2AVNA

Crystal structure of a ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from thermotoga maritima msb8 at 2.35 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
HMKLRSWEFYDRIARAYDSMYETPKWKLYHRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEMLEVAREKGVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKDKAFSEIRRVLVPDGLLIATVDNFYTFLQQMIEKDAWDQITRFLKTQTTSVGTTLFSFNSYAFKPEDLDSLEGFETVDIRGIGVMEYPDERISEREETIFRLEQELSRDRNIIWKADHIFFVLKKKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ubiquinone/menaquinone biosynthesis methyltransferase-relate
publication title Crystal structure of Ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from THERMOTOGA MARITIMA at 2.35 A resolution
rcsb
source organism Thermotoga maritima
total genus 88
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2avnA00
2AR0A 2F8LA 1H1DA 4YV0A 2YXLA 3M6WA 4F86A 2FK7A 2PSSA 4OQDA 5HIKA 5CCBA 5GWXA 3FRHA 1EG2A 1KR5A 4QQKA 4GEKA 1RI1A 3NMUF 5ERGB 5U4XA 5ICEA 3NDIA 4KDRA 2WA2A 4PYOA 4QQNA 1MJFA 4LWOA 4GBED 5DM2A 3HA5A 3UZUA 3FUVA 4YMGA 3AJDA 3GXOA 5EGSA 2P7HA 4QVGA 2BH2A 7MHTA 5G02A 1VPTA 3GRRA 3PX2A 2R3SA 4AX8A 2CMGA 3UJ6A 4AZVA 1ORIA 2ZVJA 4YUZA 2G71A 4U7PB 2PXXA 5LQJA 1DUSA 2UYQA 5E2BA 5CVJA 4DCMA 4UOEA 3S68A 1Y8CA 3GCZA 5E1DA 5F2OA 1VBFA 4GC5A 3NW9A 3PFGA 4R8RA 3DTNA 1ORHA 2OYRA 5ICGA 3GIWA 1KXZA 1YB2A 2FCAA 1EAMA 1RI2A 3KQPA 4NECA 1XDSA 3F4KA 5C1IA 1TW3A 10MHA 3EVBA 4CTJA 4RTPA 2Y1XA 3CGGA 4YUXA 4E31A 2XYVA 2EFJA 1RI3A 4HRAA 3KQWA 2HTEA 3CKKA 1FPQA 3U81A 1X1AA 5CVEA 5HIMA 1INLA 3TMAA 5K0GA 3KR0A 2ZBQA 3H2BA 4Y2HA 5GM1A 4OX9Y 2VS1A 2HR1A 4RVDA 5E1MA 4V0RA 1JTFA 2ZZKA 4HTFA 4F84A 2PXAA 3FPHA 3TFWA 3ELWA 3EVAA 2IBSA 3PX3A 2C7OA 2ZZMA 2CL5A 1M6YA 4GOLD 2UYOA 3GJYA 5DX0A 4DMGA 4MHTA 3ME5A 1NE2A 2O57A 5JUWA 1QAMA 3R3HA 5DSTA 5DT2A 3IV6A 2AZTA 2N47A 5DWQA 4OA5A 4EK9A 3LDUA 3BKXA 2YTZA 4ER5A 3A7EA 5GIPE 3P9CA 3MHTA 2PXCA 3KPWA 4U7TB 3DP7A 1JR4A 3G2MA 5FCDA 1D2GA 4BY9E 2OY0A 3NTVA 3OZTA 5EKXA 1HNNA 4K6MA 2LD4A 2OXTA 3C6MA 4KIFA 3AWIA 4E32A 2ONZA 2PGXA 3DOUA 3MQ2A 5DPMA 3UJCA 4C07A 3PT9A 4RTKA 2G8NA 2PLWA 2OO3A 5ICFA 3T0IA 3M4XA 3MAGA 2BM9A 2QM3A 3O7WA 5BW5A 3LPMA 3M33A 1ZKDA 1NW7A 3SM3A 1IY9A 1X1BA 3EVEA 4GUAA 2H1RA 3C0KA 2IDJA 4GOND 2ESRA 1NV9A 3T7RA 1EQAA 2WA1A 5DXAA 2NYUA 5K0EA 4RVFA 5EQJB 3CCFA 4F85A 3UJBA 1X1CA 2AOTB 2O06A 1SUIA 2NXEA 4KIGA 2ORED 2I9KA 4FT4A 1VE3A 4ATNA 4MWZA 3HVKA 9MHTA 3T7TA 1JQEA 3GRVA 1FP2A 5EIFA 4OBXA 5EOVA 5GM2A 2PX4A 3KQMA 5LQRA 1ZGAA 5K09A 1Q0SA 3FUXA 1KHHA 3GU3A 4CKEA 2NP6A 1YZHA 3NWBA 5LQUA 5K05A 1KYZA 1WZNA 3G8BA 5EEHA 2AN4A 3V97A 4X41A 2XVAA 4CKBA 1SKMA 4V0QA 3P9KA 2V7EA 3DLIA 3KU1A 3SSOA 1VP9A 4R8SA 5BXYA 5M5BA 2PKWA 4MIKA 5CM2Z 5LQKA 1QAOA 4RTMA 2Q41A 1NBHA 3BWBA 4X1OA 3OPNA 5EHIA 3KPVA 1KYWA 1N2XA 2VDUE 5EHGA 3OZSA 4PGGA 1ZG3A 3UJ8A 5JR3A 2E5WA 2JG3A 3BZBA 3K6RA 2B78A 4LECA 4BLWA 4PYNA 3BGIA 5EIWA 2B25A 5C9ZA 4IV8A 4P7FA 3GO4A 3EMDA 3TQSA 3G5LA 4AUKA 1R8XA 5FWDA 3DMHA 3BT7A 2B3TA 5KS2A 1R8YA 1VL5A 2GPYA 2UZ4A 3CJTA 4GF5A 3VC1A 4Y30A 3L8DA 5KQRA 1DCTA 2PX8A 3GNLA 2OBFA 2JHPA 3IYLW 2PWPA 2VDWA 4IV0A 1VQ1A 1AF7A 2OPBA 4GOMD 4P7KA 4E2XA 1TW2A 3A26A 1SG9A 2YR0A 3EGVA 3TPZA 5LQCA 5EMJA 2OB2A 3SXJA 1AQJA 1R18A 3E23A 3OU6A 1I9GA 3OFKA 5IH3A 4IKPA 3EPPA 1M6EX 1G8AA 1RJFA 3GRUA 4DZRA 1D2CA 3LHDA 1SQGA 3M70A 4HGZA 3NJRA 3C6KA 3CVOA 2QE6A 2UYHA 5CIYA 2P1DA 3I5UA 3IEIA 5BP7A 1R74A 5LR6A 1U2ZA 4H0NA 2AOTA 4X61A 2PT9A 2PX5A 3P71T 3G8AA 2ZW9A 2O0LA 4YV2A 1NKVA 3G2PA 3JWIA 3PB3A 5HILA 3A7DA 2NP7A 1WG8A 5T6BA 3V8VA 4FGZA 2YUIA 5T67A 3BWMA 1SQFA 3A27A 2ZLBA 4P58A 2C7QA 2P41A 3B3GA 1YUBA 2NXJA 3P2EA 4PIMA 3D2LA 2BR4A 3FPEA 5H02A 4QVKA 2XYRA 3O4FA 2ZZNA 2YX1A 1WXWA 1F3LA 3EVZA 3TR6A 4PWYA 2AOXA 3HM2A 1G60A 4FS8A 1R00A 5DTMA 4YMHA 5K0BA 5KQSA 3ELYA 1JG4A 1ZGJA 2IPXA 4FSXA 3HCDA 4HC4A 4PYLA 3EVCA 1XXLA 2VDVE 1R6AA 3EGIA 5CVDA 3DXXA 3VC2A 2I62A 1O9GA 3HCAA 3HP7A 1FJXA 2BZGA 4CKCA 5EPEA 5IKMA 4ER0A 1RJGA 1VP3A 3P8ZA 3DR5A 1KPIA 2AOWA 1QYRA 4L7VA 3B3JA 3KQTA 3MTIA 4M37A 4PYMA 4XUDA 4EKGA 3C3PA 3THRA 2PY6A 3LCCA 3X0DA 2BM8A 2PX2A 5GINE 3FUUA 3NDJA 2GH1A 2B9EA 4PNEA 5BW4A 3M6VA 3BUSA 4FZVA 4E33A 4FSDA 1KP9A 3LL7A 1JG3A 3R6TA 1JG2A 4P7JA 2JH9A 3EGEA 3ELUA 2PT6A 1QANA 2PV0A 3KPUA 3EVGA 3KR9A 4M7RA 1G55A 1NV8A 5DTQA 5EZSA 4E2YA 4HG2A 2AVDA 2ZIFA 3UA3A 3RW9A 5K0FA 1Q0TA 1F38A 5HIJA 1SUSA 3KQVA 3OZRA 2AOUB 2EX4A 2OZVA 3SR4A 2JHCA 1FP1D 3OE4A 1G6Q1 1BC5A 3P9IA 5EMLA 3G88A 4E30A 3AXSA 3UJ7A 5KVAA 4RTJA 4RTQA 4R6XA 2ZBRA 3DXYA 1JTEA 2ZIEA 1XJ5A 3G2OA 2FHPA 4E2WA 1NW6A 1AV6A 4XUEA 5KYGA 1JG1A 5E9JA 1XDUA 3KR2A 3P97A 2IH2A 1EJ6A 4ISCA 5D1NA 1SVUA 4KDCA 2JJQA 3KQQA 5K0NA 1RJDA 4C05A 4BP1A 2XYQA 3LKZA 3HEMA 2AN5A 3JWHA 3GRZA 5FTWA 1MHTA 2OKCA 4P7GA 3TOSA 2AVNA 3FYDA 3KR1A 4M36A 4CTKA 2HV9A 3G7UA 4PYIA 2ZTHA 5D1HA 2YVLA 4XUCA 5CVUA 3OFJA 1RI5A 1N7JA 3KQSA 3P9NA 3FTEA 3FTFA 2BR5A 3FPFA 3SMQA 4CWAA 2UYCA 1YFLA 3BXOA 3QV2A 4KRGA 2B2CA 2FYTA 2IIPA 3HCEA 4FT2A 4OQEA 2IP2A 3PS9A 5EKUA 2AOVA 3FTCA 3TM4A 4A6EA 4BLUA 5HIIA 5GOZA 2VZ9A 2YQZA 3MCTA 5K0LA 2I6GA 1OR8A 3ID6C 4PCLA 4RVHA 2Y1WA 3LKDA 5E8RA 1EIZA 3T7SA 4EQZA 5DM0A 5E8JA 2Z6AA 4IWNA 2PWYA 5HEKA 2ADMA 4HSGA 1ZQ9A 1N7IA 2PJDA 3NVKI 3LGAA 4G56A 2Z6UA 2AS0A 1RI4A 4GQBA 3GRYA 1AQIA 4RVGA 5DM4A 4KWCA 1L9KA 1P91A 3SX0A 4PGHA 5MHTA 2HWKA 2FPOA 3BWYA 4PINA 2FK8A 3ANXA 3MB5A 2ZWAA 3REOA 3MERA 1PRYA 5FUBA 2IDKA 1NW5A 3LDGA 3I58A 4M38A 1PJZA 3FTDA 3FUTA 4X63A 4GOOD 2ZIGA 3TKYA 4X60A 1VLMA 3HCCA 3P2IA 1TPYA 3LECA 5FQOA 3WSTA 1ZHFA 2GS9A 3E8SA 5HFJA 3PLAE 2IFTA 2O07A 3HNRA 4QDKA 3SGLA 3RIEA 4BLVA 3FYCA 3ER9A 2AOUA 3EVFA 4ER3A 4R6WA 3LCVB 1UFKA 4C04A 4ER7A 3PFHA 3BGDA 5CCXA 1L3IA 1WXXA 3R9XB 5FA5A 5DX1A 4RTLA 4AZSA 2ERCA 3TM5A 4HH4A 3EMBA 1UIRA 1WY7A 1XCLA 2QRVB 3QOWA 5EMMA 2NXCA 2P3LA 3HVIA 2YXDA 3E7PA 5CVVA 1NW3A 4FR0A 4MTLA 1QAQA 3RODA 4DF3A 5CD1A 5DXJA 4E70A 1L3CA 4AZTA 4DM3A 3HA3A 5DRTA 4C4AA 2IGTA 1DL5A 4DKJA 5DLYA 3AXTA 3VYWA 3UJ9A 3FPGA 2ZCJA 5C0OE 3FRIA 3UA4A 3TRKA 1XDZA 3Q7EA 3UBTA 1YZ3A 5E2AA 4YUWA 3KPJA 3DLCA 2DULA 4PYJA 1BKYA 1YFJA 4YUVA 4EVIA 3GWZA 5F2KA 2GB4A 3VSEA 2H11A 5P8WA 1Z3CA 2P7IA 3HCFA 5FQNA 5T64A 4C06A 5DM1A 5ICCA 3LBYA 4OBWA 1KPHA 4ER6A 2EJUA 2JHAA 2P3QA 4FP9A 4PYQA 3HTXA 3HA7A 5EVJA 3KQYA 3HVJA 2ZULA 4YUYA 2NXNA 3MGGA 4PONA 1P1BA 3E05A 3R0QA 4PYKA 4RSRA 1KPGA 3SVZA 3TLJA 5HOQA 2NNWB 4A6DA 3LSTA 4B17A 2XBMA 2ZBPA 1I4WA 5K0JA 4C08A 2EG5A 2WK1A 2CKDA 2I7CA 1G8SA 1VIDA 3A25A 1M0EA 3NVMB 2K4MA 5DTRA 3G5TA 3M6XA 3SSMA 3ORHA 1P1CA 1P39A 3NWEA 1I1NA 5CUQA 3M6UA 4RTOA 4GC9A 2Z6QA 3B3FA 1L1EA 1WS6A 5EC8A 2R6ZA 3KKZA 4QPNA 2FRXA 3G2QA 4RV9A 2AN3A 1XCJA 3R24A 4OA8A 1KIAA 1UWVA 2VP3A 4QDJA 3ER8A 3I9FA 2IH5A 3Q87B 3HCBA 3IHTA 3KQOA 2C7PA 3DMFA 1QZZA 2ZWVA 4PIPA 5K0CA 1YF3A 1JSZA 5K01A 3QOXA 4LG1A 5E1OA 2BR3A 3LX6A 5K03A 1BHJA 1IM8A 3AY0A 1B42A 4ZTBA 3UJDA 4KVZA 3CJRA 5E1BA 2GLUA 3MTEA 2QRVA 3UFBA 4AZWA 4POOA 4RTRA 2H00A 4LWPA 2G72A 2OB1A 5LSAA 3DMGA 2QY6A 2YXEA 3JWJA 3TKAA 1JQDA 1G38A 3LBFA 4WVLA 3FPJA 3UJAA 4EKIA 3OU7A 3OE5A 3DUWA 4RYLA 2P35A 1O9HA 2PBFA 3DULA 4O29A 5EG5A 2EJTA 5K8VA 4DQ0A 2GAFA 5EZQA 5FADA 8MHTA 5DSXA 3B89A 4RX1A 5E9WA 5FA8A 5FHQA 2PVCA 4QPPA 4RTSA 5HZMA 2P8JA 3FZGA 1XVAA 4PCAA 4DA4A 3DXZA 1V39A 4RWZA 3P2KA 5B1SA 3KHKA 1JSXA 1L3BA 2HNKA 3PVCA 3FUWA 5DX8A 4EMSA 1IXKA 3THSA 4BP3A 1T43A 4E2ZA 3K0BA 1O54A 3BWCA 3SSNA 5LQAA 4Z2YA 1JQ3A 3O31A 3UWPA 1X19A 1X1DA 3EEOA 5FWAA 2G1PA 2XVMA 4WXHA 2G70A 4YV1A 2C7RA 3HVHA 5FHRA 3OCJA 1D2HA 5F2NA 4MQ4A 3EVDA 2QYOA 1FBNA 1RJEA 1BOOA 2IBTA 3A4TA 3JWGA 4HGYA 3DH0A 4QTUB 5EEGA 4CXMA 3ERCA 3G89A 1NBIA 5GP1A 1NW8A 3LCUA 5LQNA 2O05A 4RTNA 4XCXA 3BKWA 2JH8A 3B5IA 3CBGA 3KPYA 3OU2A 5EMKA 3ELDA 2KW5A 4DCGA 3GGDA 5E9QA 2P3OA 3CC8A 4HTFB 2ONYA 2DPMA 3BGVA 2A14A 1XTPA 1NT2A 4C03A 2ZFUA 4R05A 3MCZA 2HMYB 3I53A 3CJQA 3GDHA 1EJ0A 3I64A 4JXJA 4QTTB 3PTAA 2V74B 5FULA 2GA9A 2CWWA 2ZSUA 3B7PA 3C3YA 2P40A 3LDFA 4KW7A 5DRYA 2IH4A 3EEYA 5GIOE 1HMYA 2CMHA
chains in the Genus database with same CATH superfamily
1UINA 3OO0A 2OR3A 4KQWA 3PPWA 3TW4A 4HNTA 4EELA 1WD7A 4PHTA 2QSYA 1M5TA 2PANA 3GLQA 4HDRA 5CBKA 3F6BX 5TSDA 1UMKA 1KBZA 2DT5A 1PFKA 4GEKA 5T4FA 4XUGB 4D8UA 3NMUF 1JVBA 2H6EA 3SX2A 5CDUA 2C7RA 5EXDA 3RLIA 1EM6A 1E7WA 2ZITA 1PD0A 4QQNA 2AW3A 4UUMA 2IX9A 1GL6A 4Q7JB 3R5FA 1VYUA 4C43A 1U2DA 3JATA 2DQYA 4YJFA 4G4GA 1XZAA 5BURA 3RUEA 2ZVJA 5FNVA 2DHQA 2HRBA 3PGXA 1QONA 3FOCA 1G1MA 3FGPA 3ABIA 4CM7A 4BNFA 3DKRA 4X9XA 1HYEA 4X8OA 2JJ8A 1G8FA 1RWVA 1WO8A 3TOZA 2FSVA 1LV7A 3PYXA 3W5AA 3M5WA 4UJ3A 3KQPA 4KE6A 3SZMA 4NMLA 1T5OA 4MVJE 3WP1B 3ZI0A 4HN9A 3QEAZ 4GOJA 1D8AA 2G9UA 3NPAA 4RQAA 4EY7A 1P0QA 3CGGA 3R3XA 1L0BA 4HBZA 2ZE5A 1XPJA 3M5CA 3DOHA 4CKEB 4A8JB 4JT8A 4TWBA 5KJCA 4G6ZA 2W90A 3CLSD 4DWVA 4MPRA 2D3WA 5EJ4A 3AU9A 1PR1A 5GM1A 2YXNA 3KXPA 4F9TA 5C1OA 5T41A 1NVGA 2DTDA 4NMWA 1E8MA 4H2DA 1UJMA 2FR8A 3S2FA 3GGOA 4KO1S 4E07A 1HY3A 3ZY4A 4XWWA 3EXHC 2HADA 1K66A 4QE3A 4PX3A 5BSVA 4DMGA 1N0UA 3G2JA 2G9QA 4RZ3A 2ZT6A 2XOKD 3IV6A 4FUTA 5AIBA 5C34B 1YUNA 4BVGA 3I6IA 1R4ZA 3PNLA 3QKIA 4B3JA 3I76A 1KDZA 5DK4A 1W85B 3EEFA 2HQOA 1FS6A 1KBOA 1WUJS 3GFPA 4YP6A 5JANA 3AR8A 1R37A 1SEPA 3DQPA 3CZ9A 3GJQA 4TYNA 2C4HA 5EKXA 4TL9A 4F7DA 2J3MA 3E3LA 3GAAA 2VTKA 4XB1A 4ZJUA 1LI7A 4E32A 1PV4A 2AMVA 1XJ0A 1R64A 2R25B 2YHIB 3KTAB 4DQXA 1FVXA 1Y7IA 1GVHA 4M9QA 2R97A 1CBUA 1DWOA 2OO3A 5CURA 1X80A 5GJCA 4OMFG 5TGTA 1POXA 1AHIA 1EUCA 1Y1TA 2EEPA 5LB4A 1BRMA 3LPNA 3M33A 3AFMA 1XU9A 3AUFA 1XE3A 4RK1A 1BFKA 2WFAA 4HGRA 3UGKA 4AO8A 3ZBUA 2KI5A 3C0KA 2D62A 3UWDA 1P7ZA 2VA9A 3SYRA 2NYUA 3P5SA 5K0EA 4QXQA 1Z16A 1A9RA 2BHSA 3BCHA 1NVWQ 2RHMA 2B1RA 2BTQB 3U4HA 2NXEA 5DHQA 1WHTA 1ISRA 1LGYA 3IJ5A 4OXNA 4UULA 3RGWS 3DBLA 3SQOA 2GYUA 5KSOA 2Z2IA 4IXTA 3F0TA 2GZHA 2DWUA 2J6IA 2QTNA 1IB0A 4MWZA 1FY2A 4R1OA 2QGNA 3CX6A 2I9PA 5HBRA 3B36A 4OBXA 1ZN2A 1XF9A 2EXXA 2PX4A 4YCJA 1M2OA 1VDMA 1PGPA 3RHTA 4DNOA 2BFMA 4B79A 4EI9A 3E2IA 5A4KA 1XEFA 5FTJA 1I6MA 4I1RA 1KHHA 3TJRA 1OYOA 3DE0X 4DREA 5TMPA 4BAGA 1PFUA 4ZD6A 4ZYZA 5BN4A 5AM3A 4ME6A 2GSWA 2J3EA 2WMYA 4JZKA 5BVGB 4DDKA 3JAWA 2QY9A 1AO0A 3JQFA 3ZNPA 3DLPX 3P2YA 3WNDA 3HCOA 3RC7A 1KGDA 4LYDA 4R8SA 4UHEA 4DMKA 1VCOA 5ABPA 2CCJA 2IHNA 1ZD3A 3NHJA 1CUUA 3T5BA 3WGLA 1ZICA 4JP2A 4U2DA 4ZRDA 1K8YB 2Y1LA 1R6DA 4PGGA 4NHOA 5I51A 4F46A 1KQGA 5CRIA 1CE8A 3LHIA 5K4AA 1H3EA 3VTAA 5BRNA 1GUYA 3RTCA 3OF5A 1E79D 1RNLA 4KDEA 4KR0A 3L8GA 4R0NA 2PBLA 5H68A 2O3UA 4IICA 4B09A 4OJQA 4RHUA 4JFRA 2B3TA 3WLQA 2V58A 2PH3A 4P81A 3QG1A 2J32A 5BN5B 3CJTA 1AIPA 1E2FA 4OHZA 3B7WA 2IXEA 5IJ0A 3GNLA 1OAKA 3FFTA 3PHHA 3S8YA 4RELA 2X4LA 1PWYE 3PYLA 1D04A 4YAWA 4J0GA 3WJ7A 1QYWA 3M4JA 4PFSA 3UUEA 3NT4A 3OT1A 1JFFA 1OWOA 2E21A 3ED5A 4BATA 4EYQA 2OUIA 1OIVA 2JFBA 1KETA 3FFBA 3P2JA 3MMZA 2AQ8A 3VISA 1XSEA 2FUCA 2F3PA 4PNZA 4Q02A 4RD4A 3O1LA 2WU1A 3EF1A 3LPLA 3B51X 2RMKA 4B35A 4HTAA 1KOLA 3OD1A 3I5UA 3P2MA 1D6SA 1LX6A 4R7ZA 3DL0A 5EJAA 2P9EA 2A5LA 4QO8A 2O54A 3IAM6 4ZYVA 1CZOA 4HUTA 4DG5A 5MN4A 3NBXX 2HA7A 5E6RA 3I5AA 3K9WA 3RBVA 4W9MC 3IP5A 3G2PA 2O6LA 1QQTA 2FPKA 4ZU1X 1H85A 3UB4A 3N7UA 4KSBA 4BTLA 4ZI3A 2XUOA 1C29B 2BFEB 1BRTA 2ZT5A 2Q4EA 4PZPA 2BJVA 2X1VA 1IZ7A 2NZWA 4LHEA 1ZK1A 4P58A 5G4KA 2C7QA 3LVBA 4JXKA 4DVJA 4E51A 4LI0A 1YJBA 3ENKA 1ZNYA 1M2WA 2CXUA 4WECA 1C9MA 2A9RA 3QLVC 2R2GA 4AMZA 1OLSB 2P1RA 2CVPA 3HUEA 4WCDA 3OEWA 1MOZA 4YXWA 2JFNA 3HM2A 1OB5A 1E9FA 2ZQYA 3AZQA 4RAQA 1DOZA 2GYWA 4S0XA 2IPXA 2GWHA 3B9BA 4EO9A 5KEIA 2W7TA 3PUIA 2VDVE 1R6AA 3N5KA 4C0JA 2IEYA 1Z0JA 2J07A 4FEGA 2RI6A 1T2VA 4KLZA 3WFIA 1TM3E 4O2RA 1W1UA 3U4CA 4EA6A 2UXBB 2HFKA 2YNMC 4L3VA 1SPBS 1R12A 1XAJA 5JDCC 5GMOA 2MMGA 2MINB 4QPCA 4XUDA 3T5AA 1JZTA 1S7GA 4C4ZA 3X3HA 4LHXA 2ODNA 1TAUA 2C4UA 4ZOLF 3SNKA 3UJPA 4RE5A 4I50F 1PJLA 4DR5B 1XTBA 4FSDA 1GTVA 1KP9A 3QM1A 2NVUB 2CCKA 5KDDA 1EX7A 4P7JA 4XR9A 3EBLA 1G5PA 4L2IA 5H80A 1K6JA 3MWFA 4QLBA 3TB4A 4E0BA 4OQQA 1UZUA 4PTLA 5EZYB 3UAZA 3DZBA 5A02A 1LFAA 3IVGA 1TMKA 1TYAE 1UAYA 1Z35A 2MIIA 4LYFA 4EGAA 2WIAA 3KQVA 5JJKA 1U4OA 3CLVA 4U7HA 5ADUS 4U9IS 3WA7A 3KRTA 4XKJA 1B8OA 4LOJA 4RTQA 1WHSB 1YKGA 2F62A 3QI7A 5IAJA 1MIHA 3KZNA 2FPPA 2FN4A 1KP3A 3DBHB 2XX3A 1LF5A 4EZIA 3TLZA 3ZKWA 3P97A 1WDMA 2C4TA 5E7IA 4BLPA 2JAUA 5F33A 2PV7A 3RTBA 3UWKA 3WBKA 3C70A 3GLFB 1M1ZA 3AVUA 3JQ7A 4NJMB 4NU5A 4B7XA 4I55F 2VT3A 4H15A 5LFAA 1JRLA 2WT9A 2ZSJA 1Y1KE 1I33A 3KR1A 4M36A 4EENA 3AG5A 2Q50A 1YDMA 5E6SB 3WWDA 4CHTA 4Z9BA 4KWEA 4L57A 4QUEA 4YQEA 1Q6ZA 2AT1A 4ZT3A 4CWAA 2EBWA 3WGIA 2IGBA 3EEQA 3K2QA 4FT2A 2OCKA 4AUEA 5JVDF 2IY9A 3LDHA 1V8DA 4JWTA 4ZOLA 3S3TA 1QRRA 3PXDA 4Z9AA 3WNZA 4FYMA 2VZ9A 4NI5A 5K6AC 4BMDA 4R81A 4RVHA 1GFWA 2JIZA 5JY1A 1JDSA 2YC2C 4MMXB 5T6MA 2FMUA 3UT5B 4B4VA 4JP3A 3GJ6A 3LGAA 5EE0A 1FDWA 3I42A 4RIHA 4QXPA 4MEAA 1QGZA 1G20A 3FW1A 3HXTA 2NUTA 3LHFA 1SZPA 5DH9A 1J06A 1EBUA 1FX0A 2RB4A 3FMGA 2PL5A 3ANXA 3BN3A 4KQ9A 3T3GA 1PDOA 4TVBA 1SKUA 2ZJ0A 3STHA 4PAMA 2HMAA 2C8LA 2EVWX 3R3SA 2RGCA 1ZIYA 2JFHA 1O0SA 4AJKA 5JMPA 4ALMA 4K2HA 1D03A 1SOUA 2ZE7A 2WWRA 4GR4A 5HBGA 1L8QA 4TVKA 1KI1A 4HQRA 1NOKA 1CUBA 1RW4A 1DRJA 1NR7A 5KYXB 1CETA 2R6AA 4I55A 2RIRA 2OZKA 4G0XA 1X13A 5K0SA 3ESCA 4QC2A 1AUOA 2CXSA 2QVGA 4QHYA 2NU6A 2PZ8A 2CNOA 4Q05A 4MV1A 2PMEA 3UFXA 2IOYA 2ST1A 5DN9A 3TX2A 4X66B 2BKVA 5FR1A 2VTBB 4DF3A 1V9LA 2C2YA 2UZ1B 3A05A 1DQSA 2GKSA 4LZZA 4M6WB 4AZTA 3CLSC 4FBMA 1PI3A 5IWAB 3QFCA 1F0PA 3BIWA 3CO0S 4PFKA 3CCBA 4BFWA 3GVCA 4DSZA 3EISA 1RZ3A 1WWKA 2VJOA 4R2XA 2XQJA 1NLFA 1EUZA 1YV9A 4YEDA 1VA5A 5KHAA 2XZTA 2C8JA 1L1QA 3ZLVA 3PFBA 5KVVA 1VHWA 4PYJA 5CEJA 3GA7A 1G20E 1YNOA 4GMKA 1LJLA 1POWA 5E0KB 2DSTA 5P8WA 1NVAA 3K31A 2X23A 4M55A 3G0BA 2QD4A 4G86A 4M1QA 4BMCA 4LZOA 5JLJA 4LHVA 2Q2OA 4EHHA 2IX3A 1X1QA 2DRIA 4IG9A 3WGZA 4YYZA 3T1TA 4BEBA 3HVJA 4UUAA 1NJ1A 2CXTA 1JS1X 1QV6A 3AVQA 4Y6RA 3U0VA 3CH4B 1TNDA 2P4HX 3V80A 1M10A 1QDEA 2XBMA 4MR8A 4WJZA 1I4WA 4ZKDA 4EA9A 3U39A 2YJZA 3C2QA 2ZBEA 4XQGA 5BR1A 4DMLA 3JX9A 3L49A 3QMMA 3MLAA 3OZUA 4MQEA 5IMBA 1FB5A 2C8VA 1SNYA 2DQSA 3UMSA 1P1CA 5HKLA 5IANA 1C1DA 2D1TA 5DNAA 1FYXA 3S55A 4BCCA 1NDQA 1RWMA 1V48A 1XTQA 2WOOA 3GLVA 3G5MA 4X6XA 2O5EA 3G2KA 4DXAA 1W87A 4Q9HA 1ZL0A 4YFVA 2ODAA 2A84A 3CLHA 1Z2PX 2VP3A 1JHRA 4G84A 4EPTA 2BGLA 3I9FA 4PO8A 3WYGA 1VB3A 3K3PA 2D59A 2Y4OA 4D4MA 1DIRA 5IC5A 3SF8B 3FDZB 4EX7A 1YE5A 4QBFA 4BVHA 1A4IA 4C7XA 3G2IA 3W9BA 3VNUA 4KVZA 5SZHB 1K2WA 2DCMA 1GJRA 4OI0A 1QJCA 3QLTA 2I3BA 2CDBA 5EXPA 1K4KA 4FE7A 3PI6A 5EPOA 3JD1A 1AY0A 2Q5LA 3WJAA 4EI2A 1LK7A 4P54A 1VG8A 1UBMS 3DULA 5CU7A 5K8VA 1B0PA 3U19A 1I6WA 1BS9A 2A67A 1Q0QA 1JWBB 5IMSA 1A2QA 4B82A 4W9NC 4AXBA 3VTZA 2MWMA 3TSCA 2FB9A 1X7ZA 4XPIB 1LFDB 4IDPA 5BYAA 2ZSEA 5B1SA 1N5RA 1ZUNB 2XUPA 3H11A 4QYMA 1XTTA 4MR7B 3VKFA 4UHHA 5LM3A 1DLIA 2ZROA 1JHOA 3Q6IA 4QGAA 1DG3A 1EPUA 1OC2A 5BXQC 3PU6A 3TRHA 3U2QA 1E5QA 1RZUA 5K20A 1N1DA 3ZDYB 5A4FS 1PNVA 1LNZA 5F2NA 4P0QB 2JVIA 3P4YA 1J8DA 2F3UA 3EXFA 3IPXA 3RU2A 3QMVA 2EKQA 1GAWA 5K4HA 2P6PA 5JJLA 2YS6A 1ISHA 3U7EB 1LPSA 3DFUA 1QHHB 3SS8A 1FMJA 1DIHA 3EK2A 4XD7D 1QK4A 2CB0A 3KB6A 2FPGA 2Y3IA 1OT3A 4XM0A 5BSMA 3R5HA 4FXOA 2D54A 2Q5HA 4XIIA 5BRAA 5GP1A 1NW8A 1RM3A 1DJNA 1XF1A 1U0RA 2H0RA 2PYIA 1TM2A 2WAYA 4AF7A 5CCEA 1F6WA 2QYSA 3TVTA 3WAJA 4HTFB 3U37A 1P60A 4BQQA 4HMQA 3LQ4A 4NZNA 4NENB 3WIBA 1PIWA 2G1KA 1UP4A 2ZFUA 3GH3A 2V6FA 3NWPA 3UY4A 3WQBA 4BNJA 4YRMA 1FA9A 3SX4A 4BN4A 2IYLD 4O8CA 2WKRA 1BMFD 3FB4A 3KWJA 1ECGA 3B7PA 1ZNZA 1NI4A 2OGWA 3RIHA 1FS5A 4N8DA 3LIPA 3VPHA 1T6YA 1XCPA 1KA9H 1P19A 3BWEA 1MV8A 4HLUC 3D54D 1NRWA 4S35A 4F8YA 2VXBA 2XKAA 2CYAA 3DTYA 1IM2A 1J22A 1IJEA 1GG8A 4CV2A 1Z7EA 5KZMB 3WDMA 3V4LA 1FSZA 3Q8LA 1EG2A 3VV3A 3OURA 4QQKA 2J41A 3E9EA 1DWUA 3HDJA 2EQAA 5B12A 1U8UA 3IIIA 5ICEA 3ICQB 3FAZA 1OIWA 3MIZA 3NUZA 4H35A 4II2A 5ALRA 1UBEA 3UZUA 4KFUA 3ZE7A 2RGEA 1F2TA 4N0MA 4AIIA 2FUEA 1A96A 2Q5EA 4IILA 2CMGA 2HI0A 4RMNA 5ALLA 1ORIA 5CB4F 5HK8A 5JHHB 1NBAA 3F4LA 4YAIA 1DUSA 2UYQA 3KSAC 3KYDB 1GL9B 1L7OA 4A9AA 1ECLA 2X22A 4LJ7A 1DJPA 2NMVA 5HKBA 2P65A 2ADOA 2P9JA 5IYZF 5CBPA 1FDIA 2IT1A 5IDWA 3FGZA 1T4CB 2RH8A 2DHRA 4KK3A 4OBBA 2X0EA 4PLFA 5CW1A 4ZA2A 3WI7A 4E6PA 2IXAA 3E5HA 4QREA 4OUDB 1TLTA 3L7CA 4OKSA 1QGUA 3M6AA 3ZYCA 4XWOA 1XZMA 2AMJA 2H5LA 2I7VA 2AR9A 2XGOA 4F2PA 1BW9B 1TEHA 2ZBFA 1Z0KA 5K0GA 3TZBA 3PXCX 3KR0A 1S2DA 2BGIA 2V1XA 2I80A 3C3MA 3AY3A 2AA3A 4DW8A 1U2QA 1Y0BA 4FKMA 4C4OA 2XCSB 1LPPA 1FQJA 3LY9A 1QH1A 3SK0A 1WDTA 3S5JA 4DV4B 3TFWA 3ELWA 1S0UA 4CKZA 2IKSA 2NZXA 4ZAGA 4OXKA 2X13A 3IO5A 3MQFA 1E0JA 3HGMA 4I1VA 1FP4A 2GJ9A 4M0KA 3N53A 1RXSA 4RPIA 4DYHA 2EG9A 2ZI7A 3REFA 4FYVA 1TMYA 2I8LA 4ZV7A 1E79A 3A7EA 1KIFA 4UHBA 5HZKA 4YRNA 4MMYB 1IM5A 1RAIA 4MV9A 5CT8A 1E3EA 4Q12A 2XLCA 3K0FA 2WYVA 2JAXA 3ZWVA 3H6GA 4MQMA 3BSSA 3E9DA 3ZCPA 4AJHA 2ZJ4A 5CB4A 3Q3HA 3WWOA 1DELA 4BX8A 4YCBA 1Q16A 3QE0A 4JZYA 2ONZA 3DZKA 2RD2A 5F1KA 3DOUA 3O9ZA 1Y5MA 5ALUA 2PZBA 4MLZA 1DX9A 1M75A 2IXBA 4TRRA 1U4NA 3WB0A 1YVRA 1WBBA 1SXJA 1PL7A 1S2NA 2XA1A 1H05A 3PLRA 3ZCXA 3R5JA 1QRTA 1OZ0A 3D7MA 2ZATA 3SC2A 1WXQA 3R4VA 4B48A 5A9SA 3KLOA 4KEAA 4M8KA 4NU8X 2Q6VA 1EDEA 1TM5E 3L93A 2X2OA 1XZIA 1P73A 2AD1A 1BX1A 4DWOA 4XYGA 3CCFA 4EG0A 3LBIA 2QUKA 4LDJA 3OESA 4H0CA 4RMHA 3FB1A 3BXFA 3NKVA 2VJBA 1VE3A 1IY8A 3ROMA 4RMJA 3FSEA 1KDOA 2XWQA 3GV0A 1E98A 1UXOA 5GM2A 5LZ7A 2GZ1A 2QRUA 3QVKA 4IF4A 2E18A 2JK0A 3FMOB 2XT9A 2W8ZA 2PJZA 4MO9A 2FETA 1LV8A 3BJEA 3MRSA 5J2TF 5IFKA 3DVSX 4KVGA 1OFHA 4MLDA 4P4SB 4ALJA 4E2FA 2PU7A 3P9KA 4URXR 3AB8A 5AJUA 1E9RA 3SSOA 5KKAA 3TSWA 4D26A 3LQ2A 1G59A 5LMZA 1K6IA 3QELB 2DZDA 2WDPA 2ZR8A 3DBRA 2Q41A 1RKBA 5EHIA 4A27A 4QULA 4QU8A 4DA8A 2BRUC 4ZN6A 1PT9A 3PC3A 1NRIA 2G4CA 2VKQA 2O5CA 2JAQA 4FOLA 2I4TA 5FOSA 5JXIA 2I3DA 3HB7A 3SYKA 3IXLA 4NEHB 4WCVA 3FMFA 4G1VA 2QE7D 1O4WA 1YJXA 2R79A 2QV7A 5TRTA 1NF8A 4EJSA 2B3DA 3LLMA 2BM0A 3KNZA 3V42A 4QX6A 3T7AA 1WQ3A 5B2ZA 4XX0B 5H9VA 3TJMA 4GF5A 1ES9A 2GYVA 5L3VA 2F4VB 2OBXA 4JBWA 1SUBA 1IHUA 2OPBA 2BKLA 3GAZA 2VFAA 4HWGA 4P7KA 1SCKA 1XU7A 2VTDA 3SHWA 3TPZA 4W1QA 4C2AA 3J81A 3EWSA 2CZQA 3PQFA 4RABA 1HURA 4U2BA 1IB6A 3RAPR 2LDXA 3OCVA 1IMJA 1QZXA 2CN1A 2OAGA 4MDYA 4UEKA 2P4EA 4GP6A 4XLZA 3WKDA 4DQLA 3CEMA 3GRUA 1HF3A 1UEIA 1D2CA 3P26A 3PQEA 4Q6BA 1EG7A 4HGZA 1UPUA 2XUAA 4GX2A 1AMOA 4DV5B 2NGRA 5CIYA 4YDHB 1R74A 4O1MA 2QQFA 4QOSA 4A8TA 4L8LA 3NIFB 4PF1A 2H65A 4CMBA 4Q18A 2JGIA 3URKA 2CL7X 4WN9A 2CXOA 2PMKA 3ONNA 2OBBA 3IQXA 4GPIB 2QMUA 5HRCA 3FBGA 2J30A 2H92A 1NXPA 4YMWA 5CLFA 5JJCA 4B34A 4MGEA 3VU9A 3SBDA 2CYBA 4HPJB 4PRKA 5REQB 1SQFA 2XSZD 4IV5A 1X42A 1ZCFA 4FFLA 3E22A 3B3GA 1MABB 1WUYA 3P4UA 1QO7A 1Z0UA 2AZDA 2F3RA 2XE7A 3GK3A 4CN8A 4PIMA 5AHOA 1HDCA 3JVDA 2HSJA 4MW0A 3V6MA 3QRWA 4CF6A 3EGOA 5LOVA 3QPBA 1ORTA 3L4BA 2E89A 2G7MC 3OI7A 4OLBA 2GVNA 1YU9A 3GLHE 5FA6A 3SBOA 3AIOA 1Q3TA 3NIBA 3O92A 1ZGJA 3IJRA 4MAFA 1JQLB 2QSUA 3FD8A 3S29A 1XC7A 3F9RA 3TLEA 1MEOA 1K63A 4JQSA 5EWLB 3ENQA 5A5GA 3M6IA 5K8JB 4TYYA 2VXCA 3G0IA 2RC6A 3TQQA 1U8CB 3A1DA 4UNQA 3G1UA 1VJTA 4BNTA 4B44A 1NPDA 4L7VA 5TXGA 3A2KA 4UM5A 5ERXA 5JXJA 3JV7A 3KAJA 3OCXA 3BFKA 2PY6A 4B3IA 4B6JA 3BBLA 4KGVA 4NYIQ 4DARA 4OJYA 3AVPA 2HL6A 4JNCA 2ZS7A 4AN1A 1Y8QA 2RK4A 2Y9PB 3EBPA 5CTAA 3RKSA 1U9IC 1HE2A 1NNUA 1Q92A 1VB5A 3L7JA 4CMGA 1NJ2A 1NKSA 1S89A 5T8KC 1KYTA 4KLNA 5BMVA 1YZQA 1EDBA 1GPMA 2FKNA 2B4RO 2F1RA 2GAIA 2PK3A 3P4XA 1NGSA 2YJ5A 4L78A 3SIWA 1Y42X 5FOTA 5C37A 2PSJA 2IHYA 3ZK8A 1YZFA 1M72A 1CRWG 4YWJA 3CZMA 2V7XA 3SR4A 1FRNA 5D5PA 1CRLA 1CEYA 4O2AF 3LUGA 1CERA 3HBMA 4TTVA 1B74A 3D3WA 4XCQA 2BE7A 1V5GA 2ZIEA 3QEBZ 2G0AA 5CJ2A 4H6PA 1XNRB 3G2LA 4KIUA 1HH4A 2OO7A 5D5HA 1SKYE 2PR2A 4MTCA 4N12A 3S7ZA 5GADl 4LVOA 3JW8A 3D5EA 4GM4A 13PKA 1WB5A 1SBNE 3LH5A 4OI4A 1Q77A 3D31A 1WR8A 5CP8A 2GVZC 3AI2A 4QBIA 5EYPB 3RJ5A 3RFUA 1N5IA 1JSRA 1KVUA 5JBIA 1U63A 6PFKA 4Q0MA 5LZ2A 4G2NA 4NDNE 5CVUA 4XUCA 2BGGA 2PX6A 3C15C 1AGXA 1JLLB 5DEOA 5CFQA 1RI5A 1Z82A 5L3QA 2G06A 2BJWA 1EGMB 3SZGA 2UYCA 3HB0A 3JAMA 4D8XA 4KRGA 1TU3A 3OQIA 1HE4A 4ZAWA 3SD7A 5JXHA 1X8XA 2ZS8A 3GFGA 1W36D 4WNIA 4RNCA 2I4LA 2BMAA 1DLJA 3TM4A 4P4LA 1PD1A 2YQZA 3GOQA 4L73A 2YVQA 4XGIA 4AG3A 4PX2A 4EQZA 2Y1WA 3LKDA 3PSAA 4KUHA 4A0FA 5ER9A 1VJRA 3PQ5A 2ADMA 1AN0A 2AQIA 1BJRE 4ND6A 3KT6A 3GJRA 3S8MA 3D7NA 1P3JA 3K8OE 4HNGA 5F1PA 3R7BA 2II6A 5F7JA 4BN0A 3IJPA 1NUHA 4XVHA 3GHYA 1JKIA 3DSRA 4CIAA 1OI4A 4RQUA 1PLLA 1M8FA 4G5OA 2PUAA 3PDWA 1P4AA 2IDKA 3E0XA 4O2AA 4WZAA 4OQNA 3RVSA 1U8FO 1W0JD 4WESA 3V4OA 4DIFA 1FFWA 2OC4A 3JZIA 3AETA 4OQZA 5B57C 2MMCA 2B1QA 3E7DA 4YACA 4CM4A 1JFSA 1PK9A 3JQ9C 5LMNB 1VSQA 2ZREA 2ZSAA 2BFBA 4FWBA 3SC4A 3KYCB 2EFGA 3SFVA 3ABQB 3V7WA 4EDFA 4WBNA 4GYKA 5FTLA 5L6LB 2ZM5A 1H6CA 1N8SA 4RA9A 3HDVA 4IDGA 4RKQA 4YJ3B 5IKOA 4EABA 1RC0A 1KQ3A 1X0XA 1L3IA 4PSDA 4AWBA 1KI6A 3LZ6A 3AB3A 3M1LA 5AIAA 5GVSA 4BS9A 4AJ4A 5A4DA 3EMBA 1HT3A 3LOUA 3IC5A 1CUXA 3C5CA 4EYKA 2PD3A 5E7JA 3CONA 3IFSA 3IUNA 1SOAA 3MS7A 3FOAA 3DAOA 3VR6H 5HQ3B 4J4HA 1KFJB 1NNSA 2ZR7A 4RXTA 5EIOA 3FKQA 5EA2A 1LKZA 1PEKE 3C8UA 5HMLA 1WETA 4Q4JA 5B6PA 5I5GA 2OFFA 3UB2A 3K0HA 1JILA 4IMIB 4L0DA 2X5XA 4YJ2B 5TIIA 3U56A 4RJJA 4PFQA 2ZCJA 4LVCA 4YCDA 2OLKA 5DSZA 1J5PA 5CK4A 5ANRB 3E35A 2YZ7A 3FR7A 1E1QD 3UV3A 4EZBA 1SUAA 1Y1PA 2DKOA 3OIVA 4EB3A 2CJPA 2ZVPX 2FOIA 4REQB 2AX4A 2PG3A 4TSKA 1J90A 3I3OA 2OAP1 4X20B 3ZKAA 1BVHA 1XZKA 3AW8A 2G09A 1HG1A 1JVNA 2IU6A 3LT4A 1M1XB 4JBLA 5FFNA 3TLMA 1PV2A 1E3SA 1TYEB 5ICCA 1PO7A 2DERA 1J33A 1AZLA 3ADKA 4PYQA 4E3ZA 2PWZA 3EWAA 4MW7A 4TVSA 1KMHB 2W5UA 3O90A 4KAJA 4RSRA 1DZIA 2DQZA 2LCQA 1QC5A 4G0ZA 3KSZO 1US8A 1G0OA 2RJ3A 4RLHA 3RYHA 4DXHA 2O1SA 4ASUD 3QG5A 2E4ZA 2X0FA 5K0JA 1YBFA 2BCEA 2GCOB 3QLUC 4PTYA 3VR6D 1TAHA 4KFTA 4N6NA 1CZLA 4YGYA 2P6UA 2X3UA 4BQPA 5JSQA 1MX9A 4HDAA 2P90A 4MYCA 2ZWMA 4IINA 5HKOA 2XZDA 2DJIA 4QPNA 2WUWE 2IDMA 5L3SB 2D7DA 5ISMA 2IEZA 1RMQA 3AX6A 3R3WA 3S2IA 5K0CA 4OGKA 3SC6A 5LLTA 4K9PA 3VOAA 3QOXA 1P8JA 3I92A 3K8ZA 1JP7A 3QKSB 3K70D 2XMPA 5SV2A 1D9XA 4UW9A 4ABTA 1DAEA 2H00A 2F1KA 2I3AA 3C3CA 4IM7A 4TKMA 2FWBA 1T5LA 2QY6A 2YXEA 2Q9BA 1TO1E 3A9CA 3B5EA 2F8MA 3G23A 3LBFA 4J2TA 2WKPA 3OLXA 5H4HA 3H1EA 3FMPB 1AX9A 2C9MA 4M6WA 3EXIA 3SE0A 2NNLD 1LTQA 1OPRA 1U7PA 2M98A 1E9BA 2QDXA 2ZYGA 3EUAA 4HS4A 5FD8A 3RJZA 1DCKA 1JV2B 3QV1A 2QLJA 4BEJA 3IX7A 3K7EA 4G8DA 4MUKA 4RZSA 1W36C 4HWKA 1CUHA 4JJ7A 3TSAA 1UBUS 3FTPA 2B30A 3DT9A 3OEHD 2P8JA 4Z2AA 2ZJ7A 4GOXA 2PT5A 1A2BA 1HEIA 1NBMD 1ILEA 3P9RA 4EPWA 5T7BA 4F4DA 3IPYA 1NYQA 4ZCSA 3NDBB 5BV1A 1YQ9A 5J58A 1GCAA 4RZQA 4CMAA 1F6DA 1KVTA 4JAVC 2E82A 2JARA 1Z06A 2WP0A 3BWCA 4HWPA 2ZTVA 3HO6A 1R50A 1FDVA 1GUAA 4P4TA 4CL2A 1L4EA 3GP8A 2PZFA 3H3FA 1U4SA 4GGOA 4LMAA 1UJNA 2AJCA 2REQA 5FBQB 3O8LA 3REGA 4WHMA 5I3ZA 5TY0A 3LC0A 1COWD 4FYKA 3VTKA 4X1YA 2W4MA 3D0QA 1A8IA 3VR1A 3JWGA 2WE7A 3VMMA 1ISSA 3F2VA 1W5BA 1X1RA 2NUAA 3I8SA 4B3CA 3DDCA 1PAUA 2ONCA 2QGFA 4K88A 3WGVA 1S8OA 4U2EA 1E0DA 3JRXA 4G25A 3D7RA 3PNKA 3NO4A 4PNHA 4NBLA 3VZDA 2UU9B 3OKCA 1KI3A 2HXYA 4X6UA 4AWXA 1N8KA 1YHZA 4UAUA 1ULBA 5LUBA 2W6MA 4LHYA 1YJ5A 3JQGB 4YCLA 3HK2A 2J9FA 3BH6A 4XRRA 3WK6A 1CUEA 2H2GA 4UVIA 4RIGA 3I6MA 4CG3A 3K1ZA 2Y1OA 3EB9A 1LBTA 5JG7A 5BSTA 4OQLA 2R6R1 2ROQA 1MB0A 4ZMBA 7REQA 2GN8A 3A4YA 5CFNA 2H57A 3W90A 2I03A 1PWXA 4FDAA 4KDFA 4NBTA 4D74A 5DBEX 2CE7A 1V26A 5G1OA 1M67A 2AEFA 4CI0B 2X1LA 3VO2A 2X9NA 1PUIA 1RI1A 4EFMA 1HZZC 5FUMA 1J23A 2VQ3A 3ZE1B 2C5FA 1XKQA 4XM1A 2IYZA 2X0NA 1B0AA 3Q0IA 1Y6JA 4RLSA 5ESWA 5FI5A 1IE3A 3FUVA 3WICA 2C83A 4E46A 1UUFA 2I71A 5KOJB 1V3TA 5EGSA 1Z6QA 2DC1A 2Q1YA 4MYRA 1OJLA 5AWFC 2YHUA 4AX8A 4BE7B 2JD1A 2A78A 5C5EA 1ZHOA 2ON6A 1N4DA 2H1IA 5LQJA 5GGXA 5ECDA 5TX7A 1C14A 1PQPA 1R2QA 4JGGA 4LA4A 3ZOKA 4BFTA 3W1WA 1JMVA 5HYVA 5JW6A 3A10A 4PIVA 3DTNA 5ICGA 1V7ZA 4JEUA 4MS4B 1N6RA 1KXZA 3CRRA 3CU5A 4MS3A 4BFCA 1IY2A 3HCRA 3UNXA 3JZDA 2X2EA 3W4IA 1KVRA 1NZDA 2G3YA 4H4DA 2ZAGA 4J2OA 1PVOA 4BO0A 1ABFA 3LE8A 3N2EA 2NSLA 2IVZA 2HNAA 4DB4A 5CFPA 2C4VA 4Q37A 4OLHA 2HTEA 2Q1TA 4I4LA 4INZA 3GFFA 5HIMA 3HJHA 3DAHA 3F3MA 1MOSA 3CY6A 3T9FA 2H8KA 2NU9B 5KIAA 1CY2A 2B69A 1KK1A 3CR3C 4WZBE 3OM9A 1T6BY 2CC2A 1JE0A 2FW7A 3QWBA 4PSVA 3VHXB 4E3WA 5LKAA 1LI4A 2OXCA 3F4BA 4V0OA 5BNIA 5CVTA 4ZO8A 2IBSA 2Y4NA 3ENVA 5MGNA 1YS1X 2QL9A 1JX6A 1I0LA 2HDHA 1GZDA 1UKAA 2A86A 3BF8A 3C1UA 4FE4A 4HEA1 4OHKA 3UO8B 1GP2A 3P9PA 4FM9A 4K86A 1QNFA 4ESOA 1AQLA 1G3MA 4UZSA 5DWQA 2BI8A 4X85A 3C1TA 5IDXA 4JLUA 4ZT5A 5JS8A 2AYZA 4OQXA 3KBBA 4DG8A 1BTOA 1JR4A 1DS6A 5FCDA 2JLAA 2FFQA 3CEHA 1I36A 4FR2A 1YCFA 3LYUA 4EECA 1AKUA 3ORRA 4L7QA 3K15A 2B4TO 2C00A 5AW8A 2MSKA 2P69A 2AFIE 2OCGA 2F64A 1YDHA 3I12A 2Y0CA 4IGFA 3OTQA 1A82A 4GLLA 5ELXA 3C74A 4GKKB 4UVHA 3UHAA 1ONSA 5J1TB 4RVCA 2HWUA 3FHOA 4O4JF 2W2QA 3WSWA 4I6EA 4MEBA 3LOQA 4U8HA 5AT1A 4GOND 5FLKA 5M3BA 3T7RA 1EQAA 3ZK7A 3A3PA 2ZTSA 1XWFA 4RVFA 4AJ1A 3ZCUA 2Q4TA 4O1HA 1R6TA 2IE0A 4X6YA 1V8ZA 2V6MA 3IAAA 4TMXA 3FWPA 2IRWA 2PQ6A 2PWBA 4JSTA 3B2QA 2P78A 3D4LA 3WLIA 3MHPA 1CHNA 5AICA 3Q8WA 3NVDA 1RJ9B 1L5MA 3TUZC 4MWSA 2W2NA 2A7XA 4CKEA 4A8JA 4JBXA 4J49A 1XWWA 2AN4A 2XSZA 2O3TA 3A4MA 5ALJA 5F98A 1W4ZA 1YMVA 3AEYA 5GJWC 2V7EA 3PNQA 3SCZA 1Z5NA 1SCQA 4ZZIA 2ZUFA 621PA 4X93A 5KCMA 1ID1A 5ED0A 5LQKA 2VAXA 4Q3AA 4YGXB 1BKDR 2GBLC 1ECPA 3G82C 1AXRA 4OO3A 1KR2A 1SUPA 3PXAA 2GZ3A 5I9MA 4EF4A 4IVQA 1SBCA 3P0HA 1EK0A 2FX5A 3Q8XB 1C7ZA 2B0JA 3SQWA 2Y0BA 3H4IA 1K86A 3EMDA 1IL0A 3CUTA 3QBTA 2WWVD 3HKCB 1FDUA 3BT7A 5FLYA 4JBNA 1HPLA 2HRQA 5JWRA 1NXWA 1W85A 1F6BA 4CLRB 2X0KA 4NE2A 2K6GA 3ZZ1A 1R6BX 3IDFA 1I4DD 4XVRA 4Y30A 1VL1A 1KRWA 5JHGB 5M34A 3EPRA 5K51A 3ND8A 4XTCS 5E4TA 1FIUA 2JJ1D 2YHIA 3F6RA 2HUNA 3KTAA 5A0FA 3OZ7A 4I8DA 2EFYA 3ZI4A 1QB7A 2HO5A 2YWFA 3D3QA 5AVKA 4TKLA 5HG0A 4BNDB 5J4YA 5KC9A 3GEMA 3DJFA 4A5SA 1GUDA 4MKXA 2ID8A 2FE4A 1MOQA 4RD3A 1RJFA 1TLLA 2G76A 3MJ4A 1T9GS 3HBFA 3HB1A 3ZBPA 3EHEA 4EPYA 2QE6A 4YV2A 5LR6A 1ZNWA 2DHDA 1XQWA 1NZFA 2HQBA 3GQVA 4H0NA 2BTQA 1N6LA 2FWIA 3ZXYA 2GKGA 2M32A 3D3NA 3LAWA 1UFQA 3BD7A 5JAUA 3ULKA 2AFHB 4MH0R 1FFXB 5HILA 3I52A 2XAAA 1CQIB 2YYAA 1E58A 3L41A 1J39A 1T4GA 1ZVQA 1WG8A 5AI8A 2BZSA 5T67A 4YAUA 3I05A 1WPQA 1JDUA 2ZLBA 3MUNA 4L4YA 1WIWA 1SUCA 2QF7A 2D7CA 4FI3F 1FVOA 4BV2A 2D5CA 2PO5A 5BVGA 5ES4B 3PRHA 3L7DA 1Q1NA 1WF3A 1DARA 1U2DC 1L4UA 4ZYUA 2F67A 1P7VA 2IZZA 4CT0A 5JDIA 1RQXA 1HA3A 1CUWA 3UK7A 3PT5A 1R00A 4NFHA 4D0RA 2AC7A 5AM5A 5EGNA 1JA1A 2EZTA 3KEOA 3N8HA 5B3JC 4PYLA 1OVGA 1UAAA 2F8SA 3NG1A 4FUQA 1J42A 4J1NA 1M83A 1MJNA 3L6BA 4CUKA 1YR3A 5JTUA 1MT0A 1YGPA 2HDOA 2AQKA 1DIGA 5H3HA 1UDRA 3DMRA 1MR3F 4DLNA 1KAEA 4L08A 2FPWA 4WJLA 1TT7A 2CSXA 4ETIA 1L7EA 3B82A 5CLLA 5BN5A 4A0GA 1ZS9A 3A6GA 3IEUA 4KL8S 2CV1A 2G6BA 2NYRA 2B9EA 2GUWA 2R66A 4FX2A 2DR0A 3RSLA 3GXBA 1V9SA 3TOCA 4PO1A 3O8CA 2YFYA 4BXOB 1N6KA 2PV0A 1UWLA 3BSWA 4LMPA 3I0ZA 1W0JA 3NCHA 3Q0TA 1CEXA 1RLTA 3R5KA 4J4TA 5K3EA 4IQ8A 1IHDA 3WGOA 3EX7C 4NFLA 3C24A 3V7YA 4NXMB 2GK4A 4DLRA 2WTEA 3HZRA 3D64A 3RRXA 5L95A 1QMGA 2DH6A 1T29A 1ST3A 1XHFA 2QMOA 3ET5A 4HVTA 4LWZA 2Q4OA 2R1ZA 3PQ6A 5LU8A 5C7OO 2X42A 3AXSA 2FOXA 1YVPA 2Y27A 4O3FA 4W7HA 5JXGA 1JQAA 2H3HA 5TEWA 3G2OA 2EGHA 4PU0A 2WJZB 4IO0A 4XFKA 4RHFA 3RS3A 3R8FA 1DBRA 2HGSA 2VJCA 1JG1A 3K6KA 2QI9F 3O2QB 4MVXA 4XH9B 4PN7A 3VPFA 3AONB 3PQ7A 2IH2A 5EZYF 3ENNA 3RVBA 3W77A 4WZ6A 4E22A 1R5NA 2PBRA 3DDWA 1Q0RA 1PG0A 2BFEA 5HA5A 2R4QA 2R6CA 4RBNA 4N0PA 2HTFA 3AF4A 4Q1EA 5AJXA 2AVNA 3W2EA 2DF8A 3AHJA 1MLDA 4AULA 2DU8A 4BMOB 1EFCA 1UEXC 4CL8A 5FH9A 5I7RA 1YRBA 3WGNA 3LMKA 4F3YA 4FHZA 4B3TB 2A30A 2X77A 4OVKA 2D5BA 2K2WA 1I3NA 4P86A 4YT5A 1OLSA 3SMQA 2JLZA 1Z6AA 3QV2A 2IEAA 2XIQA 2IZ1A 4G89A 5ESRA 3G7SA 1HQYE 1S3FA 4M7WA 4DCTA 2C2MA 4P3YA 3A4NA 2WSIA 5EKUA 4KXXA 3JD2A 4DIOA 2Q5JA 4WSOA 5F21A 2X9VA 3QW2A 4ZOCA 3WLEA 4RQTA 4UHCA 4OJKA 2WVJA 1UDXA 1K5GA 3WV4A 4I3FA 2CLCX 4P5DA 5H3CA 2GPNA 2I1WA 3T94A 5HGJA 1S3GA 1ZBDA 2MINA 1RI4A 1RQRA 1AQIA 2YHSA 4OKNA 4DSUA 1M2NA 4HMOA 4GGMX 4XJSA 2BDTA 3PUJA 5KTKA 3B85A 1BHQ1 1J8VA 5FUBA 3ORSA 4JVSB 3BQNB 4RF2A 5IJAA 2NVUA 2EU8A 3Q9LA 4KCGA 4XVCA 4B2IA 4EJ6A 4ENQA 3QX9A 2BSAA 3SVLA 4NU6A 3R6WA 2HSZA 2JGDB 1UK7A 5C46F 1G5HA 3SDBA 3JQDA 1TJPB 1AUVA 2WINI 4FYWA 2AZXA 4YLGA 5FQOA 1O4VA 4HZUB 5EZYA 1LNQA 2BCJQ 3L6UA 2X0RA 1XPRA 4PPNA 3Q40A 4R8MA 3GRPA 1TKBA 1KZGB 5JFOA 4WOCA 4DY6A 5IHXA 4GQAA 1SVMA 5L6MB 2V59A 2O8EB 2NSDA 1FJXA 2HMVA 2YWDA 3BGDA 1CR6A 5IAAA 3ZDDA 2H4ZA 2JFUA 1WHSA 2VAWA 1OKKD 2ECPA 2GCNA 2VHQA 4L0QA 1F0NA 1TA9A 1U04A 4UHDA 3L92A 4CEJB 2QRVB 3DBHA 1TKRA 5EJEA 721PA 2CGEA 4F3TA 1GIAA 2PA3A 3GLFA 4M9ZA 1N2IA 4I6JA 3JVIA 1L3CA 3D2AA 4NJMA 4DJJA 1JXAA 2MYTA 3K9FC 4B31A 3DDNA 3HMKA 4RPJA 4OHXA 3RU9A 1SO8A 4NOKA 4DKJA 2JJYA 2ZB3A 1DHTA 4FLMA 3YASA 1E1YA 4HYTA 1HZJA 2WILA 4AWAA 2OL4A 5KU1A 4CLDA 1O96B 5E6SA 2JI9A 3JR3A 4LYAA 3AJ9A 5AOVA 1AA9A 2Q27A 4JBYA 3B9QA 4D4LA 2J3DA 4YRGA 1QFYA 5IXJA 4WGFA 4EHDA 2EJCA 1P7YA 1BDIA 3T8YA 2Y8EA 3CR8A 1V6SA 5HRUA 1CJTC 1BD3A 1T2DA 2DY0A 4AYXA 1Z45A 2PZEA 3MOIA 5FPSA 4EEKA 4AD8A 1LVHA 1XD8A 4OBWA 4L4RA 3TPCA 1HI9A 3WAKA 3UT5A 3M34A 5EVJA 2IW1A 1QGOA 4C5BA 2P75A 1TU4A 1W49A 2PHZA 5ALGA 4MI6A 1I2ZA 4YCCA 3TLJA 4JJGA 4CEIB 1L5VA 4KWIA 3BHNA 1EVQA 1COWA 2EX1A 2PJUA 3WAGA 1W30A 3AR5A 4BPRA 1YZNA 2V45A 2QD3A 2A5JA 1U98A 1KJYA 1X1EA 3E61A 4TS9A 1HDEA 2AHRA 2QM7A 3CR7A 3RRFA 1Z07A 4COKA 3NWEA 3NT5A 4G4SO 1JJVA 1QBKC 2Z6QA 5HUJA 3DOJA 5EC8A 3NBMA 2OA0A 2QUAA 3BDIA 3AVVA 2VL7A 5KYXA 3JU3A 2IYVA 1VI5A 2KS6A 2O9JA 4YRKA 2HMTA 1Z3IX 4IYJA 5TMBA 3P19A 5GZ1A 3KOWA 2E4WA 2PUHA 2GYYA 3GZJA 2BHTA 2V6IA 1D0SA 3GUCA 5TJ9A 2VTBA 3A4VA 1IHPA 2UZ1A 2ZSDA 3HKDB 2G77B 3IA2A 3PDIB 1WPGA 2CB9A 3OY7A 3DAFA 4IZOA 4Z9YA 3UJAA 3L8FA 1SAYA 4A16A 4RYLA 4NYJQ 2B4QA 1O9HA 1NBME 4IJ6A 5EG5A 4HAUA 4D96A 2H59A 1PEDA 3HV0A 5KTYA 2WTMA 1ZD4A 4NS1A 1ISIA 1RWPA 4S3MA 5DSXA 3TVDA 4ZAZA 1GV0A 2I5PO 2OM2A 4G8CA 4NOJA 4PGAA 3GFBA 4Q3OA 4S12A 4I5IA 4D42A 1RD4A 1TAQA 3VZCA 4P31A 1ZC4A 1SUEA 1X3LA 4DA4A 3GJXC 4ZO7A 5TE9A 4GAEA 3ETCA 3D8HA 5B2FA 2CD9A 1V3UA 4RS3A 2IYNA 5DKFA 1YJCA 3N2NA 2ZCVA 3OHMA 3R7WA 3G6KA 1G8HA 3Q7PA 4IS2A 4YI5A 1JQ3A 4P35A 4RPHA 1X1DA 2QLTA 3NOXA 3DAPA 1OFTA 1QXSA 2HAEA 3IBCA 4ZARA 4JYPA 1U9JA 1YB6A 4KR3A 5I45A 4KR7A 1E4YA 1YDEA 4G37A 1FBNA 1XRMA 3LHKA 3DGEC 4R2HA 5HUQA 4FZ3A 2QXUA 4K40A 4EIWA 2ILVA 1OI2A 3T9AA 3RASA 4EY5A 3VA7A 3D6NB 3H5TA 4JYAB 3UMMA 4DV2B 5AVRA 3WBFA 4HYQA 4LY0A 4QRHA 1U2RA 2SICE 5KQGA 3CG4A 4MYTA 1KSGA 4LF7B 2J0EA 2C0PA 4U3JB 1JPVA 3RBAA 5AW2A 1L4HA 3R40A 2JGEA 3W2HA 3EGXB 2HU2A 3G49A 3MCZA 2HMYB 3I53A 3GDHA 2BHNA 1ADYA 4QTTB 3V4PB 3RAFC 3V2HA 1XXHB 1M0SA 3SF8A 3ZV6A 1QB8A 3FDZA 3O2JA 4ARUA 3ZWNA 3QBVA 1AK1A 4N5NA 4J2HA 3BMCB 2F43B 4NONA 3O7MA 5LQMA 2DBYA 4F4CA 3K9CA 4AB1A 4B1FA 3KJXA 4QNRA 2VDRB 4FGJA 3NYWA 2REXB 1PQYA 3GAFA 5FUXA 3PUWA 3WGYA 1K88A 1IY1A 3C3KA 2Z4RA 3ZWDA 4AO7A 2JZOA 1QTIA 2FV8A 2YJ3A 2DFPA 2PRSA 2HJ9A 2Q0QA 2VCYA 4NFSA 4MHSA 3R9WA 1KMMA 3Q1LA 4LOHA 4G4IA 2J4FA 3IA7A 4X8LA 2I33A 4XPIA 4F93B 5DGHA 1CPYA 2VZEA 4NAUA 1ZUNA 1ZXXA 4OHVA 4GXTA 4U7PB 4I99A 4MR7A 3SF0A 4ZIRB 1GZ4A 3LKVA 2GD2A 2QX6A 2ZT7A 5K8CA 5D7BA 1JU9A 1V41E 2HBQA 2YY6A 3B1JA 3GVPA 4C3UA 5JARA 1ORHA 2O4CA 3S2YA 1I1HA 2WWHA 1CUYA 3TI7A 3BJZA 4C0XA 1YK1A 3AL2A 1GUBA 2OHVA 5AJZA 1PFQA 1Y1QA 2VTVA 3EVBA 2AIRA 4FCVA 4JMPA 4Q9DA 5L7TA 2O7QA 3OM1A 1V1RB 2CNBA 1QHHA 1WXDA 4E09A 4DIEA 5JNWA 2ZPTX 1NUQA 2WAAA 3C3WA 3GT7A 3IMKA 4FDMA 5AOAA 1W5AA 3STUA 5M7EA 1DKPA 3U7RA 2KX7A 3S81A 4WACA 1A77A 3H2BA 3EAGA 1JDVA 4M98A 1N6IA 1C9NA 1CD5A 1F2VA 2XQKA 1GQRA 4HTFA 3KKKA 3QY9A 2Z58A 1TFRA 2ZJBA 4LNUB 4K7JA 2MSEB 1WV1A 4NENA 1W5EA 1WKBA 3KZVA 4J1TC 3H4VA 2JBWA 2OGSA 1KZ6A 2C7OA 4NBRA 1SKQA 1XROA 2WR8A 1AO3A 2HFJA 2HY7A 5DHAA 5DX0A 1MEEA 2VHUA 4EWLA 1QAMA 3H2KA 2CFCA 4ER5A 4K8RB 2P4UA 4IIJB 3MRVA 5AK4A 3ZDZB 3K0AB 2GBFA 3UEOA 1JEQB 4LZLA 1VMAA 2Q3DA 1QK5A 1RHRA 1E5LA 3V8MA 3FGOA 2W8BB 2LCIA 1GT6A 4JGBA 3ETNA 4ZQIA 1Z17A 4Z9FA 3C6MA 4CIYA 3WMRA 1ZHHA 3LA8A 4C4YA 5J4VA 3DE3X 3OMLA 1NWCA 1GNVA 1BN7A 1CNEA 3H4TA 4LBVA 1A71A 1Z5GA 3O3CA 3T0IA 2JJ1A 4R01A 3IMCA 4A8PA 1PSWA 3WL7A 2IUUA 5EWJB 4B74A 3QVMA 2CEAA 2QJFA 2OAEA 2VI5A 3U9LA 4BVLA 4OXRA 4N5IX 3T3DA 4GZLA 3WFJA 1U3GA 3V4SA 3MWEB 2ESRA 1QIDA 1KO7A 3EVNA 5WRFA 3PHCA 4B8YA 3KYDA 1L5FA 1N2GA 2CLDX 3OLWA 4YA6A 4EJFA 1AK9A 4BTVA 4WBSA 4I9GA 4KQHA 4MRSA 5ILQA 3DWEX 1SUIA 1PK7A 4L22A 3U3ZA 4KHZA 4HRVA 5AQEA 4ATNA 2YFHA 5JY6A 3BWDD 1T4CA 2LV8A 3OQPA 5TPZD 4AT1A 1WZUA 1A4XA 1QHXA 1APBA 2L18A 3JVVA 3IB6A 4GMGA 4OUDA 4TT3D 4DDMA 3I4FA 3OZBA 5K0TA 3QSGA 4LHZA 1WSBA 4MCAA 4OY3A 1EWQA 4KQ2A 2H9AA 1KJQA 3NHPA 4H7HA 3W1EA 2PD4A 3DTVB 3HSSA 4P4UA 1BW9A 2YZ2A 1SHUX 1P5HA 5FV7A 1CS0B 1OWLA 4Q66C 3ZJ4A 3KB8A 2RIPA 1EB8A 2XWJI 4OB6A 3T9BA 4O59O 5IT9A 4N41A 3QKRB 1IJKA 1WUKS 5J3JA 4R7TA 1SVNA 1T0PA 4LF6B 3JQAB 4BKQA 4QJ5A 4L95C 2RGBA 1N2XA 1XMSA 2JD2A 3DEHA 3HCNA 4LDQA 4YMTA 3GJ0A 2E5WA 4BLWA 3GF4A 5JNLA 1W5SA 5HCUA 1MRZA 2QP4A 1UT8A 2QT0A 2ZDGA 2B25A 2NZ2A 3BGIA 1I80A 3D59A 4KFSA 2QRGA 5ER6A 4B85A 2H0AA 4MUMA 2APJA 2F1JA 1ZA1A 3LWDA 3OX3A 5K8TA 1HK7A 2D5LA 1QYIA 1D0IA 1UZAA 2BELA 2IP4A 5J43A 4DA9A 4LV8B 2G36A 3BH0A 3VC1A 4DV6B 2VHVA 3ILSA 4MWBA 1DCTA 2O8BB 2O7SA 3EIHA 2OBFA 3OX1A 2PWPA 3QVUA 4QT0A 2X6TA 1VYTA 3EGVA 4R2LA 4CGZA 2FAXA 2YR0A 4ZAYA 4EGSA 4A15A 5TARA 1AQJA 2VHTA 2DP4E 3QHPA 4GXQA 1IQ0A 2WIGA 5F5NA 4BWGA 1UFOA 2NV6A 5EIBD 1C9DB 1Y34E 4KI0A 1VHTA 4J91A 3QPAA 1SQGA 4G9BA 1XEWY 1SOMA 1KAHA 2FWNA 1JB1A 1E6LA 2NO6A 1K08A 2DKNA 4QTZA 1ZIXA 1U6JA 1T8PA 1TTQB 2CFRA 3H7AA 3OTGA 4GR5A 5F35A 3RS2A 1YMQA 3TRDA 3DEFA 1I6KA 4RY9A 4ENUA 3QVLA 3CXRA 1UDCA 1W25A 4Z1MD 5EIXA 3IEMA 3JWIA 5AKZA 2R4UA 1VJ5A 1S7CA 4LJ4A 5A71A 2J4CA 1GNSA 2W2KB 3VYTB 3NHRA 4K6CA 4PLVA 3PUYA 3WWZA 4FCCA 1YAHA 2YUIA 3A27A 4RM2A 5FO0A 3CE6A 3E5RA 4Q9JA 1DDIA 3EAFA 2C2GA 1PWZA 3NOOA 4OGGA 4Q16A 1OT5A 4P4SA 4YRQA 4LOAA 1QIJA 1V35A 1XLUA 4G67A 1MB9A 1OTXA 1EXDA 4QVKA 4RQBA 2ECQA 3TR6A 3QELA 1RKUA 2YZGA 3TRFA 4FOPA 4GI5A 1YR9A 4RPKA 2J7PA 5K0BA 1Q14A 5DM70 4HC4A 3RRYA 3K0CA 3LP8A 4HLQB 1KK2A 1UKEA 4I08A 2H7CA 4P3OA 1YONA 2R65A 3C7DB 2ZRFA 3EGIA 3L7LA 3WLNA 1XVIA 3VPDA 1NULA 4DA7A 1TF2A 1Z36A 1RJGA 1NOIA 3HR7A 2WF5A 3KQTA 3D5QA 4XX0A 3T7KA 2QAGC 2VYVA 3AHFA 5LYJF 3FIUA 4LJAA 2PS0A 3GBSA 4PNEA 1G5RA 3KXIA 1DU4A 1XJCA 4UAJA 1SQSA 4NAHA 3CT4A 1FU4A 1V6CA 1ZM3A 5A1TA 5IVKA 1ND6A 1T9DA 2PAAA 3BSYA 4DANA 5DCLA 3B6ZA 1FQKA 4WIAA 1KZYC 2IF2A 3INRA 4YHHB 2H1SA 1GKUB 4ENTA 5K0FA 1S2OA 4HNRA 3BTVA 5DV9A 5JATA 4H6VA 2FLKA 2KSQA 3S28A 1P1KA 5COAA 3KZMA 3VI4B 2OP0A 4MB0A 1XMPA 2GJ8A 2AYYA 2Z4SA 5EXXA 4QOFA 4NDZA 1EESA 3I01M 5DN6A 4NZ9A 2VR1A 4RGVA 5IX8A 1A1SA 5BV0A 2YKGA 3UXEA 2WHPB 1KARA 1USIA 1XDUA 2QLBA 4WL0A 1FFSA 2HBRA 3BOSA 4TRJA 4E6EA 2OMKA 8LDHA 4DBZA 1LLDA 5K0NA 1G2IA 5AKLA 4RADA 3HEMA 5REQA 1MN6A 3TOSA 1MABA 3D2BA 3HBNA 3A1TA 4YMSA 4RAOA 1IAVA 2FE1A 5JZMA 1SXJC 3FMIA 5P21A 3BHMA 3KTDA 4G1BA 4XAQA 4ZVQA 2IW3A 2IITA 2EC5A 5KOYA 1MJGA 1HLDA 3P9NA 3TPFA 4OGWA 5LMUB 4HDKB 1P2FA 2RK6A 3E9ZA 4LC1A 5ITWA 5F9HA 4KUGA 2HSGA 2BL4A 3HCEA 4ZO4A 3AVOA 2FZWA 4QOIA 2CJFA 3STXA 3BXEA 1XLTC 2RHDA 2XR1A 1KDVA 3FTNA 4H7PA 4OPMA 5EWLA 3ZU6A 5FUWA 3O3MB 1DKQA 2GRJA 3QVTA 1ATZA 4QDXA 4IWNA 3HR8A 3PQCA 4FOTA 4NKRA 3ND5A 2QTFA 1DBQA 3GBVA 3WHIA 4CJXA 1ZK3A 1E59A 4HEJA 3SX0A 5MHTA 3BMOB 2C5LA 3JQRA 4B3XA 1J7JA 4F9FA 5ALQA 1IC6A 3UICA 3MXTA 4F06A 3MB5A 4QUIA 4UXHA 1BMTA 2LRHA 2TMDA 4AJEA 3JQBA 2ZTUA 1RXCA 3CW2A 1K27A 3VFDA 4NH4A 4Y6SA 2QR5A 1Z2DA 1Y80A 2DWPA 4F12A 16PKA 5KVCA 4K05A 4ZTUB 4AW9A 1T1EA 1Z26A 5ENDA 1HFWA 1SC6A 4PQFA 3AV3A 4OAPA 1AS0A 1I51A 4MAMA 1PR0A 4CIWA 4K6KA 4DA0A 1N34B 1LS6A 1J8FA 1G66A 2JFQA 3PFHA 5BOVA 3EXG1 3L1JA 4PPQA 2ZYHA 4EJSC 1Y9EA 3ZNQA 4ZVUA 3SQXA 4ZJYA 5C1DA 4W7SA 4MCHA 4W5RA 1V5FA 3G7NA 1JEYB 2H9IA 5AVQA 4GBGA 4GYJA 5JAIA 1ZMRA 3WG9A 1Z7GA 4WINA 2RGRA 3OMWA 3GH1A 4UMFA 4Z53A 3OOJA 4YCAA 3EARA 1FNNA 2V8BA 3HA3A 3KKEA 3PICA 4YJ3F 1B26A 2WUEA 5EYPA 3RYFB 2EWMA 1RQ7A 4I7EA 2GF9A 5FTNA 3DOIA 1JLLA 3KSDO 4ZV9A 4TRNA 2XMGA 3GP5A 2FSHA 2QM0A 5JLAA 5JPIA 5JE8A 4HNVA 4ARCA 4LS3A 4FONA 2YFQA 1YULA 1ORDA 3SDZA 4XEHA 2NO7A 3IAXA 3OZXA 2LBPA 3HJAA 3HCFA 2QW8A 3GLRA 1ADGA 1VHDA 5FB3A 1IEWA 2B7LA 1RDFA 2EBFX 2JHAA 5E7QA 4FYYA 3HTXA 1VFPA 2B1JA 3G17A 3KQYA 2ZULA 2A5DA 1P3Y1 4YAEA 1TPZA 2C97A 3MGGA 4NMMA 2F59A 3DVAB 4FMDB 4ND8B 3BFVA 5H3LA 4BNYA 1V37A 4IDFA 3LSTA 4A6DA 4B5KA 3CSDA 2DUUA 1F9EA 1SC1A 2QTVB 5F51A 3IMFA 4O02B 4YONB 4DADA 2EG5A 1J09A 2WK1A 4TWIA 1GWNA 3HFJA 1ZY2A 1W76A 1G7RA 2HU7A 2I8CA 3PDUA 2VJKA 1ZIDA 2UXDB 2ORIA 3M6UA 1ZESA 4ZQFA 4EFNA 1Z2CA 3ZE9A 1WS6A 3WMXA 3WYEA 2PKYX 4D81A 2QU8A 5BYKA 3KYCA 1HDRA 3TDKA 3Q87B 1CQJB 3GEPA 1B4DA 3Q7RA 1QZZA 4WFJA 4I1OA 1YF3A 2QU7A 4YJ3A 1TK2A 1JSZA 4YV7A 5I4IA 3AT1A 2X5OA 3N6VA 4MK4A 5K3AA 3S2SA 5BR7A 2EARA 4WA8A 3D8SA 1PGOA 3R0VA 2O5VA 3D8RA 4TYPA 3VO1A 4MI9A 2OB1A 1E3QA 1EFPB 3NR2A 1FU7A 1JAYA 1L7XA 3TRIA 3OFVA 4MQFB 2C3YA 2K2QB 3HUTA 1C81A 4Y9RA 1BWPA 3WWEA 1GTZA 4PG5A 4BLRA 2P35A 1XA0A 1HQCA 4B76A 1L7MA 3DDZX 2WYWA 1N6NA 4LVUA 5LA6B 1AG9A 4RD1A 5GONF 3V1KA 1TGVA 4QYTA 4YJ2A 3T54A 1LVGA 1XDWA 1HTBA 3P52A 1NQWA 4H31A 2GZAA 4NMXB 4IRUB 4RTSA 1R0WA 1PLJA 2Q2QA 3QW4B 1LJ8A 1O6ZA 2J0VA 5TF4A 3SQLA 2OCDA 4Y2PA 4REQA 1E3LA 4Z4EA 3WGHA 3V33A 4X20A 2BISA 4R5HA 2OHIA 3UHJA 4LRUA 1K5DA 1QYDA 1ZD8A 2WMDA 3AQ4A 2ZJZA 3K0BA 3KELA 4UNSA 3EQ6A 4ZAXA 521PA 3UWSA 3IAFA 3CZ5A 3B3QA 1XRNA 2PFSA 3VR2D 4AMGA 2G1PA 3Q8MA 1AVTA 3N5CA 3SFTA 3ZLBA 1RZVA 4C1NA 2O8CB 3P0RA 1D2HA 2AJBA 3HEBA 4L6CA 4ZQHA 2CCGA 3H97A 1KMHA 3EVDA 3MCUA 5C5CA 1RFLA 3EIFA 4HNAB 1JEJA 5FBVB 1X9IA 2H3EA 1P45A 4FFRA 3QHQA 3SEAA 4W1SA 2ASVA 3L6CA 3OT4A 1T6NA 3EW7A 4OQ4A 4Y2SA 2GCOA 3RVQA 4D3ZA 2A1IA 1AXGA 1RWNA 1ZO8A 1F3OA 2AQHA 1VG0B 1T9GR 1GUZA 2O05A 4D3YA 1R66A 3NH9A 3NM5A 3B70A 1WB6A 3GLGA 2KW5A 2R6JA 4ZVNA 3ZCQA 1E9EA 2XB9A 1DJMA 3BGVA 2IPAB 1VHLA 5L3SA 1FLAA 4OI2A 5IFLA 1XQ9A 4WY8A 2YV2A 2GDZA 1XTJA 1H2EA 2XF8A 5EJ5A 5T4EA 1CRPA 2CWWA 3TSYA 4E14A 3RRMA 2GM9A 2QHXA 3QKSA 1CCWA 4QOHA 3FDXA 3OZVA 4CUZA 2B2NA 1HMYA 4J76A 3WMFA 4G0OA 4F60A 4G0YA 3RADC 2FSGA 4KK4A 4DUZB 1O6GA 2B9VA 4R1TA 3GDOA 4IXWA 1KS9A 4NBSA 1P2SA 3FRHA 5FJIA 1VKHA 3JVEA 4OGFA 5ERGB 5LD2B 3WLHA 2GK7A 3BFJA 2ONKA 3HU3A 2M9MA 3V3KA 3HJNA 2XUJA 1CTQA 4KQ1A 4N1AA 2XNCA 3V8RA 3EIWA 1SZCA 2HGZA 2RI0A 3O82A 3GXOA 5D3ZA 1G4AE 1GYQA 1VSUA 1PJ3A 4DMUB 7MHTA 1BGWA 1EWTA 1KI9A 1MDFA 2A0YA 1U99A 5E7MA 2FPLA 4BJ3A 3O1JC 4BE9A 3ADDA 2VATA 1DOHA 4BLOA 5HWSA 2AC2A 3ELBA 1VJ0A 1ZOSA 3NW9A 4GC5A 1N25A 1RAGA 1YDWA 2Q9AA 2WVAA 3L8ZA 4EKNB 5G1NA 5K5EA 4YJHB 5L9AA 5IPFA 5KCZA 5TT0A 4LC9A 4I5EA 2YV5A 4IG4A 4G9EA 1N3IA 3E82A 3F4KA 4M86A 3GLGE 3M9LA 5TPZA 2IU0A 5LYJB 4XX1A 4RTPA 5E9AA 2K7FA 4B3RB 2WZQA 2VT6A 3MWDB 4JVMA 3FHTA 2X3FA 4HYEA 5E3JA 1DFIA 2YOGA 1LA2A 1ZWKA 5DIFA 4UXIA 4E4RA 1EFAA 1E1NA 4F5DA 2R5FA 3B13B 2O0KA 1JHPA 3ZLUA 4CNBA 3C3BA 3W5IA 1B6GA 3F8SA 4TKVB 1VI6A 4Y2HA 3NAQA 3DV0B 1PL8A 1W46A 1LC0A 5ALWA 4F5WA 3GEHA 5EJ8A 4H08A 2MU1A 4WY2A 3DHVA 5CHYA 2J3JA 2QZ4A 3WL5A 5JD5A 3FPHA 2Y0DA 2C1XA 2H5JA 3DGFC 3HYRA 4FJ2A 2EZUA 5ALTA 1RPNA 4ZEXA 3ZBTA 2R48A 2ZTLA 4X54A 1V9CA 5LXTB 3OCZA 3WYNA 3JQGA 3JQCA 2JLCA 5TV2A 3DYBA 1ZGGA 3TS1A 4DWWA 2O57A 5AUNB 1HORA 5JISA 1YJQA 1QYVA 3N2GB 3BKXA 3AR3A 3FWYA 3QKTA 3HDYA 1PYGA 5F3DA 5IXYA 2FW1A 2YQ4A 3E84A 2BGUA 3ZYZA 3DOCA 3NATA 3V46A 4GW3A 3FHLA 5CA0F 1L7QA 1C0IA 3V1LA 2OV2A 5CTJA 5ULLA 3U3OA 1M7GA 5SZKB 4E5MA 3KJIA 5EJ6A 3PT9A 1W7AA 2JFYA 4LVNA 2I6XA 1EDOA 2FW6A 3C6XA 1B93A 3E5NA 2QD5A 1PZMA 1NNI1 2A4KA 2O2EA 4N5HX 4ZVTA 5TQVA 3ILVA 5LZ4A 3O7WA 5DO9A 7ABPA 2J59A 4MVJG 3AVYA 4UUNA 3FF1A 4JWKA 1Q22A 3IAS6 4FKBA 2G08A 4JYMA 4U6QA 4QLOA 2RJNA 4IQGA 4O63O 1UBFA 5TVKA 4HJRA 1JSCA 2CFTA 4G4SP 3PKZA 3O47A 4OXYA 5EAIA 2PE5A 1RYDA 2HX1A 3EQ2A 2CF5A 3PRKE 1NP7A 2HA6A 3PR2B 2Q2VA 4IJ5A 4JN6B 2XGJA 2VDOB 1CHDA 2IA5A 3H2JA 3OBBA 4MS4A 4H1VA 2H07A 4R31A 4UATA 2ZP1A 4MVYA 1LPMA 4A6XA 3LUDA 4Z1MA 3NRCA 3M0EA 4J0JA 5A6SB 1OGIA 4BCBA 2XJ9A 4CW7A 4RZIA 1MOPA 3OPXA 2NVOA 3VU3A 2JFFA 2PTHA 3M6LA 4JMLA 1EKXA 3RHFA 4JI4B 1K8XB 1ZUIA 3M81A 4W5TA 1SD5A 3D6MA 5H8WA 1ZD9A 4PSAA 3HJUA 3TZCA 3UMYA 4IDCA 4GMDA 4E1VA 2NU9A 4B6QA 3O9MA 1ZH2A 2X2FA 1LBQA 3AHHA 2CK3D 2PRJA 4XJXA 3VHXA 3WNBA 1J8MF 4OHUA 2O8NA 1DT3A 5B2EA 1KKUA 4EH1A 3A32A 2O2YA 1ISMA 4HQFA 3LUHA 1M6HA 5EE1A 1NBOA 1GRQA 2B78A 1NU8A 1YI1A 4D9IA 3L1KA 1JNXX 2PR7A 4P7FA 1JAIA 1MVLA 1T0BA 1DBPA 5E4YA 5J4LA 3G5LA 2Q1XA 4MOWA 5HF6A 3ZCRA 2JJ2D 3H9UA 3MJHA 2C58A 3T5CA 4ZOBA 1GCGA 5IJZA 2P5UA 1TXGA 1ZM9A 1GQYA 3P45A 1IEVA 4OL0A 1BA3A 1AF7A 4YI3A 1D9ZA 1TW2A 4UFOA 1G4HA 5EPUA 2ZAYA 5DNUA 1NF2A 1ABEA 2YZMA 4MRNA 2WABA 3OPQA 4LJ5A 1PW7A 4M1WA 3EZGA 3VHRA 2B5VA 2PL1A 4XM2A 2MSLA 1U5AA 4NPHA 4LYGA 2W83A 2Y0EA 2BFPA 4BN5A 1RVV1 4LQDA 5KVQA 3ST7A 1NIJA 4MDHA 5HPYB 1M2FA 3ZVKA 2ADFA 5HE9A 3UTCA 4ZU3A 3IT3A 3QVSA 2G5PA 2ZB2A 1U2ZA 3M5DA 3UBMA 2QUJA 3B8EA 3CLUD 4JQOA 4X61A 2PT9A 2PX5A 2RH4A 1PS9A 3GLSA 2C92A 4Y3UA 2GQ0A 4DCSA 2H4YA 4CDMA 4LHSA 3R7AA 5F5LA 4MKIA 2XUGA 5AJTA 3ABOB 4MA5A 2I65A 3CRNA 1U0TA 4BO9A 2NUBA 1L5WA 1RJ9A 4TL6A 1YXMA 4X90A 3CN7A 4UU1A 2HEGA 4DSNA 1EZ4A 1I5RA 1QHIA 2C2XA 2C4NA 1T5TA 2EKLA 4HH3C 4PLTA 2EKPA 4MCIA 1VXOA 4N4AA