3RHSA

Phosphopantetheine adenylyltransferase from mycobacterium tuberculosis complexed with coa
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphopantetheine adenylyltransferase
publication title Three-Dimensional Structure of Phosphopantetheine Adenylyltransferase from Mycobacterium
rcsb
source organism Mycobacterium tuberculosis
total genus 52
structure length 157
sequence length 157
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3rhsA00
3KT0A 1COZA 2JANA 2QUJA 2YWCA 5LM3A 2I1LA 1T6XA 5H7XA 4K0RA 2H2AA 1K4MA 2DETA 5H16A 3N9IA 5F23A 2CV2A 2CUZA 5FO1A 1Q77A 1GTSA 1EJ2A 3TQIA 2YY5A 4ND6A 4CT0A 4WSOA 3GUZA 3TQOA 1WOYA 1NUPA 2ZUFA 2QJFA 1NUSA 2A1TR 1LI5A 1Q19A 2R5WA 3FY4A 1MBZA 3RFFA 1WXHA 2E89A 3IOCA 1KQNA 1RQGA 1JZSA 3MLAA 3X1MA 5BNZA 3TZLA 1MJHA 1YUMA 2PZAA 3RHSA 1JIIA 2O8VA 1J1UA 4MULA 1J20A 3RK1A 1OWNA 4YP6A 4GRIA 4MUFA 4DLPA 2OV4A 5KHAA 3SDBA 4MUNA 1WZ2A 1IHOA 3CLUC 3ZJVA 3HMQA 1GAXA 1WKBA 4KR9A 3H05A 4EG1A 2OQ2A 3IMGA 4I6JA 4NATA 1JGTA 5DB4A 2V0GA 3N2YA 1GZUA 2A86A 4UZFA 3CLRC 1JZQA 1T9GS 1YULA 2PXHA 4MUIA 1IQRA 4OJMX 3CLUD 4CDMA 1PFWA 1SURA 4Q93A 5LFAA 3QTBA 3AIIA 1N2HA 1V47A 1M83A 4EF6A 2QTNA 2QUKA 3X1JA 3A05A 3CLRD 4L2IB 3COWA 2GOYA 4ZT4A 1TFUA 2CYBA 1O97C 2Z3VA 1KORA 1KAQA 4EG5A 1G8FA 4DDKA 1N2IA 1MOPA 2PFSA 1QRTA 1IH8A 5J58A 2VXOA 4NAUA 3IOEA 1H3FA 1KP2A 1OD6A 1TQ8A 3UY4A 4MW4A 2E18A 2BTEA 1WJGA 3BL5A 5IHXA 3D6UA 3IUEA 4JZYA 3QTTA 1KQPA 4L2IA 4DE5A 1O97D 4JYZA 2NSYA 3FIUA 1EE1A 1F4LA 5HUJA 2HGZA 2JAXA 1N77A 1XNJA 2PIDA 2V0CA 4ARCA 3FHJA 3ELBA 1TEZA 3OP1A 1ZJWA 3P0IA 1OWPA 3A04A 3CVYA 1WXIA 3SZ3A 2O5RA 3ND6A 2PZBA 2IP1A 4PBTA 1NUQA 4EG7A 1S4MA 4PBSA 4ZT2A 2D13A 3PNVA 2GM3A 3LCJA 1LW7A 1M1ZA 1JEDA 3I05A 4BWVA 3Q4GA 1GLNA 1Q15A 3PNBA 1N3LA 3X1KA 3AG5A 5TEWA 2DEUA 3KT8A 3MXTA 4MUHA 2Z08A 2A84A 4HJXA 2A1UB 1JILA 1N2BA 4KKVA 2YXNA 3N8HA 4I6EA 1QTQA 1M8FA 4X0EA 1NUTA 5AHWA 1KH1A 4NX2A 2WB2A 1DNPA 1I6KA 4ZT3A 4JFAA 1JIKA 2D54A 1EFPB 3ILVA 2HZ7A 3UC5A 4HJRA 2D5BA 5LLTA 2A1UA 2HMAA 4ARIA 4MW5A 4ND7A 1R6UA 4K03A 4TS1A 3FDXA 1QJCA 1U7DA 1XNGA 1IVSA 3IH5A 3CVVA 1MC1A 1TYCA 1EXDA 1ZUNA 2DPLA 1YUNA 1PFUA 3NBAA 1V8FA 4J76A 1J09A 3N05A 1JHDA 1WQ4A 3G6KA 2E21A 3AL0C 1EFPA 4G6ZA 1O94C 2X0KA 2CT8A 3PRHA 2RD2A 1K92A 1OBHA 1VBNA 4ZCPA 1P7PA 1HYBA 1NURA 1O0CA 3G5AA 2AKEA 1PG0A 3LOQA 2ZUEA 4H3SA 2ZP1A 3AFHA 3HFJA 4R2MA 1O6BA 1PFVA 3PNYA 4WNYA 4ZCTA 2WQ7A 3DV2A 2DXIA 2X1LA 3U1VA 1O94D 2TS1A 3OTWA 3RBAA 3VGJA 1J21A 3K9WA 5KCMA 2C5SA 3CA8A 3DPIA 4YP5A 5DEOA 4XSVA 2CV1A 5KWVA 1GPMA 3TZEA 3Q10A 2YWBA 3VU8A 1O5TA 1K4KA 2DERA 4A91A 1KR2A 4XFDA 4DJAA 2JA2A 3E27A 1YI8A 1U3DA 1GTRA 4HK4A 3IUBA 4ZT5A 3IVCA 1TYAE 1A8HA 3IVXA 3ZJUA 1MB2A 2GKSA 3ZXSA 4MVWA 4MWCA 4ZCSA 4EG8A 4DDMA 1OWOA 1ULHA 3CR8A 3F3MA 3ZXIA 4MQ6A 3COZA 1IQUA 3FETA 2A7XA 1JIJA 2PG3A 4KR6A 4AQ7A 1H3EA 3UOWA 4ZT7A 5TGTA 1N2GA 4ZT6A 2BYTA 4MW7A 1GN8A 3IMEA 4NZPA 1M8KA 4GU5A 1F9AA 2NZ2A 3GLVA 1M8PA 4MW1A 3COVA 4MWBA 4CQNA 1I6LA 1QQTA 1T6YA 2A88A 5DASA 1TYDE 2G36A 4OUDB 3A2KA 3SZGA 1OWMA 1H3NA 4QBTA 1R6TA 4QRDA 2QUHA 3K32A 1QNFA 1ZH6A 2CYAA 1LI7A 2DUMA 3LE8A 3UK2A 1Y42X 1NSYA 4MUGA 3HZRA 4MW6A 3KT6A 1KAMA 1KH3A 1U0BB 3MLBA 4OUDA 3JXEA 3P52A 1XJQA 4G5FA 1NUUA 3KFLA 4ZCQA 4MAFA 1KKUA 4MLPA 4FZJA 2CFOA 4RPIA 2A4MA 2QJTA 5TEVA 4MUJA 1YIDA 2H29A 3S3TA 1J70A 2J07A 4MVXA 1JECA 1R6XA 4MW0A 3FI0A 1G59A 4EGAA 5FO0A 4MWDA 2A1TS 3CLSC 3GMIA 1EUQA 1WXEA 2DR2A 5K0SA 3H9BA 1N78A 3FWKA 3TNJA 1PG2A 1N75A 3HGMA 3ZIUA 4CDNA 4AS1A 3RK0A 3H97A 1JMVA 4MVYA 5DK4A 3ZUGA 5TS2A 1U3CA 2J08A 3CVXA 3IDFA 3CLSD 5K0TA 1K97A 4NDAA 2AZXA 4EFKA 1U7XA 3IOBA 2Z09A 3UMVA 1WXFA 1IRXA 3CVUA 1X8XA 3ZJTA 4MVCA 3TS1A 1H1TA 2IJGX 3G59A 3ISJA 3AKZA 1O0BA 3SP1A 4YBRA 1EUYA 3ZGZA 2J4DA 3PXUA 2EL7A 4MUKA 3VRHA 1F7VA 3M5WA 3RJZA 3P0HA 1FFYA 2IELA 4NAHA 1MAUA 1IQ0A 3HV0A 4DNXA 4U8HA 2X3FA 4R0NA 3A4IA 1MB9A 3FG9A 2CYCA 3FNRA 2VTBB 3NV7A 3IMCA 1QRSA 4JXZA 1PFYA 4MUEA 1KP3A 1VBMA 3ND5A 4E1AA 1FYDA 4ZCRA 1NYLA 2WQ6A 5EKDA 3FOCA 3SEZA 3INNA 3Q12A 3IODA 4KR7A 1WXGA 1I6MA 1N2EA 3CVWA 3D6VA 2VTBA 4F4HA 2B7LA 5IJXA 1XNHA 4F3RA 3FH0A 4MWEA 2CV0A 1QRUA 2X1MA 2WSIA 1QU2A 4YP7A 1MRZA 1NI5A 1CT9A 4U63A 1TYBE 3DLAA 1BS2A 1B6TA 1KQOA 1OWLA 1Q11A 2PZ8A 1EFVB 4PBRA 4R2LA 1I2DA 1VLHA 1N2OA 1VL2A 3CLTC 1N2JA 3P0JA 1ILEA 2CSXA 4EG3A 3DO8A 1T9GR 3MUEA 1IFXA 2J09A 3HL4A 3IVGA 2DLCX 1WY5A 2QTMA 1KH2A 1T6ZA 4EG6A 3SYTA 1EFVA 2E0IA 1O96B 4JXXA 3L93A 1NP7A 1D2RA 4KPUB 2QTRA 5FNZA 4S1OA 3CLTD 1G8GA 3NBKA 1YIAA 5HG0A 4XFJA 2XRYA 1QU3A 1X6VA 5JBNA 3MMXA 4P2BA 1OBCA 2J5BA 3C8ZA 3L92A 4RUKA 4PY2A 4MW2A 3H9CA 3SEQA 1O95C 2AG6A 2XRZA 2QJOA 4I6GA 1M8JA 4YMIA 4J75A 3KT3A 4U7JA 4DDHA 1O96A 1M8GA 4MW9A 4KPUA 2EJCA 3QE4A 4EG4A 1JEEA 1ZH0A 1MAWA 4HPWA 1F7UA 4Q16A 5J59A 4G5YA 3COYA 4QREA 1O95D 1N1DA 3AG6A 5HUHA 1J1ZA 2QUIA 1WQ3A 1UFVA 2RE8A 3H99A 3ND7A 4UZEA 1G8HA 1VBKA 5J5AA 1NZJA
chains in the Genus database with same CATH superfamily
1QIKA 3GLHA 5KOIA 5AD1A 3PHJA 3OM0A 4DKJA 4XUGB 3ZWVA 3BN3A 2X41A 4K3UA 2ALJA 5E3IA 4D6PA 2JFZA 4NESA 4R1NA 5IBRA 1K4MA 1JUDA 1PS0A 2Q29A 4MO9A 4P80A 2ADMA 4HX9A 1JPVA 5K3DA 2HU8A 3YASA 3E9DA 4K1LA 2GETA 1FMJA 2Q21A 2AE1A 2HJVA 4C0LA 5PNTA 2ASVA 4XIIA 5ARDA 1RC1A 4BMNA 2GLUA 4Q3CA 3TQOA 3DSRA 1LPNA 2EF0A 4QQ8A 5FIUA 2C97A 3E3OA 3OFVA 3HY6A 2E3JA 3NUQA 4XI9A 1WOYA 2PUFA 3FCXA 3G2LA 3V46A 5CLLA 1NUSA 3MQ4A 3A6JA 2W83A 3D6AA 2XZPA 3TL2A 3PCRB 2DUWA 3IOCA 2VVTA 1DQYA 1SPBS 3QITA 2YS7A 1SIUA 5FBWB 5HA5A 5L3RA 1N7JA 2J4CA 1ODTC 2B4RO 2Y27A 4BQSA 2QRHA 3X44A 5CPBA 3THXA 4MP8A 4RZ2A 1XQ6A 1Z0FA 1C2TA 4NU8X 3M9WA 4IIBA 4XCVA 1ENOA 2NXWA 4ZOAA 1X7WA 1NGSA 3NWOA 4X20A 2I78A 1MH9A 4LHYA 1QHXA 4QICA 2R1TA 4QJ5A 1KY5A 1MRNA 3ECAA 3GFTA 4NK4A 4FM9A 1AMNA 1OFTA 1UKYA 1E0KA 1UZLA 1ZBDA 4FW9A 5EIBD 4L0CA 1KQGA 5D1HA 3ZJVA 1ORRA 4DN6A 3RVBA 4Y2JA 1K63A 4KKXB 1P2TA 1QWSA 3RJ5A 2D1TA 2F3SA 4JKYA 4UFPA 2W4QA 2C5AA 3DP7A 5I7FA 4P5DA 3GVHA 1PF7E 3RQIA 2PTHA 4IDOA 2OBNA 3IDQA 4LQCA 5K8CA 2VDVE 2XECA 3V8NA 5C9ZA 3JQEA 1HI9A 1SK9A 3M4JA 4QYIA 3KZ1E 4RA6A 4D9HA 1H0RA 3ENQA 4M4SA 3F96A 1GUYA 3O1LA 2YNMA 4QGHA 4Q93A 5JXHA 3CG0A 3FWYA 5BMVB 3BZBA 3QPWA 2ZULA 4AJ1A 4TS3A 2IEDA 2H08A 3CTPA 1FZQA 4QHSA 4H7EA 5T3UA 3GJSA 2VOEA 3V3KA 4B09A 2JIZD 3KKMA 4OXRA 1REQA 1P60A 5EIEA 1G9SA 2B0CA 3COWA 3D7NA 4GMXA 4I5EA 4QUDA 5ICCA 1RRPA 3CZCA 2HHHB 1E9FA 2H1LA 4F3YA 1YE8A 3RWBA 1VI6A 1KAQA 4WNIA 1NL3A 2ZTLA 3QLJA 2WMNB 3TAUA 1LNZA 2W6PA 4RL6A 1D8AA 1AK9A 4CNQA 1ML3A 1H3FA 4FKZA 5HF5A 2XA1A 3HVJA 3WK4A 1UMKA 4MW4A 3VGPA 4UHCA 1E6WA 1MGOA 3GLUA 4R6XA 4BNDB 4ESVA 3MM4A 3INYA 3ZWPA 3OJOA 3FUXA 4C4YA 4CUKA 1GXSB 2V65A 2IYEA 4KPGA 1O5IA 2ZRKA 1Z7YA 3FSGD 1RYYA 3AONB 3PEUA 4NJEA 1E2DA 1FQKA 1KDPA 1KOFA 3HKDB 4HZIA 2QRLA 2XGGA 4QVGA 4TX1A 2DFLA 5AW1A 3RAJA 1XNJA 1Z33A 3SPXA 1ZM4A 4QASA 1O1YA 4J0GA 3FJYA 3U48A 1UMDA 3EZ9A 1E4OA 3CN7A 3HFSA 2CVHA 1XFAA 1BU5A 2PDAA 3DB1A 5K05A 3R1IA 3R0JA 5M7EA 5L9AA 3B5IA 1ANKA 3SBOA 3C8MA 1O6ZA 4D80A 2H5JA 2Q2VA 4QXMA 5T4BA 4CFSA 3DLPX 2YYZA 1ZKDA 4D43A 1NUQA 1S4MA 3QTLA 4ZT2A 3DNPA 3RH0A 4DOMA 1AURA 1W94A 3LCJA 2O8CA 4CKWB 2PLAA 1QZ3A 3QF7A 3MWEA 3BGSA 4CF3A 4QU5A 1P2UA 1EJ6A 3PGVA 3LDUA 4TN5A 4Y2VA 3U7GA 3X1KA 2L0XA 4UMDA 4WY8A 1E6EA 5EJ6A 2YVKA 2HO5A 3C0KA 2IA5A 2EAUA 4MA5A 5FUWA 5TQVA 2WKQA 3ZHQA 1LVHA 1X38A 2XUDA 3M4YA 4YRQA 1KK0A 2CLDX 4H7FA 4I8XA 3RT9A 3PHLA 1VLQA 5I48A 1PR3A 1W59A 2BFFB 3BIXA 2J3HA 3CX4A 1KH1A 1ZLYA 4GMDA 1KSJA 1I3LA 2QORA 3OEEA 4I9FA 1DZIA 2P8SA 4MRMA 4CCYB 1N1MA 3JQDA 4MWZA 1HV8A 4DM3A 5BURA 2RGRA 4R2XA 4ZGGA 2P1RA 3DVLA 1CB7A 3BXPA 3ZS9A 1ADYA 1DP4A 2BCJQ 3Q1KA 4C14A 4FU0A 4HQLA 3Q0IA 4L5BA 3UATA 4QG7A 2D5LA 2XEXA 4DGSA 5LLTA 1YR3A 2XUZA 3KTFA 5DGCA 1E8DA 1U63A 3CR7A 3HPRA 1JAYA 2REBA 1H4TA 4QJ4A 4DMUB 1IVSA 3EF0A 4OGGA 4FFSA 2E37A 3P9RA 1PR2A 3CFYA 1I1HA 3DDSA 2IHZA 5H70A 3UYLA 2IV3A 4D3XA 1NBIA 5JZMA 2EGUA 1NATA 1MJ5A 5COBA 3BH7A 4WZZA 1F5NA 4YCNA 1GCUA 2PMEA 4KFCA 2H5LA 1HE8B 2HRBA 4DF3A 1M5RA 2JJ8A 2EKZA 1IB0A 1V26A 2HF8A 3OFSA 4C5AA 5BXYA 2NU8B 4ROTA 5BNTA 2B6HA 2YV4A 4XDYA 1ZPDA 3CEHA 3IV7A 1A9XB 5LMCA 3BDVA 2PSJA 3BMQB 4KRXA 1E1CB 4LZAA 1NYQA 2OUIA 4NNPA 3QY0A 3GA5A 2XX3A 3FGPA 3JPWA 1V6SA 2QYOA 2G1AA 1X2BA 2XXBA 3QU5A 4EMBA 3T8YA 1J21A 1O08A 4H2DA 4M7PA 1XU7A 2KLHA 4J90A 1MABA 4Z4FA 3KPUA 5AVQA 1V5GA 1KIFA 4J0FA 1XCMA 1YR1A 1GNRA 1HKHA 1ZD9A 2YWBA 4URWR 5ELMA 4ZVRA 4E2XA 3CNOA 1FDRA 1RR6A 1TMOA 3OCJA 4NBWA 1FFWA 4MPTA 1E59A 2EARA 3AJAA 2XY4A 5CCXA 1X9IA 3QIAA 4GDMA 4ND8B 3ADDA 1NJ6A 1M1UA 4G9EA 2IX9A 3DWFA 4WK6A 2Q4TA 2IU4A 5FPHA 4ZT5A 3WFZA 1BDMA 1IAQA 1NMEA 2NADA 4JWTA 2WJ4A 2CDNA 2Y1CA 5K0NA 3SKVA 4TYMA 1H05A 3OFNA 4C7JA 3ZJUA 4V0ME 4G4GA 3CUYA 1UBNA 3RSOA 3GR6A 5K01A 4CV1A 3TIXB 1R16A 3IKLA 4E5YA 3URMA 2QTZA 2VAVA 2LRHA 1HYQA 4K81B 2J6CA 2AJDA 3AR7A 4K9PA 1AG9A 4JCOA 1NI4B 1IATA 1K7SN 1ZQ9A 2HJWA 2OFPA 3K0BA 5DOVA 1R8QA 3EHEA 2PAAA 1IPHA 3EYAA 1T5TA 5LQCA 1ZFNA 2R8ZA 2V5VA 3DZFA 4ZO9A 1UJNA 2G7MC 5GM2A 2EFDB 1PWZA 5EIAA 4Q3DA 3DF9A 1YZVA 3AF1A 5F76A 5KWEA 2ZUWA 5MFZA 4QUIA 1A9PA 1NXOA 3KSBC 2G82A 2YTZA 3NTQA 1N92A 3GLVA 1M6WA 1V7CA 1R2QA 1TFRA 4O6VA 1DRVA 4OXQA 2CXQA 4HFRA 3HMKA 4PPQA 1DOHA 1T6BY 4ZV9A 1G3UA 2RKWA 5CFLA 2O2YA 2F4VB 4HG2A 1XTRA 3QMMA 3HB9A 2C3YA 2PUJA 3K4QA 4L9AA 4RQUA 4FYKA 4BAUA 4D8WA 5AVWA 1U9IA 4CCSA 2OZEA 3LXMA 1FB5A 4X92A 1YS4A 4LHSA 1T4DA 1RTTA 2EIHA 2IXTA 2WU3A 5SY4A 1QYDA 2FWPA 2WUFA 3UAGA 4BWYA 1TIKA 5J2TF 2Q2QA 3L6EA 4MYCA 3R3JA 5GJWC 3W8NA 3CZRA 2PTGA 4RJTA 3MTIA 3HO8A 3LE8A 5J43A 1ZVJA 2FZCA 1L7AA 2QL9A 4Z4EA 3AUJB 1ICEA 2XGJA 3UGKA 2EX1A 1BAPA 1TE2A 1UBHS 1IVNA 3PSHA 1VMKA 2LCQA 1NN5A 2B7BA 3ZQJA 1OW3B 1NUUA 2B5WA 3S29A 2F55A 5ALXA 1E7SA 3DE1X 1XRPA 5AT1A 4IXTA 4WOBA 2XCRB 2DTEA 3RTBA 1MX9A 6CHYA 4Q5IA 2YWGA 1PL0A 2ZWIA 3MWDB 4BN4A 3E8SA 3NBQA 4IILA 4Z9XA 1A7KA 4JL6A 1J56A 1FVFA 4RADA 1X1EA 2R7MA 1A50B 4UHJA 2R5NA 2Y4OA 4DR1B 1QTIA 2HIAA 3HCPA 2O06A 3ASZA 4MWDA 4R54A 5BR8B 3NTXA 5BW4A 2B4QA 5TGDA 3ITNA 5C34B 1Y3FE 3O03A 3DHEA 4LMAA 5ALTA 2CUKA 1U2EA 4I8DA 1R6AA 1JSZA 3KLNA 4GPAA 2AJCA 4I1IA 5EY5B 3AVTA 4FYPA 1Y9JA 1PWHA 4NZOA 3ZEAA 4BO2A 1QVRA 1F2DA 5ESRA 4OYHA 1MB3A 4KRGA 4MVYA 2VSFA 5DI3A 5FLKA 4RWEA 3AVUA 3LNTA 2E4YA 3MYRA 2JAWA 3ZUGA 1U3CA 1T3TA 3KQOA 1U2TA 5A62A 1OROA 1VL8A 2JBAB 3OFJA 2DWCA 3AR9A 4TLEA 3TLBA 2B5OA 4OAOA 2IV2X 1WABA 1EINA 2O4CA 4RKRA 2JRCA 1FPMA 1FFSA 3FHLA 4AVYA 4ETWA 1D6JA 2HPAA 5EJ8A 1CY7A 5A3SA 2GCIA 3ZQKA 2RH9B 4RD3A 1ZUD1 3NOOA 1P74A 3S6JA 1A97A 1HYGA 1LLDA 3A1FA 4W5TA 3HY3A 4TYYA 4BFCA 3ISJA 4JVSB 1LCIA 1RI1A 4JJ7A 3NPAA 1Z0IA 5BWBA 3UMMA 1C4XA 2PRYA 2BFNA 3NAZA 4JC4A 4WKNA 1C9YA 3TEMA 3WMWA 3RK4A 1P3DA 5LNK1 4Q7JB 5FTJA 4IDEA 4HKTA 4PFSA 5JD4A 2JIPA 121PA 4YAJA 2AD1A 3DTVD 4RJIA 4US0R 3U1BA 2NPFA 3PVCA 5GINE 3DBRB 2YV5A 1TUEA 3MCZA 5EE5B 3K6KA 1G7TA 5CCDA 3CW9A 1QH8A 4EDFA 1FRQA 2E1RA 5I9TA 3WAGA 4MS3B 4P83A 1D2NA 3JQBA 3R2JA 3A11A 2VF2A 2XTMA 4MQUA 3L5KA 4HTFB 4OMUA 5A4KA 3N2GA 1JMYA 1KOJA 3R5KA 4OJKA 4B48A 4E4YA 4DYDA 1GLGA 2PL1A 4KUGA 3OIFA 1AUQA 4GYKA 1B8UA 2XI4A 4PAGA 2JFQA 3TUIC 1SHJA 2LIVA 1AXGA 2WU8A 2AA3A 2IIPA 2P9BA 1NVVQ 4QU0A 4I55F 4UOEA 4F1JA 4KR2A 4GMGA 4ZAVA 3ICPA 3DDUA 1Q7GA 4N0EA 4DXDA 3BK7A 2BJHA 4GG1A 4ZPXA 1XEXB 1N5KA 2C9DA 2Q4RA 1F8YA 2FWBA 1UBTS 3X1ZA 3INNA 2R8OA 3W1VA 1WKCA 1KERA 2V9CA 3JQBC 2IU6A 3I9FA 2V7TA 3EQ7A 4PZEA 2YKGA 3M33A 5E9QA 2JFWA 4FMBB 4EYOA 3OMLA 1COWD 1VCNA 5CFOA 4WCFC 3EVTA 4JI3B 3L0YA 1T5IA 3TGPA 1QQ5A 2WINI 3ASVA 2PSFA 3BOSA 4LOKA 2PWPA 3HKBB 4J7XA 3S1SA 3LHSA 1Y8QB 4HQ6A 4JHLA 1H69A 3P9IA 5F7OA 2Q9BA 3JQ8B 2P8JA 3DB2A 1UP7A 4O4IF 4Q9DA 4UASA 3I9NA 1SU6A 2P5YA 4UNQA 1UMBB 2XWPA 4K6MA 3TZHA 5CDSA 5A4JA 4DM7A 2PANA 3CLTC 1MA3A 4ND1A 4C7XA 1HMYA 4JLDA 1POXA 2NUPA 2DWPA 4MICA 5JTUA 2MSLA 1Y4DE 1RD4A 3KPVA 1DUIA 4QATA 4HAZA 2P7IA 3KHUA 3B78A 1ENPA 3JVIA 4YJDA 5KNBH 4L4RA 3I01M 2ZTVA 5JBIA 1UBRS 2GFIA 4TWJA 4XX1A 1SOAA 3N6VA 4A23A 4DNFA 2ZVPX 2DKNA 4UVHA 4CIBA 4M22A 3WMEA 3I58A 1U8ZA 4BU1A 1VE7A 4P38A 4OHZA 1CP3A 1MO6A 4EUHA 5DLDA 1N2XA 2LDBA 2ACVA 1E3WB 3TGWA 4P0PB 1FP2A 1QNLA 4GSLA 3N2KA 4X95A 4FFDA 3TBKA 1UM9B 1BYUA 3DNFA 4P0QB 1XDSA 3BRQA 1SIBE 3BXZA 1NJ8A 3LUDA 4YTEA 3UMYA 3ZYZA 3BCRA 4ESOA 4LK2A 4D8UA 3KT3A 1DAHA 5KKCA 4A0HA 2GK6A 2PX5A 2KS6A 3QYPA 3U3JA 1FP1D 2Q27A 2EJCA 1QAMA 4PLPA 3GT4A 4F6LA 1PL6A 3VZRA 4ILKA 1MAWA 1WP9A 2JCYA 2R11A 3WBBA 4QDOA 4UAUA 4V0RA 2XT9A 2H9AA 1EI9A 3TR5A 2BEUB 3J81k 2BSAA 1H8EA 5CIYA 3O31A 4P4SB 2Y0CA 2P4HX 1YQEA 1WCYA 4IJQA 1E2UA 1D5WA 3A3PA 4LYDA 1KDRA 4PANA 1T3SA 4AYWA 3TLCA 2P5SA 4TYNA 3WV5A 1Z38A 3S81A 3WK8A 4FOLA 3NYIA 4Y2GA 3RVJA 2CNKA 4TN1A 2D1QA 1WMAA 1PEKE 3KHSA 4J3JA 1U2SA 3I42A 1GZ6A 3C48A 1IRIA 1JAXA 2NG1A 3KT0A 4IQGA 4NAVA 4PNHA 4CUJA 1MUUA 4NIMA 4L7QA 4WXYB 1PVOA 2CZCA 1BXKA 2QUAA 2GVDC 1XMJA 5D01A 3V00A 1G20A 4R81A 5P8WA 1I7QB 2H2AA 1L5HB 1N9GB 3ERCA 4JGIA 3NEPX 2JHPA 4WUTA 1IHDA 4ZVSA 2IWRA 4F85A 1UMCB 3C97A 5AHXA 5KQLA 2OBBA 4P3NA 4TKLA 3D0KA 3HYRA 5B1EA 2OPHA 1ADFA 1RM4A 1Z9BA 3IEPA 1G3QA 1FYEA 1IY0A 2FN4A 4HH1A 1I32A 5BT8A 3QNUA 4G5RA 3NM5A 1Q1AA 2XMBA 2XYRA 1KBOA 3DFFA 4WIAA 3OE1A 2DUJA 1V1MB 1W75A 1YVDA 3EF1A 4BFTA 2J5QA 5DYTA 3ST7A 4UXHA 1V35A 4FNAA 3W9SA 1M2VB 2QTLA 5DFAA 3VR6H 5JNLA 2H3EA 3W5UA 4EA6A 2RCNA 3Q3IA 3PRKE 1LNQA 3OTQA 4M8KA 1DWOA 1FMFA 1NAHA 1U3GA 4ZVOA 4ZRMA 3SNHA 2NO1A 1P19A 4JYCA 3GNLA 4KYUA 4Q9LA 3S55A 5KS2A 1ULSA 4DLPA 4ES6A 1DOZA 3RVKA 2ZRAA 1EFHA 3SDBA 2XVYA 1GNPA 4E4TA 4D8VA 3DZKA 2A5DA 1IHOA 5DBOA 3T9AA 2YY6A 4PHTA 4MQEA 4B4KA 3HMQA 5D8DA 1WUJS 4HO1X 4PLCA 3VZPA 4ZKDA 5MGBA 5HJEA 4C05A 3W1EA 2OHJA 1RQNA 5BT9A 1GPKA 3KYIB 4MI9A 1Z82A 1O8CA 4RV5A 2AG0A 5EZSA 5EE3A 4ZN6A 5CFQA 2WWYA 2RC6A 3JRXA 2AC4A 1V39A 2YXBA 1UBFA 3H1AA 1T9CA 4N3BA 1GZ4A 3SC6A 1RAIA 4X3OA 3SQDA 3TNLA 1H93A 3U9LA 4DBLC 4PX5A 1W36C 5IWAB 1IQRA 2UZ0A 1T43A 3LCRA 2P0EA 4CDMA 5KWIA 4HPJB 4BZZA 1CZLA 1YBVA 13PKA 5DLYA 3HM9A 3LV8A 5AOVA 2D5CA 1DO8A 1M83A 1Q74A 1Y1LA 3FYTA 4HY3A 4FFOA 5EYPA 4OHRA 2R6CA 1E62A 4RVSA 3IP8A 2YMQA 4AZ0B 5CBPB 4AP9A 2QG6A 3CLRD 1SCNE 3L6OO 5T4HA 4D4HA 2X8WA 1JE0A 2DHQA 2C9MA 2GJ8A 2CYBA 2JNWA 2X14A 3KKQA 4CTOA 1GPNA 4M9CA 3S8EA 3ISVA 3WZ2A 1U2ZA 4YGYA 1X13A 3RSCA 1VLZA 2ACEA 2D5IA 2DRIA 4INOA 1Y1QA 2CJFA 3T5AA 1AIPA 2Y1KA 2WTNA 4G1EB 1GSHA 2WZQA 5B7GA 3BXHA 5HIAA 3UY4A 5FHQA 2PO7A 4BYGA 4K86A 3WICA 3LG2A 1CIVA 1KQPA 2FPKA 3I34X 4L2IA 1QSGA 2OCGA 2VWGA 2YICA 4LHEA 4JYZA 3LXUX 3HCEA 1EXWA 1F4LA 3QFHA 1SG9A 1PFKA 1QS0B 5FOTA 1IOWA 2OZLB 3RDPA 1FLDA 4K87A 1DIGA 1X9GA 2HREA 3AI3A 5AI0A 4KMSA 3K92A 4RJKA 2QQFA 1LA2A 2HCJB 2RGUA 1UWCA 4URUR 1E2FA 4NYIR 4K05A 5U4QA 2CCGA 4B8YA 1H2FA 1II8A 2O5RA 4N5NA 1M66A 2RHBA 1QHHA 3BIFA 3KVNA 4QUBA 4UD6A 4IXWA 5F1YA 2JBHA 3BXGA 3O8RA 4YDHB 1OLUB 4A2QA 3A14A 4B17A 1AXRA 1JPUA 3QVSA 3DO6A 3KZVA 2PXCA 4JBGA 3IQWA 4ZVQA 1LWNA 4RM2A 1L7RA 2Y0BA 3OLXA 5IC5A 3BMOB 4Q1FA 4Y1RB 1QH1B 3UCXA 3FZYA 5DBEX 1KZ9A 4EG0A 4YT2A 4X3PA 4TTRA 3SFTA 5EUQB 3STYA 1WCXA 2WWFA 2I62A 4UDXX 5MDHA 4II7A 1ZOOA 2UYQA 4F38A 5LP6B 2WHQA 1GVNB 4FI3C 3GPCA 4NX2A 2HWYA 1P5JA 3AKCA 3CKKA 4IFBA 3S44A 2UYCA 2E85A 4Y2SA 4EELA 1ZAKA 3N0TA 3ZS8A 1HYEA 2D54A 2FPRA 3CVJA 3RSHA 2WTMA 3CEAA 4HJRA 4YUAA 3ONEA 1CHNA 2EJWA 3AMVA 3QVMA 3D1VA 3P9YA 5IF3A 1V71A 4OQ4A 4S04A 1QKKA 2X5XA 5JY1A 1X7ZA 3OEYA 2OBLA 4RD1A 1FJXA 3K0SA 1U0GA 3OU2A 3ONVA 3CVVA 4OK3A 1MENA 2HH9A 4WLVA 4YDRA 5LZ5A 3TECE 1Z4QA 1PEDA 4OBBA 5IT5A 3TYXA 3EK2A 5KX5B 1EK5A 2CSXA 2E21A 2WM3A 4PSAA 4TTQA 4ZEXA 1VKHA 3QEJA 4TSKA 4TT3A 1PQYA 3UUEA 5I51A 1VMAA 3F6YA 4MA4A 4H6WA 2N1BA 2ZWPA 5EESA 3VZQA 4B4WA 3PRHA 4V0QA 4PYQA 1J8MF 4BKOA 2RD2A 2UXBB 5EHXA 2BUCA 3R3SA 4UEKA 5TRTA 5HIKA 4AW9A 3THYA 2QW1A 1YB2A 4KQIA 1LWOA 2EEZA 5IVHA 5FA8A 2AC2A 1PG0A 2WNHA 2V5UA 4LC9A 1Y8RB 2NTJA 3KYBA 1W0JD 4MQFB 3ZCRA 1G5HA 3EY9A 1X15A 2P6PA 4Q19A 2DXIA 3PS9A 5H02A 2PO5A 3JR7A 1LW6E 1UL1X 1QYXA 2O7NA 3EJWA 1BVYF 1ZD2P 3JYQA 5KCMA 4EPXA 3CA8A 4F2WA 2F64A 1JDUA 3LAWA 3UVEA 2JLVA 2BM1A 5ICEA 5GQSA 4HWSA 3GGGA 2PX2A 2WJVA 2DPYA 3SAJA 3TI7A 1JIXA 4DKXA 3NETA 4J4HA 1JPNA 1SXQA 1RMQA 1SVKA 1OTYA 4M37A 4EUKA 3E27A 4BNHA 3KQSA 2H7CA 3C5CA 3WNVA 3M70A 2ZS7A 4OH1A 5DZSA 1ECPA 4NLLA 1CUSA 2IOYA 3R3WA 2SCUA 5IM5A 4Q66C 3EXHB 5FL7D 3B70A 3GOHA 2BJVA 4P4LA 3DWIA 5AK4A 3FWPA 1RDFA 1R8JA 3V2UA 2H16A 2AOUA 2Z3WA 4LJ6A 2ZLBA 4ZYYA 1CNFA 4PLTA 4NBVA 2I33A 1TM3E 1T5HX 2FEMA 5G40A 2R6ZA 4PIPA 1O6CA 3T5MA 1ZNZA 1CZNA 4KR6A 5EJFA 1E1QA 2BGNA 2GCGA 1ZXBA 2XUAA 2VHTA 2BYTA 4ZYZA 1LVUA 1Q1QA 3AESA 5COQA 5AW6A 1W2HA 1R5JA 4C0JA 4BNIA 3PUWA 3RGWS 4KIGA 2G28A 1XJCA 1HTTA 2CVFA 3A3OA 1Y9ZA 1UXGA 4HX2A 4OL9A 5BN5B 4CBVA 5BR1A 1NX6A 3DEIA 5C5IA 3AETB 3LPCA 5JMOA 3FJOA 3ISTA 2CCKA 4DCGA 4UE2A 4DT1B 4K46A 1BX1A 5KYUB 2N42A 1W36B 5JJCA 2VK1A 2GN0A 2PT6A 3P2MA 4RPCA 4UTPA 5TQJA 3QPBA 2OUKA 4ZYTA 2VP2A 2FQWA 2FMHA 2HRCA 2IOQA 3DL0A 3GFSA 3OECA 4D97A 2H3HA 3OMWA 4RK0A 4CMKA 4DHEA 5I8WA 1NVFA 1A9TA 3GFPA 4LXXA 3E8MA 4FN4A 1JTFA 1WA5A 1ZN2A 2B83A 3REFA 1E7WA 3ON5A 1EDEA 3VNAA 1E20A 1XXHB 1HQKA 3UCEA 4JITA 2WJ3A 2O2JA 2QTTA 4OHUA 5AYVA 1I4LD 2X4LA 5IN4A 1UXOA 4GQAA 1N6RA 2WIGA 4WN9B 3CUKA 4IX9A 1CR6A 3H5IA 1XPUA 2GWRA 4YV1A 5JT1A 1TA9A 3BEDA 4G5FA 1TUBA 5DNDA 1X8LA 2WIBA 4MCJA 3WAJA 2M1XA 2CL5A 3QEBZ 4RFLA 4EMUA 1IN8A 1IZ8A 3DEYX 3LHFA 1XYVA 1Z2OX 1QMGA 2F1IA 4OLFA 2SKDA 3C3PA 4HGRA 4LY0A 1ZGCA 4KXXA 1I0LA 4A73A 4DXAA 4Q9AA 1OYVA 3CNQS 3EZ7A 2P62A 1KXZA 3U3KA 3Q41A 5LMNB 1MC5A 3NBFA 4K6OA 3U4GA 4BB6A 4CN9A 2C1ZA 2NYRA 2WHRA 3OOEA 5SY9A 5L7TA 4KQCA 5IF9A 4UTZA 3FWKA 3CNBA 3CCFA 3SR4A 3IT1A 4OHBA 2DWQA 3IA7A 5CB4A 1I10A 2OMKA 4NPAA 4KREA 4PZ0A 3UMJA 1YBMA 1QHYA 2C3MA 2PU7A 3GJRA 3GZNA 3ILYA 3K9BA 4IEFB 4KJZA 2PK3A 4JCCA 2Y76A 4QOIA 4YJGA 5LA6F 4MUXA 5U1PA 5DM0A 3VZDA 1BOOA 1YB7A 3IALA 2QLTA 4NBLA 4YDSA 4H6XA 5TS2A 4PG8A 4Y98A 1IPEA 2L42A 4C4XA 4LVCA 1UXKA 3PITA 4BN5A 2BDEA 4X1KB 2LKDA 1HL3A 1U02A 2PRJA 3DMPA 3PVZA 3W1WA 3WA6A 1QHGA 1PN3A 3FKSA 4RIEA 4D3YA 2GPNA 1G41A 2EHJA 2XPCA 4ENWA 1BMTA 1MU0A 4NH4A 2AR0A 1BTOA 1DELA 4JJ8A 1NVKA 2AN4A 3TNFA 3ZJTA 1ZMBA 2VYVA 3R9XB 2IJGX 3I5UA 4QUEA 4TPKA 1XJ5A 2IUTA 3GVIA 4RTMA 1I2ZA 3FUWA 1OHHD 3D3WA 4MROA 4YBRA 2H5EA 1JFFB 3ZI4A 2LCFA 1VIVA 3A6GA 3LPAA 4GZLA 4WI1A 1F1JA 2IHYA 3UIEA 1XZPA 2OGWA 3H7AA 3UFXA 1KZGB 1T1GA 3UHFA 3V4FA 4XB1A 3HSKA 4OA8A 4HQOA 3DCJA 3HV0A 3M9XA 3OI7A 4M1SA 3S99A 1JEOA 1WB4A 1JNXX 2X3FA 3Q5DA 1JALA 3QBTA 3SVLA 5KU1A 2L82A 1XZHA 3D43A 4U3JA 2DR0A 2J46A 1HYHA 1UWKA 3UMRA 3NIGB 5TY0A 2VEDA 1G3RA 5A5DA 3EVGA 1WIWA 4MMZB 4Y30A 3ANTA 5FEUA 4GX5A 1C3XA 3OCUA 4EVQA 1GQFA 1FS4A 3BRCA 1DC3A 1GKUB 5ALDA 1CVIA 4F1WA 3BMNA 1DHTA 2PT5A 2EBHX 3VM6A 1R9JA 5G1OA 3TMKA 1I6MA 2I1WA 2ZPTX 3JQGB 4PZZA 1FXWF 4F4HA 5JNTA 2ZIAA 4W1SA 2FGJA 3BJZA 2VYQA 1YTLA 3RVDA 2YC4C 2PV7A 2XTZA 1QHSA 2WFLA 5IAOA 2QBYB 2IYOA 2Y1XA 4HPXB 3DKRA 3H42B 4R8MA 1HL7A 4WZBE 2WSIA 2FLVA 3TXYA 4DIFA 4BO7A 1P6QA 3FRIA 3E22A 4ZI5A 1FRNA 1JQ3A 5A6SB 3V4PB 1PGPA 4Z53A 3RO7A 2XYHA 4KITB 3C8HA 3B5JA 4WK2B 1V1RB 2WOOA 3ECSA 1Y7IA 1FTGA 3IURA 4PLWA 4HEA6 3KHKA 3ET4A 5ELXA 1W85A 3HWX1 2ZW9A 1DWQA 2AW5A 2D1RA 2YJ4A 3DO8A 1ZH8A 2AEMA 3IV9A 3MUEA 2VJDA 3EQ6A 4NENA 4EHFA 1O95A 1MVNA 3CZQA 5EMHA 1URPA 3SSOA 4BO9A 3H1PA 1YDWA 1I2CA 3E0XA 1RWWA 1KH2A 2ZVQX 2E0IA 4JXXA 3NKLA 5DRTA 1KIMA 1JJ7A 3U49A 4U2DA 3ROTA 2WAMA 3CVOA 4AZWA 1IN5A 1BKYA 5DF1A 3K9FC 4NYMQ 3NHUA 1XAHA 2FQ1A 3MS7A 4NSNA 4H77A 2OV2A 4CLHA 3DA8A 5IANA 3KSZO 2WAAA 2G04A 2XOKA 3F6SA 3A1CA 3NGMA 1TO1E 1M1NA 2X4GA 1O95C 1HTWA 3O83A 4J1SA 5F3RA 3O4FA 4BB9A 1MC4A 3I2FA 2H59A 1UCFA 4UDYX 2YV3A 2RI0A 1M8GA 4BFZA 3PEWA 3EMBA 4KBYA 4Q0MA 1Z2AA 1L5MA 3GLHB 5FL3A 3AU9A 4FZRA 4DIUA 4YRNA 5HTOA 1HWYA 1OZFA 2P0AA 4KQHA 4Y6RA 1H2WA 2A6PA 3CPSA 1Q6ZA 2XW6A 4EY5A 4I4CA 4E31A 4GRDA 4RYDA 1KVSA 3G02A 4FT2A 3AH8A 2E4AA 4Q01A 3CUVA 5A4MS 4RORA 3QXJA 1LV8A 2VK8A 3OJCA 3ZHCA 3EFEA 1UBMS 3BSSA 1CJVC 3VPFA 4L8FA 1LX7A 1T2NA 3UMBA 1U8EA 1GV0A 4G5SA 3EGXA 4LTMA 3AUSA 2RAFA 2YHSA 4BO4A 4EPTA 3KALA 3PWKA 4HAXA 5B7PA 3AVXA 3OLQA 4YFVA 1LLQA 2C03A 3L2OB 4MGIR 4HVLA 1YQXA 2P35A 1SKAA 5JH7A 3C87A 4KWEA 2W00A 3W4JA 1W48A 1VJ0A 4DCPA 4R84A 1VKOA 3VPHA 2GEUA 1PX2A 2VDJA 3G79A 5FO1A 4D02A 2W90A 1R5OA 2JAPA 3I0NA 2NU9A 3A9VA 1IPFA 4DMGA 5IJAA 1NBEA 3VPBA 3THXB 2H4YA 4H59A 3NHWA 4JBNA 3DOCA 4DIBA 1O3YA 5CM2Z 4IDNA 4D7AA 3G9ZA 1X7WB 3PWSA 3F97A 4X20B 3HDTA 3CLKA 5AJUA 4MHTA 1FC0A 2QJFA 4WHMA 3JVDA 2R1TB 5KDLA 3FY4A 4EA9A 3W5SA 2QRNA 2X4DA 4MVJF 3TJZA 2HMTA 1YHYA 4NZMA 1S7GA 3NNDA 4DIKA 3C3EA 3GK3A 4TXMA 4XGKA 5JXJA 1Z45A 1F1BA 4Y2QA 1SB8A 1RRCA 3LT5A 1JNYA 3MQ2A 1KEKA 4Z0HO 4H1UA 4DMCA 1CJBA 3NKFA 3DFIA 1NVVR 3U13A 3L9WA 4OTZA 3HQ4O 3JSAA 4IGIA 4KDCA 4U2KA 1RHJA 3N7TA 4GICA 2Q6OA 1OWNA 2RHCA 3OP4A 1KAOA 4E5SA 3DDNA 3FLBA 2ZETA 2OV4A 3AEYA 4QYIB 4RA6B 2V7UA 4B3FX 4BNYA 3BTSA 1DMSA 4FYMA 4MUNA 3PUXA 4BBAA 4EW6A 1I01A 2AI3A 5JQWA 2JVKA 4A8PA 3A9SA 1JH9A 4ARUA 3KJXA 4PO9A 3UH0A 1N6LA 2GDJA 3CH5A 2Z2YA 4BBZA 4EG1A 1XDGA 1G8KA 1XTZA 3JVUA 4HDSA 1GSAA 1EZZA 2WTUA 5K9ZA 1VXRA 1XZFA 4K0KB 1FJGB 1REQB 1GZUA 1ZEJA 5CXSA 1TGYA 1D1TA 4HATA 4HWGA 3UTDA 5A5EA 1GWNA 1U99A 3BH6A 2HFKA 3FBTA 2XNCA 4REMA 3T38A 3KZKA 5ENDA 2GASA 2PA0A 3ROFA 3WB9A 3KAQA 2BH9A 2Q41A 4J0JA 3F7OA 3GG9A 1DO0A 3L1HA 4OF4A 5E9WA 2VP3A 4J0CA 5KJ1A 4CMEA 1R6VA 2P2YA 1F12A 2QUKA 1N1EA 4YFYA 3RS0A 3K72B 1TK2A 2GBGA 3SDZA 2MT9A 5BYKA 3ANSA 5HIMA 2Y4NA 4O8CA 3ADOA 3QEMA 3GPLA 1ZN7A 4B81A 4NJEB 2BKVA 3RODA 4F93B 3R09A 1B1AA 2KM1A 2QX6A 5HFAA 4EBFA 9GPBA 3DBLA 4CXMA 1U04A 4QDXA 4C4AA 3L07A 1DRKA 1UUFA 3D3QA 2FG7C 4LI3X 4CF5A 4EHAA 1AA6A 1UMDB 5J58A 3HXKA 4ITVA 5ALWA 4G0QA 3ZHOA 5CD9A 1XE3A 3ZZ0A 2BTEA 3ESYA 1H2EA 2YC2C 4EZBA 4OHXA 4A03A 3L7DA 4IDHA 4CMEC 2OCYC 4AZVA 2VRCA 3QM1A 4JLOA 2V6JA 3LRTA 1GLVA 3QENA 4PQFA 2ZRMA 2ZSDA 2P2DA 2O8CB 2JIBA 4HRVA 3VU3A 3AGPA 3MWEB 3UHJA 3LFUA 4OFZA 5AKEA 2HXYA 5EZYF 2PGDA 1TTTA 1JKIA 1RVV1 1E1RD 3JARA 4OP2A 2CC2A 3V6LA 1AVTA 3PJFA 4GH5A 4JELA 3DO5A 3W9YA 2O1XA 3O74A 1TVEA 3CUEF 2JJYA 1D3AA 2OKCA 4M7OA 4Y6OA 1AKEA 4AF6A 4RVDA 3ROKA 1GIAA 4KFSA 2TSYB 1W87A 4CI0B 1B6GA 5K2OA 4FEEA 3LOPA 4I81A 5KYXB 4MRMB 4FGKA 1VIDA 1QOQB 1IN6A 3HP4A 4PLYA 3VKFA 1Y48E 1VFNA 1U5AA 3N70A 1GLNA 5G0VA 5DYNA 2OGTA 1V3TA 5IMSA 2GK3A 3CM0A 2J5KA 2QGFA 2XLCA 3MTQA 1V4BA 4XYEA 3MXTA 1CD5A 2ZAIA 4DREA 5I4BA 4KHZA 1PJRA 3HVUA 1Y98A 2H54A 2IEBA 1QTQA 1W35A 4LSMA 4D4MA 3OE4A 4IEIA 1OA0A 2R00C 3HVRA 4AULA 4F3TA 3VSAA 1JJBA 1USKA 3VX4A 3R7SA 1QO7A 4QG3A 1EBFA 4ZT3A 1H65A 1QFMA 2PAFA 4Q1AA 4IHQA 4K40A 4B6EA 3NV9A 4GSYA 2IEGA 2HDHA 2CDAA 4XARA 2FUEA 2HMAA 3M1AA 3UT0A 3NONA 1NV9A 1ODIA 3LS2A 4B80A 2DT5A 4QFMA 1N1GA 4K03A 1E3QA 3HGQA 3OQ6A 5BR4A 3IH5A 3RIGA 1NNSA 1SXGA 1YS1X 2YMLA 4Y2YA 4F8JA 3N1UA 1ZUNA 2X8AA 3B82A 1ZJZA 3HUUA 4CJXA 4HVCA 1BDIA 1A8QA 2JZOA 3L9XA 3OY2A 1CTQA 2VDLB 2YXEA 1ZX1A 1ULAA 1ZY2A 3NIFB 4R8VA 1EFPA 1W49A 1ZOSA 3U3OA 3UOGA 3HJNA 1Z12A 2PMKA 4IDAA 1OZGA 2W2LA 4MZXA 3K70D 3DEFA 1MABB 1RAGA 3W3AD 1ST2A 4UBNA 3OPYA 4DA8A 3ZV7A 1NVAA 4YPFA 3GARA 5AESA 3A2NA 4RS3A 2DUNA 1BDBA 1F0NA 2W37A 1DJLA 3K2QA 3BILA 1JAIA 3LTEA 4MA0A 4V0MA 3WRXA 1SCQA 1ZQ1A 4XM0A 5BPFA 1JEAA 5DLQC 3IJ5A 4HXGA 2ODPA 3OZTA 2XBMA 1JFRA 1K6IA 1NSFA 1GGEA 2IBMA 3UB3A 4BRZA 1WY7A 1WBJB 1AQYA 2G8LA 4LNHA 1M2FA 1QAOA 2LBPA 4OYYA 4OXNA 1IB6A 4MYRA 2C5SA 5E38A 2QVXX 3FCEA 5DEOA 5IAJA 3Q8LA 1M10A 3OA2A 1O0SA 4WXMA 3TFOA 4C03A 4W6QA 2F1RA 2A5JA 2VSOA 3OH8A 3MJVA 4WBXC 4EO9A 2F9LA 3AFMA 1IIRA 3I9V1 2WD9A 3WRXC 2ZJ4A 2DQKA 2G5PA 3PPXA 4ZQCB 4IDGA 2FPOA 4GI5A 1QDEA 2VNKA 3BFKA 3R3ZA 5FH9A 3OX2A 4V1CA 1C30A 1Z6PA 3FNBA 4K8RB 2B35A 5IUKC 1A8HA 3IVXA 2HAEA 3WKAA 3IV6A 5JCZA 2ZYUX 5DYGA 4C2BA 5KYYA 3WRVA 2REQA 3GU3A 5CLQA 2Y6VA 4M0DA 4R40A 1R8SA 4WOPA 2ZI4A 3UAWA 3VI3B 1IQUA 2XTAA 1D4FA 4KLAA 2A7XA 2YRXA 2HLDD 3GNSA 3MZ0A 3WO0A 4DC0A 1EPUA 3PDIA 3JZFA 8MHTA 3VTZA 4CV0A 4TLMB 4PCUA 2AWOA 1OBFO 1T2DA 4B47A 4R31A 1GQYA 2F2TA 3L7KA 4XXHA 3CC8A 3G1UA 5AHRA 4ER6A 1RWMA 1H5UA 1NQVA 4PINA 4NXNB 3MW8A 1YC2A 3GFGA 2IOHA 1Y1KE 3FSEA 5KTTA 3HXPA 5HGXA 4CQNA 4B6PA 2FMUA 5ITZA 1KYXA 5DASA 1HORA 1C50A 2R44A 3NRBA 4G0PA 1N6IA 4W5HA 1EFLA 5CNMA 1KEEA 1NE7A 2G9VA 5TLSA 1ZU5A 3W5CA 2R3SA 1QIGA 3RABA 4FFRA 4N7RA 3NQ41 3UM9A 5KU7A 4HXYA 1NBMA 2O50A 1YR2A 3FOWA 2NW6A 3G8AA 5AVZA 3O0DA 3GFFA 5CRIA 2WZBA 1W5EA 2A59A 3HSYA 2RGCA 1E1KA 2J6HA 1IXSB 2H1IA 2QMZA 1EQUA 1QNFA 3O1JC 5EL0A 2GBCA 3TQQA 4UVEA 3OJXA 1KOLA 3UK2A 2GPBA 2WWGA 3A37A 3NYQA 4KDEA 4LJ5A 2IHKA 3ZU6A 3GFBA 4RD2A 1AV7A 1YO6A 4RIFA 2NT3A 1SHLA 4WLOA 5C18A 4BEVA 1ESCA 2YIMA 3BCSA 5DMXA 3KFLA 3GD7A 4C0SA 4F3KA 5CCEA 4N5IX 1U0TA 5GJBA 5EJGA 5FTLA 2XMZA 4WNAA 5ALEA 4BMSA 1AUOA 2PUEA 1GG8A 2JFFA 1K75A 2JHGA 1B8VA 5MHTA 5CYPA 2GTHA 4M1ZA 5DI3B 3R0VA 3A4MA 3B52X 2BI8A 2VAPA 1CBUA 2WWRA 3GUHA 5FPTA 4MKHA 1D09A 5G0TA 1ISMA 1G55A 4JGBA 2O3QA 4PHCA 4BZPA 5KQMA 1U0EA 3SM3A 3C14C 5M2QA 1BVUA 2QVYX 1IUNA 3V7FA 5AKJA 3GCDA 2GBIA 3DE0X 1GARA 3RC1A 2XITA 4NEGA 1RWQA 1WZUA 3TNJA 2FYTA 4AJNA 4AKTA 1Y7PA 1EK1A 1XLVA 2PPLA 3CH6A 1XZMA 4XUEA 5LBIA 3RU3A 2BZ0A 3ZW7A 1JDBC 4BRSA 3E1GA 4TTAA 5AK0A 3G0DA 1IDOA 5GTDA 3O8DA 2IPOA 1Y8ZA 2QY6A 1OFVA 1USIA 1Y6GA 1DQPA 2AR7A 3OAAA 3KKLA 4JN6B 3ZNOA 5KQPA 1PT7A 1WPGA 4M1WA 2ZUDA 4LBYA 5LKRA 2WD8A 2FZEA 1Y1RA 2ZGVA 1MW9X 3GFVA 3VR5A 1LBIA 3V1TC 4PQEA 1SKMA 4Q3AA 1Q1ZA 5AM4A 1G4HA 2VATA 2IIQA 2Q5JA 2XLBA 1ZGHA 2PZMA 3BAFA 3LWDA 4M9UA 3ER8A 1KJ8A 1NN1A 1QH8B 5C7YA 1DG9A 1G1AA 1TRHA 5HOQA 1L6IA 3SQLA 3FDFA 1R3DA 2H9YA 4JOCA 3N2GB 3NDRA 4OOFA 2E7ZA 1KFJB 2AQIA 1E98A 1BFKA 1CY0A 3T3DA 4O02B 4H9GA 1H6DA 1WPRA 2IS6A 1YB5A 3MC1A 4OHKA 5C1DA 1Q7CA 4F21A 1ZR4A 5DULA 2VSYA 1DAIA 3DQPA 1EP9A 2FGKA 2IELA 3OO1A 1JDSA 1KI3A 1DAOA 4NAHA 4O4JA 5A2QA 2CDBA 4YJKA 1XRQA 4INJA 5JRZA 2UAGA 2WF8A 5ALSA 4DNXA 4PYMA 2KBEA 5JJBA 3OZVA 5D5PA 2BF7A 5LCXA 4OX9B 2JCXA 2PIAA 5D5QA 1RQ2A 4OMCA 4KQGA 3DXFA 2HBZA 1XQYA 4YHHB 4N5DA 4WA8A 5GOZA 4P54A 3Q15C 3IP3A 3VOTA 5HWSA 1AQIA 2P9FA 3ETHA 4JXZA 1PFYA 1EM6A 4I3FA 4MUEA 1GEGA 2Z56A 5E6SA 1FQOA 1SRRA 1NPYA 2HQBA 2XNDA 4E1AA 1DX9A 1Q3TA 4FFPA 3E8XA 1RKXA 4XTRA 4XIGS 5FJJA 1YR7A 2YJGA 2C2BA 3K9HA 3VV3A 2EW1A 2HK6A 1PJCA 1H85A 2JJQA 2WC1A 1OPXA 3O5AA 3VPCA 1JQLB 4TWBA 4M1TA 1IQPA 3UEOA 3F5SA 2BM9A 1J6UA 1DEXA 4RA9A 4ZIRA 5HF6A 4AY4A 3TQCA 2NUPB 1XNHA 3ENVA 4MS4A 1YA6A 1AN0A 4J07A 4E5UA 5EXTA 2CV0A 4YGXB 1U8UA 3QELA 1NVTA 4LRQA 2CXTA 3EGCA 2AL7A 3SLGA 1NWHA 2CHQA 2ZRHA 3PWTA 3PTAA 1G16A 3UPUA 2OHIA 1IEQA 1RM3A 4U7GA 3LNCA 1EQ2A 1BE1A 3R77A 2R8EA 3MB5A 1VLHA 3K35A 3P0EA 1N3IA 4Q7QA 1M9NA 4F8YA 2ATCA 5C1PA 1C8VB 1ZCBA 3V1UA 2RHWA 1VJTA 1DRJA 1LBQA 1YDEA 3N2KB 4N5MA 4TKUA 3WKBA 1AUXA 1GR0A 1L5VA 3WIDA 4YUYA 2O2GA 3W6OA 3HL4A 1FBNA 2JIMA 1SBZA 4XDGA 4ZHSA 2BMAA 2EJTA 1KMCA 2ZJ1A 3N2EA 4ZQEA 3VYSB 2GJSA 2A3RA 3WIEA 4XCQA 2W22A 3KBOA 5DGXA 3SYTA 1XFDA 3CR3C 2I7CA 3ML1A 4NZ9A 4ZI7F 3RUAA 5JJKA 1E4VA 1ZZGA 2V6MA 4PRLA 2FPPA 3QVLA 1G8GA 3NBKA 1XDWA 5HCNA 1T2CA 1C7IA 5A4DA 1ZK4A 1AS3A 2E82A 421PA 4M1YA 4QYSA 5CT8A 4QTYA 3CUTA 3ZCUA 4CMHA 2G88A 2GNOA 4GBJA 3GEEA 1AQLA 4RUKA 3VR1A 5TMPA 2MMGA 4H4EA 1GRVA 1L7MA 1QP0A 2D5AA 2L17A 1ORTA 4LZLA 2X1HA 3RVNA 2OXCA 3U17A 3LKDA 1FYWA 3CZ5A 1W8DA 4EG4A 1L8LA 1L5ZA 1YK1A 1RBYA 2PZKA 3W7VA 1DKPA 4F5EA 1TOAA 3A1EA 3MIIA 2Q5IA 4FJ0A 3L0SA 4Q16A 2R4TA 5L4LA 1G20B 1PUIA 3LY5A 5GMOA 2NPOA 3M3HA 5HR5A 4ZGWA 5JPDA 5GPBA 1Y4SA 4OK5A 5BYJA 1RLOA 3I83A 2ZBGA 1H23A 1HH4A 2ZB4A 3UAZA 5JOQA 2C95A 4GKBA 2CLKB 3ZWAA 3LW7A 3BE6A 1EBUA 3OIUA 1C7JA 1GN9A 1SBTA 4KV9A 1DDOA 1QDUA 4PF1A 4P5EA 2CF5A 4L8WB 4A6XA 3WLOA 4EPVA 5F3DA 1A96A 4GBGA 1Y5LA 5JANA 2GDZA 1ZOLA 3WQHA 1G0NA 2XCIA 3ZDFA 1CR2A 2XNSA 1T6XA 1U0LA 3UWDA 2FOLA 4B5LA 1PU2A 3W6ZA 1V11A 2VZ9A 3OO0A 3PGKA 4DXHA 2V03A 2CUZA 2BGIA 2I6FA 1GDHA 2ZE7A 3FVQA 1QYVA 2V0NA 4TXLA 5GGYA 4D42A 4P81A 1FFAA 3IIEA 4IYRA 2VHWA 5JXIA 1KJ9A 4NBNA 3UXEA 4MKXA 2AIRA 3V4LA 4G9BA 3UWPA 3BREA 2Z4SA 4BGUA 3LVFO 4PZLA 2I99A 2Q0XA 4P9NA 2I6GA 3QWAA 4JI6B 1ZOPA 4INAA 3UMGA 5C1OA 4I1RA 2GEFA 2D2EA 2R85A 4M21A 3TTWA 1X8JA 2CHUA 1Z2DA 3I39X 4HGZA 1B8OA 3LVBA 4D74A 3I61A 2W8ZA 3LDGA 4I1UA 3F5MA 1YJAA 3FF4A 4PM4A 5EIBC 5LQUA 4MQEB 1E4EA 4PLGA 4JHXA 3VSEA 1UODA 4MUMA 3EIHA 4CIDA 1E3LA 1EVZA 4EYGA 3HI6A 1Z8DA 2A58A 4JJGA 3G0HA 1KYIA 2V96A 2C31A 1XRJA 1JIIA 4YB8A 4ZQFA 1RVDA 1D1SA 2JCBA 2JIZA 3G6WA 4I08A 2YR0A 3FE2A 4DHWA 4BEJA 1FZTA 1J0DA 4Z9BA 1R64A 3I1IA 1ZVVA 3CKLA 3QWIA 4PZCA 4CW7A 2ERYA 1BG6A 4RIIA 2RBGA 3TTTA 2IEIA 4AY5A 1JWLA 1U1EA 1R15A 2X7XA 4DC1A 5K4AA 2NXCA 2EQBA 3AM3A 4M0CA 1XDUA 5EYPB 2I34A 2UVQA 5DB4A 3SC4A 1G1MA 3L01A 3I09A 1CJSA 2WKWA 2F3TA 2E4XA 4Q7LA 2G8NA 2IUFA 3WGHA 1NOJA 2HK8A 2D62A 2XHEA 4LSGA 3HU3A 1Z6XA 5JJLA 4TQGA 4N3GA 1QPZA 4C6RA 2NTNA 4HSEA 4EZEA 1H22A 3TTSA 5EP3A 1R8YA 2A0XA 4O3FA 4BZXA 2V7BA 3QJ5A 1B00A 4URXR 5FUVA 4H6VA 1FLNA 4YAFA 1TA4A 2VP5A 5B37A 5K3EA 3ACBA 4O1MA 3R7LA 4EHIA 4OI0A 4L2IB 4O2BF 5KYWA 2VF7A 4B5KA 1V95A 4NMLA 2WG2A 1GSOA 5F73A 4ADSG 3EC7A 4K9RA 3QX3A 4QNMA 1CQXA 4R2IA 4OHWA 1G7CA 3W04A 3FCOA 1Y4AE 5AUQA 5LA6A 4EG5A 3PIRA 3GLFA 3OQIA 4DJTA 1DZ3A 4K9DA 1XTIA 2GAIA 1WBBA 2QKYA 1GYPA 2WUDA 1OUMA 3GZTB 1Z56C 2CL6X 2VXOA 3H8VA 2DCUA 3KRTA 1KP2A 4KIJA 1KZ6A 4NYMR 3W34A 9ABPA 3ZY3A 1UC9A 1II8B 4JX8A 3A10A 4WY5A 2HSZA 1DC5A 5LL6P 1A9SA 1QHHB 2VDQB 4LCBA 4F4IA 1TUGA 5TR9A 1FQJA 1HF3A 3KQNA 4DUYB 1B14A 2V98A 4GI1A 4IS3A 1MG0A 4UBJA 1N2CA 1QO0D 2D0DA 1JEQA 2HJGA 2WBLC 3ROZA 1LLUA 3TQTA 3KQUA 1C7ZA 3PTLA 2QU7A 3FHJA 2YDYA 4U7FA 4W82A 2E5LB 4D4JA 3R6DA 4IDDA 2BFMA 4UCFA 2EJBA 1OSNA 5CR9A 4FB4A 2X86A 4GZMA 2WKRA 1H9BA 1JG2A 4KDRA 5LB2A 3HJFA 5E8RA 3LM8A 5JU6A 1TXGA 4HQKA 4GDFA 3CLVA 1QIEA 1JWBB 3G8CA 3IKMB 5HZKA 1OJ7A 3BK2A 2IEYA 3VJLA 1R0KA 4B34A 2BF4A 2GRUA 2V58A 3LK7A 4Z8YA 2RH4A 3WR5A 1OYYA 4D4IA 2GAAA 2YCLA 5BNIA 5A04A 1CF2O 3I4LA 5EI5A 2OQIA 5LQDA 3V7YA 3ZU2A 2V7WA 3NAQA 2VRWA 4HCJA 3F5DA 4NS4A 4W5QA 4FWTA 2VZ0A 4BPRA 4FSHA 2WP8J 3DOEA 3DT9A 3H5VA 3M49A 1X7ZB 5CPFA 3BRWA 1NUTA 4BCCA 4X41A 3DAYA 1C1YA 2WKSA 4KTVE 4L16A 2H1FA 5CYOA 2ZB2A 5DK6A 5AR1A 5TC4A 1ISFA 3WK7A 5BOSA 4DR5B 3ITKA 1ID8A 3ANXA 1VBFA 1NTOA 2D4HA 3EUAA 3TQRA 3ANNA 4FDUA 1PJSA 2HA5A 2IF0A 3ESBA 1KBZA 1NFRA 2XD9A 3MJEA 2Q5QA 5IAEA 2RH5A 2QRVA 2O0JA 1X7XA 2I1VB 3MD9A 3VU0A 4BQOA 4G0UA 1XEWX 1PKXA 1IXZA 2OY0A 1FSSA 4KGXA 2W93A 4P6VF 4XTCS 2HZBA 1MOSA 3THYB 2EKBA 1PHPA 2QDKA 1KNQA 4HZUA 2YWHA 1G6Q1 1BO6A 2LCIA 1IBMB 5HDQA 1E2BA 2R97A 2WA2A 3O9MA 4HUJA 1YU6A 4RK5A 3V7UA 1OU4A 2P2NA 3EA0A 3U4QA 1HDOA 3NBAA 3DONA 1TKRA 1KI7A 4LGMA 1T0IA 4R0VA 1SBHA 3HCWA 3ZQ4A 1K1EA 2GHIA 4RVHA 1T0BA 1M2KA 3DL4A 3VNRA 4P53A 3DULA 3CINA 3K1JA 1ARZA 3TBHA 4OHPA 3V97A 2O8FA 1E2IA 1NX9A 4JFRA 5J4YA 4RKQA 1HURA 3EQ8A 5AW4A 1YZNA 1TW2A 2GCOA 2Q1YA 3T12A 2NO9A 4D57A 1YZGA 3H1EA 3RS5A 4BEWA 5AJYA 1H2XA 1BD3A 2QD4A 4WV3A 3PZRA 4DNQA 4EY4A 4Z5XA 4IVNA 4Q47A 4RK6A 4BLUA 4E3WA 3FNQA 4A9AA 1GA4A 1VG8A 3PNKA 3QX9A 3QXXA 4MJ7A 3IIKA 1SVLA 5CEJA 5K2MA 3E5RA 2ZE6A 3L4EA 5IXSA 1MIOA 2C92A 4M0MA 2JLUA 4E5PA 3DOIA 2GYUA 2SCUB 1LQUA 1Y0BA 2ZQYA 1JDPA 1FFDA 2W6OA 4NG4A 1JF8A 1TVCA 2W6QA 2EDCA 5CXXA 3QZUA 4DMHA 1JQAA 3WLJA 3HUDA 5CX4A 2AOUB 3U80A 5H0IA 2Y68A 5JS8A 1JIUA 4CTMA 3WL3A 4NOKA 3TUZC 3L6CA 1TLTA 4K6HA 4M8IA 5F98A 3PX3A 3FCSB 3LW8A 5AICA 2NTYC 1F51E 3AESB 1V9LA 4RL4A 4LZNA 1FDIA 2B1RA 4FX5A 1PT9A 3GJZA 4U7HA 1TEHA 2FY8A 2Z98A 2PJDA 4X8OA 5TQ2A 4C7KA 4TTJA 3LC7O 4AICA 5EP4A 2X77A 5INTA 2HF2A 1DLIA 2CSUA 3F4LA 4HFNA 4IOMA 2FQXA 4WFKA 1OAOC 2IY8A 2FKNA 3ODPA 4CKBA 1JG6A 3FETA 1XZAA 2ZBPA 3LZDA 1JPJA 4RHYA 3STHA 1GUZA 1VDZA 3WLSA 4NZYA 3RQSA 4BAGA 4BECA 4OHVA 4UPEA 5FPPA 1YFKA 1BHQ1 1XWWA 3LP5A 2GPSA 3N7UA 4Q00A 4ZT6A 5TPZA 4UQLA 2EERA 1SQGA 4UFNA 1JB1A 3TIVA 3LDFA 1RFLA 4H60A 4CI9A 2C5HA 2QJWA 4DCCA 5JS2A 2J9YB 4XCXA 3RFUA 3OQOA 2QR5A 2ECFA 4RS4A 5A5VA 3Q0EA 3WWEA 1EWVA 1Z5VA 5IU6A 3F8WA 3WLAA 2EC5A 3D8TA 3AI7A 3EJ6A 4FFBA 4MWBA 1BHSA 4B0PA 3EMKA 2AI2A 4C7OA 3WMGA 4FGJA 3SHVA 2B4TO 2ZJ8A 4Q24A 3HO1A 1WDTA 1XHLA 4H1HA 3CEPB 1TUBB 4M36A 1TVKA 5H4GA 2YJNA 1QGED 1U9YA 3HCAA 3TRKA 2EFGA 3DTYA 2ZYIA 3E4CA 1PV1A 2BZGA 2K2QB 2VTKA 1HKUA 2O7RA 3FZEA 4Z0PA 3THWA 6AT1A 3GUYA 2QR2A 3IAS1 3PA6A 1U3TA 4C4OA 5DXAA 3VZBA 2WF5A 4EHDA 5ITWA 1ONOA 3FPKA 2R65A 2VBIA 5FPKA 1IAVA 1OH5A 4FDTA 1B0PA 4JK3A 1Z5UA 2B3TA 4MVJA 4Q9JA 2GBFA 1R0LA 4Q3OA 4XWOA 4AJJA 3OBBA 2NZVG 3P52A 3EMDA 4M3NA 4N7MA 1B43A 1ZA1A 3DFMA 3IIMA 4PGHA 1UKZA 5CB4B 4ZCLA 3CX6A 1QRAA 3OSUA 1DJNA 2XQFA 3CX8A 4JBXA 4JUAA 4NRDA 1DCTA 3KXIA 3M1YA 4CQJA 3GZNB 3ZWNA 2CJXA 2H29A 4YJGB 3K9NA 1JSCA 4UHEA 1KMQA 2FG6C 2XZLA 1SKYB 5JSUA 1ZO8A 2FHSA 2HCTA 1XKXA 3LT2A 3PUJA 1Y34E 5DN6D 2VSXA 1JAZA 3PLNA 1HEIA 1OIXA 3A1SA 1AQNA 1CCWA 2OWDA 2Q1UA 3RVSA 4BUZA 5DE3A 4N4AA 3GT3A 4P7BA 3IDAA 1Q57A 1YH3A 2BFBA 4PPFA 3U3DA 3ZWQA 1G5RA 1QIIA 2AC7A 4E2FA 1CUFA 2C00A 3DD1A 4KSYA 5F21A 1CUUA 1KS2A 2RFLA 1Z29A 4HFMA 3SVZA 3VMFA 2KPOA 5K3FA 3CF4A 4P2GA 5FWDA 3IDFA 2CMKA 3D3WB 1UDAA 4NDAA 3WIVA 4Q1BA 4B33A 5EPEA 3C6QA 1DBWA 2ZYVX 2F90A 1MX5A 2XODA 4TWZA 5NLLA 1F8XA 4O2RA 4R3NA 3GJYA 1ZI6A 4Y9TA 3RNLA 3UFXB 1KDOA 3QXSA 1NVXQ 2PRSA 2XYQA 4NI5A 2OENG 1OXTA 1B3RA 2W6MA 3W6UA 4RY0A 1P0MA 1OI3A 3DEAA 3QSGA 5EXXA 4U3JB 4TMXA 1KI9A 3T7EA 5C35A 5KTNA 3GI1A 3EG9A 4QQKA 3SZUA 4GGOA 2FW9A 2AQHA 4TSRA 4BC0A 4TKZA 1LK0A 3Q98A 5FBRB 3LUKA 3JQFA 4QBIA 3ZV5A 2AJTA 3C4QA 4LXHA 4ZO7A 2QL7A 1HBJA 3HP1A 3W2HA 1HLDA 3AZQA 3E9YA 4HBZA 5JRDS 3WLRA 3BMNB 3TUJC 1SCDA 3Q6NA 4WE3A 4WZBA 2F48A 1DCFA 4D4KA 3NR2A 3FR7A 4BCDA 2VPTA 1G6OA 1W6RA 3D6NB 4N54A 5C80A 3EG5A 3NHPA 4TS9A 1KVTA 1XTTA 2NACA 1YZKA 5EZYA 1T3GA 2WYIA 4D81A 5JSFA 3NXKA 2C9ZA 1ISIA 2WFLB 3OLWA 2Z2ZA 2HT1A 1G4UR 2HHJA 3KJGA 5CU7A 2WQ6A 1XD8A 2GEJA 2V5AA 3E22B 4MDFA 4DSAA 2VT3A 2I2CA 4NQZA 3QLVA 3C41J 1Z4MA 1PDWA 5DX0A 3CVWA 2GR9A 3SDSA 2A33A 3T7IA 1T5LA 3O9ZA 5LMZA 1ESZA 1DEKA 4M0KA 5T5QA 1W85B 4IV0A 2PRIA 5IJXA 5SY6A 3W05A 1LQTA 1JG4A 1QZUA 2H2WA 1GZSA 3FH0A 2C8LA 2YZ7A 4I99A 4NENB 4D0LB 4RTOA 3R7DA 1ZD8A 1Q7BA 3M89A 2GPJA 1JDNA 3IP6A 2PFKA 1RJEA 2F8LA 2G4CA 4DLWA 4DCSA 1BS2A 3A2LA 1HNZB 4I4LA 3F6EX 1U31A 1IBRA 2BFPA 1PS9A 1ZC4A 4MKGA 1NDHA 3CNEA 5EAIA 3DAPA 3QLVC 2W2PA 3I6YA 5J5CA 1JG3A 2FSIA 4KVAA 1N6PA 5FR2A 1XL1A 2A0WA 3B1XA 2O14A 2O2DA 4ZVKA 2XDQA 4DM4A 1S9HA 2XV1A 3FNGA 1SXJD 16PKA 4X1OA 3HTXA 2QV0A 3IJRA 3LF1A 2ZBRA 1M1NB 3IVGA 4FK8A 3IA2A 3OUUA 4CQMA 4CTJA 2GNAA 2FWRA 2Q3FA 3WLPA 2GXAA 4PE5B 2AN3A 2FHPA 1EZ4A 2QZPA 3QEKA 3RRFA 2YJ6A 5KKAA 4GZ5A 2B1GA 3IQXA 2CMHA 1EFKA 4XVQA 3RKUA 1XK7A 1AB6A 1GHTA 2P6OA 1EGMB 5BNWA 2AG1A 4Y6GB 3WP0A 4EHNA 3B6KA 4AJEA 3ZVNA 1NG1A 5JBNA 5JSYA 5LR6A 2VHCA 5SZKB 1DIAA 3V48A 1BU8A 3U7IA 2EQAA 4DZZA 4LXIA 1G2IA 1ONSA 2QY9A 3GLKA 3RSLA 3WG9A 4BP9A 2ATIA 5CVTA 3AYXB 1AX9A 2JGFA 1KVQA 3WQQA 4B83A 2QJOA 3BHJA 4FBGA 3O47A 4R71A 3GLIE 4DR2B 3KO8A 3MPUA 1ZLXA 1F14A 1SO8A 1B15A 4TTIA 1H2ZA 3ZY5A 4E11A 4QFDA 2YOFA 4I4TF 4BP8A 4ZJZA 4D25A 2HUNA 1F5SA 2Q4BA 4JC5A 1JEEA 3EGXB 3HYLA 2ATEA 1D6MA 4HN4B 4RY8A 4JQZA 3IT0A 5TT1A 2RHHA 3SIXA 1MP0A 3TMYA 2YWEA 1XO1A 4LYAA 3CNNA 4GL2A 4QUAA 4UM9B 4YP1A 5JH7B 1A98A 5DGHA 1Z0ZA 4FQ5A 3ILXA 2C2MA 3B1FA 5DCWA 5F33A 4J7CA 5GP1A 3E05A 1PJ2A 3NI2A 3QF4A 1GNLA 3MHTA 1SUDA 2XQKA 3RRNA 3B6ZA 5AP9A 2BRUA 4UHBA 3NOVA 2NU9B 2YWDA 1MO4A 2J0UA 1IG3A 5FTNA 2HEIA 5F12A 2IHTA 1TDJA 2ZR0A 1OAAA 3TOXA 1DO2A 2GUGA 5THKA 4BV9A 2AOVA 3TI9A 4RMNA 4JI7B 3FJ1A 3D8SA 1RXCA 1FNBA 2GN8A 1EG7A 1I14A 2DZDA 3BXEA 4FMPA 3OHPA 3U5ZB 2JGNA 1RKUA 2AKAB 5DWVA 3E2IA 1ZHOA 2WHPA 4QPJC 2I4MA 4TOIA 2JKYA 5C8ZA 1O54A 3LSYA 1RPJA 2YINC 3KR1A 3NEYA 1GTSA 2BRUC 4HFJA 2WDZA 2JLSA 1QIDA 4HEQA 4OKSA 4CT0A 3K05A 5FDFA 3R3HA 1GTJ1 2V6BA 4QZVA 2DB3A 1CUCA 3A6KA 3BJIC 1NUPA 1YZFA 1BWRA 1LPAB 1TZBA 4RLQA 1OJLA 3MT7A 2HIMA 4HOYA 4B8ZA 1I3KA 2E9SA 3S4YA 4PIVA 2B98A 1XPRA 5J2TB 1UWVA 4P3OA 3BTUA 5BXQC 2XUJA 1D2MA 3CUWA 5DHTA 1MVOA 1ECBA 2DPXA 3UYKA 1YUMA 3HN7A 4I1OA 3C6MA 3NBMA 4HDSB 3TX2A 2VJQA 3DGFC 2X0EA 3QX7A 1AGRA 3GEHA 2W2XA 4D79A 4LOLA 3GFQA 1Q17A 3ZHVA 2AFRA 3V4OA 1BXGA 2PLFA 3LT1A 3ZTWA 1IBKB 1PNOA 2FEPA 2BZ1A 2P78A 2A78A 3KLBA 2Q1TA 4D4GA 1AK1A 1RPAA 4BVEA 1P1KA 1TEVA 3IVAA 4UNPA 4JOQA 5EHGA 2F59A 3AZOA 4OQMA 3RI3A 2N0SA 2QRMA 1UM8A 2Y93A 1TZ2A 3O3OB 4QWMA 4DWVA 1PRYA 1QZXA 3U40A 3MWFA 4EATA 1JGTA 5BV0A 3ZCQA 4YY3B 3AOEA 3GGJA 1C9NA 2Z5LA 4G1MB 4M1QA 2W6JD 3QEMB 3CLRC 2G7ZA 2ZUCA 4AJPA 1XTQA 1R0YA 3M34A 2Y8EA 2Q3LA 4G0XA 3V1KA 5E2IA 3T61A 3DBLB 4HLCA 4KCGA 4CL3A 1DRUA 2HC9A 2MU1A 5EERA 4YJFA 4W7HA 2QENA 4ZVPA 3GRFA 1RJFA 4W8OA 5LFAA 4IKOA 1EUCA 3PA8A 4M54A 4QM6A 4RPJA 2YOGA 3BZWA 5B4TA 4RULA 4R01A 4Q3EA 3O4RA 2OYRA 2Y2UA 3BKXA 4CMJA 2Q07A 2WE7A 3AOEC 3BFXA 5FI5A 4QC2A 4F8EA 3EGDA 5K03A 2KYRA 1S4QA 3IUYA 2P9TA 1DAEA 3HCFA 1NVBA 1VPLA 5JNSA 1MVLA 4QQFA 5CLFA 1T26A 4MV1A 4RVGA 5EXPA 2JEZA 1UOOA 3JARB 1Z62A 1MO5A 1X70A 2YWRA 4JXJA 4YP0A 1NJ5A 2BKXA 1BQEA 1WJGA 1NBOA 2WK1A 2OORA 1JWAB 3PUZA 3FROA 4PN3A 3CN9A 2V7QA 1E6LA 3DCYA 3LD9A 1R4MA 3M6LA 4DLLA 4RVNA 2IWHA 1O97D 2LGJA 3KVRA 3PHIA 3WFIA 3GEIA 5LQRA 3WX0A 3USCS 1KARA 1KC1A 1U2RA 2CHEA 2Y1EA 1QORA 3D5QA 4AJIA 3FOAA 1WXXA 1RZRA 2B69A 3ELBA 3N2LA 5MN6A 3ZXYA 2X15A 2HB6A 1ZR2A 1OYWA 4OK6A 4OGWA 1N5JA 1NI3A 1Z2PX 1BGVA 1E60A 1WXIA 1UDCA 5ALPA 5EN4A 3VR4H 3A58B 2FSGA 3OQNA 2OORC 2FWIA 4P3YA 2NUAA 2PZBA 2F1JA 3Q2KA 2QD1A 1LC0A 5TMEA 5KMGA 2D13A 3CRRA 2C78A 4R1QA 4KR3A 2KE5A 1V2GA 3UF0A 2C2GA 4PHHA 1BMFD 1VIYA 3Q7QA 1F17A 4F5WA 3O75A 1ZZEA 3WGZA 2YHUA 3IUQA 3RADC 2C2KA 3KXDA 2C54A 3VYTB 4ODIA 4QBHA 2PQ0A 4CM9A 3LPMA 4GFDA 2AI1A 1FFHA 1Z25A 2CLOB 3KZXA 3CRNA 2XCOA 3J7AC 1P1CA 1JZTA 1ES9A 2COUA 3GPIA 1BEUB 2PJUA 1JG7A 1N2BA 3AF5A 4B73A 2ET6A 2YXNA 5U9CA 2WQZA 4KWCA 4WGGA 4X0EA 2WE8A 1G3MA 3A9CA 5ALYA 1Z63A 3K9QO 3AFIA 1NOIA 1WG8A 1HT1E 1ZUNB 2C2YA 2B2XA 1CQJA 1WCIA 3HRHA 4ZYVA 1VSUA 1KO1A 1MMFB 1W0JA 1GITA 1GQSA 2W2QA 1P7CA 3C8UA 4H7KA 4JFAA 3V1MA 1EFPB 1KNXA 4BBPA 4KB5A 3S2ZA 3IXMA 4KQXA 1F60A 4PCVA 5GV8A 4JJIA 4R9NA 3WJ1A 1X0XA 1ZK0A 3SE0A 3NORA 3M2PA 3OPYB 4N8SA 3V7WA 3N53A 4CU5A 1H4QA 1PEAA 2UUPA 3OZRA 4MVJP 4DLVA 4ZFNA 3R40A 4OO3A 1QMPA 1UBLS 1Z06A 1I7DA 3NMUF 1Y89A 2F43A 3DPUA 4IP0A 3NKVA 1G8SA 1OKKA 3AY6A 3RBVA 2AYXA 3ESQA 4DFDA 3FKQA 1O4VA 1UEIA 3PVSA 4IEEA 1N8KA 5FL7A 4RXUA 4BQPA 1MT3A 5K51A 3K2BA 2WVAA 2OBXA 2FPIA 2QF7A 1J2EA 3DG9A 2GCNA 3F5QA 3RS2A 2IXBA 4X7RA 1T91A 3UN1A 5HFJA 3G0CA 5TGZA 2QZ9A 2BI4A 2YQ5A 1UP6A 2FW7A 1VSQA 2HWWA 4EYEA 1SA0A 2WEKA 5HVNA 1F4VA 5MF6A 3SXJA 3DJFA 1DQZA 4WK4B 4V1CB 1RQXA 2YRFA 3TQHA 1C30B 3PYMA 2X9NA 2XADA 5JD3A 4ZI7A 1J0XO 1C2YA 2TS1A 4CL8A 3TOVA 4EFNA 2G71A 4G0MA 2MR6A 1SCUA 5FRDA 4J2TA 4ZCIA 1P1FA 4Z2AA 5B6PA 3H3XA 2REQB 3LQ1A 5KYYB 2AQ8A 2C82A 2VXBA 4WRRA 4DLTA 1CETA 3KR0A 3THOA 4AAYA 1OFHA 3PJRA 1DXHA 4EHBA 2AMJA 1S8AA 3F73A 3NFRA 1BVRA 1C7EA 3WRYA 2CLCX 1G5FA 3B2QA 3PDIB 4IZOA 3ZY6A 2WNIA 2JA1A 5AJVB 3AR5A 3H11A 1LY1A 3IUBA 4FFNA 3E9NA 4C4ZA 2NVWA 3ZE0B 1EX7A 1U7WA 4U1RA 2E48A 2BMEA 3W4KA 3KOXA 5BN3A 5LJIA 1NW7A 4JYAB 3U3MA 3VH1A 4HDOB 4DDMA 3ICEA 3MUNA 1MO3A 4XQCA 1EBBA 5ITZB 4U0JA 3IO5A 5KSPA 3U9TA 5KOHA 1WZEA 1KEEB 3GEDA 2JG3A 3G9QA 5TGTA 2P9CA 3WRYC 2VA9A 3CZMA 1VHQA 3BDAA 3KG2A 4RMJA 4YAUA 1SIWA 1VP9A 4WN9A 1DDIA 2ICAA 2EGHA 4POAA 5FFFA 4AP5A 4NJMA 3SI7A 1JR3A 4GU5A 5B53A 3IPXA 3IT3A 5ECDA 1XA4A 2Z6VA 3VR5H 1SY7A 2R84A 1OZHA 2FPGA 3NIBA 3WYEA 1TT7A 1F0KA 1OX4A 5CDTA 3DHYA 1CUBA 1QQTA 2GZ1A 4GLBA 4G41A 2DM6A 3DUWA 3GJ5A 2GF2A 1VKZA 5FBHA 3V2HA 4CZ2A 4ZYUA 5AK6A 5JNWA 3CSSA 3I2KA 5DHQA 1NR5A 4WNAB 3ZGXA 5ER6A 1JDBB 2QN3A 3DE5X 3LUCA 5I9IA 1QG4A 1L5OA 3IMKA 2Q7XA 2LZ0A 3K32A 5FD8A 1CQZA 2G9NA 2AZ4A 4F6RA 4BTVA 1SVNA 4JP1A 5KYVA 2Q8QA 5HTKA 4MUGA 1KPIA 1VPTA 3H87A 3AHCA 3PEFA 4L85A 1KAMA 4Y9SA 3BWBA 1SUSA 3AJ8A 4JLMA 2R6FA 2HUPA 3WZMA 3LHKA 4LDZA 2NZYA 1Z15A 3B20A 3HN6A 4Q4CA 3U3ZA 1PWEA 2XUHA 1LSSA 3LQYA 2ZAGA 3C4JA 3RM3A 2ANBA 3BT7A 4BFVA 2J07A 5J2TA 1FX0A 3MCVA 1W5TA 2FKAA 5ESWA 1NMXA 1OLSA 1OHHA 4LSWA 4S2UA 3C6XA 3O90A 2H06A 1XU9A 2NO7A 3BXOA 4YK7A 4HWRA 4ZYWA 1SVMA 1VMIA 1J8VA 3TSOA 4XSGA 2D3TA 3P71T 4EB6A 3OLZA 4GI2A 3RFCA 3IUSA 4RVUA 3S7ZA 2C4HA 3CPEA 3RK0A 3VO9A 4JY7A 2CFTA 4X91A 3UANA 3ZE9A 2OC9A 3ANLA 2ERXA 2H0QA 2IYYA 4HQFA 2H7VA 3VVLA 4DQKA 5JROA 1FOEB 3LWNA 1QVVA 1U2QA 5FUXA 1E9SA 4L5JA 5KOYA 3C8DA 4UFOA 1YHZA 2FPWA 3LKBA 3LVQE 3QFRA 1E9BA 1UK7A 4J3FA 1X7GA 4TMFA 1Y5IA 3S2IA 3SHTA 5IDXA 5IVKA 2FK7A 4MIYA 1L7QA 1RQRA 1UPCA 3F7MA 3OZEA 1R4ZA 3QW4B 2B37A 2WV7A 3VHQA 1C3VA 4ZO8A 4PR0A 5AQ1A 3GGDA 2QROA 1DI0A 4O4JB 2C4KA 3ZHYA 2P9QA 2WKPA 2GLTA 4FQ7A 5JYDA 5F1PA 4A15A 3D7SA 4FDAA 1GNTA 1RYNA 4N82A 3IDOA 1U1CA 1GADO 4EJMA 1KETA 3QPDA 4IXDA 1IYZA 1TIPA 4QT0A 2IYRA 2O2XA 2QK4A 3ZGZA 3T15A 5KYNA 1LH0A 4R1OA 4ENPA 2JCVA 3VA7A 4HT3B 5E6SB 3I0MA 4CIAA 3RC2A 3KLMX 1FUYB 4IOKA 4W9MC 4YI5A 1U11A 4KNWA 3IULA 4DNPA 2I9PA 1L1FA