3RHSA

Phosphopantetheine adenylyltransferase from mycobacterium tuberculosis complexed with coa
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
157
structure length
157
Chain Sequence
MTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Three-Dimensional Structure of Phosphopantetheine Adenylyltransferase from Mycobacterium
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 52
structure length 157
sequence length 157
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2011-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3rhsA00
1J1ZA 3N8HA 5DK4A 4ZT5A 1LI7A 1M83A 3UOWA 1BS2A 1JIIA 4NAHA 4JXXA 1O0CA 3AG5A 5H16A 2PFSA 3UMVA 4PBTA 1J70A 1F7VA 3ISJA 1JGTA 4MUHA 1A8HA 4ZCTA 1JIKA 3CVXA 1WQ3A 2O5RA 1KP3A 1G8FA 1KORA 4YP7A 5BNZA 3M5WA 4K03A 4ND7A 1Y42X 2A84A 4ZCRA 1FYDA 3A05A 2DR2A 3Q4GA 5DEOA 1GAXA 1QJCA 1JZSA 1VBNA 1FFYA 1U0BB 3VRHA 4U63A 4FZJA 5KHAA 1I6LA 1TYBE 4L2IA 5LFAA 3ZJVA 1VBKA 3ZGZA 4AQ7A 1PG0A 3Q10A 4ARCA 4HJRA 1N2GA 5K0TA 1O6BA 4OUDA 4J76A 4MWEA 5TS2A 3ND6A 4K0RA 2J09A 1N2OA 1WXIA 3DO8A 2HZ7A 3LCJA 3DLAA 1JMVA 5FO1A 2XRZA 1IQRA 1NUTA 3IODA 3VU8A 4MUJA 3MMXA 1N2HA 2ZUFA 3G6KA 1QNFA 1O0BA 1GTRA 1IH8A 2A7XA 1NZJA 2JAXA 1PG2A 4CDNA 3DV2A 2CV0A 2QTRA 2DLCX 4DDKA 2BTEA 1T6ZA 1NI5A 1YIDA 3IMCA 1MAUA 2A86A 1ZUNA 1H1TA 1ZH6A 1GN8A 2AG6A 5IHXA 5LM3A 3H99A 2GKSA 1NUUA 1UFVA 4G6ZA 1QQTA 3IH5A 1V47A 1EUQA 2WSIA 1JEDA 1SURA 4EG8A 5HUHA 1VLHA 1ZH0A 2R5WA 3E27A 4HPWA 4WNYA 1X6VA 4DE5A 4EG3A 2YY5A 5HG0A 1MAWA 2X3FA 1O94D 3INNA 4Q16A 1KH3A 2JA2A 4U8HA 2YXNA 4MLPA 4YMIA 3H9BA 1I2DA 1IRXA 1WKBA 1TYDE 2PZBA 3JXEA 4MUFA 1N2IA 3QTTA 1O94C 5KWVA 4JYZA 1J09A 4MUEA 2WB2A 3CVVA 2D5BA 4G5FA 4YP5A 3TQIA 1PFYA 1KR2A 2CV1A 1Q15A 1ULHA 1YUMA 3PNYA 3U1VA 4L2IB 4HJXA 4E1AA 4H3SA 4DLPA 5TEVA 1R6UA 4OUDB 5TEWA 4AS1A 3ZXSA 4R2LA 3KT0A 3TZLA 2A1TS 2HMAA 2Z09A 4CQNA 2E18A 1N75A 1YI8A 2GM3A 2ZP1A 1XNHA 3HL4A 2CYCA 2A1TR 2QJFA 3H97A 1MJHA 1J21A 2PZAA 3ZUGA 2X0KA 3ND7A 1OWOA 2CSXA 3FI0A 4KR7A 1IHOA 2J08A 1NUPA 1YIAA 1JZQA 1MB9A 2PG3A 3TS1A 2B7LA 1OD6A 3NBKA 2V0GA 3K32A 1M8GA 5DB4A 4I6EA 3NBAA 4PBRA 3OP1A 1EE1A 4DNXA 4ZCPA 3IDFA 1JECA 1VL2A 2EL7A 3UY4A 5J59A 4MQ6A 2CYAA 5HUJA 1DNPA 1PFWA 1JHDA 3MLBA 3FETA 1WY5A 2CUZA 1Q11A 3X1MA 3HMQA 4RPIA 3PNVA 3PNBA 4ZCQA 2VTBA 5IJXA 4KR6A 3G59A 3CLSC 2NZ2A 1V8FA 3N05A 4ZT4A 1NURA 3CVWA 1PFVA 4R2MA 2OV4A 1S4MA 1N2BA 3IUEA 3MXTA 1QTQA 1OWPA 2JANA 3AFHA 1YUNA 2D54A 2D13A 2V0CA 1RQGA 2IJGX 3SEQA 1PFUA 1OWMA 4GU5A 1QRSA 1U3CA 2CT8A 3FOCA 2C5SA 5TGTA 4DDHA 1KQOA 3COYA 4ZT2A 3LE8A 4CDMA 5LLTA 3FNRA 4OJMX 3CVYA 5J5AA 5FO0A 1EXDA 4MVCA 1QRTA 4NZPA 4KPUA 2Z08A 1M8JA 1I6MA 4MW7A 1U7XA 2XRYA 3ZJUA 2AZXA 3AL0C 4MVXA 3UC5A 3H9CA 2PIDA 1WJGA 3IVCA 1WOYA 2DXIA 1EJ2A 4EF6A 1GPMA 1NUSA 2I1LA 3TQOA 4A91A 4TS1A 1MB2A 4JZYA 1EFVA 2O8VA 1N2EA 4KR9A 3COWA 3N9IA 3KFLA 2A1UA 1D2RA 1P7PA 4WSOA 3X1KA 3A04A 3I05A 3TZEA 3AG6A 1JIJA 3IOEA 2DERA 2X1MA 3RFFA 2IELA 4MUKA 3RK1A 4PBSA 1HYBA 1H3EA 1QRUA 3SEZA 3ELBA 1KP2A 1XJQA 3RBAA 2VTBB 2CYBA 4I6JA 3BL5A 1I6KA 4MWCA 3FIUA 4I6GA 4NAUA 1MRZA 1WXHA 4MVYA 4QRDA 1Q19A 1ILEA 2QJTA 4CT0A 3D6UA 1KKUA 1O97D 4UZFA 3CLUD 4MW1A 3HGMA 3SDBA 1N77A 4MW0A 3ZIUA 4XFDA 4XSVA 1Q77A 1IVSA 2YWBA 1KQPA 1O97C 3SP1A 3CVUA 1MC1A 2AKEA 3K9WA 3KT8A 1WXGA 3CLUC 2CV2A 3P0HA 1R6TA 4F4HA 1OWNA 5FNZA 4NX2A 3FHJA 1OWLA 3VGJA 4RUKA 4EG1A 2YWCA 4BWVA 3D6VA 4EG4A 4KPUB 2RD2A 2PZ8A 4NATA 2A4MA 4P2BA 5F23A 5H7XA 1TFUA 4EGAA 1WXEA 4ND6A 4EG7A 1EFPA 1X8XA 2G36A 3RJZA 2BYTA 3UK2A 4UZEA 1K92A 1NP7A 1NYLA 3RK0A 3X1JA 2HGZA 3C8ZA 4MUGA 3COVA 1G8HA 3MLAA 3MUEA 4KKVA 1GZUA 3HV0A 4ZT7A 3SZGA 3CLSD 3ILVA 3PXUA 1IQUA 1R6XA 1EFVB 3RHSA 2EJCA 1KAMA 3F3MA 3P52A 1N78A 3DPIA 2NSYA 3KT3A 3QTBA 2Z3VA 2A1UB 3QE4A 4S1OA 2PXHA 4MULA 2DETA 3ZJTA 3SYTA 4YP6A 1H3FA 1KQNA 2IP1A 1O95D 1WXFA 1N2JA 2X1LA 1N1DA 4EG5A 3FDXA 1WQ4A 2OQ2A 4JFAA 1COZA 4MUIA 4MWDA 2TS1A 4MWBA 1O95C 4DJAA 2E89A 4ARIA 1T6YA 1CT9A 4J75A 1MOPA 4EFKA 3P0IA 1F7UA 4GRIA 1M1ZA 2QTNA 4MW9A 1MBZA 3TNJA 1N3LA 5JBNA 1TYAE 2ZUEA 3L92A 2DPLA 1EUYA 3ZXIA 5EKDA 2QUHA 1VBMA 3HFJA 1T9GS 2E21A 2VXOA 1O96A 1T9GR 1KH2A 1J1UA 3IMGA 4ZT6A 1K4MA 1XNGA 4MW4A 3CLTD 4YBRA 3FG9A 4MW5A 1G8GA 1H3NA 4ZCSA 1KAQA 2QUIA 1QU3A 3PRHA 1EFPB 2QUKA 1M8KA 2QJOA 1ZJWA 1OBHA 1IFXA 2CFOA 3CLTC 4PY2A 3IVXA 4QREA 1GTSA 5K0SA 3ND5A 3P0JA 1M8PA 4HK4A 5AHWA 4ZT3A 3AIIA 5KCMA 2DUMA 1LI5A 3AKZA 3GUZA 1T6XA 3A2KA 3CA8A 2J07A 3OTWA 1NUQA 3GLVA 1U3DA 3KT6A 3CR8A 3FY4A 1U7DA 3N2YA 1J20A 4G5YA 3IUBA 1KH1A 4MVWA 3G5AA 2H29A 4Q93A 2J4DA 1JILA 3FH0A 2WQ6A 1M8FA 3IOBA 2E0IA 1F4LA 3CLRD 3IVGA 3LOQA 4MW2A 1TQ8A 1JEEA 1O5TA 1IQ0A 2J5BA 3IMEA 3H05A 4EG6A 1K4KA 3CLRC 3HZRA 4MAFA 3S3TA 1TYCA 1NSYA 3A4IA 4QBTA 1YULA 4NDAA 5J58A 4U7JA 1OBCA 3GMIA 3IOCA 4MUNA 4XFJA 2DEUA 4JXZA 1GLNA 3NV7A 4R0NA 1B6TA 1XNJA 2A88A 1LW7A 2GOYA 3COZA 5DASA 1F9AA 4MW6A 2WQ7A 3SZ3A 4F3RA 3Q12A 1G59A 1O96B 3L93A 4DDMA 2RE8A 2QUJA 3FWKA 1K97A 1WZ2A 4X0EA 1QU2A 2QTMA 2H2AA 1TEZA
chains in the Genus database with same CATH superfamily
4FHZA 4Q66C 3R7WA 3TM5A 1T15A 1J1ZA 1YHZA 4CIWA 1U1CA 2AOUB 2BEWA 4G9EA 1F1JA 3NHZA 1DOZA 3QHQA 4R1NA 4IH4A 5LBIA 1D2GA 3Q9SA 4KG7A 1UFRA 2TECE 1ZGHA 4ZOBA 1C8VB 1N5MA 4I81A 1OV4A 3Q5DA 3VI3B 3WK4A 1Y4SA 4J7AA 4O02B 3ANLA 1U94A 4GLBA 3WL5A 3DHEA 2FDCA 5CEJA 1DKQA 4JMLA 5FL7A 2DWCA 2PWBA 3SNKA 5DPMA 2OCYC 3VSAA 2V74B 4NJOA 3PITA 4QD3A 2ADFA 2BMDA 2BMJA 2C54A 2DBQA 3IPAA 3L1UA 4MAMA 4WKPA 5F64A 3QVLA 4QX6A 1QG4A 4L75A 5TE9A 2J0UA 2WY2D 1AT1A 2ZBVA 1LGYA 2GQ0A 4FC7A 4OFWA 2A9PA 1ZXBA 1TAUA 1KEZA 4U63A 3TNYA 2OP0A 4MS1B 1T1EA 4BCBA 1T2EA 1GD1O 1EPUA 2AJBA 2I6FA 5DCYA 3T3DA 1PO7A 3ORRA 1S9DA 4WACA 1TQ2A 2XKJE 1ZRNA 1D0IA 4OYLA 5EQDA 4B6GA 3Q72A 3NHAA 3TPCA 1VG8A 5COBA 2M6SA 1Z38A 4DC0A 2I91A 4ALIA 1E7SA 2WM2A 1XRPA 1DEOA 1Y1PA 3ND6A 4HZUB 1XRRA 1UBRS 2QXTA 3GHHA 3IHTA 2B2CA 3LY7A 1OFUX 4XQEA 2X3UA 2B3DA 3GNLA 3OH8A 2HLDA 5AH0A 3R76A 3DLAA 5EJEA 2ZDHA 4G5RA 1ZW1A 3KDAA 2HNBA 3EWSA 1DS6A 1GGKA 2IIQA 4QQNA 2KW5A 4WJLA 4XWKA 2PS1A 4IVQA 1B0AA 5HZMA 5DNAA 1R5BA 1RXCA 5TJHA 1CG6A 3FLAA 3CB2A 4IF4A 1KHTA 4LC9A 3FPBA 5D84A 4KXUA 5CFQA 3HKDA 4HQRA 2E4ZA 3OJOA 4JLWA 4ZO8A 3EZFA 1GWNA 1NI5A 4PQYA 5HP4A 1XEXB 4F6RA 1ZUNA 4URUR 4LBWA 1KZHA 1SUCA 3H5WA 3MUNA 4HYTA 5ALLA 4GXQA 1Z4MA 1L7OA 1ZWKA 5FOSA 1YCFA 1AKUA 4Y2JA 1W5EA 5HA5A 1I1OA 5JWOA 1ONOA 2WT4A 3WX0A 1JLLB 2WSIA 4FDUA 4DT1B 5BVGB 3KIPA 3L49A 5HUHA 4I4CA 2OHVA 5GJVC 3BN3A 3FLMA 2ODNA 2AOTA 3I9JA 4Q0MA 3TW4A 2HHAA 1BFUA 2ACKA 5AJVB 2CKMA 5LA6A 4LF8B 2IUFA 3I6ZA 3PLAE 3KWMA 3N2LA 1I0LA 4Q3EA 1KH3A 2JA2A 4M1EA 4B47A 2BC9A 2EQ5A 3LY9A 4EIWA 1QM5A 3CCFA 3CXRA 4R7TA 4OBEA 5TMEA 5L6LB 4DMLA 5B58T 1TYDE 2NO7A 1U0JA 3HMKA 1RYZA 3PSAA 3QNUA 1IMJA 5EAIA 5TT1A 1M1YB 2JI6A 3QTTA 4GKJB 2GRUA 5IXYA 2ZE8A 4Q4JB 3WB2A 3LT5A 3EARA 2H7VA 4ON9A 3A58B 2IU0A 4GPD1 1U8AA 2QRLA 2H9YA 4S1VA 4YV0A 2JA1A 5AKLA 4UBKA 2D0OB 4KMMA 3FBTA 1HZZC 3S68A 4DBLE 1CB7A 3KUCA 3MAGA 4F2HA 3QXCA 1HLGA 1PLLA 3HJFA 4QASA 1VP3A 1AS0A 3D4OA 4JHXA 4GGMX 2YWGA 1D6JA 5DCLA 3WMXA 3CVJA 1BMQA 3F67A 4ARBA 2HA2A 3GLFB 1A9RA 2GF2A 1CJUC 1MQSA 2C9CA 2G1KA 2PO5A 2YNMC 4YCCA 1SD5A 4L02A 4OUDB 1Y6GA 3MB5A 4XVRA 1QRTA 3ZGOA 1XXHA 3ZDBA 1D4FA 1J5PA 3KZ1E 3RR2A 4FFMA 1LDNA 1S3SA 4F7DA 3MTIA 4HYEA 4ND1A 4DDWA 4GYKA 3G9ZA 5KVAA 2QWXA 2PLAA 3AYZB 4P53A 4EA9A 5B3KA 2P6OA 4DQVA 2E1RA 5CA0A 3VTAA 4ER0A 5I5GA 3UGJA 5C1BA 2HWYA 4QSHA 4YNBA 3NAZA 1HMPA 2ZROA 4O4LB 4QDTA 2P6NA 3W9SA 3ESRA 2EG5A 4ZQFA 2J5RA 1N32B 2B4AA 4FYIA 5ILGA 1IY0A 4DXHA 2QZZA 1C1HA 3HCNA 5C51B 4FMDF 3VPXA 3Q6MA 4YYEA 5A3JA 5CB4F 1D9XA 2GGSA 3PL1A 3OFNA 4XD7A 5EE0A 4MEJA 5IMBA 1IJKA 3NBAA 4BP8A 1UBJS 3JAKA 4MQBA 1JG4A 2A5JA 2OL4A 1JECA 2JFNA 4P7KA 3CFYA 3I9MA 4QOEA 5LP6C 1J0BA 5CFPA 3W3AA 2W42A 1Z12A 4XVHA 2OYCA 4RVOA 4F4FA 1CW2B 1DAFA 1WCYA 3GD7A 4X8OA 3EYAA 3FFXA 1CUSA 2A30A 2RJOA 3DKPA 3MGAA 3PNBA 4ZCQA 4ZMRA 5AVUA 1YBAA 2VTBA 4WH0A 4YXFA 2VAPA 4GQAA 3LXXA 4RHXA 3PFCA 4ZT4A 2OV4A 2PX4A 3OZRA 2P9FA 1ATIA 2JANA 2X2EA 3QXXA 2D54A 1WDKA 1B26A 2RHOA 3AIMA 4TVOA 3RB8A 3T3OA 1A2BA 1H6DA 5FWYB 3SEQA 3JAMA 1SUWA 4HNQA 4R83A 2FG7C 3ZBTA 3IV9A 2V6GA 3B6JA 1T4CB 2B4KA 2QZSA 3B9BA 3GLHB 2HSJA 2MINB 4RWZA 1V8OA 4P4NA 4C78A 4DDUA 3HKBB 2ECQA 2WKWA 3DM5A 3GLSA 3I1JA 3R77A 2AGVA 2QPTA 2VNHA 2W6ID 4JB3A 3ILYA 1CEQA 5CK5A 1C9NA 1M8JA 3OIYA 1D07A 3JWHA 1XRNA 2DULA 4OXKA 3Q3CA 1I6MA 1SC9A 3PQ6A 4BCCA 1U7XA 1IVYA 5LZ5A 2C9BA 3W2HA 3NVKI 3CHYA 4FOSA 3MPOA 4TWZA 1UKZA 1YCHA 2BISA 3OMXA 3ZY5A 3FOZA 2FN8A 2X3YA 3JYPA 1NXOA 5K3FA 5GTDA 2O1WA 3BIFA 3HZZA 1S89A 5ER9A 5ITWA 4EKIA 4P31A 3PIRA 3KEQA 1MX1A 3D3WA 2BSQA 5AXAA 4YAOA 2A67A 3CWQA 2WRZA 4ZZIA 3DBRB 5IH3A 1MJ5A 3QEKA 5D85A 4RJJA 1C3EA 1PUXA 3OC0A 4JZYA 4CUJA 1B8NA 1O4VA 3DEAA 3MT7A 4FC6A 3WRVA 4X6UA 3NT5A 4Z4FA 2I2AA 2GTPA 3ETHA 4H6VA 5ELMA 3KFLA 1T4GA 2CEAA 2ZLBA 2W6PA 4ZU6X 2QUBA 1FJ2A 5EYPA 1UMDA 4DABA 3H7AA 3NHUA 4JH0A 3SKYA 1IN7A 3ZCUA 3A04A 5J2UB 2CD9A 4DXAA 2XUOA 3BE4A 1HDEA 1CWUA 5A03A 2F8LA 3RC1A 4AW9A 1JEYB 4Y2VA 8ADHA 5I7RA 3C4JA 4MARA 1V9SA 2QUZA 2X1MA 2PKEA 3E9QA 3EVNA 5F33A 3MAAC 5IC5A 4OX9B 1DFGA 4I2NA 5T4BA 3QEBZ 1RWKA 2F9FA 2Q3HA 4D80A 1DG9A 3B7WA 4MGKR 1FX0B 3PCTA 3MERA 4N8EA 1OIXA 4YS6A 4WW0A 5F52A 5ENVA 4EFMA 5HIKA 5I4IA 4NDZA 5JH7A 4QM7A 5JBQA 5L7YA 1A9XB 3VHQA 1WULS 3AHFA 4TKVB 5HPYB 1F8GA 2IEYA 2VVTA 2B2NA 3W8EA 4E2XA 1P29A 3B5IA 4HUQB 4KXLA 1Q20A 2PUFA 4TZ6A 3GYBA 1KRXA 2C9MA 3UA4A 4Z7NB 1Q22A 5KOHB 3ICOA 4CZ2A 3JQGA 4ZJZA 1P0IA 2ZBGA 1JKIA 1SBIA 2V98A 2AQIA 1TCAA 3KELA 4UMDA 3UFBA 3AUAA 4F4HA 1UPFA 2B6HA 5F2NA 1Z7BA 5HQTA 3WFIA 2CZGA 4TSFD 2AFIB 2R7KA 1QK3A 4Q1VA 1SBHA 1XVTA 5KVSA 2F3TA 7GPBA 3DDWA 4NABA 2D1RA 2EW8A 1U0OC 3E84A 4RCYA 4QO8A 5M34A 5AVSA 2BEJA 2YY6A 5MGBA 4EJSA 1CR6A 4IXNA 2IX3A 1N57A 3RJZA 3UK2A 3E22B 3JD2A 4XE5A 5E1OA 4KQ2A 1VBFA 2FW1A 2HRCA 2RGNA 3PUYA 1DPGA 1GNQA 2QNBA 4JBWA 4RAOA 3F8SA 2ZB3A 2XITA 1Z5ZA 2ONCA 1VJ1A 4KKVA 2QR5A 4X63A 4YUAA 5JBIA 2D6FA 1F20A 4HWSA 3VX4A 2MSCB 4QXQA 3W78A 4UU0A 5IF3A 4NJEA 3IPXA 2YV1A 1MOQA 3MSXA 4IWNA 5G02A 4YJHA 3DLHA 5U4XA 5I45A 3DFKA 4RD2A 1SUSA 4AN1A 5JVDA 3LVQE 2NSYA 2EW2A 1YR8A 2PVPA 2HBZA 1GPJA 3D2CA 4RDIA 1IU9A 2F4VB 3LBHA 5DBIA 1S8AA 1VSVA 1ZCZA 5HIIA 5CBKA 1DCFA 1B8PA 2B3TA 4IXMA 4HRAA 4E4TA 2E6KA 3ZJTA 1F7UA 3ACBA 2NT3A 3EPPA 4Q3AA 2IEZA 2H92A 3TLKA 2XWPA 1UJ5A 4PX3A 2FWPA 4R2XA 4TQGA 1M72A 1O95D 3B8EA 2WJPA 4BYGA 1P2BA 1VLLA 2HH9A 3LSTA 4M86A 2Z5GA 2QMHA 4AB1A 4DM7A 4OJQA 2UUAB 4OP3A 3V4LA 3I6MA 4ZI7B 3FSGD 2WIKA 3OTHA 1M0SA 1UT8A 4MWBA 4PANA 3VOSA 3WQQA 3H75A 4DJAA 1J22A 3IRVA 3TGWA 2RIRA 5D5HA 4F5WA 4J75A 5AJTA 3KOWA 3I9V6 2XQGA 3OLCX 1W4ZA 5WRFA 3OKPA 4LQ4A 2ZKIA 2PSDA 5FPTA 1NDUA 2C3UA 1KRHA 2GPAA 5F98A 3TKLA 5TMPA 3NX4A 2DT8A 2H2HA 3GPLA 1OGJA 3A1WA 5ENZA 4D0RA 4PRLA 4UTNA 3IDSA 5J43A 5T3YA 2XMCA 2PYZA 3TZCA 5BR1A 1GG8A 1VL1A 1L3IA 2O50A 3ZXIA 3TOVA 3MN1A 1ZI6A 3PXDA 3R24A 4HFNA 4EA8A 5IDQA 3NPAA 2QW8A 4RL4A 2RK4A 3H2JA 3CF0A 2R3SA 1CQWA 1ZWLA 4B6FA 2DLDA 3KOYA 4RL6A 4CQMD 1HMYA 1NN0A 2DCUA 2I54A 3E5MA 1K4MA 4IFBA 4INZA 2B69A 2P0AA 1M3SA 2GK6A 3LCCA 1XP5A 3PDIB 4KAJA 3FG9A 2JEZA 3N07A 4HC4A 1KAQA 5F9FA 3IJRA 4LDPA 3N8GA 1I32A 1U5AA 3A1VA 1JHRA 2IH2A 1I4WA 2YFHA 3WQRA 2ZSUA 2B36A 4LC1A 1DEAA 2QJOA 3DWFA 4BC0A 1JBKA 2XGGA 4KIUA 1UPAA 1ZMTA 1W29A 3W4JA 5K0SA 2LW7A 4Z4HA 1NASA 3K0CA 2X5OA 3WB0A 4GIBA 2HU2A 2ENWA 5B55A 2I8LA 2ORYA 3EQ8A 3VU0A 3U7HB 3QG5A 4DLYA 2YMMA 1LI5A 1P5RA 3AZQA 2WLSA 4COOA 2FN3A 1OQAA 3OHMA 3WQSB 3A3NA 3K9LA 2Z6VA 3W90A 1W93A 1P44A 1X15A 1ZNQO 2RK6A 3H2HA 3S1AA 1QV7A 1NVVR 4HF7A 4FFOA 3L4BC 4DWWA 4G5YA 1YI1A 2DHEA 3C3WA 3CCCA 3DCJA 1DXYA 1MO5A 2IPAB 1MGOA 2QROA 3IUBA 4XPZA 5DSTA 7REQA 2ZANA 5CEEA 5F76A 2QBYA 2OZKA 2IPNA 1RM3A 4YJKA 2VHWA 2IGTA 3DE3X 5EJFA 3RD5A 2P79A 1N5LA 2QI9F 3VZCA 1ISPA 1UBKS 2PRKA 2PLNA 1E1RD 2H54A 1NR7A 1XX6A 4WKNA 5FBVB 3L0OA 5KAPA 1J8YF 3D43A 1NR1A 3E9EA 3AEZA 1US8B 3GFRA 3KPYA 2EDCA 2O7NA 2BGLA 1KI6A 2VZ8A 4KR2A 4UAGA 4U39A 2VJYA 1Z7YA 4OJTA 1KP9A 3BHJA 3S3TA 3D7SA 1WZCA 2NACA 3KO8A 2PN1A 4PAGA 3WTBA 3ERCA 2JASA 1I5OA 4PZZA 1GKYA 5HF5A 1M76A 3HWWA 3QXHA 4KWIA 1H2HA 5MN5A 1LFDB 2DEUA 1O6ZA 4WBXC 4DIFA 3PENA 3C0KA 4GEGA 3U7IA 3WSTA 1PK9A 4B3DA 2PX6A 1T6NA 4Q9DA 3I45A 1XNJA 2FYTA 3COZA 3U60B 4QG7A 1OLOA 2JLRA 1IE3A 2GBGA 3I5MA 2IXTA 2RAPA 3CMCO 2ZUBA 3C1TA 1GGMA 4C1NA 1NWHA 4UJ3A 3JAWA 1ID1A 3WYEA 4E22A 3E4CA 2IYTA 2NM0A 4K6KA 4PLFA 4WZBB 3HXLA 5GONB 4EGCB 4CLHA 3II6X 3R9XA 1R15A 3P8ZA 2G04A 3BH7A 2Z3ZA 3A37A 3TOCA 3GAZA 3AF1A 2OHJA 2P67A 4UM5A 3VMFA 1G2QA 4NAHA 1UMBB 1V95A 5BYJA 5FNVB 4BO8A 5M5BA 4LXXA 1F7VA 3TLZA 2PL3A 5I9TA 2C2WA 2Q28A 4ZQHA 3IP9A 3GCXA 5JRDS 4BTLA 2OV8A 3KZVA 5GP1A 1Z2NX 1MG0A 1V5FA 2VHJA 2BR4A 1Z0JA 2W2TA 4YN3A 3KWJA 1AURA 1Z22A 2XGMA 3BRWA 1J0DA 4C4PA 1UDWA 3K94A 3OEYA 1DMRA 1W2GA 3DW1X 1VXOA 2QSYA 3RC3A 1EBFA 3NYIA 3KLOA 3BMXA 3EZXA 4DV5B 1YTUA 4PPQA 4DN6A 1YGYA 4RIEA 4OUKX 1SG0A 2DLNA 2D4AA 4OP1A 3ABRB 1PEDA 1R3DA 1YJQA 2G9QA 3HDYA 5DGXA 4Z1MA 3T4XA 4QYWA 3UWSA 5LFAA 2AHOA 3I2JA 2ZVJA 4QOFA 2YBEA 3SG0A 4A1FA 1WSBA 4WRRA 2A14A 2V6JA 2I1QA 4W6ZA 4O2AF 3T7JA 2GHRA 3O8NA 2WWFA 4WXMA 1RYYA 5DGCA 3ZHRA 2COUA 4QHSA 1RFLA 2DUJA 4TTVA 2AHRA 4F9TA 3IAS1 3ODPA 3T1TA 4FCCA 3ZUPA 1BG6A 1FP4A 1U65A 2WJ4A 4M21A 1NOIA 1TDJA 4D0GA 5C5DA 4RMNA 5E3IA 3OO1A 1EXMA 1U2QA 3DXZA 3QMVA 4OB6A 5TY0A 4D8TA 2GXSA 1O0BA 4E6PA 4LYAA 1XCJA 4C0XA 3P5SA 3O47A 3BXXA 3QVSA 1H2XA 3GT4A 4UTZA 1E79A 5BOSB 4P22A 1JR3D 1NRWA 1S8OA 3FGZA 3I0MA 5AVOA 4BZXA 1P0CA 4C7BA 3QLVC 4A8HA 4G0YA 3Q8XB 3G0GA 4HFRA 1SD2A 2XF8A 2J9XB 2A86A 2O9JA 3CH5A 5A02A 4GP7A 4HPXB 1WETA 1SKYB 3F49S 4IUCS 4NBSA 4NEGA 4TXJA 5AHXA 4XX0A 1P74A 3TSZA 4BMYA 4BEVA 3ZOZA 4CHTA 2PR7A 2Y77A 2P9TA 1ZCFA 2CHQA 4GM1A 3KFVA 1TW3A 4HUJA 1BO6A 1RLJA 3CZAA 4FE7A 3W6ZA 4A26A 4IHQA 3ZHCA 3F74A 4O4JF 4PRZA 4D9HA 1WW8A 2Y1CA 4Q48A 4W1SA 4BBAA 2KBFA 2WU4A 1RP1A 3T7DA 2J9YB 4KQ6A 3SZRA 1BEZA 1D4AA 1XELA 5JMPA 2DHRA 3WICA 4EG3A 4ERXA 2JGDA 4OYHA 3CPSA 2QOEA 5IK2A 1AZWA 1I2DA 1QIHA 2F90A 1SUBA 1X70A 4OQYA 1D1TA 1S2DA 1YRYE 2NXCA 3IAM1 5KYXA 1RYDA 1PUJA 1T5LA 1YSCA 2A0FA 2F2TA 1E4EA 3Q2IA 3R5SA 3SHQA 1E7RA 5LIPA 1VRVA 3B1YA 1J06A 5LQUA 1Y7PA 2CFTA 3UKJA 3AKEA 3GCGA 2H1CA 3HCCA 1K6MA 4YJGB 5EMMA 2Q1XA 4HTFB 1W34A 3D6TB 3CO0S 1NNSA 4L5JA 1NU8A 4TMTA 4UQOA 1Y34E 4OREX 2UVPB 3QWAA 1FMCA 1KR2A 1DBWA 2CLOB 2JIOA 4AG3A 2J7KA 1ZQ1A 2I3AA 1WCWA 2JRCA 1GR1A 1PR6A 1OU4A 2I29A 2WA2A 3C3PA 3KAJA 3OWHA 4IX1A 4JJFA 3T6KA 3WZ2A 1N3YA 1WXQA 4ER3A 2QN6A 2Q6IA 5IAOA 1C1DA 1E2NA 1T4MA 5TEWA 1LY1A 1QLHA 2ZREA 3ML1A 3KU4A 3KT0A 2IOYA 3C3XA 3DV9A 4LJ6A 1RXWA 3E2MA 1M33A 1NBAA 2H0RA 2R7NA 4S24A 1Z45A 3NO4A 3ZVRA 4B4VA 4ZC8A 1JIQA 4U00A 3H4MA 4XYEA 3GJ6A 2XDYA 1HZZA 2HQ1A 3H83A 4K6GA 4HDOB 4POOA 1TMKA 3HABA 3PWSA 5CYFA 3WGQA 2VDVE 4RXTA 4DY4A 3DYIA 3H0EA 1Y3IA 1O3YA 4KQ1A 5LYJA 1L8OA 3GU3A 1D04A 1MB9A 3I6QA 1ML3A 2P5TB 1FUIA 2F8SA 4OHYA 2HLHA 1XDZA 4JOQA 5LQRA 3SQLA 1FFSA 1WVMA 3EN0A 1BNCA 1VA5A 4JB8A 4ES6A 1YVEI 4FIZA 1DKPA 3ST7A 4YY3B 1SZPA 1U0RA 2OYRA 7MDHA 1KEEA 3L4JA 1G2OA 1DNPA 2QPAA 5AM4A 1XDGA 4A8JA 3BQNB 1VYTA 1Q0TA 3V4SA 3KWLA 5KOJB 2YMPA 2BKUA 3PPIA 1U0FA 2QGFA 4BIMA 1DGQA 3HMQA 1SEVA 1QVWA 4RTKA 1Z28A 3BMCA 4GI1A 4A4DA 3QE9Y 1A7KA 1HTTA 2Y0DA 1CIPA 4FM9A 3QYPA 3M33A 3RUPA 3ESQA 1MPTA 5BRAA 2PEYA 5ALIA 2FHPA 4J1QA 5CDUA 2QP9X 5C80A 3FLBA 4OGKA 1QQAA 4D26A 3ONWA 1BXKA 4N65A 1EK1A 1T5TA 3LUKA 1HWYA 3JQFC 4MZDA 2WPNA 4QNMA 5ILQA 3W3ZB 2JFZA 5JSZB 4WEQA 4S04A 4EYGA 4OQNA 2RAUA 1SVOA 1DDIA 4JJEA 5LJIA 1CJTC 1JKJA 5IKEA 4OCZA 5KVCA 1EAMA 1B1CA 3LKDA 3COPA 3TEJA 2O2HA 3I73A 4Z3OA 1I4EB 5CDGA 5BXYA 4JP5A 3IE2A 3RVRA 1GPH1 3T1QA 2WTBA 3OC6A 3VO2A 4AN0A 5IYZB 2VH1A 3F1KA 2ETVA 4J1NA 3PNSA 2X9NA 1EHCA 1UM9A 2W2NA 3ZOKA 1ISSA 3MJRA 2GN4A 1OI2A 3R9KA 3AL0C 2VYNA 1UC8A 3C6YA 1Z0AA 1GUBA 4LJ8A 3FX2A 3LJKA 4OIFA 1EUCA 2B0CA 1ADJA 2O2JA 3FTCA 1ESMA 2PL1A 2FJ0A 3CW9A 3I39X 5EIWA 1N7GA 2I3ZA 3DL0A 4DLVA 1ZHOA 2HGSA 4P7FA 2WU1A 1SD1A 3M83A 2IY7A 5CYPA 3TGPA 1YS2X 5AM5A 4BNJA 1NNEA 1R50A 1SXJB 5FJIA 2A6PA 2ZI9A 4RV9A 2W8ZA 3GFBA 4H3HB 3WP0A 4BPBA 1TIPA 4JWKA 1D2RA 1I9GA 2XAUA 1P3Y1 1MF7A 2GNOA 3ET4A 1MO2A 4RTNA 3AB8A 1IN5A 4DSNA 4OA5A 1W8DA 1GA1A 3V7NA 1TUIA 2ZVQX 2V7GA 3ZXYA 4Z4QA 4JEHA 1XK6A 2W2MA 4UFOA 1UMCB 4AURA 4LBYA 1TC1A 3QBDA 5HK9A 5JANA 3VR6H 3V48A 1R5OA 1E2QA 4XDZA 3RGGA 3SXJA 3HSKA 3TG2A 4DA4A 1P73A 2MHCA 2O5CA 4Q39A 4C7XA 4QYIA 4UE2A 4K9DA 3U44B 2AZMA 3CQ9A 1VHJA 2ZTVA 2KSQA 1ORWA 1D6NA 5E38A 4PYQA 3I8SA 4QHTA 3VHRA 4HBZA 4HH3C 1DAHA 3FIUA 1U3UA 2QKYA 2J0QA 1Q92A 3JALA 2O14A 4MVYA 4JBHA 3ZK8A 3HRKA 4AZTA 3KB6A 4CT0A 4DV4B 3BM5A 4ZDIA 2LIVA 1O97D 2WUDA 2VHCA 2VI5A 3B1VA 3KQOA 3U4MA 1DV1A 4H9GA 4BNTA 1I13A 2FPPB 3L7JA 3ZWKA 1DIOB 1C7ZA 1GYQA 1Y9AA 1XRQA 3OFKA 4L6AA 4RANA 5TQ2B 3AZOA 2YWRA 3ZIUA 5JI2E 3A9CA 2KLBA 1OAOC 3DZHA 2WZCA 5HFNA 5F7XA 1E92A 4GLLA 3D1LA 4KQXA 4E08A 4FSHA 4NMHA 1EBUA 1JBEA 1TFRA 2EIXA 1Z18A 2P9EA 4QODA 4S2EA 2ZRFA 2X7XA 5KREA 4MQEA 2HO4A 3QK7A 1XEWY 2Q0QA 1DE0A 2KYRA 2UUOA 5F1PA 1JLRA 3LSYA 1OLUA 5KNCD 5JXWA 5ALSA 3TN7A 4NBWA 5JS1A 2IYZA 3GRUA 1YR1A 5G2OA 3W2FA 3OE7D 2NPOA 3R5TA 2Y68A 3VV2A 3W5HA 4UDNA 1A9QA 1WXEA 5SYNA 3FTQA 2VG8A 2JGEA 5CFNA 4PS1A 5AT1A 5KNCH 5DE3A 1NP7A 1ZEMA 4R1TA 4J8PA 1UC4B 5C5CA 1G8HA 3KE8A 4PGFA 4X8HA 5GZ6A 4EHBA 2B37A 4LJAA 3SZGA 3FOBA 3WLQA 1TD9A 2I4MA 2IHNA 1JW9B 4ZYVA 5JYEA 1EFVB 3CCBA 1FFDA 4YAEA 1M6WA 2R4UA 5L4LA 1EU1A 3GN2A 4I1UA 5G4KA 1QMPA 5B37A 3WIVA 2ANBA 4PPGA 2PQ0A 4G0NA 5BN5A 3HVRA 1JG3A 3O8LA 1N5DA 3WGMA 2P2YA 1DCMA 2ONYA 4ID3A 4IIYA 3CM0A 4RJIA 4D56A 5BNIA 1T1GA 1PYOA 3ZE0B 1SU8A 2ZYTX 3N0TA 3RWBA 4TV8A 2ZZMA 5AYVA 2EBWA 3MT0A 5K4HA 4FGJA 1ZD8A 1HQKA 4RVFA 2J3QA 4WK2B 2I03A 3V55A 1Z75A 2C20A 3HR4A 1UP4A 4NDNE 1WQ4A 1DBQA 1AF4A 4JFAA 3WRXA 3W5IA 1SHTX 2CCGA 3K0FA 4IH9A 2FFQA 1E0DA 4DMMA 4YAUA 2I0FA 3WQBA 1WPRA 3AU9A 1QIKA 3BWDD 3JQ8A 3PJEA 3ZV7A 5KDDA 1SCDA 3CLVA 3WYBA 3WGTA 1J8VA 4MTCA 1CKEA 2JI8A 3GVHA 1VKZA 3QTLA 2Z4TA 3UMGA 1XTRA 4Y9SA 5CAEB 4XASA 3V3KA 2UUCB 4YR7A 1CUCA 3B8HA 3HHEA 1QH9A 1QUEA 1FTWA 3H9EO 4L8LA 5CGQB 1VPDA 5A3RA 1UBOS 4HEA1 5C3MA 1GQ2A 1RLIA 3EPHA 3WHIA 3VNRA 3VR5H 4BQIA 3ZWWA 2GUGA 1Y80A 2I1WA 4C3OB 3ROTA 1F0KA 1P8JA 1W36D 1EUYA 1QRDA 4M0FA 4IAOA 3AFGA 3BWMA 1TCUA 1PJTA 5HJ2A 3QOYA 2C1EA 1ZJ5A 1WUYA 2VPXA 3TINA 5HHTA 1V43A 1T3TA 2O06A 4KV7A 3P4UA 2H7XA 1RT9A 4BZWA 2H00A 1XF9A 1Z9BA 2PX8A 4AJ9A 4DLZA 4HNGA 3AKCA 5F12A 2VJAA 4MW4A 3ANNA 2SECE 3EXEB 4HB4A 2A5FA 5EE3A 3V7UA 5L4NA 2BFAA 1Y1SA 2OPBA 2RI0A 5FYDA 2QD1A 2C98A 4GD3Q 2SCUA 3JWGA 3HNRA 2YASA 4BEBA 5FUQA 1RAIA 2PK3A 1V9CA 1JHVA 2XVAA 3DOOA 3ITEA 4KO1S 4PZPA 1A1SA 3GNTA 3K53A 2Q7OE 1BE8A 4RSMA 4EA7A 1VSTA 3GFGA 1LJLA 4CL2A 2V65A 5BRNA 4HK4A 1UKCA 1GT91 4I4TB 4WN3A 3CPJB 1G2PA 1V1RB 2NN3C 1DKNA 2RC5A 4LJ9A 3TFQA 4BYMA 4LE2A 4MYUA 3EXFA 1S2LA 1UXOA 2IVZA 3UWDA 3AL2A 4FOTA 1FNDA 4YCSA 1SWVA 2I2XB 3KRTA 3QKSB 4G1VA 4WNIA 1PZGA 1U2GA 4TVSA 1EVZA 4P3OA 3LDAA 3KSDO 3GT7A 1F3OA 1H6AA 1BE6A 4R1PA 2I3DA 3CR8A 4BU1A 5AVVA 2IEBA 1NJ6A 3GA5A 3JD0A 4GQIA 4MVWA 1U9IC 1DX9A 3EQ2A 3KJHA 1V2HE 2O0LA 2PMDA 5JR3A 2ESRA 2IEAA 3ESYA 1Q2XA 5I9LA 1F4LA 3DULA 4BE9A 3ZGLA 1BHSA 1LLUA 4TUYA 3WLAA 4DUGA 5FR2A 4RA6B 3FRJA 3L84A 1UDBA 3F1LA 5EZ5A 1UBGA 1NJ8A 2ZR7A 3TSOA 4M6WA 1NVXQ 4QDZA 4ZICA 1WOMA 1NOJA 1RM5A 3BFKA 3IMEA 3AFOA 5DHFA 2XUHA 1UWKA 3L6BA 3CLRC 3H84A 4ZV7A 3UFXB 2OFXA 2VJQA 5AM2A 1IBSA 5ISMA 1EUDB 4TMFA 1I4OA 1WEKA 5JJ5A 4TQAA 3L4BA 1KJ8A 4B6RA 2O8CB 1ZGAA 1KAOA 3D1VA 3L7BA 4ACAA 1T36B 3KJQA 2HLPA 4YR9A 2DFVA 3LD9A 4M7PA 1IZ8A 3FYDA 1ONBA 2V96A 1EWQA 5KYKA 4QU0A 2O2SA 1GHTA 4NLLA 5KYUA 5CDSA 5IZCA 2WKRA 1CUUA 3I01A 4JXZA 2Q1UA 2F9MA 2W71A 1C14A 4HVCA 2QX6A 3KBOA 1QIFA 1IY9A 2BE7A 4LYDA 4PC2A 4QNNA 5D8DA 2XSZD 2CDRA 1SUFA 1T2AA 1DWQA 2PNFA 3WGIA 3A1DA 1E3IA 3EVCA 5I3ZA 2RARA 1JG2A 1RLOA 1UQRA 3MRSA 3URKA 5JPCA 1A98A 3ITNA 4L4RA 2Y2UA 4DVGA 2JLWA 2R6HA 5BXQC 1ULBA 3F9CA 2QG4A 1SVMA 4JXXA 3DTNA 1WEHA 1L4UA 2L18A 2G63A 3QVGA 1ZM7A 4HGNA 3CR3C 2EQAA 4UTOA 5H16A 3IT0A 4RNDB 1A7AA 3A3KA 4BX0A 3PEUA 4ZV9A 3AFIA 4EO9A 3PI6A 5JRJA 4RPCA 1J1IA 4TYPA 1VCIA 2WUVA 2AL7A 2PMEA 3T5GA 4XWYA 1EMDA 3DT9A 1GCAA 2D00A 1X14A 4UVHA 1OX4A 1J9EA 1SU4A 2YUIA 4AAYA 5B5SA 5KYTA 1XC7A 3GD5A 1C1XA 1B43A 5DTMA 1RPJA 2ZBEA 1V3UA 3BYZA 1KOGA 3WL7A 2C95A 5KYWA 1TYBE 1U1FA 2AK2A 1AG9A 4P3XA 2INGX 3NHJA 1C9YA 4GPIB 1VHLA 2F43B 2PX3A 2XXBA 3ASYA 4LRSB 4F21A 1NW9B 3R0VA 2EW1A 1RWXA 2FSVC 3CRRA 3BGOS 1WCV1 3EG9A 4Q82A 3TQFA 3WJAA 4I9HA 4YO8A 1TZJA 3N2NA 3E58A 2GN2A 3HTXA 2XRZA 5FO1A 5HQ3B 1J2UA 4IINA 5GWXA 4JLSA 2NPFA 3MCZA 4E33A 2QAGB 3E53A 3V1TC 2YYZA 4AY5A 3EPJA 5AJZA 1PJLA 2AIRA 3WGHA 1ZM3A 4MI9A 1NR5A 1SVIA 1C9JA 5BSKA 3DV2A 3PFBA 5L6MB 1VE5A 1EA5A 4LE0A 4DQUA 1VMKA 3FUWA 4EPYA 1WU7A 1PYDA 2CN1A 5KTOA 1MIOA 1XZFA 2WP8J 4LJ4A 3T5AA 5SZIA 4IIJB 1VKOA 1YIDA 2ZZKA 1VPLA 2C99A 1JA9A 3E3NA 3GQVA 2DQZA 1Q7EA 3JPWA 1XSEA 1MCZA 2QZPA 2HSGA 3U4QB 3FJ1A 1RJEA 4NJMA 5B1IA 1BX3A 1CC1S 4HVAA 4FN4A 4RVDA 3CT6A 5I7FA 1BQ3A 2BELA 2VBCA 1ZH0A 2PUDA 1U1GA 2FZWA 4KO3S 2AEMA 3ZN2A 2AUMA 2FW6A 1AXEA 3UBTA 2BR5A 2YY5A 4BX3A 5B58C 1RRGA 4NAVA 4L22A 1PJ8A 3QLVA 5JY6A 2NYUA 3GEIA 3OECA 4DMRA 2RHGB 4KUGA 3T3HA 1I24A 3EZYA 3FN4A 1XKQA 2B8WA 4DJEC 2Q6OA 4HGOA 1E94E 3ANYB 1I4DD 4E2WA 4QUDA 1L5RA 4LW8A 4CUZA 4BXOB 4NESA 1S01A 3EFHA 2R60A 3LKZA 3ZTTA 4LDAA 5BW5A 4V0OA 5BSRA 2V3VA 3Q85A 4BNDA 1CIVA 3TRHA 3AERA 4GECA 1TTPB 4LFCB 4WV3A 4ADSG 2DTDA 1OU0A 5FTLA 4WL0A 5G0TA 4DCUA 2W0SA 5CD1A 5AUQA 2QL7A 4IJWA 2GFQA 2CK3A 4WZZA 5IAKA 1I51A 3ZX5A 2GAFA 3SJZA 3LBNA 4LZNA 4UXHA 3ET5A 1UFKA 3P9XA 1MEEA 1L6IA 1T34A 1QFZA 3ON5A 5LQCA 3ORYA 2GS9A 1N8KA 3CISA 4ND4A 1KMCA 4PFKA 4XIIA 3IURA 5L3ZA 1CJKC 3TOXA 5A4JA 2C03A 2YINC 2FWMX 4O1MA 3Q0IA 3UB4A 3ED1A 3Q9NA 1BEUB 3UGKA 4IJ5A 4EB6A 3AJ9A 2OKCA 5KQMA 5F1OA 1POXA 1VGRA 3ZUGA 5KO2A 3I62A 4UPDA 2OXTA 3ND7A 4X6YA 2W22A 1Q0LA 5ALMA 4DR7B 1T24A 1Y8RB 1DOHA 1THZA 4OBBA 2IF2A 5DT9A 2C5GA 1KI3A 5DRYA 3AF4A 4YUVA 2WSSA 2H1HA 4B3BA 1L7MA 2VDLB 1T5OA 3L8MA 3NETA 4EEZA 2ZIGA 2GB4A 4EQ6B 2GN0A 1SCBA 2NTYC 1PS0A 1UP7A 3RS0A 2NP7A 1Z4LA 5JAUA 4MRMA 3KJIA 4KTTE 4DIOA 4TKUB 3K9QO 4URWR 3T9FA 3LHFA 1AV7A 2WPDA 5A4FS 1Z2AA 3FHTA 2ZB4A 1E8NA 5KSPA 4IBOA 3VC7A 2OWEA 4E13A 4JJIA 1XZKA 2JEYA 1E9DA 4DNQA 5H9WA 1CVRA 2AG8A 3HSSA 1XZGA 1Y4DE 1QFYA 5REQB 1D2MA 3L4SO 4URFA 3R7LA 3BB1A 4BNGA 3BQMB 3WHLA 4TKZA 1A88A 5EJIA 4BP1A 2Q2WA 1ZGZA 4B7ZA 1FQJA 4AVYA 1N8TA 1TYZA 3FKSA 2AJLI 2D2VA 3A1TA 1L8QA 1Z08A 1SCUB 3VR4H 2JATA 2Z2JA 2C7VA 4M0EA 2RGCA 3V3TA 4FDVA 4YAWA 1JR3E 3D5QA 3TQSA 1NW3A 2CHUA 5C81A 3LIPA 4BB6A 2PEZA 2DRIA 4YT2A 1ZKDA 4ZYLA 3U3OA 1G20A 4YRIA 2IXGA 1SMKA 3Q7EA 2X4GA 2ZUTA 2CT8A 2Q5CA 2JAQA 2D1QA 2J33A 1HNNA 3DFIA 1AY0A 5CURA 4G8DA 3DF9A 3OEWA 5E95A 5TGTA 5IKXA 2Z6UA 2PNJA 1FQWA 3IR7A 3NFRA 3LE8A 3M4JA 1ZVMA 3FLEA 3CVYA 1J8FA 1CJSA 1WMFA 3C7CB 4AICA 4ZPXA 1XP8A 3PPYA 3KYCB 1HLDA 4NZPA 1S2GA 2PGDA 4GF5A 3OZTA 4LCEA 3MCTA 4BB0A 3HO6A 1LK5A 1B74A 4FHGA 5KYYB 1CSEE 4O1HA 4O2BB 3S1SA 3LT1A 4GSLA 2PO7A 2WWRA 4U9IS 4X1YB 3HVJA 5KQSA 2C5LA 4IEIA 1HL7A 1T8TA 4LDQA 5GVSA 4KSBA 4M0CA 3WKBA 3EGDA 2PRYA 1ZO8A 3WTCA 2JJYA 3H9UA 3ZG6A 2H48A 3TLGA 4F12A 3A6JA 3A4LA 1NUSA 5I4BA 3FGOA 4L0MA 3KALA 1E1CB 4WFQA 1RKQA 3REQB 3P9IA 1DKRA 4NBRA 4UUBA 4UM9B 1YOVA 5ENDA 3QGMA 4HN4B 1Y81A 4C5BA 2NAFA 1GTJ1 1BHO1 4KDRA 4YCAA 3ZDQA 5JPDA 1N2SA 4PRYA 5AK3A 5BN3B 4HAUA 5EOVA 4HUTA 5CM9C 3ZHZA 5FCDA 4UOEA 3ODGA 3K6SA 4TTSA 4IFTA 1RRVA 3ACDA 5A7HA 3L8GA 4G09A 5FH9A 4Q9IA 4MRRA 3UV6A 5GGXA 2V5UA 2GLTA 1V2GA 1WL8A 2BBSA 2BI8A 5EWMA 3TIFA 3ZWDA 1OC2A 2DERA 3H19A 2OCBA 3KV3O 5KNDA 4CLRA 4UAUA 3MG9A 3THYB 4HT3B 1HYBA 2ORIA 4BNYA 2C8VA 1C81A 2G67A 2I6TA 3SHVA 3SEZA 1FFAA 1KP2A 1E4YA 1X7XA 2H7YA 2VPYA 4JJ8A 4JZKA 3BL5A 1UL1X 3ZBPA 1GPBA 1I36A 1F1BA 2DCMA 3I58A 3WHKA 3X2FA 3I37X 4WCVA 5LOVA 2HRBA 4B87A 1QS0A 1DG1G 4L9SA 3QI7A 1UAGA 5AOBA 4PZEA 4EDHA 2PUWA 1K75A 1HH4A 3E3MA 3O92A 2XWQA 2VUSA 4FWIB 3TDKA 2Y1OA 3AR2A 1NMZA 4L4YA 3MTAA 1O9HA 1M10A 3DOCA 1K5GA 3MYYA 2DJIA 4KNVA 1K5PA 4GSKA 2G76A 1AHHA 5ED0A 2IYOA 2B4QA 2YWBA 4WOBA 4H7HA 5E1DA 1T4BA 1PZFA 3IEKA 2JAHA 2PPLA 2XNKA 2P4QA 3GP8A 4EHNA 1N1GA 2MYPA 3UUEA 2CMKA 2G07A 2N0SA 2XY4A 3Q41A 4KGDA 3RABA 2R96A 5G0WA 2QZ4A 4XGNA 4BY9E 4OQXA 5IH7A 1QGUA 4LYJA 1QE5A 1SQ0A 2PZ8A 4IOJA 1G7CA 2AXNA 1YR6A 3ZDCA 1MENA 1IAVA 2E2WA 3QOXA 1S7CA 4EG7A 2GPSA 1EFPA 1VXRA 4JBNA 2CLKB 1FUUA 1JFFB 1PCXA 2H5JA 2R85A 3BTUA 1OAOA 3E8XA 1DBPA 4HI0E 4RZUA 3IIMA 1CRQA 2P2CA 4NQRA 3LAWA 5IJ9A 3EQ6A 1T9KA 1XNQB 3MWEB 2C57A 3BXZA 3EDMA 3LPAA 1YS6A 4HWGA 3PQCA 1X19A 2PUHA 1AMUA 2WKQA 3NIDB 1GTVA 3PHHA 5DDIP 3S8EA 1D0VA 3KYBA 4BO1A 3O4FA 3VAYA 3B1KA 3HDHA 1CUZA 1VJRA 1N78A 4UC0A 5LDHA 3VC1A 2XTAA 3RYFA 2NU6A 2ZJ1A 2YXPX 1C9DB 2O59A 4CMIA 4YUWA 3CSUA 2LIPA 2I2WA 5FDFA 3OZGA 1LPOA 4LECA 4L4UA 3ONDA 3PI7A 3TRIA 5K03A 3HUEA 2IPXA 4DCTA 3RHZA 1U7WA 1GCUA 1BKSB 2Q3JA 4RC9A 4GWGA 4YONB 3PGKA 4EYSA 1A7JA 1KDZA 3VJRA 1N1DA 5DYIA 4BNMA 3M6MD 3NP9A 5ER6A 5FPKA 4RKEA 3GP3A 4KHZA 4QWWA 1E96A 1VHQA 3BAFA 1JFTA 3CJTA 1C30B 4YJ2F 3SZOA 3EZLA 3O93A 2C94A 4KXXA 4ARIA 2HREA 1UPXA 4BQSA 1V71A 2F59A 1E3EA 1ZVQA 2EX0A 4HNHA 5EHIA 3TFOA 1JKFA 5JG7A 3O5AA 2XUGA 4R05A 1Q12A 5BO5A 4D6XA 3GBVA 2VF5X 4LMRA 4IDEA 4S1TA 3A4YA 2FAXA 5JBNA 2IU6A 3NM4A 3KB8A 2J9RA 1AKVA 3EF1A 3FYCA 5CFZA 4TMXA 2Q1TA 1GVNB 4GFDA 4KK3A 5D3ZA 1IM8A 4IXDA 1XU9A 4JCOA 1RM0A 3BXOA 5C3UA 4EUFA 4BFYA 4ZVVA 4PGAA 2YWXA 1Y3CE 2L0XA 1JHXA 5CU7A 1N5KA 4UUPA 3ZCSA 4EY8A 4CF3A 1NM5C 4YAGA 4H1VA 4XM1A 2V6MA 3QU9A 4TN5A 4Y2TA 1I7PA 2XMRA 1W96A 2SKEA 4MR7A 1LVHA 1NNUA 1FF9A 1KH2A 1BZYA 3JYLA 4FBGA 3GZNA 4HV4A 1X42A 2LVBA 2XIJA 4KIGA 3DT8A 1QQ5A 2BGIA 4M83A 4WKBA 3C24A 5MGNA 3R6TA 4LY9A 4MGHA 4F5YA 2VN8A 3RYIB 2NADA 3Q9UA 2BM9A 4OKIA 2V7XA 3WGOA 3JQAD 1KDVA 1M73E 1NBEA 2PUJA 3N2GB 3A2LA 1GGEA 4XQGA 2FN9A 4DA6A 3WNVA 1UOEA 2C5FA 1L5FA 4U6SA 5F5NA 4IQ0A 3IDAA 3PFFA 3Q8MA 5TQVA 1BW9A 1QB7A 2D3TA 4OOEA 1YR9A 3HXPA 5HDBB 3TMKA 2BGGA 2Q8NA 4YB8A 1A27A 1KFEB 1C3OA 1T6XA 2DSNA 1ORDA 3H0KA 5EWLA 2E5FA 2GHQA 3FYUC 3OJCA 2WVJA 4JP8A 2O3UA 4QRHA 4QL3A 3PT5A 2VKQA 2ZYHA 3GDGA 4XJVA 5L7TA 3W34A 1Z4JA 1L5SA 4D02A 2ZWPA 4DV6B 3ADDA 3SOPA 1NP6A 4E15A 1CY1A 2H29A 1NIPA 1JILA 1CS0B 1G21A 3JQCA 3YASA 2ZIZA 1PS8A 1PR3A 3VH4A 2DU8A 1JDZA 3KCNA 3H2IA 4IWXA 4TM8A 4WESB 5KX5F 1FIUA 2GCIA 3OMWA 1FDOA 2FP3A 1HORA 3N70A 4IJUA 4R1SA 4LOHA 3WNCA 1XFDA 3A25A 2DWUA 1YAJA 2ZI4A 3BL6A 3F6RA 5TF4A 1YR3A 4OKSA 5BY2A 4M1TA 1KS2A 1IG0A 1KQGA 1E1MA 1HEIA 5DKFA 4XIYA 1O58A 4LF7B 2X22A 1PAUA 3UJBA 2GO7A 4B3XA 3GW8A 4MAFA 4UU8A 4EW2A 3RRFA 2WZDA 3D8NA 3NV9A 1E0AA 2XWJI 1GFWA 1E5XA 5D87A 4M88A 2XWSA 5M29A 2IP4A 3HWSA 2PCJA 4R7GA 4PXAA 5CH5A 4KR3A 1MB3A 2O2XA 3H04A 2YFQA 1DC8A 1Y63A 1ORIA 4HNRA 4XW2A 5FPSA 3VHXB 2W6CX 4N7RA 4PIVA 1LQTA 5FL7D 3KQLA 4IKEA 1JEQB 4IW3B 1U9YA 4R0NA 4KRFA 2QTGA 2R8YA 5HRUA 5FLEX 1YL5A 1YQGA 1HNZB 4FX5A 2A88A 4HDMB 1N7HA 4OOFA 4G9BA 1XTIA 1C9EA 5B7PA 1ZR4A 3L0IB 3VR4A 2JAOA 1KSJA 1FVOA 2FY8A 1BXRA 2XZDA 1QYIA 3DEIA 2CF5A 2WF8A 2KX7A 3GUVA 3U1BA 5E6SB 1OH7A 2G83A 4B76A 4UVEA 3CRMA 3A9TA 1TM3E 2HXYA 5ADVA 1TOAA 3AEUA 4WI1A 1GYRA 3ESDA 4KQEA 1EWTA 2JJMA 2OVBA 3C6ZA 3UOWA 5I4CA 2FCAA 2MMGA 5ALKA 4OLFA 2XBMA 2Y27A 3KR2A 1AQNA 4DBVO 2Y2VA 5BSGA 3O4HA 4JYCA 4EUKA 5IUNC 4TL6A 1BHJA 1XCMA 1YS4A 4XCXA 1JAHA 3ZZUA 4M7WA 3ZNOA 2HLDD 7ADHA 1F17A 3GT0A 1F2TA 3G8YA 3H42B 5FBLB 3HR7A 1XZQA 3G23A 4K03A 3VFDA 3CNQS 4ND7A 1EWVA 2ISQA 4UBOA 4XSGA 4TV9F 5HE9A 2A84A 3LC2O 4AJJA 4JI2B 3T7EA 1RAFA 1JALA 5EJ7A 3I04A 4A0SA 4P0TA 1JPNA 4NYIQ 5JCZA 2ABWA 1I10A 1JPJA 3SF0A 3AV3A 2GBPA 1GTMA 1U0SY 2E85A 5DTEA 1Z7EA 3T99A 3IQIX 4ZD6A 5C1PA 3DEKA 2R8OA 4B6OA 3SVLA 2IODA 1HE5A 3PR1A 1E9SA 2ZJ4A 3V8NA 2CVZA 4OQEA 3UCFA 5TPWA 5T8KC 1YJ5A 4G36A 5K3AA 1SBYA 1TAGA 5K0CA 1VCOA 1N5OX 3MILA 3DO8A 2VATA 4ONEA 4IP0A 4R9UC 2M9MA 5E6RB 4AM8A 4CKEA 3AESA 4JLVA 3IODA 3AFMA 2C7QA 1R4NB 1Z4NA 3CNLA 2L82A 1DZ3A 1R37A 1N2HA 1OBVA 2RSLA 3WGYA 4DIMA 1Y3DE 1CZUA 1PZMA 3HRHA 2WMOB 4I5FA 3DMHA 4QYTA 1LD3A 1T2NA 4NE7A 4CDNA 1XZHA 1OYYA 3EW7A 3QEMA 3GJQA 4PG8A 2QTRA 5A5EA 1L4KA 4GWKA 1L5MA 2NZYA 3FFAA 3RLIA 2AI3A 2XUAA 2OHOA 1JJBA 1ML4A 3AW8A 2FSVA 3EEIA 2HMUA 3FM9A 4YJFB 4LXGA 2W6QA 3VYUB 4PNHA 5KSWB 1A96A 5D1HA 3MGBA 3PYMA 1MTZA 4J9VA 3KC2A 3TDNA 1M6VB 3TTYA 5GIPE 2FPIA 3JARB 3IKTA 5IANA 2R7MA 1RCTE 1H05A 1SURA 4I55A 4EG8A 5FD8A 2AKAB 3EIUA 4NQZA 5CJJA 2VF4X 3KQPA 3R0ZA 5BYAA 4BFTA 1B16A 5AW0A 4DARA 3F7OA 1ANKA 4UNIA 5FI0B 3OJ0A 3K09C 2EJWA 2ADOA 5HG0A 5LJLA 3ZQJA 3WL4A 1CNFA 1W5BA 2W8BA 4XUEA 3BWCA 5JXJA 4M9QA 3TZBA 2R87A 2HDOA 3QW2A 1YKFA 4PSAA 2QSZA 2HI0A 4OXXA 3C1OA 5HE8A 3ZD8A 4R9NA 1L3BA 5I51A 3FDFA 3BK7A 5LSAA 4QJ5A 2VTKA 4LXTA 1QVZA 1IATA 1N3BA 2IHVA 2X8WA 2V7UA 2BP7A 4P7JA 3UJ3X 3OJXA 1VCNA 4I3GA 1RDFA 1KIAA 2IITA 1XJWA 2QQEA 3PJRA 3B20A 1T26A 3QIAA 4G5FA 4F4DA 3JPYA 2IYVA 4YP5A 2NW6A 4YMVA 2WDPA 3RV4A 3OFND 2JNWA 3AMVA 4BVBA 2M1XA 4NOMA 4QUHA 2HQOA 1UOQA 2HJ9A 5GOTA 1Q5PA 2X9LA 4AROA 1PQ4A 1KJJA 3E7DA 3MTDA 3OZEA 2PQ6A 5LA6F 5DNUA 1HSZA 3P2MA 3KLBA 1FDUA 3W3AD 4ZHQA 1OREA 3O91A 3RG8A 2ODEA 3CEJA 1S6YA 2NZUG 4AS1A 3QX7A 5K8VA 1GOTA 1ZIYA 2X0IA 4IDHA 1YDGA 5AI4A 4B9EA 2GM3A 2QJWA 1KE2A 5IJWA 2Q1YA 1OFGA 3PIDA 1UJ6A 1DC3A 4Y2SA 5BYKA 5FWXA 2PX5A 3RM3A 3AJEA 1F6BA 2CHFA 4EFDA 1RI5A 2HF9A 2X86A 3GA7A 4C08A 1ZS9A 3C39A 1PK7A 2JPDA 4KBGA 3NM6B 1GAQA 3ZI4A 4EVRA 3BZBA 3GUYA 3Q15C 4BV9A 2RC6A 3ZJ4A 4YDRA 2JARA 4IH1A 1U2SA 2EWWA 2AE2A 4JIGA 4KQ9A 3MFQA 1IUPA 5ALUA 4DLLA 1W1IA 4UVIA 3KPWA 3WLTA 1F2UA 3SF8A 1GGJA 1JRLA 3ZQUA 1I5EA 1KFCB 4HQ0A 4X84A 5BT8A 2VF8A 4N6NA 3EWAA 3C43A 3D7RA 1GDTA 2YC2C 4GI7A 4WN9B 4JUBA 5EMJA 2VZEA 2O2CA 4X20B 3LF2A 1W36B 1QHEA 4ZU1X 4EKYA 2CUZA 1Q11A 1J23A 1ZD3A 2R44A 2ZBFA 2AR7A 3I9FA 2HU5A 2YS7A 1DTWA 4RCVA 5IJXA 3JR3A 5CA1A 1QZZA 4ETIA 2NUTA 3IA7A 5F35A 5TGZA 3IP3A 5FTJA 1U04A 4U2BA 5CA0F 3U4HA 3EVGA 1S4MA 2IYWA 5KSZA 3ENZA 4EYEA 4HB0A 3KBBA 3KEFA 4MYSA 4W4TA 5JW6A 2IOFK 1YUNA 3D8BA 3KAQA 4CM5A 3ZY6A 3QJGA 4MHTA 4P54A 2D13A 5EHNA 1RQGA 1NI4A 5E3HA 2IH5A 4ZQBA 5ARCA 2XYGA 3K1ZA 3GLIE 1QRSA 3P9RA 4ETWA 1XWIA 3X2EA 3E70C 2K4MA 2JIRA 3FOCA 2VLIA 4JQCA 2C5SA 3V8EA 2QW0X 1QFJA 1X0VA 2IUSA 2VNIA 2QU7A 4Q18A 3WWDA 3REGA 1XTZA 2ZXFA 1Y7LA 2DAPA 2I80A 4C4AA 1QGDA 3SHFA 1REQB 1WB6A 2NG1A 2OBYA 3BFJA 1GL7A 3VZQA 1PHPA 2X41A 5ANRB 1SIOA 1WDLA 1XHLA 1RXIA 2ZQYA 3DAFA 2KI5A 3NNSA 3M3DA 4KPUA 1UKYA 3W06A 5CYOA 4IHJA 3U4CA 2OORC 2P78A 1XTQA 3NKFA 4K9RA 1TT7A 5EE5B 4EB3A 1GPWB 2EKZA 2W6JD 5K0JA 4C9BA 1SCAA 3EVBA 2NXNA 4PIPA 3TRFA 3W5UA 4EW1A 4HQLA 3FIJA 3RKUA 1BGXT 2C5BA 4H7DA 5HMLA 3RV3A 1WTAA 4EL0A 5ALPA 2PIDA 3R0IA 1S2IA 3AVUA 4A92A 5AVWA 4C7OA 1NDQA 5K3BA 4EKDA 1E3JA 1NTOA 2GCNA 2V8BA 2XT6A 5DH9A 5DYGA 3X1WA 1TJPB 2HM7A 2VRBA 4GDMA 4GI5A 4WZAA 3ICCA 3RROA 1EP2B 3ZLTA 3ZJ5A 1W59A 2H07A 3LP6A 1ORRA 4MQFB 2C3PA 3DO5A 3S70A 3A36A 3ZKWB 5CB8A 1DWOA 3Q88A 4FN5A 3IAAA 2IUUA 2HX1A 2Z5VA 5ILOA 2YHBA 2V7EA 3AY6A 3W8FA 1WXXA 1T8PA 1FDVA 3BDIA 2ZYSA 3INTA 4R2KA 4U7WA 4F84A 1K06A 2G7ZA 2HL6A 4RH0A 2OXFA 5A4KA 1SBQA 2GK4A 3W7BA 1PI3A 1ZDMA 3K92A 1JQJC 4N40A 3GRKA 1GYPA 3AJAA 3TZEA 3AP2A 3MMNA 4BNIA 1YHNA 4O4HA 2Y0BA 1U99A 2VT6A 4MPTA 3EEOA 3BB3A 1JJVA 4S3MA 2YHIB 1YKGA 5B4TA 1XCLA 1A71A 2AA3A 5ADHA 3IR6A 2XYVA 3UVEA 2I2BA 4XAQA 5AIBA 5A2QA 5CLGA 2PHZA 2PUCA 3JTEA 1GZ3A 2A33A 3DDUA 2G9UA 4RADA 2RDMA 1G98A 4I6JA 5J2TB 1DRKA 4CMAA 4MVJI 3WK6A 4AYTA 1WRBA 1HLFA 2AN5A 2GT1A 1WKCA 4I6GA 4OQQA 3BXGA 1L9XA 1E6WA 3D6NB 3K15A 4QHYA 2G9NA 5C7IO 4BATA 3GVIA 5A4DA 2CW5A 4MIYA 1G5HA 3KD3A 1SBZA 1N77A 3FRIA 5IKPA 5JD6A 3OM1A 2EGGA 1ZD1A 4Y2GA 4CEJA 1NFFA 3DSRA 2YV2A 3BE5A 2V6FA 1IVSA 2FGKA 4TRJA 3WNQA 1NONA 2ZULA 3B5JA 1PFGA 4MPRA 4TZTA 1M2JA 2O7SA 1IZ7A 3N7TA 3K9WA 4LNUB 1U7PA 2X42A 4Y7CA 2I4IA 1BMFA 2OGZA 3DCNA 3E3AA 3OIWA 4AZSA 1OROA 1XCPA 3TSCA 3C4QA 3GAMA 2GCGA 5IX8A 2IHTA 3JWPA 3V4PB 5DHAA 1JKMA 3KJEA 3WLOA 2PUEA 2BFDA 1JDBB 2ASVA 2JBWA 2Z83A 4BOYA 4F4CA 2EJVA 1UADA 1MNAA 5FBZA 4NR0A 1RWPA 2EX4A 3NHRA 3L0DA 3WGVA 3QPCA 4HAXA 3ZHTA 2B6NA 1I7QB 1GZDA 1XA4A 3IIEA 3TQTA 3X1JA 1Q7BA 2EHJA 4E46A 1XB2A 1CBUA 4XIGS 3HVKA 4CF6A 1N9KA 1QHGA 4JVLA 4X93A 1NJ5A 1ZL2A 3U4IA 1HL3A 1DAEA 2FW0A 4EEKA 3D3KA 2GAJA 4KO8A 3NMUF 1HEUA 2P9YA 2UZ0A 2PJDA 3GX1A 1ZIOA 2Z04A 1UINA 4KLZA 3IPYA 4D74A 3FCCA 4IR7A 1KAMA 4F85A 4JI4B 2F3UA 3VHLB 4PNPA 1QK4A 4OHWA 3ZWVA 4KMRA 4F8JA 3LPDA 1F5SA 2Z2IA 3HKEB 1XPOA 3JYHA 1CJMA 3IP7A 4OBXA 4FEGA 2YDYA 4RVUA 2AJCA 4H0NA 1VGVA 1SKQA 2OGUA 3O4GA 4TL8A 4XWWA 4KOAA 2YJ5A 3OWXA 4ZVOA 1RVV1 4Q47A 3SM3A 3V34A 4GAEA 5IJAA 3GRZA 3FYSA 4QSMA 5SY4A 1E8DA 3JWIA 3QU5A 1JU4A 3GEEA 3G82C 4DL9A 2DG2A 3TNLA 1K7SN 1A1VA 1ZU5A 2H2DA 2FG5A 3FDXA 4MUIA 3TL2A 4B43A 4EYQA 2OGWA 4KVGA 4TTJA 4A0HA 4EKEA 4I1OA 2ZYDA 2NTJA 5ALRA 4KFCA 2E89A 4BFWA 4ZRMA 3QUBA 3WLRA 2EX1A 3TRDA 3FR7A 5EUBA 1GCOA 4YMGA 2Y0EA 4O4IB 3LC7O 3D5EA 1K8YB 1RLTA 2FPMA 2RHWA 2IDZA 1DC4A 4ZCIA 4UU1A 4DM4A 2JBHA 1XAGA 1Y48E 2BMEA 3JX9A 4WJKB 5AKYA 3RUIA 5JNUA 5A7FA 1MO3A 1U2TA 3W7VA 2VSYA 5ECYA 5LXTB 3EA0A 3RAEC 2VPQA 2VP4A 4ESOA 4INOA 4P7BA 4QXMA 2YL2A 4OXYA 2W11A 3K5IA 1TK3A 1U2DC 4D44A 5IPFA 3TSAA 5TRTA 3CY6A 3HFJA 1RJGA 2B1IA 4GX2A 3B38A 4C0QC 1VTKA 2DPYA 4MXDA 2YIJA 3L01A 2FWJA 4CF5A 4B40A 4YAKA 3KQHA 4JJ4A 3G89A 2RI6A 2FK7A 2H0QA 4Q3OA 3OTOB 3O1HB 4XPIA 1MH9A 1Y6JA 2EFHB 5AHKA 1LRKA 1DFHA 1Y5LA 2BLLA 1FTYA 2RHBA 1U1EA 2PAAA 1N9GA 1PJCA 3HUTA 3NKVA 5HF9A 2HCBA 1WY7A 4HLCA 2FZGA 2G25A 2XOXA 2OZEA 1SK8A 2R1TA 3N8DA 4KXQA 3TSYA 5K6AC 5IM5A 3RSLA 1NPDA 1HDIA 4L3VA 4NZZA 1EVKA 4TXMA 1RJ9A 3EIXA 1QQ7A 3OX4A 1IFXA 4IKOA 3EC1A 3E9DA 4K28A 4AY3A 1FYVA 3WAGA 1EVJA 1NM5A 2SICE 3JSXA 4PWYA 1NX6A 1C1YA 3COJA 2I3GA 3UZUA 1VL8A 4BQRA 3SYLA 4BJHB 4JYBA 4C4SA 1V16A 3BMNA 1E1LA 1I14A 2BUBA 3JYQA 1NF9A 1II0A 3OQBA 3Q98A 4UJ5A 1JQ3A 3TK1A 3RC2A 4F93B 3SLGA 3GUZA 5EE9A 1PDOA 4DJTA 4GG1A 4KUEA 1NU6A 2H1IA 1TAQA 2FQXA 4MH0R 1NQAO 4A10A 4K9OA 4IIVA 3KT6A 1Z8DA 2Z57A 4S1NA 1Y37A 1U7DA 1PJQA 4D5EA 4C0HA 1R6AA 2VRNA 3JCZA 5AVJA 1RQPA 2ZYAA 4NECA 1AKEA 4ZGBA 2XVMA 3DBLB 2JLSA 5EZYA 3MJFA 2ARKA 3MINB 4OHPA 3GUUA 3VBEA 1V11B 3DXYA 4JL6A 5EMHA 1P1RA 5EZSA 3PHLA 2ID7A 3JATB 2JD0A 3QUSA 3TW8A 4FYHA 3HP4A 3S28A 4LWZA 2QMUA 1T8UA 1PNRA 5JAZA 1E64A 4BVHA 2XPCA 1Q50A 3NVAA 2EL9A 2QMQA 3P19A 3QI2A 4OGFA 2JLQA 4JLKA 4RKWA 2X14A 5C46F 2G70A 3EULA 1YGPA 2O8BA 4YV1A 1DEHA 3NNDA 1DT5A 1VG0B 3B36A 3DO6A 1JQLB 3AF0A 4NFYA 3Q7PA 4NDAA 1L1QA 4X54A 9LDBA 4BXOA 3O75A 4P81A 3RIHA 2PJRA 4CEIB 3AJ8A 2NV0A 2GEJA 3VPSA 2X0FA 2QP4A 3F8TA 4BFUA 3LY8A 2OB2A 3RTCA 3VUFA 4P0QB 1YDWA 1NFRA 2PZJA 1DX4A 2WYOA 2XOKA 2YVQA 3BRWD 3PK0A 2W93A 1SNYA 2G7MC 2YQ5A 4HSEA 3U17A 4ABYA 3GEPA 1TKCA 2ET6A 1AA9A 1KMIY 4H3VA 1Y3AA 4ZPJA 4CMEC 4FPXA 2YVUA 1G41A 4BVJA 3NONA 3BMQB 1Z07A 1E1NA 4H0CA 2B1JA 4Z1MD 1LSJA 4ZT5A 2DSTA 1CUJA 2JFPA 2HC9A 1E2FA 2I22A 3DUWA 3OVMA 3P9CA 3PEVA 4JVSB 3RK4A 2ZS8A 3PTLA 4PO8A 1NKVA 2Q6VA 1EKXA 1W94A 4XYGA 4Y6LA 3HK2A 4MWOA 2OCPA 5DX0A 3TG8A 1IN6A 1H2RS 3LNCA 4G41A 4ZCTA 2ISCA 5K0FA 3R0QA 4Q3DA 1A9SA 2G9VA 2NVUA 2POCA 2ZTSA 3FNGA 1SB8A 2ON6A 4HEJA 1TO1E 1AS2A 1CRPA 1BCRA 1TUEA 1FU4A 4E2YA 1FTSA 1TT5B 3AB3A 3K4QA 4WOJA 5AM0A 2FEAA 4DIKA 4ESEA 1RWOA 2VDWA 1FU7A 1OXMA 3WDLA 4F9GA 1IJFA 4LKRA 1WUHS 4BJ3A 5CLLA 3TF5A 1E79D 3ZZ1A 2LP4Y 2P68A 2NP6A 3ZWCA 1YBVA 3RVLA 1Y8QA 1AVTA 2X0JA 1U80A 2F7SA 2QXYA 4IDNA 2I99A 3N0VA 5KHAA 2WM3A 4M4SA 1KYQA 5H5JA 1ZIPA 4BFVA 2CXUA 3IHLA 2QS9A 1PG0A 1XU4A 4MEBA 3RSCA 3V6MA 2ZIXB 1KHHA 5LQMA 5CXQA 3FCUB 5TS2A 2XDAA 1YDHA 4OH1A 1YZGA 1JT9A 1YKSA 4MIOA 4OFZA 4R3WA 2DVMA 1ISJA 5BSFA 5BRJA 1MEOA 2D59A 2C8LA 1JMVA 2K5UA 5GY7A 2UXBB 2H7CA 2QRVB 5BW8A 2HMVA 3KQYA 2IYXA 2JLUA 4HRVA 4GYYA 1NV9A 4JU9A 4RHTA 3OURA 3LYLA 2AF4C 2PVCA 5IK2D 4BECA 1U2RA 3M5DA 4KXMA 1LXCA 2P62A 5DP2A 3HCWA 1UQUA 1M6EX 3T7IA 1Y33E 4Z4GA 4DY6A 4PLCA 1O8BA 4FB4A 1NATA 4AJPA 5CW1A 2X6RA 3NHMA 5K3DA 1ZICA 1B4DA 3MNFA 3O0TA 4UZSA 3RWOA 2P11A 1BN7A 4BNXA 1SA0A 3DM9B 4Y6SA 1S02A 2BWJA 2C2MA 1RTTA 3MAJA 3BVPA 4E7OA 5JPIA 1TIBA 3MWGA 3WJ1A 3WFZA 4HN2A 4C0WA 2XA2A 4LV6A 2XUKA 2HCFA 4UNPA 3IE0A 5JS7A 3KZOA 5IFKA 4L76A 2WWGA 2G40A 5CITA 5EPOA 5CFLA 1OV6A 1P17A 4E4RA 2J32A 5AMXA 4FYVA 3QSYA 3EE6A 4FINA 4YRBA 8LDHA 1D2NA 3A1FA 4HHEA 1UUFA 5A9SB 1EGVB 1D1QA 1FLAA 2FSSA 4H4EA 3QP9A 1Z6PA 1P4SA 1QONA 1W0JA 3FKQA 3TZQA 4HLUA 2JK0A 2PXXA 4Q4HA 3DLBA 1CB0A 3DB2A 4FFBB 1DWPA 1DBVO 2EFJA 3Q6IA 4MQMA 4WAUA 4L3WA 2H3HA 5ALYA 1P2UA 4YRFA 3SSAA 2ZSJA 2VA8A 5IVDA 3NHPA 3T3MB 2PGNA 1XEAA 4KWTA 5C8YB 2ZBUA 3C5EA 5FFFA 4WKCA 2P35A 3LI2A 2WP0A 3JVVA 4M55A 4UMFA 3AR3A 3K09A 2D7DA 5LQNA 4CLOA 3W5SA 2LNDA 3TMAA 1QWOA 2EP8A 4V39A 4M36A 5CH8A 2CV1A 2G1PA 1Q15A 3FCXA 1YUMA 5DYNA 3I5XA 1LB1B 1USIA 5JEDA 1FFXB 2OO5C 4BZPA 2WE8A 1ISRA 1Q7GA 4N3AA 3VR3A 1JSRA 4B81A 2LTAA 5CDHA 2FQYA 1E9FA 3D3EA 2WKSA 4DPLA 1N34B 1CE8A 4WECA 3T3PB 1TVCA 3KU1A 1Y3HA 2P9QA 2VWQA 3L8CA 5K0LA 1Q1GA 4W7IA 3SC2A 3U61B 3ZLJA 4GW3A 3MTBA 1EFDN 3LUCA 4PS0A 3T41A 2VWPA 2O5EA 2I4TA 3H97A 4G4SP 3R7FA 3MS2A 2HA7A 1PBNA 1AQJA 4R2IA 1PTJC 3C14C 3FI0A 4S05A 2Z9DA 4JSRA 2FB9A 4M87A 4AS3A 1BU8A 3IBCA 3M4NA 4YCMA 3D8HA 4AKTA 2GILA 1RPZA 4ZXPA 4FFPA 1KARA 1NY6A 4A5OA 1HG1A 3PSHA 2I3BA 4JU8A 4CI9A 1WR8A 4QEKA 3M0EA 2AT1A 5ITZB 1G7RA 1NN5A 1W1UA 2YWHA 2Z9CA 3PTZA 3QA3E 1IC6A 5DLEA 4ZA2A 1PN3A 3ONFA 4IFEA 2L19A 1L7NA 3SD7A 5CA1F 1GRNA 3U6BA 4N8SA 1ZIXA 4GMGA 5H9VA 1BX1A 1U0LA 1R4AA 3LRTA 4YAJA 1NXPA 3PPXA 4OMUA 3W1WA 2PXCA 1UWCA 1W46A 3MWDB 4WE3A 4AJ4A 1E3TA 2CVQA 4F5ZA 2NV6A 2QLFA 3RVMA 1V6AA 4NMXB 1HYGA 2BCGY 4I0WB 4ZVLA 3QU2A 2WIGA 5J5VA 2YC4C 1GADO 3L1HA 621PA 1GFIA 3HGTA 1D2HA 4DFDA 4N01A 4O25A 3B13B 4MLDA 3QHPA 5GIOE 3RSZA 1PEKE 2E7ZA 2AC7A 2GD2A 4Q7MB 4LISA 2UYHA 1C4OA 1R0RE 3LXUX 1GR0A 4AIIA 4ZVSA 4I2VA 1FFWA 4H7JA 4TZKA 4DV3B 3K6KA 1L1EA 2ZRLA 4PEVA 2VHQA 2R6R1 5B6JA 2CDCA 2D2EA 2XE7A 2QNRA 4O33A 3G88A 4NHEA 1EIZA 3ABZA 1WQ1R 4U02A 4ZT2A 4CM3A 3RSQA 4W5RA 4ZOLB 1YV9A 4AF6A 3VNBA 1BXGB 1C29B 2QMZA 4I9UA 1YFLA 1ZAKA 2NU8B 2OCAA 1B42A 1IAQA 3R7AA 4B3SB 2Z08A 4HLDA 3NAQA 1QIGA 5B3AA 4MDEA 1K0FA 2QVXX 3HH8A 3OZVA 3BZWA 3Q7QA 4ISBA 3UPDA 3H4TA 5U1PA 5KQLA 5FL3A 2D2XA 1LU9A 3GG9A 4U2CA 3TW6A 1XXHE 3GRAA 421PA 5HIMA 3NWJA 1NN3A 4RDXA 3ZS9A 1H0SA 2JHGA 3S6JA 4ZARA 1GPMA 3OSUA 1UC5B 1Q0ZA 4BL5A 1K5HA 3OZSA 3IT1A 1EDOA 3QUQA 2HQBA 3AO0B 3OKCA 5EL0A 1MAAA 4V1CB 3BE8A 2MSEB 2OORA 4J91A 3R7WB 4OHBA 2ZT7A 4MUYA 2BEWB 4HXGA 3V46A 3ZW8A 3QH4A 1UANA 1P7PA 2AMVA 2C4UA 5HDQA 5IBRA 3KOMA 2BFBB 2BFEA 2F1RA 2GN6A 1ZD2P 1WA5A 4ZIRA 5F4BA 2C82A 3FTEA 3KB2A 3JRXA 4CRWB 1X9GA 3PDHA 5TT0A 3DV0A 3E9MA 3ZWXA 4PGHA 4CETA 2QENA 3ITDA 3HCDA 4IDGA 2IELA 1DADA 1JDNA 1GQYA 2VP5A 2WIBA 3ICPA 5DSZA 3VH3A 3L7LA 4F9EA 1SC3A 3ZGYA 5HKBA 5L3QA 4V0MA 2AN1A 4F91B 3MYRA 1QCCA 3MJCA 1UMKA 1WB4A 1LDBA 3I64A 3CGGA 4O59O 3WGJA 1WU8A 2XUIA 2BKLA 2BEUA 4U5QA 5SYAA 4AL4A 1U9CA 3P9KA 5DBFA 3LRXA 5F9MA 3M81A 4WMLA 5ICEA 1IJEA 2WTAA 3M9LA 1QGZA 2C2OA 5FT9A 2AN4A 4KE8A 4Q9LA 1S0UA 2H5IA 2ROQA 3WBKA 2C29D 2ORVA 1P2GA 2ZJZA 1KI1A 1Y4AE 3QYFA 2VXBA 4N4AA 1ZK2A 3O8OA 4YRJA 1YZTA 2YOFA 4MW0A 3IESA 4TMWA 4EW3A 1WV0A 1EJ6A 1VSUA 1NPTO 3LXRA 4YP0A 4EZBA 1CJCA 3EEYA 1DAPA 1UEXC 4HDNA 4R2JA 4K81B 4PGGA 1M0TA 1GU7A 4NXMB 3ORFA 3P1JA 4LRYA 4OM8A 3CYFA 5KEIA 5SZJA 5B3JC 1NBWB 3C48A 1VHWA 1PGPA 5FOVA 2AW5A 1XYGA 1W1WA 2HSEA 3F98A 1CZRA 3KQVA 4FR0A 3G2MA 4HEA6 5AVKA 3TDMA 1E6KA 2RAVA 4CYMA 1BYIA 1JNYA 3KVOA 1ISGA 3OU2A 1WP4A 1X2EA 4X61A 4DXDA 1QO0A 1BWSA 1TXGA 2DE0X 3KQQA 5K05A 3QUTA 1CV2A 3E15A 4XWGA 2DMRA 2Q5LA 1O8CA 4B3IA 1U0NA 1C3XA 1XI2A 1KZYC 2GHIA 5ALGA 3B9PA 4DMUB 4F6RB 2M6RA 4KP7A 4RJTA 2GM5A 4OHUA 5TMBA 3IULA 1KSHA 4L6IA 4YLGA 1APBA 3PXUA 1S8FA 1UZLA 4CFSA 3SBDA 3JQBA 2EQBA 1FRVA 1R1DA 2IUEA 2DR0A 3MB8A 2M6KA 1Z36A 4V38A 2FMTA 1MVNA 3NEAA 5E7MA 2ACEA 1VG9B 3QYAA 3R40A 4MR8A 4TTIA 2A1UB 1Z88A 4R8VA 1VIMA 3CRNA 4Z7QB 1K8RA 2SNIE 5KOYA 4ENQA 3N87A 1SRRA 1J0EA 4TLBA 2ZJ2A 4LX0A 1YVPA 4MS3B 4PHGA 4DA7A 5KUTA 3QLUC 2M32A 1AQUA 1AQIA 1U4SA 3Q3GE 4M8LA 3N8KA 3I2KA 4YP6A 3G2OA 1KQNA 4ZQCB 3QWHA 5KTTA 5KNBH 3O1IC 1VMDA 1W25A 4QT0A 4OLBA 2UVQA 3NH9A 4N5NA 1WXDA 4CIAA 1IDOA 3H5NA 1F06A 5FADA 3LGXA 5FOQA 1U1DA 1COZA 1MQAA 1U4OA 4W7HA 3RUDA 3SIPA 2JGMA 3ZWYA 5DCUA 4JUDX 3A1NA 1GU1A 5A1JA 4XGKA 2Y1KA 2VIIA 2O4UX 2A9KA 1TZKA 3KV1A 4G5SA 3RANA 1OF1A 1VIYA 3OF3A 4LOKA 4GRIA 3VJKA 4FLMA 2PR2A 3DE4X 5J2TF 3K30A 4U1RA 4WFJA 2AW3A 3RNOA 4B32A 3E3OA 1ADFA 3Q1LA 4LGYA 1J97A 4LQDA 1UKEA 4EATA 1RI2A 4YMLA 2ZUEA 4UCWA 3T34A 1XPRA 5C4IA 3DPUA 2W2KB 3P5BA 4KDFA 4HXEB 1ZVVA 4TV8F 2WYIA 1M2HA 4X66B 2OV6A 3LL7A 3Q3JB 1VLVA 2H1FA 4B3MB 4P83A 1ZCBA 1CUIA 4FCWA 4CEHB 3V80A 5BR4A 1B73A 1QX3A 4Z7OB 4GLFA 4KUHA 3HXKA 2KQUA 1WV1A 2DWPA 2VBIA 4XFKA 3DKIA 1HDGO 4CLXA 5HIAA 5TV2A 2X7JA 1LNSA