3DULA

Crystal structure analysis of the o-methyltransferase from bacillus cereus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
217
structure length
201
Chain Sequence
TWTAVDQYVSDVLIPKDSTLEEVLQVNAAANLPAHDVSPTQGKFLQLLVQIQGARNILEIGTLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEKYEPFDFIFIDADKQNNPAYFEWALKLSRPGTVIIGDNVVRIRRFYELIAAEPRVSATALQTVGSKGYDGFIMAVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase, putative
publication title Structural and functional insights into O-methyltransferase from Bacillus cereus
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transferase
total genus 66
structure length 201
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3dulA00
2EG5A 2EJTA 4F85A 2JH8A 3FUXA 1G8AA 2VZ9A 3V8VA 5HZMA 2ZLBA 1KHHA 5DRYA 5FHQA 5K0BA 1R18A 4DCMA 3CJTA 4V0RA 5DWQA 1YFJA 3LCUA 2FPOA 2BM8A 3C3YA 3FPFA 2PKWA 5E1OA 2IFTA 4YUVA 3FYCA 3KPYA 4YUZA 3EVDA 4OA5A 3OE4A 4QQKA 3G5TA 3JWJA 1ZQ9A 3DLCA 3HTXA 2YXLA 3EVGA 4F86A 3DMGA 2AOWA 3HA7A 2B9EA 3MCTA 2FK8A 5IH3A 2KW5A 3O31A 2HR1A 3ER9A 1JG4A 3EVBA 4ATNA 4AZVA 1SG9A 4YMGA 3ELUA 4MIKA 4EK9A 5E9WA 5CVEA 3VC1A 2PSSA 5CCXA 2N47A 1QANA 4PWYA 1L3BA 2GAFA 2I7CA 3NJRA 2YXDA 2Z6AA 4GOMD 5E9JA 3LPMA 1OR8A 1QZZA 3TKAA 4AZWA 2GH1A 4RV9A 5K0NA 3UJ7A 5ICFA 2AN5A 1RI5A 3THRA 2AOUA 4R05A 3P9CA 2IBSA 3PX3A 4DM3A 2GA9A 2VDUE 2ZZKA 4M36A 4RTKA 1G38A 2YQZA 3TOSA 5DM0A 5K0JA 3FTDA 1RI4A 4HH4A 3H2BA 5CVJA 5GM1A 2ZBQA 4CWAA 2VP3A 1Y8CA 3PT9A 3ELYA 1IXKA 2H00A 3GRRA 3HCBA 1FP1D 3LDFA 1JTEA 4KIGA 4QPNA 3GCZA 4QPPA 3KR2A 3GDHA 1YZHA 3B5IA 5JR3A 5KVAA 2O06A 1G55A 2QRVA 2H11A 1IY9A 2YX1A 5EZQA 3G8BA 3V97A 1M6YA 3T7RA 3CCFA 5F2OA 1ZGJA 3UWPA 3M70A 3PX2A 1P91A 1N2XA 2JHAA 3FZGA 5FTWA 3R0QA 4CKBA 3HM2A 3G88A 4FGZA 2IH2A 4A6DA 3G8AA 1JR4A 5EGSA 3G7UA 4XUDA 1RJEA 5E1DA 4X61A 4GOOD 3NTVA 5D1HA 4DKJA 3R24A 1JQ3A 4PYOA 4ZTBA 2G72A 3R6TA 1NV8A 3GIWA 1SUIA 2ZWVA 4AZSA 5LR6A 2UYCA 3BT7A 4PIPA 4ISCA 3BGIA 3SMQA 5CVUA 4X41A 4POOA 2ZCJA 4YMHA 2V74B 3P97A 4GOLD 2P41A 5B1SA 1R74A 2YUIA 3CBGA 4P7FA 2ZIGA 5ICCA 5E1MA 2V7EA 5M5BA 2ZZNA 3OU6A 1HNNA 3OU2A 5GP1A 1YB2A 3DULA 4PYIA 2O05A 4FT4A 4MWZA 1WXWA 5LQUA 3C6MA 3BGVA 4KVZA 4RTNA 1XTPA 1N7JA 1IM8A 3PLAE 3ID6C 4FZVA 4E2WA 4GC9A 3I58A 1VPTA 3DUWA 1P39A 5BW5A 4K6MA 5KYGA 2PWPA 1I4WA 2BR5A 1D2CA 3GNLA 5K01A 4QTUB 2ESRA 2ZWAA 3I64A 1QAMA 2AOXA 2HNKA 1EJ0A 3DTNA 2K4MA 2QRVB 3B3GA 5EMMA 3MGGA 4E2XA 4A6EA 3O7WA 4C06A 3EEOA 2PX4A 4GF5A 4LG1A 2ZIEA 2UYOA 1VIDA 2P8JA 4RYLA 4GC5A 2PWYA 4RTSA 2UZ4A 2ERCA 3OCJA 4AZTA 2PX2A 3TM4A 5EMKA 4YV1A 4P7JA 3MHTA 2ZULA 5DM1A 5DX8A 5DLYA 3BWYA 3EMDA 1TPYA 1I9GA 1VQ1A 5CVVA 2UYQA 3RW9A 3KPUA 2PT6A 5G02A 2C7RA 3G2PA 1BKYA 2YVLA 4HGZA 5LQNA 3KQQA 5EEHA 5FA5A 1R00A 3ER8A 3SSMA 3FPJA 3KPWA 1BOOA 3PVCA 2ZIFA 5ICEA 4YV0A 3GJYA 3TFWA 1FPQA 1O9GA 3EGIA 3A27A 4HG2A 4R8SA 4RTLA 3M6VA 2NP6A 3NMUF 1KP9A 5EMLA 1EJ6A 2CKDA 2NXCA 3NVMB 5DXJA 1JSXA 1KPIA 2QYOA 3PB3A 2ORED 2ZFUA 3T0IA 1KR5A 5T64A 2ZZMA 3FTCA 1NW8A 2ADMA 3GRYA 5DTQA 4CXMA 3OU7A 4RVGA 5GWXA 4G56A 5U4XA 5CD1A 5LQCA 4HSGA 5ICGA 5EOVA 3I9FA 3Q87B 2YXEA 5P8WA 4YUWA 2IH4A 2B3TA 2FK7A 2DPMA 3TQSA 2BM9A 3FUTA 2I62A 3KR9A 3PFGA 2GS9A 5ERGB 5IKMA 3B89A 3ORHA 1QAQA 4DZRA 2QY6A 4BP1A 5T6BA 3WSTA 3E23A 4R6WA 2BZGA 1WG8A 5C1IA 4RTPA 2PY6A 5FHRA 2PT9A 1KYZA 3T7SA 2XYQA 3UA3A 1MJFA 2XVMA 4P7KA 4C4AA 4DMGA 5EKUA 4RTJA 1ORIA 1D2HA 2HMYB 5EKXA 3BWBA 2O0LA 3HA3A 1XXLA 3OZTA 4Y30A 4AX8A 1R8YA 4RVFA 5HEKA 3KQPA 3OFJA 1XDUA 1RJFA 3FRHA 2IBTA 1N7IA 2LD4A 3KQTA 2OYRA 4BLWA 4C05A 1EIZA 3DH0A 4PYQA 4Y2HA 3LX6A 3LL7A 3K0BA 3RIEA 1G6Q1 5EEGA 1R6AA 5LQRA 5LQKA 1F3LA 4FSXA 2AOVA 1EG2A 3LDGA 5CUQA 3NVKI 5FQNA 2IPXA 1SVUA 2JHCA 3DR5A 5DXAA 3C3PA 1MHTA 5EVJA 2PJDA 5DRTA 5DSTA 2IIPA 2PGXA 5FUBA 3SR4A 4EQZA 5EIFA 4R6XA 5DX1A 4GBED 5T67A 4GUAA 2H1RA 3UFBA 3KKZA 2AS0A 2OKCA 4FSDA 3ELWA 1F38A 4BP3A 3AXTA 2PBFA 3KU1A 3HVHA 3QOXA 5EC8A 4RTQA 2EJUA 3A7DA 2OB1A 2AVDA 4C07A 2BR4A 3TMAA 2BR3A 3GU3A 3THSA 3A4TA 4HTFA 5F2NA 4QQNA 4P7GA 1JG3A 2BH2A 3P9KA 4O29A 3MTIA 4QDKA 4E70A 1TW3A 1UWVA 3HCAA 1X1BA 3UJBA 3U81A 3NWEA 3VYWA 1JG2A 1SQGA 1KYWA 1M6EX 2OY0A 3JWHA 3UZUA 4HRAA 3LHDA 4IV0A 1WS6A 5MHTA 3CC8A 3EGVA 2Q41A 5DM4A 2QE6A 2PX8A 1XCLA 4CKEA 3EVFA 5C9ZA 3FUVA 2Z6QA 5HIMA 1VP3A 1UIRA 3UJ8A 4WVLA 4HGYA 2FRXA 4RTRA 1JSZA 3G2OA 3KQMA 5FQOA 3ERCA 1ZG3A 5K09A 5CVDA 4XUCA 2R6ZA 5CIYA 5DT2A 7MHTA 3SSOA 3TLJA 2AOUB 3HCCA 1B42A 4NECA 1YFLA 2IP2A 3G2MA 2XVAA 1JG1A 3GXOA 4OBXA 4E2YA 1ZKDA 3LSTA 3HNRA 3LDUA 3VC2A 4RTMA 5HILA 5D1NA 3M6XA 4GQBA 1KPHA 1WZNA 4YUXA 5LQJA 4CKCA 4PYJA 3FUWA 3OE5A 1TW2A 2O07A 3OPNA 5FADA 4RWZA 5KQSA 2ZSUA 4C04A 4MTLA 3UJ6A 5KQRA 2P3QA 3K6RA 3FTFA 2JHPA 2VDWA 5DX0A 2AVNA 3C6KA 1DL5A 2G70A 1ORHA 3R3HA 5DTRA 1NW5A 5K0EA 1XDZA 3E7PA 4E2ZA 5K0CA 3G2QA 2P7HA 3O4FA 2XBMA 3HVJA 4HTFB 2B25A 3P2KA 1EAMA 1XVAA 3E8SA 3LBFA 5E1BA 3KQSA 4FR0A 2C7QA 4LWOA 2GPYA 3BWCA 4PIMA 3PTAA 1NBIA 3BKXA 3B3FA 4E32A 1NKVA 4CTKA 4FT2A 1BC5A 1JQEA 1NW3A 2CMHA 2QM3A 4KRGA 3CGGA 3AY0A 2OB2A 2ZW9A 3OZRA 3Q7EA 4OA8A 2YR0A 3I5UA 5EHGA 4EVIA 4F84A 4EKIA 3DOUA 2OXTA 2OPBA 5BW4A 1T43A 3HCEA 4LECA 5K0LA 1UFKA 3MERA 3GGDA 3HEMA 3D2LA 3C0KA 3P8ZA 5EZSA 1O9HA 5CM2Z 1JQDA 5GIPE 1KPGA 5E8JA 3FPHA 3GRUA 4WXHA 3KR0A 5EIWA 1SQFA 5FWDA 4H0NA 4PINA 5DPMA 3UJ9A 5HOQA 5LQAA 2PXAA 3HCFA 4GEKA 4MHTA 5FWAA 4KW7A 3QOWA 3TKYA 5BP7A 2WA2A 3DMFA 4FP9A 4JXJA 2NXNA 1VP9A 4P58A 2CWWA 1I1NA 2HWKA 4M7RA 3GRZA 3BZBA 2EFJA 4QDJA 4BY9E 4IV8A 3DXXA 4FS8A 3UJCA 3ANXA 4E33A 5CCBA 4IWNA 3SGLA 3BWMA 3B7PA 4BLVA 3UJAA 3MCZA 9MHTA 1FBNA 2NNWB 3EVEA 4GOND 1X19A 3HCDA 2IDJA 2P3LA 3VSEA 3AJDA 2AN4A 3M4XA 3R9XB 1U2ZA 3DP7A 1RI2A 3E05A 4QVGA 1AQJA 3M33A 3TR6A 1DUSA 4IKPA 2C7OA 1RJGA 2P7IA 4L7VA 3FPEA 2C7PA 3DLIA 1SKMA 4CTJA 2JJQA 3CJRA 2WK1A 2ZTHA 2IH5A 1SUSA 4OX9Y 2PVCA 3G89A 2E5WA 4Z2YA 3NDJA 3GWZA 5DTMA 1PJZA 5E2AA 4UOEA 3LCVB 4DA4A 1FJXA 1XDSA 3BGDA 3NW9A 4ER0A 2B78A 3P2IA 5DSXA 1NW7A 3KQWA 1P1BA 2CMGA 2AN3A 2R3SA 3GRVA 2IDKA 4PYLA 3BUSA 4U7PB 3S68A 3EVZA 1AQIA 5FCDA 10MHA 5KS2A 2XYVA 1X1CA 1VBFA 1VE3A 4PONA 2VDVE 3ME5A 3P71T 2AOTA 4QVKA 3HP7A 3UBTA 1DCTA 1YZ3A 4X60A 2GB4A 2O57A 5K0FA 1KXZA 3A25A 3B3JA 3DXYA 3NWBA 3KR1A 2P1DA 3AXSA 4EMSA 5JUWA 3LGAA 3MB5A 4B17A 5EMJA 3FUUA 2PX5A 4RVHA 4E31A 2DULA 5LSAA 3HA5A 4OQEA 2GLUA 1XJ5A 1ZHFA 4PGGA 2AZTA 3EGEA 4KIFA 3CVOA 5EQJB 3IYLW 2G71A 3EPPA 3TM5A 4KDRA 4PNEA 4HC4A 2G1PA 2B2CA 2ONZA 3KPVA 3KQYA 1Q0TA 1L1EA 3LKDA 3TPZA 5K0GA 1VL5A 4BLUA 4V0QA 2Z6UA 3BKWA 3RODA 4YUYA 5K05A 5EG5A 2AR0A 4X63A 2IGTA 1RI1A 4MQ4A 3IEIA 5C0OE 4RSRA 4YV2A 1NW6A 1NT2A 3A26A 2JG3A 1V39A 4DQ0A 2OZVA 2P3OA 1Z3CA 1L9KA 2YTZA 3BXOA 2OO3A 2Y1WA 3JWGA 4AUKA 5HIKA 2I9KA 3LBYA 5EPEA 2VS1A 3SVZA 4C08A 2ONYA 3EVAA 2HTEA 4RVDA 3M6WA 4X1OA 3KQOA 2PV0A 2NP7A 3DXZA 1Q0SA 4DCGA 2EX4A 3HVKA 2FYTA 3MTEA 1P1CA 2I6GA 5E9QA 4RTOA 3EEYA 2PXCA 5FA8A 3AWIA 2FHPA 3NDIA 1KIAA 4R8RA 1QAOA 2ZBPA 4M37A 1BHJA 2A14A 2NXEA 2JH9A 3SM3A 3A7EA 2AOTB 2XYRA 1R8XA 2G8NA 4KWCA 3GO4A 5DM2A 4OQDA 2P35A 3EVCA 5E2BA 3HVIA 3JWIA 3KHKA 2WA1A 3KQVA 1WXXA 3ELDA 1RI3A 1WY7A 1XCJA 1YF3A 4QTTB 2NXJA 3IHTA 4ER6A 1PRYA 3LKZA 4LWPA 3T7TA 1JTFA 4XUEA 1QYRA 3OFKA 1H1DA 3KPJA 5K03A 1NBHA 1VLMA 5H02A 4PCAA 1G8SA 5GINE 2HV9A 3QV2A 1RJDA 1X1DA 2NYUA 3TRKA 4M38A 2P40A 3F4KA 3LCCA 3X0DA 3FYDA 1AV6A 1ZGAA 5E8RA 2FCAA 1NV9A 5HFJA 1L3IA 3CJQA 3G5LA 3M6UA 3DMHA 1EQAA 3PFHA 5HIJA 1X1AA 5GIOE 1AF7A 1HMYA 2UYHA 4PCLA 3SX0A 3P9IA 1FP2A 1L3CA 2PXXA 1INLA 4PYKA 4PYMA 1D2GA 5BXYA 3OZSA 4U7TB 3P2EA 1G60A 5GOZA 2CL5A 2Y1XA 2OBFA 3CKKA 1O54A 3REOA 3UA4A 8MHTA 4EKGA 5HIIA 3UJDA 2F8LA 3FTEA 4ER3A 3EMBA 2PLWA 3MQ2A 4C03A 4KDCA 5K8VA 3MAGA 5FULA 1NE2A 5GM2A 4DF3A 3PS9A 4RX1A 4ER7A 4E30A 1YUBA 3P9NA 3SSNA 3FRIA 4OBWA 4XCXA 4PYNA 4ER5A 3IV6A 3LECA 5F2KA 1M0EA 2ZVJA 5EHIA 3SXJA 2ZBRA 3I53A 3L8DA 4PGHA 3FPGA
chains in the Genus database with same CATH superfamily
4ECAA 2PZFA 2JH8A 4I4NA 1JDVA 1QOPB 2QTWB 3O8OA 4FC7A 3S2ZA 3UGTA 1SBNE 4A0GA 1L4YA 1W88A 2LNDA 4M54A 5ANRB 2JLQA 4JBIA 3SJ7A 3UXYA 4DCMA 1IRIA 2IOFK 2X9LA 4S1PA 1D0IA 4YYZA 3Q7QA 1G9SA 2BFCA 4IOJA 5I9TA 2I91A 4QTXA 1KEPA 2ECQA 5AW9A 1H4QA 1QBGA 4PPYA 3CMCO 1FFSA 1GLGA 2XIJA 3A0RB 4KO1S 5BMOA 3HTXA 3KJGA 1GM5A 2DSNA 3U9TA 3S1SA 4FD2A 2PX6A 3Q7SA 1RWOA 4XJTA 4XASA 4CNBA 2QBYA 4HWTA 1UDBA 1PNVA 3C1TA 4LXHA 3S2GA 1S02A 4IEIA 1BCSB 1TU3A 4HN4B 5DHQA 3ZV3A 2W42A 2W4MA 1K2VN 3ZE2B 4W9NA 2AZDA 3K0FA 2IS6A 4XB6B 3H9UA 3N53A 1R2QA 3QU4A 3P9CA 1X70A 4CN8A 3CH7A 2CVHA 2GA9A 2C2ZA 1Y82A 4EJFA 2GDZA 2NTNA 3MBIA 1Y4DE 5K3CA 3TOSA 2OWEA 2GN1A 4PC2A 2PLAA 1CERA 1MCZA 3PT9A 1E6KA 1ND5A 1PTJA 1FYEA 1Y8CA 2OFOA 2J9FA 3JAWA 3Q3CA 4HDRB 5CA0A 4CLDA 2X3UA 1JI0A 3W3ZB 2OMEA 3LCRA 2W6MA 3B5IA 5KHOC 4ROTA 4W6ZA 1MU0A 3GG9A 4C0SA 2FUNB 2GF2A 4P4GA 4AJEA 4XDYA 1LPPA 2OO5A 2V7GA 3NT2A 4MQ6A 2EL9A 2GCIA 2DMRA 3C7TA 1DIOB 3TR5A 1C3VA 3NOOA 3W8RA 3O8QA 4DAOA 1Z5PA 1KOFA 4IGAA 4FGZA 3JTEA 4A6DA 2PTGA 3WXMA 5DGXA 4XUDA 1G0NA 1FE8A 4DKJA 1XQVA 4IILA 1DJLA 2QNRA 3H3JA 4C1NA 4F5WA 1C3OA 2NV2B 2CCJA 1G5QA 3CRZA 3HKEA 4Y2QA 1UBKS 4E22A 1TD9A 2MINA 3K72B 1K2WA 3D3WA 4HQOA 4MKFA 5AOVA 5I3ZA 1Y5LA 3AEYA 1FTGA 2Q3CA 3OLXA 1NWCA 1O94C 2MU1A 3BGIA 3KUCA 2OFWA 1TMGE 1VPDA 1DIAA 4HDSB 4M0KA 5AJXA 2OZKA 1Z12A 2Y3IA 4XAQA 1UT8A 1J7JA 3I2FA 4YVFA 1U0BB 4YP7A 4LZPA 3OU6A 5CCDA 1QE3A 1Y1RA 4KMMA 1X92A 3V1KA 3A1CA 1TJ3A 2EKZA 3TH5A 4AS3A 3T3NA 2QRKA 3C5CA 4IG9A 1CULC 1P9NA 5F1OA 5ADWA 1DIBA 2IX3A 3TQRA 3KUUA 2N75A 4WBSA 2FZCA 1ESZA 1GYQA 1BGVA 2ASEA 1NUQA 2JIOA 3EH1A 1EBBA 2R7LA 4Q9JA 4B83A 3DR3A 5IDVA 2NZYA 5JXHA 4KRFA 1EWQA 1G4UR 3T94A 4BWYA 3ORFA 2WP8J 4F1JA 1GGKA 2BMFA 4GXNA 3MJTA 4A23A 1U0LA 2VYVD 5ALPA 4DB2A 4ZAVA 4C78A 2IDZA 1G4AE 4W63A 3EXHA 4H7FA 3WGQA 3D7MA 3FJOA 1KO7A 1AUXA 3LUBA 2HY7A 3PNYA 4MMZB 1NOJA 2PH7A 3H0KA 1MIHA 3DDOA 4BGVA 3M2TA 4J43A 4AF8A 3CPEA 1X3LA 3Q5GA 1DO8A 4Q3KA 4RF3A 2WU3A 3ISJA 4EJ6A 1YE8A 3VNSA 1LTHR 4ZHSA 1QHNA 1E64A 1UXGA 3GBPA 3GPIA 4PSCA 5G02A 1Q3HA 2WMNB 1DAFA 3DT8A 1YBVA 3K1ZA 4HL6A 4LGVA 5EVCA 2YHUA 5WRFA 3ER8A 3GL9A 3PRJA 2EFCB 5TGDA 2CXXA 4HGPA 4AUNA 4EL0A 4R8SA 3VDMA 1L7MA 4F4IA 3URKA 1AKEA 2DQSA 3OC0A 2HNBA 1TUBA 2HA7A 2NXCA 3GT4A 4I55A 4FDAA 5KKCA 2V1XA 2Q5EA 2J5QA 3DOHA 2HF7A 3G5AA 3CG0A 4JJZA 5AP9A 3O26A 3FTCA 1AK9A 3QFRA 4I50F 4H17A 2WD7A 4LTNA 4PANA 4RVGA 2YZGA 2AQ8A 2VKTA 4WOBA 5EA2A 3SBEA 3WLQA 1SD2A 3ZWWA 1P73A 1R6VA 2J3MA 2YXEA 2XPCA 1ZN2A 2WYOA 2GBLC 3L18A 3NYQA 5B3LA 5EIBD 2AFIA 2JIQA 1CJSA 4J0EA 5ERGB 3ITEA 2JKZA 2HV8A 3AQ4A 3GH1A 2QVZX 5EIHA 3U5TA 1KMHB 2BEUA 3EA4A 3IELA 3S28A 4CLOB 5CBPA 2R1ZA 1YK1A 4HCJA 4MKGA 1KI1A 2FA9A 3MZ0A 4F7DA 2B8JA 4DYDA 2FEWB 3RS2A 3GLIA 5A5VA 3UA3A 2XYQA 1DJQA 4GM0A 2CBXA 3RYFA 1L5RA 3E7XA 3OZUA 3SZMA 1NBMD 5CXSA 2BY4A 3DVQX 3R9KA 1X87A 3JQGA 3IVXA 3TE7A 1CKEA 5BSMA 2C5FA 3W05A 4D0GA 3OQNA 4RVFA 2IXGA 2IS4A 3HKCA 4PZ0A 4BGUA 3MOSA 1W6RA 4RXMA 2QRMA 1P1JA 3ZQJA 2FY8A 3FZNA 2XQGA 1B6RA 1RC0A 5JAQA 4G2NA 2KI5A 4NPAA 1SU6A 1E9BA 5ES4B 3GOQA 2O8DB 2BMDA 4JVOA 3BJIC 5HXAA 3HO1A 3A37A 3ZWKA 721PA 4MV6A 2WWYA 3OWXA 4O33A 1P0FA 1JLLA 5FUBA 3E9DA 4REQB 5HJ5A 2G9QA 4GBED 3WYCA 4GUAA 1B6TA 4X7MA 5D3KA 3KKZA 5BNWA 3L1UA 4LDAA 3OQHA 2X0DA 1F38A 1Y3IA 4HQ6A 2C5BA 3ROXA 3UUEA 5K6RA 4NK4A 1MH1A 5ALYA 1OXUA 2A5FA 5K3FB 3TMAA 3SLKA 3DBRB 1TZKA 2Q4TA 1SC6A 2ANBA 3IIIA 2GYUA 3NHZA 4YO8A 3EOAI 1QHHB 4H27A 4KQHA 4N5HX 2DHDA 4JLKA 4X6XA 2IEZA 4ZPXA 2WV9A 3EQ6A 3II6X 4KN6A 3DVAA 4EAAA 3P4UA 2C8KA 1C9KA 1T3HA 3NWEA 2J3KA 3BB3A 1N1GA 4WJLA 2IBTA 4MR8A 4EVQA 3IOBA 1WS6A 3PGMA 1GNPA 4B2YA 3H6GA 1CB7A 1UM8A 1XCLA 1OXKB 5M2QA 2PGIA 1ECLA 3R7FA 5KYWA 1YB4A 4PV7A 4UHKA 4U4AA 1AN0A 4BO9A 1CNMA 3GJ0A 4TM7A 1MVOA 2PD3A 4RNDB 1Q21A 1XMPA 1EXVA 4GMDA 1J8QA 4IRMA 3ODPA 1E6CA 2GDJA 2DJIA 2XEXA 1U4NA 2YNMA 3K9HA 2M32A 4O8ZA 5DTJA 5JMTA 5K6TA 4Z4GA 3SSOA 4Y9UA 3BS4A 4HY3A 3FLEA 3HNRA 3GGJA 5HQJA 5D1NA 3WLTA 2BKAA 4A3SA 1H9AA 4DXHA 1BIFA 5I51A 3TNJA 3JAWB 1XRMA 5CA0B 1ISPA 2NTEA 1O77A 2WHRA 1E7RA 3EC1A 3VR2A 3DO8A 2RJNA 1XP5A 5CB6A 2R7KA 5C31A 5TMDA 3X3HA 5LIRA 3WV4A 2G9RA 3R3JA 4LE1A 4QXAA 2QRZA 5E0KB 5IJWA 4JN6B 5T57A 4JA2A 3RHTA 4UPVA 4TM8A 2X1VA 2VBFA 2JGLA 3FYUB 2E1PA 5CX1A 2Q6IA 1XEWX 2BP7B 2XITA 4IWXA 3IE2A 1AS3A 1HQDA 5PGMA 1GGEA 4G25A 1MC8A 3LU1A 1U0TA 4IV5A 3RVSA 1QJCA 2Z8XA 5FPHA 1KR2A 3OPMA 1RWVA 3CGGA 1KFJB 4RF2A 3I5UA 2FWAA 1L5OA 1N2JA 1NLMA 1VCMA 2FTKE 3AF1A 3EQ8A 2B0JA 1COWD 3GOHA 4YCAA 2AF4C 5H0IA 5A3SA 3HSYA 4GGOA 3HYRA 5I7WA 2IEYA 1XEXB 3DBHB 2QP4A 2Z56A 5D84A 3DFMA 4B09A 1OLSA 3T1VA 1J9EA 1U0EA 3HGMA 4OHCA 4NV3A 3ROKA 1U2SA 1KPGA 1U31A 4K1XA 1JH9A 1EFTA 3C2QA 1KWGA 3DNMA 4XD2A 4UM7A 4F4JA 1RWWA 3P9ZA 3BL5A 1T8RA 2PMDA 5I48A 3QNUA 3DCNA 3THOA 3TLEA 2XNKA 1IOLA 5I9BA 3C4VA 1BHSA 3DMFA 1GL6A 2G0NA 1PN3A 4RY8A 3THXA 2RHBA 4B79A 5HVNA 1ZJWA 1DC6A 3KD3A 3ELBA 4AP6A 4YRBA 4QUHA 4ADSG 3E4DA 3MRTA 4AFNA 4EX6A 3ES9A 5B1DA 3LVRE 3SLGA 1E2QA 1QQBA 1UC5B 1G64A 3CNHA 4GI7A 4Z4QA 3SEQA 3EXHB 2ZG6A 3KYIB 4J03A 5KTNA 1QO0A 1S1CA 3FZYA 4M1QA 3RSCA 3T5AA 2I6UA 3KYDB 4IDAA 1FX0B 2CF6A 4V0ME 5LXTA 4MIOA 1UQTA 3E48A 5CLHA 4Y1FA 5C3UA 5TMBA 3VOBA 4HAXA 5DULA 4OLJA 5HKLA 3G49A 4BQPA 5JQGF 1YI0A 5ALKA 2GN2A 1AZTA 3QBJA 5G1NA 3WXBA 4BZWA 3AR3A 2G1AA 5A05A 4UD2A 1JECA 1T5BA 3GWZA 1RFGE 2O7SA 3ACCA 4OIMA 3WLFA 5LB2A 4DA4A 2B3DA 3LOQA 2ONKA 2VP2A 3R6WA 1ULSA 1KI3A 1BYIA 2GRUA 2CMGA 4U7PB 4JT8A 3TR6A 3IV7A 4AQDA 1QX4A 4JXKA 1K8QA 1TEVA 3EVZA 3PITA 1PGQA 3GNTA 1I14A 4HGOA 4WESB 5GMOA 3ZI7A 5K9ZA 4KVAA 1EUCB 1FVXA 3NEYA 4TXLA 1CV2A 5IG2A 2PUFA 1JR3A 2DFKB 2WD7B 4D42A 2EFEB 1L0BA 2VUTA 1QOZA 1OTXA 3AXSA 1Q0UA 4X3PA 1U8CB 1ZUWA 5KJEA 4AMUA 3NDBB 4OXNA 2PYZA 2E55A 1HFKA 2EW1A 4BIMA 1SOMA 3FUUA 2WLTA 3HB9A 5AUPB 1CUCA 4JOBA 1NXSA 1UC8A 5FTLA 1Z8FA 2WWHA 2IEDA 4DLSA 1XJ5A 4JOSA 3JVIA 1XPJA 1GDHA 3CLTC 4JD5A 2JANA 2OAEA 1DBWA 1VLVA 3GAMA 4ZFNA 5DBGA 4GWLA 4Q82A 4WGFA 3ZJYA 5CBPB 1ZVMA 3N86A 1L1EA 3TPZA 4C7OA 4JLPA 4CIDA 4EKYA 1YWGO 2ZKLA 4YMUA 2X3FA 3OQ1A 4N41A 1PGJA 1V8OA 1HZZA 2XBUA 1PZFA 5GJBA 3O4JA 4LDPA 3AEUA 3OZDA 3RVRA 2XGSA 2JG3A 4QYMA 3AG5A 2WHQA 3NEJA 1TQ6A 4FLMA 4MLCA 5IDQA 5LZ4A 4M6WA 1HT2E 1QQ6A 1XHEA 5HA5A 1A7KA 3BSWA 2EBHX 2VP0A 4P7BA 1JIXA 4F12A 1P1CA 2A6PA 1KMIY 3JSAA 3F1LA 1AOXA 2RAUA 2ZUVA 3WQHA 5A5DA 3AGPA 4OD0A 1KIAA 4CRWB 3K9BA 4R8RA 1QH8A 3AIKA 3FOWA 4NSNA 2XWQA 1U3UA 2JARA 4PR0A 4D02A 1FIUA 2C4NA 4YCLA 3HVIA 3JWIA 3V2UA 4WKPA 2QNBA 4UCQA 2ENUA 4BV2A 5IANA 5FLXA 3IFSA 4Q3LA 1DFGA 5I7EA 3GJXC 3RUDA 1X7YA 3ED5A 1PRYA 2FG5A 1RRKA 4J1SA 4Y9TA 1CUUA 4EHAA 1PWXA 3A9CA 4PEVA 4CEIB 1VHQA 1QSGA 1E59A 2P75A 2R65A 4PCAA 4ZDWA 3WLHA 4XGIA 4B6QA 5AHRA 1YI1A 4C6TB 5J2UA 5CIWA 3L6RA 1JDBC 5KTSA 4TMYA 2RJOA 3HRKA 4Z5XA 5IPFA 1PS8A 3HSKA 4Z0NA 4DBLC 2GK4A 1YNOA 4P92A 1J9GA 3DMHA 4FKZA 4ISBA 5JZBA 4QU9A 3BSYA 1WQ1R 3QMMA 1J2JA 3WGHA 3ZCXA 1L3CA 3QVSA 2EATA 3DW1X 5BXYA 3B51X 3WK6A 4RJTA 2QP9X 1ABFA 1T15A 3CO0S 3LUKA 3Q5DA 1W48A 1H1LA 13PKA 1CZNA 3BJEA 3JQ7B 1RQ2A 5L45A 2JIZD 3A2NA 3S2IA 1NG9A 3U1TA 4J90A 1P29A 2GD2A 1A8IA 5HIIA 4WK4B 3UJDA 3GP5A 3LCMA 5JZ9A 2WM8A 4FHEA 4KDCA 3RSQA 4DLXA 1HEIA 3L9XA 5GM2A 4D4MA 1SCNE 3TI7A 2DFPA 3E1SA 3JVEA 4DBZA 3VAZA 2XF8A 4Y0NA 2Q5OA 3DWEX 4ZEWA 4JSTA 3Q85A 2B6NA 1D7OA 4KG7A 4V39A 1XQXA 2H9IA 4UHEA 5KBYA 4XSVA 2DSTA 2PJUA 2P9FA 3O4HA 2EG5A 1ABBA 4C4SA 4UNPA 3QM1A 5DHUA 4AF6A 4QYTA 4LNUA 2RBKA 1MPTA 4IJVA 1V5GA 4MO2A 2HQ1A 2ZLBA 1OSNA 5D7BA 4G9EA 1X8LA 3IEXA 5BQPA 2C2HA 2YV5A 3TW0A 2NZWA 4B6RA 2A4MA 1WR8A 2P2DA 3EF1A 3IUPA 1C30B 1YFJA 2IXDA 3IILA 3B1VA 1THTA 1UJ5A 4DDKA 2YOFA 3B6ZA 1W25A 4I2NA 2QK4A 2WR8A 4OA5A 4XLTA 4XQGA 2K7ZA 1W4ZA 2PH1A 3GH3A 4XGQA 1MJ5A 1P2DA 4D79A 5EWJA 4G36A 2B9EA 4CM8B 4D97A 3FI0A 1KS9A 4A0QA 4MRVA 1LI4A 2C4UA 4M7OA 1Z0UA 4OYRA 3SMVA 3BAZA 4M7PA 5AVVA 3HJGA 4IIDA 3ND8A 4ANFA 1L3BA 1JVBA 3IX7A 3PUIA 3U62A 4B3BA 4H16A 4P80A 1PJ4A 3LPMA 1JWLA 4YRGA 5SZIA 1ZC3A 4IZ6A 2YW2A 1I36A 3P27A 4JYMA 4WFKA 1M0SA 1F6WA 1HE1C 4KE6A 4RKYA 2IKSA 5FNVF 5IC4A 3KC2A 2P0YA 4CEJA 3TOVA 5JI3E 1QQ7A 3BK1A 2YQZA 4GX5A 1N6OA 4M21A 3U4MA 2IHVA 2WHYA 2JW5A 4IMPA 3LDHA 5AJZA 2EEZA 2JLWA 1AKRA 5CDFA 5T8KC 3N7TA 4PHGA 4NOLA 3N2YA 4FDUA 4QPNA 4IEFB 4X5OA 3ZIAA 4G89A 1V7ZA 2M6LA 3EDYA 4P5DA 1USUA 3QPWA 4B43A 5KVAA 4BBAA 4KTVE 1T9ZA 2QJTA 2QRVA 3EJ6A 3KB2A 2R6CA 3QLVC 3PR3A 4UM9B 2WYIA 1H5UA 2BDEA 1XKQA 1MC5A 4Y0AA 1FYXA 4AO6A 2RONA 1A7JA 3PF9A 3SE7A 3ZJTA 4LI3X 5J4KA 2ACVA 3ZDDA 5IVHA 1YKGA 2DHCA 3BD7A 2QSUA 2XGJA 3M1AA 3BL8A 4RMNA 2Y8EA 2GI4A 5BOVA 7YASA 1P81A 1QRDA 3SZGA 5JOQA 2QJOA 4XM2A 3TS1A 1OH5A 2UYCA 3GFGA 1R4NB 4P31A 4LIPD 2OV1A 3WFZA 3ZDAA 3EDQA 2KWIA 3AB7A 1TZMA 4PSVA 2YHSA 2V74B 2QRPA 2X6RA 2QD1A 3H7AA 3UHFA 2HCTA 4G09A 3P0JA 1FUIA 4LY6A 3WWPA 3VYRB 1KORA 2R68A 2YJGA 3DLPX 2C4VA 1R9GA 4HYTA 4YMSA 1V7PC 2VJOA 1R3DA 3OCVA 3PXDA 1I3MA 2BHSA 1IM8A 1T3SA 2NOAA 5L40A 4H0FA 4TGLA 1EP1B 1YSCA 2OBMA 3M8KA 4JUAA 2W6QA 3RM3A 3WLIA 4DLRA 4C7OB 3DG9A 3LQ4A 3EOZA 1MZVA 4QTUB 3VHXA 4WMLA 2H4WA 1JQAA 4FHZA 1VKOA 2PMWB 4MMYB 3VPFA 1EJ0A 3PLRA 1UH5A 1WP9A 3AEUB 3MGGA 4Y1GA 1B6SA 3OPVA 2ZIEA 3H13A 4RYLA 5DYTA 3ZE9A 1DTWA 2P62A 1GEGA 4D25A 3OHPA 4X6UA 3MHTA 4NP6A 5DX8A 2WWVD 3OOYA 1HQKA 2ZI9A 5EJ7A 3MW8A 3KVOA 2SNIE 4Q16A 4BO5A 3DDHA 4HVTA 4WCDA 1KI4A 2CV0A 4YRJA 5K8JB 3NKFA 3QW2A 4TMWA 4BEVA 3ZTYA 2LP4Y 2OORC 2QN7A 2Z43A 4GPAA 4PZZA 3W9BA 3JARB 1VJGA 2NO0A 1GUDA 2JAHA 1A77A 1D8TA 4F91B 4D26A 1Z6XA 3IQEA 1JXMA 4BDTA 1IK6A 1XL0A 2GBPA 4K8OA 2HBQA 2B4KA 4LHVA 4TS1A 3WA7A 1QGAA 1GO2A 3KL2A 5DMXA 4A03A 3U44B 4YV7A 2VNSA 1HYBA 1OIVA 1GQ2A 4MYUA 2WVAA 2CLMB 3OT1A 4HFJA 1VBKA 2XRFA 1FRZA 5BV8A 3IIEA 5FL7D 1USIA 4XIYA 5MGBA 1UK8A 3GD5A 1KRWA 5SYMA 1XE3A 1J1ZA 2GK6A 2I1WA 1SKYE 3ONEA 2VSOA 2Z4RA 3ZVLA 5HKKD 1N9ZA 2HRZA 3BZWA 4XARA 1I7PA 2AJ8A 3F73A 1RMQA 4RBNA 2EDAA 4JJ8A 5ALWA 3FPSA 4RVSA 5IKEA 1XNGA 3I2GA 3OZFA 3CUWA 5H68A 4LOIA 4MWCA 1LI5A 3EXFB 1T0IA 3V33A 1U8YA 3PRHA 3HDJA 4P7KA 2PKRA 1YNSA 2WT4A 3WDLA 1YTUA 2ZK7A 5DCWA 4FONA 4ONEA 1EFVB 3IB3A 1R8YA 1PR1A 3G0DA 1FU8A 4INAA 4PM4A 5DWVA 4EFDA 5FT9A 3KUXA 4JELA 4ZRNA 2UV8A 4WNIA 1XB2A 3LX6A 4JYBA 1XFDA 4EW2A 2JF0A 4D4HA 3FI9A 1IXRC 1EG2A 3CEPB 2ENWA 3NNSA 4MYTA 1Y5IA 4XFKA 4MVJE 2CZCA 2VYND 1QH9A 3ACDA 3DEZA 2A0XA 2ACWA 4C89A 1IBCA 2G5PA 3Q8MA 4KHZA 3JZIA 1F5NA 1QG0A 1L6RA 4IZIA 4WZZA 1X0VA 2AS0A 2F48A 2GLXA 3CWQA 1JI3A 1GCUA 2O7VA 3A3NA 3O7MA 2PBFA 4RACA 4YREA 1DP4A 3SXPA 3G23A 2YN0A 2A8YA 4MRNA 4XWGA 3HB5X 2RGGA 4ZI7B 1RM3A 4J1NA 4OFXA 3TZLA 4BQSA 2BHTA 1UDCA 3G0IA 4ZHQB 3QVJA 2A9KA 1X1BA 4EABA 1HR0B 1VLQA 3AKYA 2I3BA 3OF2A 3A6LA 3Q8WA 4JMPA 1DNPA 1MV5A 4MR7B 4N8DA 3WRYC 5FUMA 4MQEA 4ZK2A 2FPGA 1DQSA 4F60A 4F6RA 1CS0A 1UXIA 2I2CA 3U31A 1U6KA 1QZ3A 2AYXA 2FEXA 3HMQA 4KK4A 3IKVA 1N5OX 3C85A 5BQ5A 4I1OA 5JCPA 3F8WA 3ZD6A 4GLBA 2X8BA 3IOMA 4WJZA 2GKGA 4EPRA 1PAUA 3L8CA 1ECFA 2Q3EA 3KSZO 2PL9A 1XTJA 1CPYA 1XF9A 3P0EA 5FUYA 3ZGLA 4EF5A 4F04A 1VKNA 4RMIA 2DT5A 2H29A 2WW8A 3IUMA 1P1IA 1E66A 2WFMA 1VIAA 3KOOA 1YUNA 1ZRMA 4YCNA 2C20A 4RHEA 3KCNA 4KWTA 4CEJB 3E1GA 4EI9A 3PJGA 5KYVA 4PX5A 1QC5B 2HHCA 3MIIA 5DHAA 3STUA 3ZNQA 3FUCA 4EZEA 3ZOZA 1UQRA 3FUWA 3I2KA 3LLVA 5AI8A 4LBZA 3KLOA 4G4JA 1NXXA 1W5FA 2DUMA 3UJ6A 4ZYYA 1NBMA 1M7GA 3RASA 3SXUB 1ODFA 4HNAA 2EJBA 2AMVA 3DE7X 1T1IA 1WZUA 1X7ZB 2BMEA 3RT7A 2X0NA 4WT7A 3VO8A 5JXWA 1AO3A 3BHJA 5K0EA 1WL8A 3DOJA 5K0CA 1Q91A 1OFVA 1SCDA 2JJMA 3P2KA 9ATCA 4YJ3A 1HLFA 5E1BA 4JZKA 4L3OA 3QPDA 3TCXB 4HD8A 1YJQA 5CNJA 5JSZA 4NNOA 2IY7A 2DPLA 3Q72A 5DI9A 3WTCA 1XMIA 4LEIA 3IA7A 4OA8A 3AY0A 4OGWA 1IZ7A 2OCKA 3FH0A 1WNTA 5A9RA 3D2CA 4PG8A 2HA3A 2XMBA 2QL9A 3BEDA 3STTA 1XOIA 4ZYWA 2OLKA 4URYR 3PT5A 4AUEA 2XUDA 2DEUA 4LECA 3J7AC 2NO4A 1YDGA 4YGYA 5HG0A 1M6VB 3V7NA 4ENPA 4DSAA 3P9PA 1JQDA 2W93A 1IPFA 3DNPA 3JY6A 3LI2A 1ZGCA 2Y2VA 4Z8YA 1QRRA 3RIYA 3KETA 1N2SA 1OE0A 4WFJA 2OV2A 5FD8A 4XIFA 4JI1B 2DPHA 3U2QA 3NHRA 5ALHA 2AE2A 3ADBA 3VZSA 2A5YB 4YRMA 4ZKEA 1I1QB 1UDAA 4CMAA 1RLOA 2WA2A 4HPWA 3V8PA 3HGTA 1EXDA 2FP3A 5IASA 5ESXA 1IL0A 3WGOA 1MO5A 2NUAA 1CY6A 1K6JA 4OJQA 4OHMA 2PT7A 4UMDA 1QHEA 3IQDB 3OKAA 4JR0A 4BY9E 2WKWA 2A7QA 4X7BA 3V1UA 3BZUA 3B78A 4HYEA 3PLAE 1WWKA 3B7PA 4L5AA 4EJ0A 1AX9A 2NNWB 3ZVRA 1ZMRA 3C3CA 3CVYA 4M87A 3NT4A 4BE4A 4MKRA 1JALA 1VHTA 5JWOA 1NAHA 1RI2A 4F9EA 1Y1SA 1BEEA 5JSFA 1TK3A 4ZAYA 2ZBDA 1TD1A 4MJLA 4BRUA 5KNLA 4QASA 3CB4A 1MOQA 3SBOA 4BFUA 4QO8A 1JQLB 4RA6A 4AW9A 1HDCA 1KO4A 3QFTA 1RWQA 1JHRA 2VAPA 4DV4B 3DLBA 2CMKA 3JV7A 1P45A 1OBFO 4FTWA 3T3GA 4N1AA 2QRUA 2Q8NA 1AA6A 1PEDA 4JLMA 2PUGA 1SHUX 4JXZA 1CX9B 4NXNB 4HGNA 2P6UA 4DHWA 4BX8A 5JI2E 3ZDXB 2XYVA 2PDAA 1J22A 1VE3A 4CV3A 2O7NA 2XBLA 3EBPA 4MYRA 4IRXA 3HS3A 3KQHA 2P4SA 3D6JA 1SBHA 3A25A 4MQFB 2V6GA 2O8EA 3OM8A 3RRMA 2E9SA 4DADA 2O4UX 3IUJA 2H9AA 2QZPA 3T06B 1J25A 1H3NA 1Z5VA 1WKVA 2BKLA 2ZTUA 1X1TA 4K81B 4XQEA 1FJHA 1G8KA 2HGSA 2O20A 4FHFA 1DXQA 1DS6A 2ST1A 5EJFA 2WWRA 5BSGA 1XTSA 4I4TA 4P53A 1P2VA 1C9YA 3MVEA 3ZWXA 4F3RA 4N54A 4JR1A 5FIUA 5HDBB 3LKDA 4EW6A 2H2IA 3T52A 4W8GA 3TWOA 4NH0A 4CTMA 2E4YA 2XUQA 5F4ZA 2YWRA 2FH5B 3E3AA 3GLGB 4W1RA 5JW6A 5I7RA 3AR5A 5C0OE 4N48A 5T4BA 3HR8A 5AKGA 1F8GA 3ENQA 3CLKA 3F96A 1CUZA 2YQ4A 3M1YA 5JV5A 3S8YA 2WJ3A 5DLDA 1IH8A 3CEJA 3KKOA 1K27A 1I2DA 3O8RA 4BECA 3MWJA 4LZWA 4FJ2A 4LYYA 4QYSA 5LZ7A 4CM1A 2AYYA 2IYQA 4X1YA 4I5EA 4L6AA 4ENTA 2VT2A 4IFBA 2MSEB 3DAOA 3LD9A 2IHUA 3MTEA 5CFRA 1TT7A 3K70C 3L0BA 4LXUA 2AFIE 2J30A 1HYHA 2PXCA 3HBFA 5FA8A 3JQ8B 3WGZA 1QS0B 4BZZA 4DCSA 1AH2A 3WL8A 1UMBA 1WHTA 2GEDA 2JS7A 4KITB 1WTCA 3TECE 5AVTA 3UAOA 1YQXA 3H1FA 2HPZA 4F4HA 3IBFA 1XCPA 1G66A 1CD5A 3S8EA 3GLIE 1EFLA 3KWMA 3NGXA 1RI3A 4PRLA 3OEHD 5FOSA 1OFGA 5F7ZA 4N3AA 4QOGA 2PWBA 1FFGA 1DEKA 3MLEA 4TTSA 4LWPA 4YJHA 1JTFA 1A5SB 2ZXUA 1H1DA 3KK0A 4REOA 1UMCA 3O9VA 5I9MA 5TT0A 2QM0A 2GBIA 4X1IA 3U4AA 4BLPA 3WWDA 4TRMA 1I7SB 1QB8A 4BP8A 1QVRA 1PG2A 5EHNA 4IF4A 1AU9A 2FNAA 5C52B 4JGBA 2IPMA 3NM4A 5DFAA 2BISA 2RGAA 1A1SA 3ADOA 3DZHA 1U2PA 2QHXA 4P34A 4RELA 5I4BA 5IULC 1F2TA 3NRBA 4IIHA 5CT8A 1ZN7A 2F90A 4UNRA 2OQ2A 3IJRA 4ZOEA 2R1TA 2HW8A 1PSDA 3I6MA 3AY3A 4AP9A 2UDPA 1OC2A 2ODBA 3I34X 4GZ5A 3FFAA 5LMNB 3OVMA 4NBRA 4AWXA 3FTEA 5KEIA 5C34B 2AQIA 2CVFA 2XZDA 5K8VA 4L73A 1NW4A 4G23A 4J7AA 2IT1A 4RHFA 3PXGA 2AB0A 2Y27A 2QI9C 3PC8C 5E9AA 5C32A 1ZMOA 3HB7A 1E1RD 5EHIA 4DGSA 1K75A 3O91A 5AKZA 5EP4A 3L8DA 3RVPA 4EB3A 2EJTA 5ALNA 2VQSA 3G5MA 2QW0X 3ZHXA 4M8IA 4O2RA 4QBHA 1BU8A 4HLUA 1DBPA 3KZOA 4L72A 4OBEA 3TZQA 5ITSA 5M04A 1W94A 1NT4A 4IJ6A 5BSUA 2JBAA 5IXYA 1H2HA 4IZOA 2FX5A 2AT1A 3HABA 2XD9A 2IYWA 2PKWA 4YUVA 5A02A 2RGDA 2QW1A 3H2GA 3NM6B 1FRFS 2Q29A 2VP9A 3BDAA 4HYQA 5E7JA 1FU4A 4FFSA 4RLQA 5JWHA 4MUXA 5AKYA 2K87A 4CDNA 1HE3A 4RETA 1ECPA 3A6PC 4EFNA 2QPTA 2W9XA 5C4IA 4R3UC 3GZTB 2V65A 3A1EA 4JT2A 3LXRA 1XQWA 5CVEA 3IUNA 1FRQA 1X9HA 2E2WA 2OESA 2R84A 1BE0A 2IU6A 3IE0A 4Q3NA 3S1AA 3ZGVA 1MT3A 4QZVA 1QZZA 4WSOA 1D6MA 1WHSB 4HWKA 4OO3A 4QOHA 2F00A 5HJ2A 5K0NA 2HXSA 3TOZA 2C1EA 1XZAA 3W2GA 3G2HA 3O1IC 1NBWB 1XMQB 4LX0A 1ZM7A 1ZITA 2Y4NA 1F3OA 4W9RA 3TINA 1Z4IA 4OJYA 2H31A 4MYCA 1C3EA 4FGLA 2CE2X 3I2JA 4PX3A 3AFOA 4FDVA 5DTIA 3SHQA 4LXXA 3AI7A 1NVMB 4MP3A 5U1PA 1G8GA 1RI4A 1NI3A 2QRJA 1OIXA 2YASA 2PO5A 2FV8A 1GSIA 3FPBA 1RRVA 5KI6A 2CNOA 3MUFA 1XHFA 4FX5A 4MUNA 1A72A 1DXHA 1NZDA 2AZMA 3DVRX 4Z54A 4PQYA 5CG1A 1E6LA 3FMOB 1FLDA 2Z4SA 4F1WA 5AR1A 4Z51A 3QXJA 3CRRA 4U3JA 1UK9A 4A7PA 3L0SA 4WHMA 3RBXA 5CCEA 3L7NA 2FX2A 4AWAA 1WUHS 2YFYA 3IALA 4MUIA 3KDSE 3ABIA 4M1SA 1RM5A 4C0JA 1M6WA 1V6SA 5BUSA 3KSRA 4UUBA 4CKBA 5CXUA 4M46A 3RK4A 5L3SA 2JGMA 4FIDA 4NG5A 4XJSA 4YAUA 2EVWX 1TIPA 3F90A 3G7UA 1SXPA 4LRYA 2I80A 1P7PA 3EQ2A 4K2AA 4L5YA 4B3FX 1SVSA 3V8EA 3BCRA 4AY5A 5A1JA 4EM6A 1H69A 1I4TD 1YU9A 2WHEA 1Z2NX 1GFIA 2JCVA 2IYSA 4CQNA 4G1EB 2C3OA 4TLMB 3BWVA 4EHNA 4ZJUA 2QRNA 4DDMA 1O4VA 3TUIC 2O8EB 2YUIA 4EA6A 3V1LA 1UZUA 2N1BA 4EI8A 2ZPAA 2PD6A 5NLLA 1WCYA 4PYIA 2YZNA 2ZJ2A 1FTNA 1Z6AA 3BOSA 5HK8A 5DNWA 5EUQB 3A9TA 4KVZA 3BGVA 2NIPA 2RH8A 4L95C 4ARZA 3CX6A 1R16A 2QTBA 1SUPA 4ZQIA 1N7JA 4BMYA 3LUPA 2DWCA 2P8SA 3M2PA 1RQGA 1QG4A 1T1JA 4I4TB 4M22A 4NENA 4B48A 5ABPA 4HXEB 4K9OA 5FDFA 4C2UA 3A4LA 1P39A 2C5GA 2OV4A 1M2VA 1P3JA 1JQ5A 5KYGA 5JBNA 1NX6A 4M0FA 4BKOA 5K01A 5CW1A 2IVFA 2FG7C 1O5OA 2ZWAA 3OG9A 5L9AA 2AOXA 3DTNA 4X66B 4IH4A 2BFDA 3TLYA 1EUQA 5EJ6A 1JZQA 1CFZA 2KHZA 4MB6A 3I6BA 1IFXA 2G06A 1VRVA 5AJWA 4ZCQA 4GVXA 4B35A 3T3MB 1EWKA 1Y7TA 2DXIA 1HDOA 3SWWA 1F60A 1DEOA 1JR3E 1KC3A 3P0HA 2YMLA 3I32A 3G13A 3EUWA 4NKRA 2ZSBA 4W1PA 1XPRA 2JBHA 2M1XA 3F3YA 4C0WA 3K6KA 5K8IA 1GQFA 1OYVA 4CF7A 2QVXX 3K0CC 1BDHA 3HCOA 1QFMA 4JJGA 5LQNA 1J2EA 4BJ1A 1HE8B 3R7DA 2RGWA 2PRYA 5ICEA 2DQZA 4HQLA 1CQJB 4RK7A 4E12A 3RT9A 1BKDR 1N5MA 1O3YA 5FJJA 4OHFA 1UUFA 3BJRA 2F7SA 5JDCC 2D6FA 1E1NA 5FV4A 3PNMA 3R0VA 3E5HA 4TV9F 1UPCA 6REQB 1MRZA 1VI2A 3CH4B 1FYVA 3DDZX 4WKNA 3WFJA 1CR2A 2D54A 2JVIA 4Q4JB 1C9MA 3LHSA 1YV9A 4Z3KA 1W8DA 1S2OA 1ZIDA 5T41A 3TZEA 3UAWA 3V55A 3BD8A 2LPMA 2NWQA 3GXBA 1KSGA 1GZ3A 1T9DA 1QR2A 3C3KA 3K94A 4ZVTA 4MROA 3RVMA 4ETWA 3K6JA 2Q5CA 2VZLA 4N6GA 4ZZIA 3PQ6A 1MJGM 2ECKA 3NS7A 4RXTA 2I62A 3T7KA 3TJMA 1N3BA 2D00A 3EASA 1T3ZA 2GD1O 3UXHA 1UC4B 1D2AA 1Y8QA 3BTOA 3CZQA 3I04M 3NIGB 2GK3A 3SZ3A 4WWHA 1JXQA 4CETA 3IO3A 2UAGA 2ZJ4A 5C5CA 1XNHA 3DPSA 1W5SA 3V4SA 3NUGA 4QNMA 1V2HE 2C99A 3PCRB 4EWLA 4JVNA 1F2TB 3SR3A 1O94D 4TN1A 1JMYA 2BSXA 3UFXB 4H3KB 2X0JA 1NAIA 3HR4A 3U3DA 1B26A 5DBHX 3HA3A 1EVQA 1LJLA 3U3JA 4HH3C 2WZQA 4O02B 4Y30A 5A3VA 1WUTA 5HEKA 3AM1A 3KQPA 3LXMA 1XDUA 4XR9A 4JROA 4MA4A 5H1YA 2QSJA 4UTXA 3BH6A 2VTVA 4UBLA 1RFLA 5B7PA 2W2OA 3AERA 4RPHA 3WADA 3G2IA 2WD9A 4PY2A 4PS0A 2C78A 2UZ3A 5CAEB 3ADKA 4B6SA 5IYZF 4DTIA 3AFHA 3AV3A 1SVUA 3DR5A 1FMCA 3BDVA 3H97A 4HQNA 1T8PA 4NV1A 4YAIA 1WBDA 2PFSA 5DSTA 5BXQC 3EIHA 3I62A 4E5DA 3BMQB 4JJ6A 1W0JD 3L40A 1PT5A 5E6RA 2HSGA 1PCXA 3I37X 1H4VB 3D9QX 3RTAA 1OH8A 1MO4A 1ISHA 2BUCA 1OXTA 3K7EA 1DFHA 4AICA 2OB1A 2QVBA 4JC5A 2OM6A 2XB4A 5HZKA 1RYMA 2OXCA 5HWSA 3GU3A 5C81A 1GVHA 2H2DA 2JBAB 4F96A 3KZCA 3E3MA 3AX6A 3GVHA 4UHBA 4KCGA 5F77A 4C6SA 1MENA 2ZWMA 3DL2A 3N70A 4OB6A 4UATA 3VZPA 3X1XA 1SA0A 2XNCA 3MD0A 1SQGA 4R3WA 3ZXYA 4IV0A 3GC6A 1VYVA 2ETVA 1IVYA 4RXUA 4RESA 2HB6A 1T1GA 2B9VA 5E6SA 3K2BA 1YDFA 3GQBA 3SQNA 1HE4A 2H0RA 1YVPA 1IZ8A 5HIMA 4ZYUA 1CJKC 2ZJ7A 4BNIA 4FYKA 4PSAA 1IU9A 1S9HA 4P4LA 1E6EA 3AINA 4GAEA 4Q3EA 4JP1A 3V4FA 2ZJ1A 5CVCA 2H4YA 3A6EA 3DFUA 2AI1A 2PKYX 2A67A 5K09A 1Y8RA 2O1EA 5JNSA 2RE8A 1E1MA 1HG1A 2H0QA 2NV0A 5DEOA 4BXOB 4LHXA 8ABPA 5KJFA 1BXGB 2VK1A 3A3PA 2G8LA 4DJTA 5HKKA 1A95A 3GPLA 3K32A 3ZDZB 2HUNA 3GEDA 2Y6UA 3GEEA 1UPAA 2ADOA 2PRSA 4QHSA 5I9IA 3RS0A 3PWSA 1M1UA 1RTTA 4AG5A 3AETA 1CJVC 3W6OA 1YQQA 4G6ZA 4QTZA 5DU2A 2YMMA 3H5RA 5COAA 4FYYA 4NLLA 3SHVA 5TLSA 2PUCA 5AD1A 3RC3A 1K92A 3NH6A 4FJ0A 4KI0A 5A7HA 3V4VB 1FNNA 2F8MA 1SBYA 3MD9A 1ND6A 2I2FA 3CZPA 1TAUA 1VSQA 1NN1A 2NZUG 3P0IA 1LZLA 4DUYB 3C70A 2IP1A 1W6UA 1JT2A 3NC1C 5KCZA 1BHO1 2JFGA 1AKQA 2IV2X 5H9VA 4CKBB 4Y2JA 5JWRA 2YJTD 4FGSA 3L8EA 4Q6WA 1HT0A 1TEXA 4RU1A 4IR7A 4JT4A 3QMWA 2QTVA 4NVRA 2WVHA 3IUSA 1L7PA 1T2CA 4FFDA 1YMVA 3FNIA 2CMHA 5A06A 2OSVA 2HADA 3LKBA 3OKFA 1ZI8A 3PHIA 1KDVA 4L85A 4CMIA 1HDRA 2D3TA 3AWDA 3BHMA 4FUTA 4CL3A 4EKIA 4IHQA 3KKNA 2CEKA 1QF7A 4P36A 3TFOA 3B6JA 4HGQA 5CDFE 5GZ1A 2P2LA 4DUGD 4CEHB 1E8MA 1XWWA 4LQ4A 2MSKA 3R41A 4OCZA 1U63A 4RK6A 3GRUA 5EIWA 4AY2A 3ABSB 4QUGA 1SQFA 1VXRA 1XUOA 1AHNA 4F21A 4F71A 7MDHA 4PINA 2FLKA 4QYIA 5DISB 3PL1A 5I7HA 2Q27A 1XDWA 1YRHA 4BNDA 4XCVA 3REFA 1LK5A 1PD1A 1ZQ1A 3DMTA 3GPBA 1S3IA 1WRBA 3PWKA 1RAFA 4OHVA 4PZUA 3D2BA 3EXAA 1Z8HA 3L1KA 3GJQA 4NENB 4M7RA 3KELA 2VPWA 5CH5A 2EFJA 1M2VB 3ZY3A 4IV8A 3A4IA 5TQ2A 3GD7A 1Z6ZA 1WUIS 3UJCA 4NCHA 4KO8A 3B20A 3P9YA 1Q15A 1R0LA 2IF0A 2QD2A 1T5DX 4EUKA 4N0PA 2GNPA 2DM6A 3ON5A 1BG6A 4NHEA 3A6HA 2G6BA 5I8WA 3JQ6A 3QIVA 4Y7CA 3TQIA 3T1HB 2HT1A 1VB3A 3L7YA 1AQYA 1LTKA 1U1IA 4ED9A 3EZLA 2H1WA 5B3JC 1CSEE 5SICE 2VC2B 1SKMA 1EFKA 4PR3A 3F98A 2IYZA 4FE7A 1L8XA 2WK1A 1H5QA 2AFHB 2HU5A 2YS7A 3CLSC 4YAJA 1XELA 2G1UA 3BXHA 3NHUA 4Q7LA 4IJ5A 4RPJA 4RE5A 4DANA 1A9TA 4OATA 5CBKA 2ARKA 2Q5HA 1A8UA 3AL2A 3B38A 5AYVA 4EYGA 5JD6A 5D01A 2O2ZA 5A0TA 2Q1UA 3UBTA 2Z9CA 4NBWA 1ISIA 2UXCB 1GN9A 1MO3A 1YBHA 2QLTA 2Z2ZA 3V8NA 2W2KB 4UEWA 5LKAA 4EG8A 3KR1A 4CMHA 3UHJA 1GP2A 1FS5A 4CE6A 3A6ZA 1JEOA 1QDLB 5LMCA 3LH5A 4F97A 1TM3E 5IHXA 3D4PA 5CU7A 2HXYA 2PX5A 1OGIA 3HUTA 5JATA 5JRDS 1NN3A 3TLMA 2Z5GA 1G1MA 2IX9A 4LDZA 3LUFA 1REQA 2AZTA 2C4TA 4EYKA 2BVNA 2RGYA 2ZI3A 2VUHB 1QHYA 2IYEA 3GA7A 4BPRA 2WWGA 1UKEA 1WW3A 2E18A 3PF8A 2NVBA 3B8HA 4EB6A 4OP2A 4UNIA 3OLWA 2YRFA 1L1RA 3IEIA 4E07A 3H9BA 4G5RA 4GT1A 3U0BA 1FNBA 5JD5A 2FSVC 1OZ0A 1QKJA 2DTDA 4MVYA 3UMFA 4EJSA 3MPOA 1TLLA 4R98A 4W7IA 1IN5A 5JMOA 1BWRA 4HZUA 4NBKA 4UVGA 4D46A 4YUAA 1LBEA 1I13A 1A97A 3RUPA 1BMQA 1S1MA 1XVIA 2QUJA 4OY3A 5L7WA 2BTQB 1E5DA 1LRKA 3EFOB 2ZBVA 4L5BA 1TJYA 4JWTA 3CX4A 4H4EA 3Q0EA 5JHHB 4WY2A 2GN9A 5EE5B 5BUQA 3AI3A 4RLFA 4DRXA 4HLNA 5F2EA 5KKAA 2N46A 2XI4A 5LKRA 3RBZA 4A8JA 2OXFA 1M2KA 1T6ZA 2HO4A 2JH9A 3H17A 2C1ZA 3T61A 4JQSA 1ZU4A 2IPLA 3KYCB 2EW2A 3U3RA 2Q8QA 2GCEA 3QJ5A 4H18A 3VO9A 5E6RB 4BNMA 3USCS 5HW0A 3O1LA 2FFBA 4JLJA 5AVJA 1Z2CA 4Y6PA 1HQYE 2E21A 4HAUA 4LXGA 2NXJA 4Y9RA 3ZHCA 1QZTA 5BV1A 1NM5C 1XV5A 2GZAA 2W2XA 3L7KA 4RQAA 5LUBA 1TAQA 2C2BA 3WRXC 1D9ZA 1E58A 3ZCTA 1QBKC 4E3WA 3R5FA 4UUAA 3CISA 4K0RA 1G8SA 3HRHA 2XCSB 3CVUA 1BH6A 1X1DA 2RHHA 3MWKA 3UB3A 3CLVA 5JTUA 3QJYA 3IP8A 4G0PA 3C6BA 4WY8A 2F55A 4N7JA 3RT1A 3BULA 4UFNA 5IK2A 1K4MA 1E96A 1O08A 3QWIA 2JLXA 2EW8A 2EYUA 1A5TA 1XKTA 3AF0A 3LY9A 3QMPA 2OGTA 3CZCA 4O4HA 2HLDD 4R54A 4YR7A 5L7TA 1FW6A 1E6MA 4ALNA 4EG3A 4PYMA 1DOHA 3HJNA 5IM4F 1D2GA 1ZSVA 3V80A 4NK5A 4KI7A 1NUAA 1PWYE 1G60A 3SOPA 5EHXA 3C6ZA 4F1KA 2DU8A 5P21A 1GZ7A 1SCQA 4H7DA 4C3ZA 3E8XA 4XVCA 3UG6A 3REOA 1DJNA 4ROSA 1RRCA 3CS3A 2F8LA 3KRTA 3NUQA 3D2AA 3QLUA 1YZFA 5FBWB 3MAGA 4Q66C 4OHPA 3CLTD 3TZ6A 1BN7A 1DAEA 1SOUA 4UBMA 4BGIA 4XYLA 2BGKA 1II0A 1HTBA 3OF5A 2HA0A 3P9NA 8ADHA 5BUCA 2L2QA 5EHQA 2A5LA 3MQ4A 3IV6A 4JY7A 2SBTA 3CVVA 5ERXA 2PZBA 1ISMA 1WXFA 2JLSA 2RKBA 3ZWYA 1E3LA 1ZY2A 1W0KA 4PGHA 3FPGA 3G2NA 3HLKA 2Q4DA 3OLYA 1JEAA 5I4CA 3L6UA 3QPUA 4ZEVA 2H17A 4IIXA 5G0VA 5CFOA 1S6YA 4BFLA 5JCJD 2XXAB 4OLFA 1R18A 3D4OA 1U9ZA 1JEYB 2VRBA 1PZNA 4BFVA 4HEA6 4BFTA 1RNLA 1TYBE 3EE6A 4PHFA 3USES 1V11B 3C3YA 3OZAA 3RNOA 1XWFA 4U2FA 1NMSA 2CJXA 4WLVA 1WU7A 3WGTA 3HWWA 4TS4A 1KEKA 5JXIA 3WIBA 2OHJA 5F52A 3JWJA 1UIMA 3UHOA 3EYWA 4F86A 4C4RA 2YHBA 4FKMA 3SM9A 1I3KA 2XD4A 1TJ5A 5ER9A 3F2IA 4R81A 1NRXA 5ITWA 1RTKA 2OHFA 4EX7A 1NBME 4U5XA 2XXJA 4FI3F 4E46A 1D0VA 1N3LA 4ZO9A 1TYEB 3W5SA 1IN4A 1XGKA 3B5EA 4Y0VA 5E9JA 1DU4A 4IHJA 2D5IA 1N0WA 5AHWA 4RV9A 4ALJA 1LF0A 1RI5A 2J59A 1YKSA 1AGPA 4MW0A 2I78A 2FZEA 1QPGA 3TO5A 1DG1G 1MRSA 4ENQA 4JBNA 2YJ5A 4HFMA 1GITA 1E99A 2DHEA 3I5MA 4OP3A 1Z45A 3UTCA 4DMRA 5JQWA 3HCWA 1TZJA 3MWDA 2ZBQA 1QUFA 3FNHA 4O2AF 5ALMA 3UVEA 1V5FA 1NYRA 1E0JA 3KR2A 1VSTA 4KLRA 2JJ1D 3FTNA 2WTUA 3U7FB 2G17A 1U0SY 1V2GA 3ECCA 3T1OA 3G1WA 4C0KA 2OCYC 4DSTA 1WPGA 1D03A 2V7XA 3G8BA 1M6YA 4TVKA 3T35A 5J4HA 5F21A 4C3VA 3ONFA 1PX0A 3PX2A 1S3FA 2BEWA 3COPA 2OE2A 4ZT4A 3DUFB 2CB0A 3G8AA 3W2IA 1FNSA 4TYPA 2A0YA 5LYYA 4RA9A 5NULA 3HKBA 4KQMA 3DAPA 1Z0AA 2BONA 5JFGA 4XW2A 3H9QA 2WJJA 1O7JA 3DD1A 4KEAA 1KJ9A 1NMXA 5DHSA 4C5AA 5ESRA 3Q12A 3DDUA 1I9CA 4DJAA 2O1WA 4P6VF 2ZYGA 3NGMA 2DAPA 1UEXC 2DUUA 2VO1A 2XUKA 1CG6A 3A3YA 4WCFB 4MLPA 2EKLA 4PE5B 4BGDA 2VEOA 3H42B 4MWTA 5AUOB 5ILGA 1JIUA 3OY7A 4L8YA 2DBYA 2BFFB 4EGCB 3A10A 1ZWKA 4XD7A 1PT6A 1WVMA 1XTPA 2OM2A 3KJZA 3QV1A 2BFMA 4KGVA 1BS1A 4KL8S 1I6MA 4YDSA 2FP4B 3WMXA 4G0OA 1ZXBA 3H1PA 4PBRA 4XM0A 2QG6A 1M66A 1SCJA 5IAAA 3QOFA 4EI2A 1T3GA 4KZKA 3ZZ0A 1JEDA 4BFWA 1W4RA 1PNOA 4NWIA 1C8LA 3KEFA 3KB8A 4FFBA 2XQIA 3OEYA 5AVZA 3RLIA 3GRKA 4EPWA 4RVCA 4MVWA 2YN4A 3FMVA 4EJSB 2UYOA 3I92A 3M6MD 4JGGA 4P83A 1RHRA 5ENDA 2J8ZA 4L2IB 3P20A 1XXHA 4DSOA 2J3JA 1C4OA 3CUUA 4P3YA 1ITZA 5D3ZA 2MHCA 1CZHA 3AILA 4IIBA 4BNFA 1IJEA 3BWYA 3QNWA 3JS5A 4PFKA 1H6AA 4NEQA 3MRXA 1KL7A 1ZCZA 2PT6A 3W4IA 1VYTA 1XKLA 3KDAA 4HGZA 2GWRA 3RIMA 4DR5B 3DYVA 1Q1EA 1T36A 1HQCA 3VDQA 1W5EA 3I9JA 5GV7A 2Z2YA 2Q9BA 2ORIA 5KMGA 4RDHA 3SKYA 2OLEA 1E92A 1MG5A 2LE0A 2RHDA 4KFUA 1YRLA 4RANA 4BUCA 2ET6A 2ZRMA 1KP9A 4OI4A 5DB4A 2GPNA 4ZQGA 3MWLA 3GJTA 2QYOA 3ZV4A 4BDSA 3ZHTA 2HHLA 1LXCA 2Y71A 3KBBA 2XWPA 3OPYA 4QHYA 2ADMA 1K08A 2VOJA 3FKJA 4G56A 2ZITA 1RXSA 3VR4H 1Z5UA 2APJA 1JX6A 1DAHA 1O57A 3DEJA 1JKJA 3GCXA 2WHXA 3KAPA 1WB6A 3EAQA 4XZ3A 3Q9UA 6ADHA 5IT9A 4Z3OA 4EGFA 3OM1A 1Z34A 4GX0A 4BVJA 4QXPA 4NL4H 2H3EA 2HJVA 5A1TA 1Z37A 3UUWA 1R12A 3DLTA 3ZCPA 1KFBB 3DHVA 5TPZD 4FDTA 1NQWA 5CFLA 3CHYA 4B2LA 5AI0A 1CY8A 4H60A 4K26A 3M7IA 1RHUA 2V7BA 3JZDA 3LXUX 4HO1X 2XVMA 4PZCA 3FOEC 4E4TA 5KWEA 3HXMA 3U48A 3F5QA 5GZ6A 1ZIYA 1STOA 3RJTA 4E5PA 1Z8DA 2WMDA 3FM9A 3HXTA 4N47A 4W9NC 3FNFA 4HKTA 1ZRNA 5B37A 2NVUB 4V2UA 4EY4A 4ENSA 4CIYA 1N7IA 1Z9BA 2OCBA 3IOCA 3KYJB 5JARA 3I61A 2NUTA 4BEJA 1MX3A 5AJHA 2VJCA 3WWOA 4K28A 3LBIA 5EMNA 1RE1A 2ES4A 3DJYA 1PDVA 3M3HA 2FMFA 3VMMA 5DXAA 4F2WA 3OLQA 3M81A 1UBLS 2RI6A 3DFFA 1AZWA 1PTJC 5DHTA 3ZKWA 2AKEA 3KEOA 1QRSA 1U0GA 1MX1A 2VK2A 1ZW1A 3RD5A 2JK1A 2ZVPX 2QF7A 4QBKA 3MMNA 4K6KA 1BD4A 3K9QO 1OV4A 4ZARA 2YMQA 2PUJA 3QOXA 2OO5C 3H2IA 3S40A 2JK0A 4ARCA 3OOSA 4E4RA 3NYIA 5AXDA 2Q6TA 1WABA 1TVKA 3T15A 1GRQA 3E9MA 3QJGA 2XW6A 1M34A 4KMOA 4J0HA 1HKUA 4MVXA 1IDN1 4O4LA 2B7LA 1NP7A 3TIXB 3ZHOA 5I7AA 3N76A 2XJ9A 2PT5A 2Q28A 5JXJA 4XOUA 3Q0IA 1OT3A 2H1OA 4KRYA 1J8VA 1E2MA 2BDTA 5DV9A 1QHFA 4P3PA 4RAQA 1NQTA 3PQ3A 2H57A 3KJIA 1IWOA 4G8JA 4HEHA 2WUEA 4OU4A 4JQYA 4UU1A 1XTBA 1Z36A 3TLXA 3GEMA 5L6MB 1MGOA 1ZZEA 2V59A 5CT9A 1AZLA 1N6PA 1K9SA 3LTNC 3OCUA 3I12A 4IHJB 4OKSA 2NPFA 5IC5A 1U0NA 3A1DA 3HACA 3RSOA 3IPRA 3THYB 1QRTA 2QZSA 4I66A 1U2EA 1VRWA 5BWCA 3MJ4A 3TZBA 1C9EA 4OK5A 3PC3A 2ZJAA 3AOGA 2B61A 3BCUA 3RVBA 1SZPA 2GYYA 1S5PA 4DSNA 1XDBA 3K4QA 4YDHB 4D5EA 2ZSUA 1OD6A 2ZTLA 3GBVA 2VHCA 2Z1DA 3VHLB 4NPCA 1UZLA 1RHQA 2Q5LA 2JLAA 4FWBA 4RJKA 4CDGA 4EOGA 3AW8A 4JP5A 4LRWA 3EXHC 1E1YA 2W6PA 1E98A 3OFSA 2VBCA 4KGZA 3CZ4A 4ZC8A 3MRSA 3TTVA 4CV1A 3E27A 4OMDA 4E2ZA 4DILA 4LFAB 1B4DA 2BGTA 1UJBA 1H23A 2EERA 3R23A 2R8RA 4GVLA 4HTFB 4L15A 3TBFA 4X64B 1Y9AA 5JY6A 3VR4A 3PPIA 3RFVA 4BC0A 3HUFA 4MP8A 4UHHA 1VL2A 3BWCA 4MI3A 1YAJA 4L9AA 2F59A 1NR5A 1DUVG 1OFHA 2H48A 3NP7A 2O8BA 3FCAA 3I9KA 1GGVA 3C87A 3CURA 2VDPB 3CNBA 2FR0A 3ZCQA 4I2VA 4JB3A 3ZW9A 3ZQUA 4BZQA 4EVIA 1E9SA 2W2LD 4EENA 3RQIA 1LEHA 1EWTA 1L1QA 1NGSA 1UFKA 3OJOA 4ZCRA 1OASA 2PL1A 3C0KA 3JVUA 4XIJA 4CMBA 3OC6A 3IJPA 4YRTA 2QZJA 5DYNA 3UAXA 2WJVA 4U7HA 5EHZA 3F7NA 3FXAA 3D7LA 3UWOA 4O1HA 2KLHA 5LUAA 4QM6A 1CNFA 1E63A 3ML1A 3CEHA 1H9BA 2PGLA 2WT9A 4EEZA 4R9SA 2WU1A 1R64A 3NHAA 3TKYA 3AVPA 2ZBUA 5E4TA 4EHLA 4ZYVA 5E7MA 3TEFA 1XNRB 2ZUSA 2FZ4A 3WL7A 2H5EA 1G63A 3SZOA 1W8IA 2NMVA 4FFBB 4MPPA 4PG6A 3RAEC 1AF4A 3MCZA 3UJAA 2ICAA 2PU7A 1EGVB 4IM7A 3VSEA 1KK0A 3IQGX 2KBFA 3KKMA 2HQSA 3EWAA 4D4IA 4EJ2A 3KSAC 1YHNA 1W4LA 2Y0BA 4MQBA 4HDMB 4M1MA 2H4HA 3NHYA 3EGXB 3UCFA 4B3JA 3TG8A 2QR3A 5DN6D 3A8TA 1A8HA 1NC1A 2IZ6A 2JJQA 5CA0F 2A94A 3ZWNA 5JNWA 4E7OA 3AU8A 2GFQA 4ZOLA 3S99A 3WISA 4Q0MA 3SC2A 2I4IA 3EZYA 3ZQ4A 3L1HA 2V5AA 4IBOA 2O0KA 1SC9A 3DSRA 5E2AA 4AMBA 4BBPA 3MLBA 5LLTA 1VJ1A 1XZFA 4V03A 4HEA1 1SR8A 4IIYA 3VR3D 5JRJA 2UKDA 4K0KB 4Q1FA 1P5FA 2P6NA 2OUIA 5DK6A 1Q1QA 3MHPA 4AJPA 4BVEA 1DAIA 4OBBA 5JT1A 1C0EA 1FNMA 4WGGA 3RSHA 3UV3A 1NU8A 1U02A 2AI2A 3KL4A 4L78A 2B2XA 5TF4A 4D5GA 3BIJA 1SG0A 1X1CA 3ME5A 5EWMA 4X8MA 5IVIA 4BE9A 1OC4A 3ZTWA 1QNFA 2B4AA 1KXZA 1ZD8A 3BMXA 2C2OA 1TYCA 3H5WA 3NWBA 4LE2A 3AZQA 4M76B 4PLPA 1YU6A 4IO0A 1U9JA 3QXSA 4MQMA 2HBYA 4HGRA 2VLBA 2J5KA 3K8YA 1J0EA 4Z1MD 1EUDB 1Y8AA 3BHNA 1K89A 3K3PA 2WD8A 3B2EA 2WICA 3M9LA 2E4UA 4YH1A 1OBOA 4MW1A 4Q02A 3WA6A 3MINA 4RO0A 5BV0A 4KDRA 1RSZA 2BKEA 4H1VA 1XA3A 2CE7A 3ZU4A 1YRWA 2QL5A 3KPVA 3O2JA 4NG4A 5MFZA 1FZTA 3NRCA 4DMUB 1YASA 2IGBA 2A7XA 2P6OA 2BE7A 4DUGA 3L0IB 3URMA 2NQTA 4BLTA 4DZTA 5F98A 1ORVA 2CJPA 5HR5A 3H1GA 4WJKB 4JFAA 4S1WA 4YRDA 1WZIA 4ARVA 1VSUA 5KTOA 1S9DA 1T4DA 5MN4A 3H86A 2ZSHA 1L8QA 1ECCA 1OZAA 2P3OA 1Y9EA 4FLFA 5FB3A 1TRHA 3SQLA 3G0HA 2YNMC 3GQVA 4I6GA 1U7HA 3K0HA 2GNAA 3VZCA 4CZ2A 3N8DA 2JAUA 2RGXA 3T34A 5AHXA 1C5KA 4KJXA 2ZRBA 2PU5A 1Z4LA 2PZKA 1QYDA 4IMIB 4H3HB 2V1UA 2HEGA 1R5JA 4FNOA 2P5UA 2BGLA 2XLBA 3L8ZA 2FHPA 3EGWA 4LYJA 3ZUPA 4QFCA 1FJGB 3ESRA 5IFLA 1BHJA 1W5AA 2NXEA 1TM2A 4H6VA 1ZIOA 4O0MA 2OHGA 3GO4A 4MV1A 4DQLA 3C7CB 3WHKA 4XRGA 5E2BA 1FP6A 1Q3KA 2GEFA 3GRCA 2DPYA 3D7NA 2JFFA 2GJ8A 5ARCA 1YIAA 3N5CA 3B6KA 5ICSA 3HCRA 4QTTB 2QN6A 1XQ9A 4ZQHA 4EP1A 3T9AA 1NNEA 3HJFA 3STWA 1K3FA 1ZK4A 1LGYA 4LE0A 1UBSB 4AZ3A 1LPMA 4MPTA 4QLAA 1I4LD 1Z4MA 2RHOA 2XQVA 2ZYRA 3AZPA 3KEQA 4I55F 4WK2B 3SD7A 1KP2A 1RJ9B 1G7TA 2OP1A 2P5YA 2WFLB 1YB1A 4ND8B 4E5MA 3IL2A 3RSSA 3VH2A 2RARA 3H4MA 5EUCA 3GGGA 5CA1B 3AHCA 4HMOA 5HQ3B 3L0YA 1JEJA 1E69A 4G07A 3UKOA 1RVV1 2HMVA 1V9CA 1ONNA 4O2LA 2PRKA 3V3TA 3Q5EA 3ZW7A 5IEBA 1SZDA 5B1YA 1PO7A 2DR2A 2X2PA 3JQ9A 4IVRA 3VZRA 3SKVA 1KFCB 1R88A 1RXWA 2SHKA 4CTNA 1X15A 2H2FA 5CB0A 3CKKA 4MV0A 1F9EA 4K9NA 3WI7A 1AG9A 1OLUB 2A9OA 3WLMA 4CCWA 3PX7A 1II8A 1YR7A 5AKIA 2JB9A 4F9TA 3L07A 3HLYA 3PS9A 5HGJA 4Q03A 4CUJA 2IZ0A 3M34A 1WOMA 1G1AA 2QENA 3KT3A 3NPAA 2M1ZA 4JAVC 1E2LA 1A5ZA 4KXMA 5U4QA 5BQXA 2Z58A 3SXJA 4AROA 4WXMA 4RFVA 4ZI2A 3O2SB 4L0CA 1E1DA 2QG4A 5YASA 3S2YA 1Z74A 3HB1A 3L46A 1M7HA 5CDHA 1N2CA 1U94A 1G5FA 4RZIA 1XD2A 2NU9B 1Y63A 1I8TA 3H2ZA 3PKJA 1OQAA 5DRYA 4BBJA 4P0PB 2G3YA 1EQUA 5KX5A 2QSZA 5DF1A 2GZ2A 1PYOA 3RAGA 3FCEA 1KZ7B 1T0HB 2BM8A 3QKRA 2DHRA 1Z35A 1VC2A 3IRVA 1TM4E 2C61A 5B1IA 4JC8A 3K70D 3ICVA 3MUOA 2WAYA 1UBRS 1WMEA 4FNAA 4FYXA 4JUFA 4B6PA 5CFNA 5I7SA 4U02A 2YXLA 4IH1A 3MCTA 2P2SA 4LBYA 5JSYA 1AK2A 4GXTA 5K8CA 4ZRMA 3W1EA 4Y18A 1CJCA 1VXOA 4JITA 4MIKA 4HJXA 2ZT6A 3L8YA 4OVKA 3VC1A 5IDWA 5K45A 1T9BA 1ZL0A 1LA2A 3KJNA 4DPKA 4Z7OB 2XE4A 1ZLXA 3ZHBA 4QIHA 4XLLA 2Z2IA 3QU9A 2HQOA 1E9RA 1YULA 2QMQA 2BTOA 4Y2VA 2G4VA 3UJPA 1O96B 1E0DA 3ESDA 4XJVA 2QV0A 3O4IA 5EIXA 3BMOB 3I1IA 1RMTA 2VDUE 3FSGA 4MEAA 1JLMA 1Y3FE 3QEBZ 3BWXA 5JY1A 4OOEA 1WBJB 4YRNA 1O95A 3N2KB 5HP4A 3K96A 4JDUA 1IXKA 1CJBA 4US1R 4HUTA 3C8HA 2B94A 3ADDA 4R41A 4W7SA 3RRYA 1ABEA 1N9GB 3OX3A 4O4JB 4QU0A 2PZGA 1HZZC 3F3MA 3ZVMA 4GL2A 3JZAA 2OOKA 1UF9A 4U6NA 2W2VA 1IY9A 5JD4A 1TYAE 4OM7A 3HWX1 4QBIA 1NNSA 4F8YA 3PGLA 2IZ7A 5EXDA 4GP9A 1K0UA 2CBZA 1M2WA 4HDQB 2Y2UA 5B12A 4A2QA 3O1HB 4UUNA 2E1RA 3OX1A 1X1QA 1JR4A 4EKEA 5TQ0A 3CKMA 2OXRA 3BRCA 1AGNA 1V6AA 3PFBA 3QVGB 4U5QA 4HTAA 5EUBA 1T1EA 2V4ZA 3NNDA 4TV8A 4UFPA 3U26A 3UUGA 2CSUA 2QUAA 3OI7A 4HB3A 1ISRA 4R1QA 1VJ5A 2MTBA 5COBA 2PBRA 4QUBA 4BEBA 3P2YA 4KPGA 1JYEA 2FW6A 3UGKA 1QIKA 2Q9AA 3AR4A 2FHSA 2FSUA 3NBQA 1Y3CE 2EC5A 2V7EA 3D4LA 3WG9A 4CM4B 2V0NA 4BQOA 3DNFA 1IB0A 4YPVA 2P0AA 4JNKA 3FWYA 3C6MA 1NVDA 3ORYA 4IDHA 3JQQA 4BJHB 2V9ZA 1PEKE 2YV1A 3WL6A 5KNCH 1GV1A 2LIPA 3IKLA 4QPZA 2NPOA 1E2UA 2ODEA 4DMKA 1Q0RA 2CL7X 1LFDB 1VPTA 3DUWA 1FSGA 1HG0A 4OSPA 5ECWA 5FKJA 2OENG 4UCWA 5JQGB 5A62A 3QIAA 1J49A 1I4WA 1D2CA 1T6NA 3IBTA 5BUZA 2AZXA 3I5YA 3T5PA 2ESRA 5BWLA 3HUUA 1Y7HA 4P2BA 1E4OA 4HATA 1I7LA 4OHOA 4PSUA 5A4IS 1I3NA 1Q7RA 1Z7EA 3JYOA 4LMBA 3T4PA 2GTHA 4EEKA 4F93B 1N0HA 3PC7A 1OKKD 3OOHA 1QE0A 4CMJA 3Q98A 4YV1A 1HUQA 2B0CA 5CB8A 3SQOA 3VKFA 5G2OA 1AB5A 3GLSA 1MEOA 4IL5A 1WMDA 4P4SA 4D0NA 3CPHA 4LGMA 4R8KA 1KXJA 3PCTA 4L0MA 1Q7TA 2BD0A 4NIMA 1VI6A 5FA5A 1D2EA 1SJ9A 1XVLA 2OYSA 4ZMSA 4V3BA 4WXRA 3HRIA 3H5AA 4YV0A 1H6DA 1YO6A 3ANLA 4PICA 1F17A 2JJ1A 4LDJA 1TUGA 3INGA 3NHSA 3T6KA 1JVNA 1TECE 3TLCA 4AJ1A 1JR2A 2VH1A 1K68A 4QRHA 5GONA 3NHJA 4M7WA 5F1KA 2H2WA 4UDOA 5EE1A 1T91A 4MNTA 2CZQA 1D1SA 2ZZMA 3LT5A 5KOJA 4HZGA 3U80A 4P0TA 3K73O 2FAXA 4WZAB 1KVTA 3FR8A 1J0CA 3QI7A 4HSGA 4IW3B 4OHWA 3FHCB 3N39C 1ZO8A 2B3TA 1V1MB 3E7FA 3NV9A 1I2AA 1Q7CA 1VMEA 4NF2A 4R01A 2SICE 4I9HA 2QVLA 5B53A 3ABRB 3CIFA 2B8NA 2FN9A 1K86A 4ZK6A 4G84A 5C80A 1I7NA 3O90A 1NF9A 1U5BB 2VHEA 5M29A 2FEMA 4JA0A 1HLPA 2E0IA 4EF6A 5BQOA 2HMWA 1SZJG 1SKAA 2CGEA 2ACKA 4CR8A 1WMBA 1GPNA 1XJWA 5EKUA 2HMYB 1D2HA 4IJMA 4F9GA 5EKXA 3IT2A 3B1ZA 3KTFA 1XRJA 3OZTA 1FY2A 1A96A 1ECJA 1HDGO 1Z5ZA 4R9NA 1XQ1A 4RDIA 3VC3A 2F1HA 3RUAA 1SEVA 2FE1A 2V54A 4A82A 2PBZA 3GGCA 5FEMA 1PQWA 2JZNA 2C3MA 3N87A 1II8B 2JJYA 4PTZA 4NYMR 4RHYA 4JLBA 4YJDA 2RGUA 3K0BA 3N2LA 3N8IA 1E79A 1R6AA 4DR1B 2IW1A 1EGQA 3K05A 2A86A 3I1YA 1PVVA 2WKRA 2ZAIA 3T5CA 5G40A 2JHCA 4ZZ2A 3C6YA 1JQBA 4AMYA 1Q84A 3DONA 4WFIA 4YLGA 3IQIX 5BRNA 2QB5A 1YZKA 5KVQA 5CLFA 3O2QB 4ZYXA 1SBQA 3H5NA 2XRMA 3SF8B 1E5LA 2CUZA 2H1RA 4LCJA 2X1HA 1JIJA 1OT5A 4QUJA 4C6HA 3VUEA 1N2CB 2DTXA 1IM2A 3DOEA 3LS2A 1XD2B 3AUUA 2PX3A 1RR6A 3R40A 2XVYA 2J08A 4X24A 4ZODA 5C1BA 3ZYCA 5KX5B 2WFAA 1T9GS 4LAFA 2XNJA 4EBFA 1C2TA 5HRCA 1YJ8A 2VPQA 4BFYA 3QKRB 1X7DA 2BH2A 4O29A 4QOJA