3DULA

Crystal structure analysis of the o-methyltransferase from bacillus cereus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
201
Chain Sequence
TWTAVDQYVSDVLIPKDSTLEEVLQVNAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAYFEWALKLSRPGTVIIGDNVVRIRRFYELIAAEPRVSATALQTVGSKGYDGFIMAVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O-methyltransferase, putative
publication title Structural and functional insights into O-methyltransferase from Bacillus cereus
pubmed doi rcsb
source organism Bacillus cereus
total genus 66
structure length 201
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dulA00
3REOA 3CVOA 5FULA 3LCUA 3R6TA 5CCBA 5E8RA 2G1PA 3BWMA 3GRVA 3P2KA 3A7DA 2VDVE 2ONYA 2B2CA 2YQZA 1X1AA 5E1OA 3UJBA 1FBNA 5CVJA 1VIDA 4AZSA 1QAMA 3AJDA 2G70A 3I58A 3SXJA 4HC4A 2ORED 3TLJA 3PFGA 3EVBA 5E1MA 2OPBA 5CVEA 3VYWA 2PGXA 5EEHA 5GOZA 1P1BA 2YR0A 4P7KA 1KHHA 2VDUE 4Z2YA 4EVIA 2I6GA 5LQAA 3UWPA 4XUEA 1P1CA 2EJTA 2H11A 3S68A 2AOUB 5GP1A 1JTEA 1DUSA 3Q87B 5LQJA 1D2GA 2IDJA 1NT2A 4LG1A 4RSRA 2V7EA 3P2EA 5K0EA 4MQ4A 4ER7A 5JR3A 3LDFA 3QOWA 2E5WA 3ER9A 3LX6A 2PX2A 3DTNA 3M6WA 1MHTA 3M4XA 5FUBA 3WSTA 4YMGA 4ER5A 2B3TA 3HP7A 1EG2A 1IY9A 3C6MA 3HA5A 5ICCA 3TKYA 5DM0A 2FRXA 3PX3A 5LSAA 3DUWA 1SUIA 3D2LA 7MHTA 4E2WA 1MJFA 1JSXA 2XYQA 4H0NA 1QYRA 3UJ9A 5ICEA 2NP6A 3SSNA 2YUIA 2P41A 5E1DA 1ZGAA 2B25A 3DXZA 2ZZNA 5K0LA 5GIOE 1D2HA 2PLWA 3NDJA 4P7GA 2PX4A 4KIFA 5BW4A 4F86A 3SSOA 4PYNA 3EVGA 1RI3A 2UZ4A 5IKMA 1ZKDA 2P7IA 3NVMB 2AOXA 3GCZA 3IEIA 5K0GA 3FYDA 1L3BA 4KDRA 4PINA 3BGVA 3P8ZA 4AZTA 4C4AA 3G2QA 3KR2A 3G2MA 2OO3A 5DTMA 5IH3A 5CCXA 1G55A 3G8AA 3R3HA 4OBWA 3KQMA 5FADA 1O9HA 4P7JA 3I64A 3DP7A 3MB5A 4M7RA 3V97A 1NW5A 2P3OA 4PYJA 2O07A 1VL5A 1G8AA 1VBFA 3NJRA 2PSSA 1RI5A 4QPPA 4PNEA 2PV0A 5EKXA 4YV2A 4GC9A 2AN5A 3PB3A 2Y1XA 4PGGA 2I9KA 2V74B 2DULA 3MTEA 3GU3A 3NMUF 4O29A 2PY6A 4FGZA 2P3LA 1YZ3A 2ZBRA 3CBGA 3HVIA 4EQZA 3Q7EA 3BT7A 3KQPA 3JWHA 3QOXA 2NXCA 1JG4A 1RJEA 4DM3A 1WZNA 3FTEA 2OY0A 3P9KA 3R0QA 2ZLBA 3BGDA 2PXAA 3EVDA 1DCTA 3B3JA 1AQJA 3G89A 2PWPA 1WS6A 4XUCA 5FHQA 2GB4A 4M36A 4IV0A 3UJCA 1JQ3A 5DM1A 3T7SA 2ZWVA 2QRVA 2JHCA 3HCEA 4YV0A 1UWVA 5HFJA 1R18A 3BWCA 4U7PB 1TW2A 2VZ9A 4PONA 3VSEA 5K0FA 4QDKA 3AWIA 3C3PA 3C3YA 2NP7A 4E2XA 3RW9A 1SG9A 4E30A 3FUWA 4PCAA 3UZUA 3G5TA 4QQKA 5EGSA 5EMJA 3DMGA 1PRYA 5F2KA 3LKZA 2K4MA 5K0JA 3UBTA 3G2PA 4AUKA 4RTNA 1Q0TA 2XYRA 2FCAA 4RVDA 2PKWA 5B1SA 2ZBQA 2AN3A 5EPEA 5D1HA 4BLVA 2AVNA 2AOVA 2R6ZA 3LDUA 3BZBA 4K6MA 4OQDA 4ER0A 1D2CA 2UYHA 4RVHA 2Z6AA 3O31A 3U81A 2IBSA 3HCBA 3KPWA 3HCAA 4M37A 4RYLA 5DLYA 8MHTA 4FSXA 3UA3A 2VP3A 2FK8A 4CWAA 5FHRA 3KQYA 5EEGA 3GRYA 2ZZKA 4YMHA 4KDCA 4YUWA 2HMYB 1JSZA 2GAFA 2ZZMA 3DXYA 4FP9A 4UOEA 1R74A 2AOTB 1JQDA 4GC5A 3KPYA 5F2NA 3MQ2A 1H1DA 4AZWA 1NW7A 2AVDA 4KIGA 5M5BA 3M6UA 1JG2A 4AX8A 4OA5A 4RTPA 2PX5A 1VPTA 3NW9A 3OCJA 3OU7A 4WXHA 5ICGA 4RVGA 1NV8A 3EMDA 5BW5A 2OZVA 1G6Q1 3C0KA 1KP9A 3OFKA 3KPUA 5KQRA 10MHA 1P39A 5T6BA 4X63A 5HIIA 3HNRA 1Q0SA 4POOA 3HVKA 5HIJA 1KPGA 1VP9A 1KYWA 3HEMA 3VC2A 3M70A 1JQEA 3PS9A 5GIPE 2O0LA 2B78A 2WK1A 1P91A 1YFLA 1NBIA 5DTRA 5HOQA 1WY7A 3HCFA 2IH2A 4RV9A 5EQJB 3KR1A 5FCDA 5K0CA 4GOMD 3UFBA 3OZSA 1G60A 3CC8A 3QV2A 3I5UA 1ZG3A 1UFKA 5EZQA 3HA7A 2AZTA 2PBFA 3DLCA 3P2IA 5K0NA 2HTEA 3FRIA 3FZGA 5FA5A 4X41A 3CGGA 3G2OA 3PVCA 3HCCA 3KQVA 4WVLA 3KHKA 4RTJA 4Y30A 4OX9Y 2XYVA 3K0BA 3SSMA 5LQCA 3G7UA 3ER8A 2ZBPA 3KQWA 5FQOA 3ANXA 3NVKI 2FHPA 5CM2Z 5BXYA 2B9EA 2ONZA 5DX8A 1SKMA 1YB2A 3LBFA 2OXTA 4RTQA 3MCTA 2PXXA 5GM2A 2G8NA 3G88A 5T67A 2AOWA 2PVCA 3GXOA 4R8RA 2IH4A 5EMMA 2AR0A 4CKEA 1IXKA 2CWWA 2O06A 3ELWA 3B89A 3GRUA 5E9WA 2GLUA 5ICFA 5EC8A 4QTUB 1BKYA 1O54A 1XDZA 3GNLA 4YUXA 2G72A 5HZMA 1XJ5A 4CKBA 3E05A 3GWZA 1VP3A 2Q41A 2VS1A 2IDKA 2ZIEA 4P58A 2EJUA 3UJ8A 3V8VA 4BLWA 1YUBA 3ORHA 4X60A 4RTKA 5MHTA 5D1NA 5E2AA 4M38A 5K0BA 3MCZA 1N2XA 5DM4A 5DSTA 3FPGA 1F3LA 5CUQA 3A4TA 3OPNA 5EMKA 2Z6UA 2ERCA 2YXLA 4IV8A 2AN4A 4R05A 1RI1A 4C05A 2BR5A 3VC1A 4AZVA 3SM3A 3O4FA 3EVEA 3TR6A 3P9IA 2NXNA 4LECA 3THSA 4HRAA 4DF3A 3FPFA 3FUVA 1M6EX 1ORIA 5HIKA 3KPJA 2I62A 3X0DA 4Y2HA 1QAOA 4NECA 4YUZA 4HGZA 3GGDA 4R6XA 3LL7A 2P40A 1PJZA 2VDWA 3NWBA 3OU2A 4BLUA 1BHJA 3OE5A 5CVUA 4HG2A 5JUWA 3PLAE 1X1BA 5CVVA 3P9CA 4QDJA 4X1OA 5FWAA 4RTMA 3DULA 1ZQ9A 5E9QA 4DZRA 2UYOA 4BY9E 4KW7A 5G02A 1G8SA 3HTXA 2QYOA 5HIMA 4V0RA 5EZSA 4DCMA 1UIRA 1AV6A 3MGGA 3R24A 4GF5A 4EMSA 1XDUA 4RTSA 4ATNA 1NW8A 2YX1A 1I1NA 2QRVB 3C6KA 1I4WA 4PGHA 1RJGA 4E33A 5KYGA 2C7QA 2XBMA 2BZGA 1KXZA 5DX0A 2IBTA 4PYQA 3TRKA 3FUXA 3P71T 4A6EA 1NE2A 2GA9A 2IIPA 2XVMA 3H2BA 5DT2A 4C08A 3ELUA 3BXOA 3LBYA 5DTQA 4DCGA 5BP7A 5T64A 1N7IA 3PT9A 1WXWA 2H00A 5FA8A 4CKCA 5C9ZA 5LQUA 2C7RA 3L8DA 4E31A 2NXEA 2EFJA 1BOOA 2G71A 3LGAA 3BKXA 3GRRA 4IWNA 2CKDA 3ID6C 2JH9A 3TFWA 3KQOA 4QTTB 5E1BA 5EHIA 3SMQA 5DRTA 4RTOA 1EQAA 3FPJA 2AS0A 3AXSA 3CCFA 4LWOA 3UJDA 4ER6A 3EGVA 5EKUA 5KQSA 1JG1A 1RI2A 2OKCA 3FPEA 4G56A 2LD4A 4RX1A 2OYRA 3F4KA 1R6AA 2C7PA 1R8YA 2WA2A 5FQNA 3UJ6A 2HV9A 1QANA 4QQNA 1QZZA 1ZGJA 2YTZA 3E8SA 3GDHA 1AF7A 3EVCA 3HVHA 3K6RA 3ME5A 1DL5A 3EVAA 1VE3A 2CL5A 3FTDA 4FT2A 3T0IA 4DMGA 1QAQA 3I53A 4PIMA 3DMFA 3TQSA 2YXDA 2HWKA 4CXMA 2HR1A 1KR5A 2JHPA 1I9GA 4CTKA 4FS8A 5EG5A 4MTLA 3IYLW 1G38A 2JG3A 3IHTA 1IM8A 2PT6A 3GIWA 3OE4A 4RTLA 4QPNA 1YF3A 3B5IA 2WA1A 2A14A 2KW5A 4EK9A 5KVAA 5H02A 1R00A 1VQ1A 3P9NA 3UJAA 3EPPA 4L7VA 1RI4A 4C03A 4E32A 4YV1A 4F84A 3TM4A 4HTFA 3CJRA 3DMHA 1TPYA 1XTPA 2GPYA 3A26A 3B7PA 3MAGA 4R6WA 2QM3A 3A25A 3T7RA 2QE6A 5K03A 3JWJA 4IKPA 5DPMA 1NBHA 1L3CA 5DX1A 4GEKA 4B17A 2P35A 1INLA 1TW3A 4JXJA 5P8WA 4C06A 5LQKA 4E70A 2ZULA 1KYZA 1SQGA 2JH8A 3HVJA 2EX4A 5U4XA 1L1EA 4HSGA 5E9JA 2BM8A 2Z6QA 1EAMA 1XDSA 3LCCA 4FR0A 5DRYA 3OZTA 4MHTA 1SQFA 3FUUA 2IH5A 2PXCA 5LQNA 4MWZA 4GOND 3LECA 2OB1A 3LHDA 3BWYA 3LCVB 4PYKA 1HMYA 5K05A 4C07A 1WG8A 3DH0A 3TM5A 2AOUA 4GBED 1HNNA 3OFJA 4YUYA 4FT4A 4V0QA 3EGIA 5GINE 9MHTA 2HNKA 5CVDA 3TKAA 2ESRA 3EEOA 5LQRA 3EMBA 3GO4A 3O7WA 1SVUA 2YXEA 4ER3A 2BR3A 5FTWA 1R8XA 3NTVA 1KPHA 3LDGA 4PYLA 2IP2A 2OBFA 2PJDA 2FPOA 4KVZA 2IFTA 1OR8A 1B42A 3KQSA 1F38A 3EVZA 4DQ0A 3BGIA 4BP1A 1EJ6A 5K8VA 1NKVA 3FUTA 4C04A 1JTFA 4PWYA 1XXLA 1RJFA 1KIAA 3M6XA 1M0EA 2H1RA 3AY0A 3JWGA 4PYMA 4P7FA 4RVFA 1O9GA 4RWZA 2O05A 2BR4A 3T7TA 3MTIA 5LR6A 1FJXA 2ZCJA 1JG3A 3CJTA 3IV6A 1SUSA 5E8JA 4CTJA 3UJ7A 3BUSA 1AQIA 2ADMA 2JHAA 3LSTA 1XCJA 3EGEA 3A27A 1FPQA 2ZTHA 5EOVA 3KQTA 3ELDA 4DA4A 3FRHA 3NDIA 3GRZA 5ERGB 3KU1A 3LKDA 4EKGA 5FWDA 1YFJA 3OZRA 2Y1WA 3MHTA 3LPMA 2P8JA 3FTCA 1U2ZA 2I7CA 4XCXA 1RJDA 1Z3CA 2OB2A 1EIZA 2NNWB 3B3GA 3TMAA 2ZVJA 2PWYA 3SGLA 4E2ZA 4PYOA 2DPMA 4PYIA 1NV9A 2N47A 5E2BA 2GS9A 3KR0A 4QVGA 3E23A 1FP2A 2R3SA 2ZSUA 3PFHA 4OBXA 3SVZA 4GOOD 3SX0A 1X1CA 3G8BA 4OA8A 2UYCA 1XVAA 4R8SA 3P97A 4E2YA 4PCLA 1M6YA 1L9KA 1ORHA 1T43A 3KPVA 4F85A 1Y8CA 1V39A 1L3IA 2ZW9A 2ZWAA 3DOUA 3I9FA 4U7TB 3PTAA 4GQBA 5CIYA 2JJQA 1BC5A 5EMLA 1JR4A 4QVKA 1KPIA 2ZIGA 3HCDA 3KKZA 3NWEA 4KWCA 3BWBA 5C0OE 5KS2A 5F2OA 4FZVA 4HH4A 5GM1A 2PT9A 3ELYA 2UYQA 3DXXA 5EIFA 5C1IA 2NXJA 4KRGA 3A7EA 3M6VA 3FPHA 3FYCA 2XVAA 4HGYA 3SR4A 3CJQA 5DWQA 3EEYA 3BKWA 5EHGA 1EJ0A 1XCLA 3B3FA 3JWIA 2C7OA 3MERA 1FP1D 5GWXA 5DM2A 5EIWA 1X1DA 5K01A 2EG5A 5DXAA 5CD1A 3ERCA 1X19A 3PX2A 3HA3A 2BH2A 4YUVA 4A6DA 4ZTBA 3E7PA 5DSXA 1NW3A 1ZHFA 3KR9A 3HM2A 2ZFUA 4MIKA 4RTRA 3THRA 3M33A 3DR5A 2FK7A 3GJYA 5HILA 3RIEA 3TPZA 2IPXA 4ISCA 1WXXA 2IGTA 2CMGA 3AXTA 4PIPA 5DXJA 4GOLD 4EKIA 3KQQA 2PX8A 1NW6A 2GH1A 2P1DA 2BM9A 4OQEA 3DLIA 2YVLA 2CMHA 2ZIFA 4BP3A 1VLMA 3G5LA 5HEKA 5K09A 2O57A 2QY6A 2FYTA 4GUAA 3FTFA 2AOTA 4X61A 2NYUA 3OU6A 4HTFB 1YZHA 3RODA 1N7JA 4XUDA 4LWPA 3TOSA 3CKKA 2P7HA 4FSDA 3R9XB 3EVFA 2F8LA 4DKJA 2P3QA 5EVJA 3UA4A
chains in the Genus database with same CATH superfamily
4GOXA 1IG0A 1RAHA 2D1TA 3RBZA 1RQLA 4CUZA 3H2HA 3I2YX 8OHMA 4U7GA 3L93A 3WMXA 5CCBA 3IIMA 1L1QA 4BKMA 4KO1S 2QN6A 4PSKA 3TTSA 3ENNA 4B0PA 1Y42X 2OYSA 3DE5X 3FGNA 4EFKA 3K16A 4L27A 5E1OA 2YIVX 3WFIA 1VIDA 2NO7A 1SXJA 1JMYA 3O0DA 2OBMA 4RF5A 1TYEB 3S29A 1X7XB 4TV8A 2NTYC 2BFNA 2H92A 3E7WA 3EVBA 3OTHA 4AXBA 2OCPA 1Y1TA 2WJ6A 4KWEA 2PGXA 2WNIA 1BXRB 1K75A 1WIWA 1ZWKA 3KYBA 3A2KA 3TG8A 5G4KA 5LP6F 4DSUA 1II9A 3AFNA 3KDSE 1ZGGA 4WL0A 3W7AA 1U3TA 1YZNA 2C8VA 5CFZA 4DUYB 2EJTA 1WBDA 4CV0A 2AOUB 2SNIE 1DOZA 4YAIA 3R5JA 4PZCA 3UYLA 2GBLA 2DU8A 1LFAA 1H22A 3KUUA 1C8VB 1F0KA 1IZZA 1T4CB 1IXSB 2AZ4A 1WOMA 4JUAA 1QF6A 1TM2A 4YRIA 4JR0A 5CFQA 3ISVA 1KXJA 3FTNA 3RU7A 5K4HA 3PHCA 3CFYA 5TEWA 1DRJA 3EULA 3L1IA 3PUVA 3NV7A 1SOAA 1IY9A 2AG0A 2E6UX 4WN9A 4CI0B 2PKEA 3UK2A 4DNQA 2HMSA 3GN1A 4V39A 3RFCA 3ORQA 4RK6A 2H2DA 3GNQA 3WYEA 5IJWA 1UMDA 2PL9A 4OK6A 2J3HA 3TOXA 5KTOA 1XCBA 3RK4A 1HI9A 4YRQA 3KVOA 4CIVA 1OOEA 2H2GA 1JDNA 4YRPA 4W7HA 1K3UB 3ELBA 2JFQA 1PGJA 2G5PA 2JAWA 2OBXA 3IIEA 1PR6A 2V5UA 4MYUA 4FFOA 4IRUB 4HH0A 5F4ZA 4W6QA 1Z6QA 3PL5A 2P7IA 3JD4A 1AKWA 1LDBA 4LJSA 1MDBA 3EGOA 4RY9A 4Y98A 1PR4A 1A8QA 5BPHA 2YJ5A 4AZTA 1F0PA 2ZYVX 5F77A 2H7XA 1G55A 2DTDA 2VUTA 4PHTA 5K2OA 3KIPA 1O97D 3BQNB 2X1MA 2W5UA 1O58A 1G8AA 1RI5A 1TRHA 5I7OA 1LQ2A 1MH9A 2HUPA 1RM0A 3BL5A 4GC9A 1TT5B 2Y27A 1JT2A 4QSMA 2YMMA 1D2AA 1LBQA 1U5AA 1R27A 2GM9A 3C6BA 4V2UA 3NMUF 3PUHA 1YZ3A 1C1YA 2B1JA 1B1CA 1SUAA 1SCIA 2ZYSA 4YPFA 3LC0A 4GU5A 3WB1A 2IYYA 3W2HA 4MVJA 3T99A 3EVDA 4RPGA 1MP0A 1WS6A 5C5IA 3G3EA 4DMLA 2GT1A 3UHOA 4PC3A 4BO6A 1CUAA 1LUAA 2ZB4A 3Q3JB 3P9XA 5B1YA 5ADHA 1J1UA 3GUHA 4RJ2A 1JG6A 4YPVA 2QLMA 4YAOA 4EECA 4BV2A 4PLYA 2E49A 4OJYA 5DTIA 1ZOPA 3KHTA 4JENA 5L4LA 1PS0A 3VGPA 1R3UA 3LO5A 1JA1A 1UIMA 2GZSA 4ZC8A 4HWGA 1E2FA 4UASA 1PRYA 1RAIA 2C7BA 4G1MB 5COBA 3WRXC 2FF5A 1PNOA 3IIIA 2NTVA 4I5GA 3LZCA 3VR4H 1LC3A 2BCGY 2Q5HA 1T36B 2ENWA 1YUMA 5AXDA 3HRHA 4LOIA 2H1OA 3AESA 1HO3A 1Y6JA 4BTVA 4BLVA 3DFMA 1UP4A 3HN2A 4HPXB 4Q01A 4ER0A 1VLVA 4FE3A 7GPBA 4CNBA 2QPOA 2AJBA 4KSBA 4B74A 4URFA 3FM9A 4F3KA 5KKCA 1JH9A 8MHTA 4D96A 3UA3A 4X1KB 1GQQA 5HCUA 4UEOA 3DF9A 5EP4A 2FUNB 1U99A 4R1MA 3KP1A 2HMYB 2PD6A 4Z2AA 3AR8A 1CR4A 2ORVA 5HJ5A 4PQFA 1ODCA 3OECA 2PKCA 2JRCA 1CULC 3MN1A 3NDRA 3QPAA 4N8DA 5AJZA 3W5DA 1VPTA 3R7BA 2BMWA 1WWKA 3A37A 5IDWA 3V8RA 1D9XA 1SC3A 2P9YA 3N6VA 1E6MA 3LU1A 3NYQA 1RKQA 2PHZA 3AJAA 3H9BA 4RVGA 3TK1A 1RRFA 5L95A 1W88A 3JYNA 3QMPA 1QIGA 1QFMA 1U0EA 3B52X 3HGQA 1JEEA 2PMDA 3C70A 1UANA 4TSFD 3SJ7A 3FYTA 3T1TA 1K06A 4WQMA 4U3JB 2WK1A 3HK2A 4DWWA 1ZL2A 5IHPA 2CLOB 5DM70 1EFAA 1K9VF 5KNBH 3I5AA 1Q74A 1TEVA 3OM8A 3OT5A 4LDAA 4UFOA 3FX2A 4RKFA 4XB1A 4C78A 5AW6A 4QUKA 3UT5B 2R1TA 1EX6A 1FDSA 2C1ZA 1CR0A 2Z9CA 3MK31 3OUTA 3PXCX 4R1NA 1BS1A 4DV6B 1T0HB 1EINA 3TRFA 4C2BA 1Q7GA 5BRAA 2IXBA 1S1MA 5E6UB 3T5DA 1TIPA 3VHXB 3QVTA 2HN9A 4L5AA 1USWA 4LMRA 1WKCA 2AC4A 4MQFA 4Y30A 4A1OA 1HNZB 4OBBA 4FILA 2W6QA 3H2YA 3KQWA 4OTZA 2NNLD 4MINA 1V8OA 1WPQA 2PWBA 4TV9F 1GNSA 3VR6H 2CZCA 5BXYA 3K1YA 1HM5A 4H08A 5JS8A 3OMWA 5KNLA 1QYCA 3V1UA 4X65B 4XWTA 2HUNA 5FTKA 4X6YA 4MVWA 3VDNB 1J6UA 5JCZA 4K9QA 4LOHA 5ALSA 2O2JA 2R97A 3HHPA 1CDEA 5CFMA 1NBAA 3IDSA 3W5UA 1RPZA 1H2YA 1QP8A 2ZSKA 3IBGA 3PA8A 4CKEB 5DTJA 4X64B 4KUEA 4NOKA 4BOYA 1V2GA 3H6HA 3A58B 5I01A 3KT6A 1NHWA 3PSHA 4PWZA 1T8WA 2OHVA 4QDXA 1FU4A 5SZHB 4GICA 4YMWA 4ZHQA 3AEQB 3LF1A 1DRKA 3PZBA 3OCVA 3L43A 4Q03A 1ZA1A 1WP9A 4UZSA 1TDJA 4X60A 5J47A 4I3FA 3GLIB 4ZC1A 1W87A 4Q16A 1AS2A 2VHJA 2W2TA 4F6RA 1T9GS 2QK4A 3EY9A 2Q4TA 3H5WA 2QX6A 2YXLA 5B3JA 2GLTA 3CNNA 1MAHA 1K7YA 3ZWYA 3EVEA 6CHYA 2H1FA 5G1PA 5A5VA 4CBVA 2Q99A 4J75A 4F46A 2DFTA 2VDPB 1Z35A 1KFEB 4GYKA 3M4JA 2G17A 4GYYA 1BRMA 4LY0A 1X1RA 3IQHX 4P3YA 2XVZA 1NI3A 3FOBA 3KUKA 4D0NA 4LHZA 4JIMA 4HGZA 1GZVA 3D6TB 3O8OA 4WK2B 3IEKA 2ODWA 5BO5A 1YIOA 1J5PA 1PJCA 3BRCA 2XDWA 3AIIA 1P1KA 4YJ3B 2BC9A 3P9CA 4KXXA 2VPYA 1O1YA 1PNVA 3IQEA 1SU8A 4P84A 1DBPA 3LHSA 2HAEA 5FWAA 4JSTA 3S2IA 4B8ZA 2ZR7A 5BXQC 4R5MA 5E9QA 4XLTA 4ZI7A 4YRNA 2YICA 4J3FA 2QN8A 2JGNA 2LV8A 1YL5A 4MVYA 1RXIA 4P36A 3U7RA 1GVHA 2R6HA 1G3IA 4MGYR 4EG0A 4Z3KA 1CX9B 3T7JA 5LZ7A 1I4WA 3FVTA 4M1TA 4BO2A 1XZLA 3ANYB 3GH1A 5AKZA 4A6EA 1I5RA 4NBRA 4C08A 2JI6A 4Q4AB 5LYYA 4DABA 3HDTA 3NIDB 4KTTE 1AS0A 5DK4A 3DMDA 4JX8A 3V33A 3WSWA 4RMJA 1KSFX 3HXMA 2XX3A 3OICA 5C9ZA 4KR6A 3SWWA 4D3DA 3WAGA 1OAOC 2W0SA 5CDFE 3CRMA 4QXQA 3TFWA 3WLFA 4ERXA 4ZZ0A 2XD4A 3BDIA 1GPKA 3GAAA 1YS6A 1E7MA 5F51A 1YZTA 3MW8A 4RD1A 4ER6A 3SQXA 5CHYA 2C5AA 5KX5F 3HKEA 2WG0A 3OD1A 1VE1A 3OHPA 5FWXA 4CT5A 3P26A 5K3BA 3T1OA 4NX2A 4H17A 2GJ9A 4D9FA 5BR4A 4NZNA 3URMA 4FT2A 5AMXA 3KAKA 4JLSA 2MINB 3WBKA 3OPYB 4LQCA 1EX9A 1YAHA 3B70A 1YGPA 3VNAA 5BNZA 3VOTA 5BNWA 3JD0A 1GG5A 1MNQA 1HA3A 2YBDA 3KTAB 3LZDA 4K9OA 4X95A 5K7SA 5JO0A 4CXMA 5KNDH 3HZZA 3KEMA 4CTKA 3P0JA 2BFBB 4MHSA 4RBNA 5K6RA 2C2OA 2AG1A 1IM8A 4XTCS 1M7HA 2CEKA 5BV8A 1AO0A 2EZ8A 3B5IA 2EBFX 1T5IA 2PH1A 2NIPA 2FMTA 4DYHA 3TQOA 2VTBB 4MYHA 3GJSA 1Q3TA 4IIDA 2GMWA 2YWXA 1Q1NA 4JU8A 3KZNA 2VQ3A 4XYEA 2Y0PA 4IJVA 3MAGA 1G17A 5AKIA 2DWUA 4MRNA 1AS3A 1T4DA 1MLDA 1E92A 2A8YA 5G53C 4CQMB 4DDVA 2GJAA 4B17A 1DCMA 3P9SA 1TW3A 3Q5DA 1KJWA 4P81A 4PSDA 3ZXXA 1RYNA 5LU8A 2I7TA 3D8RA 4MUJA 3QW2A 2XDQB 1R9GA 2IYZA 1MUUA 4WDRA 2PXCA 4MWZA 5JJBA 3ZWMA 2RBEA 4J43A 4K2AA 4BB5A 5FNVA 1SVLA 3LCVB 3C8ZA 3R9WA 4KQCA 4JMLA 2HPHA 4FYXA 5FOQA 3SYMA 1SBYA 4K28A 4C0WA 1QH1B 3N6XA 4HMQA 2V0GA 2W2MA 1PX0A 1R6DA 1CLEA 2Z5VA 5IAJA 1C9JA 1EWTA 1S5PA 2H8KA 5L3QB 5IKXA 3GDOA 221PA 5L4NA 2QRQA 4MJ7A 3JASA 4F93B 1VM6A 1QHIA 1R2QA 2PYZA 4EHAA 4Z1OA 2FJUA 4FYWA 4M7PA 1I30A 1K27A 3NHKA 4JUCA 5LA6F 1MW9X 5A02A 1XYYA 4QUHA 1OZ0A 1LKZA 5FFFA 5BN5B 5C3UA 2VEOA 1IK4A 1L0BA 5DXFA 3AR4A 5FAKA 4TLBA 3R74A 1SBCA 6ABPA 3KEOA 4FYKA 4KGZA 1QHGA 1C0LA 5THKA 2WTUA 3R0ZA 5KJEA 4CL8A 3QG1A 4LBYA 2VRCD 1U6JA 4AKEA 2BONA 1U4NA 1XMIA 2HU5A 1JG3A 2JCBA 3H2JA 4QFDA 1NTRA 2Q1UA 4YRKA 4OUKX 4EO4A 3FFAA 1U7UA 4EJSB 1W4BA 1WP4A 3EZGA 3LSTA 1N34B 3KJIA 2FSVC 1P9WA 3JD1A 3P0FA 3SEAA 3ICPA 4ZO8A 1QO0A 3CX3A 1TK2A 2WQZA 3FRHA 3G0BA 3PI7A 5BUZA 2QVXX 2O1WA 1NPDA 1GPUA 2JCYA 3K8QA 4FZJA 3X3HA 1YONA 2IXAA 4EB8A 4IX9A 4NKRA 3EBLA 2MT9A 1FXSA 2OB2A 2HA3A 3T0FA 3QBTA 1GNPA 3BTSA 5IH7A 1WZEA 4FYYA 2PUEA 3AY7A 1XCMA 1O2DA 1LC0A 1Q6YA 2JGKA 5F7JA 5J4VA 1VXRA 1AGYA 4CLRA 3GLVA 3GCWA 4KLZA 3PFHA 4HLNA 4PC7A 3N0XA 5DASA 5HKAA 1OH5A 1X1CA 1WUJS 1X7HA 1TTHA 2WHXA 5KOIA 1KRXA 1O95D 3JQCA 2H31A 3OJOA 2IYLD 4BQFA 4CDNA 5A4DA 2V7PA 1JTVA 1WDKA 5FBQB 1ZSVA 3ICEA 3QEMB 1M2NA 4WNAA 4Z4QA 2RHDA 3C3BA 5EMLA 1B16A 3CWQA 3G7NA 3H18A 2RDMA 2BEJA 4KWTA 3UNXA 4S05A 2R1UA 2EW1A 3BWBA 4LGMA 3AR5A 3CKMA 3E3NA 4RW0A 1GRRA 4X8OA 5ALGA 4YS6A 3G85A 5EL0A 2ODTX 1MGOA 1K5GA 4DA0A 1UC5B 2PQ6A 4RPKA 4UOZA 4F7WA 3FF1A 2B98A 1K0UA 4K6HA 4A0RA 1K0FA 3TJMA 4HGYA 2CDCA 2K7ZA 3B3FA 3SZRA 2DUJA 2HCJB 2VZEA 1FCJA 1VBNA 3L82B 5COAA 5HM8A 3GLIA 4Y6RA 4G5OA 3MT7A 1KSJA 3DOHA 4RSGA 1Z4PX 3W5BA 1NZJA 5FRDA 1QR2A 3KKOA 3BMQA 4E0BA 3ZVNA 3THRA 3M33A 3UATA 2B7LA 4D3SA 5CDYA 2R47A 4HGOA 4ISCA 1YVEI 4JBYA 4UJ3A 1XP8A 1LZKA 2E7ZA 4V0NA 4KO4S 2IYAA 2WOOA 4BJHB 3W1WA 1TVKA 2GILA 1EGMB 1NW6A 3L5OA 2KS6A 3ZGZA 4ZVTA 2VT3A 1RLMA 1FTSA 2BGLA 2XMRA 3A1WA 3SFVA 3OQIA 5IZ4A 3VA7A 1KEEA 4OU4A 4QOEA 2AI2A 4KR2A 2HJ9A 4F71A 2QE7A 2OYCA 3L8HA 1J5XA 1MIOB 1PFQA 3EF1A 4EP1A 2NYUA 4WZZA 3FTFA 1AJEA 1O57A 4J4HA 3ZJYA 1QGDA 1T4BA 1G5HA 3CZ9A 4UPVA 2D54A 3UA4A 4KG7A 4OGWA 3WHKA 3A70A 3CVOA 4XX0B 2QTLA 4W8GA 2PLNA 1PSWA 1V9SA 4L8YA 1FRFS 3HNOA 5E8RA 3TGPA 3Q4GA 1ML4A 2BEVB 2FZCA 3NEAA 3RC9A 3DQPA 4GFDA 2WP0A 4MP3A 5IJXA 5LFAA 2YL2A 3MTAA 5L6MB 1H0HA 3BWDD 4UMFA 2OBBA 1UZAA 2IV2X 1Z37A 1A2KC 1SKYE 4KYIB 2VN8A 1U9ZA 2NSDA 3K2EA 3KFXA 1Q5PA 4L85A 4DC1A 2PR2A 2VF2A 4P7KA 1ZIOA 1XCOA 3KJNA 5AK5A 4GGPA 1XT6A 1RWNA 5COQA 3W6UA 1PWHA 1QH9A 2OXFA 4C3ZA 4CI9A 5BWOA 2ZRQA 3UWPA 4WBNF 3PFIA 2OP0A 4M86A 4YAFA 1CHNA 5H81A 1MMFB 1YB7A 3R44A 2X7JA 4I14A 3SLKA 3OQBA 5DISB 4GO1A 5FOWA 5I3CA 4KODA 1EE9A 1WCIB 2D7CA 3BYZA 2AF3C 3OOYA 2QXUA 3RVQA 3TIGA 1Z3IX 3CT4A 4II2A 3AKYA 5ANRB 2Y1EA 1THZA 4X71A 1G8MA 4F4DA 4MULA 3D6HA 1E64A 2BCJQ 1RABA 2FOXA 2B5OA 4D4HA 1R6VA 1XOIA 3T3MB 1OMOA 3FW1A 5IKOA 3PQ3A 3HMQA 3BK7A 3WIEA 2W90A 3RCBA 2GYUA 2VI5A 4BMSA 1ZGAA 2ECKA 3FRJA 3JZMA 3D6UA 1PBNA 3VR4D 1GPMA 2HJGA 2O2GA 2OUKA 3L9WA 4NONA 3SHOA 2Y2UA 4OI1A 4F86A 4TXLA 1KGSA 2DPGA 2IHYA 1GPJA 2MHCA 4LDQA 4W9MC 3F67A 2UZ4A 1YCFA 1KOGA 4U0KA 2PSHA 1XRRA 1X86B 5L51A 4R2IA 2ZBVA 4E15A 1M76A 1MO2A 2WHYA 2X2PA 3GYGA 4ROTA 3B12A 1PJQA 1ZK2A 3EPRA 3K9LA 4X9XA 5ALEA 4WLVA 4C01A 4Z53A 3A9TA 5ENVA 3ZUGA 4JLJA 3QFFA 1PZEA 4TUYF 5ADUS 2NMVA 1KWKA 3U7QA 3RYHA 4LN1A 5DBHX 1D2EA 3OHSX 2C92A 4UQPA 1S6YA 1SXGA 3JZDA 5A3SA 1DAPA 2PV0A 3WLMA 3UPUA 5AI5A 2WABA 4EYKA 3LDAA 3VR5H 4GMKA 4BVEA 3A32A 3GHYA 3NPAA 3GFRA 3DAOA 3QXXA 4MUFA 1QU2A 1Y8RA 3DJYA 1QGZA 3O38A 2D74A 4PRYA 4RH3A 3G23A 3VHRA 1NBME 4YR9A 2YRWA 2V7QD 3D59A 1ECJA 3OF5A 2C3MA 2BFOA 4CM3A 4F5WA 5K4GA 3G2HA 4O4HF 3G89A 3TAXA 3MVEA 1CZKA 2MCFA 1CP3A 1KZ7B 1YQTA 4G97A 2WTNA 2BV3A 3EX7C 2BGTA 2ONKA 5KYXA 2PO7A 5C32A 5KNBD 4ZOBA 4JBGA 4XB6B 3AB7A 2H4XA 5G2OA 3IKVA 2A4MA 5KMGA 3V3TA 3E0XA 4XJSA 4KQ9A 3JQRA 1L8QA 3B60A 1DJOA 4PONA 4JODA 1JQKA 2V6IA 4DIBA 2PNFA 3LLUA 1OASA 4IQ0A 2V0CA 2WAOA 2W2LA 5CB6A 4E30A 1N78A 4IZOA 3DPUA 2DY0A 3VR6D 1C4XA 1TZCA 4KSYA 3GV0A 3SU8A 3U4DA 5F1PA 1VYHA 4GR5A 4YT5A 1BXGB 1PSZA 2HREA 1M8FA 1OT3A 2P4QA 2XI4A 2ZI5A 3SHFA 3U49A 4DSZA 3QKWA 2HLPA 5JSKA 2Q29A 1GYQA 3AVOA 4TTQA 4H3HB 2BWJA 1H4QA 2OTCA 4CMIA 4P82A 1HQKA 2KB0A 1JAHA 1M1YB 3RRYA 3BFKA 4LX8A 1TVCA 3EG9A 6ADHA 2O2HA 2V8BA 2LDBA 1P1JA 1Y4ZA 3UH1A 1CF9A 3WHIA 3HCBA 4JBNA 1W0CA 4P80A 4YP7A 1RPNA 1V37A 2FJPA 4YP6A 2EQ5A 4BMPB 4F97A 2ZZMA 3RARA 2FRVA 1XJ0A 1I8TA 1M34A 3A3KA 3DXYA 4M1KA 3ESCA 3HB9A 1RRCA 1PP4A 3KPYA 4H77A 3TFOA 4IR7A 4BLPA 5EERA 4LJLA 2IITA 1Z36A 4S1PA 5JDCC 1MBZA 2TMYA 2IC5A 1QZUA 3MTJA 3EMDA 1KS2A 3DZBA 3QFRA 2CFTA 3DUFB 5AJXA 1D4OA 2C0CA 5AI6A 3CUWA 4HLQB 2ZAYA 1Q0SA 3GLGE 1P44A 3L5KA 3V48A 2GM5A 2RGWA 1YVDA 1NNI1 2QB5A 1QBGA 4JZYA 1U0HC 4QFMA 4OMUA 2C1XA 1ORVA 3WLAA 4WZAE 4F2HA 2G28A 3KR1A 4KAJA 5FCDA 2OM6A 1CNMA 2XYPA 1Z6TA 2HGZA 3ND5A 3QA3E 4G9BA 4R2LA 1GU0A 1FUIA 4UHBA 2JAPA 3ABQB 3E4CA 1WXEA 4TMYA 5KI6A 1SK8A 1EUDA 3VDMA 3TE6A 1NQAO 4Z9FA 4NCXA 2JCSA 1G2IA 2XHEA 4NU0A 1HT2E 4DL9A 4IOKA 4ZVUA 2ZBPA 3PNBA 4EG8A 4Y1EA 1JKFA 2E6KA 2VRNA 1T9ZA 1SKMA 4QODA 1E6LA 4M1EA 1J2EA 4JVSB 4LPSA 2GTIA 5JDIC 2IHNA 1XZCA 1MO5A 2QZ4A 2JC3A 3QK7A 2FGJA 5ED4A 2I6UA 1ZUNA 4YMVA 5G3ZA 3GVHA 1K3FA 3RUDA 3KQLA 3GMSA 1W7AA 4UEKA 4G1UC 4QTUB 1M2FA 3DS8A 1ECCA 4P83A 3UV6A 2IP4A 3E05A 3GWZA 4F9GA 3H5RA 5EKTA 4ZJPA 3RYFB 3CRRA 1HL7A 3L49A 4KLNA 4QYXA 3OX1A 1C4KA 4DV7B 2Y93A 4N3CA 2OE2A 4JUBA 1WMDA 1NJ5A 3TB6A 4CFYA 3UXEA 3KJQA 5EWMA 2B21A 2RHTA 4CEHA 2IEIA 2ID8A 1XEWY 4Q4JB 1TQ2A 2WW8A 3NIFB 3OSZA 2AXNA 1Y5MA 5I7SA 4H0FA 1VLZA 1LVUA 3AUJB 3QUCA 5AW5A 1RWQA 2V98A 3TL2A 5B2EA 4IX1A 4JL5A 3THSA 5KAMA 3TIVA 1LTKA 3CR7A 3D4PA 4JB0A 3R3ZA 2NPFA 4D57A 3FFBA 4AS2A 1M6EX 1GPNA 1RJ9A 3CUYA 1CZHA 1DV2A 3U09A 1O95C 1UBHS 4FFPA 3VZQA 3VKHA 1OT5A 2YJ4A 5EQFA 2YZ2A 4BECA 3KALA 3HZHA 4XR9A 3VBEA 1VPEA 1CYEA 1RM5A 3EE6A 2YRXA 3IXMA 3OJCA 3NNNA 5GMOA 4EW2A 2QYSA 3C5EA 4LY3A 4ZQCB 4ZU6X 1YR1A 1TM3E 3JARB 4HFNA 4WNCA 2B30A 3D6FA 5FPHA 3UHJA 4BZXA 2FWIA 2VPTA 1K9SA 5LNK6 3H2KA 4KW7A 4RF4A 4TPKA 3GGGA 4DCMA 5CFRA 3RSQA 3TI9A 2CD7A 1L7QA 5K3DA 2NZWA 2NO5A 3E5NA 2HEIA 3DBOB 1KEZA 4W63A 1NU8A 5DX0A 1YK0A 1EXNA 5DNVA 5JAPA 2IIPA 1Z0UA 2XW6A 2Y0DA 1TF5A 4Z9BA 1SXJE 4ZVLA 2P5TB 2UZAA 1BCRA 4ZVKA 1N7IA 2K5UA 4EUEA 4HNTA 2QAIA 3G9QA 4D0LB 4EUFA 1PLJA 3GUUA 3UTCA 1T8PA 2WD7A 2X42A 1UM9A 4YNBA 2EJCA 2JH9A 1CRZA 2BDTA 4YWHA 4C3OB 1EQAA 2ZB2A 3IT0A 3A6LA 4FI3C 3IMCA 3JQPA 2ZCUA 1RC0A 1EU1A 2AS0A 2BFEA 1V8FA 1XVIA 1YCGA 1J56A 2DYKA 2XQIA 2VUUA 3OJWA 4FDTA 4Q18A 3NC4A 2DPHA 2Q0XA 2WZCA 2OKCA 2RI0A 4PCUA 3SN6A 2W6OA 1M33A 1BFKA 1U63A 3DP9A 2B2NA 4UD2A 1X74A 1MA3A 1SHLA 3L7DA 4UHKA 4Z86A 3N7UA 1MB0A 4JROA 1KK2A 4XR4A 3S1AB 3SAJA 3EVCA 1AN9A 1TTQB 5DV9A 2QTVB 3IHWA 4OHCA 3RTEA 3QU7A 2IF0A 1QAQA 5JU6A 1YS4A 3DMFA 2W7TA 2G5CA 4Q7LA 5G0UA 4U2EA 3W2GA 2FFQA 3OTGA 2WD9A 3MRTA 4JU9A 4ICIA 2FSUA 4OB7A 1QQAA 3AETA 4FLMA 1YMQA 3RVKA 4B8WA 3F47A 2W58A 5F23A 1GFWA 1USGA 4LZZA 4YIHA 4S2EA 5DLDA 3LRPA 5H02A 4L7VA 1QNLA 4G86A 3KKLA 1DQSA 1GAJA 3L6OO 4XWWA 3UMMA 1FTGA 2C5SA 2VUIB 4JBWA 2I0FA 4J16A 4MGEA 4CNQA 4L5BA 4FFVA 4KE6A 4C4OA 2XUQA 3QENA 4LCJA 4AROA 4C0AC 5JAMA 1FSGA 1M2OB 3ICCA 3OX2A 1PZXA 5DX1A 1IQRA 1XBTA 2YNMA 1ZCJA 3I4LA 3DQZA 5E7IA 4Z1MA 4ZOLF 4C06A 4I50F 1NN1A 4P4NA 5LBIA 2EYQA 2QUJA 4MVJG 4WA7A 3KOMA 1B2LA 1ZIPA 3C4VA 1BXKA 3EA4A 5AM0A 1GTL1 3DM5A 3PUKA 1EDZA 5DP2A 3VUEA 5JNLA 3QYFA 2QAGA 5E9JA 3FMVA 3MJCA 3OZTA 2H08A 3A11A 2X14A 3AEZA 5KAPA 2HBYA 3VV3A 4IXNA 3BD8A 2AFRA 1ZINA 2GRUA 1Q20A 1DARA 1AUOA 1BCSA 1LX6A 1PFVA 2JGLA 2NT4A 4MVJE 4R2HA 3S3TA 1G5RA 3ZEAA 2CYCA 4L02A 2ZYUX 3ESQA 5ALQA 5JPDA 4KFSA 4FT4A 4X7PA 4C2TA 3B6ZA 1NI4A 5BWCA 4KREA 3IPXA 2DERA 2XCQA 5EMNA 4Q19A 4KQ6A 3IURA 4D8XA 5FL7A 4PN7A 1W25A 2IP1A 2FPOA 4H3VA 1OIXA 2CVPA 2IYWA 2IYSA 4L08A 5C18A 2FUG1 1LZLA 3LSYA 1IE3A 4I4TB 4W5QA 2C9CA 1NKVA 2JJ1A 1UFVA 2X8JB 4PWYA 1ZM4A 4HDAA 4QGFA 4MWDA 3OKCA 1P77A 1BFDA 2H1RA 4TRNA 2F2TA 3CN7A 5JLAA 4D79A 4JQCA 1YSCA 2HWWA 3H9JA 3ZBTA 3AFIA 4BFSA 1Z29A 1KU6A 1UBTS 4M9ZA 4OLFA 2AA3A 3UT6A 1P8JA 1KYIA 5KYWA 2ZCJA 3E22A 3RYIA 1WUYA 2AMLA 4UM8B 2D0PB 4O0MA 5AJVB 1DXYA 3FY4A 4NNJA 5EMHA 4ZWNA 2JAOA 3B1VA 4CGZA 3EIFA 4LZPA 4IUBS 1IEXA 3ESRA 2BDUA 4DLYA 5EOVA 1P4SA 3BHIA 2INGX 4JT9A 4OHPA 1DRUA 2I55A 1ISSA 3AZPA 5HKOA 4LZNA 4J4TA 4HRYA 3CRZA 4G1CA 4AIIA 1C1DB 1OU0A 5JZSA 3RT9A 2C99A 2GI4A 5ECYA 4GPD1 4D02A 1HEIA 3F90A 5AJUA 3B3GA 5AVKA 2YJ6A 4YQFA 3L4KA 1ZXBA 4KFUA 2L19A 4XVHA 4LKRA 5FUQA 4PYIA 2A5GA 4C87A 3CVYA 2SICE 3CH5A 1OE0A 1P74A 1YJQA 2ZYIA 5ALTA 3IESA 1JYFA 3I37X 3TQRA 3GRFA 4HXGA 1FP2A 5HZKA 5I7FA 4ZZ2A 1DQZA 1G19A 4FMCB 3RVSA 4QBTA 1DEAA 1E2GA 2WMNB 3TBKA 1SIUA 2XKBA 2CBZA 1EUCA 1G5PA 1M6YA 3NS7A 4PCLA 3HWX1 3LC2O 3ITNA 1FJ2A 2JFGA 4WKNA 3OT1B 3R0XA 3GLUA 5LKRA 3C7DB 3EYWA 3SIXA 3BJEA 5KSYA 2C5BA 2HCRA 3RABA 3GA0A 3HKBA 1NQ5A 1PZGA 1R4NA 1RR6A 4MUGA 4E46A 4C22A 4CDGA 3O82A 1SQ0A 1ZYUA 2ZT7A 5F2OA 4I1OA 5ECWA 1W47A 3V6MA 3CRQA 4OXQA 4YC7A 5F7ZA 1QVVA 2VYVA 2RJOA 1XRNA 3CW9A 4PLFA 5HFAA 3ENQA 3MCAA 3O93A 5A3VA 2ES4A 5AVVA 5TQVA 5DBFA 1GZSA 1E4OA 2J7PA 5GGYA 5K99A 3PE4A 4XWOA 1DOAA 3ZCRA 5DU2A 2PKXA 4TMZA 4Z7OB 1X7ZA 5K0CA 1AGRA 2NZJA 3HDYA 1C9MA 2ZRFA 3R5KA 5JS1A 2NUTB 4Z6KA 3EZXA 5AH0A 4DMCA 4PGFA 2VATA 4UTXA 4RVOA 2W6JA 1L5LA 3F3YA 3NRCA 4YI3A 1TA0A 1JEYA 4PZDA 5JD4A 3TPZA 2D6FA 2AFHA 2ZJ8A 2BGKA 1JALA 2BHLA 2HPVA 1UMBB 1A9XB 2D7JA 1V35A 1QRAA 3P32A 3SQLA 3D3WB 4A0HA 3T38A 2PKQO 3CVWA 2QAJA 4MX8A 3CBQA 2VJKA 2YVLA 5DGIA 1NZFA 2WJIA 1D1SA 5AR1A 3DM9B 2FWJA 4KR3A 2P6PA 1NFFA 1IEVA 4OQ4A 2PGLA 1QQBA 3BD7A 4ESVA 2F8LA 5DBOA 1OX5A 3S0JA 1SZCA 3D3JA 5FULA 2PZEA 2CJFA 2P4UA 4XCVA 3CZ4A 1SU4A 3BWMA 3DNFA 4FOOA 4NEHB 2YVAA 4IHJF 2R00C 2DH6A 2VA8A 4Q3AA 3RK1A 2PBLA 3M81A 3UJBA 4F3NA 2E4AA 5C35A 2RHJA 2QP9X 3I0ZA 4JR1A 4AZSA 5C37A 4FM9A 3KLOA 5CH3A 3VR5D 4QUIA 2UVDA 3AEUB 4IXWA 1HK7A 5B30A 2Q9CA 2VF8A 4MVXA 4GDFA 4OMDA 3UG6A 3DO5A 1H2ZA 2WWYA 4IMRA 3ABIA 1M6VA 1AQUA 4RZHA 4Y9RA 5IVIA 1N9GB 4EJSC 5BV1A 4I4IA 1C3OA 3AF0A 2Y4NA 5FOSA 3LVFO 1W34A 3U3DA 5DWDA 1W0JA 2XTNA 3C3JA 4DR6B 4UDXX 2AD1A 4F4JA 1DC8A 2DQSA 4RSRA 2O2CA 3P2EA 4JN6B 1ZPDA 4GX2A 3EFOA 5DMHA 4C0JA 1D0IA 1ODIA 3PG5A 3W3AH 3STUA 1E4EA 4E5SA 4N3GA 4MVJI 2NACA 2P6OA 5FUBA 3SQMA 1W76A 4YJHA 4BWVA 4AN0A 2O8VA 3B6KA 4KV7A 4B44A 1ZVQA 3L02A 3U9LA 4H6WA 4BMXA 3GUZA 4N6GA 3DFZA 3COPA 3PX3A 3V80A 1XQ6A 4B81A 1CS4C 3W5AA 2IX3A 2Z6VA 4R81A 3VYVA 3ZHXA 5IF9A 3O3OB 4I55B 4L3WA 3QH4A 1O6FA 4IEIA 3V9PA 1RZRD 2P2SA 4NJMA 4FZ5A 4Q3DA 4TKZA 4R7GA 3WYDA 5E1DA 1MF7A 3WNQA 1CPYA 1WY5A 4GD3Q 5DDIP 4HNQA 1XP5A 5JMTA 5GIOE 5GJBA 3O4RA 4JI2B 1W5TA 2GCIA 2QJOA 4UREA 4A2WA 4D82A 4PZYA 4YCLA 1LPNA 4PSCA 1BYUA 1RI3A 1GG8A 5KWVA 5JY1A 1E79A 4CVNA 2OFWA 1MO6A 1TUBB 3D0QA 1S2LA 4CMKA 3TZQA 3GCZA 2NU7B 3BGVA 3P8ZA 2QT1A 3ON5A 3QFTA 4YJGB 5HQTA 1KE2A 3GA5A 3ZHUA 1XEXA 5FADA 3I64A 1UAAA 3IO3A 3H16A 2WJAA 2SCUB 1IHXA 3QVLA 4P54A 1N3LA 4YX9A 5J2TB 3I23A 3UK7A 2GN4A 1BDIA 1P0PA 3ZKWB 3IEVA 3TXYA 1SD5A 1TLLA 2BP7A 3BFXA 3IBCA 3NB0A 3T3HA 2JAXA 1ZHHA 4RMHA 4CPDA 2DR3A 1QIIA 2A9QA 2I2FA 2XUJA 1W29A 3G0GA 4QU9A 2QIPA 3ZG6A 3Q7EA 2DECA 3JWHA 2X6RA 1Y7HA 1EYZA 1YXMA 4BNMA 4C2UA 3K1ZA 4MYSA 5J23A 1IBMB 4XPIA 3TD2A 5LOVF 4AY5A 4F3TA 3OZVA 1Y9AA 4NZZA 1E1KA 2FPLA 2IZ0A 1SOUA 3I8XA 4JB8A 4MI1A 3UXHA 1F2TB 1POWA 1M1NA 4ZD6A 2K7FA 5LN1A 1DAFA 1U28C 5AM1A 4NE9A 3W9BA 4DLVA 4X7BA 3JD3A 1UQRA 3RIMA 1P62B 4LHSA 2JCGA 3F7NA 5AVSA 4UAUA 1W5AA 1KS9A 2NVBA 3RBXA 4YO7A 1GEEA 1G3MA 1H8HD 4IO0A 4ZEWA 1OTHA 3U0BA 2O14A 2X41A 3I6YA 1UXGA 2EEZA 4XFKA 1YQDA 1LK5A 1DO0A 4XGRA 2G8LA 4YGYA 5DI3A 2FMUA 3IEXA 2C97A 4DZZA 1RKXA 1ZQ1A 3B53X 5JJ5A 1DUIA 3JSAA 4N0DA 4OI4A 4Z0HO 3DV0A 4CR6A 2QU8A 4DQXA 1FFDA 1U11A 2WHPB 5CK5A 4FI3F 3I9LA 2CXQA 1VG0B 3E03A 3A6EA 1FXWA 4AJPA 4EF6A 1PTJC 2AEMA 2N1BA 3DEFA 4Y1RB 4PC6A 3FSEA 1S8FA 2FFBA 4MXDA 2CJYA 2H9IA 1EDEA 5IDYA 2RARA 1PEYA 2DTEA 4N0EA 1IBKB 4V0LA 2I6QA 2R68A 4LHVA 4NDNE 2X23A 3BZWA 3RB8A 3H5LA 2HIMA 4UOEA 4GKKB 3FR7A 3NJ8A 2J3MA 3K8ZA 4HS9A 1UZLA 2JFBA 4BFLA 4UBMA 1I94B 3OJLA 3IP3A 2ZXFA 4Z7NB 5HKKA 3FHOA 3U4QB 2FN7A 1P4AA 4LYDA 1ZA2A 2EBHX 4QU5A 5TNXA 2YKGA 5CK4A 1CG6A 1PT8A 1QHEA 3O26A 3L3BA 4PC2A 1JZSA 2CXPA 4GZMA 3Q9NA 4XLLA 4MARA 3BJMA 2BZ0A 1U2RA 3T15A 4ES6A 1DDGA 1PWZA 5IW8A 2TYSB 5CBPA 1PZHA 3QVVA 4IJ5A 4HNAB 3THWA 3DOJA 4PN3A 1I4TD 1B8VA 2Q6IA 1T2UA 3F8TA 5GONB 4ZCQA 4B46A 4BASA 2CV2A 4IOMA 3BTVA 3OCUA 4LDNA 3K9CA 2ATVA 2XNDD 1E7RA 3VPSA 1EAYA 3OCZA 1VJTA 4Q9JA 4HH3C 5TQ2B 3ZTYA 2BLLA 4ASUA 3UK1A 5IJZA 1ZONA 3MYYA 4MA5A 2NSYA 2X5JO 4J1TC 2QQFA 3KT8A 1WBBA 1ZNZA 4GZ5A 1YMUA 3G7SA 1T0BA 1SIWA 2BAGA 4W9NC 3I5XA 1X15A 4YMIA 1CRLA 4WJKB 3FZQA 4N3NA 3RQSA 4G2TA 3F98A 1SGWA 1WMSA 1SEPA 3ZHYA 4CM5A 4BQEA 5KWSA 4BZWA 3EC7A 3LBFA 1RXYA 3HRKA 3O9MA 4G6ZA 2JIPA 4GP6A 2R8XA 3M9LA 4N6NA 4C7KA 2IH4A 1CY2A 4JUFA 1QHNA 2EFCB 5EMMA 4GL2A 4URYR 2Q4RA 1IXKA 4XQ0A 2FMHA 3LT0A 4NENB 4H1WA 2WWHA 2GPJA 3ROPA 4BC1A 4MUNA 4IHKA 1G6HA 1YTLA 4WFKA 3BHNA 1G3UA 1JECA 2J6CA 3NEPX 1HETA 3RKRA 5B5SA 1SM4A 5JJIA 2VPXA 4FGLA 1KF0A 2H6EA 3UW1A 3SY8A 1B6RA 3RC8A 3KC2A 2OHIA 4U2KA 1AG9A 3VV2A 1N2XA 5DSTA 4ARZB 2B6NA 2Z2JA 5ERXA 5F12A 5CUQA 3MCWA 3MMZA 4P35A 4GOKA 1CZRA 2VYNA 5HVNA 1EM8B 5KTNA 2EZ4A 4HEA1 1UMKA 4RHUA 4MVJP 1Q3KA 1RI1A 1EHIA 2IU0A 1MFPA 3O5AA 1THMA 2H5IA 3R5HA 4GMXA 3OOSA 4WMLA 2V7UA 3PNYA 4QICA 5DH9A 4IJKA 3STVA 3HM9A 2J6BA 3M5CA 3GGPA 5IX8A 2VTVA 4M9RA 5FV7A 2I62A 4R3NA 2HHCA 1E1NA 2FPMA 1P6UA 4AS3A 4GWGA 2VDWA 2BVNA 3SFTA 3M1LA 1OAAA 1YQGA 5JASA 4C7MA 3PFWO 2FMXA 1K86A 1JPJA 5FUMA 4MYRA 2G9RA 3DULA 4XYBA 5HS6A 3H1PA 5FPPA 3T5PA 1NVXQ 4EY8A 3VSBA 2UYOA 4L28A 2GYYA 3NT5A 3EH2A 2Q9BA 4WERA 5B4TA 3LH5A 3CT6A 3MGGA 2PTHA 1NW8A 1IH8A 3PJFA 4KBYA 2W2KA 3BFVA 1NQVA 4BKUA 1S8AA 1RAGA 4E33A 2EL9A 1E7SA 4ENVA 3AV3A 1U8TA 2HWYA 4J4BA 4DVJA 3CXUA 1EK6A 4DR7B 1WW3A 1NSYA 1WD5A 2HT6A 1NOIA 1FDUA 2ZAMA 4L9SA 5DMXA 3WGVA 4FK8A 1H1LB 1QLHA 1BQEA 3MMPA 1MH1A 5T64A 3TCNA 5DEOA 4PRZA 4CQMD 4Q7MB 4RGQA 5FA8A 5LQUA 4MRPA 3L8DA 5AOBA 4R68A 2OQIA 4IWNA 1OBCA 3MS2A 3VR2D 4Y7CA 3WO1A 4D9HA 1J42A 4MGHA 2IK8A 1WZIA 1CY7A 2PBRA 1T15A 2C42A 3ZV6A 2I4LA 2LUOA 3HJCA 4J0FA 1ZISA 3P20A 2P6MA 1ZW1A 2W6CX 2XUFA 4DAEA 4RABA 2B1QA 1R6TA 3TR5A 2EYUA 5CB8A 1QHXA 3H1EA 3IELA 3LOPA 4G24A 2DT5A 4IEEA 4JEMA 4QYIB 3NFRA 1SHTX 3OQVA 5DULA 3C6ZA 3H5OA 3WV4A 4JYPA 1DTSA 1KP3A 4YQYA 4QQNA 4XVQA 1AZLA 2XYHA 5JTUA 1RZ3A 3LQ1A 3QFHA 1SMKA 3EVAA 2RG1A 2CL5A 2UZ1A 3IIJA 4M9UA 3AUKA 1OFTA 3GJ6A 4IF4A 5IMBA 3I53A 1F3OA 2YWFA 5CDSA 1QP0A 4LRWA 2HF9A 3OURA 1X8LA 2QW0X 2A7XA 5HE8A 5H16A 3IYLW 3ZHTA 2OAGA 1KDZA 1CS0A 4B4WA 1ZAKA 4R0MA 2VSFA 1NXQA 1MAUA 5BYBA 2WYIA 3LQFA 3WMWA 4L95C 2PZGA 4PZUA 3FOAA 3T1VA 4N5MA 4G5XA 2DHEA 1SJ9A 3M49A 3SF8B 3A6KA 3WLEA 4HQFA 3VJKA 1K66A 1TPYA 5AVZA 3Q7TA 4FYVA 4KE7A 2HBZA 1W30A 1KJYA 2PBZA 4CYMA 4HGNA 4IUCS 4M0PA 4FBGA 2WU0A 4M0MA 1SC6A 4IHAA 2ONJA 2R1VA 4XRRA 4EJ6A 2PA3A 2RD2A 4OYHA 5P8WA 4IVPA 3ICVA 3BJIC 4X1YB 4CEIA 1J8MF 1WB4A 2JH8A 4WH0A 3WE7A 4G0NA 3PUIA 4ZU3A 4JLOA 3X1JA 5LYJA 1IEWA 3KEFA 4O2AB 4OQMA 4DXHA 4E4RA 2Z6QA 3QPUA 4X85A 1L8LA 2BBTA 2PAAA 3JW8A 4DUPA 1ZJ5A 2V7BA 3KYIB 4GOND 4BBJA 3WMFA 2DE0X 1AURA 3R8CA 4BWYA 1VPWA 4CTOA 3PGVA 4I2VA 4RDHA 5DBEX 5B3LA 2Y77A 3FIUA 3GNTA 4DUGD 2DBVO 1NUUA 5DHSA 3LYHA 5D01A 3TCKA 4YUYA 1RBZA 3CZMA 3PBKA 5CVDA 3WIUA 4Z51A 4LXQA 4BX9A 3CISA 3K4HA 3KV1A 1A9TA 2ZWPA 4INOA 5FTWA 3WGMA 2V6FA 4XWKA 3C15C 1FMCA 1P9RA 2D13A 3C87A 3S27A 3A1EA 1OR8A 1JQ5A 1VKNA 2YIMA 4HNHA 2G1KA 1SHZA 1PWXA 3AHGA 2O2IA 1C8KA 3FUTA 1G6OA 4ZQBA 4N8EA 3QVUA 1NYLA 4RACA 4REQA 1SRRA 3EIUA 5FD8A 5F98A 3N8NA 1NY5A 1OFVA 1YULA 2JZNA 3PRYA 5JCPA 4RVFA 4ZYYA 4DDWA 1IB6A 4MB2A 4LE2A 4Z7QB 3AKZA 4QM7A 1NXSA 3JQFC 5A9SB 1X2EA 4FC7A 3A9UA 4MRMA 4EKDA 2REQA 1M8JA 1GGMA 5LLSA 2D59A 5JZBA 4L3VA 2NVUA 2WWFA 4MQ5A 4WOPA 4C4RA 3W06A 4U7JA 1CQIB 4CIAA 1XXHB 2ZJYA 3SKXA 1H6BA 3UPDA 4EKGA 5L9AA 2DUWA 1XZJA 2XRMA 1W4RA 3CE6A 4FX5A 3RAJA 2OV8A 2E37A 2I4OA 3U37A 4E2FA 5AUNB 3PXAA 1MAWA 3HUDA 3NO4A 1CERA 1M34E 1WMBA 1NVAA 1CIJA 3C1OA 3Q6NA 4PBSA 3RS5A 2FAXA 3AWDA 3QIAA 5E2BA 5FR1A 3ZIAA 1WMEA 1V7QA 2X1HA 3U3JA 5IT9A 1N33B 3LS2A 4CL2A 2J0QA 4CT0A 1ZU5A 3D1VA 1H1TA 3RRNA 3LMKA 1L7EA 2HU2A 4R8SA 2J3EA 3VZCA 3QE4A 2QQGA 3B3AA 2C3PA 1YCDA 2R8PA 2RAUA 3PNKA 4AM8A 1AGPA 4A3SA 1OZFA 1LI4A 2OAP1 3H9EO 1Q84A 3LW7A 1RFLA 3QELB 5TXGA 4GLBA 1R37A 4YR7A 3JQQA 3HJAA 1CJVC 4HATA 3R3JA 4MUIA 3D0RA 4XGNA 1T0PA 2ZYAA 3WP0A 2X4IA 4NFLA 3RHTA 4RHTA 1FU7A 4FZVA 3TQFA 1ETUA 4IS2A 4D8YA 5F9FA 4YHHB 2H0RA 3ZLTA 5L8VA 2QTNA 1NW4A 1AD2A 3PFFA 3MAAC 5BSTA 1U3UA 3FPHA 1M8KA 3NC1C 2Q5JA 4A15A 1MABB 3DOIA 2X58A 3QKSB 1EJ0A 3PCTA 1LSUA 3EXEA 1K98A 1YS2X 4BNYA 4QQRA 5GWXA 1YQEA 3N39C 1GJRA 4TRMA 3SMVA 1A5BB 1G20A 2EG5A 1J06A 1EA5A 3L6CA 4KQMA 2Y67A 5JTTA 4WZ6A 3W3AD 1CDOA 4BDTA 2NVOA 5BV0A 2FLVA 3PDWA 4I0WB 2G0AA 5CA0A 2EIHA 2PX0A 2Q6TA 3DA8A 2IWHA 4RTRA 1J07A 1YQUA 3KOWA 2FB9A 3AOGA 1AHNA 1H05A 2VK1A 1QQ6A 4A0FA 1WKBA 2JFYA 3L0IB 3TDMA 3UOGA 2FPSA 4GRDA 5E0KB 3EMVA 5LZ9A 3S8EA 3PLRA 3WNVA 1CRPA 1Q0QA 1ULZA 2NSLA 3Q5EA 3FGOA 1M72A 4EGJA 1C0IA 1CRQA 4DCUA 2RHMA 1UM8A 1E9AA 3G5LA 2BE7A 2AN1A 5HUQA 2FG5A 1YBMA 1OXUA 2FYTA 3NHUA 2AOTA 3RBAA 4PYRA 5CFOA 4LFCB 1WDLA 2J07A 3ZVRA 4DNXA 1I7SB 2IY8A 3COJA 3OLWA 4BLQA 1Z5GA 3FDZA 1TQ6A 4NCJA 2LBPA 4PM4A 1O6ZA 2I1WA 1RYDA 3U62A 3N2GB 2ZE5A 4X1IB 5FBRB 5FUYA 3U48A 4I9NA 2Z0MA 2QL7A 4J0CA 3CTMA 5L3SB 9ATCA 1U04A 2YQZA 4DJTA 5C8YA 2PR7A 4F04A 1QAMA 1TYAE 4OPMA 2FPWA 1X9IA 3LXXA 4ZU1X 3QE9Y 2WSIA 3TLJA 4BO7A 3A4VA 3C3DA 1SVMA 3G6WA 2HL6A 4XD7A 4S1TA 1G59A 3QKRB 2X3FA 3OCWA 4I9FA 4LMPA 1USVA 4OHUA 2Q45A 3X1XA 1QP4A 2Z09A 3G5AA 2VDUE 2WEKA 4FNGA 5AM5A 5JWHA 3UUWA 4FSHA 3FNQA 1R8QA 1XHEA 1ZC3A 2N1MA 4LRQA 4OUDB 4Q1DA 1TAGA 1JTEA 2C94A 4GRIA 5LBUA 3ZE8A 2ZSFA 4GUDA 4HADA 3M1IA 5DGHA 4DV4B 5K0EA 3DT9A 4ER7A 1KARA 3LDFA 2K2QB 4QUEA 2AQIA 3BIFA 3QBDA 4ZYZA 2XCLA 4BIMA 1PUXA 1H4SA 4DPMA 4JNCA 1VRVA 1NY6A 4MCAA 3WSTA 4C6RA 2MSEB 1VIVA 1OZAA 3PYMA 4RL4A 3GP8A 4IMPA 3D3KA 1ZGBA 3JCZA 1SUIA 3D2LA 1ARZA 1P8AA 3C74A 4MP8A 2Q3LA 2HA4A 2YHSA 2ODAA 3PQEA 4E2WA 3ILSA 4LNAA 4OJQA 3O8CA 2EZTA 4MS4B 3UN1A 5FH9A 1G7TA 1ZSNA 3GG2A 5F5NA 1VSTA 5KQSA 3RS3A 1I2BA 1LXCA 5L7YA 5BVHB 5JD3A 3RG8A 4B79A 1E3WA 2PX4A 1ATIA 4BEBA 5B1EA 4IQ4A 2C9OA 3O8QA 4C0KA 2PMCA 5IC6A 4P93A 4DAOA 4TVKA 3GLGB 2JBAA 1QO7A 2BFFA 1KZGB 1S2IA 3SKYA 3GVIA 3NANA 3IEIA 1AQ6A 4QDTA 5K0GA 3MCVA 4WZAB 4OOFA 2JLZA 2P62A 5GOTA 3CSUA 4YRFA 1G8YA 1ZMTA 3HWWA 2OO3A 1NASA 5EWJA 2RH5A 2IT1A 1GG2A 1ISFA 1U3VA 5CT9A 3I32A 2F55A 2RGNA 3CQ9A 3CF0A 4RV5A 2HV8A 4RLFA 1PYGA 3V4SA 1Y1RA 2ZDQA 3KUCA 3UICA 1DJNA 4EWLA 1XQXA 4HJRA 4D7AA 3L92A 3GA7A 2YW2A 2XUHA 3OE7A 1WZNA 1Y7TA 2OY0A 5EUBA 2IOFA 4MEBA 2ORIA 5G3YA 3GZJA 3TQQA 1GNRA 4JK3A 2ILVA 4BQSA 2XTAA 2BEWB 1AHPA 2GJ8A 4JGBA 4IV0A 4P4TA 4M53A 2P9EA 2Y1FA 2IHVA 4HFJA 1ZESA 3GJ4A 5HFJA 3RTAA 1I4EB 3D6JA 1MX5A 4JB2A 4JJFA 3WYFA 4EJ2A 2JF0A 4K1LA 4TMTA 5D86A 5E95A 1KKMA 3ROZA 2XOXA 3OFNA 3VPDA 3PFKA 1E2BA 3LG2A 2RIPA 1FSPA 2JKYA 4TLEA 4MV8A 5CM9C 3UZUA 3WZMA 1KIFA 3QU2A 1E9RA 3ZE2B 1ZUD1 3QEBZ 1KC3A 4G67A 4ENWA 3JD2A 4QRDA 4QG3A 1C29B 2C59A 2Q1XA 4YAJA 3UWSA 4RTNA 2XYRA 4E5DA 3GN2A 4HDKB 3H3XA 3ZS9A 5D1HA 1T9HA 2AVNA 4YQEA 3GPIA 1C7QA 2AOVA 3O92A 4Z4CA 3PWZA 2Q0SA 3O31A 2WPDA 4A2CA 1ACLA 1PJAA 4JZKA 1JZTA 5K0ZA 1UZUA 2GAIA 1I3NA 2OD9A 5FHRA 3U56A 4IIGA 4KYTA 5AK3A 2EP5A 1ZH0A 2F9FA 3G2NA 2FP3A 1JHDA 3FI0A 4EW1A 4P2BA 4YJ2F 4L57A 3NHAA 2G3YA 2ATIA 2DWCA 4GC5A 4RVNA 1WSDA 1PG5A 3HCPA 4XQCA 3UUGA 4JYZA 1RQXA 1R10A 2NX2A 1H1DA 3LVBA 1QRSA 1NW7A 4C4TA 2CE7A 1JG2A 2VK4A 1UBUS 1YZLA 2A9PA 2E48A 2FTKE 4BO5A 5HDQA 2CLIB 2NOAA 3DCIA 2IOQA 1PFGA 4FMBB 5DLQC 1SBQA 3I1YA 5AKEA 1PR5A 1POXA 3FA2A 4QKQA 4Q02A 5HIIA 3AGPA 3HXKA 5C8VA 2DUUA 1Z62A 1SXJB 1FUEA 1JF8A 2CHVA 2XMGA 3LKBA 2O0LA 3OD5A 2YMQA 3JTEA 4TT3A 1P91A 4TV8B 5A5DA 3C5HA 2BSXA 1OB2A 2XCUA 1NUHA 2XNHA 2XQKA 1W5EA 4FHZA 4YJDA 4ZTZB 4X93A 2OHGA 2MSDB 5HZGA 3PGA1 4JLMA 1S01A 4XJTA 5LWHA 1XK7A 1CSEE 3QEAZ 1T91A 2OXCA 4IO1A 1R9NA 1XALA 4HX5A 1YJCA 3ASUA 5JXHA 3FZGA 1OX4A 1P7WA 3S4YA 3L0DA 2XE8A 2JK0A 2O54A 2EEPA 2RHHA 2VF7A 3L40A 4P4SA 3MSCA 4LJ5A 1NN5A 2PWZA 4R9NA 3RRMA 4B7CA 4F2GA 1TAHA 1WW8A 2ALJA 3H0CA 3JR3A 4PCVA 5BWLA 1KQGA 2C9MA 2PMWB 4UUNA 3EFHA 4ZXFA 3X1WA 1I0LA 3HL0A 3EK2A 3QLUA 4RTQA 1CDZA 2VC2B 4WN9B 1LNSA 4WLUA 2R65A 3CPSA 2IOHA 2Z83A 4L8GA 2ZR9A 2G76A 2GLUA 2WY2D 5AVQA 1EFKA 2B35A 2AN9A 3E1SA 1Z8NA 4DV5B 2A9JA 2W2QA 4N0QA 4XDZA 3TLEA 4DTCA 1VP3A 3T1YB 5KTRA 2OV2A 3TL3A 1Q22A 3PQCA 1CC1S 3RWOA 4KVAA 1UPBA 2Y6VA 1PU2A 3U7JA 3WNBA 2WIFA 4FCTA 2C4VA 3RI3A 5HNKA 3ORHA 2A9VA 3T9CA 1DC3A 1EDDA 5EE5B 3SZGA 1J97A 4MQ6A 3F9IA 3DEAA 1SUBA 3H9UA 3HBLA 2ZRHA 1FP7A 4S12A 3SZ3A 2CXSA 1SCKA 5LMNB 1ZRHA 4L7QA 5TQJA 2XXAA 1SCUA 3H05A 4CQLA 5JEEA 2NXNA 2WAYA 2EFDB 2A9RA 4P0PB 1PWYE 2QUZA 2C29D 1D6MA 1QV9A 3I9OA 2JGDA 3TD9A 5IAEA 4DLKA 1ORIA 1OXVA 1KAOA 4OYLA 2AFHE 2V6JA 4EMBA 3QEJA 2ANCA 3EASA 2Q1SA 3H1AA 4L76A 3GGDA 3O73A 3LL7A 4R6XA 5D51S 5ALNA 3LT4A 3IQGX 1Z5PA 3QU4A 3SBOA 1OKKD 1NQWA 1U6KA 3ABSB 3LA8A 1NI5A 2ZIAA 4YCNA 5JSFA 3C85A 4TT8A 1D2MA 1RQNA 5B1HA 5B7PA 2A67A 5I7RA 3TBFA 2VHXA 1Z4OA 2R6FA 1IHDA 2JLCA 5G41A 3KCNA 2QYOA 1EZZA 1EVKA 2J0UA 5EKSA 3JALA 3I5YA 3QXJA 4GF5A 4L73A 4MJXA 2F9LA 4EMSA 2GF2A 3DG9A 1FDWA 3HN7A 5HFNA 3H3FA 1LRKA 5J1SB 2JLAA 1WV0A 2BZGA 4B2IA 2Q3CA 5EJ2A 5FX2A 1IZ0A 1LNZA 1W5SA 1QYIA 3NC0C 3AOEA 3BIOA 2FEWB 1Y9DA 3KVNA 2HKIA 3N5KA 3ZTWA 4AC9A 1I80A 3EAGA 5AW0A 1T9DA 1ZMBA 3V5NA 3NX4A 1G8HA 4DCGA 1KHTA 2D1QA 2I66A 3TTXA 1I0ZA 5EQDA 4E12A 1ONSA 2NO9A 2EFJA 1BOOA 4KPGA 4FCVA 2WFLA 2VJQA 5CCDA 4OK3A 1UBRS 4WKGA 4XSGA 4DLBA 1Q0ZA 3N9IA 4TMWA 2XUDA 1YU9A 2EHDA 3NAMA 5KNCH 5K9ZA 4R41A 1CUSA 3PEYA 3FPJA 3KL4A 1EZ4A 3BCUA 2XMBA 2P9CA 4B0OA 2G7ZA 2BJWA 2OBNA 2V9CA 3AESB 2H63A 2TMDA 3BQMB 3NHMA 4GI3A 4AIRA 1ZH6A 3PFCA 5ES4B 1SH7A 4K87A 2C7PA 3OO0A 4BCBA 5DYYA 1YC2A 1YRQA 1ZNQO 5K8IA 3LTEA 4RMNA 1YU6A 1T2DA 4Q6BA 1VE3A 2WYOA 1WQ4A 2A1UA 1L7AA 2Z5GA 5BW8A 4UCQA 3NPMA 3PU6A 4HFRA 421PA 2WT9A 5C7LO 4JEHA 3GX1A 5T5QA 4JDUA 4K0RA 1E1YA 1F9EA 2YDYA 3EG5A 3RUEA 5K5EA 3O2JA 2H4WA 3FETA 1M0SA 2II6A 3HYNA 1FS4A 3NTLA 1DX9A 5GY7A 4EHHA 1S4MA 4EK9A 3K0CC 4EARA 2C2HA 1RC1A 2GQ0A 1W88B 5BORA 4JKIA 1BW9A 1DC5A 3D7SA 1YB5A 5BYJA 4NV1A 2AHOA 2E3JA 5I47A 1PQWA 3T9AA 4KR0A 3V7UA 3ZK8A 5K03A 3RG2A 2DP4E 3G0IA 1XC7A 3KDPA 4GVPA 2QU7A 4XYGA 4R54A 5EZYB 3S28A 2CF6A 3OI7A 4ALLA 1DXHA 1UJMA 2P35A 3AKDA 2R1TB 3A1CA 5L6LB 3CEPB 3EWIA 3NAZA 2RHLA 3DVAA 2BFDA 1GA1A 1SELA 2WAMA 3SOPA 1SQGA 2QTTA 2ZI3A 4CQJA 5FJIA 1Z0ZA 2AJDA 1I2MA 3V8NA 1D0VA 1LI7A 2RKOA 4MQFB 4HSGA 3TL6A 5BY2A 5J9FA 5JEDA 1QMGA 3ZWXA 1G8GA 1UODA 5K0TA 3BH0A 1UPXA 4IIJA 2RB5A 4HDOB 2XUZA 4B7ZA 4WZBA 1YBVA 1Z88A 3B9QA 4RS3A 4BPBA 2BBWA 2QRLA 4PYKA 1K5HA 3KJHA 4MGKR 3GXBA 3QF4A 3RRXA 5DJ5A 4EBBA 4IG9A 4IMJB 3H99A 1X8KA 3PRJA 4DBLE 4F5DA 4DR4B 2JLSA 4KR9A 4YY3B 2FE4A 3TKAA 3MGAA 2OVFA 3FKJA 3G68A 4CR8A 2F59A 5U4QA 1ECBA 5EZ5A 4ZHQB 4Z8YA 3V8EA 3NBKA 2JAHA 1NR5A 4CFZA 1PR1A 2WSSD 4CM7A 4ENRA 2Q2NA 4R8KA 3MOSA 1I2CA 2QQEA 2RJ3A 3AF3A 1W0KD 6Q21A 3ZDDA 2O2YA 2B4TO 3INGA 4TTJA 5D00A 3OETA 3E18A 3JQ9C 2ORYA 1MEJA 1P7ZA 1DJMA 1R0RE 1EVZA 1T10A 2OVBA 4YRCA 2X7XA 4EF4A 1A0OA 3ZBUA 3HMKA 3BFPA 1QM5A 3SVTA 2YV4A 2VNKA 1PN3A 1U2GC 1H2AS 1PLKA 3U7IA 1QORA 3QHAA 2YY5A 5J40A 2O2EA 3I30X 2IQIA 2MYTA 4X20B 5C4GB 1EESA 4Q3KA 1B4DA 2YWDA 1QK3A 3ELDA 3HJGA 3Q3HA 2DHDA 4UNSA 4CKXA 1ZN7A 1Q1ZA 3O8OB 4DREA 1SKUA 5H9WA 4EUHA 1RBYA 4AKGA 3OZRA 3OAAA 4S35A 5B55A 3FTCA 4LVNA 1S8OA 2CVHA 2B99A 5AVUA 1YH3A 1JIXA 1JXAA 2NNWB 4LMBA 2A0KA 5D7NA 3SHQA 2RC6A 3ZWCA 2C84A 3TLZA 3W5HA 4ZI7B 3T1HB 1E5VA 3PDUA 5D3QA 4NIMA 1LDYA 1HG1A 3QVSA 2GA8A 1ST3A 5JAOA 3GLKA 2EKQA 4OA8A 3T34A 1ZCBA 3EIHA 1T0JB 4M1MA 2D7DA 3S7TA 5EE3A 2EIXA 2ET6A 4FDUA 4PG8A 1L9KA 1H9AA 3B36A 1G0NA 3EOBI 4KXYA 4XJVA 2ZQ5A 4WVFA 4DQKA 3R3XA 4XRGA 3DOUA 4C29A 2M98A 3G2IA 3T3IA 1LH0A 3IPYA 3EGDA 4QLBA 5HJ7A 2QI9C 1LVGA 3KS9A 3LRXA 4DIDA 2XDAA 1WEKA 4GP7A 1KPIA 4LVCA 3W6OA 3WV5A 2GCEA 5K8UA 2HDWA 3JZFA 2QGNA 1NFRA 4K2HA 4I7EA 1DEOA 1KY3A 5SY4A 5C1IA 9GPBA 2HHHB 1QHFA 2OXRA 4KRGA 3RANA 3FYCA 2PSDA 1QKJA 3ZW7A 3HKEB 4K26A 1N2ZA 1Z26A 4NFYA 4WCFC 4O25A 5FWXB 2LRHA 4IZHA 4CFSA 2C82A 3IQDB 5CD1A 1TI7A 1XD2A 5C7IO 4BNZA 4F45A 1N32B 1GXSA 1U9IA 2O5EA 2X9GA 1EQ2A 1ZHFA 1G8KA 1FEZA 3AI7A 4MIKA 4QO8A 1N5IA 2BGWA 4I1PA 2ETVA 4S1OA 4OGGA 1PJTA 2BMVA 4RK7A 2IYOA 4ZVOA 4EGCB 3ICQB 1GAWA 2I3AA 4IKEA 1E6CA 2WWXA 2YCBA 2R48A 3UVEA 1BYIA 3OCXA 3OKAA 5K3OA 1TO2E 4ABYA 2VDLB 2CMHA 2D1YA 2PS1A 2ZUDA 1N2SA 3DD5A 1L5GB 3ZZ0A 1HR0B 1TYBE 4WKCA 2CB0A 4J2OA 4AJIA 2QY6A 2AJLI 4H31A 5B7QA 5K09A 4C7OA 5KB3A 3WWPA 3N6RA 3NGLA 4QE3A 4N5LA 1S1CA 4R1PA 3A2MA 4M0EA 3REOA 1FYFA 2C9YA 1TLFA 5J4KA 2I7XA 2CNKA 1GLVA 3CKYA 3JS5A 4JHLA 4TKLA 3UMJA 4EH1A 2BI7A 2W2NA 3GRVA 1NC3A 4G81A 5CJJA 4E5KA 3ZHSA 2B6HA 1LK0A 4AJNA 1OWNA 2SECE 4DT1A 2JLWA 2WF6A 4R8VA 1PD0A 1AIPA 2YV5A 2ORED 1CDDA 4L2IA 2OM2A 5BYAA 5ITWA 5BMVA 2ZIZA 1P0FA 5CVEA 3PPXA 4I4LA 1KFBB 3CF4A 4O4IA 2CNNA 4OOEA 1JLHA 3S81A 1G9SA 2C5LA 1IBSA 3AUSA 4JB3A 2IE8A 4PE5B 4GLFA 1LDNA 4Z2YA 1X92A 2BGMA 5FNVB 2PRIA 3SYTA 6REQA 4NNOA 3E5RA 1NJ8A 4JOBA 1Z4MA 5IARA 3TE7A 2GCPA 3GAZA 3FPBA 1GR0A 3G0CA 3UPTA 2R7MA 4LG1A 4P98A 5ALWA 4H1VA 4BKQA 4NHOA 1NPTO 3TJRA 2OEPA 3WLHA 1IRXA 1XVLA 4A16A 4AAYA 3JASB 5C4IA 2C95A 2KLBA 2ACWA 3ZVLA 4YMGA 4QWMA 4JC8A 2E55A 3DKRA 4AO7A 2AX4A 4G4SO 3EQ7A 4HJXA 1YQ9A 3GGJA 3BSFA 5LP6A 2I2BA 1GUFA 5BSGA 1LBTA 5ICEA 1G5TA 3LUDA 4F9EA 3FZEA 1K8YB 4FWBA 3CVUA 3UB3A 2YUIA 4FIZA 4U7TB 1VKHA 2H29A 4HXEB 5J5AA 2VUHB 1TA9A 2FFHA 2EZ9A 3L8FA 3IBYA 4OL9A 2VUSA 1RXEA 4M7WA 4WCVA 1L1FA 2YH2A 1KMMA 1WNFA 2XAUA 4Q1CA 2CD9A 5F7OA 3IEMA 1G4HA 5D3ZA 2O8DB 2PZJA 2BFPA 3BCHA 4YAGA 1YVPA 4J1QA 3A1TA 1YRWA 1C5KA 3FSGA 3ZE1B 2HGSA 4J94A 2Z8XA 1I7LA 2JA2A 3L4BA 2PUDA 2QTCA 4YUAA 5BSFA 1GUZA 4JJZA 4NMXB 5GVSA 1QE3A 5D5QA 3P94A 2O3SA 4HR7A 4DMHA 1FF9A 2H0AA 2JGMA 3L0PA 1P81A 3I1JA 1IY0A 4QM6A 2BGUA 4CLRB 5JFTA 4B6EA 1Z33A 1GILA 2V74B 4BPRA 3FWNA 1T3LA 3JQ7A 4K3VA 5BSHA 1CP2A 1E2HA 1E9CA 3BT7A 4FNOA 4I5FA 1XDGA 1II8A 1XA0A 2REOA 4Q34A 2BEUA 1WVGA 4X8LA 5FXMA 1CQJA 3A9SA 1RWVA 3PYLA 1JVSA 5LDHA 3C3CA 5EIBD 3Q9LA 1Z68A 4LGCA 5FHQA 2PUFA 2BMJA 4WNAB 2FW6A 3MELA 5LZ8A 4NS1A 3D54D 4ZA2A 1MU0A 4P5EA 5FORA 3RSFA 2ZWVA 4NZPA 5DNCA 3BCSA 1OC4A 3EC2A 3EGCA 1PE0A 1GCGA 2WRZA 3FNRA 3GHHA 3TIIA 2VJBA 5DCLA 3OHMA 1V5FA 3QOYA 3T9EA 2GXQA 4EHBA 1TD9A 1U7HA 2CLMB 4QYSA 2R62A 2NUPA 3BRQA 4CM9D 2ZRMA 3C98A 2VK8A 3MPUA 4LJAA 1EK1A 1DDIA 4FLFA 2Q62A 4PANA 4OATA 1SG9A 2ZUCA 5EUQB 2C98A 3H4IA 3OEWA 3QXGA 3HKCA 2FR8C 5HF6A 1QHHB 3DYVA 3ZDFA 2NZXA 4FFSA 3VYUB 3ODPA 1TK3A 3G2PA 2J9RA 2XWPA 2N0SA 4K9RA 1VHJA 1ZUWA 4Y2JA 3BMQB 1JJFA 2P9JA 2QUBA 3RSZA 5JZ9A 4IHQA 4TMXA 5HQ3A 1GIAA 1DCFA 3M6LA 1NLZA 2VNHA 4WE3A 2ZI6A 1IM5A 1HZZC 1JJIA 2J4CA 2Z6AA 4O33A 3R4VA 2OV4A 1TVKB 3AT1A 2X2OA 2XB6A 4OJTA 3OQIB 2ST1A 1ORTA 1KEEB 3DDOA 5IKEA 4G8DA 1M2HA 4ARCA 4CIXA 5A0VA 2WILA 3KLNA 3E4DA 1NT4A 3EN0A 1AKRA 2C83A 2H4YA 4KVFA 4YXWA 3BSYA 4E5PA 7ADHA 5IRCD 3GPDG 3CSDA 3IH5A 4S3MA 4ZCPA 5FWYA 1P9NA 3LZ6A 3NW9A 4V3CA 4KXLA 2WKQA 5PGMA 1R0BA 1W35A 3AFHA 5ENZA 3TLCA 5A4FS 3HP4A 2XLCA 1AB5A 1JQJC 3IGFA 2GERA 2ZBGA 3NCHA 1O08A 1HUQA 4GYWA 1QK4A 4FU0A 1XZNA 1Y4AE 3L1JA 4NQRA 4FGKA 5DN6A 2QX8A 5HIJA 1KPGA 1X7WB 1SUFA 3EAQA 5GIPE 1OLUA 2PFGA 2WWWA 3ZI7A 1OHHA 4ZYTA 4BO0A 5AM3A 3T9DA 4EA8A 1DGQA 1THTA 4H4CA 3ZV3A 5I9NA 3K0KA 3D0OA 3FB1A 3PLNA 3HV2A 3M7IA