3RHSA

Phosphopantetheine adenylyltransferase from mycobacterium tuberculosis complexed with coa
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Three-Dimensional Structure of Phosphopantetheine Adenylyltransferase from Mycobacterium
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 52
structure length 157
sequence length 157
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3rhsA00
5KHAA 1K92A 1K97A 4XFJA 3CLUD 2PXHA 2IELA 2A1UA 1WQ3A 2VXOA 4XSVA 1MJHA 1NUPA 4OUDB 3CLUC 4JXZA 4YMIA 3IODA 4WNYA 1NURA 3ZJTA 4MUHA 4NX2A 3CVWA 4MW9A 4GRIA 4CQNA 3TS1A 1O0BA 4ZT5A 3P52A 1JILA 2H29A 1TYDE 2J09A 2PZAA 4I6GA 3DV2A 4XFDA 1O95D 1V8FA 2Z09A 1X6VA 3F3MA 2O8VA 3PNVA 1EFVA 3IVXA 1R6TA 1EFPA 3I05A 4MUNA 1O95C 1I2DA 1R6XA 2A86A 2EL7A 1KQOA 3HV0A 1LI5A 3G5AA 2XRYA 3MLAA 1J70A 1TQ8A 4EG3A 4EG8A 3COZA 3SEZA 3TQIA 5J5AA 2QJFA 1V47A 2ZUEA 1MRZA 1KAMA 3ZXIA 1S4MA 1JECA 1VBMA 3ZJVA 1QRSA 5J59A 4G5FA 4NZPA 3AIIA 1GAXA 1XNJA 4ZCPA 2DXIA 3CVYA 3ZXSA 1YI8A 2HZ7A 1KKUA 1O94C 2GOYA 3N05A 3H9BA 1BS2A 5FO0A 4EFKA 1VBKA 1XNGA 4MVWA 1T6YA 3HGMA 1EE1A 1LW7A 4UZFA 1JMVA 2B7LA 2JAXA 1Q77A 3ND6A 4ZT3A 3QTBA 3UOWA 2BTEA 2OQ2A 5KCMA 2AZXA 2NZ2A 3KT0A 2CYAA 2DLCX 3PRHA 4WSOA 4K03A 1G59A 3IDFA 1D2RA 4KPUA 1XNHA 4MW4A 2DR2A 3AG6A 2PZBA 3RK1A 1EUQA 4ARIA 1N2JA 4L2IA 2IP1A 2DERA 1QRUA 3C8ZA 2VTBB 4TS1A 1O96A 1ZUNA 1OWMA 1N2EA 2H2AA 3Q4GA 4Q16A 1H3NA 1QJCA 3AFHA 1NZJA 4DE5A 1MB2A 1JGTA 3COWA 5BNZA 1ILEA 4HK4A 2DEUA 4Q93A 1IQRA 1KQPA 4HJRA 1YUMA 3OTWA 4MLPA 3IH5A 3A04A 1IVSA 4U7JA 3D6UA 4A91A 2OV4A 3SYTA 1O0CA 4FZJA 4OUDA 1TYAE 1QRTA 1KP2A 2CSXA 1K4MA 3RJZA 3CLTC 1G8GA 2YXNA 3KT8A 4MVCA 4P2BA 5IJXA 2AKEA 5J58A 3FH0A 1M8JA 1KORA 1YIDA 2NSYA 4YP6A 1WZ2A 1VL2A 2DUMA 2PFSA 2WQ6A 4CDNA 3P0JA 3FI0A 4R0NA 3X1MA 4ZT6A 1J1ZA 1JIIA 3AL0C 1G8HA 1Y42X 3DO8A 3ND5A 1NUTA 1H3EA 3LE8A 1GPMA 1IQUA 3ELBA 1JEDA 1COZA 1MAUA 3PXUA 5HUHA 5K0TA 4U63A 2RE8A 5FO1A 2HGZA 2V0CA 3UY4A 4MAFA 1PFVA 1CT9A 2XRZA 3DLAA 1FYDA 4OJMX 1QNFA 1OD6A 1DNPA 2ZP1A 3ZIUA 2D13A 2QTNA 3Q10A 2E18A 3IVCA 3UMVA 4PBSA 2E21A 3RFFA 4KR9A 1U7DA 2TS1A 3SEQA 1O97D 2CV1A 3NBAA 3A2KA 1JIJA 1JHDA 5TS2A 3H05A 1X8XA 3L93A 4I6EA 3IUEA 3QTTA 4AS1A 4YP7A 3LCJA 1KH2A 1WJGA 1KH1A 1ZH0A 4RPIA 1GZUA 5TEWA 1T6XA 1GLNA 2HMAA 5HG0A 4MWEA 2D5BA 1MOPA 4ARCA 1M1ZA 4DDHA 1R6UA 1NYLA 3CR8A 1OWPA 4J75A 3MMXA 3H99A 3ZGZA 1NI5A 1IRXA 2DPLA 1U3CA 2PZ8A 1KQNA 1OWNA 2R5WA 2YY5A 4ZCQA 1XJQA 4DDMA 5EKDA 1JEEA 3G6KA 4JZYA 2QUHA 1Q11A 3D6VA 4EG7A 2QUIA 4EG1A 3K32A 4BWVA 1H3FA 1PFUA 3L92A 4HJXA 3N2YA 5HUJA 1MAWA 3FDXA 3SP1A 1N2HA 3E27A 1EJ2A 1T9GR 3M5WA 3ND7A 2VTBA 4PBTA 1G8FA 2A84A 2Z08A 2V0GA 4PY2A 3RK0A 1M8KA 2J08A 2X1MA 1WOYA 3HZRA 2PIDA 3ZUGA 1TYBE 4EG5A 1WXFA 1O6BA 3IOEA 1TFUA 2BYTA 3ZJUA 3Q12A 4EGAA 1IFXA 4MUFA 3NV7A 5DB4A 5F23A 3IMGA 2AG6A 4MWBA 1N3LA 4ZCTA 4DLPA 3VU8A 1JIKA 1WXGA 2GM3A 1GTRA 1N2IA 3S3TA 2JANA 3KFLA 4F3RA 4DJAA 4MW6A 1F9AA 3BL5A 3IOBA 3IMEA 5LLTA 1M8FA 1A8HA 2WQ7A 3IUBA 3PNBA 4NDAA 1QTQA 5K0SA 1N75A 4X0EA 2X0KA 1M8GA 3OP1A 4JFAA 5DASA 4CT0A 1YULA 2J07A 3CVVA 3UK2A 3HMQA 3FG9A 1IH8A 1KP3A 4YBRA 4QRDA 1WQ4A 3RBAA 4EF6A 1QU3A 1KR2A 1O5TA 1H1TA 1NUQA 3PNYA 4ZT4A 1YUNA 2CUZA 5H7XA 5LM3A 1EUYA 2A4MA 4H3SA 4ZT7A 1GN8A 5JBNA 2J5BA 4ZCSA 2YWCA 4MW0A 1IQ0A 3IOCA 3A05A 1F7VA 1WY5A 4MW7A 4NAUA 3ISJA 4AQ7A 1RQGA 5DK4A 1WXIA 1N78A 3HL4A 4MW5A 2WSIA 3VGJA 1T9GS 3N9IA 1I6MA 2GKSA 1T6ZA 2C5SA 1JZSA 1YIAA 5KWVA 2CYBA 3H9CA 5FNZA 4QBTA 1N77A 3LOQA 2A7XA 4J76A 2YWBA 1N2OA 1PG2A 2PG3A 1Q19A 4QREA 2A88A 1N1DA 1PFYA 1O97C 4YP5A 3U1VA 4CDMA 2IJGX 3FETA 4EG6A 4GU5A 3FOCA 4MVXA 3H97A 4MW2A 3FHJA 3A4IA 2DETA 3N8HA 1WXEA 4MUIA 4MW1A 3X1KA 1U3DA 1I6KA 1QQTA 4MULA 3P0HA 4ND6A 2E89A 4K0RA 1JZQA 2A1UB 3CLSD 3SZGA 1K4KA 2E0IA 1MBZA 3AKZA 4S1OA 4DDKA 3VRHA 1TYCA 1SURA 4JYZA 3FWKA 3CLSC 3FIUA 1B6TA 4ND7A 4NATA 3X1JA 3DPIA 4NAHA 3KT6A 3CLRD 3GUZA 2A1TR 3KT3A 4MVYA 3TNJA 4JXXA 1NSYA 1N2BA 1IHOA 3SZ3A 3CLRC 2QUKA 1N2GA 1U7XA 3SDBA 2X1LA 5DEOA 1J1UA 1WKBA 1HYBA 5TEVA 4MWCA 1M8PA 1EFVB 3MXTA 1EFPB 3TQOA 3CVUA 1OBCA 4KR6A 1O94D 2EJCA 1OBHA 3G59A 4MUEA 4PBRA 4RUKA 2ZUFA 1NUSA 5IHXA 1I6LA 4MUKA 2D54A 2WB2A 1LI7A 1VLHA 2QTRA 3ILVA 1KH3A 3IMCA 1NP7A 1OWOA 4KR7A 2CT8A 1WXHA 4HPWA 4I6JA 4KKVA 1PG0A 2O5RA 1TEZA 1J20A 4DNXA 3K9WA 3RHSA 1MC1A 2G36A 1P7PA 3COYA 3FNRA 1ULHA 3IVGA 4G6ZA 3JXEA 2J4DA 2Z3VA 3GLVA 1OWLA 3GMIA 2QJTA 2CYCA 1VBNA 4MUJA 3TZLA 4F4HA 5H16A 2CFOA 1FFYA 1U0BB 1J21A 3MLBA 3QE4A 1ZH6A 3NBKA 1PFWA 2QJOA 3CVXA 1F4LA 2QTMA 4ZT2A 1ZJWA 1NUUA 4E1AA 4R2LA 4MWDA 2X3FA 2QUJA 4G5YA 1QU2A 4R2MA 1GTSA 4MUGA 4UZEA 1J09A 2A1TS 1UFVA 3INNA 4KPUB 2CV2A 3UC5A 1M83A 3CLTD 2CV0A 2JA2A 4MQ6A 4L2IB 1KAQA 1EXDA 4ZCRA 3AG5A 2I1LA 3CA8A 3COVA 1O96B 3HFJA 1MB9A 4U8HA 5TGTA 2RD2A 1F7UA 3TZEA 1Q15A 3FY4A 4EG4A 3P0IA 5LFAA 5AHWA 3MUEA
chains in the Genus database with same CATH superfamily
5KHAA 1S5PA 1X3SA 1S2LA 1Z34A 3EGIA 1I5OA 3G8DA 4NEHB 4CM8A 4EY8A 1ONBA 5I7WA 5JZVA 1PU2A 1MJHA 2QTTA 1POWA 2CNNA 3KXDA 4YDSA 5ICEA 5KMGB 3BERA 4LRQA 1QX4A 1V96A 1I2BA 1NBMD 1RM4A 1WQ1R 2QMUA 2DGDA 2Z2JA 3KZMA 3QWIA 1LNSA 4J7AA 4JJAA 4YMIA 5HKBA 1RRMA 2C9OA 2V5UA 1GRRA 5EIOA 4K3UA 2ATCA 4HWRA 4AD8A 2F43B 3MB5A 3VR4D 1SKYE 1YUBA 3GVPA 1JB9A 3VNQA 1Z17A 1RYEA 4TTIA 2F2TA 3DEZA 4TVSA 1PJQA 2QE6A 3ZVKA 2R3SA 1DSSG 1S89A 5AKJA 1JMKC 4FWBA 3KQWA 1PX2A 4I9UA 4AZ3A 1MJFA 4JKYA 2CXTA 5LBTA 1LNQA 4TOIA 3ISTA 4RGVA 4JIMA 1R0YA 1ONPA 3LCRA 2XZDA 4X1IA 5EZYF 4BO2A 1W7AA 2Z43A 3SMQA 1FFHA 4XR9A 4ERNA 5K5EA 2DHDA 1NP3A 4X6LA 2VP9A 5HBRA 4PIPA 1KC1A 5B7NA 4BGDA 3VKVA 4MVJH 2PS9A 2J59A 3GRVA 3R41A 3O92A 1W46A 2OBYA 4DJEC 1EUCA 5L7WA 4PTLA 3VISA 4YALA 1NSTA 3SLKA 2FWAA 2WVAA 3MLAA 2AFIE 4J0KA 4MJ3A 5M29A 1GFIA 1T4DA 3SEZA 2GDZA 2OLKA 3GP3A 3NHSA 5CTJA 3VYWA 3C2QA 4BVGA 4ZHQB 1WVIA 1WB6A 4IXTA 3C3AA 5JD5A 4OK6A 3I6QA 1VRWA 1YU9A 2BBOA 4H1HA 721PA 5AHOA 4UNNA 5DI3B 5ALLA 1FU8A 2NIPA 2ZS7A 4LQ4A 2YHAA 4C7JA 2Y8EA 3EUEA 2RGBA 2ZCUA 3OM9A 3UK6A 2PMWB 1UWLA 1Q0QA 3F8SA 4BL5A 2FW7A 5JFOA 3ZGNA 4UBMA 1AKNA 3KHKA 4HL6A 3UJNA 4IJQA 4OHCA 4PYNA 5IG2A 1PWEA 1SWWA 1RPTA 1SK9A 2C1ZA 2OL4A 3CZPA 2GOYA 1Z4OA 2G5PA 1D1TA 1TVKB 3EDCA 1UBSB 3PKIA 4KH1A 1TI7A 2ZSUA 4LYGA 4OK5A 5DXAA 2HSJA 3TTWA 1TM3E 5CLFA 5IEJA 2QU7A 3NHYA 3H8SA 5AUOB 1EFAA 4PWZA 4Q9IA 1JAIA 1Y7TA 2G4LA 2G88A 2K2QB 1KY3A 1O6GA 4TRJA 2V3CC 3THXA 2WM3A 2N3ZA 1A2BA 3H1FA 4MS4A 3ZDZB 4G85A 1GR1A 2G72A 2ZVJA 2BTEA 1ZA2A 3TVYA 2NV0A 4JASB 4XASA 3BULA 5DCLA 3EQ8A 5JLAA 1PSWA 3B6MA 4W8GA 1KVUA 1LLUA 1P7ZA 4F96A 1J22A 3OCCA 4BVLA 2P2SA 3ESBA 3AP1A 1B26A 5E6RB 2F8TA 3K73O 3OT1A 1L7OA 3GFFA 3L2OB 3K4QA 5F9HA 3PR3A 3DOHA 3RKRA 2WTNA 3A70A 1JE1A 2YC2C 4TMXA 2DERA 3UAZA 3SHWA 2J87A 3EOAI 5JROA 2ZT8A 4G4GA 3TSCA 4TVOA 4OFZA 2JHFA 4L3VA 4OXIA 3WWOA 1VGVA 4QXRA 2C4NA 1TM4E 3I4LA 3WLOA 3TVTA 4R7ZA 4XYMA 1QAOA 3NTOA 4UU7A 5BN1A 1KMCA 2VNJA 1KK1A 2ZJAA 3OJEA 1IQRA 3SJAA 3O0TA 4HJRA 2HX1A 4MVJG 4BE9A 4NCIA 3RIXA 3IH5A 4JELA 4EECA 3THOA 4ALIA 3H8VA 4B2PA 3D7SA 1OTYA 2Z9DA 3G2LA 3WJ7A 4P3NA 5F9MA 3OU7A 3TG8A 4ISCA 5KMGA 3N1UA 4BNUA 1YKFA 4KQGA 4BZZA 4KYTA 1KYIA 2XTAA 3HU3A 5NULA 4G8CA 2DULA 3LUCA 1RQNA 1LS1A 4BX2A 3HN7A 2ZXEA 2F43A 4S1VA 4WFIA 2JLYA 1N0HA 3VO1A 4BGVA 1U2GA 1WUYA 3FH0A 1IIBA 1TU4A 1XQYA 4LQDA 5E1MA 3ELDA 1E2KA 4OGFA 1LSOA 3FUTA 5I9MA 5CA1B 3O4RA 1YJXA 1SOUA 1EH5A 3GIDA 1TLTA 4BE4A 4ZT6A 5ALQA 3LQ1A 2Y99A 4MMZB 5F2NA 1C9JA 1SU7A 3WICA 1DDGA 1NVGA 1W4RA 1GPMA 3O73A 2YBEA 3V42A 5B3LA 5BXQC 5DTQA 4ARAA 4NTZA 3P2EA 3TXYA 4KPGA 1WG8A 1E2UA 2BH2A 1DADA 2ZI9A 3G7UA 1KFKB 1KJQA 3KB1A 5JCPA 4JCOA 4QBFA 1DO8A 4ZHQA 3RS9A 1C3JA 1SB9A 1U1EA 2VN8A 3ACDA 3JWIA 3OPMA 1BGXT 1V5WA 1Y89A 5DI3A 3SEQA 3QE9Y 4E5NA 4DWJA 3O4VA 3LUBA 2UKDA 3DT8A 1D0IA 2J67A 3A36A 1ZJJA 3TUZC 1PVOA 2RHGB 1FNCA 2A9QA 2HPZA 2A94A 3E4DA 4YP7A 3E8MA 1L8AA 3E9MA 3FPAA 4DWVA 1T2DA 1UJ5A 1ZD3A 3KKKA 2GERA 3KQTA 2PMKA 3GUCA 4MIEA 3GD7A 1W30A 1J0EA 3DO6A 4IIJB 2XGGA 3T4UA 1TVKA 2WWYA 3S6JA 1U2DC 2Q1TA 2XTNA 1YB1A 1KEVA 1FMLA 1KSJA 2JVIA 2WJGA 1SBZA 2I7TA 4HQFA 4R01A 2B8JA 4TMZA 1IN5A 4WDRA 3GFTA 4WXMA 1UFQA 3KV1A 4L28A 1DEHA 1KEEB 3CEHA 3G5TA 3PC2A 4LHEA 3ZYCA 4HSEA 1W73A 2BJVA 4EPWA 4WBNF 3VPXA 4BB9A 3CR7A 4V1CI 2RMKA 2EARA 3MWLA 2FQQA 4J7CA 4OMUA 4IBOA 4X8OA 3W4IA 3MZ0A 2PCLA 3ZHYA 1BHJA 2XF2A 1SA0B 3ZU6A 4BZPA 3J7AC 3HP4A 3R3ZA 1PUXA 3W5SA 1X14A 1N0IA 4K3VA 2C78A 3KYCB 1XHEA 5JNTA 2PPVA 1JPUA 2W6NA 5E6RA 5HOQA 3WGZA 1P7WA 4IMPA 4M7RA 3U3JA 4M0UA 3K09A 2CVFA 2HHLA 3O4IA 2W6ID 3AM4A 2MSEB 4KVZA 3BILA 4DEVA 1KA9H 2J9FB 4F04A 3HDGA 3HSKA 5HJ2A 1DLIA 2HOQA 3C45A 4JUDX 3AERB 1YRBA 2RGNA 2D2FA 3I58A 3RK0A 3FW1A 1LBIA 2FPXA 2Q2OA 3HPRA 1NNEA 1WOYA 2IOFA 1KE1A 2D59A 4C29A 3L0DA 1KBZA 2F3QA 2PIDA 1OXBB 2RSLA 5DZSA 5B7QA 3SQXA 1RRFA 1TYBE 3IESA 4QVKA 4RLSA 3PQDA 2NQTA 3WKAA 1D4AA 1U0GA 1NE2A 1ZOSA 4HYEA 3VR2A 2XXJA 4LF5B 1H23A 2ZJBA 2R6AA 2XUQA 1U2ZA 3MC1A 1EP2B 1GA6A 4C1NA 4NBTA 3PQ6A 2V9ZA 2CVOA 4MWBA 3EC1A 1P4JA 3DV9A 4C6TB 1JX6A 1P2DA 1S9DA 4IOJA 1T5LA 4BU1A 3MSXA 4OQXA 1ZXXA 5T64A 2VPZA 4YMVA 1SIOA 1X19A 2QZSA 5GZ3A 4L5CA 5LLTA 1PS8A 1M8FA 3I3OA 4QFDA 1KI6B 4HEA6 5HFAA 3ID6C 5CA1A 2G9RA 2WZDA 2GVZC 1Q6ZA 2NVOA 2ODAA 1Z5GA 3PNBA 4RTOA 3G9XA 3WRVA 2Z8YA 5DX0A 3ZBQA 4DC1A 3UAXA 1KI7A 1QAMA 4C04A 5JYBA 4JI3B 4HDOB 1W35A 1PT7A 2QL9A 4AW9A 3B1ZA 1MVOA 3GJQA 4BPBA 4YA6A 2VA9A 2BEUB 4ZYLA 1FC0A 2IYEA 3CGGA 3D54D 4JT4A 4L9WA 4Y2RA 5J43A 4YI3A 1YASA 2QJWA 2VT6A 2EP8A 3CRNA 2W58A 4LTMA 4QNNA 4DLTA 2Z1DA 4IFEA 4PGHA 3H19A 2YASA 3LUHA 5JBNA 3T99A 2QZZA 4ITVA 2PD4A 4MW0A 1N2SA 3ZZMA 3IOCA 4S12A 4YRIA 3V1TC 4L08A 1E92A 2A58A 2G40A 3L1IA 3LXMA 3M6LA 4BFZA 3WRYC 1RABA 1WXIA 3C3PA 4DG9A 2PK3A 2I3ZA 3EXAA 5D7BA 5K51A 1A8UA 4DIDA 2J3QA 3L1UA 1I6MA 4J07A 2CLKB 1G9SA 4J0JA 1Y4SA 2LCIA 4E3WA 1C1HA 1XQVA 4NNOA 2ZPAA 5E2IA 3PKJA 4IIJA 3JYOA 2POQX 4HH1A 2RH5A 1RAFA 1N77A 1NVXQ 4EHNA 2HQBA 1UMKA 1LDNA 4E12A 2VHCA 2BUCA 3FYTA 2UV8A 3HEAA 3AINA 3NHMA 4ZFNA 1KEEA 1VJTA 1NXVA 3QJ5A 4OSPA 4ER7A 1XTSA 1G8KA 3H13A 3KR2A 1JU9A 3GLTA 4RY8A 3RU3A 1SA0A 4G67A 3ZN2A 3R3SA 3TR5A 5TB5A 4KHPB 2EFJA 1N5OX 4P54A 3K9NA 4X8MA 3T95A 2F67A 3KYCA 3R0IA 4RMGA 2P0EA 2BMDA 1SD5A 2NPIA 3N07A 4NFSA 3VHRA 1JXMA 5DF1A 4EG6A 4NOMA 1K5DA 2EEZA 4ECEA 5JNWA 3OEYA 3P9ZA 4AN4A 3UJHA 3N0RA 3LUJA 3V33A 2D74A 5DLEA 1G7RA 5GGXA 4ZI2A 2Q6KA 3WWEA 2J9FA 5BW4A 4LKOA 1C8BA 3IEUA 5E6UB 4BFSA 4EP1A 2UZ4A 1BEZA 4L9SA 4O08A 4K0RA 1CLUA 1M76A 3UMJA 3T4PA 4EUEA 3AERA 1WL8A 2WJYA 1XLTC 2XIQA 2QVYX 4CU5A 1CEEA 1QDUA 2A9FA 3MT8A 1J2RA 3ASZA 4J4HA 4LJ9A 3E58A 4MV6A 3FWKA 3PXEA 4XCVA 1A9PA 4NULA 1RHJA 3FVTA 3CPEA 4B3GA 3CLRD 2QK4A 4M1TA 2IQIA 3H3JA 3IP6A 3JAKB 1D04A 1M2HA 3G9TA 4JEHA 2FWNA 1TIKA 4FNMA 3AU8A 4NBUA 3SZ3A 2ONYA 3E1KA 1OZHA 3AWDA 3NQ41 4PNZA 3NC4A 4C6TA 3O47A 3K0CC 4EENA 1UBFA 5JMWA 4UNRA 3EAQA 5GOTA 1DKPA 3E53A 3LUGA 3GLIB 7GPBA 4GZ6A 1H2WA 4FFDA 5C1OA 3LPNA 2HDOA 1OR8A 2HLDD 2ZB2A 2GPAA 3OOSA 5AJVB 4ZZ1A 1DVRA 3FUCA 4BUJA 1KI6A 3GLQA 2PZKA 3BQMB 3H0EA 4LZWA 1U04A 3UENA 2RBEA 4LEIA 1W52X 4PBRA 4XCQA 5L4NA 1NUSA 4DN6A 3CF6R 1X1EA 2OHJA 1QQ7A 3DBRB 4M1QA 5CNMA 3QOYA 3D1JA 4IVRA 3MT0A 5HRUA 5ILOA 1YFZA 4NV1A 5K99A 1UWVA 4GPEA 1HLDA 2BEUA 4D4GA 3BHJA 3KU1A 3CNOA 1XDDA 4LBWA 3KD2A 4AYXA 2GO1A 2O7QA 1TJYA 2XUKA 1E66A 3RHSA 2F3SA 2HRCA 3T7RA 1K1EA 5K3EA 3EJ6A 4YMSA 1OFIA 3AO0B 5CFMA 2WU0A 1BEUB 4KAAA 3RT7A 1FF9A 3GGOA 4MUJA 4F4HA 2XPCA 2YFHA 4FGUA 3ZJYA 4B4DA 4F6LA 3KFVA 5LQJA 3SS8A 4M49A 3IDQA 1NN3A 3L4SO 4NX2A 4RXUA 4XB2A 5FBKA 1WBBA 5EWMB 4IFIA 3KB8A 1DUSA 3TGWA 4EVRA 3NBMA 3BE4A 4JFRA 2CNDA 5K9ZA 1M6YA 4LWOA 3E03A 1KK3A 1QGDA 4CQMD 1YVDA 3MVEA 1PS0A 5ENDA 1XN4A 4Q1CA 2TYSB 4JLBA 4QJBA 4ES6A 2PKQO 2O2SA 4FVTA 2ORIA 5A7FA 5FB3A 1KO1A 1M54A 1P74A 4P93A 4H27A 3D3KA 2RAUA 4AMVA 5J4YA 4QUHA 2VNAA 4MUGA 4HQKA 2YRFA 4JBXA 2BMVA 4UVGA 1R7RA 1PGPA 1BVUA 3TB4A 5JDIA 2OD9A 2F59A 4FDMA 2JJMA 3JWPA 3DLBA 1OGJA 2UAGA 3DL7A 1VCMA 2FNAA 3NP7A 4NBLA 3EW9A 4K9KA 3WHIA 4MQUA 1EZZA 5FOTA 1VL1A 1X42A 2OFXA 2O8FB 1GCOA 1JTEA 4Z4EA 2IIVA 2HLDA 4HH0A 4BQNA 3T1VA 1BWRA 4N5IX 2V7UA 5D1NA 1QAQA 1UIRA 3IIEA 4LRWA 1AKUA 2OAQ1 1D9XA 4Z0HO 1PKXA 1ADGA 5KHLB 3OKAA 4YPFA 1E62A 1ODFA 1T3ZA 3Q85A 2JZCA 1Q15A 1DELA 2BPOA 4FFBB 2EBHX 3K1TA 1F8GA 1GG8A 2C2YA 3P0IA 4P5PA 1I94B 5B3JC 4TYNA 3PHBE 3HEBA 3KEFA 5IM5A 1AV7A 5E6UA 1AK1A 2R84A 4WLEA 4IV8A 4BV8A 1ZNZA 2NAPA 1DUIA 3ANNA 5J4VA 5F98A 4GG1A 1E8NA 5HMLA 3CUSA 1E32A 2GFIA 3IUJA 2DFLA 5LXTB 3THYB 3QI2A 4RD0A 4H6WA 1NVAA 2PGLA 4KE6A 4D02A 1LJLA 4JQSA 4MUHA 1ZXLA 3MF4A 3U3OA 1C1XB 1M2VB 4IXDA 3JAKA 5AJWA 3RIYA 4ZZIA 5BNWA 2FMUA 1CUHA 4LWZA 4BWGA 3B3AA 5L8VA 1OI2A 1TZCA 2BFCB 2M6KA 3NM5A 3CO0S 3SEAA 3OZAA 3BWXA 4QEKA 4D41A 1SBTA 2PM8A 3D0QA 1J0XO 2Z09A 3R4CA 1X6VA 3O26A 1Z2OX 2VK8A 2RH8A 2WG1A 3IKLA 3L8MA 1IM8A 3T1TA 3GLIA 1Y8RB 4G24A 1DDOA 1NRIA 1ZICA 4CIVA 4QJ3A 9GPBA 4M0EA 1TQ6A 5D8DA 1G38A 2I91A 1BRMA 2OESA 2O5VA 2B34A 4BNDB 2W6CX 2NQ2C 1AN9A 3SX4A 3DQZA 3PUYA 4U2BA 4WLOA 3DBRA 2XTZA 4HDNB 4UXIA 2BGLA 4BRWA 5F76A 1RWKA 4BTVA 1KE2A 2H9AA 3SSAA 3WDMA 1S96A 4LSMA 5CVEA 4IOKA 4HXYA 4UTPA 4BNFA 3THSA 2II6A 1EWYA 1IBSA 2GB4A 1P9LA 3ACBA 4U0JA 4WJZA 1SKMA 1ZVVA 5TSDA 3MNFA 2D1FA 4E88A 3I01M 5DBHX 2C4UA 3V2HA 4D4KA 1RPAA 2EF1A 4Q1AA 1UZUA 3DFFA 1P0CA 3JAWB 3I04A 4YAUA 4Y6RA 3RG8A 2Y66A 4ZKEA 4EL5A 5TJ9A 1NM5C 1K5PA 2H2WA 3FWNA 5A7GA 2PH3A 2CNKA 2RKBA 3E9QA 2GBCA 4CQLB 1MB3A 2V7QD 4HZUB 3D2AA 1O2DA 4XM2A 5EWMA 5FUVA 1BQ4A 3QXJA 1IY1A 4NCBA 1OFGA 1X1QA 2AMJA 3KB6A 4HSGA 5SY6A 1QIEA 1UBMS 1ZN2A 1T9BA 2YV4A 3B5JA 4P9NA 4R05A 3HU2A 4N6OA 5K03A 3L01A 2JAXA 2B30A 1DCKA 4N3AA 4QVGA 2P5TB 4ZHQF 1IWBB 4CPDA 4ZQGA 5AUQA 1FFBA 2FXVA 2R6HA 4NZNA 5DFAA 1YGYA 3O3MB 2RKWA 4JU8A 3UCXA 4WSOA 1QHXA 1KZ1A 4BO3A 1KDOA 1VBFA 1SB8A 2J33A 1AV6A 2O8FA 4NPCA 3H65A 2O1WA 4TUYB 4U4AA 2NXEA 2X41A 3P9SA 2EFCB 2XR1A 1DRJA 3QNMA 3R6LA 4FW8A 4OKNA 1E2QA 5JAOA 1DKLA 1FEZA 2C4HA 1U2DA 1YH3A 3I9KA 1CUJA 3QVUA 4EW2A 1G3RA 4DKJA 3NHRA 5GM1A 4XTCS 4QO8A 5CT4A 4F4FA 4YT8A 2XQGA 1TADA 2PGOA 3SZRA 4DBVO 4YCLA 1CLEA 1CY8A 4CL3A 1MB2A 1RW4A 4FFBA 1G98A 3AUUA 3G8AA 1F51E 1P0PA 3I64A 3O2QB 4HK4A 4L07A 3F6RA 3RVSA 4V1CB 3M89A 4MLPA 5HK9A 1T24A 4IQ8A 1J2TA 4JJ6A 5BWMA 1NDQA 3W6OA 4JR2A 3FJOA 1PEKE 3OFVA 1RZRD 3OT4A 1FRZA 2X5OA 3PFGA 4BJ3A 1ULBA 2PH5A 3IVRA 1B0AA 4UAUA 2XCTB 4KX5A 3B12A 3TX6A 4MVCA 3U16A 2ZUDA 1FJGB 2CL0X 2XCOA 1A71A 1J23A 1M2VA 5TQJA 1DBRA 3KJNA 4MA0A 1DAKA 2EP5A 1T8TA 3HBLA 1XQ1A 2BFCA 4OV6B 3ASUA 3LCVB 5LYYA 1YR1A 1F0PA 1U0FA 2B1GA 4B79A 3E9ZA 3OE4A 3RRMA 3L43A 5LR6A 4EW1A 3LFTA 5HXAA 4FINA 3DZKA 2AXNA 5EE0A 3FCOA 3HXTA 3AVWA 1YB5A 4D5GA 1EBFA 1Y3FE 1Y8RA 4JQCA 3WL4A 3FHTA 3R3JA 1JEDA 1AKEA 1COZA 3INYA 4GLBA 4I9NA 4E5UA 2HGZA 3K05A 3P9RA 4KWTA 3IVAA 4JDPA 2ECKA 4OGKA 4MAFA 4DJJA 1P77A 2WMYA 1U8YA 4Q4CA 3AR2A 3ICWA 4HDNA 3T1QA 4MS1B 5AT1A 3VDXA 2IP2A 2C61A 2Q4EA 2FH5B 5H82A 1QK4A 2E18A 2WJ6A 3ROZA 3V7NA 4C4PA 5JH7B 2B9VA 4ZOLB 4MIKA 4ND5A 3V4OA 2JFVA 1SXHA 1X0XA 3U5ZB 4YP1A 1X8XA 1Y7LA 3JQGB 1DBSA 2NADA 3DVSX 5AJXA 5CPFA 1IBRA 1PD0A 3A7DA 4IHKA 2VXCA 3JAWA 2RHLA 4RORA 5LU9A 1JAYA 3AIMA 2FPPB 5LUBA 1Z2CA 2VAXA 5KSPA 4CF6A 1YDGA 5CLLA 1KEUA 1P19A 1UFKA 3GRUA 1ACLA 3HY6A 4I3GA 4M0MA 4JUFA 3LC7O 4Q19A 4QHYA 4GZ5A 3OQJA 4HZUA 5TGZA 4CQLA 4DFDA 5JPDA 2C7QA 4H17A 3RC9A 1AB6A 2RGUA 3LX5A 3ZW7A 2FKAA 5T6MA 3X43A 2AG1A 1BRTA 2J6BA 5D2CA 2YJTD 3ABSB 2RGWA 3G2NA 3O1LA 1CEXA 2GRAA 1BE8A 3GZNB 3I0ZA 4TTSA 1J8MF 5REQB 3OJOA 1WSDA 4R3WA 3ZWKA 1WHSB 2WU1A 4KRXA 1BCSB 1JAZA 2AJTA 4JYPA 3WRYA 2QUIA 4EG7A 5KNLA 2E2WA 1NKTA 4RTKA 3I28A 5EZSA 2P9BA 4HJXA 4PFSA 1MG5A 3HKEB 3OU2A 5ALWA 3OFJA 1MU0A 4F7WA 1QO0D 2GTHA 5KUTA 2D0DA 2IH5A 3CH5A 4TUYA 4Z1MD 2R1VB 3QF7A 4AJ2A 2MSNA 4QXAA 5K0CA 1ZMBA 4F5ZA 2D6FA 1SQ5A 2MR6A 3PYMA 1BC5A 1E9CA 5EXPA 2AN3A 3WRXA 5I7SA 2CB0A 2Q3FA 3BICA 3B5IA 3LP8A 4QFCA 2J3EA 3BGDA 2VFAA 4GKVA 1KZHA 4ZO9A 1GY8A 4ER6A 1YK1A 5FLEX 5K2OA 3CVJA 4MB2A 4V1CA 4KQ2A 2JK1A 4UD2A 2CCKA 2Z56A 3NVDA 4AN0A 3V3TA 1T3LA 4GWKA 2DQZA 1OE0A 1LF0A 2IU6A 2PWAA 2ENUA 4DDWA 4BQEA 4G0WA 2OC9A 3DJYA 3K8YA 4R1LA 2HHCA 2FZ4A 2MIIA 5LWHA 1Z0AA 2HXSA 1I7DA 3UO8B 4CGYA 2P4HX 3WDLA 4CUZA 4H2DA 4AIRA 1H8ED 2ZJ7A 3A9SA 1L6IA 3GLHB 3MBKA 1WSWA 3JWHA 4GOJA 4NPAA 2Q7OE 4BCDA 4ZGWA 3Q0EA 3DZFA 5PGMA 2XAAA 1E5TA 1R0RE 1V8BA 4EO9A 4DR2B 4K0KB 1OW3B 4FN5A 1VG9B 2ZSEA 2OCBA 3FB1A 1RRPA 1XLTA 4CU2A 4FE4A 2CHFA 3ESDA 4X90A 1RQXA 4NDAA 1AC5A 4CW7A 5JQWA 1QTQA 1CY0A 3AF6A 2GARA 2MSKA 5F9FA 1M8GA 1TPZA 3EAGA 3LGAA 2WSLA 1CUAA 3P9KA 4UM8B 4XSHA 3WZ2A 1JRLA 2HYDA 2WLTA 5BYAA 2YOHA 2ZB7A 3K20A 5ALNA 3PIIA 1TEXA 4EW6A 1JL3A 2ZE5A 4F6CA 2EWVA 2PBFA 2WKRA 4OH7A 5LQDA 5GIOE 4RTJA 1NMZA 4J90A 4KSCA 1UXOA 2VTKA 2HHJA 1O5TA 3RJ9A 4RKWA 2J3MA 4R7GA 1VKOA 3U26A 5DIFA 1JR2A 5AWFC 1YUNA 3UTDA 3H9JA 1TK9A 2G08A 1GG5A 3K0CA 3U7JA 3O1HB 4BKUA 2JIOA 4MS1A 5H4GA 2VH1A 4DGSA 2ZUCA 2O0KA 5E7JA 1T2UA 1Y6JA 3CO5A 3DXXA 3LOUA 3OCJA 4KVGA 4ZCSA 4OQMA 1GTVA 4K5QA 4W5JA 4ZOLA 3HBAA 1BFUA 2E82A 5F1YA 1I7NA 4JLPA 4MVJD 2OCGA 3QFHA 3VZDA 3JQGA 4D8TA 3ZU3A 2ZBPA 4R1UA 3ZOZA 3I2GA 4MW5A 3CNLA 4QTUB 1VA5A 1AQLA 1T9GS 2BKXA 3TZKA 3M6VA 4Q5IA 4YQFA 5B2FA 5BMOA 1TM2A 2FPPA 5MGBA 4YP9A 3LDAA 4CIDA 4RK7A 1OFUA 1T6ZA 3WL6A 1NNLA 2C5SA 4R0VA 2BV3A 3LT5A 4YDRA 4II2A 1B8UA 1QNLA 3FLBA 1CEQA 3RRZA 4BNVA 4YUVA 1NTRA 2YWJA 3H9CA 4YRDA 1IN6A 2AIRA 1WWKA 3NORA 3Q8WA 1U0EA 2OLEA 3HUFA 4R6WA 3HPQA 1AKTA 1PG2A 2MINB 4UAJA 2Q3BA 1H8EA 1NHWA 3OIDA 3W5JA 4E2YA 2IU0A 5E7IA 4B6OA 3GZNA 5IZCA 1RQPA 4N01A 1YC5A 2ZU6A 5REQA 5KQPA 3FMFA 1WHSA 1L7QA 2H92A 3EFEA 1BCSA 3I32A 1JDBB 1MQ8B 1TCAA 3B9BA 3KVOA 3TE7A 4JHLA 3W3AD 4BAGA 3VVMA 2W0MA 1GXSB 2VHTA 2G4CA 3NALA 1B8VA 2WHQA 3HKEA 3L77A 2E4UA 2DH5A 2JHCA 4KU4A 4UBKA 4GLLA 5JSKA 4N5LA 2R1VA 4DHWA 2PZEA 1U11A 2PEYA 2BMJA 3R0JA 4NS1A 4DXAA 4DMCA 5EKSA 3AT1A 1I6KA 1YGPA 2X1HA 1JG2A 4G8BA 3TE6A 2WNHA 2ZJZA 2DOKA 2I4LA 3FSGA 3SZGA 3SDSA 1Y8CA 1A7KA 4R8VA 4GDMA 5L4SA 1YQEA 2IEBA 4GM4A 1E0KA 2VDUE 4AJOA 4CVNA 2I71A 2LPMA 1N6RA 4JYZA 1YFKA 1SQ0A 3QU2A 2YHSA 3L6CA 2XAUA 5KYNA 1XA3A 1DKMA 1NU6A 1ZPDA 1OXKB 5ALOA 2FV8A 2P2NA 3H2JA 2VTBB 3EK2A 4MVJA 1BWQA 5H3LA 1Z0UA 2VA8A 2V1UA 1JYEA 2QHXA 1FFSA 4ZU3A 4DUYB 2PX5A 3AVQA 1USKA 3EW7A 2GM4A 4LY6A 4LRSB 4W5QA 2H2HA 4M0CA 1Y1RA 3ACCA 3HE3A 1Q0PA 4GOKA 5B3JA 2LNDA 3GLHA 1D5WA 2ZZNA 2AEEA 1VCIA 5EIHA 5CXSA 2PE5A 3TXAA 1FFWA 1UH5A 1FA9A 1C0PA 3NT5A 1JBEA 3FA2A 3SYRA 3FOEC 1ZINA 3OFKA 3FI9A 4UHEA 2W70A 1A8SA 4ED9A 3ZWXA 4HMPA 2BHRA 1V3TA 1GADO 2W6OA 1Y9ZA 3KSDO 2LBPA 2RHOA 3DFZA 1R8XA 1PR5A 2C4VA 2PKXA 3CUYA 1BFDA 1Y8AA 2I4RA 4RUKA 1UC5B 2OXIA 4QJ4A 3DHVA 4AJLA 3RV3A 2P8JA 2VDKB 1J49A 1ORDA 2ZYGA 4OJKA 4PZCA 4BQOA 1R6VA 1KH3A 4F1KA 1XCPA 3L82B 4UU0A 2HRBA 5HCNA 1UFOA 3FWZA 3ZDDA 2FF5A 3W3AA 4R68A 2PSDA 1XELA 1X15A 1ZSNA 5IJAA 4ZQFA 2XOKD 3S7TA 3ZLVA 2RI0A 5DBEX 1JDUA 4BFWA 1QYIA 2QAIA 1MC1A 3LXUX 3IAAA 3ZWYA 1IEQA 4ND2A 2V03A 4ZZ2A 3B6ZA 4DV6B 4HAIA 3DW3X 2H5EA 2ANBA 2BI8A 4HLUC 3I0MA 2ZSIA 3SIPA 4Y3UA 3TPZA 2OOKA 3SNKA 5JISA 1U0BB 2W2MA 3L0CA 4J0GA 2C04A 2VDOB 2P9JA 4INZA 4GOLD 5DWDA 1FRVA 3LVRE 3R5FA 1ZH6A 4G0QA 2WF6A 1EGHA 3DDNA 3LO5A 5CCDA 1XV5A 2UYCA 4FUTA 1HRDA 1X8KA 1ISSA 4HH3C 4TKMA 4IVNA 5A3QA 1TNDA 2ZIWB 3R6TA 2D06A 1C7QA 4L8FA 2D3TA 3DDCA 4GXNA 1KY4A 2QY6A 2PXCA 3QZUA 1MH1A 5FWNA 4OHYA 2JFBA 3AKCA 1YS4A 1XCBA 4EBFA 3STUA 4N3GA 5CT6A 2HREA 2QF7A 3URMA 5GAJA 1MGOA 4OYLA 1I4OA 1UFVA 2YBDA 1NP6A 1PSDA 1RQRA 3DGFC 3DNPA 2MINA 1GU1A 2NNLD 3HU1A 4UCFA 3NBFA 3S1AB 1EFCA 3EMBA 3LPCA 4GQAA 2VUHB 1I80A 2G1AA 1E1MA 1NM5A 2R6FA 3EZGA 4L2IB 5GJVC 1ZVQA 2B1JA 1JIVA 5JAUA 2NUPB 3C97A 4N3BA 1DX6A 3KXLA 3A4TA 3COVA 5IPFA 4CCWA 1GIAA 2XWSA 3AR3A 1GXSA 1T1JA 3TW8B 5TVKA 4ZYYA 1BWSA 3VMFA 1QLJA 1T5TA 2O1EA 3K4PA 4LOLA 1GQ2A 1F7UA 1A7AA 5EE5B 1K8XB 2VAVA 3BD7A 1LBSA 5DYIA 4FNOA 1A9XB 1NLUA 2FQWA 3MUEA 2R8RA 4ZPXA 3OQVA 1W581 1B16A 1YWGO 3ZQKA 1NHGA 3T5DA 2HBQA 3UMGA 5I9IA 4KXNA 2XOKA 2NU9B 4GI5A 3BE5A 2H59A 3CLUC 3SVZA 1L4BA 3DXZA 2JRLA 4DANA 3LUDA 3FSEA 4D9JA 4TMYA 4RZUA 3VO2A 4NE2A 3LTNC 2GN1A 1S01A 1U8ZA 1UK9A 2CLFB 4WNYA 4YUWA 5KTTA 2VF4X 1BU5A 2J9GA 2X2OA 1HA3A 3B53X 3TPFA 1NFFA 2B7CA 4N39A 5FFFA 5AXAA 1FQJA 3WMGA 1QV9A 4NYJQ 2NZUG 4R9NA 3QXCA 3UJBA 5ERXA 3WIEA 2WF7A 3DTYA 2VDWB 1BDBA 3ZD9A 3EF3A 3OP4A 2EHJA 4XYEA 3KOUA 3I05A 1ISHA 4GI1A 3ZW9A 2D2VA 2P77A 2WIAA 2QGNA 2EL7A 1WPXA 4LDQA 4RELA 4ACBA 4F3CA 3UMFA 2J3DA 2JG3A 4XRRA 3G0IA 1LSJA 1U1FA 4Z5XA 1Z0DA 2XQIA 2C5BA 3CM0A 2CLHB 4N5NA 4FGWA 3Q5EA 3FBTA 3DKPA 5HVNA 4EG3A 1BO6A 1YDEA 3OZWA 4D6XA 3O4GA 1UOPA 5J5AA 2BMFA 1V47A 3TD9A 4WI1A 1LSSA 3MIIA 3KKZA 4RY2A 3P20A 5LJLA 3UAGA 3QA9A 1I7SB 3VJLA 2R7KA 4D46A 1RE1A 3DMTC 2ZULA 1EEHA 2C0CA 3NATA 1Z45A 3QG5A 3OE1A 4IO0A 3UKJA 1V7CA 2E49A 1IONA 4KGZA 3FPGA 1QRSA 4PPQA 3RNLA 1QIHA 4ASUD 4CM5A 1PBTA 3K72B 2YMQA 1WPQA 4XX0B 1M1UA 4BO7A 3D5QA 5JCJD 5FPTA 1YI8A 4KO4S 3D0OA 2Y1EA 2HZ7A 4RTLA 2CDBA 1X7GA 5EEHA 3GQVA 5LZ7A 3L3BA 1LCIA 4QHSA 4L15A 3E35A 2YH2A 4EM6A 2X9NA 4ME6A 1ZGJA 1YRHA 3MTDA 3RG2A 3SBEA 2Q8QA 1DKUA 1YQGA 2P0YA 4ON9A 1XRSB 3EVBA 5DSZA 4BDSA 2HF2A 1IZ7A 1SVUA 3IP9A 4PNEA 5D5QA 3GNLA 3PWTA 2QRPA 3ZV5A 2GUGA 2H5IA 1JMVA 2W8ZA 5MHTA 4YRTA 1Q77A 1GDDA 2XNJA 3KJHA 3ZYZA 2JFYA 3HJAA 3R7DA 5GJBA 1E9RA 1K5HA 2A30A 2NZ2A 3DMNA 3I1YA 4ENQA 1K7YA 2POCA 3ZWAA 5DJ5A 4MYTA 1T6NA 1QYRA 4LYDA 1U6JA 5THXA 4DMRA 3DKVA 2R1UA 3EG9B 4JX9A 4O0MA 5JAQA 3S1AA 3TLXA 5KVCA 1EIWA 4YAWA 3OLVA 3CCBA 1IUOA 1H2AS 5F12A 3WP1B 3RSLA 4L2IA 3OD5A 4UHCA 3B1YA 2FJPA 2NUPA 1I0LA 5GV7A 1XVAA 3OM8A 1IE3A 5J2UF 2PTGA 4LZOA 1HEIA 3TAUA 2V7VA 3DXFA 3TW8A 4RD2A 5EMKA 2AL7A 2VTDA 5BV8A 1GGNA 1H3NA 4NZYA 4NY1A 2DRIA 2DP4E 3ONVA 4S24A 2Q3MA 3VR5A 3W2IA 1ZD9A 1A9XA 4JZKA 3EULA 4QU0A 1XAIA 2PMCA 3SZMA 4AIIA 4INPA 5ADHA 5HR5A 3CWZA 4KVFA 4C08A 5BNTA 4PE5B 3MPOA 3A0RB 2J9ZB 4ZAFA 5DNYB 5CJJA 1Q1QA 2RGYA 2F4VB 2PD6A 4I5IA 3JQBC 5AM0A 3W78A 4FX5A 3P27A 3IQZA 1HT2E 3EVGA 1K6XA 2QX8A 2WJ3A 3CFYA 3D4LA 2P9HA 2JEOA 4ZU6X 5TMDA 3KOXA 3TLZA 4ASUA 3HVRA 1PJBA 1CUEA 1YIOA 3ESYA 1G3UA 1GP2A 2W93A 2XECA 4O3FA 2BZ0A 3GBVA 4H59A 3SE7A 3ZCSA 1Z6TA 2C8JA 5DN6A 3BREA 1T43A 2HRDA 3K0EA 1Q0UA 4ZP1A 3ESZA 4TUYF 1DMRA 1RHRA 4D8XA 1I2AA 3IDOA 3IPAA 4UBIA 4GWLA 4JYAB 5HFJA 2D00A 1NJSA 2Q4TA 4D3ZA 4BVFA 4UAVA 2JARA 3X1MA 3TTXA 3RABA 4ZDJA 3AL0C 1G8HA 2B37A 2C2GA 2VDWA 5DTIA 5KSOA 3S8YA 3I2JA 1D3AA 2PAFA 4TLAA 3ROMA 3W5AA 2PJRA 4KCGA 5HUHA 3C7TA 4GYKA 2LTAA 1ODKA 2I7CA 4L8VA 3N0TA 5KYGA 4BNMA 3STVA 1E9AA 4BB6A 2J85A 3ST7A 2CXPA 3AJDA 4L6AA 1IN7A 5EAIA 2ORWA 2BDEA 2VQSA 3IJRA 5D86A 2Z2YA 3AEKB 4YHHB 1P5HA 1YSCA 2HIHA 2QAGC 3UWMA 2ZQZA 4ARSA 1D5CA 3NM6B 4OSEA 1TC2A 3L9XA 1F1BA 2PY6A 3JWJA 2VJBA 5ALHA 4CIAA 3B1JA 4MHTA 3YASA 5ELMA 2YX1A 4P0TA 3T5BA 3AJ9A 3IGFA 4LJ5A 4Z4IA 4TT3D 2WSSD 4KV9A 3WNVA 1C8KA 2P5YA 3FKJA 1VRCA 3CBGA 1N57A 1OBVA 3RYFB 1XZFA 4XX0A 1C3EA 3PC6A 2VPTA 2I2FA 3WK4A 2W2PA 2QQGA 2HMAA 1P39A 3WLQA 3LWNA 4I1VA 4R0MA 4ARCA 5SZKB 1R6UA 4IZIA 4L0CA 1XTBA 3K0SA 1N5LA 2DHEA 2REXB 1U6IA 4KSYA 1JDJA 1QIDA 3NONA 4UHKA 4WQMA 4X7PA 2ZBEA 1ZM2A 2G9UA 5DP2A 1H9CA 2BFPA 3HH8A 5EOVA 4LS3A 2IPMA 4ZVRA 5FOQA 4IIYA 5GVRA 1JR4A 1RWMA 3QQPA 4Q1VA 2KLHA 4JQOA 3VI4B 1SZPA 1N6OA 2C2HA 2Y77A 4X20B 2J5KA 5EXTA 1QZ3A 1BZYA 5JE8A 3BDIA 3I5YA 3T3NA 1TD1A 1UADA 4NZOA 4LZJA 1F12A 1PZNA 3F5MA 1I3CA 4EG1A 4O2AB 4LUCA 1MEJA 4RPLA 1SZCA 1KHHA 4V0RA 4NEGA 5A4KA 4ZOLF 3GH3A 2VATA 3EG9A 3QRWA 3LQRA 4QUJA 3X44A 3DOOA 2OT3B 1WXWA 3ILXA 3JU3A 4FOTA 4QDUA 1PYDA 4XDYA 4C30A 1UBUS 1REQB 1U1IA 4JJFA 1EDOA 3O4JA 1W0JA 4JXJA 3M9XA 2CJWB 4FKZA 4I4IA 3S29A 5MFZA 4DAEA 3M5WA 4EA7A 2ETVA 1DKRA 3EBLA 3N2LA 2NAFA 3IEPA 2EBWA 1HMPA 2VHUA 6YASA 4DUZB 2B1RA 1H42A 4JL6A 1NW9B 4AQDA 4XQ9A 3LFUA 1V8PA 2QP3A 4BV3A 1NASA 4IGFA 5DW0A 1V3UA 2YXBA 5CW2A 3I5MA 2TRSB 4MDEA 3Q7RA 4PPNA 5FBZA 5HDQA 1QGAA 4JI5B 4GWGA 2XVZA 4ZV4A 1IFXA 1PR3A 4TQUS 3SYMA 3MRXA 5JWHA 4QZVA 1SR8A 1E2BA 2OV1A 3DA8A 3RVMA 4C2BA 1GFSA 1UOQA 1YZFA 4W9NC 4B6SA 3ET4A 1LY1A 3MS4A 4C0SA 3PB3A 3LWDA 4PVDA 1Z7GA 4BMNA 3K5HA 4L51A 4B7CA 5B1SA 1ZWLA 2W43A 3FNFA 4V2IA 1TQDA 3HZOA 1C7EA 4HLQB 3PFWO 2CHQA 1FW8A 3GYGA 3ROKA 1PJZA 4H1WA 1DCMA 3H2GA 1GU7A 4YJDA 5CB6A 3I6IA 4YY3B 2XEXA 3FUWA 4I50B 2PYZA 4E6EA 5H02A 3F9IA 4G07A 3OOJA 3GC6A 3R9XB 5A0VA 5LMCA 1YULA 4F46A 2NOAA 5KTPA 1VE9A 5BQPA 4E94A 1ENOA 4JV5B 7REQB 4ARZB 1K4YA 3HYCA 3JWGA 3VR3A 1ST3A 4L16A 3RUHA 5JBQA 4OXNA 4L0QA 1NNUA 3M4XA 1ZI9A 4R3NA 1VJRA 4QDXA 1TYEB 3MPUA 3N86A 4BUCA 5B64A 1C3LA 1TTPB 2I2DA 1MORA 2MU1A 2V7GA 4R6XA 5F3WB 3R23A 1DTSA 2FUG1 4Q3DA 3GV0A 5KQGA 2IY8A 3JQ9C 2RARA 2XNCA 4ZT7A 1AQYA 3SM3A 3N0WA 4D43A 1RM0A 3EVAA 4S1PA 5EKXA 2IW3A 2EBFX 2XDAA 1AS0A 2CVZA 2YOGA 3AEKA 4GS5A 5ICCA 5LQRA 3PFBA 1Z4IA 2ZR9A 1F7VA 3IE0A 3C41J 7AT1A 5A5GA 4FS8A 1I8TA 3FPJA 4PX3A 5JATA 4JODA 3IQHX 2PO7A 3MCUA 1LLDA 2AXEA 4LG1A 1YS2X 2WJVA 3OZBA 3FMVA 4A8PA 4DDVA 3CIFA 3MUFA 4U2FA 5KKAA 2V97A 1BGWA 1F0NA 4HNSA 3RYFA 4ZAVA 4E1BA 5C46F 1WBJB 3C85A 3H0KA 3KNZA 5BV7A 1AGNA 1F6BA 1S8OA 5EMMA 4XVQA 4M0LA 1M1NB 5EJFA 3AOEC 4ZU1X 5AKXA 2WILA 1NJ5A 1O9GA 3JV7A 3A1NA 4RVFA 3SJBA 3RS4A 4IDQA 3BRWD 2JLAA 2YWBA 3D31A 3W9BA 4BV2A 4EB3A 3E5NA 1Z06A 2WWWA 5LBUA 1GZVA 1E6UA 4OKIA 4CRWB 1ZRSA 3EDYA 4BQFA 1Q19A 2GN4A 3ZHZA 1SU6A 821PA 1Z13A 3TF5A 4WOJA 4HLUA 1LDBA 2WU4A 4X20A 3ZH2A 2H8GA 3BMQB 2JHAA 1PQ4A 1UC9A 1IUKA 1T3HA 3I4CA 4O2AA 4B4KA 1Q20A 4B3DA 1CP2A 1IXKA 2XHZA 3FCYA 4LJSA 4RL4A 3D4BA 5SZJA 2VQ6A 3IKMB 4HAWA 3F9RA 4HQ6A 3V1KA 1C9KA 1KDYA 4XQCA 1PHPA 4JYMA 3WFJA 1REQA 2ONJA 2A7QA 1N1EA 3D6HA 4TQ9A 2ZB8A 2CJWA 1TUEA 3JQPA 1YZYA 4OSOA 4WEQA 1RXEA 2Y92A 2ZRMA 4BO5A 2IHTA 3AM5A 4EAAA 3U9LA 5U9CA 3M1YA 1G0NA 4E09A 5BYBA 5A03A 2FHPA 3AOGA 3AP3A 3KHUA 3SKYA 3DP7A 1OY1A 3NHFA 3LQQA 1WF3A 4UQPA 1BNCA 1VPDA 4ND7A 5CP8A 3IMFA 5K3SA 2O50A 3U9TA 3QPBA 5LZ5A 4YGYA 4UMEA 4F3TA 4M76B 5KTMA 2CHVA 3B7WA 4HAYA 1Q12A 3MRSA 5FA8A 1NSYA 1N2BA 1MPXA 4WNIA 2OMEA 1XCLA 3BSYA 3DMDA 1RYFA 2XRFA 2PJDA 2V7TA 1QYXA 2UVQA 4PFJA 1ZIOA 4AB1A 3ZCQA 1E1YA 2X1LA 5KVQA 3LMKA 4HNTA 2GHTA 1JG7A 1XT6A 2XUGA 2A4KA 5DX1A 1CEYA 3ESCA 2EZTA 4DA9A 3QPVA 5BUZA 5HE8A 4DMHA 4DIFA 1M8PA 1YVUA 4G9GA 2J45A 4WERA 4DBZA 4NH0A 3ZBTA 2AOVA 1I2MA 3JTEA 4IDBA 1M6WA 4RVNA 4YLGA 4F7DA 1K7SN 4I50A 5F4ZA 5EMJA 2GAFA 5TQ0B 1DAMA 4XLZA 5IBPA 3TLJA 5I7UA 2V6IA 2ZWVA 2GZSA 3R9XA 2OGWA 2JGAA 3CNBA 4FEEA 3CZQA 3NGMA 1A9RA 4HYQA 4PFKA 3B13B 4OEHA 1L5KA 4DJTA 2HA5A 5B1IA 1VLHA 5FTJA 4ARZA 7REQA 2GZ3A 4LCJA 4FOSA 1Q7RA 2WI8A 5BOSB 1V25A 1DUVG 2FPUA 3U7GA 1XEWX 4QAQA 1SHZA 2O5RA 4JT9A 3EGWA 4MH0R 3USZA 5CVDA 4V0LA 1LBQA 2X9GA 3F5FA 3JPWA 4ZDWA 3N59A 5JY1A 3UJAA 1YVRA 4LV5B 1P7PA 3GCXA 3IVGA 4FDUA 1BEEA 1C9EA 3UB2A 3F6CA 4QLAA 5EHIA 4LZPA 2EAUA 1VHDA 4LC9A 3VSBA 3C3XA 5KU1A 2CFOA 2OECA 2DSNA 2EQ5A 4OG2A 1DO0A 2HBZA 4V0SA 4AF7A 4UTNA 1E1QD 1K8YB 3J80A 4QDTA 2B9EA 3IB3A 4J0EA 5CB4B 1J2EA 2CZCA 2IYFA 3BWYA 2QTMA 2QTBA 2V4UA 2EVWX 4DT1B 5IULC 3KPYA 2OGSA 1EVLA 3C4JA 2K2WA 1KO4A 4FGJA 4RHTA 1D03A 4HXFB 2IUYA 2XY4A 2QUJA 3OUTA 3MMSA 1M1NA 3HLYA 4JJEA 1GTSA 621PA 1U8FO 1CUVA 3L7YA 1L1FA 2ZM5A 3Q87B 1DIHA 4YP0A 4WLNA 2WM2A 4AN1A 1BH2A 4NPHA 4DUPA 4G65A 4EHDA 2QMQA 2VUIB 4ZVLA 2CV2A 4ML3A 1NI4B 3L1VA 2HBRA 3RQIA 1Z38A 3BK1A 1E8DA 1S3SA 3IHLA 5C1PA 3BMQA 1VFPA 2OCYC 2Z6VA 5HZGA 5LC1A 1Y3IA 5EJ6A 1EXDA 1U7HA 4QM7A 3ZGLA 1PT8A 3NVKI 1ZC4A 3R6DA 9ABPA 1MB9A 3H83A 5BRAA 3RODA 5B4VA 5TMPA 4U8HA 3VX3A 3HCBA 2PLNA 3ZWNA 3KCQA 2NYAA 1ZA1A 3ZHOA 5MFPA 1FNBA 5EHQA 3DE7X 3LRXA 2GQ0A 3GRPA 3OPQA 3L7NA 2B4KA 4YAJA 2XWQA 3DWEX 4IY1A 4OQFA 4DCPA 1EE2A 5E2BA 4EA6A 3EGEA 2XBMA 4G8JA 2JH9A 2HCFA 1Q17A 3V9PA 4Z0TA 2BR4A 2C00A 4R9UC 1P5JA 4A92A 4ZOBA 3AILA 1KYWA 3DZBA 3DE3X 2OZLB 1Y4UA 3OTIA 5TQVA 1T1RA 1OH5A 5A0TA 2CL5A 5L3QB 3UUFA 5T67A 1KJ8A 1O0BA 3FTNA 3L0PA 4LJ8A 5A5DA 4Q21A 1ZJ5A 3OEED 3RTBA 1LDGA 1W75A 4YQEA 2J09A 2GXAA 2XNDD 4I6GA 1QYDA 1RIFA 2FI1A 2V8OA 3WQBA 1M3SA 3IKJA 3PHGA 5C8YB 5HHTA 2D2EA 3P2YA 4YCDA 3W7BA 1NQUA 2JIDA 5EUBA 4BAZA 1J25A 3FMGA 4EWLA 4W8HA 4XCXA 1RWOA 4K7JA 2OGUA 4MUNA 1A2KC 1OKKD 1P3DA 1Y8ZA 1V7PC 1QF9A 3DZCA 5B1HA 2J0EA 5DM1A 4F84A 1OAKA 1WS6A 3JQBA 5TQ0A 5ICMA 2YNMC 4G0NA 3ISVA 4HQRA 2J7PA 3ZLTA 4POOA 1E94E 4CUKA 4WW0A 5DBOA 3I9V1 3K7EA 3LT1A 2ZUEA 3CE9A 1Z7WA 1MR3F 4YV1A 4GPZA 2QZJA 3SKXA 5BOSA 4AJJA 3TUJC 2OR3A 3JYHA 2PKWA 1CJCA 2JLRA 2KSQA 2OMKA 3PTZA 3CJRA 3R5XA 1CRWG 4IDEA 2KHZA 4WCFC 5FPSA 3F8TA 3L7IA 4GECA 4OIMA 4NZPA 1HL7A 1H2XA 4X91A 1NDHA 2P6RA 4OYRA 1FUIA 1M2WA 3CTMA 1GU0A 3KQVA 4PZ9A 4KIWA 4DREA 5ED4A 1DE0A 2IW1A 1PNVA 4IUDS 3QOFA 3GFGA 3PPYA 1QS0B 3P9IA 5FOVA 1G42A 3W0LB 4BO6A 3GRZA 1DC4A 2AZDA 3WAGA 5LMUB 2H3HA 2FSIA 3NHJA 5CB4A 1WUKS 3PU6A 1V4NA 3EPRA 2ZYTX 3RAGA 4HTAA 4DT1A 1P1RA 2XNHA 3GDFA 1NR5A 2YCBA 4A9AA 2N0SA 1BQEA 4YRFA 2LDBA 4CMJA 2EU8A 2WFAA 4JI4B 2DTDA 4D9MA 1EK2A 2HQSA 3NBUA 1PR1A 1VJ5A 2AN4A 2J9XB 1UXHA 2DLCX 2OUIA 4QD3A 4NYJR 5JADA 2ZB4A 3FWYA 1RAIA 4FYWA 3CT4A 3Q0TA 3GHYA 4GH5A 3VZBA 5KNBH 1NI4A 2I8LA 1Z3CA 2GYWA 3KJEA 2X5XA 5HJ7A 4P98A 5T4BA 1OKKA 1DQNA 3O8QB 1HI9A 4IRMA 5EFZA 4HB3A 2W0SA 1TRHA 4BLTA 1T8YA 2FWPA 3H1TA 1P9RA 2H07A 2OUKA 3I6ZA 3QMVA 4FU0A 2H2AA 4FYMA 5LYJB 1MX1A 1THZA 3P1JA 3ZS8A 5COAA 5BUSA 3S2IA 2ERCA 5P8WA 3MHTA 1ZKDA 3E3MA 4HNGA 1VP9A 1T9ZA 2HU5A 3M9WA 2JJQA 1KJ9A 1T1GA 2AVNA 1QP4A 1TB4A 4Q47A 3V34A 3X1YA 3E9YA 2OCLA 4LBYA 4R2HA 4FZJA 5JY6A 2ANCA 1M6VB 1V11B 2KJQA 3IAM1 3R0VA 3ZBUA 4D81A 5T7BA 1QG6A 1K06A 1D2MA 2OZLA 4RFLA 3KUXA 4IUYA 1EWQA 1JEAA 3TQCA 1T5OA 4CDGA 1NJ6A 2W98A 3Q98A 4LN1A 5L3QA 3QMWA 2R48A 1LU9A 3R7AA 1L4YA 2XDWA 4F3NA 1WZ2A 1GL9B 4U9UA 2HY7A 3CZMA 1S7CA 1L8OA 4G9BA 3TZBA 5BN3A 2IYLD 3HZZA 4Q9KA 5C8YA 2QRGA 4RVHA 1X1RA 4EF5A 4B3HA 4UTVA 4M8KA 8AT1A 1R5NA 4A6XA 1MIOB 2VPWA 1WE2A 3IBFA 4JUBA 4ZCMA 2OBXA 3CC8A 3PUZA 5IK2A 3I04M 1EX7A 1C41A 1W0KD 2V0CA 4TQGA 1WY7A 5AW7A 4LZLA 1A1VA 1RWQA 4G0YA 5CB0A 3W7AA 3H5NA 3IO5A 1YZQA 4PQYA 4W9NA 3T35A 3FYHA 1G5FA 5ECWA 4JA2A 5DDIP 3E9EA 3O3NB 4QPDA 4RMJA 2Z4TA 5CJ2A 5FI5A 2FGKA 3G82C 3AL3A 1W4AA 4X62B 1IWOA 2V7PA 4ZVMA 1OCEA 2UU9B 1G8PA 3A1WA 4A36A 3SLGA 5JNUA 4FOPA 5IS2A 2QR5A 4KXYA 2KW5A 2CV1A 3NDBB 3SHOA 1GNLA 1G21B 1I1OA 5I47A 3V2IA 2G0NA 4I6EA 3F71A 4FZVA 1GR0A 2EEPA 3LCJA 4J0IA 3SX0A 2ZS9A 1KH1A 1ZH0A 4EEZA 3N3BC 3T5GA 3ZNNA 3O38A 3A1DA 2I3GA 3JTMA 2VHYA 1TPYA 1EXVA 3U9SA 3IAUA 4MMYB 4AF6A 4GUDA 1QS0A 2ECFA 4V0NA 2ATEA 1MJGM 1B8PA 2XSZD 2Y76A 3NEPX 1X7YA 5IVPA 2HHHB 3S1LA 2HBYA 3CB2A 3RRFA 4CMKA 4PYKA 4F86A 5LIPA 4FFSA 4ER0A 3LLMA 3MMXA 2XOEA 2A9KA 3HM2A 3T7IA 3TDNA 2BE7A 1SEPA 1XJQA 3PKZA 4DDMA 3I5UA 1HETA 4QYMA 4ZAGA 4MROA 4HAVA 5FLKA 1X7XB 1FS4A 3FNBA 3HY3A 4EQ6B 5EXSA 3QKRB 4ZRMA 1MAAA 3RRJA 2E5WA 5E6SB 3DMRA 1CJSA 3T7SA 2R0QC 2HDHA 1JLLB 5AJUA 2QD2A 1JLRA 4E5YA 4OXRA 4BZQA 2JRCA 2J41A 1KJNA 3GLFB 1Q7CA 1N3YA 2I6TA 4A1FA 4DR3B 2C82A 3SKVA 3O8QA 2WG2A 2WKQA 3N6XA 4HQNA 5HZKA 3AOEA 5F21A 3NHUA 5A3JA 4QELA 3NNNA 4ZRNA 3BHIA 1CB0A 3FFBA 4RWEA 3VSAA 5LYJA 1W9MA 4F5EA 3AUJB 3FYDA 2X0NA 3SIWA 2ZUVA 3NM4A 1CUIA 2B4QA 4LBZA 4D9KA 1KO8A 1OFUX 5HTKA 4Z4GA 3A6PC 1QQAA 2HCJB 1Z22A 5H5JA 1L7XA 3SVTA 2FEWB 3U13A 2IYYA 4ZCIA 1FDOA 4M21A 1JNYA 1Q1NA 2PQMA 4EO4A 3C0KA 1HDEA 4CV2A 3I62A 1BDMA 5FKJA 2XBLA 4AO7A 1H2EA 2ZCVA 4C5AA 1M6VA 1V11A 2SHKA 2XADA 3S40A 1RC0A 5DYTA 1XXLA 4O2AF 1M74A 1NBWB 4DV2B 1UXIA 3KLPX 1GTRA 2FWBA 4XW2A 3S3TA 2INGX 1PWXA 1MH9A 4BMPB 2C2KA 2GMWA 2XSZA 3EIQA 5U1PA 1EBBA 4KIGA 1EVJA 3DOIA 2R9VA 4ENPA 2DECA 4QJ5A 4TYMA 3KG2A 5HYVA 2WQ7A 3GRYA 3IUBA 1N5IA 3GRKA 3TEJA 2Q5CA 3OP1A 4V0MA 2VYQA 3R9KA 5JCOC 4Q3AA 3GD5A 2QWXA 4GGPA 3BM5A 3FD8A 1KYYA 3VOBA 4ZDKA 1WOMA 4HGQA 4DYVA 2PUEA 3BTSA 4YBRA 1MIOA 1V7ZA 5FADA 3KKLA 3RTGA 3RSSA 2B8TA 4NS4A 4BEVA 2O3JA 4E22A 3PGLA 4IZHA 2I67A 4OGGA 2IC5A 1F6WA 3IR6A 4Z1OA 1WZUA 5M2QA 1QLHA 1KIFA 1UJ2A 3QSGA 2IEDA 4GYJA 4H3SA 5I7RA 3Q2IA 3U7HB 2VZ0A 1FX0B 4PZZA 5KNDH 4DWOA 3JQDA 3NIBA 1U7UA 4LVUA 4PEVA 1XWIA 1U0RA 1XZGA 4KB5A 1M6NA 4PX2A 4UUQA 1ZBDA 2FTKE 1ZIDA 3E0XA 5EFOA 4L8YA 5FP0A 4BKQA 2Z98A 3QITA 4R71A 4HN2A 1G21A 5H70A 2BGIA 5KJEA 4QQKA 1M0WA 3ZHCA 4I08A 1Y5RA 3UJDA 3S8EA 1RYMA 4R83A 4IFTA 3WGYA 4G26A 4GMFA 4RQBA 1DRUA 1K6JA 1QM5A 3KZCA 5DP1A 5FWAA 4TWAA 3TQTA 3LQ2A 1E9VA 3PLRA 5GP1A 4LDJA 3WHKA 3EZYA 4EPYA 5DPMA 3TL3A 1MXHA 2GEFA 3QHQA 2VH5R 3ONDA 2CYBA 3ZWOA 3IQDB 1LPSA 4PQRA 3HXLA 3UNXA 2H48A 3CN9A 4WCFB 2R1ZA 2VYND 4I1SA 2JGMA 4H6XA 4TTPA 4GI3A 3SAJA 3COJA 4TL7A 1N2OA 5AI0A 3GHHA 2BP7B 2OY0A 2PG3A 2FFBA 2Y67A 2GXSA 2PX6A 3IHWA 2EW8A 2Q5IA 2QRNA 1X7XA 2QP4A 2O3SA 2WA1A 1GKIA 5M34A 1O97C 4UHHA 1AURA 4EQ6A 2Z6QA 3U4CA 3QKRA 1XLVA 5E6SA 1PD1A 3NAZA 3NVMB 3JVVA 3C5VA 1RWVA 3HO8A 3Q1KA 4E5VA 2QSYA 1UEIA 5IDXA 2O4UX 3NXSA 1EMDA 1JLLA 4D26A 5EMHA 1A76A 1RBYA 1DEXA 2PAAA 2ZTUA 3AR5A 4MVXA 3GLFA 4AMUA 4MW2A 4XFKA 4Q4JB 3CVOA 3ZWQA 4CF7A 3SN6A 4MW1A 3KPUA 4X3CA 5AHKA 2GD0A 1M34E 3PC7A 4P4GA 1ACJA 4PIMA 1NPDA 2CGEA 2ZZKA 1DARA 2BIFA 4M89A 1ZOOA 4QGGA 5ADVA 3FDZB 4C05A 2ATIA 5EIWA 3GJTA 3PPWA 4XEUA 4CKEB 4CM3A 5IARA 3FKQA 5MN4A 1UKCA 2BI7A 4KGXA 1NXPA 4UQLA 4D45A 1S1MA 5CFLA 4NATA 4J16C 4JD5A 1U9JA 1Q1GA 1UJ4A 4JP2A 4LRUA 4IFBA 4DY6A 5LU8A 3GUZA 3A11A 3T8YA 1U4OA 1Z2NX 3R44A 1AH2A 5GJCA 5EIXA 1C9YA 4NCXA 3EXG2 3VVBA 5H68A 1IHOA 1DBQA 3UVEA 3UQZA 1HDXA 2NO9A 3CZCA 4K05A 5HIIA 5K20A 4HDSB 2EZ4A 3WWDA 3GVHA 1BDIA 4XM1A 3NDPA 1FDTA 4IXWA 3HWRA 3MWDB 4BMCA 1H5QA 1HYBA 3WQRA 4MSUA 1ZY2A 1DO2A 4A5OA 4Z7JA 4MS3B 2HDWA 5G3YA 3L4KA 3VI3B 2YHIB 5ARCA 1E0JA 1NRWA 2H1CA 1WHTB 2PVCA 2VYNA 3EUAA 4G5RA 4OQPA 4ETIA 3NT2A 1Q84A 1N9GB 1Q92A 3HY4A 4MUMA 1TK2A 1XDBA 2J31A 3I3SR 4FFWA 1EAMA 4NK5A 3LGSA 4US0R 1Y48E 2BBWA 5DRYA 4CTOA 5JSFA 2WB2A 4CM4B 1BXZA 5DO9A 2GJ4A 3FUVA 4HGRA 3TLAA 5K8IA 5ALSA 4E03A 2DYKA 3CINA 4UEOA 3PJRA 4XQEA 5DHPA 4XUGB 1DIRA 1NNI1 1J8QA 4FYVA 3COPA 3CONA 3DAFA 3IBGA 3STWA 3AWIA 1Q7BA 5LZ2A 1YC2A 1FX0A 4Y9SA 4GX2A 2NT4A 4RKQA 3FSRA 3M3PA 2QJTA 4EEXA 1ZK1A 3E70C 3KQKA 5H0IA 3GF4A 2R47A 2I54A 3JQ8B 1VXOA 5K3BA 1QHYA 1WXXA 3MTEA 1F4VA 1Z7BA 2WIKA 5BV1A 1QFZA 2AR9A 2OBBA 2VAMA 5IF9A 2YNMA 1TQHA 3AHGA 4FSDA 4E2FA 3PDWA 5GTDA 3PNMA 3W2TA 1CJVC 3OUUA 1UBNA 4X6XA 4R31A 3WWCA 3DDSA 3R4VA 2PRZA 1NUUA 1RLJA 4TYPA 3AHFA 2ZTLA 1WW2A 4YH1A 4ESOA 3RTAA 1C2TA 1U9IC 4R2LA 4XD7A 3D6AA 2C97A 4N5MA 3WLAA 4Y0VA 3CX6A 4R16A 3ONFA 3NWOA 3VSCA 2JBHA 1JHAA 1L3IA 3GGSA 1PQYA 4WCFA 3PDHA 2KPOA 2HYIC 4IR7A 2F17A 2OPHA 4Q7QA 5EIEA 2BP7A 4NWIA 3ZI7A 3QPAA 1PJAA 5CT8A 5ALXA 1HWYA 1TZKA 3CZ4A 1AUQA 1Z4NA 3DE4X 1PTKA 2ZIEA 4QU8A 4DA7A 5C7YA 3W8NA 5CR9A 2VHQA 1GDHA 5G40A 1E2JA 4PCUA 3V2GA 3EUFA 3OD1A 1BTOA 2BGNA 2I1LA 3HFSA 3QE0A 4RWZA 4YCJA 2AW5A 4AWAA 3IKTA 1V1RB 4BX3A 1MHPA 1KTVA 5FA6A 2BWJA 1RJDA 3URKA 1Z73A 4Q4JA 1P29A 2F6RA 1AZSC 2VQEB 1I3OA 5CB4F 1NOIA 2R7MA 1RYDA 2TMYA 3CISA 3RS2A 1OC2A 2CDCA 2CKDA 1ESDA 2FSSA 4N82A 1UXGA 4O63O 1B74A 5F4BA 5J5CA 1CRZA 4DUGD 3RVDA 1T25A 3FDZA 4G0OA 2NG1A 2P35A 1SXJD 2WIDA 3GRRA 5FRDA 4CKEA 2FUG6 3V4RA 1GKYA 1HQDA 3IXMA 5DHTA 3QF4B 2WAYA 4J4TA 2Y6UA 3OVMA 4JI6B 2TMGA 3E2IA 4KUHA 4YAGA 2AV6A 3IOMA 1SIUA 4HT3B 4K81B 1P2TA 1HSZA 1V8ZA 3VO9A 4HO1X 2GEDA 2VUSA 1IHUA 2QVZX 2CZGA 1RXIA 1W5BA 3ILSA 3ZNOA 3GDGA 3KL4A 1EUDB 1QSGA 1G3IA 1K3UB 3DJFA 3GGDA 2PZAA 3FPBA 4GSYA 1USIA 4HDSA 4PGGA 4QOJA 1RYBA 1PJSA 3RSCA 4WBXC 2HW8A 1WA5A 3MMPA 1OIWA 2HFKA 3X3HA 3F3MA 3TG2A 4RK5A 1DJLA 3LVQE 3KUCA 3NTVA 1I5RA 1Y33E 4H7FA 5FI1B 4MS3A 2QN8A 3F4BA 4EFLA 1IY8A 3IE1A 2YHIA 3UWKA 1ODJA 2P65A 1IHPA 3BGSA 4FYKA 4CMBA 1KQOA 2PLWA 2V7BA 3KX2A 1GNPA 1K7EB 1WHTA 4Y2GA 1W93A 1PF7E 5E2AA 5G4LA 2PPLA 1M7GA 1CKEA 1N9GA 1Y80A 2I6UA 4RLFA 3N74A 1CK4A 3PFIA 4UU8A 3RWOA 1J70A 1LGYA 1ORIA 3JW8A 3EVZA 3MTGA 3NBZC 1XZCA 5EPEA 2C5EA 5CX1B 4PRYA 2BC9A 3DCIA 1J8FA 3LFHA 1C0LA 4CM4A 4EBBA 1GL7A 2ZJ3A 2M6RA 4H7IA 3PXAA 3KJZA 5FLYA 5K0JA 4MDFA 4K9MA 2V0NA 1ONSA 5K6RA 1T0IA 1KAMA 1OX6A 1STOA 2P91A 2ZETA 4MYUA 4XZ3A 4CEHB 1Z63A 5HM8A 3V7FA 1QE0A 1GZ7A 2ZQ5A 3E18A 3UYLA 3NC1C 2JCXA 5J59A 4NH4A 1GGFA 2ISQA 2ZKLA 3AKDA 4Q7MB 3RQSA 5HRAA 1XDUA 5H59A 3OURA 2E1PA 1DJOA 4C7OB 4DUGA 3JQ8A 2C20A 5C8YF 2H5JA 5J40A 3P0EA 4Y1RB 3G5MA 5JJCA 1KKUA 1XRLA 2I03A 2JJ1A 3TBKA 3AF5A 4PNPA 3KJXA 1ZCJA 3QOWA 1A97A 4CMGA 1AOXA 1FDVA 3DS8A 3G0GA 1OX4B 3KSUA 2IEGA 4XKJA 1Z74A 4LJ7A 1R6AA 2ENWA 3FNIA 4AS2A 4DM4A 3JQAB 2GEVA 1U1DA 3OQHA 2PWZA 2R7LA 3T5AA 1P6QA 4XVUA 2FQYA 3BIFA 1BE0A 2X14A 3AHDA 3JYQA 3WB2A 4EEKA 1KRHA 1E0AA 1KU6A 3GJYA 3CZRA 5GWXA 2H0RA 1N7HA 1SCIA 1QP7A 1OLXB 3UQYS 2WMOB 1WZIA 1DWPA 3PITA 4CM9D 3GLGB 2BF4A 4B73A 1RU3A 3ZHBA 4EY4A 5JD4A 4FQ5A 2DHQA 3IUSA 4NL4H 5G1NA 5KINB 1F60A 2O5EA 4QXPA 1C8LA 2ZG6A 1BCRA 4NICA 2CLMB 3KBBA 1CZNA 4ZZ3A 1V2HE 1MC4A 1PZGA 1SBCA 3LKVA 2EIXA 3DD5A 4MRSA 4UNIA 5E7QA 2XT9A 2HWUA 1JVNA 3FLEA 3QPUA 5DTRA 3T9FA 1V1RA 3K6JA 4UFPA 3SJUA 1Y3BE 1Y37A 1V26A 2ZSAA 4D0LB 5BNZA 4L4UA 1XCJA 2QLLA 2XUIA 3NAGA 5EJ7A 2DEUA 4YQZA 4AWBA 3NX4A 3RK4A 4C0JA 2AGVA 1UPFA 5HA5A 3USES 1UKAA 2OKGA 2GVDC 4GX0A 5ITZB 4BMOB 1F14A 1G4AE 4IKOA 2Z4SA 3ZDQA 4IMIB 4M9XA 4MGKR 3D59A 1K4MA 3U7EB 1L5ZA 1M5UA 2DU8A 3QF4A 4JUAA 1A9QA 1QVRA 3SBDA 3U49A 3UZUA 5IASA 1T9KA 1KK0A 4IXMA 3GMSA 1W4LA 2X0IA 2ORVA 2AFVA 4QOGA 5DSXA 4L7QA 5CDFA 3FFXA 1ORRA 4WD3A 3CUWA 4M1MA 1XRRA 2WP0A 4LY9A 5CBKA 3AEYA 3B7PA 3N0VA 5FFNA 4KI7A 2ZZMA 2CK3D 1EUDA 3Q7TA 2OXRA 3C1OA 2F3PA 3E7FA 3BORA 2FN7A 2A0FA 1VE7A 2GEKA 4NG5A 2XBUA 4IGAA 1PUIA 5LYJF 4FW9A 2C9ZA 1P8JA 3WLTA 3HB9A 1UZAA 1AKVA 2FPIB 3LIIA 4RHEA 1XCOA 2GGSA 3Q5DA 2O0HA 4II3A 5CK5A 2WT8A 3DOUA 4XE5A 3THYA 1NBEA 3FVRA 2RDMA 4Y98A 2AHRA 3ICOA 2CKMA 2IIBA 2Y3IA 2HL6A 1ZUD1 1ZHOA 1IXYA 4BNDA 3KKQA 3LY8A 1UT6A 3VNAA 1U02A 4JHXA 3MJFA 5CG1A 1UJ6A 3WAKA 1DNPA 5CX1A 4TZTA 5F52A 1CVLA 2B3TA 1UXJA 4KK4A 1WB9A 4TROA 1PKEA 4URUR 1DXHA 4NMXB 2ZJ8A 1V48A 3GN2A 2XVAA 3RHFA 1M66A 4IEEA 3TIFA 3ZBPA 1GQRA 1O97D 3B8EA 3AIOA 2GDJA 2JIQA 4CEHA 4BO9A 5AI6A 3ABIA 2ZI3A 3ZWVA 1JWLA 3L7JA 4CIWA 2VQ3A 5JCOA 4BKRA 3HR8A 4IYRA 5JS1A 4YV7A 2XKJE 4LXUA 2NU6B 2EGUA 3B8HA 3E81A 3DKKA 1JB1A 5AKGA 2GVNA 2JLXA 4C7OA 1H2FA 1X2BA 3GDWA 4W5WA 1MOPA 1MO5A 2LKCA 4Y1RA 3OQOA 1OXXK 4KN5A 1IEVA 4HWTA 1N6HA 2R2AA 2DHRA 4OM8A 2VUUA 5GM2A 4J75A 4UUAA 5IJZA 4G1CA 5LPNA 1Y34E 3TI7A 3SQWA 2YHBA 4XX1A 1OX4A 4YJGB 3L8FA 4GFDA 2OBFA 2VG8A 1OOEA 1ZDMA 2OXEA 4HNVA 2ZT5A 1RCUA 4LYFA 3JQAA 3BG5A 1NV9A 3LLCA 4ZYZA 4R54A 2BD0A 2GYYA 3C8HA 2NQ8A 3OI7A 3V8RA 1SKAA 2QUHA 4B48A 3D6VA 2I6XA 3I45A 3O4HA 1BGVA 2VJPA 3WNCA 1PV1A 2Y93A 2EATA 4QPZA 2CK3A 3OLZA 2I3BA 4AC9A 3PUJA 2KMLA 4LXGA 3ZGZA 4Q34A 5K0FA 2W7TA 1OLXA 5GONB 2AKAB 5BQFA 3WV4A 4R1QA 3FYUC 3GLGA 3MB8A 3NKVA 2H3EA 2F1IA 1DX9A 3WB1A 3AEQB 3C7AA 5AVZA 4PS0A 5F1KA 5AVVA 3WX0A 4Y1FA 1TVCA 2PUTA 1RYYA 3ND7A 1G16A 2H1SA 3JYNA 4J7UA 4MI1A 4D82A 5C1DA 2VTBA 3BGIA 2Z6AA 2V0GA 4BN5A 4F85A 3WSWA 3GRFA 4KTTE 4PLYA 2WHPB 1ZLYA 1AIPA 1DKQA 3TTTA 1E20A 3HZRA 3RIMA 1HKUA 3UC9A 3ODPA 5E8RA 3ZUGA 5A02A 5CURA 5ENZA 1SZDA 4OLHA 3IOEA 1TFUA 1VECA 2I9PA 1T13A 3UYKA 2L82A 3QV1A 5ITZA 2XE6A 3WNQA 3KQYA 3GT7A 4EAQA 3Q8KA 4QNMA 2Q21A 4XIJA 2QQEA 4AMGA 4B3SB 2C4TA 2G9VA 4RESA 3F9CA 4IS2A 1XVUA 3BIWA 3AH8A 4RM2A 2FN8A 2YXEA 4GL4A 2JBWA 5ALIA 5EUCA 1NVEA 1L5QA 4LRTB 4REQB 4CKBB 1WABA 4KQXA 2RB5A 3MQ4A 3NPMA 3AZOA 2VNKA 4IJMA 2D4AA 2DPMA 3L8YA 3H18A 5CITA 2B8EA 3K0FB 3K8ZA 2DC1A 2ZBUA 1A8HA 5D6NA 4AJ1A 2AQKA 1CIPA 2V45A 4OQ4A 1ZH2A 5F73A 4YX9A 3A4YA 4F91B 1WTAA 2YTZA 3NIGB 5FX2A 3CEJA 4Z7OB 1AK9A 2WHRA 4AKHA 1VSBA 2XODA 4PZAA 4D9EA 2J07A 4J16A 2WWXA 3T3HA 4CT5A 1YQXA 1ZM7A 4U6QA 2FPIA 4B5LA 1OX5A 3P9QA 2OXCA 1LTHR 1QIIA 1DAGA 2DY0A 3CJTA 3DAHA 4JYBA 5FPPA 3SEFA 4IEIA 3IQIX 1KR2A 2QRKA 2VZ9A 4FK8A 3HI4A 1XTVA 3RLIA 1FTWA 1PDOA 1RBQA 4HS4A 3WXBA 4FHDA 2PJZA 2VLBA 4M38A 3JZFA 2R6DA 3BXEA 3GFOA 2YICA 2XT6A 4I55B 4OO3A 1EG7A 4C0KA 1N9KA 2HRZA 2H7YA 3NRBA 2FEKA 1R27A 3EPPA 1EKXA 5J23A 4FR0A 5KC9A 3LGXA 1UODA 4YI5A 3KO8A 4MW7A 5B58C 1E69A 3WB0A 2I6SA 4EFMA 1WD7A 4AO6A 3ZH9B 3H5WA 2IV7A 2VKQA 1Y5MA 3OZEA 4LTNA 1XEAA 3AFNA 3GT4A 3N9IA 3GUVA 2NU6A 1RDFA 4JOSA 4RD1A 5CA1F 4XIGS 4AL4A 3WK7A 4RSMA 2NPOA 4QKQA 2ASVA 3BF7A 1QHNA 3BA1A 3GIWA 3QBJA 1PRYA 5JCZA 1Q2XA 3H3FA 1T4GA 3E3OA 2X7XA 4RHYA 2DFDA 1BA2A 4JP5A 2B2XA 1T0BA 3OG9A 2IP4A 3IAM6 3L41A 1Q16A 3CRQA 3DE0X 4O2LA 4YJGA 1WMDA 3R7BA 2A1IA 2M6LA 4J7XA 4LE1A 3IIJA 1YR8A 1EHYA 5AD1A 2A88A 3AFIA 5FBVB 4N4AA 4RSRA 2RGGA 5K01A 3FOZA 1KJWA 1J8YF 3R9IA 2JFXA 4M99A 3JSXA 3T3IA 3E9DA 4W5RA 4Y2UA 6ADHA 4EB0A 2IJGX 4YJFB 2YZKA 1PWHA 3D8SA 1M2OB 5FR2A 4ALJA 4DCSA 3UCFA 5GONA 2DTEA 1PNOA 5BT8A 1TZBA 1RLMA 5IW8A 2WINI 4C0BA 3MWFA 2YL2A 4RKEA 1WXEA 1U9IA 3AEQA 4F56A 1JMYA 1U3DA 3GCDA 3S2SA 3CU5A 4TTJA 1XZHA 1M0SA 3SIRA 5JTUA 5GADl 1KZYC 2QRHA 2E0IA 3UV7A 4XD2A 1IVNA 1JUDA 4S1OA 2WHPA