3U81A

Crystal structure of a sah-bound semi-holo form of rat catechol-o-methyltransferase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
218
structure length
218
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 74
structure length 218
sequence length 218
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2011-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3u81A00
5IH3A 2PX4A 1QAQA 1RJGA 3TKAA 4ISCA 2ZZNA 1YFJA 4GF5A 1MHTA 3LBYA 3FUVA 3HP7A 4X61A 4M7RA 4ATNA 2FCAA 1WS6A 2QRVB 4OBWA 3LCVB 1PRYA 2PLWA 3I64A 1O54A 3KKZA 3R24A 5DM2A 5EEGA 3V8VA 2K4MA 4JXJA 3I5UA 3C0KA 1EIZA 5EOVA 3EMBA 3O31A 2ZBQA 3OPNA 2O05A 5JR3A 1TW2A 3KQOA 4PIMA 4X63A 2FHPA 2ZBPA 4U7TB 4G56A 4GOOD 4PGGA 1SG9A 5EEHA 3B3JA 4FSXA 2AOWA 4GEKA 5EPEA 3WSTA 3MB5A 3Q7EA 5CIYA 1JG3A 5DTMA 3O4FA 4PYLA 1YUBA 2HNKA 3OFJA 4QQKA 3SSNA 4YV0A 4GOND 3P9NA 1FP1D 5DLYA 5G02A 4KW7A 4Z2YA 3KR9A 4BP1A 2ZW9A 5DRYA 2IGTA 4YMHA 4HTFA 3OE4A 4P7FA 3R9XB 1VP9A 3SGLA 1QYRA 3LHDA 2C7RA 4RV9A 2B2CA 2I6GA 3R0QA 5CVDA 5DSXA 5FUBA 1KPGA 1R8XA 5LQUA 3IEIA 5EVJA 4POOA 5DM0A 3G2MA 3PX2A 2IIPA 1ORHA 3PX3A 2UYQA 4RYLA 3HTXA 2AVNA 4LWOA 1G6Q1 4LG1A 2FYTA 3I53A 5DT2A 3RW9A 3UJ9A 3SX0A 1DL5A 1N2XA 2IDKA 3JWHA 4CXMA 1AV6A 2G72A 2IFTA 3BWCA 3I58A 2ONZA 3NDIA 2PX8A 2CMGA 1O9HA 2YXDA 3EVZA 4QDKA 4R6XA 4XUEA 3C3YA 3LDFA 2ZCJA 2PSSA 2G71A 1L9KA 4HRAA 5CVVA 3UA4A 1SUSA 3SSOA 3CGGA 3BWYA 4A6DA 7MHTA 5KYGA 3DMHA 1KYWA 3DLIA 3EVEA 2F8LA 2FK8A 4C06A 5EGSA 3PFHA 2HV9A 3G2QA 2VDUE 2V7EA 1EAMA 3LECA 3S68A 4E2WA 3A27A 2B25A 3TPZA 3EEOA 2DPMA 2GS9A 4PGHA 1NV8A 5LSAA 2UYHA 3FZGA 3GCZA 3T7SA 2DULA 3KR1A 3BZBA 4X1OA 5HOQA 1OR8A 1P91A 2P35A 2P40A 3NJRA 4RWZA 2EJTA 4ER5A 2YXLA 1NT2A 3LCCA 2GH1A 5B1SA 3REOA 4GOLD 2I62A 5FADA 5K0CA 1KP9A 3NDJA 4MWZA 5DM1A 1SUIA 2XYQA 5GM2A 3UJ8A 3AXTA 3UJAA 3KHKA 2I9KA 3DMGA 3EVDA 1PJZA 3EMDA 4EMSA 4XUCA 1B42A 1D2HA 1ZKDA 3FPHA 3C6KA 1NW7A 3UJCA 1I1NA 3FPEA 2A14A 5EKUA 2NP6A 9MHTA 3PTAA 4C4AA 3GWZA 2ESRA 5P8WA 3QOXA 1WXWA 2AZTA 3UJBA 3Q87B 4PNEA 4CKEA 3EVBA 2QYOA 3FUXA 3KQMA 3OCJA 2NP7A 4M36A 1AQIA 4CTJA 1D2CA 5E1BA 3MQ2A 4LWPA 3FYCA 3R6TA 5DX1A 5E1MA 5C9ZA 2H11A 4KIFA 3CJRA 2FPOA 4AZWA 4HC4A 3G5TA 4Y30A 4RVHA 4EKGA 2HTEA 2P3QA 4P58A 3P71T 5GIPE 4RTOA 3F4KA 1VLMA 1T43A 3ID6C 4RVGA 3NWBA 5H02A 5T64A 4F86A 1UFKA 5K03A 1IXKA 5F2KA 1XJ5A 2LD4A 1L3CA 3M6UA 1EQAA 4DCGA 3GRRA 3FPJA 2QE6A 4O29A 3T7RA 5HILA 1SQFA 3BKWA 3GRYA 4RTRA 3KQVA 2OPBA 3DULA 3PB3A 4HTFB 4P7GA 5GOZA 3HCEA 4UOEA 4GUAA 3EGVA 3K0BA 5DTRA 1G38A 4RTJA 3K6RA 1M0EA 5FWAA 4EKIA 3FUWA 3QOWA 4ZTBA 3VSEA 2JG3A 1X1AA 5BW4A 4RSRA 4BY9E 3BGVA 4QPPA 1RI4A 1VQ1A 2BR5A 3SM3A 3UA3A 2Q41A 5K0LA 4E2YA 4M37A 3KPUA 1RI2A 5EKXA 2YUIA 3ELUA 5CCXA 2ONYA 1X1BA 4KRGA 1NW8A 4PYIA 5JUWA 3HCCA 4R8RA 3MAGA 3AJDA 2XYVA 1Z3CA 2IBSA 3KPVA 4H0NA 2PVCA 4AX8A 3KQYA 3ANXA 1XDZA 1ZHFA 4EQZA 3HNRA 5DXJA 3DP7A 2IH5A 5GINE 3FUUA 3B3GA 2JHCA 3M70A 2H1RA 5LQNA 2PY6A 2QY6A 3G8BA 4PONA 5GWXA 3DR5A 1JSXA 4YMGA 3HEMA 4FS8A 4MQ4A 2IH4A 3EVCA 5FQOA 3E23A 3LPMA 2EJUA 3HCBA 3KPJA 1G8AA 2ZULA 4HGYA 4Y2HA 3TQSA 4RTKA 3SVZA 4E31A 4C07A 4OX9Y 1KPIA 1WY7A 1BHJA 4FZVA 4KDCA 3X0DA 1AF7A 2FRXA 5U4XA 2JHPA 1WZNA 4C05A 4CKBA 3NWEA 5CM2Z 1R74A 3HCDA 1RI5A 5EMLA 4FP9A 3O7WA 1Q0SA 2P1DA 1SQGA 3DUWA 3BGDA 5F2NA 2ADMA 2H00A 5CVUA 1YZ3A 1RJDA 3LKDA 3HVKA 4IKPA 5DSTA 3THSA 1JG2A 4RTLA 4PYOA 1NW6A 4AZVA 2OY0A 1XCJA 3FPGA 3GO4A 2PV0A 3FYDA 4YUYA 1G60A 5BW5A 1XDSA 3ORHA 1JG1A 2AOTB 4PYKA 4AZSA 3HA5A 3OU6A 4FGZA 3UZUA 2PWPA 1YB2A 5F2OA 5FQNA 3BT7A 1JTEA 3QV2A 2BR4A 5HFJA 1ZG3A 3OE5A 2OB2A 4QDJA 2B78A 4DM3A 3LDUA 1KIAA 3ELDA 4WXHA 3CBGA 2P7IA 4F85A 2IH2A 1XVAA 2P3OA 2XYRA 3D2LA 5DPMA 3TOSA 3PFGA 3V97A 3HA3A 3E7PA 5K0GA 3MCZA 5KQRA 2UYOA 3CCFA 1RJFA 4RVFA 2GPYA 3UFBA 4FT2A 3FPFA 4AZTA 5EMKA 3OU7A 3RODA 4IV0A 1D2GA 2GA9A 2ZFUA 4IWNA 4C08A 1HMYA 4C03A 1YFLA 5FTWA 1HNNA 3DLCA 3A4TA 3T0IA 4CKCA 3CJQA 3MERA 2WA1A 3E8SA 3TM4A 2O06A 3OU2A 4ER0A 5DX8A 2JH9A 4X41A 3TR6A 3SR4A 2P8JA 4OBXA 3GGDA 3MHTA 1M6YA 1L3IA 2JJQA 1EJ0A 1UWVA 3GRZA 3JWJA 3BKXA 4PYMA 3M33A 5C0OE 5ICCA 1VPTA 3GU3A 3AY0A 3KQSA 3PVCA 5E1OA 4FSDA 2ZLBA 3GIWA 3SXJA 5LQCA 1ZGJA 2AN3A 2GLUA 4E70A 5HEKA 4U7PB 2Z6AA 3M6WA 4YV1A 4OQEA 3ELYA 5C1IA 3HA7A 2ZVJA 5E8RA 4YUWA 4QTUB 5BP7A 2ZIFA 5HZMA 2AOTA 3I9FA 3VC1A 2XBMA 5DTQA 1VBFA 5MHTA 4XUDA 1R6AA 3G89A 3FTDA 1XCLA 5K0FA 2N47A 2C7PA 3HVIA 4ER3A 3P2EA 1KHHA 5FA5A 5GIOE 1YZHA 3LL7A 3NMUF 2P7HA 3LDGA 3DH0A 1N7JA 4KDRA 5KS2A 3AWIA 2EX4A 3IV6A 2VDVE 1ZGAA 1NW5A 2JHAA 2NYUA 5DWQA 2OZVA 2ORED 5EMMA 5EIFA 1KR5A 3KU1A 4XCXA 2KW5A 4PIPA 5HIJA 2C7OA 2CWWA 5FULA 1G55A 1X1CA 3KR2A 3A7EA 3A7DA 3NW9A 1F3LA 3P9KA 3R3HA 4FT4A 4RVDA 3B5IA 3C6MA 3TLJA 2CMHA 3EPPA 3JWGA 3JWIA 5E9JA 3GDHA 5T67A 3CC8A 4KWCA 3THRA 1BOOA 4DCMA 3UBTA 4L7VA 3FRHA 2R6ZA 2OB1A 1VL5A 4PCLA 1R00A 2ERCA 3UWPA 3BGIA 3G88A 1BC5A 4RTSA 3BUSA 1L3BA 1SVUA 2AR0A 2G8NA 3VYWA 2B9EA 3KQQA 5HIMA 2OYRA 1SKMA 3DXZA 1Y8CA 2ZWVA 3LCUA 1DCTA 2NXJA 2YXEA 5EMJA 3P9CA 5T6BA 5ICEA 2O0LA 2NXNA 4OQDA 4QTTB 1VE3A 3DMFA 3NVMB 1QAOA 2NNWB 1Q0TA 2PWYA 3P97A 1JQDA 1WXXA 1BKYA 3ERCA 1JQ3A 3ME5A 1KPHA 1NE2A 4HSGA 1F38A 1FBNA 3EVAA 1INLA 3VC2A 1WG8A 4B17A 1QANA 4PYJA 5KVAA 1N7IA 3OZSA 3TMAA 3UJDA 3T7TA 3IYLW 3A25A 4FR0A 4RX1A 3MTEA 5GP1A 4A6EA 1QAMA 4GOMD 3B3FA 5K0BA 4DQ0A 1U2ZA 1NV9A 1VIDA 2BR3A 2YVLA 1AQJA 2PBFA 1RI1A 5LQKA 3DOUA 1KYZA 1X1DA 5FCDA 1FP2A 1TPYA 3L8DA 2WK1A 5ERGB 3FTEA 1EJ6A 4V0RA 4LECA 5DM4A 3PT9A 3HVHA 3KR0A 3OZTA 3IHTA 2B3TA 3ELWA 3KQPA 3C3PA 2JH8A 3EGIA 3HVJA 4AUKA 1QZZA 4GC5A 3GJYA 1M6EX 4MTLA 2O07A 4HGZA 4KIGA 2UYCA 2HMYB 4PWYA 3UJ6A 3NVKI 3FTCA 2IP2A 5K05A 3M4XA 4K6MA 4PYQA 3FTFA 2IDJA 4MHTA 2GB4A 1NW3A 2GAFA 1MJFA 3FUTA 3G5LA 2PT9A 4GC9A 3HM2A 3P2IA 2NXEA 5CVEA 1UIRA 5E9QA 2EG5A 5EQJB 2PX5A 3ER8A 4IV8A 3PS9A 2IPXA 3TRKA 2V74B 2OO3A 1RI3A 1L1EA 2I7CA 4P7JA 1NBIA 3MCTA 2ZIEA 5EHIA 4DZRA 4RTQA 3SMQA 2AOXA 2VP3A 5K0EA 3EGEA 2ZTHA 3TM5A 2G1PA 1O9GA 5LQAA 1I9GA 3LBFA 1R18A 2ZSUA 2FK7A 3EEYA 3GNLA 5E2AA 2Z6QA 2PJDA 3M6VA 3DTNA 2UZ4A 4E32A 1RJEA 2BM8A 4HH4A 5DRTA 4E2XA 1X19A 5ICGA 3AXSA 3LGAA 2YQZA 4BLUA 3OZRA 2XVAA 2AOUA 5EIWA 1G8SA 1P1CA 1XXLA 4E33A 2IBTA 2BH2A 5BXYA 5FHRA 4QVGA 2XVMA 5EZSA 5IKMA 2BM9A 3CKKA 2P41A 3E05A 3G2OA 3U81A 2PXXA 5CCBA 2PGXA 2QRVA 2VZ9A 2ZZKA 2WA2A 4OA5A 4YUXA 1P1BA 2E5WA 5K09A 3GRVA 4HG2A 3NTVA 3B7PA 5CUQA 5K8VA 1TW3A 1V39A 10MHA 5K01A 1VP3A 1XTPA 5FWDA 2P3LA 3KPWA 5LQRA 1DUSA 5FHQA 4RTNA 2HR1A 3KQTA 1JR4A 5KQSA 1IM8A 3BWBA 4YUZA 2O57A 3GRUA 2C7QA 1JTFA 4DKJA 1EG2A 4MIKA 3BWMA 5EC8A 4ER7A 5DXAA 4QPNA 5LQJA 3MGGA 2ZWAA 3H2BA 2PKWA 3B89A 3BXOA 4E30A 4PCAA 3RIEA 3CJTA 3FRIA 2ZIGA 2YTZA 1P39A 2VDWA 1KXZA 3M6XA 2Y1XA 3EVFA 3P9IA 3G8AA 4PINA 2BZGA 4OA8A 4R05A 2Z6UA 4R8SA 4DF3A 3G7UA 2VS1A 3ER9A 2G70A 3DXYA 3P2KA 8MHTA 5M5BA 5HIKA 5FA8A 5E2BA 4YV2A 4YUVA 5K0JA 5LR6A 1YF3A 2PT6A 4BLVA 4C04A 1FJXA 4WVLA 4GBED 5E9WA 1FPQA 2AN4A 5ICFA 4NECA 1R8YA 2OXTA 4GQBA 2R3SA 3LKZA 2EFJA 2OBFA 2AOVA 2PX2A 4QQNA 4BLWA 3LSTA 5CVJA 4CWAA 5K0NA 3UJ7A 1ORIA 3HCFA 3TKYA 4QVKA 4DA4A 4P7KA 4X60A 3DXXA 4RTPA 1JSZA 5E1DA 4R6WA 2NXCA 2Y1WA 4CTKA 2HWKA 5DX0A 2PXCA 4PYNA 4RTMA 3GXOA 3EVGA 5EZQA 4DMGA 3PLAE 2AN5A 5D1HA 1NKVA 2PXAA 4EVIA 1NBHA 2QM3A 1ZQ9A 2ZZMA 4E2ZA 2YR0A 3CVOA 2AS0A 4EK9A 1I4WA 1JQEA 2OKCA 3KPYA 3KQWA 3LX6A 3P8ZA 5GM1A 1XDUA 2AVDA 2CL5A 2YX1A 2ZBRA 3G2PA 3MTIA 5D1NA 5EHGA 3OFKA 4KVZA 5E8JA 4ER6A 2CKDA 1JG4A 3A26A 3HCAA 4V0QA 3TFWA 1H1DA 1IY9A 4F84A 4M38A 5CD1A 5EG5A 5HIIA 3SSMA 4BP3A 2AOUB
chains in the Genus database with same CATH superfamily
3HO6A 4IY1A 1BKSB 4UC0A 1N1GA 3QXJA 2FLVA 3DNPA 1TUGA 3EZ7A 2QJTA 2H4XA 3OTGA 1NN5A 3FUVA 1F12A 4M7RA 5KTPA 2HMUA 5JS2A 1SXHA 1DOZA 1IZZA 3RVNA 4RWEA 4ABYA 1M5UA 1ZD8A 3R24A 5DM2A 2NO1A 1V6AA 1QPZA 1RJ9B 1U28C 3EMBA 3P19A 1AKYA 3UKDA 5B3LA 1E9DA 4R3WA 5SZJA 3LNCA 3DHYA 1LDMA 1GGHA 1S4QA 1GSAA 4HEA6 4TOIA 4LFCB 4G56A 4AX4A 1KH2A 4JLPA 4FSXA 3ZHZA 1Q3HA 1EUCB 1CY6A 2WFLA 4FMDB 3GRKA 1BHO1 2JFNA 4PG5A 1NC3A 5F77A 2OCGA 1U0LA 3E7WA 4E08A 1Y9ZA 3UOWA 3GRPA 4E03A 5I4CA 2VBGA 3EEIA 4X1YA 2GPJA 4G4JA 2AKYA 1EK0A 1I2ZA 3IOYA 2VO1A 3QUBA 1LQ2A 1ZJZA 2PH7A 4JSTA 3L6BA 2O3RA 3G17A 3MTQA 5ALNA 4CMIB 4G0VA 2J09A 4RQTA 1PFWA 4DV5B 1QNLA 3HRIA 1VG8A 1R6TA 4A2CA 3ILYA 1NIJA 1NMQA 3ZQJA 5B1HA 6REQB 2IIPA 4EB6B 5F3RA 1W4BA 1EA7A 1SIUA 2P77A 4ISBA 4BBPA 4M9ZA 4MGHA 3DT6A 4RVCA 3VV2A 3WTBA 3SX0A 4O4HF 1Z5UA 4LF8B 1FU4A 3ZQKA 4YWJA 2AF3C 2X14A 3RH0A 1TM1E 1QOZA 3NDIA 3L8MA 1TZ2A 1O9HA 2BFAA 5LDGA 1T3GA 3QVGB 4DLPA 1UKAA 1UFRA 4IOLA 3SEAA 4GG1A 1HL3A 1RP1A 1Y1KE 3ANNA 3DFIA 5JQGF 4KR3A 1V8BA 3RS5A 2N0SA 7MHTA 1HT1E 2JFOA 3P2MA 4JIMA 3JPYA 2X1MA 2QX6A 2XNJA 4MVJI 4HPWA 5IANA 2HV9A 4Y18A 2CNLA 3GLGB 5EGNA 2FVYA 5L9AA 3I8SA 4OHPA 2B25A 3AV3A 5AVUA 2C1XA 3A6FA 1MW9X 2EYUA 2XAAA 2GJKA 3AVYA 1T8UA 2JJ2A 2WJAA 4MUIA 4RJIA 3TNJA 3OZDA 1T8WA 1GPDG 2QTWB 2XA1A 3Q0EA 2CHUA 2HXGA 2VCHA 3AUTA 2WUGA 1H0HA 1ZBDA 2G1UA 1AS3A 1LJUA 3TKLA 2DUUA 3WL7A 3OIGA 2M1XA 5GM2A 3UJ8A 4Q7JB 3IMEA 5JNVA 1J24A 1SD2A 3DMGA 5CFRA 4AQYB 2AEJA 4I1RA 2XIJA 4H08A 2NP6A 3K0CC 3QOXA 1C14A 2BGWA 1UDRA 4CL0A 3OZAA 3NT2A 3LY5A 2QDKA 5HTOA 3X1KA 4I5IA 2H1OA 1E1LA 1TX4B 3AL2A 3FYUC 2FW1A 4MQFB 3EC2A 4R2XA 1QIKA 2JHGA 2X1HA 3G5TA 3KLBA 4QG3A 5JEDA 4YREA 4UBMA 4OG2A 1W36B 2E49A 2W98A 3AK4A 3FDJA 4ENWA 1IN1A 4B45A 5H02A 1J49A 2OQVA 1U8TA 2ZYWX 1RAHA 1XJ5A 1Y63A 4N6OA 2WSYB 3S2FA 1VDMA 4MUNA 1VHTA 3CZMA 3HP1A 3KZ1E 1QIEA 4W5QA 3QVSA 1S3IA 5K8CA 1I8TA 2VF2A 4NCXA 2WINI 3L0ZA 1G5IA 1OX4A 2PFGA 4JAVC 5ALKA 3RT9A 4CL2A 2HA7A 4XD7D 3K0BA 4BO6A 1DCKA 2F8SA 2ODTX 4R2KA 5EYPA 2JLVA 1WDWB 3INTA 5T41A 4YDRA 4BGVA 4UJ5A 4RSHA 1H22A 1UKBA 3DFZA 3KKLA 4MPJA 5DHRA 4F3TA 1Z4QA 4M7OA 3JZIA 4BY9E 4PIVA 2HAEA 5B7PA 5ELLA 3B6JA 5HF6A 5MFPA 2QRKA 4DIMA 4MI1A 1DVRA 3N0VA 1VKOA 3LUGA 5BSGA 2R751 4M37A 4EG1A 1FP6A 2JLBA 2ZWPA 5TQ0B 1X8XA 3KHSA 5AVTA 3T06B 1G8YA 1IZ9A 1F2UA 1XC7A 3NBMA 3P27A 5LOVB 1JKIA 1ZJ4A 8LDHA 2W83A 3RRJA 3SLKA 3WQHA 5F5LA 4H0NA 3PYXA 1EFTA 4BO8A 1ODLA 1XTJA 1PQUA 3EODA 4TKVA 2WWHA 1Q6ZA 2ZETA 4K6FA 5T57A 4G3XA 4GAEA 2XUZA 1DJNA 1RIIA 1NM5A 1M2WA 2J41A 3HEMA 4D81A 3VVCA 4US2R 1ZNYA 4A2PA 2PVSA 2ZULA 1TLFA 2HCFA 2ZSEA 3OQ1A 2QROA 4N82A 4QJIA 2RHDA 4TRNA 5FBZA 1BHJA 3PC6A 5BN5A 2ZSKA 1RYDA 2FRXA 4U2GA 5JZBA 1QE5A 4A8TA 3FOFC 3W78A 4OCZA 1P5JA 1TI7A 4FVTA 4GBGA 4DVGA 2IIBA 2PUJA 3D3WA 3A9UA 2YMPA 5AK4A 4LQ4A 3MK31 2ZJZA 5K3FA 4XUGB 1CT9A 1JG2A 4ZMBA 2F43B 3PD1A 1SAYA 4M1MA 4JLUA 1Z38A 3AP3A 4GQAA 2WRZA 5IAOA 1SBTA 4NV0A 5IJ9B 4E0BA 1YAJA 1Y37A 4RETA 1GEEA 4X1IB 5EE9A 3UHOA 3L4KA 3GJ8A 1MO2A 3ED1A 4JNKA 4HAIA 4RHEA 2X40A 5CLGA 3TXYA 5JCJD 4MMYB 1C0LA 4YCAA 2WKRA 2YRWA 3QV2A 4MKZA 3AEUB 4WCFB 1R27A 1Z12A 2C5FA 5KCZA 2OTCA 2FXVA 3BZWA 4JYCA 4QPJC 4XWAA 4YMWA 4U7DA 1UJBA 3IUMA 5HFNA 4URFA 3ZBPA 1O97C 3MJEA 4WRRA 3EA4A 2WSSA 5K0GA 4Y2XA 4M0PA 3IVRA 3IE1A 4PGAA 2OYCA 2FZGA 4WFQA 1C7FA 2YFHA 5I9SA 3RU9A 4AYTA 2DPYA 5EXTA 4L4UA 2P3SA 1JEYA 1WMEA 3A4TA 2PFKA 2XGSA 1CZNA 1SU6A 3PUJA 1QG6A 4BQOA 1QRTA 4H6PA 3F9CA 4F8YA 4GWGA 3HUTA 1IIRA 4EFNA 3VNUA 4HWTA 4GLLA 4UDOA 1DMRA 4OMDA 1ZISA 5C0OE 2YN4A 4CFSA 3IAXA 3H2KA 4H4EA 2BHSA 3SXJA 2Q3MA 4Q34A 1G4AE 5BMOA 2AN3A 1YB6A 3B3QA 3C6ZA 3PCXA 1Z4LA 2D0IA 3ZGYA 1T25A 1TM4E 3HJCA 3ZW9A 1G8MA 4GHWA 3F90A 5HJ5A 5E8RA 2H2FA 4OHMA 3MINB 1E8MA 3FDZB 1PJ2A 1TTHA 3CUYA 3NPMA 3P9PA 3ZKAA 1Y6FA 3QY0A 3B6MA 5GPBA 3NR2A 3V1TC 2GWHA 5C5EA 2PUBA 2BMJA 3A4LA 2Y2UA 1UANA 2FMFA 3TQQA 4BHTA 1D2RA 4L78A 3HJHA 2H2AA 2XA9A 2ID8A 1CUGA 5EIBD 2W6QA 3ISJA 3H1AA 4ZXFA 5MN6A 4E15A 3KUUA 4M53A 5ESXA 5C8YB 5HR5A 3V55A 2PDAA 2Q5HA 4Y2UA 2NYUA 2PWAA 3T7AA 3AVWA 4WA8A 1OFIA 1SVKA 1MEJA 3NOOA 3PQ8A 1AXEA 2G4CA 2C7OA 3RTAA 1PEYA 3S8MA 3HMKA 1CR1A 3KE8A 4IJ6A 4K8RB 4X84A 3R3HA 5BUQA 1UPXA 4XB1A 4NG4A 1JEJA 2II6A 2P9CA 4TMXA 2CMHA 5F9HA 1TCCA 2Y3IA 3ODGA 3BHJA 1V25A 3QNUA 2G5PA 4LBVA 4Y6PA 9LDBA 1QFJA 1PX2A 4HS9A 4CDGA 5TF0A 1Q7BA 1YACA 3GJRA 3P7MA 4D98A 4EDHA 2H5JA 3A6EA 1Q7RA 1IH8A 2PH3A 2EVWX 4S0XA 4CMEC 4Y6RA 4C7XA 5WRFA 3HBFA 3BZUA 4O2AF 1AKMA 4RJKA 5EMJA 1SRRA 4P4NA 4OJKA 1MXFA 2HIAA 3E2MA 4Y7CA 3ZYCA 1B6TA 2NNWB 4C0BA 3P97A 4ALNA 3MPUA 1JQDA 4CEHA 3ZH9B 1J2RA 1REQB 2JI7A 1HEYA 2HWXA 4HWKA 1B6GA 3A6JA 4NJOA 4P4TA 2FZVA 3ZK7A 1NE2A 5THQA 4HHEA 3A37A 6REQA 5ARCA 5LQRA 2VK2A 4NAVA 5A6VA 3IJEB 4FLEA 3HB0A 4B3SB 5IN5A 1QK4A 1A7KA 1RNLA 2OG2A 3FR7A 2PBFA 1WZIA 4BFCA 1HEIA 5DHQA 5MF6A 3JAKA 1W8DA 3DMYA 5AJHA 3LK6A 3SC2B 5THKA 5ERGB 5G0UA 1LY1A 4YXWA 4BMOB 2PG3A 4UEJA 3VDMA 2C5GA 1KZ4A 3ELWA 1C9DB 3HKEA 4UCFA 1MHTA 1V4BA 3BREA 2EWWA 2HSZA 2LKDA 4IV5A 1WCWA 4OIFA 1TYDE 1T10A 5H16A 1R0ZA 2GHQA 4RNCA 3RSFA 2UVDA 4WNYA 1M8GA 5CGQB 4H9GA 4CEIB 1SIWA 2J5XA 4NLLA 5DHTA 1ZK3A 3RBAA 5E9QA 4X95A 3P2IA 3CW2A 2HQRA 2BSXA 2OP1A 1YDEA 3L6OO 4E5VA 2H4WA 1RI3A 2OO3A 4BRZA 1CULC 1IXRC 1UMBB 4JEMA 3SK0A 3U7QB 5TY0A 3VJMA 5EHIA 2NYAA 3I01M 2WSBA 3B5EA 3IP5A 4F7DA 4WBNB 4PZUA 3Q3JB 2YZNA 4OQLA 3ENWA 1EX7A 3GQVA 2R7MA 3FNGA 3N8NA 2LIVA 1LEHA 1JHQA 3IEKA 3SZOA 4BX3A 1Z34A 1H66A 1ADBA 3DTNA 1VI2A 2V6FA 3ANTA 4HDNB 4IMIB 2R85A 4IX1A 5EMHA 4E3ZA 2VZ0A 4HOYA 3S1LA 5C8VA 1JW9B 2J3LA 2OCKA 4X64B 2PCJA 3BXXA 3GGOA 3L6DA 3GN2A 4GDFA 3VJRA 4QO7A 3FD8A 1M75A 3OLQA 4HFJA 4UU8A 2PGJA 4BN4A 1FFXA 5HQTA 3ISTA 1RD4A 4Z4FA 4H0CA 3LVQE 3DT8A 1MD9A 1QGZA 2BHRA 4ZO8A 4YASA 2ROQA 4B2YA 4B44A 1WA5A 2WA2A 3PJDA 4DRXB 3N8DA 1P2BA 4DJFC 2AR9A 1MW8X 5GJWC 2VQSA 1PGOA 3NTVA 5CJ2A 4WE3A 3AGQA 2FEWB 2WG0A 4WNAA 5B4VA 4ZRNA 2Q5EA 1A4IA 4XA8A 1OJ7A 4N5NA 4U8GA 3DBLB 2ZI3A 3L4SO 4EY6A 2DVMA 3EDQA 3BMQB 2R5FA 3PC8C 2DX7A 3NYQA 3WNVA 5KQSA 3T3PB 1BX0A 2WTBA 3LL4A 4F72A 2P9EA 1ZJJA 4E94A 4WJLA 3D64A 4LDJA 1TM7E 3BWMA 3P1JA 1SKYB 1GDDA 3Q3EA 4D97A 3OJLA 1MR3F 1DWPA 2MINB 3FF4A 1N2ZA 2CVFA 5GV8A 2GF9A 3CPHA 4YAUA 3JAMA 3FRIA 3N2LA 4U6NA 1V6SA 3ZUGA 3B1VA 3VNSA 1KXZA 5AK3A 4HDKB 5JFTA 4GL4A 2QN8A 1BCRB 3G7NA 2RAUA 4OU5A 2ZJ4A 1QRDA 3LZDA 3U62A 2G70A 3O3MB 4OAOA 2AE2A 1C9JA 3UN1A 5M5BA 1AXRA 3GLQA 2Q4DA 1PWYE 2DHEA 2FZ5A 2HLPA 5E2BA 4I5FA 2O14A 3IIKA 3DMNA 3OIWA 2GEKA 3FDIA 3MJFA 1FXUA 2JBAB 5L7YA 1HBJA 3JD4A 1NDQA 1AZLA 1G66A 5A02A 3G23A 2V3CC 1N7HA 2XNDD 1GILA 3LKZA 2C2GA 2OBFA 4FJ1A 4YRTA 1VLZA 3Q4GA 2O0JA 1WZCA 1GLNA 4IX9A 4NXMB 4IWYA 5GJBA 4CWAA 3PRKE 3G13A 4CTMA 5J5AA 1G0NA 4YP1A 2Y1CA 2XZPA 2HU7A 3MPOA 3B5JA 4C4ZA 2FSFA 2I2FA 4WKPA 1QIGA 3TRJA 1SXIA 5KYUB 3O0DA 4BU0A 2Y1WA 1EBBA 3OUUA 2I34A 2E48A 1J0CA 2IY8A 1JDJA 3WMWA 3M1IA 4ZJUA 3RRBA 1QIJA 3GXOA 2E3JA 3WO0A 2O3SA 3F2VA 2PL9A 3Q5GA 5EZQA 5HX7A 1Y98A 1MB0A 2P78A 1THZA 4HJXA 5D1HA 4S05A 1NBHA 2YWEA 1T0PA 4PSUA 3HBMA 1JIVA 4FEYA 4QX6A 2GZ1A 1V1MA 4V3CA 5EQTA 5LZ8A 3OIDA 1JZQA 1NLYA 3IR6A 5HCUA 2OKCA 2Y9MB 1QDUA 4NBSA 3ICPA 4RXTA 3G2PA 1LDGA 2XQIA 4ER6A 4BUCA 3MAJA 3T7KA 2YN2A 2VWPA 1GGVA 1SHUX 1JQJC 4O3MA 4NAUA 4MUEA 1EXVA 1QRAA 4F84A 4KWTA 2IU3A 1W0KA 4KP7A 4EYSA 2CD9A 1YMQA 3QMVA 1H2XA 3PHHA 1D2AA 1WHSA 4KJXA 5HCIA 1R0CA 4PZAA 1SELA 5EP4A 4HNUA 1D07A 4HNAB 3I2FA 4J07A 3NAQA 3K5WA 1ONSA 4TX1A 2ORVA 3AR7A 1GGJA 2HEGA 4PXAA 3MYYA 4MLDA 3C98A 2ZBQA 1MA3A 2YHIB 1JLRA 1SD1A 5L6LB 1QGDA 2HREA 2HRCA 4HRVA 4I36A 3KV3O 4K6CA 4X8LA 3GP3A 1KRXA 1LTKA 3SEQA 2A9PA 1E3LA 2Q5IA 3M6LA 3N0XA 4I9HA 3Q41A 4KVAA 4NHEA 5DTMA 4YQZA 4A8PA 3G1UA 3WRYA 2XVYA 4C4YA 2PZJA 1K6IA 4Y2TA 5NULA 1L8QA 2O19A 4CE6A 3ZJVA 5AK6A 1EWYA 1UM9A 2F64A 3MMZA 4JX9A 3SG0A 1EVIA 2IU6A 1JDBB 4ROTA 3U7IA 5ADVA 1E5DA 1DBIA 2O59A 4R1NA 4RZQA 1JXMA 1VLQA 2A84A 4LZPA 2IHBA 3UAGA 3AKZA 1N78A 2ZUUA 3V7UA 2PEYA 4Q24A 2O2IA 1ZRHA 2HYIC 4UVDA 3EH2A 3ROFA 2J0EA 2FJ0A 2NVUA 1XQ1A 3HYCA 3R76A 3K2QA 2Q1SA 4H35A 1IJBA 3SBDA 4P5DA 3VJKA 2Q4OA 1E2PA 1OZHA 4KIUA 3UF0A 1PLJA 2BFCB 3SF0A 2DSNA 3HDHA 5I9LA 4GVLA 5BSMA 3EVZA 4OTZA 4ID3A 5AJTA 3LCMA 5ALSA 1ZX1A 4UU0A 2B94A 1DLIA 8ADHA 3K9NA 2FEKA 3SSOA 4U2BA 1AZTA 3TOZA 2V0CA 1L7AA 3E27A 2LCQA 1L5WA 5A0TA 3H4VA 3CY6A 4O2BF 2BFBB 2DAPA 1K97A 4TUYF 2DMRA 3X44A 5BWLA 3CMMA 2FZKA 2OCBA 1Q2UA 3GJ0A 3KV1A 3KYDA 4G07A 4JC0A 4GE0A 2DR0A 2P0EA 3GFGA 4E2WA 5JS1A 1HF3A 3EEOA 1OAAA 1DFIA 2IOFA 1U2TA 4BLOA 4A0QA 4DUGD 1JB9A 1E3IA 1OLSA 1YJ8A 4JVLA 3M5CA 3MS4A 3V1LA 5CW1A 4V3BA 5HWSA 3BTSA 1WUKS 2WMOB 2PIDA 4ZAGA 1S0UA 2DUNA 1QZUA 3PITA 2NWQA 3Q7PA 2WF7A 5KYTA 1U1CA 3OPMA 4B3XA 2WU4A 2XYQA 4MEAA 2PTHA 3UICA 2C04A 4RXMA 5I7HA 4D0LB 1UFVA 5LMCA 2OHXA 3VR5D 1PCXA 4NI5A 2A6PA 1KEVA 1LI5A 2NSLA 4DSOA 2LW7A 3DVAB 3H42B 4NBTA 3RQIA 3ZU6A 4C7MA 3ADCA 4U5XA 4CKEA 1AKVA 3OCJA 1RJWA 3FRJA 5CB4A 2ZRIA 2CE7A 4OY3A 1E9RA 2NTEA 3F6PA 4LWPA 3ABRB 1ACJA 2N46A 2O7QA 4AXXA 4YMUA 1B8UA 1NBWB 5PGMA 1YONA 1XI2A 3ENZA 4GXNA 3D43A 3BEDA 4TKUB 4EKGA 2OBNA 1YFZA 4NJMB 2HD4A 4NBVA 5C35A 2P8SA 1F4LA 1TA9A 2CNBA 1TMKA 2OXCA 2Y1LA 5DLPA 5F76A 2O2CA 1U1GA 1JJ7A 2WUWE 2OPBA 4ZAZA 3WGKA 3K6SB 4XOIA 4GPBA 5KTSA 4UNPA 2OL4A 4IDBA 4IQ8A 3N87A 4H4CA 1M2VB 4WBSA 4BX2A 1XPJA 3G0BA 2FX3A 2WFAA 4IFEA 1JTVA 3UWOA 1U6KA 4IKOA 4BVEA 4F1WA 2WTAA 3VOSA 1K3TA 4FCTA 4WFIA 3IMGA 1NRJB 1Y4DE 2IODA 1W0JA 2Z04A 4HAYA 4DJJA 2JFWA 1A95A 1PGNA 2C7GA 3FPKA 1H8HD 4HX9A 1OLXA 4RSRA 2FRVA 5TSDA 3LUKA 5DLQC 1V1RB 1RI4A 5ALFA 5LXTA 2IS1A 3C15C 2DBYA 3HUFA 3RARA 1V35A 3VBCA 3A6DA 3ZWWA 3U4MA 1YS2X 4R1QA 2YW9A 1FMJA 2GEFA 4N49A 2I6SA 3L2OB 5CCXA 1FFWA 2HJVA 1DRUA 1GCIA 1KO7A 2HU5A 3PUXA 4PLTA 4RMGA 3MWJA 3CT4A 5LDDC 4I1IA 5EJGA 4N54A 4RVOA 4WXMA 2AYXA 3NKLA 2PZKA 2BSAA 1XZKA 2WMYA 1JEQA 5LU8A 3ZS8A 4AJNA 1C30B 1ZN9A 3D4IA 3ETDA 3I72A 4RMHA 2JW5A 1DJLA 4QC2A 1KYXA 1C1XB 2R84A 3G8BA 1QE3A 1XTTA 5FF9A 4NE9A 2CUTA 1J42A 1R66A 4QASA 4PPQA 1YOBA 4ZANA 3FNFA 4OX9Y 4BO0A 5FJIA 1BXKA 1YZYA 3CRW1 3Q10A 3UUFA 3GN1A 2IPMA 4RFSB 5JDIC 1TVEA 3AEKB 1GHTA 3GEDA 1PVOA 2JHPA 1UBNA 1WZNA 4YYEA 2C84A 1ULUA 2JGKA 3PK0A 3HCDA 3K9HA 4FE7A 2EZ9A 2X5JO 2JAXA 2IZ7A 4Q12A 4IP0A 1L7DA 3HJRA 1Q0SA 1SQGA 4M87A 3ICQB 2RGAA 1QR6A 2ADMA 4PX2A 4LYFA 5CVUA 5DF1A 5E95A 5AUQA 1NYRA 4ZODA 2A5FA 4Z9YA 4RTLA 1KJ8A 3H8SA 4U02A 4AMYA 4ZKDA 3IT2A 4X6LA 4OB6A 1NPDA 5BW5A 3LY7A 2R8YA 4DV4B 2H5EA 5FI3A 4HLQB 3VNQA 3TS1A 3V4LA 3JQAB 2C9BA 2IV7A 3FX2A 3GH3A 4K81B 4NOKA 4FGKA 4ZVPA 1J8DA 4RKYA 1M66A 1EVEA 1T2UA 3GUUA 4M76B 5F2OA 4QM7A 2GBLA 2P0YA 1VZ3A 3LXMA 4QLAA 1ZG3A 5DE3A 2ADFA 1FX0A 2I3AA 3WNCA 1JI0A 4DM4A 4WXHA 2WDPA 1EX9A 3PKIA 1LFAA 2XDYA 2HMSA 3H97A 2IH2A 1FYEA 3TOSA 3UMCA 4OLFA 1DRWA 4R1TA 1BDIA 5F7XA 3H1EA 3MCZA 1RJFA 2I6TA 1JBQA 3C8ZA 2Z4SA 3GAMA 4FFSA 3NFRA 2WWWA 4Y1RB 4EG8A 3TD9A 4CQNA 3IALA 5LFAA 1EWVA 1HMYA 4C7OA 4CKCA 5IJZA 1QTIA 1X7HA 4JBNA 1Y3IA 1U90A 4PPYA 1D8AA 1BHSA 1C7RA 2ZS8A 4EB3A 1GZ4A 2OBLA 2FPMA 1A27A 2Z8YA 3MXOA 3R0XA 1NUUA 4X54A 2FZCA 4DS3A 1KYIA 1ELOA 3RAFC 3S8YA 1E1RA 3F6EX 4NARA 4M4SA 2JCBA 3EBOA 3FI9A 4HBZA 3V8MA 5D6OA 3WR5A 5H9WA 1OH5A 4X66B 4JNCA 2X3FA 4FX2A 4J1NA 1R4ZA 2H4HA 1GL6A 2BGRA 4TKZA 4YV1A 3KJZA 1FFEA 5F23A 3JALA 5D00A 5KDDA 4AYWA 4BV9A 3O84A 2XWBF 3FWPA 4NS1A 1ZP6A 4O5OA 2O2JA 5KSWB 3T3NA 3A9SA 3HWSA 4QNNA 4ARCA 4Q7LA 2CNKA 1B0PA 2H0RA 3ZD9A 3G89A 3QVOA 1F8UA 4JB2A 5BY2A 4OGLA 4UARA 1MTZA 2RGYA 2ZDQA 4HFRA 1MGOA 2ODWA 1BMTA 2EYQA 3F5SA 1M5TA 5J4LA 4QFBA 2FUCA 2OYSA 4KDRA 2GCOA 4XYMA 1JYSA 1IBSA 1ENOA 1X7GA 4HF7A 5DWVA 1U1EA 2QRPA 1H69A 1FFCA 2HIMA 4XCXA 1JKJA 2VUIB 4TYQA 5HIJA 1XX6A 1W4ZA 1TFUA 3TD6A 3TEJA 3QITA 1K3FA 2PBZA 2HWUA 2R6JA 4MAAA 5CM8B 2PEZA 3SR4A 1L4UA 3IE2A 4AN1A 4I4CA 4BQNA 1IN5A 3MOSA 2AKAB 4GD3Q 4QOSA 4Q4AA 4HDRA 3FZQA 4RHCA 4X6YA 2ZJYA 4RF2A 1IWBB 3GVXA 4NONA 1TD1A 2W2OA 4JLBA 4LRUA 4B84A 3WRXA 1JALA 2Q1WA 3DSRA 3JVVA 4YJ3B 4E1BA 3B1KA 2JGFA 2JKZA 3VRHA 3RSHA 1M1NA 4D3YA 4WLFA 1Y3DE 2FPGB 3OUTA 4GMFA 4WK0B 5FBLB 4BNLA 4LF5B 3NTUA 4EL5A 1JFFA 2CHVA 3CHYA 3NC0C 2ZXUA 2BEWB 1O95C 4MW1A 4BUZA 4DNQA 2ORIA 1U1DA 2B61A 1ZD3A 1P2TA 4NYJQ 2WTMA 1AK9A 2BUCA 1JQ3A 1KI6A 1EE9A 2O1WA 2ZUBA 2FX2A 3QVWA 3ERCA 5JCXA 4BNFA 4O08A 1H2FA 1F38A 2RH9B 4CI0B 3NLLA 2CFTA 3GMTA 5JXGA 3AR6A 2XE7A 5CMLA 4DAEA 1ONOA 4URUR 1EXMA 1M2NA 2QNRA 4HNQA 4PFKA 4RMIA 2I66A 3S70A 4F06A 2O8EA 5GZ6A 4BV8A 1O08A 2Y6VA 2MWMA 3LY9A 3OHPA 1ZL2A 1O03A 1QG4A 4DA7A 4YYZA 4HGOA 5IMSA 5A7GA 3DOUA 4K6GA 4CLEA 4QTXA 3LM8A 4NEQA 1GNTA 3FB1A 2UU9B 2NV2B 3VYVA 3O8NA 3MEQA 4P82A 5K20A 1NZFA 4JR2A 1QF9A 3BFKA 4KQIA 3C3PA 3ZY3A 5C4MA 1TVKB 16PKA 3QWIA 2ZIZA 1KARA 2G80A 1JR3A 1UKYA 3T7JA 2VIIA 1OBOA 1NXQA 2AI2A 3ZBQA 3A04A 3PL1A 1Z06A 2C5LA 4X45A 3EE6A 3JQFC 1ICIA 2CLDX 4FGSA 2IP2A 4J49A 1E3TA 4Q7QA 1IOWA 1SUPA 5L4SA 1DFHA 3KJNA 1L7MA 1NGSA 5DN9A 2L18A 2O9JA 1MB9A 1X94A 3TNFA 1PJLA 5HKKD 3ZWNA 1NYLA 2XSZD 4MGEA 1J70A 3VSCA 4CNQA 1KDTA 3DM5A 1SQ0A 1Y1QA 3KHTA 2HRQA 2V74B 1NUAA 1ISHA 2TMGA 2VG8A 2M2IA 3NT4A 4TVOA 1XZMA 1G21A 2PJZA 5K0EA 1UODA 4BKRA 2ZUFA 1OB2A 4HXEB 5BR4A 4NOMA 1AZSC 2KLHA 2X8JB 3QPUA 2DKNA 2PWBA 2YHSA 2YJ5A 3A2MA 3Q40A 3EMVA 1WCIB 4JB3A 5AW5A 5HKOA 1QE0A 2RKBA 3S5JA 1XMXA 3KJFA 4NMHA 1BX3A 3H4IA 3ZHBA 3WZMA 2MYUA 4HH4A 4LX8A 1J0AA 1RYEA 1D9ZA 1JBKA 3AXSA 3E70C 1I13A 5EQFA 2BRUC 3NBYC 1CQZA 5ALDA 1P1CA 4RZXA 3EIOA 5BSVA 1ZOIA 1P61B 1VPDA 3QFCA 1AHHA 4YJDA 3I2YX 1Y7LA 2J48A 2HBZA 1LK5A 2QTFA 2W8ZA 1RPNA 3BEOA 3NHBA 5EWMB 1BXRA 5HQJA 4JI2B 1U7ZA 2QRNA 3RSOA 4PG4A 2DF8A 3K8YA 1QHIA 1CU1A 3R23A 3N70A 1UP7A 2GTHA 2V7UA 1RXCA 2ZSBA 3IDZA 5C3MA 3NCHA 3INYA 1NFFA 5BWBA 4N3CA 1Y5IA 1TW3A 2ZI6A 3RJMA 2JNWA 4QO8A 7AT1A 4BVLA 5AM0A 1B93A 4CT4B 4ARUA 4BFXA 4EWLA 2G6BA 2ZE7A 3L0CA 4FINA 1XTZA 1EB9A 1PW5A 4JLJA 4GX5A 4LY3A 4QU8A 4UVEA 1JWBB 2GWRA 3A9TA 2O57A 5H4HA 1PSZA 2QTAA 3H9BA 5CAEA 5IJWA 5KJCA 5LBIA 3CF4A 4AY3A 4EI2A 1ATZA 4DREA 1X38A 5LLTA 2YJNA 2BI4A 3Q3HA 3VR6D 3GP8A 4CV2A 4YX9A 3U3RA 3B89A 1H0SA 2YV4A 1N2BA 3TLXA 2YASA 3TTYA 2HA2A 2QM0A 4MPDA 4EPTA 1KO8A 3I73A 1G7TA 4OA8A 3L5OA 5CCDA 3AL3A 3QQPA 1S8AA 5KHAA 4PHHA 1UPFA 3DWIA 2H7XA 3NRJA 5LPNA 4KQJA 4LK2A 3WL6A 4OXYA 4Z9BA 4QEZA 3VR4H 1IMOA 1W9HA 1T0HB 3GLUA 3NHRA 4CCYB 3K30A 3O5AA 1QC5B 3EPKA 1ENPA 2JAQA 4G86A 1P0IA 4F2DA 1HDEA 1TJ4A 3ESQA 3SNHA 4DMLA 1HLDA 1E2UA 3M4YA 1XD8A 1JBEA 4GQBA 2QUHA 5COBA 4BC1A 2PH5A 1C8VB 2N1BA 3BK2A 3GCGA 3QF4A 4S1WA 2DWOA 5KVQA 3U39A 1NTOA 1NX9A 2VOEA 2MIIA 1U80A 3KFXA 1ZMOA 4KN8A 4TLCA 1LRLA 1SEVA 1UZAA 2ZB8A 3T99A 3UGJA 2F4VB 1ORIA 1QG2A 4AKSA 3H16A 3PNPA 3ADBA 5IASA 2BHTA 5IARA 4OK5A 4ZICA 1FDRA 3DL4A 1D8TA 2HQ1A 1NP7A 2PX6A 1FEZA 1NONA 2GZ3A 4C0HA 1T29A 4I4TF 2EQBA 3CLTD 3KAPA 1KEKA 2HO5A 1LDBA 2AFIB 1JJFA 3WHKA 1FS5A 4EVIA 3P4UA 2VP0A 3VYRB 1JHRA 2XRYA 1FTSA 3P94A 3KUDA 5LNK6 1K7EB 3RT1A 1JHVA 2W22A 2ZBRA 1XAJA 3R0ZA 4TVBA 4AUNA 1J0XO 2J32A 2VHVA 4UDXX 4V02A 3L6RA 4XIJA 2WHYA 4LJRA 4X85A 3K94A 1IBRA 1IEVA 4PLVA 4QYIB 1ULAA 1C3XA 1Y1TA 4U9IS 2QBYB 1NLUA 1XMVA 4BP3A 1HDXA 4J0IA 2XTZA 4D80A 5B1IA 1X0XA 2DYKA 1YCHA 2QLNA 1CZHA 1JIKA 1RTKA 1UMDA 1M2GA 1YO6A 5CHEA 1IXZA 1E8DA 4HBGA 4AS3A 1E79D 2AC2A 4YO7A 2FCAA 2Q2VA 3CXRA 2Q7DA 1D5WA 1RYNA 3I1FA 4I3GA 2NO5A 1X7XA 5KO2A 1UBCA 2FQWA 3DHEA 5EUCA 2BGKA 4UTZA 1AGPA 1KA9H 3NTRA 4AJ9A 3EJWA 1EVJA 4MR8A 3WWPA 4UFPA 4RPJA 4UPVA 1N6OA 4HCJA 4AP9A 2B36A 2A88A 4XD7A 2HU8A 3QFSA 1Z8FA 2NTYC 3O4FA 4OXNA 5KYNA 3OHMA 4HAOA 4R9VA 1NF2A 4BZQA 4EB8A 4WT7A 3P9NA 2Y92A 3TTVA 4A73A 5IXSA 5JHGB 3BORA 2W2KB 1VE5A 1NXWA 3TLBA 2W6ID 4ESEA 4EO7A 5AW1A 3FMIA 2VDWB 3A0RB 4AZ0B 1XDWA 3LHDA 5SZHB 4U7JA 5KNDD 1VGVA 1C80A 2IUSA 3OWOA 4NENB 5DSXA 5EL0A 3Q0TA 2VDQB 1KPGA 2YZGA 1OV4A 1EM8A 4MMXB 2XRFA 3H83A 2IQIA 3PD0A 3PBKA 2PFSA 4IF6A 1E20A 3X1MA 3UJ9A 3WG9A 1LSOA 2I55A 3DEKA 4K46A 1N2XA 3OOEA 3QBJA 2VHXA 5CH8A 2V97A 2EW2A 4AS2A 1TECE 4YXFA 3H2GA 1FCJA 1QCYA 1WW2A 2VT3A 3R40A 1AQUA 5LLDA 4UKDA 3MG9A 4FZJA 3GLIA 3PVZA 4QEDA 1J5XA 3E7DA 3UB4A 3TLGA 1HR0B 1ESMA 2DJ5A 5CVVA 1U3VA 4HWSA 4J1TC 4HL6A 3E15A 4XM2A 1JPVA 4Y9SA 3SKXA 1Z4KA 3UCXA 3ZWXA 1TKAA 2ATIA 3HUUA 3VSDA 3FDXA 2E18A 2XADA 3QUCA 4W7IA 5KWSA 1SCAA 3GRAA 1Y1LA 4J0CA 2IV3A 3ADKA 1X74A 1XUOA 4IQFA 4L8FA 3TLAA 4Z54A 3W8DA 5K8LA 1DBQA 1NWCA 1DC7A 5AUNB 1C2YA 5F64A 3AHJA 4XEHA 1TFRA 2GS9A 2XZDA 5DW0A 4E14A 1J20A 2OXFA 5JRDS 3GYGA 4LKOA 4AC9A 3U6KA 4IIDA 3KR1A 1SKQA 4G1UC 4D79A 1PV4A 2VTDA 1FFBA 5HF8A 1IUKA 4Q00A 4CMIA 2PN1A 1MAAA 5JCJA 1Z37A 1R6UA 1KP9A 3K8OE 2B0JA 2C1ZA 3IBGA 5EFOA 3AXTA 3BXGA 3F6YA 2G5TA 2AG1A 3BFVA 3RUAA 4DY4A 4EB6A 3GFRA 4L4ZA 5ESDA 4OHXA 3V8RA 5IH7A 1N92A 2BYTA 1N5LA 3FPEA 2J3HA 1EDEA 4RD4A 3OIYA 1A2KC 1CR0A 3KWLA 5DHSA 3Q8LA 3P0HA 4D44A 2QP4A 1X8JA 4R3NA 3ZCQA 3EXFB 3LUFA 5BQXA 3L46A 1PFUA 2QK4A 3VOBA 1C9MA 5CITA 4UD6A 1RLUA 1ULBA 2AZ4A 3FYCA 1GZ7A 3E84A 1U2EA 3O2JA 4QHSA 1PL6A 5E1MA 3ZZ0A 3LNTA 3QVGA 2IKQA 4RKEA 2YRXA 1G5FA 4AZWA 2ZTMA 2IUUA 2I03A 1PK7A 3OJFA 1X9HA 3WKAA 5AKKA 1RQ2A 3I05A 2ZJ6A 3BMNB 4RVGA 3C6QA 5DYNA 4F38A 5CEEA 4TYMA 2D7DA 1I30A 4HMOA 5EZ5A 3BBPA 2RMKA 1N9GA 1EQAA 2X9QA 4IH1A 1CP3A 3BSWA 4P92A 3HPRA 2N42A 4KG7A 4L73A 3WICA 1NVXQ 3AY3A 1PSDA 4D4LA 1N36B 2QR3A 2RHWA 4IEEA 2IOQA 5TQ2A 1E7SA 2DWCA 1Y6GA 1LSSA 2GPSA 2BN4A 1U0EA 5LP6F 2BONA 1JJAA 3R7SA 1KZGB 4BVBA 1Z5WA 4GUDA 2ZPAA 4M0UA 2E5LB 4KVFA 5HMLA 3ESXA 1Y5RA 2JDIA 4U0JA 2CE2X 3AKCA 3QOWA 2SCUA 5H5JA 2PGDA 2XDWA 2IKSA 3DWFA 4EKNB 2K2QB 1EFVB 3QXCA 1ZH6A 2BGNA 1OU4A 2XUQA 2XNSA 1XZDA 3DBHB 3F49S 4Y6OA 5IYZF 4UE2A 5K0LA 4ZRMA 3A6LA 3WGMA 3IOEA 3ZE6A 4GLOA 1W5EA 1JMYA 1XFAA 3ELUA 4NX2A 1DBRA 2I29A 4ND3A 4RLFA 4ZEMA 3HCCA 1ACLA 2AN9A 3DHWC 3EG9B 3P4YA 2D0PB 5KX5B 2HJHA 5KVCA 1NL3A 2F3UA 2NN3C 4OI2A 4UMFA 2IBSA 5E3IA 4EEKA 3ANXA 3ORFA 2PLRA 3WV5A 1N5IA 1KDPA 2VH5R 2ZKLA 3B3GA 3DOFA 3FUUA 5HKBA 1FNMA 2H1RA 2PY6A 2V7PA 1NQAO 5IXYA 5KNBD 4HRXA 4M1SA 1JSXA 2Z08A 2BP7B 3LPMA 4ETIA 3IKJA 3CH4B 3SVZA 2PGLA 4ONEA 3PC3A 4NMXB 3RDPA 3BSFA 2LXNA 1CY4A 4LC1A 3DTYA 1EIWA 1ESZA 1XRJA 1MB3A 2R6AA 3PEEA 4LJKA 2G83A 4BB9A 2QTVA 5BOVA 3SD7A 4DPKA 5F2NA 2P1DA 1YI0A 2I2CA 3BGDA 3C39A 2CZGA 1YZ3A 3ELBA 3JARB 4L3WA 5FTJA 3WK9A 4XWKA 3MWLA 1Q0RA 4LZJA 4PHFA 4ZQGA 4I3HA 1DKLA 3AUUA 1PWZA 3H2JA 3O93A 2RHJA 4L5JA 2TMYA 3VV3A 1L5GB 1LC3A 4YUYA 2AOTB 3I9NA 4BNJA 3EF0A 3HA5A 5IC6A 3TNDA 3ZWOA 3DKRA 1XTIA 1YVDA 3E35A 3GPBA 3TRFA 4CG3A 5BWOA 3O3CA 2B34A 1JTEA 1T1GA 1U0HC 4I50A 4AUMA 3OE5A 1RCTE 2BF7A 3EF1A 5IJXA 5AW3A 2CLSA 5EE0A 1HOXA 5I7OA 1Z5OA 1SXJB 2Q6LA 3L06A 5CLJA 2GZHA 4NPHA 4WBXC 2COKA 5FFFA 5KVVA 4RHYA 5B7GA 1PL0A 4CLOA 3WFIA 2AWNA 3PLRA 1UXHA 1ZZEA 3C6BA 4JP2A 4KAAA 4K9QA 5DGHA 4W1SA 2N9UA 5IFLA 5JDCC 4QGBA 2R5NA 4LSGA 2YV2A 2Z2JA 3RBZA 3RNLA 1ZC4A 2J9XB 5DNVA 5FTWA 3TLMA 5AOAA 5LYYA 2QG4A 3TLCA 1YFLA 5LN1A 1FYDA 3B3AA 4BEVA 1IQUA 1NUSA 2NT4A 3QXSA 3OKFA 3UCFA 3IPYA 4M1EA 1PK9A 3SIRA 4TQUS 4GYYA 2QEQA 2C31A 1YQGA 3BILA 1W85B 4MR7B 3D3QA 2NVWA 2QWXA 1KI9A 3JWJA 4UEWA 2I2WA 2Z4TA 1Q22A 4L5CA 1FVFA 1NVVQ 1DIAA 3CUWA 1L5NA 5C5IA 5LQCA 3L18A 4FYPA 4IFIA 1ZAKA 4ZN6A 2G0NA 3TQOA 4LY6A 4K9PA 4DCCA 4NK4A 3AB8A 1CQPA 5ALYA 2A35A 4K6KA 1JSCA 4AB1A 3I3SR 3MUNA 3VC1A 1YJQA 2DCMA 2A3NA 3JYLA 5CDUA 1F6DA 2GBLC 5EIXA 4DQKA 2UVPB 1CP2A 1SBZA 2NU8A 4B34A 3JQ6A 4FDUA 4M9CA 5FA5A 3IO3A 5HKKA 4M0EA 4F45A 1VSUA 3FSJX 3TIFA 2WTUA 4MR9B 5DGTA 1MVNA 4R2HA 5LMZA 4KR7A 1JH8A 3H8WA 1ZD9A 3QELB 4OJNA 1PGJA 2VDVE 4OAPA 4OYHA 3E5RA 1IHOA 4L3OA 3F1LA 1OHHD 3I5AA 5FL3A 4N18A 1KZYC 1NAHA 1D2MA 4KNVA 4JIGA 4BWGA 5AI0A 1KJJA 2NYVA 1UK7A 4RY0A 3L4JA 3AZQA 1U3DA 4X0EA 2QN7A 2HLHA 5BT8A 1TIKA 4BTEA 1B1CA 3F98A 1L7NA 1QH8B 2D59A 3HR4A 4FUQA 5ICSA 3BE8A 2XB2A 4A92A 4CIAA 3I6QA 1XKXA 3MLAA 4J43A 3L79A 4CR8A 4ZK6A 3VYWA 5CLIA 5KHLB 2H4YA 3CIOA 4WY5A 1SKMA 2HW8A 3LCUA 4ND7A 2IYPA 5C8XA 4M0FA 4Q15A 4M2LA 4UBJA 3BMCA 3ZCPA 4OQDA 2RBGA 3MINA 4KLRA 3MM4A 2BEJA 1RQRA 3OOSA 2HMWA 4XYEA 1EQ2A 1S2DA 2QJFA 3WYDA 3ZHTA 1SUFA 3EAGA 3ROXA 1M1YB 4CW7A 5KJFA 5TNXA 3KCQA 2GZDA 4TS9A 1BDMA 4FHEA 1GTVA 1FUIA 3W4KA 2YVUA 1XZEA 3N3AC 4PYJA 5LD2B 2XNDA 1V8FA 3T7TA 3IYLW 4EJSC 4LSWA 2WJPA 4EMUA 4JY7A 4U2FA 5FWXB 2XNKA 1C7ZA 2J5QA 3W5IA 5C8YA 3NVAA 2YRFA 4EHHA 1NQWA 3RREA 3T1QA 2P6UA 1T3ZA 1O3YA 3LX8A 4FIDA 4JX8A 1GZDA 1U11A 3BXEA 3WGJA 5DM4A 2P9YA 2V6MA 2IXFA 3IHTA 1W25A 5ESWA 5B7QA 1M0WA 2AX3A 1AXGA 4QA9A 5EKTA 4DCPA 2A33A 3MMSA 5EZYB 1DV2A 3GOQA 4HPJB 2R9VA 3ZDRA 5B6JA 2J6CA 3WRXC 1SIBE 3I37X 3F67A 2BZ0A 1RMQA 4AXBA 3NIFB 2VAWA 1SGWA 2C00A 3BD9A 3WGTA 5K05A 5ALGA 1VRWA 2VDRB 4OPMA 3VZQA 2NMVA 1DC6A 3OQ6A 4G5RA 3T8YA 4E31A 2OFWA 2BPOA 2NXEA 1J97A 2H54A 2B4RO 1GY8A 4FFWA 2BBWA 2LPMA 1V2GA 2Q2NA 4HQFA 3WL5A 4KQFA 5AJVB 3IUJA 2IEAA 2ZJ1A 3QI7A 4TSFA 7ADHA 3GLTA 5A9SA 3W04A 2VCYA 3L0DA 2H1IA 3EGEA 3RC7A 4C29A 1ILEA 2OBYA 4C3UA 1SBYA 2G25A 3JWPA 4OUDA 2DKOA 3IAS6 1R0RE 4KNWA 4QFDA 4WXEA 2PJDA 3ZNPA 4R71A 1DJMA 2OSBA 2H65A 1ZCAA 8ABPA 2M98A 2R1TA 2YH2A 3KKNA 2X0IA 4JCCA 3FMFA 3WGOA 2GVZC 2LV8A 3K70D 4DUZB 2QRMA 2E5FA 3KOXA 1VA4A 3K70C 1IEWA 3DKVA 3QFHA 2Z09A 3VKGA 1S2OA 2P41A 3E05A 3T9EA 3THXB 4BXOB 5G53C 3TI9A 4A16A 5JNWA 4JYMA 4ZMSA 5A4DA 5DEOA 1YB5A 4CUZA 1N2IA 1P8JA 3LP8A 2G06A 4YP6A 1JF8A 3RRYA 5KAMA 4LSZA 4M9RA 4ND2A 4RGBA 3GPCA 2QMHA 3S8EA 1J1UA 2ISSD 4CEIA 4L9AA 1XTSA 3KB8A 4Y67A 5J5VA 1A8UA 1AO3A 1SJ9A 4MITA 4DA8A 2AQKA 3L02A 3PSHA 3V7WA 4KL8S 2GM9A 3HKDB 1U0RA 1UIMA 2EDCA 4CF5A 2X5OA 2HSEA 3U7QA 5CDFE 3KAKA 4WBNA 3CTMA 1BDBA 1GSOA 4DC9A 1P60A 2JIQA 2YTZA 4LGVA 4ND8B 1MAVA 1VSBA 1J0EA 3EVFA 3KFLA 1LK0A 2HNBA 5GGXA 3QG5A 4YDQA 5NLLA 1PVDA 1QHHB 1ZM4A 3H86A 3D6MA 4G67A 2Y1FA 3BIJA 4J2OA 3QP9A 4IXNA 4H1WA 5CFQA 1ECFA 5HE9A 3CX3A 4CTOA 3TQFA 4PW0A 4FEEA 5CDSA 4RQAA 3H9EO 2MYTA 3R7NA 3MTAA 5L3QA 1Y3AA 2OEPA 4G6ZA 2AN4A 2YNMA 4LXGA 4MWOA 2OGWA 1GYQA 4IG4A 3BCSA 2ORYA 2OXTA 2IYNA 2QD4A 5SY6A 1ZBQA 3GEMA 2EL9A 3V1YA 4F6CA 1A2QA 1ICEA 2EFJA 3CRNA 3CO0S 3QE2A 4X8OA 1TD9A 3PWTA 1N6IA 4DUGA 1XEWX 2VTKA 1FLVA 4DG8A 2GO7A 4UPEA 4GVXA 5LA6A 3EF3A 3C3WA 4DA4A 1BWQA 4KAXA 4J0DA 4KDFA 4N9WA 4EARA 4M7PA 1PN3A 3OZEA 3SC3A 4YMSA 2NXCA 2XA2A 3BQNB 1XG5A 3DBLA 3R7AA 3UWMA 4MUHA 4IHKA 3VU1A 5CA1A 3B78A 3FMGA 2AFHA 4RELA 2FOXA 3WBJA 1F2TA 2PS9A 3UKOA 3ABSB 3JPWA 1XCGB 3HDJA 4E2ZA 1HUQA 4ZVNA 3VR5A 4Z99A 3B9BA 2V98A 5EZ6B 4PS0A 2ZBDA 1MDBA 1W5TA 2C8VA 1SUEA 5EIWA 1J99A 3CZQA 3OFKA 4DYDA 3USES 5ARBA 4C6HA 5HK8A 5FOWA 3ACDA 4E22A 3DB1A 3HB7A 5C31A 2RHBA 4MHSA 2GYWA 1XDDA 1KVRA 2BFPA 3IB6A 4NCKA 3ZCRA 4XH9B 2PGNA 4O2AB 5JBQA 3HYLA 2B9VA 2PX4A 1GPUA 1OXSC 3G0CA 5KJ1A 4D1YA 2FKNA 4MZXA 2RONA 4JGGA 4GF5A 4XDHA 2JBAA 1EGQA 4RSMA 1AQYA 1E2FA 3LQYA 2AIRA 3O26A 2IXBA 1YUNA 4C2AA 5JARA 2G17A 4Q0MA 2OPHA 1PRYA 4BFSA 4OQFA 1O54A 3UT6A 2ZBVA 3I5UA 1CS4C 1NI5A 3OPYI 4XJXA 5J58A 3IVGA 2JAWA 4OK6A 3WE7A 4ZT5A 1V5EA 2XNHA 4LYJA 3LA6A 1WETA 4MMZB 4ZVQA 3JQGA 4PGGA 1SG9A 3RUEA 4PLWA 3ITDA 5L51A 3ZIDA 3TD2A 2B6HA 2Q07A 4NH4A 4MJLA 3SWWA 4YV0A 5BMVF 1Y6QA 1MP0A 4ROSA 5KYYA 3RADC 3DAFA 4B3IA 3RS3A 3H1BA 1H8HA 2ZYUX 4PRZA 4IMJB 2IEBA 3LIIA 1FLAA 3V4VB 2JJ1D 5G40A 4M1TA 3M81A 3K1AB 3G6KA 2G7MC 3DZKA 3LRPA 2TMDA 3QUQA 3QPBA 5KTNA 4YHHB 3R0QA 1KFKB 3H0KA 4UXIA 3W8EA 3AETB 3QW2A 3LGSA 2PD3A 3E1SA 2UYQA 4IRMA 3ZDXB 1L4LA 5EAIA 1NQ5A 3K4PA 1DL5A 3LBNA 2Z1NA 4N7MA 4CXMA 1KJYA 4QM6A 1Y48E 3GZNB 3BWCA 4K1XA 2G6TA 3AYZB 4B79A 1YHZA 3RYCB 1L7PA 1PGPA 1YQWA 3IRUA 2OC4A 3HH8A 1ETHA 1HRKA 2XMZA 2F1IA 4ARBA 4BZPA 1J56A 4BZXA 4GKJB 5BN1A 4GLBA 1LQTA 3IAUA 3T7IA 5KNCH 4NYMQ 1P2DA 1II8A 3VU0A 2XHZA 4GPZA 4FOPA 2YHIA 3H4MA 3VPBA 1KQPA 4BB6A 5ALMA 2IVZA 1CQIB 2CLCX 1M10A 2F8LA 2OWDA 4QUDA 1C7IA 3D8RA 5BQOA 1C0KA 4P0PB 4U5QA 2FUKA 1E60A 2I7VA 2G9NA 5JNRA 2QMZA 4H7HA 3KSBC 3JTMA 3ZV4A 5J2UA 1QKKA 1NQVA 1DO2A 2C3MA 2QAJA 3WK4A 2R86A 3JY6A 4H1VA 3TZCA 4EW6A 1IY0A 5EMNA 3BZBA 4Q1FA 1UAYA 1M2OA 1UMKA 2BBOA 4PO3X 3WWYA 3VO1A 4GZLA 1DAEA 3WQQA 3MAAC 4OHVA 3QK7A 3LCCA 3PKJA 3DE4X 5FADA 5K2MA 5K0CA 4Z7NB 5DM1A 5B2ZA 3GLGE 1A98A 2Y68A 3ZI0A 4CKWB 5IZ4A 4X92A 4EYGA 4Q02A 4GECA 4U2KA 1RWNA 4JXKA 1D2HA 4XUCA 4DLLA 5LKRA 3BL8A 2FSUA 1BGVA 4WY8A 1HYQA 2AZTA 4Y2RA 4D9FA 4IDEA 1HEUA 4BAUA 1D1TA 4DWWA 4PNEA 2Q99A 4KZPA 5KUTA 4MKIA 4MV4A 1A9TA 4YJHA 4TVSA 1KFJB 4NXNB 5I7AA 4FBGA 4MUAA 3GR6A 3NHFA 4BN5A 1LJLA 3RIGA 4BNDB 3U5ZB 4I46A 2J45A 4TTJA 4DWOA 4YY3B 3ZS9A 3PA6A 4QKQA 3EZYA 2BFBA 2C8KA 5K03A 1GSIA 4TZ0A 4N0PA 4ZAVA 4AN4A 2W8BB 4QXPA 1Q57A 2X4GA 1FQOA 1SQFA 3ZCUA 1DMSA 3O95A 1DRKA 3S7ZA 4N8EA 1LPBB 3OBIA 1DAIA 2ENWA 4HTFB 1M7GA 1IUOA 1X7ZA 1TK9A 2B8JA 1WCV1 4BVHA 5KSPA 4BP9A 2M6LA 1P29A 1DBWA 3BWEA 4M9XA 3GT0A 3NO4A 4J2HA 1UAGA 4IW3B 4NZOA 5FIUA 5LZ7A 1K27A 5COQA 2LBPA 2X7XA 1KK2A 4HB3A 3I1IA 1AV7A 1I2CA 5JE8A 2ASEA 2N1MA 4MYHA 1UBKS 4UUPA 3ZJYA 3T5AA 2MSKA 3T1OA 3H0EA 5BSRA 1CJTC 4A8JA 5DOZA 4B4DA 4NBUA 2JFPA 3TSYA 3NBZC 5KJ6A 1QYIA 1H0KA 2W5UA 3HACA 4H7DA 4QU0A 2Z1DA 3LQRA 3QBVA 1KMMA 2X4LA 3DVAA 2BM0A 4I6GA 5CLHA 4Z8XA 1GR0A 4ALLA 3EARA 1HE5A 2V1XA 3JX9A 4EGCB 5FOQA 2W48A 3KVNA 5AM3A 1XNJA 1VIVA 2R44A 3G9TA 3ZDFA 5CYPA 4F2PA 1KBOA 2AA3A 4PO8A 2MSWA 2XVZA 2F3QA 4W6ZA 2XYVA 3PRJA 4I9FA 4ND5A 5CK5A 1LK7A 3A2KA 1MQAA 3N0WA 1BW9A 3O1JC 3ES9A 2YZ7A 3DDHA 4L8YA 1Z6GA 4TKUA 5ALEA 3Q5DA 3SEZA 5IHPA 2NZVG 1UZLA 3ZV7A 4J90A 4B3DA 1GG8A 1U3WA 1HA3A 4IIJB 4MEBA 4ALJA 1G5QA 4J0EA 1UZUA 2EGGA 2VNHA 4U63A 2EJUA 1WP4A 3T9DA 3TQSA 1JILA 2QQFA 1GPYA 3G9UA 4GSYA 4R2WA 4WZAE 4FEGA 2CY0A 2RARA 5JD5A 2ZTVA 4ZOLF 4DGSA 4B6RA 2RG7A 1M2VA 3KKMA 3NWEA 1PT8A 2QSZA 5EMLA 5EFZA 1OFUA 2HPVA 5IU6A 4I55F 5AH0A 4COOA 3UEOA 2JGDA 2V58A 1TMGE 2VDMB 3AR5A 4FPXA 3B38A 1P9OA 2H07A 1USUA 4GMDA 4HK4A 3G8DA 1KE1A 2IWRA 4Q3BA 3QX8A 4F4JA 4Z0TA 2VYQA 1T3SA 2YFQA 3QYFA 1YB4A 2GEUA 1EWRA 3EQZA 1CSEE 3EUEA 1Y6ZA 2NU9A 2ZDGA 3IR5A 2ZREA 4XIGS 3TK1A 4R9SA 3UZUA 3I34X 4R2IA 4L4RA 1QFXA 3DEHA 4C0KA 2GEDA 4W5RA 2OB2A 1ZXXA 3CH7A 3RFTA 3TGWA 4P5PA 1W19A 3GT4A 3MFQA 3ZJ5A 3A3NA 1XIVA 3T0GA 2I33A 3TL6A 4UTPA 1W36C 2IVFA 1NPYA 3L40A 4Q9DA 2XMPA 1UJ6A 4XWOA 1S2GA 2C8LA 1YDHA 3DNFA 2GPYA 3GEGA 1FTWA 2KYRA 1V9CA 1C1XA 4UHKA 3ZD7A 4MRAA 4EH1A 5H7XA 1W2HA 1VKRA 4IV0A 4RA6B 3EISA 1RW4A 4C03A 4DEYA 2LE0A 4TMVA 2B1GA 5T4HA 2EEZA 4OIMA 2ZUTA 3WGNA 4EVSA 4UZEA 1O94A 2ZB7A 3HZOA 3HXKA 4I1UA 2VYND 2LCIA 4L51A 4G0NA 2GBCA 3G9XA 4RFSA 3IE0A 2XSZA 5DP2A 4K0KB 3O8OA 3AEKA 2X9VA 1OFUX 2R8BA 1RE1A 1T5LA 4G0MA 4Q16A 4JI4B 5G3ZA 5FO1A 1G0OA 2PUVA 3QA3E 3M33A 1VPTA 4TUYB 1FTQA 1W5FA 3P9ZA 1CUCA 2RSLA 4FQ8A 4MW4A 5E1OA 1EDDA 4BTLA 4C2BA 1YH3A 3F7NA 3OD5A 1L4NA 1E1CB 4C5BA 4UUBA 3VDXA 1U3FA 2FP4B 2YCLA 3HXQA 3ELYA 5C1IA 5L3VA 2YOGA 3WIEA 4XDGA 3MILA 3OP1A 4CLXA 1GLGA 3WHIA 5E38A 4HDSB 3TTWA 3I4LA 3WLOA 2BT4A 2R8PA 1ZI8A 2IZ0A 2BF4A 3EOBI 2CV0A 5GONA 2AWOA 1G3UA 1GQ2A 5HMMA 1OAOA 2PX3A 6ADHA 2I1WA 3LL7A 1W35A 2DSTA 1NASA 1Y34E 1I2DA 3MIIA 5IEBA 2AD5A 4L0QA 2AC4A 2WHRA 3TUIC 1GPMA 5I9IA 4KV7A 4AZVA 5AVZA 1CUAA 3IV6A 4Y6GB 1JEAA 1ATIA 2AG5A 1SKUA 2PZMA 4QUGA 1NLZA 2G9RA 3AWDA 4R8KA 4CQMB 1VG9B 4KMMA 4I81A 1EXDA 1K7FB 4HAVA 1VSVA 3AJEA 2JLZA 1G55A 2BCJQ 3LD9A 3D2BA 2VHZA 1M6VA 1UQTA 5A3JA 1G8PA 1ZA1A 1NW4A 3AUXA 1GT6A 3EEFA 3IA2A 4MVJP 4ES6A 3M3HA 5PNTA 5FH9A 3N53A 5KMGB 3FRHA 5TPWA 3VR6A 2R6ZA 3OUZA 3UWPA 2NVOA 3FVWA 3PA8A 3KM0A 1JYEA 4G24A 4WQMA 3GVIA 5HDBB 1SMKA 4B6SA 4FHFA 3S5UA 1ECJA 4MWEA 1PJQA 1AVTA 2BFFA 2XCOA 5AK5A 4HP8A 3ZWBA 2G5CA 1TEHA 4EPXA 1VPEA 2XGGA 5AM1A 1ZNZA 3FVRA 5ARDA 4JCOA 5KWVA 2UZ1B 2ZGVA 3ANMA 1JEOA 3F1KA 3ETLA 1IPFA 3KZNA 2HPZA 3T3EA 1C0EA 4TYYA 1NNSA 4JDUA 4OX9B 4BNYA 4WCFC 3GK3A 1INLA 3CCBA 2BUAA 1U9CA 3TMAA 1QFMA 5I4BA 1KP2A 2CNDA 5CXUA 4WZBA 3TIXB 1IBKB 4O4LB 2R1ZA 1XK7A 3W9SA 2BR3A 1NP3A 2PLFA 1XMIA 3CWZA 3DLAA 1X1EA 1JRLA 2NACA 1JN0A 4KX3A 4OFWA 5CEFA 1SOWA 4KWEA 2EWMA 2JZNA 3OMWA 3OECA 4X8MA 4LMAA 4E21A 4LECA 3KTDA 3PEFA 2IS6A 3CA8A 3KZOA 4G5QA 3OAAA 1MIOB 1KFEB 4J7UA 4JLKA 4XSVA 4CL3A 4DR4B 3FYUB 2W37A 3ZEAA 3P52A 2UYCA 2HJ9A 1DWUA 4V1CI 1NI4A 2OVFA 1PKXA 1UINA 3TR0A 1RRCA 2NZJA 1B2LA 2RHOA 3BL5A 3K0FA 1NW3A 2FPGA 4ZT7A 2WM8A 5EQJB 1N25A 1V11A 1ZSVA 1AGXA 4MQEB 3HGQA 3OQHA 4WTOA 4AF7A 2BEWA 2I7DA 3PS9A 2W42A 1Q77A 3WLEA 1M72A 4J2TA 1MJNA 1R6DA 2DR3A 4PR0A 5DV9A 2P6RA 4MS1B 4UUQA 7MDHA 2G1PA 1O9GA 4ZP1A 2I80A 3D7NA 4J7AA 2DP4E 3FCXA 1E79A 5AO9A 5K09A 2GEBA 5LQMA 4D4KA 3ZLTA 2GERA 2C61A 3F3SA 1T9BA 1U02A 4BZZA 3DUFB 3I6MA 1OH8A 3RVQA 1ZHOA 1I7QB 3CPJB 2I1LA 4H27A 4TS4A 4RZIA 5KI6A 4M9QA 4A8HA 1YRYE 3WLKX 1TO2E 1NUTA 1FFHA 2I9PA 4YT5A 1AJEA 3MTDA 1PEDA 1VL8A 1YQUA 3BGSA 3TXXA 4EVQA 4NYJR 1RWMA 3T94A 1HO3A 2VZ9A 4XVUA 1EVLA 1JQAA 3CX4A 4CIBA 4YUXA 4QBKA 1R9JA 2JI4A 2JARA 4HNTA 2ZR8A 1GZ6A 4PSVA 4LF6B 1BXGB 2FPPB 4EVRA 1K7CA 4MWTA 4WZ6A 4GMXA 4PHGA 2W6IA 3AYXB 5E7JA 1JDNA 1WU7A 1T4DA 2OXRA 3AUYA 2GN4A 3NRCA 4IHJF 1EAYA 4HGNA 4KQGA 4IICA 5C80A 2H4JA 1ODJA 4E51A 4W1RA 5B4TA 2EJCA 4GXTA 1B2RA 3HS3A 4Q9AA 4CI9A 3TDMA 1OWMA 2EFEB 4MQLA 2MCFA 3I5XA 3BXOA 1DAKA 1N2CA 2C4TA 2TECE 3NXKA 4TMYA 3ZWQA 1N75A 1BS9A 4U9HS 3ZE7A 4FJ2A 3Q8MA 1MVLA 4DSUA 2X8JA 4NCIA 1CFZA 1QJCA 4II7A 1W59A 4YAWA 3K1TA 5AKJA 3SQNA 3DV0A 3L8FA 1WCIA 3DXYA 4CLDA 2QYSA 4KGZA 4MUKA 1P5ZB 3EJ6A 3WYFA 2HMAA 1ZDMA 3JU3A 1CEXA 4WACA 1RLIA 2AJCA 3LWBA 3R0IA 4URZR 3RM3A 3WK5A 4E09A 2FWNA 3DBOB 4N65A 3S0JA 4I1VA 5I8WA 4ZO7A 1S6YA 3CX6A 2A0YA 2PT5A 3GB9A 4M98A 4OP3A 4ZKEA 2FEMA 3SZUA 1FU8A 4ZWNA 2Q5FA 5KC9A 1E2EA 5C1PA 2HQBA 3OWXA 3P26A 1BZYA 2C9CA 1TEVA 4LVUA 3FCYA 4PO9A 4RD2A 3SDBA 3HCFA 3T1YB 2EGHA 2F3RA 4YLEA 3WISA 5ES3A 2XEXA 5JMTA 4RTPA 1ZIPA 2IE0A 3X1DA 3BH6A 2YS7A 2Z95A 2O50A 1DOAA 2NUPA 3N8KA 4P81A 4ZQFA 3TR5A 1USKA 2XMQA 3U80A 3EGDB 1KI7A 1O6CA 2DH5A 1RQ7A 2AN5A 2DJIA 3TZQA 2F48A 1R6XA 4XGNA 4XX0A 1FDOA 4LJ8A 4MGIR 3GGGA 3BMOA 3MJTA 4FXOA 1WE2A 4EK9A 2WMDA 4REQA 3ZDBA 1UXOA 2ZIAA 1E9VA 2F2TA 2AVDA 1U7PA 3HMQA 3G0IA 3MTIA 3NH9A 4UM5A 5LBTA 3T35A 3DGEC 1UJ4A 5M2QA 1NVKA 3TFOA 3GCWA 3K2IA 4UHJA 3RI3A 5CD1A 2VCEA 4WUTA 2XCUA 3ZE0B 2D5BA 4GZ5A 1ZUNB 1Z2DA 2RHTA 1QAQA 2WHPA 4XARA 4YGYA 4KPYA 3M0EA 1V9LA 1ZIDA 2YNMC 3K9GA 4EABA 2EF1A 1TT7A 4LI3X 4RA9B 3PUZA 3HP7A 5MGBA 4KXFB 2EXXA 2P4QA 5LQAA 2HY7A 2OUKA 3R9WA 4XWYA 3LCVB 1PUIA 2P2NA 1X9IA 2HA0A 2IU4A 5CD9A 4R69A 2V6IA 5IABA 5IJ0A 5AI9A 5IAAA 3N0TA 4M60A 4MWSA 4O4IF 1EEXB 1Z0JA 2H1HA 2P9ZA 2PAAA 1XP8A 2Y67A 4Q7MB 1A9XA 1U9JA 2PRKA 3VZCA 5EIOA 1AO0A 3PC4A 2VZEA 4YACA 1YHYA 2HZ7A 3E3AA 5I7SA 4QQKA 4QXAA 2DBRA 4CTNA 2CNOA 2XT6A 2Z8ZA 2IOYA 5ALTA 1SWWA 3UMJA 1CUJA 1T9AA 4I8DA 5AXCA 4BEBA 2IGTA 2J4FA 5T7BA 2ZWOA 2XXAB 2ODNA 5C18A 1FTGA 2I0FA 4C7VA 2HYDA 3WNQA 1KO1A 5IT9A 3RVRA 1C1DB 2DY1A 3S40A 3FUCA 2C7RA 3B12A 2HRRA 4FHDA 2QTTA 4MV0A 2CVOA 1ZK4A 2HGZA 2OKGA 3AM5A 3KZVA 2GUWA 2WG2A 1KJIA 2DE0X 2PMCA 3KOWA 4DIUA 5JMWA 1G6Q1 2O2ZA 3ABIA 3RW9A 2PUCA 3DM9B 5LMNB 3SEFA 1LVHA 3Q7QA 3A4NA 3DHVA 5K6RA 3S81A 1VFPA 3IBYA 4DR5B 3WK6A 4ZAFA 4CF3A 3SFTA 1JAXA 4TSFD 5AP9A 1LWNA 3OD1A 3ORSA 4XUEA 3R5KA 3LDFA 4EX6A 1IE3A 1WBBA 2FG5A 4HVLA 1SUSA 4Z4CA 3CGGA 4FE4A 2DFLA 4PZYA 2AMVA 3ESYA 3KU4A 5TARA 4EPWA 1LPSA 1WVGA 5A1TA 3RUPA 3D3JA 1TM5E 1DB3A 3G2QA 2X0FA 4RL6A 1M83A 1NQXA 5E3JA 3V4PB 3VPAA 3WMEA 2O8NA 4IDCA 4PGHA 4DSNA 1WHTB 4JI5B 1R5NA 4RIIA 5L95A 3C5EA 3DZFA 1HOTA 1M7BA 5J5CA 1OR8A 2DHDA 2ZG6A 2P40A 2J0SA 2EJTA 3GDFA 3T5DA 4C2TA 1VCOA 4KSCA 5JFGA 4GOLD 3E61A 3H2HA 4C6RA 1MC1A 1WXDA 1WUJS 2ZYGA 4MWZA 4PX5A 3DO8A 1GNLA 1K5DA 5F9FA 2OZPA 4PYRA 4BECA 4KYTA 2VT7A 3E0QA 3UJCA 1I1NA 1DV1A 1M76A 2A14A 4G5XA 3HN6A 4GMHA 1TYEB 4L6AA 4HYTA 4OJYA 3UFXB 2HBQA 5P8WA 4Z4HA 4OLAA 3D54D 2Z9BA 1Y5NA 1K9SA 2I71A 2JVJA 3DV2A 4YMIA 3GEHA 2J5BA 2Z9DA 4TL6A 2NP7A 1JIQA 1I6WA 1PW7A 1QIFA 1OIXA 4MVJM 3G82C 3GUYA 2HL6A 1PLKA 3R4CA 2H11A 1JHUA 1RE0A 4FFVA 3AUSA 4RKQA 3KJIA 3DVRX 1JA1A 4LF9B 1OWOA 2ZT7A 5GIPE 4P58A 2CMDA 3UOAB 4CF6A 1VLMA 3ACCA 4LHEA 1BKDR 2O2SA 3O2NA 4KLNA 4KE7A 5ELXA 2JFHA 3IEPA 4OOFA 2QI9C 4MWDA 4W7HA 3KXLA 3IAM1 2VXBA 4JI0B 1N0VC 2FG6C 3ML1A 4MULA 4ZEVA 3EXEB 3F5MA 2NZUG 1O97D 3VBEA 1XK6A 1PFKA 1L1FA 3LZCA 1GEGA 1J2JA 4QTZA 1JDBC 1N5MA 2VL7A 3EGVA 1G38A 3H8VA 4WDRA 2GAAA 1RRVA 2REBA 5AKYA 1T6NA 3MT8A 3UXHA 3FBGA 3KJGA 2Q4EA 3MT0A 2GT1A 3RC3A 2F1JA 2ZKIA 2OVBA 3PQ2A 5F35A 4I4TB 2B21A 1DEAA 5D5QA 1HMPA 4I8IA 4KRFA 5CNJA 2H5LA 1P2UA 2WD9A 1OYVA 4DM7A 4DUPA 5KOHB 2FQYA 1MGPA 4Q9NA 1SCUA 3TCKA 1ZVJA 1ZONA 3D7RA 4RE5A 3U48A 2OOSA 2PKQP 3N58A 4QWMA 1U8XX 1X1BA 4DMFA 3NB0A 1TUBB 1OHHA 1IU9A 4Q3AA 2CDNA 5H1YA 1G6HA 5JT1A 1GU0A 3IIEA 4ZGGA 3AJDA 4FXPA 5HK9A 4V0KA 2CJPA 3WIUA 4S1VA 1M34A 4B9EA 4HVCA 3RCBA 1TRHA 2Y4OA 1ZOOA 3GD5A 4HQ0A 3VO9A 3GZJA 3E0XA 4I3FA 4A91A 2JHCA 3CZPA 5I9NA 1GNQA 3IUBA 1PYDA 3TZBA 5GWXA 1JZTA 1ZMBA 4D9JA 3VPGA 3KKOA 3PHIA 3HXPA 3ONVA 3RJZA 4Q4JA 5C7YA 2RD2A 2CFRA 2WJ4A 4HWGA 4LZLA 4C4PA 3KXPA 4DBVO 3NJ8A 4JT2A 3T38A 1FDUA 5EP1A 2GKGA 1WY7A 5HE8A 2HK7A 1HX7A 3AVXA 1AF7A 1XCBA 5EWLA 4L0CA 1DNPA 4XLTA 3UPTA 1TXGA 1H2YA 4QOIA 2XJ4A 5JY6A 1YRLA 2XCLA 2D06A 4MYCA 1O6FA 4A2WA 4E5MA 4JLNA 4CG0A 3W6ZA 1TZKA 1N6PA 1S8NA 3HB4X 3CS3A 1LVUA 5EE5B 3GO4A 4PZDA 3AKEA 1T5HX 2QRHA 2NG1A 4YQFA 4OKNA 3SQLA 1OIVA 3ORH