 1ZX1A 1PFQA 5DJ5A 3SD7A 3WLEA 4BNGA 3LNTA 1VG8A 4UKDA 4YTEA 5C1PA 2XYGA 3FBGA 4BFCA 4OM7A 2WKRA 4RHXA 3L8HA 4F0JA 4RENA 1E5DA 2MSNA 3S27A 1CLEA 1KEWA 1SELA 2NTEA 1CHNA 2P75A 2JFQA 1GA6A 2YJGA 2HDWA 3UT0A 3INRA 3VXKA 4B4UA 5LZ4A 3LTNC 1FQJA 1USKA 1X80B 2XR1A 4IIYA 3NH6A 4N8SA 2VCHA 1ZWLA 3JASB 1SEPA 4FT4A 4MMZB 4X0EA 4AZVA 1QNLA 5EOVA 3IRUA 3RRXA 1XXHE 4GKBA 2QXTA 2O3SA 3B1XA 3JR3A 1V5EA 2DPYA 3CF0A 3C3PA 5IANA 5AVKA 3C98A 3VU3A 4YN3A 2JB9A 3VHXB 1V8ZA 4R5MA 2OHXA 4RABA 4JUDX 4RQUA 3ZJ5A 3X1XA 3N86A 3LX8A 3KLNA 4Z5XA 4PXSA 3E5NA 1M0TA 3LMKA 4DMMA 1NVKA 2J9GA 4P2GA 3E9QA 4EI2A 1M9NA 1O9HA 1EJBA 2VYND 2P7HA 3OE7A 5EPOA 3ROMA 5JZBA 2DY0A 4W7SA 4MMXB 4Y9RA 1OWNA 2GKSA 3TMKA 1WMBA 5BXYA 1XA3A 3UM9A 1PUJA 1G5RA 1C0KA 1YE3A 2WTUA 2J8ZA 1K7YA 2CV2A 1GGMA 5IN5A 1U3DA 2FEKA 2YIJA 4HUQB 4FP9A 3P0IA 1W46A 1JX6A 4Z4EA 1NE2A 2ZAIA 1GL7A 4YX9A 2CJYA 1OVGA 1XDUA 2QGNA 3CO0S 3IA7A 3ILXA 1ESMA 3QNUA 4IBOA 3SEFA 3W5JA 3R44A 4UDXX 3MZ0A 1U2TA 1ADCA 2CMFA 2FXIA 1XD9A 2BE9A 2YWBA 5B1EA 3GRZA 1IHUA 1HLPA 4DPMA 1V26A 1IN1A 1JAIA 1RHQA 1WUHS 2FEAA 1EYZA 2HY7A 3K5HA 3MMNA 4K26A 2OV8A 1KMCA 4Q12A 4YMWA 1DJOA 3IDAA 3RHZA 4ZHQB 2AEMA 5DT9A 1I8TA 3AONB 4UHKA 2J3EA 3HJTA 5I4CA 4F2HA 3JZFA 2J7PD 3FF1A 1UZUA 2HLPA 2MINA 4DLTA 1EHYA 1W0JA 2IA5A 1JHVA 1XZJA 1U2PA 5AI0A 5ALKA 1NI5A 3R76A 4AX4A 1Y6FA 4R7TA 4HXGA 4Q1EA 2PY6A 3QPBA 4IG9A 1DKUA 1DWUA 4M46A 1ECBA 3EUWA 3PR2B 3RC7A 1EJ6A 2FP4A 5F7JA 2K4MA 2BCGY 2ZBDA 2PVSA 5BV2P 4WEOA 2QYHA 1U7PA 4Z7QB 2Y99A 3D8NA 4Q47A 3FA2A 3S81A 1QBGA 2HCRA 3LVBA 1QF6A 1GQ2A 4YCJA 3WGYA 3WIOA 4TTTS 3GNTA 2QTGA 1ZYUA 1EVKA 4QBHA 1AB5A 2CD7A 2HYDA 2JAWA 3ETJA 4M0KA 3UJPA 3Q0IA 3FRIA 1EB8A 3K0AA 3KJNA 4AZ0B 4XSHA 1DDIA 1ECFA 3ROKA 1ZS9A 1BOFA 5C9ZA 1P2BA 5JC8A 5L40A 1WKVA 1FDIA 3GT3A 2NNWB 4BEVA 4UC0A 5ITWA 4LF6B 3HMKA 3F5FA 2XE6A 4FYVA 2IF0A 1PK9A 5HDQA 3VISA 3N8HA 2OGWA 4QG3A 4OXQA 4IHJA 4O0MA 4IDQA 3S2YA 2OO3A 4F85A 2GNAA 2IXTA 3UYKA 1VPDA 1NVAA 1ZUNA 1W4CA 5GONB 1H8ED 1Z6AA 2IYAA 2A9KA 2VF7A 4EFDA 3BFVA 3WAGA 4TT3D 3C6XA 1CUCA 1HDOA 4H3SA 2RC6A 3TSZA 1P1IA 4KXWA 1EE2A 3UMSA 1OTXA 2NV6A 3RLFA 4CW7A 4Y3UA 1COWA 3SJCA 2G40A 5CLFA 1N5DA 2ZT7A 4GRAA 4QGBA 3WWYA 2YN2A 4UCQA 2H6EA 4MRSA 4MVJG 4PYLA 1NOKA 1Y1PA 4ZFNA 1KETA 2PRJA 4HQ6A 4N5NA 2WHEA 3U39A 4C2BA 3OJCA 4EUFA 3GPCA 1CRPA 3IPYA 4W4TA 4NP6A 5AXAA 2G9VA 2P4UA 2M6KA 4TWIA 1DIBA 2NXJA 4IQFA 5B58T 1PTJA 2NUTB 3DCNA 3RRJA 5A5EA 6REQA 1GAXA 1GT6A 5B4TA 5AUNB 4WXEA 9ATCA 1Z5ZA 4CETA 4ZYTA 2C58A 3GT4A 1TYCA 3LUPA 3AB8A 4JYCA 5ES4B 2W7TA 3PKJA 3EIEA 4H4EA 4KZPA 5JAQA 3VC7A 1RKBA 2GF9A 3RFCA 2VO1A 5BORA 4LRSB 1M8JA 5SYMA 8ABPA 4NNOA 3RT7A 2QUAA 3PS9A 1KMQA 4EHAA 1EI9A 2BKVA 3P0EA 4II3A 5F3RA 2TSYB 3RS9A 4K6OA 5C8YA 5SY6A 3UK6A 3WB2A 3M6WA