3OO1A

Structure of e. coli chey mutant a113p in the absence of sulfate
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTPATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the effect of an allosteric site on conformational coupling in CheY
rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 46
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3oo1A00
1DRJA 2FKAA 5T3YA 1JFVA 2QR3A 4QYWA 1EWKA 2FN8A 1XHFA 2PL1A 1YS7A 5EWLB 1YK1A 2PUGA 4N0PA 3TB6A 4Z4CA 1Z12A 1D2AA 1SRRA 1NXOA 2AYXA 2VUHB 3GWGA 3O2QB 4MR8A 4RY9A 5TQ0A 5C5EA 1TMYA 2CWDA 3EGCA 1USGA 4RXUA 3HDVA 3FGZA 1USIA 3C3KA 4N76A 3JPWA 1JWLA 3H5OA 4WT7A 3CKMA 3A3KA 4XFKA 1OXBB 3CG4A 4UHJA 1EWVA 2LUOA 3GRCA 2VYCA 4FE7A 4G0ZA 4KNYA 4MS4B 1NXWA 2BGGA 3CTPA 2FTKE 3JTEA 2FLKA 2IPAB 1URPA 2RDMA 4H3HB 3KHTA 5TQ2A 3O75A 5FWXB 4RDCA 3KKEA 3M6MD 3CRNA 3QEMB 3TMYA 1HEYA 2E4YA 1M5TA 5IC5A 3RVOA 2IOYA 1CHNA 4MS3B 3DBIA 4LRQA 5KC8A 3HK2A 4ZYLA 2LPMA 1DRKA 4EYKA 2KYRA 2MYTA 1NXVA 4H3KB 1Z16A 5FBKA 5IUJC 4EYQA 2WY2D 4M88A 2HJ9A 5BRJA 2PUAA 1JHZA 1NY5A 3SG0A 3QEKA 1JDPA 1YMVA 3UKJA 4NQRA 1KMIY 4WUTA 5CHYA 3H5TA 3K4HA 3H6GA 1DBWA 2L19A 1NXXA 1ZH2A 2WMYA 2PMCA 2VK2A 5IEBA 1B00A 4EVSA 1EAYA 2PJUA 3IP5A 2JVKA 3NHMA 3O2JA 3RVRA 3UK0A 3N0XA 1E6MA 1QQAA 1BDJA 1U2PA 4E7PA 1F4VA 4XARA 4W5RA 3RVMA 4EVRA 4N41A 1ZGZA 4RKQA 4DADA 4ZMRA 3HXMA 4P98A 5IUKC 4DN6A 4KMRA 2WJWA 3KCNA 3N0WA 4Z99A 1DCFA 2JVIA 2JVJA 2PKXA 4KZKA 4RK5A 2QVGA 1K66A 2IKSA 5KC9A 5TPWB 5B3JC 2JRLA 1GLGA 2LIVA 2NUBA 2FSPA 1ZY2A 5DTEA 1ABEA 4KVFA 1DCMA 3EULA 3T6KA 3W9SA 3QK7A 1Z25A 1AB5A 3OMWA 2M98A 1NTRA 2B1JA 1AB6A 2QV0A 3IP7A 1Z26A 1R8JA 3GBPA 2FQWA 2MSLA 3HUTA 4YR7A 3QEMA 4YRZA 2H3HA 4RU1A 1M5UA 5JS1A 2FVYA 5CNKA 3GBVA 2FW0A 1P2FA 4JA2A 4OTZA 4RY8A 3C6QA 2WB4A 4G97A 4LZLA 5IEJA 3N75A 3RVLA 2F8TA 2HSGA 4TLLB 3GYBA 3CNBA 1FFSA 5EWJA 4YP9A 4YS6A 2CD7A 1F51E 2L17A 2FMIA 4Z4HA 2FQYA 4MR8B 3LKBA 2FMHA 3A10A 3CFYA 5PNTA 3RVSA 4HNRA 4KQCA 3SM9A 3KJXA 4MS1A 4Z4EA 2FEKA 2GBPA 1P6QA 3MQ4A 2X7XA 3Q9SA 1H9CA 1XHEA 4GNRA 4MLCA 3URMA 5IBQA 1QO0A 1CYEA 1P8AA 3DLHA 3TD9A 4NCBA 3KYJB 4Q6WA 3NNSA 1ZHHA 6CHYA 1D4ZA 3E3MA 1DZ3A 4EVQA 2H0AA 3LTEA 3CZCA 1LBIA 3KG2A 1J56A 4LDZA 2JK1A 4N03A 3L49A 4KFCA 3C3MA 3OLZA 5JNUA 2DRIA 3HV2A 5DKFA 3H75A 5IULC 2PUFA 5JNTA 3RQIA 4MQFB 5IX8A 2P9HA 4RSMA 3H5WA 2NZUG 2R25B 2RGYA 5JNVA 3CG0A 1YVUA 1JFTA 1JL3A 1P6UA 4DQDA 3F6CA 3EODA 3VNAA 2Q5CA 4YCSA 4KPYA 4GPAA 4G0PA 1D5WA 3BILA 5GQSA 4OLBA 1ISSA 1LJLA 2JCGA 4IRXA 2HQOA 3CZ5A 2FN9A 3LUFA 1IIBA 5KWSA 9ABPA 1NXTA 5F64A 1YK0A 1C4WA 3JS5A 4OLAA 2YHBA 1KRXA 3KLNA 4L85A 1ABFA 4FE4A 1KRWA 3DZDA 4ML3A 3I42A 3MF4A 1BVHA 4KK3A 4RK6A 4D6YA 4S05A 3QLUA 1QP7A 2M1ZA 1D1PA 4G0XA 4HYEA 4MQEB 1K68A 2GI4A 3A0RB 4XASA 4YV7A 1QPZA 1E6KA 4RK4A 4HNQA 3OM0A 3KSMA 4O1IA 4OG2A 4G86A 4RWEA 2HPHA 1FFGA 1LJUA 4PZ0A 1MB3A 4NV3A 4LX8A 1YIOA 3A0UA 3H1EA 3RVPA 5DCLA 3HS3A 5JNSA 1S8NA 4JOQA 4HNSA 3KS9A 3OQMA 4ETNA 4MAAA 3M9WA 1MAVA 5B3JA 3S99A 3FFTA 2PAFA 2ID9A 1U2QA 3OQOA 5KQGA 2I6FA 4OBBA 5E3JA 3C97A 3BBLA 3OLXA 1ZN2A 4EYGA 3DGFC 2OQRA 2MSWA 4TN5A 1ZITA 3O1IC 1RPJA 2GX6A 1GUBA 1DCKA 3Q7TA 4E7OA 3LUDA 4WXMA 4ZJPA 1DG9A 3RVQA 3F6PA 3I09A 2IYNA 3P9YA 3I5AA 3DGEC 2NT3A 2FEPA 4KV7A 4LE2A 4YLEA 4CBVA 2ZAYA 3H1FA 4ZMSA 1SD5A 1MVOA 3LUKA 4Z4GA 2QSJA 4LE1A 2FQXA 3ROFA 1RZRD 5FBHA 1NATA 2TMYA 4NICA 2NT4A 5CNIA 1ZGGA 2B4AA 3TX6A 4MR7B 3RH0A 5KQMA 3N0RA 4F06A 3QX8A 4N0QA 1FQWA 3TO5A 3H5VA 1SXIA 5ED4A 1EHCA 3UUGA 4WZZA 3ROTA 3SY8A 5HM6A 2OENG 1M2EA 4MS3A 2P4UA 1ZDMA 2PL9A 3T38A 4S04A 2PUBA 4B09A 4MYRA 4IILA 1DBQA 3GV0A 1PHRA 4MQFA 5TQ2B 1NXPA 1TVMA 2XDYA 4TMYA 2WRZA 1PEYA 3OLYA 1DC7A 3IPAA 1JDNA 2QXYA 3LKVA 4ZPJA 3T8YA 1PNRA 5JS2A 2MSKA 4RXTA 3MA0A 4NCAA 3HCWA 4MR7A 2HQRA 3QX9A 3E61A 3JPYA 3BRSA 4L4UA 1JYFA 1M2FA 2E4UA 3CU5A 4LE0A 1MIHA 3N53A 3HDGA 3OO0A 1LK0A 3Q15C 4MS1B 3QLUC 4D6XA 1W9HA 1L5ZA 1RNLA 1QP0A 3O74A 1FSPA 4G0YA 4Z9AA 3FFWA 4WWHA 4EYOA 3HM9A 3HZHA 3OLWA 1A2OA 4UHKA 2PLNA 1TM2A 2CHEA 4D74A 3QELB 4MR9B 4RXMA 3H1GA 2LP4Y 2RJNA 2A9QA 3FMVA 3O2SB 3DLBA 3HJFA 4RK1A 3HUUA 1E6LA 1Z2EA 1JX6A 3O21A 3HO1A 3JY6A 2QU7A 3LUCA 2CHFA 4JAVC 1U8TA 2E4ZA 3MIZA 4EUKA 5TQJA 1UDRA 3JVIA 2ZWMA 1OXKB 4F8JA 1ISRA 2F8SA 1RXIA 1PUXA 3NNNA 1XWWA 4QYMA 1QNLA 2O20A 3L6UA 1W25A 4PYRA 3LUJA 1BDHA 4RV5A 2GKGA 1VPWA 1VLZA 4RK0A 2WJAA 4Q6BA 2A9OA 3IPCA 3OO1A 4RZSA 4QPJC 4Z4FA 3GT7A 1YTUA 2FMFA 4MS4A 1ZAYA 3ILHA 5TQ0B 4PEVA 5KI6A 2FLWA 6ABPA 5HKOA 1SXHA 3NBMA 2QW1A 4XXHA 3HEBA 3Q41A 4IF4A 1YMUA 1JYEA 2AYZA 2V0NA 4N47A 5ABPA 1EWTA 5C5CA 4RY0A 1WETA 1SXGA 3EDCA 1QKKA 4PICA 3KTOA 5TPZA 1FFWA 4F11A 2MYNA 1I3CA 3D8UA 2FEWB 3FFXA 3G1WA 3RVJA 3LMKA 5T7BA 3GL9A 4W5TA 1CEYA 4MPTA 4MQEA 2JBAA 2PE5A 4IGAA 3H5IA 4MGEA 4EY3A 4H60A 5BQ3A 1YS6A 1GCGA 5EWJB 4KK4A 3HSYA 1D1QA 1NXSA 3MM4A 5JNWA 3LFTA 4JASB 3O1HB 1A04A 2N9UA 5DLEA 3EQ2A 2YHAA 1Z18A 4IMIB 4TLMB 4W5OA 2A9PA 3K9CA 4JB0A 2WWVD 2VUIB 3QELA 4MR9A 3KLOA 4Y9TA 1LBHA 4LDAA 1L5YA 4Q7EA 2IDMA 4FB4A 1EFAA 4W5NA 4XLTA 3N8IA 2RJOA 1DBPA 2GWRA 2R4QA 3H5LA 3IP9A 4MRMB 5FWYA 1GCAA 3MYYA 2JBAB 2QVCA 3LUAA 3R0JA 4W5QA 2PUCA 1C0EA 4OATA 3QLVC 4JB2A 1A0OA 4F3TA 4O1HA 3LUGA 3MMNA 3D02A 1PEAA 1BAPA 5HQJA 5D2CA 3T95A 2R48A 2A9RA 3CS3A 3FDFA 3OM1A 4G0MA 3RVKA 4RKRA 3SNKA 2FXIA 3LOPA 2NZVG 4PE5B 1DC8A 2J48A 4RS3A 1VRVA 1JFSA 4Z9BA 5GOTA 3OLVA 1ZH4A 1QP4A 3EQZA 1T34A 3OMXA 1TJYA 2IPNA 5EWMB 5TPWA 4G0QA 3B2NA 3KYIB 1E2BA 3BREA 4KRFA 2QZJA 2E4VA 5I4CA 1MB0A 1USKA 5KQPA 1Z17A 2JB9A 3IDOA 3Q7SA 4JP1A 3ILYA 3IP6A 2FMKA 5IUNC 5TPZD 2E4WA 5CNMA 4YO7A 3QLVA 2L18A 5DGCA 4YGXB 1Z13A 2MYPA 3I45A 3Q7RA 1PNTA 1TLFA 4YWHA 4Z4IA 4MLDA 3NNDA 1Z15A 1GUDA 1VKRA 4Z0NA 4XAQA 4G0OA 2PUEA 3F7NA 1Y1LA 1DJMA 3G85A 1APBA 3QLTA 5CNJA 4EGSA 5TE9A 1QQBA 1ZVVA 1QO0D 3SQNA 3O1JC 1QMPA 3EJWA 2E4XA 3CLKA 3EAFA 2IPLA 5EWMA 2HQBA 5BRAA 1RZRA 2PUDA 1JBEA 1Z2DA 3CHYA 1JLKA 4MRMA 5FWYB 1KGSA 4F12A 4QICA 3SAJA 2IPMA 5EWLA 4RK7A 3RVNA 3LUHA 2L2QA 3M9XA 4ETMA 5HSGA 3C3WA 2MYUA 8ABPA 4ETIA 3HVRA 1JH9A 1BA2A 7ABPA 3GA5A 2R47A 1DP4A 4WXEA 1RXEA 1U0SY 1BDIA 2ID7A 2W42A 1ZESA 5FWXA 5BR1A 2LBPA 3NHZA 5KQLA 5JNRA 3OQNA 3H6HA 4KREA 4IMJB 1JF8A 3BRQA 3N6VA 1U04A 4P1ZA 4O5AA 4KQ9A 3VNBA 3JVDA 3F73A
chains in the Genus database with same CATH superfamily
5DF1A 5JYDA 5F3WB 2QR3A 1KJWA 1EWKA 2QJWA 2YTZA 3OKPA 1RCUA 4N6NA 4WCVA 3W2EA 4E11A 5JR3A 4FWIB 4QU8A 4CGZA 3IUYA 4FZ5A 3QEAZ 2WHQA 3OF2A 4ABYA 3A04A 4B3MB 4MUJA 5AHOA 2UZ3A 1VYTA 4ZTZB 4L73A 1VBKA 2GN6A 3FYDA 2DECA 4ID3A 3IJEB 4LOHA 4MR8A 4NOLA 3V34A 1U8AA 3VBEA 2C84A 2XA2A 3OX2A 3JYPA 3RANA 1Q19A 2OAGA 5LYYA 1QKIA 1Q83A 1AC5A 2RGWA 1LDBA 5G02A 3GG2A 3IR7A 5BUZA 3BIJA 4C4TA 2JPDA 2WSLA 4XQGA 2E5LB 5IKPA 1LQUA 4RDXA 2R3SA 4XR9A 4BRSA 3LQRA 1G291 1I32A 4JEHA 3ED5A 5AKJA 3BE6A 3I9MA 2OGWA 1WIWA 4YMGA 3BAZA 3EQ7A 4YRLA 4KR6A 1WCV1 2E4YA 1CLUA 2P3LA 2FN4A 3NTLA 1S4QA 3N2GA 4ZOCA 1RMTA 4DJDC 2WYWA 1EUCA 2ZE6A 1ZHFA 5ALVA 2ZJFA 3COJA 3ESBA 4OOFA 3QVJA 3VPGA 1Z16A 1E4YA 3QHPA 2X6RA 4U5QA 5ALGA 2ZAMA 1XCGB 1NY5A 1GRRA 1ORTA 5KWIA 3ZQUA 1YMVA 2QDKA 2WF5A 2C4KA 1OBCA 3DEHA 4I8IA 5FOSA 2IIBA 4TV9B 2H2IA 2HXYA 2XKBA 2GD6A 3PDIB 3H6GA 4JL8A 4IDPA 1ZXBA 2AMLA 3WS7A 3LYAA 2NO1A 1HOXA 4YQYA 5BOSB 4GKBA 4RMGA 3JWJA 5GOZA 2ZRGA 4B43A 1W36C 3I6QA 3TFWA 3F6SA 4M3NA 3VZBA 1E5TA 3ZDZB 3A4LA 2O3TA 3MSCA 2D8MA 1J2YA 3E9NA 1W35A 3O2JA 3NV9A 3UK0A 1QH0A 3LWNA 3N2KB 4CJXA 4KR3A 2BRUA 5EZ5A 3SZGA 1NG1A 2J30A 4EY4A 1WUKS 2QUKA 2VTKA 3CN9A 4V3BA 4UMEA 4B3CA 4D4JA 3FETA 4P2BA 3WLSA 3PHIA 2ZULA 4RKQA 1ITZA 1GKKA 4CIBA 1U1FA 3OCYA 4JYCA 4KJXA 4KQKA 4KMRA 5IUKC 1YRBA 4RTSA 1SO8A 4LGYA 4CLRA 3EXIB 3F3KA 4JCOA 4C7OA 1IY8A 2FPGB 4UNQA 3WGIA 2JVIA 3SYRA 1GQRA 4JSRA 4D9EA 4KH0A 4BZQA 4DY4A 5CXQA 1EINA 1SUSA 4C89A 1SC9A 5DK4A 5TPWB 2JRLA 4JLBA 1ZMXA 1R0XA 2B8TA 4B44A 4H0FA 1VFNA 1Y5RA 1P73A 2W0MA 1EBUA 4L3VA 4UC0A 4KR0A 2C2HA 3AGPA 4AK9A 2AJBA 4PGAA 5GGYA 1WCIA 3AW9A 4IO0A 2C3OA 9ATCA 3PRKE 5B3LA 1B6TA 1ONPA 1T1RA 3VZQA 3RBZA 3HUTA 3EGVA 2FSVA 2YMLA 4TWBA 3DYBA 2CHQA 2OFXA 1R50A 5FA8A 5JANA 4DCJA 1KRHA 1RXYA 4EFDA 4IBOA 4YCMA 2VLBA 2EKZA 4B7ZA 4ZT5A 5IEJA 5LN1A 2CLFB 3D8BA 1KERA 3KJQA 3ZJ4A 4OFBA 1LZKA 3ZCQA 1P18A 5CA1F 2AOXA 2BEKA 5LU9A 1IBKB 4GAEA 3LGAA 521PA 1O94C 1Y3HA 4MR8B 1XZLA 4UUAA 1Y3IA 2I6SA 2VHXA 2BEVA 3LKBA 1PQ4A 1U7XA 1TCVA 4IIYA 5SZKB 5H4HA 3P7MA 1ZD5A 1O96B 5GIPE 2I1VB 2UVPA 5EMJA 1E2PA 2AOVA 1ENZA 3LBNA 1J8DA 3V4FA 1B1AA 3C5WP 4KG7A 3MTAA 4RS4A 5CFLA 5JMTA 2DPHA 4HQ6A 2XY4A 3TEJA 2FJPA 3URMA 2VDLB 1JVBA 1JILA 2DPXA 4JODA 3PXBA 1I94B 3H9EO 2V6MA 1S2IA 3D31A 3K9GA 3G2LA 2PVPA 4E2WA 1WE2A 3YASA 3HYRA 2IF0A 4YIHA 3T7JA 1F2UB 3GGPA 3CPEA 2ALJA 2XYPA 1EJBA 4OREX 3QKSB 5EESA 2BAGA 2ZRDA 2XE6A 1IXYA 3IELA 1SB9A 2PZ8A 4MAFA 2QTHA 5ALXA 2ACKA 1DQNA 2JK1A 4TWZA 2XCOA 1MC1A 3OLZA 3QM1A 2H1CA 3HV2A 5IH3A 1RVDA 2C82A 2GFQA 4KXYA 3BIWA 3ZHTA 3IUMA 4DIOA 4S2EA 2BKLA 2QRMA 3GT0A 4J2TA 4OH7A 4OU5A 1X77A 5IWCA 5JNVA 5BSMA 2X1VA 3GUYA 3RK4A 1SH7A 1KJ9A 4MINA 4IIBA 3O3NB 1T4CA 2P2LA 4CF6A 1IJBA 2CGEA 5LL6P 3V1KA 4DV4B 3BILA 3GLFE 3C3BA 3P2OA 4KQMA 3UUEA 3KU4A 2GFHA 2H2DA 3K73O 4QDUA 3T5CA 1J8MF 1XTZA 4LN1A 3TFQA 5BXQC 5KTYA 4ESHA 3CLTC 2XUKA 3LT5A 4HLDA 1NNUA 1UFKA 4BFTA 1W0CA 1SCQA 1G41A 1J70A 4L2IB 1PWZA 3RWMB 1EHIA 5GONF 3PFWO 1NULA 1FDUA 1O9GA 1VBMA 2DR0A 1GADO 4QUDA 3HVJA 4CT4B 1Z2OX 5CYPA 2ZVDA 4XSVA 4YRSA 2QJOA 1MEOA 3B1XA 2YIMA 5EKUA 3NVMB 3T06B 2HADA 2YFQA 1UT8A 2VJPA 4Z0TA 3LECA 1MVNA 1OAKA 5HCUA 4MQEB 2WMOB 4XLLA 2O7SA 1LTHR 4JZYA 1QHSA 1NLFA 1GTSA 2OBYA 3K53A 3FY4A 5K0NA 5I5GA 1HG0A 2JATA 1IXSB 2NQ2C 1G8FA 1G8MA 1PV2A 2ZB2A 3C6MA 3KZMA 1EFRA 2EFEB 3L1VA 4GDFA 1K5DA 1V8FA 4W1PA 1XD8A 2OBMA 2VFAA 3ZD6A 2DY1A 3B9RA 4BNGA 3AEUA 2DCMA 5JLAA 4JOBA 2CB0A 3H1EA 5FFNA 2XCQA 3F4KA 4TWAA 5EKSA 4JOQA 4UE6A 1DARA 3U3MA 5J23A 3DJYA 5DMHA 3IX7A 1MR3F 1FW8A 1QGUB 1MAVA 1W75A 1D6NA 5AJWA 2AVNA 2RHGB 1GSHA 3EUFA 4I2NA 1HFWA 2A94A 5KOYA 4MHTA 1BCRA 5DE3A 2BM0A 2IHUA 2NACA 2DBRA 2VS1A 1GPMA 2QLBA 4IGEA 1N4AA 3SYKA 1SBQA 3IPRA 3Q72A 1NUTA 4TRMA 4YAIA 2WMDA 3EDYA 4AN1A 4DFDA 2HGSA 4B0OA 2PYDA 2XCRB 4UVIA 1WU8A 2D0DA 1XLVA 4U2DA 4ZXFA 3S2EA 3W2FA 3QY0A 3C8DA 3T9FA 3FMIA 3H9QA 4QNNA 1WDWB 3G2QA 3IJ5A 1HC7A 2CZGA 1SD5A 1MVOA 4OHYA 2DUMA 2WOJA 2G76A 2AX4A 3S2UA 3WRXA 5CDHA 2HK7A 3FNGA 1NDQA 4FDAA 1P4HA 4QT4A 3EXEB 3EZ9A 1LC0A 4OXYA 4X5OA 2OECA 3WLRA 2C9ZA 1PDOA 2PUVA 4FGJA 4L50A 4LTNA 4XR4A 2TMYA 5COAA 4ND2A 4GF5A 1XTTA 1MRNA 2C20A 4Q37A 4X54A 4AJ9A 3QXCA 5LMNB 2NADA 5H8WA 4AY4A 3BQMB 3I83A 2FX3A 3HRIA 4KFSA 4I2VA 5B1EA 1NP6A 3LY8A 4IQ0A 1TUIA 3F9IA 4DARA 2XZPA 4FDUA 2O0HA 1RCFA 1Z39A 4NBSA 2IXFA 4PZ9A 3E3NA 1KJQA 1KU6A 1H65A 1V71A 2XGMA 5EIWA 3RS8A 4ZI7B 5HZHA 4PANA 5B4TA 2X9VA 1IN4A 2PH1A 1E7SA 2Y1WA 3KPJA 1ZGAA 3B85A 2JI8A 4KQ2A 2PZAA 4MH0R 5E2IA 2ONCA 2GJAA 3GVXA 3D7SA 4GI7A 3T1QA 1MOQA 4PVCA 2OG2A 2V7PA 3TIIA 3GPCA 2CFSA 5DNVA 1R8XA 2J0VA 3AEUB 3DF9A 2VRNA 4QARA 4GPTA 2XRYA 1HXHA 3GG9A 1QIHA 3KJEA 5JNLA 1UINA 2J9FB 2E4UA 3M1LA 2XHZA 3X1ZA 3BAFA 2XB2A 2OAQ1 1QP0A 2WTMA 3IBGA 3EGWA 3F2VA 2ATIA 1C3LA 2NVWA 4NJMA 4O8CA 2YWDA 4UNRA 4OHMA 2AJ8A 4LOKA 2EL7A 1ULAA 3D6AA 4ONEA 3TXAA 5HP4A 3HM9A 2Q5QA 1IUPA 3HZHA 3M4ZA 3OFVA 3C1TA 4D1YA 1H5UA 5K0FA 4EJSA 1EQAA 2EKBA 3U0BA 2KWIA 1GTMA 4MR9B 2RBEA 2LP4Y 3S2FA 3WK6A 1QQ6A 2QMHA 3FKSA 3HY4A 1XCLA 2I2WA 2ID8A 5FI5A 3OIDA 4DLYA 4ARIA 1LPMA 4EYEA 3O82A 4FCTA 4DMMA 5AQ1A 1HMPA 3W78A 3L4BC 4B5KA 2QU7A 2VYVA 3LBHA 3A1NA 3L40A 4YP5A 5TT0A 2PJDA 5LCXA 1VPDA 2OBFA 3B36A 3ED1A 3EISA 2PMFA 2WA2A 3ISTA 3A7EA 2GYVA 4KE9A 1ECPA 3T4EA 4DRYA 4LF7B 3IT2A 1JWBB 4GGMX 3IAM6 3AUYA 4KDCA 3PLAE 3IUNA 5H68A 4C3ZA 5HWSA 2G04A 2H4HA 5DYYA 2N0SA 1A82A 3L77A 1YU9A 5JSZA 3B5EA 4GL2A 3I73A 3GLTA 4AJ1A 1ULBA 2ZIVB 1EU1A 4ZT3A 1AG9A 1PT5A 3NNNA 4IF6A 2ETVA 2PA0A 2O20A 2YJ4A 3KXLA 3L6UA 3QUTA 1BKYA 4YJ3F 1E3JA 1X2EA 3LUJA 4J91A 4EH1A 4F56A 1U1CA 1SCKA 1SKBA 3Q3CA 4YCCA 1OV4A 4FGZA 4HWTA 3GNLA 3ZQ6A 1KQGA 1JP7A 4I9GA 1LPSA 3UAWA 2VT2A 3QZUA 4J1QA 4OSEA 1F4LA 5LP6F 3FX2A 3UEOA 3MFYA 5K1ZA 3TBFA 3ZTWA 4ZCRA 5AQEA 3EA5A 1CULC 2ZUEA 4MUEA 3DV9A 1FDSA 3LX6A 3DJFA 1I9GA 1R5BA 1SHKA 3GLSA 2NV0A 2W43A 2YCBA 5G3YA 1O95A 1LX7A 4RA6B 4FCVA 5T41A 3LMKA 3O8BA 1DKQA 4W7HA 1WLSA 2XDQB 3UH1A 3RYCB 1AGXA 3JX9A 3H5IA 1TEZA 1PD0A 2HCFA 3LDAA 5JDCA 1M0EA 2OV6A 4YRDA 2Q3FA 1PV1A 4LRWA 5J47A 4KFRA 4JASB 4O2AB 2Q4DA 4W5OA 3EQ2A 4OSOA 3O8DA 2GTHA 2VPPA 4IW3B 4RCVA 4B82A 5K03A 3KAKA 1HDXA 2J9YB 4UDYX 5D5QA 1L5YA 3X2FA 2FMTA 3AVVA 4XD2A 2A59A 1MLDA 3L8DA 5ADUS 2YQ4A 3RSSA 5KVQA 2OHHA 3R1IA 1TZKA 4LWQA 1KA9H 4QAJA 1C0EA 4OATA 5AVWA 3UB4A 1MD9A 3D3EA 4R2WA 3EFBA 4O1HA 3ZWKA 2X19A 1F0YA 4QYXA 5JD6A 2VZ0A 2WEKA 3T95A 2ZTUA 1DOAA 3ELYA 4JXJA 4PQRA 3PP8A 3RJ9A 3P2IA 1TD1A 4E5KA 1IJEA 3BF8A 4ZC8A 4RVNA 1I14A 1AH2A 4G37A 2G09A 1EUYA 4Q1FA 2UZAA 3AY0A 3KYIB 1VPLA 4OL9A 1E7YA 1OREA 1YDWA 2BCGY 2AZDA 3E0XA 3RAPR 4F97A 1TVKB 4XTCS 4JYBA 1Z17A 1TVCA 5JAUA 3UAOA 3ZIUA 1QOZA 5I9TA 2IEBA 2BSXA 1OYYA 1OROA 3CXUA 5LBIA 4D4LA 5CFPA 1ORIA 1P1JA 3TW6A 1G3MA 1DS6A 1FNNA 3WYBA 2OCKA 5EJ7A 1O5OA 1TLFA 2IGBA 4PLGA 4MLDA 1P33A 2XQVA 5CVEA 3UHAA 3PHBE 4HWOA 4KKXB 4FHGA 1FNBA 4MUHA 2ZIXA 4RGVA 1ORVA 1P31A 1QKJA 3EFEA 4G0OA 4G0VA 3NJRA 1P7PA 4DMGA 1O97D 2FFBA 3QTLA 2ERYA 2EFGA 2ACVA 4U3JA 1AV6A 1UBMS 2NUAB 2AZTA 1ZG3A 4BVJA 3LM8A 1UEXC 2HRRA 4I8XA 1EVJA 1GPWB 2JIPA 5L3SA 5LD2C 1WEKA 2LV8A 4QWWA 4WY5A 4EY8A 2Q6IA 5AKIA 3W5UA 3CLHA 1VE5A 3WISA 5L7YA 1A8SA 4XGKA 2PUDA 4U2CA 1Y1PA 2NV2B 2J0QA 5T6MA 1K7XB 1PQPA 3L7CA 1P9LA 2AJTA 2QLNA 4IUCS 2H5LA 4WERA 2GHTA 1JJ7A 5TDHA 8ABPA 4JCCA 4RVHA 1IEXA 1H2XA 2J67A 1I10A 3CVJA 3GA5A 3LT4A 1Z3CA 1XE3A 3R8CA 4B74A 2H7YA 4D4MA 2W98A 4NE9A 1AN0A 1XIVA 2EGHA 4BB6A 5I3CA 1N9ZA 5FI0B 1JLMA 2YQZA 5K0BA 5K0JA 3SJCA 2CXXA 2ZYUX 4R1MA 1QS0A 4NIMA 5JPDA 4ODIA 3AFOA 4HAZA 4FZJA 2C5GA 1FB5A 1DJPA 3HV0A 4OD0A 4MXDA 4P1ZA 4QQFA 4RPLA 1YH3A 2QAJA 4MWDA 4DLWA 1EWYA 4HGOA 3AEQB 1N5DA 3RYIB 2CE7A 2ZJ6A 1CV2A 1BWPA 1DJOA 1DKMA 3KKKA 3PGXA 2VWGA 4QIHA 3S5UA 1M34B 3I8XA 5LYJA 2J08A 3ZWYA 5K0TA 2QL9A 1Q84A 3ABZA 2PL5A 4M99A 3BKXA 3Q8WA 4X7RA 5LXTB 3CO5A 1N77A 1Y6FA 4EG5A 3PGLA 4QBGB 1N2BA 1CK4A 1KK1A 2EKLA 2P6RA 3CPJB 4MQBA 2W6CX 2IOHA 3BT7A 4BGDA 1USIA 3BTSA 4XWOA 1MEEA 3ORQA 1Q2UA 1NUQA 1O5TA 3CZMA 3SCZA 3V8MA 4RQBA 2CXHA 3H87A 3M3HA 3VUEA 1FLDA 1V6AA 1XQ9A 2H4WA 2F8MA 2W2KB 4WLFA 3RGGA 4ZCIA 3K0SA 5D5HA 1PK8A 2C1ZA 2FFAA 3E48A 1ZMBA 2W2PA 4N1AA 1V0JA 2JIOA 4QXPA 1SG0A 2PXHA 3ZXXA 4CL2A 1JB1A 1JE0A 5LA6F 3KAQA 3KHTA 4F84A 2XIJA 3HFRA 1KYVA 4YWJA 3QEMB 4YRRA 3OKFA 4L16A 4EI9A 4AVYA 3NWOA 1P81A 4LRQA 5E8JA 5CDGA 3DZFA 4ISBA 1DDIA 1F2VA 5G1NA 3KT8A 3DBLA 4E08A 3VISA 4IV5A 1E9BA 2ZQ5A 2XCLA 5DN6D 2RC5A 3PITA 5EHGA 4B3TB 2DHEA 4NFLA 2APJA 2CFCA 2ZT7A 3G17A 4DOMA 5F35A 2C4VA 5E4TA 4JI6B 3SG0A 1JDPA 1P2VA 1AKNA 2AR9A 3UKJA 1HQCA 2JFGA 4P33A 4V0LA 3GC6A 1RC8A 1EFCA 4M8KA 2ZR8A 4HZIA 5DGDA 1YQXA 3CKLA 5A0FA 4EVSA 1QYRA 4B3HA 3ITKA 3MJ4A 4PLCA 4CR8A 2YWEA 4I4TF 4TMWA 4TLAA 4Q9JA 2G36A 4IDQA 1HFEL 2A1TS 1VSQA 3O90A 4WOCA 4HDRA 2POCA 4ZKEA 3STTA 1SCIA 3GU3A 2CHGA 5K8IA 1JEYB 2Q3JA 4D0LB 3LXUX 2W11A 3RLIA 3SC4A 5KMGB 1K1EA 2Q45A 4IJKA 3H3XA 5LZ4A 5FLKA 3NB0A 4TKMA 3LF1A 1EFLA 3MBKA 1ICEA 5IWAB 2BMFA 3V4PB 2C0QA 4YCNA 4F4CA 1N2HA 1LKZA 1OASA 1X19A 4J7XA 1L5NA 4EFKA 3GCXA 1YB2A 1SK8A 3DAGA 4TRJA 4WNYA 1ULZA 2Z2IA 3WL3A 1CG6A 2H1OA 2IPXA 4OAPA 2PQ2A 4DLBA 1FFEA 2R1UA 4EHHA 3QPUA 4I5FA 2ANCA 1YHNA 4QOIA 3RU2A 2BHLA 4RIGA 4RORA 3QFSA 5LBTA 1UFVA 1YJAA 1JA0A 4WBNA 2Z6AA 2YHSA 3LHIA 1KO8A 5G40A 4KUEA 1K5GA 5IDXA 3QVGB 3AQ4A 3KLPX 3USCS 3E5RA 3OFSA 1OZFA 2HB6A 1CQXA 2CLEB 2DJIA 2OR3A 1E5XA 1OVMA 2FVYA 3B6MA 1AKWA 3FOCA 3L7AA 4ZCQA 5CNKA 4Q7QA 2B25A 5G1OA 2J41A 4JUBA 4PO9A 1R4ZA 1PT6A 2ZUCA 1Z37A 4HG2A 5DCUA 4ZPXA 1V7CA 2VDMB 4FZRA 2W71A 3OCVA 3GYBA 3UMCA 4EKIA 1S2LA 3EC1A 3MT0A 1E8NA 1R9NA 2VHTA 4IXNA 4YI5A 3TL2A 4BMNA 3F1KA 5AJUA 3VR0A 3QFTA 4EB0A 3UAYA 3U7GA 3GJ3A 5E6RA 1ZQ9A 3E9EA 3ECSA 1EFPB 1L7QA 5PNTA 1G55A 5DI3A 4QTUB 3F3SA 1N9GA 1JIQA 4LF5B 4MS1A 2O7RA 4CN9A 2BKXA 3M6XA 3EGXB 5FOQA 4IJVA 3SXUB 2X7XA 1H9CA 4G5YA 3NRBA 3OIWA 3ORYA 2A35A 2ENWA 1E1KA 1T6XA 2CCJA 2FJUA 3BULA 3EJ6A 1K8ZB 3M8KA 3FCCA 1A5AB 1Y7HA 5F9FA 1HFKA 1BSVA 1IQ0A 1E0KA 4Z2AA 3FJ1A 4PZDA 4O4HB 1PL8A 3H86A 2BH9A 2J3EA 3KYJB 4V38A 2WT8A 3DFZA 4Y1RA 4RNDB 4F3CA 1KR5A 4Y9DA 1AQIA 1OKKA 2PGXA 1UFOA 4K6HA 3I9V6 2BVNA 2CXOA 4DV0B 4HVTA 4H4DA 4GBMA 1JPNA 3EWAA 1KO5A 3L49A 5I4IA 3MWFA 4FLFA 2A9VA 1A97A 1H0KA 2JFBA 3L0IB 5IT5A 4HLCA 3TF5A 4H6PA 2VSFA 3RVDA 2JAOA 1KXJA 3AUTA 1FW6A 1F0KA 1NOKA 2QGNA 4RSMA 1NX9A 5F78A 5HJ7A 4HI0E 1QB7A 3S70A 4WW0A 4D9IA 1I8TA 5KNBA 1LLCA 1EXDA 1ZA2A 4L28A 3UMJA 5L3RA 2QM3A 1YR9A 1QORA 1RBYA 3P4UA 5B3AA 3WYAA 4DLPA 4M37A 4CLEA 2IOQA 1LPAB 4MKHA 4ILKA 1ABBA 3JASA 5WRFA 1GEEA 4CFSA 3SHFA 2H2HA 3HLKA 4Q1AA 1U9JA 2V7VA 3HJHA 3EEYA 5ALSA 3RSLA 3ESDA 1HQDA 2Z98A 2FZCA 3GCGA 1Y4ZA 1EGVB 2D0OB 1ZKMA 2JGJA 3O9MA 3EAGA 3JS5A 4B3SB 5IDYA 1SKYE 2A14A 2O2SA 2ZRKA 1XRLA 3ZCUA 1C1HA 3DZDA 1T4DA 1V3UA 3HJGA 4TT3D 1G5IA 4DA8A 2ZRAA 4ZCPA 1IHPA 1WXWA 4N5DA 1KEUA 3A27A 4JQSA 4LTDA 4U1RA 4J7UA 4W99A 4MWBA 3V7NA 2OZPA 5L6MB 5IXSA 1HZJA 1OX5A 1KYQA 2X8LA 4FYMA 2OM6A 2QVBA 1U8EA 1OZAA 3I0ZA 3RTAA 4FI3F 4P38A 3NT5A 3BL8A 4EBFA 3OVMA 2VEDA 4G5FA 3NRCA 1Y5MA 3CUEF 5UKDA 4JJEA 1C3VA 4DR6B 1YS4A 4X41A 1Y3CE 2YASA 3WA7A 1XQ1A 4NOKA 5JNSA 1A7UA 4GOLD 3UMMA 3KS9A 1E5LA 1XCBA 2A5GA 2BMAA 2PH5A 3QV1A 3VPDA 3SFTA 2PUTA 4ES6A 3IAXA 1N4DA 5DLQC 5A4MS 1MG0A 4K9QA 2GPJA 2R6JA 3B12A 3WX0A 4B6GA 2Z5GA 1ZIXA 3IBCA 4B31A 1L7XA 5GZ6A 1RBZA 3NHFA 2BMEA 2RD2A 1R0LA 1ZN2A 4JXKA 2VYFA 4UEOA 1DADA 5BWBA 1ESMA 3AWDA 7MHTA 2B9EA 3AEYA 3PYXA 5JDCC 4A1FA 4L76A 1ZIYA 4E7OA 4A0GA 3GJZA 2XYQA 5LP6C 4ZYTA 2HOQA 3MJEA 5JS6A 3I09A 3A8TA 3T7SA 4D92A 2FWRA 3ADOA 1N0VC 2FEPA 2L69A 3C8ZA 3LK6A 4YFVA 4G8JA 4OYLA 1E3LA 1L7EA 2I65A 3IAS6 1BEZA 4PX9A 1KQFA 2Z8YM 1P74A 2JD1A 4AZTA 1MQSA 2QTWB 4XRRA 3EXHC 5LXTA 4TV8A 2QRLA 3FROA 2R6HA 4N8DA 3OLQA 4NV0A 2O5CA 3F3MA 3GRVA 1BZYA 1LPBB 1NATA 4I1OA 4EW3A 4CEHB 1R6AA 3O2NA 2PQMA 2WU1A 2VHJA 4CMGA 4YRTA 5KHOC 2VPTA 1M1NB 3ZOZA 1JHQA 1Y4UA 4K9NA 1KAGA 3IUQA 2WUDA 4JKOA 5BVGB 4LWPA 4X1IA 3C7TA 5B3KA 3CCFA 3WK8A 4WZZA 2C5HA 1PTJA 1PX2A 1AKRA 1FX1A 3B70A 1B93A 2GCPA 1TTQB 3JQBA 4RVDA 1Z4NA 3D0OA 2XDYA 4RD3A 2JGMA 3ZE2B 3S8EA 3WLAA 5KJCA 1XZMA 5E3HA 4DR4B 1D03A 2WFAA 2WMNB 1ZK2A 3I9KA 1UM8A 3WKCA 4CF3A 4JP5A 4OQYA 5I3ZA 1UMDB 1B4DA 4XVRA 3FGOA 3U7EB 1UJ4A 3EARA 3PXUA 3BMQB 4PC7A 1KI9A 5JCJA 3BWBA 5DM2A 3IIKA 5CT9A 5JBNA 1B16A 3ZBTA 1JECA 3EB9A 5HKAA 2C77A 5KVSA 1FF9A 2OHVA 2WWIA 3W8EA 1PLLA 3ZHQA 4YV1A 2RHTA 5ICCA 1Z45A 1SQGA 1Y33E 1UPAA 4FOPA 4AT1A 4N0EA 1E5QA 3FYUC 1UZLA 4J07A 1X0XA 3QELB 4ASUD 2JCVA 1TIKA 3PV0A 4J0KA 5HF6A 1Y3AA 4K9PA 4RZ2A 3ZW7A 4ARBA 2GDJA 2C1XA 1DKRA 1PJBA 3MJTA 2Z58A 3REFA 2GAIA 1DIAA 1PZMA 4JAVC 1T6YA 2SCUB 1CY8A 3EASA 1EP2B 1K2VN 3W4JA 3WB2A 3UMSA 4O2BA 2HO5A 1U2ZA 1UUFA 3KZXA 1G4HA 5IDVA 5AIAA 4B3JA 3L5KA 5EIHA 5HBGA 3OESA 4B3DA 1P4SA 3LY7A 1WSBA 2WZBA 4LGCA 5AKLA 2X41A 4HOYA 5AHWA 4IH1A 2VDQB 3VHLB 3K6SA 1FA9A 4UU7A 3MPOA 1ZU4A 4HYQA 2GRAA 3EEBA 1DDGA 4MVJD 2BISA 3JVEA 3L05A 4QASA 5F2KA 4F8EA 4RK0A 5FL7D 3H04A 3QVXA 2AG6A 1U0OC 1YC2A 1S89A 2I7TA 3QFFA 4Y67A 3SWWA 4IY1A 4YJKA 3P9CA 3ZE8A 2B4RO 4N6OA 2WPDD 5EPUA 1DG3A 4RDIA 1ZWKA 4N8EA 4OQDA 3W1VA 4C7JA 3J80A 3BQNB 3DE1X 3ZE9A 4TTRA 3QTTA 3A6LA 1UADA 1JYEA 2HBRA 2AXNA 3NORA 4MVXA 4N6GA 5ABPA 1DAGA 2HIHA 3R0QA 3QRWA 4HQFA 1YGPA 1Q91A 3W6NA 4W1RA 1QKKA 2BY4A 3KTOA 5LD2B 1M8JA 5TPZA 5JAHA 3G1WA 3DAPA 1Z5UA 2EQAA 2QENA 3CRMA 3HU1A 5J4LA 3DLCA 3I9V1 3ZWXA 4W5TA 1QIIA 1SHJA 2G0AA 1QWOA 4AWBA 1Q17A 5CHEA 2QTLA 1K6IA 4BVLA 1GYRA 4WESA 1GV0A 3IDSA 1K3FA 1CS0A 1M0SA 2CL5A 1P1HA 1VSUA 4CL0A 1KVUA 1QNFA 2PRIA 3KKOA 3VU1A 1W76A 5AJXA 2ZAIA 1KJ8A 4F6CA 5KOIA 3BZUA 3V48A 1KAMA 2PT7A 1KY3A 2GESA 2CT8A 2PKQO 4IXWA 5K20A 3KQLA 4I81A 3QFRA 2X0DA 1KIMA 2GLXA 2YWRA 1TFRA 4PYLA 3W6PA 1KI4A 3N8IA 1MW8X 2FSIA 2ZTLA 2IBTA 1H6CA 4P5DA 1EB8A 2QX8A 4J6EA 3FRIA 2B94A 3PVCA 1ZNXA 3LH5A 5EJFA 3C5HA 1M66A 2GVDC 4OUDA 3WYEA 1T36A 4HTFA 4W5QA 1Z7GA 1GZUA 4RHUA 1BCSB 3QLVC 1YR8A 3TGWA 3INRA 3W04A 3T7KA 2PZKA 4EPTA 1BQ3A 2H5IA 5HIMA 4ALNA 4DGSA 5K51A 4CV0A 3LTNC 1FDOA 3DUFA 3OM1A 3O8OA 5FTJA 3HSSA 2HYIC 3NIFB 5KAMA 1SCUA 1LRJA 1W2WB 3LOPA 5IDWA 3O8RA 1N6PA 3GLIA 1L7BA 2O2GA 1VL6A 1D1SA 3H8WA 3KZ1E 3U80A 2Q0QA 4CMHA 5JROA 1Q57A 3FNIA 2HF9A 2WD7A 1SVIA 4ALJA 1U8ZA 2V0GA 4L08A 2VHEA 2ZUWA 3K1TA 3WBJA 1ZSVA 4INOA 1EE2A 2O7NA 3KOXA 1USKA 1N2CA 2AJCA 5CFNA 5LIRA 4LK3A 3VKVA 4RJIA 4NDAA 2ZYSA 4BJ1A 1BX1A 4JQYA 4ZVPA 1IATA 1GCIA 3TOSA 5T6BA 5TPZD 3T3PB 2ZG6A 1IM8A 1Y1QA 2X9GA 2Q2QA 4L8VA 4OBEA 3WWCA 4CLOB 4DCTA 4JVLA 4MV8A 1X39A 5H4GA 1CR6A 2IJGX 3LK7A 1N0IA 3AL0C 3NNDA 3RS4A 4B47A 1GUDA 5EJEA 1CQPA 3GLHA 1TZBA 2Y1XA 3I76A 3HP1A 3QU9A 2O8VA 4TKUA 5TF4A 1NHWA 2G9NA 3EEOA 2CXSA 2ZWPA 3U4HA 1P72A 2Z04A 5AJVB 3LRPA 1TK9A 4I9NA 5AW3A 2KSQA 1UC5B 4AROA 3TRJA 2BHRA 4NBKA 3G2IA 1AUOA 1UAGA 3EAFA 2O19A 2A1UB 2XWPA 1BE6A 4O4IB 4P93A 3CR8A 2P9FA 3OQHA 1CP2A 5JUWA 3TDKA 1FFYA 2YWCA 4DV7B 5A03A 1YQQA 1YRLA 3CH7A 4TKUB 4UXJA 5JCZA 4KX5A 4DA7A 3LWZA 5AVOA 1FQOA 3HZOA 1D6JA 3DXYA 4RCYA 1ZVQA 3IO5A 1RLIA 4K40A 1UC9A 5ADVA 4EMTA 4HNHA 4OP2A 3HCEA 1X9IA 4C21A 2G5CA 1EAMA 3PICA 3UFXA 3U44A 2PMBA 4YBRA 4YMIA 3N6VA 1U04A 2ZRPA 2G5GX 2JHPA 5EIAA 1QCCA 1Z6YA 4COKA 1RIIA 3JQBC 3RC2A 2FKAA 2FR8C 4LXYA 3ETHA 4RTQA 4UD2A 2V7WA 2HJSA 4RJKA 3PTZA 3RHTA 5GADl 3DOUA 2C92A 5CFQA 2OXCA 4JMLA 4UM9B 5KVVA 3QQ5A 1UBTS 3LCVB 2OCYC 3WMXA 1A72A 4L8GA 3DSRA 3I32A 4M7OA 5C7YA 2AN1A 1MO5A 1KZGB 2YYZA 3TD2A 4BRWA 5ALPA 1HRKA 1WXXA 3ZIAD 2GN1A 1USGA 1OXSC 1D0IA 5SYMA 4O29A 2O8NA 1ST2A 2VAMA 1KHTA 3SZLA 4AF8A 4EJ0A 1XZJA 5I9BA 1R0YA 2ISSD 3UWOA 3C74A 1N5JA 2XUAA 4QU0A 4X7PA 2DKOA 3RU9A 4DXAA 4XVQA 1YS1X 3HVHA 1ID8A 4TLDA 2ZJOA 3CY6A 4JS0A 1X7ZB 3ZWWA 1L5KA 2X14A 1NXWA 1PG5A 1JFLA 1CUBA 4H6VA 2ZS7A 3DV0A 2FLKA 3BWDD 2Z4SA 4FMCF 2CEAA 3OHMA 5REQB 5TQ2A 1JIXA 1E60A 1K88A 1GYPA 1I3KA 1KP3A 4R1NA 4CYMA 3U49A 4KC0A 5K0ZA 1M5TA 2QF7A 5CA1B 2HR1A 4HWRA 4GZLA 2A7XA 5AK0A 4Q9DA 1NE2A 1FDRA 3J81A 3K70D 4H3KB 5LZ9A 5ALZA 2IZOA 4GSYA 3I04A 1D8AA 4YO8A 1H2YA 2F3QA 4PPYA 4F86A 4UAVA 2I03A 1Q0SA 5KPJA 4LEIA 4P4NA 3ZU6A 1B8VA 2JH9A 3ZXUB 4ZZ2A 1F8YA 1QOQB 3TTTA 2R8BA 2V5AA 2E0IA 3K4HA 1Y0BA 2ZJ0A 3AJRA 5D3ZA 2F9LA 1B3RA 1DBWA 1NFQA 3CLVA 5EMLA 5KTNA 1NXXA 4S1VA 1RRGA 3K8ZA 4CKBA 4IOKA 4KZPA 4RLHA 3OSZA 1LVUA 3H42B 1KK2A 2VAVA 2VHUA 3K9QO 3S6JA 3TQTA 2JVKA 3A58B 2ZXEA 3V2GA 4AMYA 2B61A 3K0CC 3NYQA 4TMTA 4ARVA 2WYUA 5M3BA 1SIWA 4S1TA 3ZXYA 4IUBS 1DXYA 3GLUA 1SCDA 4IIHA 3PSAA 1TYBE 4DWJA 5K0EA 1BJRE 2JARA 4R16A 1PRYA 1UBGA 2HJVA 2XBUA 4LCBA 4QLAA 5JZVA 4N41A 4ENWA 3HMKA 4ZMRA 3L01A 5DYWA 4D8UA 3P19A 3QVGA 2B99A 1T1GA 3A1CA 2RK6A 3PCTA 1RLJA 4GMHA 1DAFA 2IS6A 5EJMA 4B40A 1OVGA 4KZKA 4DCUA 3GLFA 3PEYA 3FVTA 5NULA 5IABA 4O4JF 3S81A 3BXHA 1OFGA 2HSEA 1VCHA 3ICCA 1ABEA 4P34A 3NM5A 1TVKA 1XRQA 3AP3A 3PZRA 4RQUA 1R9GA 1KMCA 2OV2A 1O95D 2PNFA 3ER6A 1Z25A 3TMAA 3X44A 1AB5A 3ZU2A 4E21A 2J3IA 1CERA 1WCWA 1Z6AA 3EXHB 1M6YA 1SHUX 1ULUA 2NZWA 1UKVY 1RVV1 2EATA 1AT1A 3GDOA 3LAWA 3PFGA 1ZOPA 3QNMA 4DDWA 3FTEA 2NU7A 2Z8YA 2XXJA 1RRPA 1VRCA 2GUWA 3IH5A 4Y6GB 4M86A 2ZBQA 4MUKA 4PN7A 1WB9A 1E62A 2ZUDA 3B5IA 1BS9A 1J9GA 1MENA 3PNLA 4JLPA 4N18A 2FQQA 4E3WA 5K8VA 5TC4A 5DM0A 3TRFA 2VJCA 1UMCB 4WCFA 1OU4A 2HSGA 4JUDX 4AF7A 4B2YA 5JISA 2F8TA 2ZWIA 5H3HA 4RL6A 1MJHA 2QD1A 2AW3A 5K9ZA 1HURA 4PVDA 5CT8A 2M9MA 4D45A 3WQHA 2B0CA 1AQYA 1V48A 1RKQA 3CFYA 3AHIA 4D8XA 2DPGA 1QP8A 2XB6A 3KJXA 1UPTA 5I6DA 1EA7A 3H2KA 4B73A 3KFXA 4RX1A 2BR5A 1LC3A 1QMGA 1YSCA 3UWSA 4AY2A 3SPXA 4LVNA 1ZVJA 1PTKA 4AG3A 3QP9A 1X7ZA 3PC4A 3R20A 4P81A 5U4QA 4LVCA 4BFLA 3NC4A 4PFJA 4ZO4A 1E3WA 3TJMA 1JV2B 4B3XA 3OI7A 4DNXA 5JZ9A 1YF3A 2GNOA 4ZO8A 4A8JB 5CB0A 1G6KA 4NK4A 2O2DA 1P8AA 2GAAA 3NYIA 1CYEA 1RJ9A 4CKCB 4BNFA 4J4HA 1IAQA 1ZHHA 2VYNA 2HYDA 4IKEA 5BN5A 4UOEA 3LVBA 4XEUA 1CBUA 2Z2XA 3IKTA 2CMFA 2DT8A 4RPKA 1XMQB 1AMNA 3VJLA 4KFCA 4AZ0A 4JROA 4ALIA 4C1NA 1OH5A 4X92A 2XX3A 3H75A 3VVMA 4OM7A 5MN6A 5TMDA 2JS7A 4DW8A 3MJDA 1ZIPA 2H1HA 2QTVA 3E1SA 2P9HA 1FJ2A 2XGGA 3UFBA 2HA6A 2VBIA 5K8CA 1YA8A 1N2XA 2RGYA 4DYVA 1OTYA 3V7UA 4NEHB 4B0PA 1VSTA 2BEUA 1DHRA 1UJ5A 2A88A 4B7CA 2PRKA 2QT1A 5G41A 4BS9A 3F6CA 1R0SA 4NX2A 3FLMA 3BXXA 4DDKA 3I01A 3S0JA 3CR7A 1A95A 2CLCX 1G5TA 4IVPA 4RABA 1W5AA 1NRXA 3G1UA 2WWHA 3H5NA 4RFLA 3D2BA 3O94A 4CIWA 1J42A 4TRRA 2IQIA 3OFKA 3TTUA 5KYYA 2I6UA 3QXSA 1M1ZA 1ZP6A 2WYOA 3Q7IA 3QG1A 4LSZA 4WZ6A 4LXIA 3GEDA 1A5SB 1YVRA 1PEKE 5JS7A 5THQA 2RGUA 3JAKA 1MX1A 4YQEA 3KSBC 3I6YA 4CV2A 4DM3A 2XNSA 3Q0EA 3TPZA 4D8TA 1TYCA 2OGTA 2M1ZA 3M2TA 3ZU4A 2P9GA 2XDQA 1F3LA 5GJCA 4OK3A 3RTEA 1TMGE 5B4VA 4QU9A 3K92A 4NNJA 1OA1A 1TCBA 1Q1BA 5C2JB 3WYDA 2YW9A 4XGNA 1GR1A 4M0EA 1T6BY 2LRHA 3RSFA 4Q4CA 4C0XA 4U02A 5CYGA 1CVRA 1MPXA 1OGJA 4XYEA 4D3YA 1MX3A 2RH9B 4F5EA 5JWRA 3K0HA 2O2EA 2ZVPX 4FX5A 2PU5A 3BRWA 3CEJA 3W8RA 3R5HA 1XRJA 1V11B 2VVTA 3QU2A 4KSYA 5DGIA 1AM4D 1DTWA 1R4NA 4EBBA 3B7PA 1G5HA 1NJSA 2J9FA 4KQ6A 5ALHA 4B33A 4B71A 3BJRA 3KXDA 2PO7A 4TKVA 3I5MA 4UTXA 1RE0A 1N5RA 2XWJI 5DGTA 5ALYA 1AOXA 4OPMA 3SQLA 2BYTA 5FJJA 5BV8A 5JEEA 1W88B 5HGXA 4RD1A 1F2TA 1P9WA 5HCNA 4TGLA 4IFBA 2RGDA 1RW4A 3MS7A 4Y2QA 3V2IA 2RHJA 4UNPA 3T9CA 3MCVA 2QZSA 4TL8A 3FOWA 1HT2E 4U2EA 3WDSA 4U7FA 1NR1A 3NP7A 3BMNB 3L1KA 3FHOA 5JSQA 3F6RA 3P9YA 1EXMA 3VOBA 1QXSA 2IUYA 4FEYA 1LQ2A 2QTCA 1QK4A 2GPNA 3H1FA 3K2QA 4PR3A 4PYIA 5T67A 4IDNA 3SKVA 3OZ7A 2I8LA 1XJ0A 4HT3B 2YH2A 4EPRA 4NOMA 2XE8A 2OCPA 3A32A 1VKOA 5C8YF 4Z9XA 1A2BA 5HKLA 3QE3A 3V4RA 1ND5A 3GCDA 1I6LA 1B0PA 4HDMB 5K0LA 4DVGA 2P91A 3CX7A 2R6CA 5C3MA 5IXJA 4LS3A 4P86A 5SY9A 2AIRA 4Q7KA 1J24A 4QDJA 3JRNA 4JC4A 1AF4A 2PYZA 4IJMA 1W2GA 3FH0A 4HLQB 1EHCA 2HU2A 1H8ED 3BCSA 3T7AA 3WDMA 4I4LA 1DOZA 5DCWA 1HR0B 4AJLA 3A36A 5DT2A 3FAZA 4DIEA 3GRPA 3CVYA 3BQ9A 5ITVA 1UP4A 5AUQA 3Q4GA 1XL0A 2PSHA 5DBFA 4ER5A 1J06A 2QROA 3VDMA 5CX4A 3TN7A 3PXDA 1DC7A 3GLKA 3RTDA 3WQQA 2Y6UA 4URVR 1CY1A 1PGOA 2MSKA 3ZY3A 4RVFA 2YY5A 3EFOB 3IQEA 2BOVA 2VF8A 3DR5A 3JQQA 1IK6A 1L4FA 1N2EA 1O6FA 2FOLA 1QDEA 1IONA 2NAFA 2GJ8A 2PHZA 4B3RB 1EFVA 2OHIA 2OZVA 1WBBA 1JNYA 2I29A 1ESNA 4DCMA 3C45A 1TPYA 4OMCA 4J8PA 1T9HA 4C4SA 4AJHA 3VKHA 2VKTA 1JR2A 2RH4A 4WNIA 4XQ0A 1XELA 2RG1A 2EQ5A 1CUCA 2O5EA 3JAKB 1Y5LA 1RU3A 1NNSA 1UMBA 5KDLA 2GCGA 3BFVA 5CUQA 3KWFA 4HH1A 2DGDA 1C9KA 3K35A 3DC2A 4DCCA 1A8UA 5SY4A 1U8TA 4XCXA 1LNQA 3PEFA 5CX1B 4K3VA 1E1QD 5FULA 4BIIA 1K98A 4EUKA 5B1HA 4KLCA 2MDTA 2JI9A 2QP4A 3A9WA 3OIVA 4LOAA 3QVTA 1GG2A 3KVYA 4KQXA 2D2XA 5FBRB 4UEJA 5FT9A 4AJPA 3GFQA 3VHXA 4L3WA 4KFTA 4RHEA 3E8XA 4HDKB 3W1WA 1WPXA 1CZHA 1V11A 2DFPA 2Q4RA 3A1SA 2FQ1A 3C41J 5AHKA 4YMTA 3MTJA 4ARCA 1PQWA 1EP1B 5GV7A 1UBNA 3ZV5A 4CTOA 1SC4A 5AP9A 1U2DC 3F9CA 3UAGA 1IBRA 1ZOLA 3D6UA 1KKUA 2Q5EA 5CX1A 3WR5A 1KSJA 2IODA 1MB4A 5J4YA 2ZE7A 5KSZA 1IBLB 3EBPA 4S35A 2QTAA 5HKOA 5IC4A 1U8CB 3EHDA 5EE5B 4HVCA 1R4MA 1OWPA 4KAFA 1G2IA 2A0FA 4XDHA 5F98A 2IYTA 4MGZR 4HB4A 2CNKA 8OHMA 2Z9CA 1V45E 4IDAA 4IG4A 1D09A 4G25A 1ADBA 2DXIA 4K2AA 4D7AA 5IG2A 5TY0A 1XDSA 3Q10A 3ZK8A 4J0IA 5FBQB 3M6UA 4IIJA 4C3VA 3W5BA 2O0JA 3OUZA 1E2MA 4F93B 4H60A 1G9XA 3PPYA 2X7HA 5KHAA 5AM2A 3E1GA 3JZAA 3DT9A 1QG2A 3M33A 4MWOA 2V59A 2LWIA 4JLAA 2WWGA 1JFFB 5AKYA 3HH8A 1UBUS 1RJFA 3S2SA 5K3DA 3TYXA 1X1AA 3HY3A 5A3RA 1TQDA 3ABRB 3KYDB 4G01B 4GR4A 4C2BA 3C3XA 3K09A 2O8BA 3H11B 3G6WA 4GQAA 4QFBA 3TQCA 4E30A 3H5LA 2A33A 2P0EA 1ZNYA 4R9SA 3A6FA 2FSVC 1M1XB 4JK3A 4C6TA 5AI5A 2CWWA 1BS1A 4DMHA 2JFXA 3AOEC 1QH9A 1T5LA 2WKRA 1Z4LA 2HQ1A 2N1MA 3HI4A 1LZLA 1PLKA 2Z30A 3PXGA 2K7FA 2HQSA 4BU1A 2DHDA 1GM5A 2Z6QA 4K2HA 1H42A 3UB2A 1Q3HA 5JG7A 3GJ7A 4QO8A 2IL1A 3K5PA 3B48A 2A9RA 1FJGB 2QYHA 4YX9A 2GRUA 4WJZA 4B4UA 1E7QA 1CRPA 4G5XA 3KEFA 4C7MA 3EEFA 1NNEA 2RGXA 3PHGA 4OVKA 3X1KA 4WFJA 3LC2O 1OB5A 5G4KA 5D01A 3NBZC 4QXOA 4R98A 5FWDA 4O4JA 4D44A 1TJYA 1Z4MA 5EJ4A 4Q34A 1H3EA 4JGBA 2WKWA 1KEZA 3EMVA 4BRZA 4KRFA 1DQYA 3AP2A 1RQ7A 2LTAA 4ZYUA 4PSUA 1EUZA 3H0KA 4EUSA 4Z8YA 4AB1A 3VGJA 3ZK7A 2X6TA 4EG7A 4RKEA 2C00A 1EX9A 4ZRMA 4MA5A 1A2QA 1E1CB 3H05A 3PFFA 4IIFA 5TNXA 2C9YA 3E7FA 3FMPB 1XTRA 1ZD2P 1RLOA 3BX1A 4YGXB 5DX1A 3RJ5A 1A7JA 4GYJA 4X1KB 3WLFA 3UIEA 1Z28A 3QOYA 4EITA 3VNQA 1QQ7A 1RFLA 5I7HA 4IIXA 1N3IA 4Z1OA 5GZ3A 3NR2A 2HSJA 2NP7A 4U6SA 3ROEA 4LK2A 1G20B 4BQFA 3M4YA 2QTZA 3G85A 4F96A 2V7QA 5LC1A 2O3SA 1KDZA 5I5EA 2XECA 4Z3KA 5DEOA 5DTIA 1ZS9A 1C1DA 1F8XA 4GS5A 3ROKA 1K6XA 2DG2A 3K2BA 5AXCA 2PD3A 2HLNA 2WM2A 2G6BA 2P4QA 3T1TA 3NHSA 1KIFA 2JGEA 3PC8A 2NIPA 3D6VA 4MRMA 4MHSA 5DB4A 1JN0A 5DLYA 2P79A 3GFTA 1CE8A 4ETMA 1JDTA 1BQEA 2BLLA 4Z1MA 5EKTA 3TLXA 1RS0A 2FZWA 3ETDA 4AICA 4C78A 3SM3A 5JU6A 2QRKA 1OPRA 2YXNA 4F72A 3BXOA 1LQTA 2LZ0A 2YOHA 1DP4A 1V26A 4L4RA 3G7SA 4BAGA 3VSEA 4MI9A 1HE5A 1FDWA 2ID7A 3OOSA 1VKJA 2W42A 4DSTA 1WMEA 2J3MA 2G08A 1MO2A 2UUCB 4QJIA 1J0XO 4QDXA 4D82A 1QCYA 4I1PA 2RKOA 3KETA 2PSSA 4Y2XA 3ZY2A 4X95A 3JQEA 5FR2A 1DUIA 4O63O 2Y05A 5FI1B 3UC9A 4G5HA 2FN8A 1IZ0A 2GILA 5E2AA 2VXYA 1O08A 1G3UA 2IIQA 5GTDA 2CDAA 3V9PA 4EMUA 3HHEA 1SRRA 3LC0A 4NSNA 1NRJB 5ERYA 3O2QB 4KPFC 5E1DA 2QLTA 2VZ8A 3OY2A 4UVEA 3UUFA 4N3BA 4WHMA 1ESDA 3DLIA 1XN4A 1YS2X 5KWEA 1H1LA 3I0NA 4NK5A 1LU9A 2VN8A 3U3OA 4CKYA 5DBHX 1KZ4A 4P32A 1JU9A 1RT9A 2ZIFA 1OY1A 4HN4B 2ZT6A 4KX3A 2ZTMA 5DFAA 1XZ8A 2VWHA 4FE7A 4WEQA 5IAEA 1SXJD 2I3AA 3L2OB 3MJHA 5C1IA 1S2GA 5AKXA 1HE4A 2RDMA 1Z68A 3PDIA 4G84A 1OWNA 2EWMA 5F77A 2JHCA 5LUBA 4PNHA 3VH2A 4EGQA 3O75A 4FNAA 2H2GA 5E7QA 3M6MD 1SHZA 2I6TA 4NPAA 3EZFA 1YE5A 2GCOA 2QI9F 3K32A 2GETA 3MMSA 4YACA 2HTFA 3W7BA 5CDFE 2YV1A 1XMPA 3EHEA 4DLZA 1G98A 4RACA 4FR2A 4OK6A 2YKGA 1VYVA 1Z7WA 2WKPA 1VCNA 3L7JA 4GRDA 1IG3A 3ZHXA 2YZMA 4DCNA 3L6EA 3KR2A 4QEDA 4RUKA 6REQA 1GU7A 4URWR 2WQ7A 1C0PA 3IAS1 2V6JA 4FFBB 4Y1EA 4GWLA 4GX1A 1QHHA 2XR1A 2OO5C 3DHVA 3JAWB 2AD1A 3L0OA 4YPFA 3F6BX 1T9ZA 2R86A 3RUEA 3WJ2A 4BNIA 1T8RA 1XVVA 1CNFA 2OCAA 4H6XA 4Y2TA 4XJSA 2B7CA 1F2DA 2B6NA 3TIXB 4K9SA 1ZOIA 2FLVA 3DEAA 4CMKA 1LDNA 5B1DA 4PZPA 4KXXA 2EKQA 4LV6A 4KV9A 4N39A 1CW2B 2O2CA 2XNKA 3OE1A 1ML4A 4MW9A 4XA8A 3WLMA 4DCGA 4F4JA 2PR7A 3R3XA 1NZJA 3O3MB 2MCFA 3C3EA 1S1CA 3ZI4A 3TQIA 5FJIA 3DE0X 1NMEA 3IMKA 4B32A 3PE6A 5IK2D 2HF8A 1WG8A 1PJRA 3HO6A 4L4ZA 3LLMA 3ZGYA 1TU4A 1TM4E 3KCNA 3U17A 2FG7C 4B84A 2ZIGA 3VR2D 2PKXA 3EYWA 5CCBA 2VK8A 5CM9C 5I7VA 2O2IA 2WC1A 4QHTA 1JTFA 1RKXA 2WUFA 4HQ0A 1U9CA 2BKEA 3PSHA 3UPUA 4JI8B 1KDOA 4KQJA 4NZYA 3VA7A 3AI1A 2ZYWX 1ZBQA 4HDKA 2IXGA 1YR6A 1YAJA 5D6OA 3T6KA 3PPXA 5DLPA 3OCCA 3OFND 4HPJB 3WQBA 4ZEMA 4FLEA 2HTEA 3G5UA 1FP7A 2H2AA 4GI3A 1CZRA 4CG0A 4EIWA 4MSUA 4JLMA 2GYWA 1R4AA 3QTBA 4ICIA 3KR9A 2ZYTX 4IM7A 1EDBA 1TAGA 2ZUVA 4QFMA 2HHCA 2GAOA 5LZ7A 4U9HS 3S2YA 4B7UA 4DNQA 2BV3A 4ER0A 1YBMA 3L7MA 1YI0A 4G0NA 4JA2A 4BNMA 3DT6A 3ZX5A 3U9SA 4UD6A 2BTOA 4BPBA 1OT5A 4LZLA 2E48A 1V3QE 4B5LA 3GGCA 1VXRA 2EW1A 1NW8A 4KBYA 5H1YA 1T4GA 1U7OA 2VSYA 2DP4E 3LS2A 4LQ4A 1CB7A 1UBCA 2PWAA 5ECWA 3ERCA 4GEKA 1GT91 5FPQA 4Z4HA 5EERA 4NLLA 2AS0A 4HO1X 1IQPA 2FWPA 1XLTA 2RI0A 3A10A 3GIWA 1Y1RA 4GR9A 4R8KA 4ED9A 1SOWA 3BHIA 4L57A 1UH5A 3D3JA 3C7AA 1ONSA 3HU5A 2WLSA 2PDAA 1XR3A 1E89A 4NYJR 5DISB 1EGQA 1ZD3A 2QTMA 1VE9A 3C98A 4HDNA 4BO5A 1N6RA 1TM1E 3TZBA 2C59A 3EXEA 4QUHA 4UM5A 5C7LO 1Y6RA 4RF2A 5B4UA 4MYCA 2P41A 3C3DA 3HR4A 1ZI6A 2FWNA 2XHEA 2W8BB 1T0JB 1NMQA 1EK0A 3VC1A 4HX5A 2BBOA 1T1EA 1WXQA 2PZFA 4NH0A 5HFAA 1M33A 3NXKA 3O9ZA 4LJYA 5TR9A 3CC8A 4JLDA 5FWAA 3T34A 1DHTA 1R3DA 2YVAA 5G1PA 4AY6A 4K28A 1Q15A 1YFZA 4GOMD 1RXUA 1O95C 2PUFA 1I3OA 4KRGA 4DC1A 1ZD8A 1J25A 4DJAA 3LPCA 1UXOA 1HMYA 1THTA 2V98A 3O92A 1X1TA 1ETHA 2DQSA 5FPTA 3V6MA 3RADC 1JFTA 5AT1A 4QD3A 3LX8A 4AS1A 4TTIA 3D6JA 3S5JA 1GKIA 1CRQA 4TLCA 4QBFA 5HPYB 3OHPA 1HOTA 2Q2OA 4MDYA 4ZT7A 1TJ5A 4MA4A 4IVRA 4JI1B 2IF2A 2PLAA 1DXQA 4X00A 3USES 2IVZA 1JTEA 2PT9A 2W0SA 2JCGA 3EIWA 1W8IA 1U2GC 3N39C 1ZZEA 4GOOD 2HHHB 3N8KA 4YI3A 1RWBA 5B7QA 4FFVA 4ND6A 3ZZUA 3GAMA 3FSEA 1GKLA 1YK0A 4Y7CA 1XQWA 3ACCA 2F3TA 5EC8A 3EIUA 4UTRA 4WBNF 1PR4A 1K8QA 3KLNA 5FTKA 1ABFA 1A9PA 1ONOA 2ZCUA 4FE4A 4R7TA 4BNYA 5J3JA 4XX1A 3GPIA 4UMFA 3IP8A 2Q8QA 4MEJA 1H94A 1TYEB 1QIEA 1FP1D 2J59A 3Q5GA 5ARDA 4ENVA 3NHBA 3QKUA 3IAAA 2DUWA 1E94E 5A6VA 4INPA 1KZ1A 4GPD1 3FPBA 4FR5A 2HIAA 2K6GA 2JIZD 4U3JB 4GVPA 3DXXA 4YMSA 4RBNA 1GU0A 3AM5A 5C31A 2XQGA 1RWVA 2JLBA 1RLTA 5E6SB 2HPHA 1SKYB 4QTTB 4XM2A 1DPGA 3C6KA 3T9EA 2HSDA 1YIOA 2WIDA 4Q03A 4L4XA 4HWPA 4HLNA 4IDFA 4ZDJA 1ZJ4A 5AOCA 4UQLA 2JLSA 4XQ9A 4YY3B 1YDEA 1Z62A 5ICSA 2Z1NA 3LQQA 3PB3A 1GTZA 4YAUA 3KAPA 2RAPA 2LW7A 3ZXSA 3K70B 2Y92A 3AF1A 4JD5A 4P82A 3O8CA 5K01A 2SECE 3WSVA 4QNRA 1JLSA 3MQ2A 1TKRA 4TN5A 2XAUA 2ZJ2A 4UE3S 1C9YA 3NHAA 4AECA 1GUBA 3A3YA 1MOZA 4ZIRA 3UPDA 3Q6IA 5FUMA 3X1XA 1THMA 4C87A 3F6PA 1VDZA 2CDRA 1CUEA 1J5PA 2BKUA 1YAHA 1A9QA 1DBSA 1HT3A 1O4WA 2HA3A 2JC3A 1P2BA 3E81A 3HJCA 5U1PA 2ZTHA 3TLGA 4AS2A 3SF8A 3TCKA 3GLFB 3EPKA 1NPTO 1QFMA 2WD7B 2YWBA 3WADA 1AMUA 2WIAA 4O2BB 4QHYA 1IXRC 1SUCA 5FUVA 3OPVA 5FNZA 2ZWOA 3GAFA 3NVAA 2W6ID 2QM8A 4YP6A 2C4WA 1IZ8A 2W2MA 4X6UA 5KJEA 3S68A 1PUJA 1Y9AA 1U02A 4TQAA 1UKCA 1XX6A 5CLHA 4KDEA 3GY0A 3ZV7A 3IALA 2VTVA 2P0AA 4KHZA 2J85A 4E4TA 1GTL1 4L0MA 2WV7A 1NSTA 3V42A 4N0QA 4IFEA 2FRXA 1AQLA 3QKSA 4TZKA 5ED4A 4P5PA 3UUGA 1IYZA 3RFTA 3M5PA 3Q1KA 1EP9A 3QLEA 4PX2A 5FO1A 4RF4A 1J8FA 2XB8A 1TZMA 3CEMA 3GHHA 4MEAA 3W9UA 2JCXA 2J3JA 2J5KA 1OFIA 1P3DA 2BMWA 3C4VA 3DW1X 3TKAA 4ENRA 5CAEA 5KYUB 3A11A 2JRCA 3PNBA 1NBME 1YVPA 3IIIA 1GG8A 1TAQA 3LP5A 4CMBA 3T5GA 1QGZA 1H66A 4ZK2A 4H7EA 5C51B 1R6VA 1IMJA 3FCUB 4KIJA 2F48A 2DLDA 2IHJA 4XE5A 5AJYA 5LQCA 2EEZA 1LS6A 1N1EA 2GDZA 1SOAA 3LFUA 4OCZA 5F73A 2HWXA 5GJWC 2B3DA 5EHQA 4NU5A 2X0NA 1GAEO 4E7PA 4FN4A 1RC1A 3N53A 3HDGA 3AH8A 2ZBVA 3ZK9A 1QZXA 4RV4A 4IINA 4PC3A 4ZOAA 4AKHA 2H1FA 3H8VA 4J43A 5EFZA 4CTJA 4ESVA 5TGDA 3C8UA 2JKVA 3Q0IA 4WCFC 4D74A 1FEZA 3WHLA 2EGUA 4F8YA 4YJGB 3DLBA 4NZ9A 2IYXA 5K2OA 2Y2UA 2AQ8A 2WTNA 4WXPA 4CKCA 3H18A 3G5AA 3PEVA 5I7EA 1U1GA 4MGHA 3RVBA 2QG9A 4TYYA 2Z2JA 2ONYA 3BH6A 4D8WA 5DM1A 2R1ZA 4YCLA 1ACLA 1L5QA 1YACA 1J2JA 3IUEA 3QBEA 2DHRA 3BTVA 4MVJP 4AUMA 3B1WA 2FN7A 3FI9A 4PNEA 4FM9A 1Y8CA 5B58T 5BY2A 1GR0A 4A6PA 3GDFA 2QTTA 2X5XA 3DOOA 1N5KA 1UDRA 5JE8A 1E2NA 1NQXA 2ZWMA 1EUDA 4ENSA 3K3PA 3URKA 1D2GA 2BH2A 1ZUHA 3M6IA 3PQ8A 5CH5A 4PTYA 1OXXK 4GP9A 2BFBA 4BVHA 2D1QA 2WJHA 2ZYIA 5JFGA 1QNLA 4EHNA 1QU2A 2PUWA 3PDHA 3K0FA 3R3JA 2WNIA 3FTPA 5FPPA 5F33A 2GKGA 2WIGA 4MQ5A 2XQFA 4F5ZA 1GAXA 5F5XA 2VF2A 3GAAA 1AQNA 3OO1A 2DMRA 3ZD8A 3HI6A 1PNQA 4Z3DA 3VU9A 1CQJB 1XMIA 3NWPA 1ZRSA 1T0UA 4LYDA 4DL9A 1UJ6A 2BJWA 1XYVA 1AUVA 2QW1A 3EXG2 3Q3JB 5YASA 4BNUA 3Q88A 2WHEA 4U7DA 2BF7A 4CKWA 1T0PA 5LA6B 2XTMA 1D0SA 1O97C 2R1TA 4YQZA 1BHSA 1M8GA 4BCBA 4EHAA 3NBYC 4KDRA 4AY3A 2ZVJA 3G8AA 2P3SA 1EVKA 2R8ZA 3COVA 4INJA 3IAUA 2Q0XA 4IIVA 4X20B 1W36D 4LRUA 3UGTA 5KS2A 4RCZA 4RLFA 4YDRA 4WXYB 5FTMA 5TJ9A 1ZXXA 4A3SA 3FIJA 5IANA 3HCNA 3OCUA 5TGTA 3UJDA 1FZQA 5F4BA 3A14A 5JCJD 2YHAA 5TSDA 1CCWA 4Z3OA 3CUTA 2YQ5A 3DZIA 4C3OB 3K9CA 1A76A 5CA0A 4DAOA 4FCWA 5GIOE 3S40A 4D56A 1U5BA 2R96A 4LWZA 1UZMA 1ZI8A 2D7JA 4X1KA 1ZXLA 3GZJA 4HWGA 3WMRA 5G4KB 4QNMA 5HYVA 2NU6A 3PPVA 5FIUA 3IP1A 4BLPA 2B69A 3FBTA 3MYYA 5A05A 5BYBA 3IODA 5HG0A 3EZXA 4JLKA 2C3YA 3JAMA 1LRLA 1UWLA 3Q2KA 4E5MA 3JVVA 3O8QB 4EFLA 3ADCA 3AU8A 3PGKA 2WDZA 3DVAA 4KXUA 4RESA 5DX0A 5HQJA 2EW8A 1Y3BE 2WYVA 2Y4OA 3EZNA 4F6RA 1JHOA 1E4EA 1F3OA 4IUDS 4Q9NA 4NARA 2ZANA 3FDFA 4KQHA 4TKZA 4WSOA 4BV8A 4MOWA 1HLFA 1TYZA 2FXIA 4RKRA 5A4IS 4KO2S 4UEQA 5JQGF 3P94A 1RXVA 1U9ZA 2E6UX 1LY1A 1FX0B 3L6DA 2PGDA 1U4SA 3B2NA 1SC3A 4L6IA 1QRTA 2H00A 4RTRA 4IIDA 5HKKA 4YT4A 621PA 1CUIA 2G3YA 1ML3A 2WFLA 4G36A 2J3KA 2F17A 2GSWA 1T4CB 2FRVA 1PDWA 4CM7A 1MAWA 4I5GA 5MGBA 4IH9A 1ZNQO 1VQ1A 4M1YA 4PHGA 4WASA 1XV5A 1K7SN 5LZ8A 3X1JA 4UTVA 4LFCB 1LX6A 4TL7A 1E20A 2JI7A 3BJEA 4XB1A 5BN3B 2EX0A 4CM9A 2HZBA 2VDRB 3WRYA 2Z1MA 2OT3B 3GT3A 1TJNA 1MOPA 3GJXC 4FTWA 5LQRA 4HF7A 3GPLA 1U9YA 2PFKA 2PUEA 4LZOA 3A37A 1QH8B 2CNBA 4BQOA 1APBA 421PA 3ZHOA 1DAIA 2NXCA 3VX3A 3WV5A 4EB6B 4KLZA 4BWGA 1MA0A 1K5PA 1YL6A 2VUUA 2CLSA 4BB0A 1PJSA 3LQKA 4Y3UA 5KDDA 2VJBA 2I3GA 1G59A 3KELA 4RIEA 5ALUA 4CDMA 5DWDA 2IPLA 3K1YA 4J9VA 3HJRA 3WSTA 1U3VA 4D8YA 4WK4B 2HQBA 5ADWA 5IP5A 2GK4A 3CHYA 2FG6C 1SA0A 2EBHX 1YKFA 4W8HA 1PZEA 2A0KA 3RRFA 1ZCAA 1U6JA 3OPYA 4M7PA 1N3YA 4U7JA 2GR9A 3RVNA 2RIRA 3WLIA 3M9XA 2ADFA 4M0FA 1TMOA 2I4MA 2AD5A 3JYLA 2Q2VA 3LA8A 1T3ZA 1E77A 4HSGA 3FVQA 3A6KA 1PJLA 5TQVA 4YN3A 3WBBA 4BV2A 2NPFA 3FPFA 1RXEA 3U6BA 5KKNB 5CB4A 1CXZA 4JN6B 1G2PA 3OZDA 5FDFA 2Y1CA 4IMJB 5DBGA 5CVVA 3DEJA 1FE8A 3X1MA 4F2GA 2Y68A 4UU8A 2C88A 3A9SA 1DRJA 4KJZA 3RUCA 5CVTA 3IDZA 5JAMA 2QBYA 1LV8A 1RPAA 2FAXA 3FYTA 4JBXA 2NGRA 4I4NA 4BLTA 1HO3A 2VHQA 5BN5B 2R9VA 4RTLA 4QBIA 4DZTA 2WTBA 2OCBA 2QNIA 2XUZA 3E58A 4I36A 5TQ0A 4YMVA 4PN3A 5JHHB 3NG1A 4U9UA 1OTXA 3G2NA 3NH9A 4GM0A 5CT5A 2BF4A 3IOBA 4N0MA 5K3OA 4C08A 2JG3A 3NBFA 2BONA 2XXAA 3L8ZA 1VXOA 1OXBB 1GPUA 1VMEA 2GK3A 2VYCA 2WVHA 4DWWA 5HOEA 5IZ4A 1KAOA 4W4TA 4YP1A 1CE8B 3H4IA 1A88A 2JD2A 3DE7X 4CIAA 1WQ1R 2JNWA 5CD1A 3FGPA 1ZWLA 4Y98A 2OB1A 4NWIA 4ZCSA 3V1NA 5FA5A 5FWXB 2PRJA 4KWTA 3JARA 4EJMA 1W1WA 2GF2A 3PGVA 5IC5A 1XMSA 2XIQA 3M4XA 2UV8A 3TW0A 4AJNA 1YJ5A 2DY0A 1OBFO 1T6ZA 1VBNA 2XUIA 4A23A 4ZYLA 5D7BA 2V55B 1G20E 3GT4A 3IEUA 3CRVA 3QMVA 2CNNA 3UXEA 5I47A 5JV5A 1K97A 2WJ3A 3T4UA 4OXXA 3TSZA 4A5OA 1A9OA 1CJVC 1JHZA 3RC8A 3LPNA 3D0KA 1VHWA 3PT9A 1IHOA 4QOSA 3KTAB 2Z08A 1X87A 1SVMA 4FP9A 1SUIA 1X3SA 3PWSA 4EDFA 3FSGD 1TQ6A 4A82A 4GRAA 1NVFA 1OFUX 3MWGA 3IESA 4ZXPA 5B12A 4PSAA 1XFAA 2PMCA 2VK2A 1NV9A 1B00A 4CQMD 2GTPA 4OV6B 5IN4A 1RR6A 2OESA 1AO3A 1KK0A 2FRDC 2P9ZA 3OEED 3RVRA 4BQIA 5JHGB 2YWHA 4LJ7A 3F49S 1KC3A 4UTZA 3I01M 2UUAB 1CZLA 2XE7A 3T1NA 3AB7A 5F1OA 1EZ1A 4NG4A 5D1HA 5KYYB 2W2LD 1N34B 5ANRB 3DT8A 3OQIA 2GN0A 4AX8A 5KYWA 3I62A 4LOLA 1HSOA 4QM7A 2DKFA 2WM3A 4OEHA 2XPCA 2B30A 4PIVA 5KQSA 2XEDA 3VYTB 4IZOA 2BM1A 3R3SA 1P60A 1NBOA 1Z0KA 4R3UC 3U2QA 1VSVA 3CZ4A 3HBMA 4RMNA 3W5SA 2NSHA 1ISIA 1L4YA 1YE8A 3SHOA 2GM5A 3AEKB 2J0EA 4TWJA 5KWVA 2IHYA 3RSZA 1PWEA 4UUMA 1XZIA 1M6HA 2H2FA 2Q0HA 1KJIA 4P92A 2OO5A 5D84A 4YUAA 3AI2A 4X1YB 1XPUA 1SBNE 3EULA 5HIJA 3SP1A 3A9UA 4JFAA 3IQWA 4J75A 4LHSA 3V1LA 3G6KA 2KMLA 2QX6A 1A50B 3THSA 2B4TO 3WG9A 1K8YB 1V6SA 2ZRJA 3JQ7B 3OZWA 1XC7A 3GBPA 4DR2B 2FQWA 2JA2A 1Z4QA 2G77B 4DEVA 4TYMA 3JD4A 3QUBA 2FUNB 1NMZA 1RYDA 3K0KA 4ZANA 1XG5A 5ECYA 2I4RA 3SXUA 1J33A 1BN7A 3UT6A 4E31A 1UL1X 2GO1A 3HRKA 3IEPA 4J2HA 5DXFA 2ZM6B 1YJBA 2GEUA 1GAQA 4LMPA 4UXHA 4EHKA 5AUPB 4GU5A 1XWIA 5IRCD 3VKGA 3HBNA 3U09A 3BWVA 4YP9A 1CR2A 1X8LA 2BSAA 2CD7A 3VVCA 2WZDA 5ALMA 2E3JA 2L17A 4U2GA 5CP8A 4POOA 4L5CA 3VZPA 2I1WA 3CF4A 4IRUB 1EBBA 1MG5A 4CE6A 1TKBA 2ECFA 1U0RA 1DTEA 2Q9UA 3AGQA 2Q9CA 3AUFA 4HNRA 4PYNA 3LYUA 5DNUA 5GONA 2FPIA 1KARA 4MMZB 3EVCA 2DHQA 3LCRA 2D2FA 3OETA 4U8HA 4TYNA 3UJ9A 4KBFA 2DETA 3VR1A 2AZ4A 2W70A 2GXQA 2HA0A 5A62A 3AM1A 4I55A 4Y2VA 1TEHA 3IIMA 5A7HA 2WF6A 2IHKA 3AJAA 3U3XA 4N8SA 1CJMA 2BFNA 5AKHA 2XNDA 4S12A 1C3OB 2P35A 3EPRA 4JQZA 3DLHA 1MH1A 4F71A 3OAAD 1OPXA 2IE0A 3DMRA 1P62B 1YOVB 3JWIA 4ZZ3A 5C46F 2DHCA 3NC0C 3IHTA 4EVQA 2NZXA 2FZEA 3LF2A 4YUWA 3JASB 3LTEA 4GWGA 3B9QA 4C1BA 2CLDX 4Q3KA 1MT3A 2Z8XA 4ZAZA 2QN2A 4F9EA 3C3MA 3ND5A 1W85A 5JNUA 2DRIA 1ZPDA 1XQVA 1X7WA 1KWGA 3T35A 3IRVA 3RQIA 1QTIA 2QLLA 5IX8A 4HNAB 1GAJA 4E07A 1QHEA 1AKEA 2GXUA 4Z49A 2P2NA 3COZA 1EVIA 1K2WA 4G4IA 1FP2A 3UVEA 1XK6A 4R8MA 1ICIA 2ZSKA 4C2AA 3M83A 5ECDA 1JAXA 4BECA 3THXA 3FPCA 3ID6C 1QIFA 1FCJA 2GSDA 3ZI0A 1UXHA 2X2PA 3L6OO 5GQSA 4V39A 2K2QB 3OEWA 2GCOB 5ES4B 2AN4A 3PQDA 4BNTA 1QRSA 5FV7A 4UBIA 4IUYA 1BMFA 1XEAA 4H4CA 3F67A 2FI1A 1OFTA 2NTEA 1IIBA 1ECJA 2AOWA 3ZU5A 1C4WA 1HT0A 2KBEA 3A1WA 5K0GA 5I9LA 1KRXA 1P9OA 4Y9SA 4K03A 3M82A 4Z1MD 5HF5A 2P2DA 3OZUA 4LI3X 2OPHA 3TNFA 3UCXA 4K26A 5E1MA 3KDAA 3KSDO 1CUHA 4BV9A 3D64A 3OC6A 3LT0A 1QG0A 5K4HA 3AQIA 4G0XA 2RGBA 1N9GB 1BKDR 3DMGA 3KYCA 5DT9A 1GQQA 3JQ9A 1L7MA 3ROPA 1RKUA 2EOAA 2GZSA 4OFZA 1KDYA 3GIDA 1B23P 3BK1A 3JZDA 4OMUA 4BO1A 1GNPA 1NVGA 1SQ0A 2ZJ3A 1LPOA 3MWDB 3OM0A 4PQFA 1UODA 4PZ0A 2XGSA 3DMYA 4L1KA 3RV3A 4X60A 4XWWA 4ZYZA 5CA0F 4NV3A 3V7YA 5AMXA 5K6TA 3B6ZA 2M6KA 1Q1QA 4R1PA 1Y4DE 3G2PA 4R9UC 2XMDA 1S8NA 5HRCA 1T5TA 2G07A 1FU7A 1RQ2A 3DDCA 3ZJ5A 1CKEA 4D4HA 2FP4A 1IWOA 3V4LA 3ZZ1A 4DIUA 1E7WA 1O6CA 1AHHA 2AF3C 3R6DA 4AUKA 1U2QA 4UOZA 5BV0A 1EUQA 3MOIA 4GPEA 2A1IA 4OBBA 3ZV3A 1TJ4A 3BBL