2AVNA

Crystal structure of a ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from thermotoga maritima msb8 at 2.35 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
b'HMKLRSWEFYDRIARAYDSMYETPKWKLYHRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEMLEVAREKGVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKDKAFSEIRRVLVPDGLLIATVDNFYTFLQQMIEKDAWDQITRFLKTQTTSVGTTLFSFNSYAFKPEDLDSLEGFETVDIRGIGVMEYPDERISEREETIFRLEQELSRDRNIIWKADHIFFVLKKKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquinone/menaquinone biosynthesis methyltransferase-relate
publication title Crystal structure of Ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from THERMOTOGA MARITIMA at 2.35 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 88
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2avnA00
5LQCA 2ZIFA 2NP7A 5JUWA 3ELWA 3KR2A 5DM0A 3THRA 1N7JA 5ICGA 3RIEA 2OB1A 2PJDA 2XYQA 3EVFA 5DWQA 4ZTBA 1RI2A 2QRVB 2WA1A 3ELUA 3TOSA 5D1NA 2YXDA 4DZRA 4P7KA 3CVOA 5U4XA 4PYNA 3GO4A 1XVAA 3EVAA 5EMMA 2CWWA 1KYWA 4CKEA 5KQRA 3C0KA 5GM1A 5IH3A 3SXJA 3HA5A 1NW5A 3A26A 3EVBA 1G8AA 2G70A 4K6MA 5ERGB 1Z3CA 4AZVA 3PFGA 4GOMD 4PONA 3GRUA 4YUXA 3ERCA 3P71T 5HIKA 5E2BA 4YV1A 4UOEA 4FSXA 3JWIA 1EJ0A 2JHCA 5K09A 1MHTA 3FUWA 4FSDA 1RI3A 1M6YA 2DULA 2PWPA 3EVZA 1TW2A 4EKGA 4WXHA 1VLMA 2AOTA 4KDCA 4OQDA 2VDVE 4RWZA 5FWDA 7MHTA 4B17A 3JWHA 2EX4A 2GH1A 3FPEA 4KRGA 2CL5A 1D2GA 1AQIA 1JQ3A 1NT2A 5HFJA 3R24A 1U2ZA 1IM8A 4PCAA 1NW8A 5DX8A 5GM2A 3GGDA 3CJQA 2LD4A 4GF5A 3SMQA 3FTFA 4R8SA 3TM4A 1JG2A 2BR3A 2QYOA 2ZFUA 2ZZKA 3G8AA 4DCMA 3I9FA 5G02A 2UYCA 4IV0A 4XCXA 2B25A 3B7PA 4E31A 2WK1A 4PYKA 10MHA 1P91A 2B9EA 1XXLA 4BP1A 3FZGA 3NW9A 4E33A 2Z6QA 4RVGA 2YVLA 4RSRA 1EQAA 3QOXA 4F86A 2P41A 5EQJB 4RTPA 2EJTA 4MTLA 3HVJA 1Q0SA 1WY7A 3DLIA 3HVHA 4M37A 9MHTA 2A14A 3NWBA 1NKVA 3F4KA 2C7QA 5GP1A 3DXXA 2UYHA 3R6TA 1AF7A 2FPOA 4DM3A 1P1BA 4OA8A 5C1IA 2PVCA 3OFKA 3GRRA 5K8VA 5LQKA 1DCTA 5EKUA 2PGXA 3LCVB 1QANA 5E1MA 3SGLA 4MWZA 5F2OA 3G2OA 1F3LA 1M6EX 2P35A 2ZIGA 3HVIA 1X1AA 3KPWA 2CMHA 3E05A 2AOXA 2VDWA 4PIPA 4C03A 2JHPA 5K0FA 1VBFA 1N2XA 2H11A 1B42A 2F8LA 1I1NA 1D2HA 1R18A 3GWZA 4XUCA 2G72A 5CCXA 5CCBA 5DLYA 2P1DA 4Z2YA 5LSAA 2JHAA 3E8SA 4DF3A 3JWJA 3NDIA 3K6RA 2NP6A 4HG2A 1NE2A 2FHPA 1DUSA 3KR1A 3M4XA 2H00A 3M6UA 1G8SA 2GB4A 3MAGA 1JSZA 3P97A 3SSOA 3VC2A 4CTKA 5K0GA 3OCJA 4PGHA 4LWOA 3DMGA 1XDUA 2FK7A 4QDJA 4YV2A 1F38A 3OZSA 3CJTA 4R05A 5EG5A 5EGSA 1JG3A 2HWKA 3FRHA 2ZZNA 2JH9A 3BWYA 3KQPA 4DKJA 5FUBA 2B2CA 3I5UA 3FUTA 3EGIA 3LSTA 4M7RA 2ZVJA 3JWGA 4RVDA 5DPMA 5F2NA 1R6AA 2XYVA 3B5IA 3QOWA 1G6Q1 2IDJA 3MB5A 3LBYA 5LQJA 2NXEA 4YMGA 3C3PA 2CMGA 4E32A 1G55A 1WXXA 4H0NA 4DMGA 5KYGA 5DM2A 3FPGA 2I9KA 1QAMA 2DPMA 4GBED 1R00A 4MQ4A 2O05A 2O07A 3LDFA 3OU7A 1NBHA 1VL5A 2OPBA 3HCEA 5E8JA 2IH4A 2PT6A 3KPVA 4X63A 5CVDA 5EIWA 4AX8A 4MIKA 3KQWA 4RTQA 2EG5A 2ONZA 2GA9A 2IIPA 5EMJA 3O4FA 2EJUA 3GRZA 4E2YA 2NXNA 5EMKA 4IKPA 1YFJA 4BY9E 3MHTA 3S68A 5GIOE 2PWYA 4MHTA 2IFTA 3I58A 3FUXA 2OBFA 2UYQA 3M6XA 5DM1A 4X60A 2ESRA 3HA3A 3EMBA 3KQSA 3LGAA 3OU6A 4PCLA 2XVAA 1NBIA 1BKYA 1RJDA 1X19A 1UIRA 2IH2A 4NECA 3ER8A 4RTOA 1XCLA 3IHTA 3HM2A 2PKWA 1H1DA 5C0OE 3GDHA 2PX2A 3EPPA 2ZTHA 5EPEA 2EFJA 5F2KA 3AXSA 5E2AA 3EGEA 2ZCJA 2C7PA 5CUQA 3UJ7A 3NVKI 5K0NA 4AZSA 4C04A 2P3QA 4R6WA 1JQDA 2JH8A 3BGDA 4LECA 5E1BA 2GAFA 1ZQ9A 4ER6A 1YUBA 4E2WA 3DXYA 4AZTA 5BP7A 3LECA 3VSEA 5EMLA 2P3OA 5K03A 1SG9A 3GRVA 3SR4A 3SSMA 5DSXA 3SX0A 3U81A 5EZQA 2R3SA 3BGIA 3FRIA 3LCCA 4Y30A 3M6VA 2IP2A 2I7CA 3BGVA 3GCZA 3LCUA 5LQUA 1L3CA 3HP7A 3DXZA 3D2LA 5ICEA 3MERA 4V0RA 4E2ZA 3KHKA 2NXCA 4OBXA 3VYWA 3QV2A 2OKCA 3DULA 3CC8A 3H2BA 1RI5A 5EEGA 4YMHA 5CVVA 3IV6A 3OU2A 4RTNA 1FJXA 3PX3A 3OZTA 1R8YA 1JTEA 3ANXA 3I53A 4YV0A 2Y1WA 4KVZA 5FQOA 5GINE 2ZW9A 3M33A 3P9KA 3PVCA 1I4WA 3P9NA 4HTFB 5GIPE 4RTMA 3KPYA 2AOWA 5LR6A 3DH0A 4C06A 2BH2A 4F85A 5E8RA 3UJ9A 4X41A 3EVEA 4BP3A 2O57A 1YZ3A 3DTNA 1UWVA 3HCCA 4IWNA 3CKKA 3GIWA 4LG1A 4OX9Y 1KPGA 5DXAA 3OPNA 5CD1A 5HIJA 3HNRA 4GUAA 3C6KA 3ELDA 5DTRA 5DX1A 2AN4A 1RJEA 3BWCA 5B1SA 3X0DA 4ISCA 3HCAA 1G60A 5EEHA 5CVEA 4ATNA 3UJAA 2AN3A 5T67A 4PNEA 1NV9A 3LBFA 1RJGA 2QRVA 2BM8A 2HMYB 4XUEA 5HOQA 4GC5A 2UZ4A 3G89A 3FPFA 3FYCA 3BKWA 4ER0A 3NDJA 1M0EA 4RX1A 4ER7A 3BKXA 3P2EA 5E9QA 4RTJA 4A6DA 4QPPA 1SQGA 3REOA 2AOUB 5GOZA 2HTEA 4Y2HA 3UA4A 2ERCA 5LQNA 2P3LA 3DLCA 1D2CA 3SSNA 5DSTA 5BW5A 4ER5A 2ZLBA 3G5TA 1HNNA 3FTEA 5EOVA 1N7IA 3M70A 3HTXA 3ELYA 2PXCA 1OR8A 3G2PA 4GOLD 4KWCA 4CXMA 3EEOA 1YB2A 1BOOA 3HCFA 5CVUA 2YQZA 3DR5A 2AS0A 1BHJA 2KW5A 5EC8A 3KQYA 1XCJA 2AVNA 3LKDA 3EMDA 2IBTA 1ORHA 4HGZA 3IEIA 4PGGA 2PLWA 4QVGA 3T0IA 4CWAA 1VIDA 2ORED 2OXTA 3PLAE 1VPTA 2YXEA 5D1HA 3SVZA 2NNWB 3B3GA 4DQ0A 4R8RA 3PB3A 4P58A 4F84A 5EIFA 2E5WA 2B3TA 3TKAA 1JTFA 2AOVA 2N47A 1JR4A 4BLUA 5DX0A 2G71A 4EK9A 2FYTA 2YTZA 2VDUE 5JR3A 5HIMA 5IKMA 3KU1A 1XDSA 2AZTA 1TPYA 1JQEA 3AXTA 1IXKA 1L1EA 5K0BA 3KQQA 2VS1A 4CKCA 4EVIA 3Q7EA 5DRTA 4R6XA 2XBMA 2Q41A 2Y1XA 2PXXA 4QQKA 1WXWA 2VZ9A 1ORIA 3KQVA 1KHHA 3G7UA 1WS6A 3LL7A 3BWMA 3M6WA 1NW6A 2P7HA 1NW3A 4X61A 3LDUA 1JG4A 3NWEA 1EJ6A 4IV8A 3MCTA 5FULA 1VP9A 3A27A 2ZSUA 4U7PB 3KKZA 3P9CA 1PRYA 5BXYA 1T43A 3PTAA 4GQBA 2AVDA 3HA7A 4PYLA 3O7WA 4RVFA 2AOTB 2IGTA 1KR5A 4CKBA 2Z6UA 1L3BA 4QPNA 3TQSA 1VP3A 4HGYA 3V97A 2OZVA 5DXJA 2ZBRA 3FTCA 3CJRA 5KQSA 1KIAA 1NV8A 2B78A 2BR5A 3PX2A 1L3IA 3P2IA 3PT9A 3A7DA 5EHIA 3TKYA 2PBFA 4ER3A 1WZNA 3EVCA 5FADA 3B89A 4O29A 5FHRA 2OY0A 4P7FA 2PX4A 4BLWA 1BC5A 1ZGAA 4PINA 5K05A 5E1OA 2IDKA 4E30A 2WA2A 2O06A 2I6GA 5K0EA 2GLUA 4LWPA 3KPUA 3HCDA 3RODA 3KR0A 2BR4A 2CKDA 5ICCA 2XVMA 5C9ZA 4GEKA 1SQFA 1JG1A 1VE3A 5DRYA 5E9WA 8MHTA 4FZVA 2YR0A 4BLVA 1RI1A 3I64A 5K0CA 1G38A 1QYRA 5ICFA 2HV9A 4PYIA 1XJ5A 1RI4A 2BM9A 2QE6A 4C05A 3OE4A 1O9HA 5K0JA 1TW3A 4M36A 5FTWA 5GWXA 3EGVA 4QDKA 2IPXA 3C6MA 4OBWA 3UJ8A 3KQOA 5HIIA 2VP3A 1AQJA 4G56A 1QAOA 3UJBA 2P8JA 2OYRA 4WVLA 5DT2A 2AR0A 3OFJA 3UJCA 3MTEA 4EKIA 3LHDA 3KQMA 1SUIA 3UWPA 3MQ2A 5FWAA 1JSXA 3E7PA 4P7GA 5HILA 2ZIEA 4YUYA 3B3JA 4GOOD 2JG3A 3CGGA 5MHTA 2ZZMA 3MCZA 3ME5A 3R9XB 1X1CA 3OE5A 3HVKA 4OA5A 4PYJA 4OQEA 1YF3A 1R74A 3TLJA 3AJDA 5CIYA 2YX1A 3RW9A 2PSSA 3R0QA 2ZWAA 4PIMA 2NYUA 5CM2Z 4U7TB 2PV0A 1KXZA 4YUZA 3NTVA 2IBSA 4KIGA 3LPMA 2ZBPA 2ADMA 4CTJA 1RJFA 4C08A 4YUWA 3CCFA 1INLA 2FRXA 2ONYA 3G8BA 4JXJA 2HNKA 5DTMA 2XYRA 4X1OA 5FHQA 4FGZA 4A6EA 2C7OA 2PY6A 3UJ6A 3UBTA 4PYQA 4RTLA 1O9GA 1NW7A 3ORHA 5P8WA 1EIZA 3VC1A 5CVJA 1YZHA 1MJFA 4EQZA 1XTPA 2PT9A 2ZULA 3P2KA 4FR0A 4E2XA 5KS2A 1FPQA 5T64A 3A4TA 2YXLA 4P7JA 1KPHA 4RVHA 3BUSA 2I62A 2PX8A 3A7EA 1O54A 3TRKA 3GU3A 1WG8A 2ZWVA 2V7EA 3LDGA 3GXOA 3IYLW 1FBNA 4YUVA 4QVKA 5KVAA 3DOUA 3MTIA 4QTTB 1IY9A 4L7VA 2H1RA 4GC9A 5E1DA 3BWBA 1VQ1A 5EKXA 3GRYA 2FCAA 3UZUA 5DM4A 3LX6A 2C7RA 2AN5A 3P9IA 4FT4A 4HH4A 5M5BA 5FCDA 3SM3A 1EAMA 4M38A 4RTKA 2FK8A 4HTFA 3T7TA 2BZGA 3UA3A 4HSGA 2PXAA 2JJQA 3FPJA 2O0LA 3L8DA 4RYLA 3TPZA 4EMSA 3EVDA 3FPHA 1SKMA 5FA8A 2QM3A 1ZG3A 1X1BA 3O31A 2P40A 5T6BA 3A25A 1XDZA 5EVJA 1V39A 2PX5A 1KYZA 5FQNA 4QQNA 4DA4A 4HC4A 5LQRA 5H02A 4C07A 3KR9A 3G88A 2QY6A 4FS8A 3TFWA 2HR1A 3DMFA 3DMHA 1SUSA 3MGGA 1EG2A 2NXJA 5E9JA 4HRAA 1I9GA 1QAQA 3T7RA 3UFBA 3THSA 4RV9A 4V0QA 3TMAA 2ZBQA 3TM5A 3WSTA 5EHGA 3AWIA 3G2QA 3T7SA 3ID6C 1P1CA 4E70A 3BZBA 1P39A 3G2MA 5LQAA 3HCBA 4AZWA 1QZZA 4AUKA 1FP1D 1SVUA 1Q0TA 5K01A 5FA5A 3GNLA 4RTSA 2R6ZA 2G1PA 3K0BA 4KIFA 3NMUF 4FT2A 3FTDA 2GPYA 4DCGA 3P8ZA 4PWYA 1Y8CA 1DL5A 3R3HA 4GOND 4PYOA 3FUUA 1R8XA 1ZGJA 3E23A 3EVGA 1FP2A 2AOUA 2OB2A 2UYOA 3GJYA 4FP9A 1L9KA 3G5LA 3PFHA 3NVMB 4KDRA 1X1DA 2G8NA 4POOA 4C4AA 4PYMA 1YFLA 1KPIA 3NJRA 5EZSA 1UFKA 3FUVA 3CBGA 3KQTA 3EEYA 4KW7A 3Q87B 2IH5A 5DTQA 3FYDA 4QTUB 5HEKA 1ZKDA 5HZMA 4XUDA 3DUWA 1AV6A 2V74B 3B3FA 1PJZA 2GS9A 2YUIA 2K4MA 1ZHFA 3C3YA 3HEMA 3AY0A 3KPJA 5K0LA 3OZRA 3TR6A 3V8VA 2OO3A 4RTRA 3BT7A 2Z6AA 2P7IA 3ER9A 3PS9A 1HMYA 3UJDA 3LKZA 3BXOA 3DP7A 1KP9A 5BW4A
chains in the Genus database with same CATH superfamily
3HQ4O 4V0ME 4H6VA 2F8MA 3BE8A 4PG5A 3KR2A 4Q1EA 1FU7A 5DYNA 3RUIA 4PCVA 1F0YA 3TOSA 1S7GA 1IRIA 1Z6PA 2CJXA 3X1ZA 1XVAA 2QK4A 3OMXA 5CYOA 4M53A 5EMMA 1KSJA 4IFIA 3EXHC 4QFMA 2OVBA 3WA6A 3KZXA 3E5HA 1I5OA 3SJUA 3HGQA 2PANA 1GL6A 3QG5A 4XLZA 3DOOA 4KH1A 4NZ9A 1E0SA 4UFPA 2H9IA 2Q1YA 2XUAA 1NA5A 4HMPA 3KXLA 3W4IA 5G4KB 4ZXFA 3B1YA 4H7KA 3GOQA 2YN0A 1XC7A 4U6QA 1TM2A 1G6KA 4Y2TA 1XTZA 3T1TA 5A3QA 5LP1A 2Y6UA 1E3DA 1JHAA 3EVZA 5KNDD 4JUIA 4Z7NB 1TW2A 2AIRA 2ZI9A 1PJ8A 4LRSB 3J81k 4LY9A 5FBQB 2K2WA 5MDHA 3C6XA 3QTBA 4TLMB 4A1FA 3IUBA 4N01A 4G65A 3M81A 2VATA 4JJZA 3TX6A 1A9PA 2LDBA 2EX4A 1ECJA 3FPEA 5TVGA 4ZPJA 3VKFA 2DP4E 4CETA 3TSZA 2OV3A 1D2GA 1OTHA 1AQIA 1R6TA 4LOIA 4Q15A 3ZDFA 5TC4A 2KHZA 1GAWA 1YS6A 5DIFA 3VO2A 1SCQA 2FZ5A 5TPWA 1J24A 3CCBA 4R41A 1EE9A 1X86B 4R8SA 1YVPA 4OI1A 3V32A 4IIDA 3I0MA 4EKEA 2PBRA 1TYZA 3B7PA 1KKMA 3N6RA 2BONA 4CM4B 3FDZA 4MUAA 3UGQA 4OFWA 1JV2B 2B9EA 1COZA 3H2YA 2QTZA 3TKLA 4KO1S 4Z7QB 5FPYA 4YIKA 5BWMA 2ZQYA 3I1FA 2XQVA 2PD4A 4CKCB 1L5NA 2Z2JA 4OSPA 4HQOA 3A58B 1B76A 1LS1A 1Q19A 1VLVA 1W5BA 1CHDA 2J3MA 2AA3A 2Y6VA 5BMVF 1QG4A 3IXMA 3CLVA 2ASVA 3Q85A 1GP2A 2PNFA 4TRMA 2B4RO 3PR2B 1OROA 4E4RA 1VKZA 2FPPB 4CNQA 1AGXA 1NOIA 4L2IB 1QP0A 4K6GA 3VRHA 1CQXA 4MV0A 4RZXA 1DEAA 1LY1A 3DQZA 1W48A 2YZKA 2H2FA 4P38A 4Q7EA 3U0BA 2H48A 1HMPA 2AOXA 2JI7A 1ODLA 5CH5A 3B5EA 4ZALA 3E22B 5CHEA 4E1AA 3HN2A 1A1SA 3EIEA 4O2AA 1TUBA 1WZIA 4H27A 5EFOA 3E4CA 2QTRA 3NVAA 5ANRB 4BVGA 2AXEA 1DARA 3QNWA 4C21A 2PSHA 4A2WA 2NP6A 3IPRA 1WSAA 3JWJA 3NDIA 2C99A 3O7MA 4HG2A 3R9XA 3IIKA 3RROA 2YOFA 4ZVNA 5JANA 1OU0A 3P5BA 2GB4A 4WCDA 4EG3A 4NOKA 2YC2C 2Q6OA 1O5IA 1ILWA 2AEJA 4X20A 1JEOA 3WHPA 3T3HA 2VWQA 1YQQA 4YAKA 3U44A 3U7HB 1ZR4A 3NHYA 3TQRA 3IOEA 3P0FA 1HZJA 1V95A 2VPXA 2DT5A 3KG2A 4XX1A 1OB5A 3UHAA 1S4QA 4C0QC 1HC7A 2HT6A 2XDYA 4HRXA 1UJ6A 4K9SA 2D3WA 1VJ0A 1TLLA 5J58A 1GNSA 3IELA 5DPMA 3K4QA 1XO1A 1JEEA 2JPDA 2W2PA 3BYZA 2FFAA 3BREA 1IUNA 3M4ZA 1G6Q1 1ESZA 4G09A 5I9BA 2BSXA 2EAUA 5DCLA 5LD2C 3ZD6A 2J0QA 3GMIA 3FY4A 1HDOA 2AX3A 1TRHA 4M6WB 3PEWA 1LDEA 4Y2RA 3U61B 1EFTA 3BE5A 4TPKA 2FEMA 1KFBB 1VL5A 3GD5A 3FTQA 3GMSA 4QJ4A 1TJ4A 3ZE7A 3WLOA 1ADCA 1K92A 2WJ6A 1AKYA 2H1SA 4JELA 1R9NA 1Z88A 4HDCA 1NKSA 4IGEA 1PSDA 3A6DA 3EQ6A 4K6FA 3TW6A 3RT9A 2A88A 4E2YA 2PZGA 3ZHZA 5C1DA 3MHTA 2PWYA 2FQWA 3Q0TA 4YCBA 1PYOA 1V8BA 2UYQA 3R6DA 3L46A 4ENRA 5CX4A 1RAEA 2Q5LA 2QD3A 4PCLA 4A0SA 4MPJA 4P0TA 2B8EA 5KQRA 1BKYA 1NBIA 1RJDA 1X19A 2HFKA 3GDWA 4IFTA 3INTA 3WE7A 5CNIA 1B26A 2QPAA 3WTBA 1PF7E 2ZTUA 4BMDA 3O91A 3E3OA 5CTAA 4GRAA 3SEFA 1FUEA 1KIMA 4MVCA 2FN7A 1QYXA 1SUPA 4KPFC 2ZTHA 3DDWA 4TTQA 4BBAA 1L7AA 3NNDA 1KMHA 5FFMA 3KT0A 5GOTA 3AEQA 2H2GA 1PVOA 3ZTWA 3KALA 1JR3A 4TX1A 5E0KB 3MWKA 2IOFA 1H93A 1IB6A 3OE7A 1GG9A 1G20E 3JSXA 3KL4A 4WY5A 5K4HA 1RPZA 2QQGA 4X91A 2M2IA 4YRFA 4C01A 4OI0A 2QD1A 1P29A 2ZVDA 4Q19A 4DA0A 4ZI5A 2EJBA 5DULA 5IAJA 4L5JA 3EXIB 1Z16A 2IX3A 2QJOA 5JQGB 1QQ7A 2X1VA 2FRVA 4J0JA 4NC9A 4P4UA 4QBTA 1W96A 5J1SB 1HQYE 3A2KA 2O3SA 5E3HA 4PNZA 1QIJA 4V0RA 1CIPA 2XZLA 4RHTA 1PW7A 3QA3E 2OKCA 2VEOA 3U39A 3OIFA 1RI5A 4BEVA 1XGKA 1M1XB 3EC1A 4XARA 5B58C 1T4GA 5EJ6A 4W99A 3S81A 1DX4A 5D2CA 5HJ2A 1QRAA 4KVZA 1ESCA 5NLLA 3PYXA 4XWWA 3AI7A 4OHUA 2A35A 2IY8A 4O4HB 3W5JA 4CL3A 1SBZA 2AOWA 3GEBA 3TPFA 2X19A 3WZMA 1EA5A 4J7AA 1R12A 5HKOA 3D3WB 1IN1A 3LK7A 4AURA 3DTNA 2XUHA 2Z43A 2FRDA 2X40A 3CKKA 3IESA 5BQPA 4EP1A 1U0GA 2VJYA 3PJEA 4GPTA 3WMGA 1CY1A 3TF5A 5LP6A 4BGUA 3F6YA 5IXSA 4RD4A 2YV3A 3PEFA 5EAIA 1V8OA 2ZYIA 5DX1A 2KLHA 4NH0A 5HIJA 1BRMA 2Q4TA 2XQFA 4TZKA 1VL1A 3HCAA 1P8AA 5DTIA 1ZL0A 1XZHA 2X0JA 1CDEA 2H2WA 3PL5A 3LBFA 4Y2JA 4D26A 4CF6A 1P4AA 2XHZA 4ZCMA 2G07A 1PR5A 4KNWA 4URUR 4Q3BA 4ZOQI 2IHTA 4WBSA 3JYQA 3SXPA 3WSVA 2ZIUB 3OP4A 4I5FA 4I2NA 4OAPA 4OYRA 2AOUB 3GUHA 2B69A 4JP2A 1XPRA 2WQ6A 3HLTA 4HMOA 5THXA 2QG9A 4REQB 1N1GA 3QNMA 5GGYA 1U6KA 1SVMA 3QITA 5GMOA 4LF4B 4IKEA 1KFKB 3I01M 4NCJA 4F9FA 3HM9A 1CUJA 4Z4EA 1D8AA 4E4TA 1OTYA 3CTPA 1P7YA 3Q0EA 1Y4UA 4HNQA 4FHCA 2C2GA 2CHFA 2OQRA 3PUVA 3PWSA 1R6VA 4JDPA 4NDZA 5CVUA 1NFRA 1TZBA 5AKJA 4UMDA 1I4TD 3O9VA 1N5DA 3H4TA 5IKOA 2CV2A 3CZRA 3D7KA 4AUEA 3L7AA 2FW1A 4D97A 2IPOA 4QU9A 5CDTA 4LK3A 2J85A 5HA5A 2DPGA 1O2DA 1QO0D 3FDJA 3CVUA 4E46A 4LNHA 1KU0A 2NNWB 3CZAA 2HJ9A 2I3AA 4N0PA 1SURA 3II6X 3Q3EA 4PTZA 4ZOLA 3VGPA 2P27A 4JEIA 1A9OA 1RIIA 1EWQA 3ZKAA 4D8VA 1GTSA 3PDJA 1ZM4A 4DW8A 1WXDA 4K6OA 5JSUA 3OAAA 4UAVA 5HGXA 2IEZA 4MDFA 4JI2B 2A5FA 3HNOA 3LYUA 1V3UA 1G5TA 2LW7A 1JGTA 1E2PA 5FB3A 2MJLA 1SU6A 3EAQA 2XB4A 2VI5A 2XSZD 2VZ9A 5BN5B 3X1DA 2WJPA 5TJHA 1G5PA 3PZRA 1JMKC 4H9GA 1TMGE 1N57A 1ZGGA 3JU3A 3NH6A 1RQ7A 5DHSA 1NVBA 4W1SA 1OXUA 3RUDA 1Y0BA 1Q0HA 2M1XA 3B36A 4TQ9A 3VR2D 1YQ9A 3E3LA 3P9CA 4MRRA 1XX6A 1OH5A 1C3VA 2BFBB 3DBLA 2VAWA 4G84A 4J76A 3B70A 3VTFA 5FAKA 6NULA 1P18A 4FN4A 4OU4A 3ZR4B 4S1TA 2PKQO 2WSIA 2CJWA 4IIJF 4B3IA 3CJRA 3FUCA 2CDRA 4P8RA 5ALWA 1N3BA 3BMXA 1FNDA 1OE0A 1NL3A 2PVSA 3DV0B 5DNUA 4ZT7A 3UAGA 4ER3A 5GZ1A 5HUHA 2OGWA 3DBHB 3ENZA 4LVOA 4XQEA 4GI3A 1O6ZA 4YJFA 2O2DA 2OY0A 4IRUB 5KNCD 4BLWA 2Q6IA 3ZCVA 3V4OA 5C35A 4Q9NA 1CZNA 4G0VA 1BXKA 5JMTA 3A2MA 1D7OA 2WA2A 4K3VA 3TN7A 4W5OA 4J94A 4R0VA 4YAJA 9LDBA 1NI4B 3SMVA 1XZFA 2MIIA 1NP6A 1T0UA 1U2EA 1VJDA 3DTVB 3PVSA 5C9ZA 3HGMA 2BFFA 3ORRA 2I91A 5FTNA 4BLVA 1THGA 4V24A 4CLOB 2JAHA 1F5SA 5TNXA 1SCUA 2ID7A 3V9AA 2PGOA 1XPJA 3QG1A 4I9FA 4NHOA 1MG5A 2P6UA 1EEXB 1Z35A 1C30B 1Z8NA 2ZRJA 4DC9A 2RGYA 3TMYA 3AR8A 2B21A 3BSSA 1A8SA 4LRWA 1W76A 1N6LA 1UBKS 3BZUA 4Y9RA 2ONKA 5A06A 4K6KA 5CB0A 1Z29A 3T1QA 3ZK9A 1AQJA 3ISTA 4KRYA 2W11A 2C00A 4D3FA 3L8YA 5FUMA 2ZDGA 3LUCA 4L4XA 4GKAA 5JQGF 2EATA 2Y0EA 4EG1A 1WCWA 2AJLI 2Z4TA 3G2LA 1YU6A 2OV2A 3H17A 4P7GA 3DONA 4MRVA 2EIHA 1P61B 1QWOA 1Y5NA 3UAZA 3INYA 1EDDA 3S2UA 5HBRA 4TZTA 2AUTA 4KLZA 1D6SA 3UV6A 3ROPA 3QJ5A 4P3PA 4R2LA 4BX3A 5ED0A 2ZI6A 1K89A 2P6PA 2I6QA 3DVAA 4RJ2A 1TAQA 3ETLA 1AB5A 3JSAA 4FHFA 3O82A 1EVLA 3Q2KA 3F73A 1IWBB 1PR6A 2KI5A 4WY8A 3RV4A 3MT8A 1K8QA 5FHQA 3S1AB 4EZBA 3F5DA 4AZ0A 2VH2A 4PZCA 4MZXA 4L0CA 3DHYA 5HM8A 4P3KA 2CNNA 4D96A 1YA6A 3MVEA 3ZE0B 4Y9UA 2MYTA 1X1RA 3O84A 1JEJA 5DGDA 3R5TA 3FHOA 3OMLA 3A1EA 1QZUA 4IR7A 4WLOA 3EAFA 5C2JB 3CH4B 3NT4A 5IJXA 3B78A 2J6BA 3O1LA 4JIMA 5AK3A 4EABA 5CLJA 2IJGX 1KE2A 3BUSA 3RSLA 1H6DA 1AIPA 1IAVA 1D0SA 1U7WA 4BFVA 4EY5A 1FIUA 1BKDR 1E1MA 1JQ5A 1XRJA 4ZZ2A 1KAMA 3DOUA 3IO3A 4YR9A 3EJ6A 2PKYX 4A27A 4WK2B 3D3KA 3PEEA 4DL9A 5DM4A 1DKLA 1SUEA 2NV2B 1HE4A 3MTGA 3I1JA 2JCBA 1B8UA 4KXYA 3WQRA 5DLEA 4BJ5A 4MS3B 2VDMB 4MQEA 3V8EA 4Z5XA 1RYZA 3PWTA 4P4GA 2W6JA 2ON6A 2GEVA 3JPYA 5BVHA 4WMLA 4B7AA 2DPXA 4BJ1A 2NZ2A 3BH6A 2P2SA 1SPBS 2IXEA 2NVOA 2WTNA 2B9VA 3KT3A 1FDIA 3O74A 1MPTA 4OHCA 4QQNA 4CV3A 1TVCA 3HL4A 2QY6A 2OD9A 4MLZA 3DMHA 1EG2A 1H8EA 2X14A 4FPXA 4X64B 1CUUA 1P0MA 1QAQA 1T0JB 3X1MA 2QTAA 1ZAKA 2OOKA 4NBLA 4E5DA 2DERA 3E2MA 2O7NA 3LWNA 3NHSA 3KFVA 4UBLA 1NQVA 2BFEA 3I2KA 4WVFA 2BUBA 2P9ZA 4MGZR 2WQZA 5GJCA 1PSWA 1P39A 1T9BA 2FX5A 2GZ1A 1EFPB 2HEIA 1HEYA 1JDTA 4JI1B 3DYIA 4HAXA 3RSCA 5EJMA 3JQ9A 5FA5A 3FR8A 4NFYA 2R6ZA 1CHNA 4KAXA 2QGZA 1C3XA 1KA9H 1N4DA 2V7QA 3WLIA 1RQLA 1N3IA 2XJ4A 1UC9A 4BVJA 4DSAA 5D5PA 3GARA 4OY3A 3LUDA 3FUUA 3NOOA 1R8XA 3CLSC 1QVWA 3M6AA 3L0BA 4NWIA 1SBYA 5JXHA 5K6TA 4PG7A 3NCTA 2PYZA 3GLTA 4Z8XA 1X1DA 3AETB 4Z4IA 1I33A 3AF3A 4ACAA 4MB2A 2N42A 2JGKA 3F6PA 5DF1A 2W2LD 4AY2A 3CSUA 3DT6A 3FVWA 4ZC8A 3LW7A 4KW7A 1GTG1 1QHFA 4NK5A 1RDFA 4C4RA 1DAIA 3LUHA 1PJZA 3ISJA 5JAPA 2VXOA 4RABA 2PLRA 3WMEA 1RTTA 5AKZA 3UUGA 5JYCA 2C29D 1XMXA 1J6UA 1P0CA 4HWSA 3KSMA 1USGA 3DP7A 3IP1A 3OWHA 4C1NA 4AK9A 4OQ4A 4UNIA 4LDPA 4Z1OA 3BT7A 3ER9A 3PS9A 1GR0A 3I28A 3V8NA 2G40A 4XTRA 1KY3A 4NG5A 2C3OA 2QUJA 3KZNA 3NTUA 4XD7D 3RV3A 4BPRA 2BD0A 4I66A 1BN7A 2QP4A 3G23A 3ELWA 3L7YA 4GPD1 3RIEA 3EVFA 1YBVA 3BE4A 2AJCA 1WU8A 3N1UA 4HDOB 1RI2A 2WA1A 3STUA 4BAGA 1HE1C 2BGRA 4TLCA 5D86A 5C31A 2Q7DA 3C5VA 2VJLA 3R7FA 3ZWBA 5KWEA 4KL8S 3WRXA 3A9VA 3C0KA 3CX8A 3NC4A 1Z7BA 3G85A 2XXAB 5JO0A 3QF4B 3VJLA 4YCLA 2CXNA 4LYGA 2AF3C 3H5NA 4YV1A 4KO3S 3GLGA 4UAUA 3DOEA 4QLOA 3IIEA 5LQMA 3ITNA 4KFTA 2JHCA 4EAQA 2OBYA 1ADJA 1K4MA 4P2BA 4UC0A 4M1YA 3I9NA 4CIAA 4NQZA 2AN1A 3NBAA 4XI9A 3V2GA 1M54A 4WXHA 4EKGA 4RENA 2P2ZA 1R27A 2QLNA 2ZRIA 4OQDA 4Q1FA 2G28A 1FY2A 4PC1A 1BSVA 3DCNA 7MHTA 1KK3A 5B57C 1EFCA 4RHCA 1JEAA 1O6BA 5CLIA 4XFDA 4IUCS 1NRIA 3H2ZA 1J0AA 3KTFA 3EUEA 1AXEA 5KAPA 3SWWA 3CJQA 1U7TA 4R3NA 1ZJYA 4JJAA 1A8UA 1CNFA 4Q4HA 4GRIA 3B6JA 1L1RA 1M73E 4I5GA 5FFFA 5T8KA 3WIOA 2VHTA 3T7DA 2R1ZA 4HXGA 1O1YA 2I4RA 2JFHA 3GZNA 1IULA 3NKVA 1Z33A 2PR2A 4J1QA 3WBJA 3QYPA 3AEUA 2C9YA 3HB7A 4GM1A 2VCYA 3RK1A 1BNCA 2HY7A 3VZSA 1KNQA 2WTMA 1HYQA 2R8XA 2XOKA 3Q7IA 5TSDA 1T4CA 2XVXA 3CNHA 5KYYB 2ILTA 5DSZA 5HF5A 2IXGA 4IUYA 5E38A 1GLVA 3JR3A 1MAWA 2ET6A 4GGPA 4HY3A 3TVYA 1GAJA 1NLFA 5SV2A 3FIJA 3TYXA 2WYVA 5BPFA 4Z53A 2IS2A 3LCRA 1F3LA 4Q03A 4RDCA 4LRYA 3TIXB 5JE8A 1MC4A 2G63A 4QWWA 2YN2A 2RAPA 3C41J 3HDTA 3RRNA 2QL5A 1USIA 2J3QA 1FSFA 4QM7A 1NVKA 4KPUB 4XUCA 1AM4D 3L7LA 4IP0A 1Q1QA 2ZS8A 4HQFA 4KACA 5KC8A 2P1DA 3QI7A 4FFRA 3CNLA 1D5CA 4G01B 2B3DA 3M6UA 3M4XA 4U2EA 2XUGA 3SR3A 1U3WA 2ZB3A 4WBNB 1TQ4A 2QNRA 1AUPA 1O94D 3DMGA 1YFKA 1J25A 3IV9A 1NXTA 2QENA 3EIHA 2OQIA 3QPUA 3KWMA 4P83A 4HN9A 4PFSA 3RG8A 3KKOA 4D4JA 2BELA 3E9RA 2WJVA 3AO0B 3EGIA 3ZHVA 2WF7A 4UHHA 3ADCA 4ZEVA 3DLHA 3FI0A 4BEWA 6REQA 2WAXA 1DKNA 3JYHA 3NDRA 4X92A 1CQJA 4EJSC 3RTCA 3EXG1 1R1DA 3JZDA 3SHTA 4MQFA 5LQJA 1CUBA 1O95D 2CMGA 1DBIA 1DAFA 1WXXA 2KE5A 3VQTA 5AQ1A 4TYYA 3K0AA 5DM2A 5DLPA 3KAQA 1Y7HA 3EDQA 3TZBA 1PJBA 2QPLA 1H2AS 1NAHA 1GQ2A 1HE3A 3D1JA 3W8DA 3NBFA 3LDFA 5FBKA 2BLLA 3Q10A 2GFHA 1GTMA 1YTLA 1A8PA 1ZY2A 3WZ2A 4DV5B 4LOKA 4G85A 1IJFA 4LGVA 4TKVA 4LY3A 3VYTB 2AEEA 2BGKA 3VVMA 3W3AH 5EXEA 4G1MB 5SZKB 4B48A 1OI3A 4F2WA 3Q2IA 1PLLA 1MOSA 1TJYA 1MIOA 5GIOE 1RU3A 2OFPA 2PRKA 1NBMA 3EGXA 4XKJA 3VOBA 1L7XA 1BU5A 1A9XB 1WD5A 3ICWA 1QE5A 4EYQA 1UDCA 3GLIB 4IHJA 2BAGA 1X1TA 1L5KA 1MT0A 3AR7A 1I1HA 5DYIA 3HBLA 1F4VA 5CAEB 4CR8A 5HPYB 3ER8A 5KOHA 1TU3A 1PVVA 1XFDA 3C4VA 5CH3A 4DHEA 4MW0A 4L6AA 4GX5A 3DEIA 3L1VA 3LLVA 3RC3A 1ZCZA 3ANMA 3EIXA 1SBNE 4DCPA 1BX3A 2Y0DA 1X87A 2H54A 3T5MA 3JQAB 1K4YA 1RRMA 3GFSA 4K9RA 4UVDA 3UJ7A 4IUDS 2I4NA 3MJSA 1K5HA 1JQDA 1U2PA 1ZISA 2G9ZA 2ZYSA 3BGDA 3C5HA 3KL2A 4FDTA 3W2TA 3INRA 3ZNQA 1NF3A 1T9CA 4OI4A 2X9LA 1Y9JA 3OQJA 4AZTA 4EFLA 3TLCA 1H4SA 2VSQA 2J59A 4UVGA 5CCEA 2IY7A 2I7CA 3QZUA 5KX5B 1L4BA 2VTBA 3RNLA 3RYFB 4HSEA 5KJ1A 1GA4A 1OGIA 3IJRA 3MF4A 3UB3A 4YJGA 4BQNA 2WILA 2FWIA 4BMVA 4BOYA 1LSOA 3LUPA 5H81A 3H2BA 3QELA 2A5DA 3VHRA 1CB0A 2BGNA 3VH4A 1YS7A 1F8YA 3HJRA 3IEMA 2CWDA 2GCOB 3RT1A 5FOSA 2WHXA 3SYMA 1K7XB 3S2SA 4FHEA 2COKA 3HDJA 2FSPA 1YL7A 1I4WA 2OGZA 3A1WA 3G17A 3QPBA 3TZKA 3WX0A 5HKBA 5JAOA 2ZE8A 3FGOA 4RU1A 4HAOA 1KAGA 1OXSC 3TB4A 3IQFA 4CCYB 3CW2A 5E8RA 2A4KA 5LPNA 4ZT4A 3ZHRA 4BNMA 4CODB 2ORYA 4XGNA 2H8GA 1LTHR 2G80A 1UWVA 1E63A 2UVPB 3M3PA 2R4TA 821PA 3LSYA 3D8SA 1C3EA 3GIWA 3CN7A 4HYYA 1EFHA 1TUIA 3ED5A 3PBKA 4LF5B 1C0KA 1QOPB 2Y0CA 1QP8A 5L3RA 2CFIA 3SQNA 4NXMB 4IDGA 3D2AA 4XIIA 1Y8QA 4KHZA 3RBVA 3IBTA 3ZWVA 4QNMA 4A0QA 5HOQA 2N0SA 2UZ4A 5JJ5A 1MA0A 1DQPA 4NLLA 5A6SA 4L16A 2B7BA 2QTTA 2XGSA 2Q8NA 2P1RA 3NDJA 4ER0A 5HJ7A 2A9VA 1P5RA 2MSEB 4P33A 4GIBA 2EKZA 4PZ0A 4YAEA 1SVLA 5A4FS 5J43A 2HTEA 1M6HA 3RRZA 5JFGA 3NDBB 3QLEA 1FSSA 2C8JA 2ERCA 2XF2A 1VJGA 3ADBA 4Q3OA 5KPJA 4J29A 4PAWA 4N65A 2WU0A 4O4JA 4P5DA 3PGJA 4B6FA 1BJKA 4IZ6A 4ESEA 1N7IA 1SVWA 1M8GA 2R1VB 2QX4A 3EHDA 3P9SA 4KG7A 3P9XA 1NXVA 2AFHA 2C20A 2V6MA 3BSYA 4DLXA 2V7VA 2WF6A 1N1MA 3TS1A 2R2AA 2DHDA 1EUCB 5DHRA 4YP6A 3MUEA 4AY5A 5K8JB 4OJKA 5G0SA 2J33A 3IAS6 5ILQA 3PJGA 3ROMA 4Q34A 2WVGA 4BO9A 2IYRA 4XW2A 2OLEA 2E37A 3ON5A 4V2UA 2FWPA 4AXXA 4DUZB 1GT91 3ZS9A 5MGNA 3PHCA 1OYYA 2CXUA 3C3EA 1POWA 1XTKA 2WIGA 4XJTA 1IZZA 1JPVA 4DMKA 1ZVJA 2JKVA 2Q46A 5JC1A 3AL2A 1W85B 2FSHA 3L06A 3N8GA 4J1TC 5ALLA 4WBNF 2FYTA 2IYNA 5TARA 4L5CA 2CFOA 1XPOA 4FYHA 4ME6A 2ZYHA 3CUVA 4GOJA 4F4FA 4AWBA 1M8PA 2ZT6A 3EQ9A 3M8KA 4DIFA 2W43A 4EENA 4E5SA 1R0ZA 2I4IA 1XZMA 2XD4A 3GRKA 1CYDA 3RRMA 2NV6A 3PDIA 3TZHA 3ZQJA 1UMBA 4RK5A 2J0UB 2BFDA 3F90A 4RFSB 2P9BA 3SS8A 4DFDA 1JJAA 2OCDA 3AHJA 2W4QA 3HBMA 4HDMA 3NYRA 4IDNA 4KITB 4JJFA 1CJMA 3NZEA 1ZNQO 4JUAA 3P9QA 4BWVA 1U0BB 1FS5A 3O8OB 1S02A 1SXJB 1U7DA 3H1BA 3N5CA 4QPNA 2WABA 1A9ZA 1IONA 1RWKA 4QXOA 4D02A 5HQTA 2EFDB 3LWBA 5A4IS 1A2BA 5SYAA 4LFAB 1M3SA 5EPOA 4BB6A 3EUFA 3OJOA 4BQQA 4JX8A 4F2GA 3TKYA 4D80A 5KJCA 1KAEA 1DE0A 1WZNA 2FSGA 3U0VA 4TT3D 1EVJA 3V4LA 1DIRA 3R9KA 3KSAC 3WADA 2X23A 1IM5A 4O29A 4RE5A 5TPZD 4OMCA 2PX4A 3RUHA 4RD6A 2RK3A 3P2MA 3UCFA 2G6BA 2J41A 3GVIA 1Y89A 2GA8A 4GI7A 3VSBA 2OCYC 3PGMA 4WESB 4RXTA 4TV8B 4BO8A 3OEHA 3V55A 3AM3A 5H7XA 5KQGA 2Q4DA 2OHXA 1GRCA 4L8LA 1T8YA 2Q0QA 4KK3A 3WP1B 5AJUA 8MHTA 4FZVA 1N7GA 2C3PA 3UAXA 3I64A 3QVGA 3MJHA 4FCVA 5JNSA 5K0CA 2EERA 4W1QA 3D3EA 3WJ1A 1WDMA 3URMA 2JLUA 2BM9A 2NN3C 3RS9A 4AIIA 1O96B 4Q7KA 1UBRS 5FTWA 4JI4B 1GTL1 1AMOA 3EGVA 1ETHA 3E3MA 4RZIA 4JLDA 3U17A 3Q2OA 3RFFA 2QL7A 5HSGA 1WQ4A 1Y3DE 5AIAA 2BEWA 3NTQA 1PJ2A 3SZGA 3WDKA 3HCRA 3DTVD 1LNQA 2WT4A 4D9HA 4RVCA 1E62A 2HSZA 3NOVA 1HTTA 4EMUA 2DFTA 3BK1A 5KX5F 2AG1A 3TNJA 1ZJZA 1CEXA 2FPIA 4M7WA 3LG2A 2WWFA 4L7VA 1RWMA 4DXAA 1SHLA 2ZAGA 3QTTA 5EIOA 2XAUA 1ZO8A 1GRQA 2B6NA 4JHLA 4MRNA 1CNMA 4UVHA 4KVFA 1ODTC 4M98A 1GSAA 1B74A 3NAGA 4HWPA 1Y9EA 4XVRA 4ZO8A 2W42A 4K5QA 2E7ZA 2EHJA 1BMFA 1X7GA 2FWAA 3FROA 2OG2A 1JT2A 2PRSA 4QHTA 4UZFA 2DTDA 2GZMA 5KYXA 3GNQA 2C03A 3X44A 3LTEA 3QBJA 2YW9A 1U63A 5IYZA 1D4FA 1XCBA 3SZMA 4EJ0A 3A3KA 5LKRA 1AK2A 2RI0A 4NV1A 2YY5A 3B1ZA 1GDDA 3CX6A 4Y1FA 3AESB 1CERA 3H9CA 2XCQA 4TMTA 1UEXC 2D8MA 2IUYA 1V47A 2PRJA 2YHIB 2ZSEA 4WLEA 1NLMA 5K0TA 1HY3A 2C8KA 1EIZA 5HF6A 5FWYB 3W6OA 3GG9A 1BG6A 3HYTA 3W9SA 1MVNA 1G8FA 4EQZA 3K9FC 2WOJA 2CUNA 1S2NA 3L49A 2NSHA 4K8RB 3AHHA 3PYMA 4EF5A 1GTZA 1X7XA 3GDGA 4A36A 4JH0A 2JANA 4OSOA 4P7JA 1KPHA 1SH7A 2AMLA 1WG8A 3HYCA 1IHOA 4YUVA 4PC3A 4QVKA 2PR7A 4P3YA 4GC9A 4EW6A 3D7SA 1ONOA 5EKXA 1D6MA 2ACWA 4TTTS 1E3IA 3ECAA 3FWZA 2ZI4A 5JFTA 3QM1A 1PEAA 5IC6A 4MQLA 4EB0A 1JHPA 1XCMA 3F3MA 4ICIA 3GCWA 3SP1A 4I50B 1W2HA 1LF0A 1VHDA 3EGOA 1IG0A 1D9ZA 2O8VA 4UTVA 2NU8A 2GWRA 4B6RA 2FWNA 5KQLA 4NZPA 4V1CB 3F4LA 1L4EA 4DV1B 3ONFA 4FMCB 1J22A 2X5KO 4GSLA 1ZLXA 4IEFB 3ZDRA 2HIAA 2XVYA 1NG9A 3BB3A 3PPVA 4HWTA 1GPAA 1UJMA 3FSEA 1JB1A 1DFHA 3AEYA 3FWYA 4QOSA 1IOLA 2E1RA 3TMAA 2H16A 4O2LA 2PZMA 2XMQA 3AWIA 4MKXA 5G53C 1YJCA 3DAYA 3T7SA 1R5JA 2J45A 5CNJA 2HLNA 2PZEA 2JK0A 1ZXLA 2XUDA 3RLFA 3WYFA 5E3JA 4BQSA 4KMOA 2C8VA 4TVOA 5AXBA 3REGA 3C7TA 4LYAA 2BFMA 3HR7A 4F6CA 2HIGA 2OYSA 3MUOA 4CF7A 3DWGA 4BN4A 2B20A 3BDIA 3EF3A 5AJZA 1VCMA 2NYAA 5LYJA 2V4MA 4XLLA 4LXQA 4O6VA 4X0EA 3ZGXA 1MQSA 1O5OA 1T2CA 3UFXB 1JLLA 2HFJA 3NB0A 4KDRA 2CXOA 4MR8A 1VMEA 4MR9A 3UH0A 4CHGA 4POOA 1QNLA 2F17A 3EODA 5EZSA 1UFKA 3PFIA 2HWWA 2ID8A 3VSAA 3PVZA 3C74A 3WMWA 1AQLA 1WHSA 2CB0A 2L17A 3FWNA 4BKOA 2RHWA 3O8LA 4QHYA 1GGHA 1Q17A 2VOEA 3SVLA 1UAAA 1HT2E 3FNBA 1YJBA 1YC2A 3U7JA 5K20A 2V1UA 1SOWA 1YHZA 2K4MA 2Y05A 1SOAA 3IJPA 3VXKA 5HMLA 2I55A 3HRHA 4G8CA 4ARBA 4UCQA 3GBSA 1WP9A 1JKJA 3JASB 2OCPA 1Q14A 1Z8FA 2HWYA 1E6UA 1Z6TA 4B3TB 4D5EA 1W1UA 2PQ2A 2R44A 3WGTA 4IIXA 3GJTA 2PQMA 3MINA 4A73A 3EQ7A 1G3RA 4M0CA 4CM8B 2ZM5A 3SAJA 2QRVB 1Y7TA 3BRCA 3NATA 4D0GA 2HL6A 3RYIB 4TVBA 3QEAZ 2CLEB 4XQ0A 4AAYA 4WJLA 3A6PC 4I9NA 5DXFA 1NU8A 2JEYA 4C5CA 5ICSA 2LGJA 5IH3A 4F8EA 3BICA 4XGKA 4DAEA 4UU7A 3GFOA 3L7IA 5B64A 4XJXA 4BB0A 2FSSA 3N58A 1MC8A 4TTVA 5J63A 5K3FB 4CQJA 5HW0A 2QM0A 3M4YA 3DEYX 4YUXA 4EELA 2JKZA 2Z83A 4OGGA 1L4KA 4ESVA 1OHHD 4NE7A 2Y66A 1S3SA 5ALNA 1A4IA 1E1KA 2BFOA 3SS7X 5CFPA 2JLZA 1EVKA 4D4KA 1DZIA 3EZFA 3MWEA 3RREA 4QBFA 3FPKA 4UQLA 4KUGA 2NU9B 1UMDA 4AN0A 1ISSA 4KDCA 5KZMB 4B82A 5KQMA 4DRXB 2R6HA 3JQFC 2I65A 3R0VA 3EZLA 4PCUA 2GJ8A 1EWRA 2ZRGA 4B83A 2BKLA 4YRIA 4KRGA 4LFCB 3RFXA 1UP4A 2ZANA 3N86A 5HFJA 1RMQA 3AY7A 3EQ8A 2NPFA 3EIOA 1A7AA 2NZYA 3F6SA 5IM4A 2BF7A 2GSWA 3F3YA 2R86A 4AJ4A 4QQRA 1GUDA 2F1RA 2OSBA 1LPMA 1ONSA 3C7CB 1WZ2A 4IXTA 4X5OA 3KZMA 4KQ2A 4B34A 4E33A 2AR9A 3B1VA 4LN1A 4BMOB 4OXYA 1ZVVA 3T34A 2YHSA 4KLRA 4DMLA 1ZEMA 4CQMD 1FW6A 1JU3A 3NYWA 2CVQA 4N0EA 2FN9A 2QM7A 3F4KA 4YY3B 2FG5A 2VPQA 4P2GA 2DB3A 2NYVA 3J7TA 1VE9A 1AHPA 4S05A 1WCXA 3R3YA 1E9DA 5IS2A 2ABWA 2R87A 3JX9A 1PYDA 2A1UA 1H5QA 4NMLA 3D3JA 5AI5A 2OC9A 3A0RB 5B3JC 5TEVA 1L7BA 4MWZA 1E4YA 2HAEA 4E5PA 4FMBB 2GAJA 1XWIA 2JRCA 4CKBB 3O4VA 4R2JA 4E21A 3WLJA 1NTOA 1XZDA 1PX0A 1EAYA 3KVVA 4NAHA 2G9NA 5ALJA 1H22A 2CE2X 5AOCA 3ZCPA 3VKHA 2G72A 3SHWA 5CCXA 3KVYA 4O3MA 1QV6A 3CSSA 3P0EA 1XYGA 3U40A 3FZNA 1E79D 3WQHA 3K6RA 2X4IA 3Q15C 1FXUA 3ITEA 1NE2A 5D00A 4NMXB 3TKAA 5LMCA 1G4AE 3BD8A 3L04A 5K0GA 4B8WA 3JAKB 3PXEA 3OFVA 4X1YA 5JZMA 1MA3A 1VB5A 3KKEA 3G5UA 5EYPA 3V4SA 1CJVC 1Z4NA 2E9SA 4QJIA 1V16A 1W5SA 3OZSA 2KX7A 4QBHA 1U0EA 3HXKA 4MYRA 2JH9A 2PZLA 1ECGA 1SC1A 3ANLA 3DAPA 4I50F 4NQRA 4MV8A 4H6XA 4GT1A 1I1OA 4QULA 4UBNA 4F46A 1TF5A 1A9QA 1IZ0A 4FW9A 4ERNA 3V1MA 1KEEA 2OT3B 4Q3LA 1MOQA 2XA9A 1YGYA 4M1KA 3VPGA 1E9EA 4BJ3A 1GGMA 2QQ5A 3N2YA 3RAFC 4HX2A 4ND8B 4E32A 4RY0A 4N12A 1FFXA 4KLNA 3A32A 4FGJA 3TLKA 3VR4A 5B55A 1WCV1 4QARA 4WZBA 3ZCUA 4WINA 5IMSA 2H7XA 2RGXA 5FNVB 3ZGNA 4ETIA 2VHJA 3A8TA 2YNMA 4FI3F 3STHA 2XXBA 3RBAA 3TQIA 3X2SA 2IYFA 1EDOA 3CPSA 1CQIA 3IPYA 5KCMA 4AX8A 1VE1A 3K16A 1IU9A 4WADA 4MIKA 3T4EA 2VSYA 3WWPA 4MV3A 5IEBA 3RVDA 5L7TA 2JDIA 1VGRA 4B0OA 4MVWA 4ALMA 2GD1O 3O4FA 2CVHA 4UHBA 2ZSFA 2HXSA 2YQ5A 4DC0A 4G9GA 2VT3A 2DBZA 4A4DA 3K8OE 2VK2A 3DWFA 3HA3A 1UDAA 16PKA 4D43A 5IJWA 4CV2A 1NXQA 4IG4A 1NOJA 4FFVA 1CG6A 3HXQA 3RCBA 3ZY5A 4B44A 3ABZA 2W6QA 3IHTA 3JAMA 3ZH2A 4DR5B 5AOVA 4P53A 5J1TB 4KNYA 3ZDXB 1I2BA 2R68A 4BNIA 3ZOKA 2A78A 1Q3KA 3BDVA 2PUWA 5K8CA 5I7SA 4KFCA 4W9NA 3QFHA 1E96A 3EGDB 4OV6B 2QN2A 1FE8A 5FUYA 2C2OA 3OLVA 5K0NA 2QRLA 3IDSA 3QTLA 1THZA 2WJAA 1NP7A 1ZQ9A 4XJSA 2F4VB 1LNZA 1QH9A 3NBMA 2LR0A 4HEHA 3BBLA 2ZJZA 2AFIA 1HV8A 4YRZA 1VRVA 1Z6ZA 4HLUA 1E0DA 3U4DA 2PN1A 1E5VA 1Z6YA 4IBOA 1U3VA 4KDEA 4JYBA 4N7MA 3RM3A 3UK7A 3WJAA 3O6VA 4Y6GB 4XVQA 1ARZA 1QFZA 1A97A 2P4HX 3S55A 3SEAA 1L3CA 2BP7B 3HUDA 3EPKA 1Q20A 1IBMB 2C59A 3WK5A 4AJKA 3UUFA 4CIDA 3NYIA 3VR5H 4F0JA 4M1OA 4BFXA 2A5LA 4CF5A 5MN4A 3IV6A 2PPLA 1EVIA 3K05A 3LVBA 3PX3A 2ECPA 3AINA 4YI5A 4B3DA 4RSMA 3A6KA 2Z8ZA 4HTFB 3FYUC 5DU2A 4CF3A 3AR5A 4P92A 3E9QA 3T12A 2OCKA 4C06A 2HIMA 3OOHA 4IW3B 2AX4A 1TK3A 1N0HA 2DHQA 3SF8A 2Y1FA 1T9ZA 1ULTA 1ABEA 1YZQA 4L9RA 4X9XA 3R7SA 1ZD8A 4CLHA 4IX1A 4YEDA 5IG2A 4EW3A 1SC9A 3UAOA 2WM3A 3AFNA 4NZOA 4QAQA 3A1SA 3ZHCA 1B23P 1P5JA 2O6HA 4LG1A 4XM2A 2J3KA 2SICE 3FSGA 3L4BC 4QLAA 4DPLA 2E5FA 4Q9KA 4GX0A 3ZHXA 3HNRA 3AKDA 2RGUA 3C6KA 2PE5A 3DE6X 3R5HA 3UHPA 1W2WB 4LHEA 4M9XA 5T5QA 2YV1A 4IF4A 2VCEA 3IPXA 3MMNA 1YDWA 2QVYX 1UKBA 1YVEI 2HMYB 4TTJA 4ZANA 5JFOA 3U7FB 3UNXA 1J39A 2PU7A 1ST3A 4LSZA 4M0LA 2WTUA 3D4BA 2V4UA 1NUTA 1GVNB 3STXA 3A9TA 1IBKB 3JQBC 2K5UA 4RJKA 1DIBA 4DT1A 4QTYA 3CG4A 4ZQFA 3TJRA 3LBIA 2VJQA 3HLYA 3QMWA 4MK4A 3O93A 5DSTA 3WOVA 1EDBA 5JT1A 1XG5A 3WKAA 4C4YA 3G0BA 1AB6A 1T9GS 2EGHA 3SKVA 5A4AA 4DYHA 4V3BA 1ZH0A 3WDMA 4AS2A 2IWRA 2APJA 2WYHA 5AVWA 1TAHA 2VDOB 1BHJA 3QSGA 1EVYA 4Q1VA 5EC8A 4ZV9A 4R9NA 1JAHA 4Z1MD 1PQ4A 5KTOA 1C9YA 3UAVA 2NPIA 3HZZA 3QXCA 4HLDA 3VM6A 1PT9A 2F64A 4OP3A 1ZN8A 5EZ6B 5JMWA 5FTLA 3C8ZA 2G0AA 2OG1A 4NATA 3C16C 1UC5B 4HX5A 3ZBQA 1OD6A 3UT0A 5F7JA 1BN6A 1ISJA 1HXHA 1QGED 1ZJ6A 4HUQB 1N9GB 5B53A 3CN9A 4AKHA 3Q6MA 2ZE5A 2CMFA 2AOVA 1L7EA 3P2OA 3E70C 2SKEA 2XI4A 1ZMRA 1CUFA 1O6CA 2GJAA 2IOQA 2ZTVA 3D0QA 3H19A 3JQRA 3SQMA 1N2BA 1VMKA 4W8OA 2W2NA 3A10A 5AVTA 1L1EA 2W6OA 1PZGA 2R65A 3JATB 3OI7A 4H3SA 2AJTA 2DH5A 3QLUC 4FR2A 4D1YA 1QIHA 2QAGA 2RHBA 1Q1BA 4JB3A 4ND6A 1JPUA 5AIBA 3G6KA 1P1JA 2G1UA 2YZGA 3GHYA 3RFUA 721PA 3AB8A 1KHHA 1L7OA 1NE7A 2BFCB 1WS6A 2XUZA 1T3SA 3DZDA 3EUAA 3HKDB 3LL7A 4LNAA 1MC5A 2AN9A 2XMRA 1RW4A 1TM5E 5DLDA 5FT9A 1X42A 5DOVA 3WJ2A 1VP9A 2ZCVA 3C1AA 3R1IA 4BPBA 2R7LA 2PIAA 2ZJ4A 2D0DA 2IYOA 2DKNA 3R3XA 2XTJA 3ZZNA 1FTQA 1DIAA 1R5NA 3MELA 1VHTA 4RVFA 4LZWA 4RCVA 2X7HA 3FE2A 4RS3A 3A14A 1YZGA 3DMTA 4UEKA 5FNVF 5HRAA 1IMOA 3SU8A 3SR0A 1JJFA 1J5XA 2ZBEA 4YO7A 5JBQA 4KN9S 4J03A 3PX2A 1L0BA 1P2SA 2D0PB 3WLRA 3A2LA 1MNAA 3OHPA 3QYFA 4DDKA 1QB7A 2ROQA 3OF3A 4UCFA 2QMOA 4D3XA 4ZCRA 1R50A 2IEBA 2M6RA 1FRNA 4V0MA 2XWJI 4KX3A 4PINA 1ZGAA 4XUGB 1N4AA 4A0HA 1U0NA 1RAFA 2CCJA 3A6JA 1MTZA 4N5IX 4G4JA 1I2DA 4I9GA 3TAHA 3M2PA 3WHKA 1SXJD 1M1ZA 1NGSA 3D54D 4DXHA 5FWXA 4PZ9A 1EFLA 1VYHA 4XLTA 1FJGB 1QUEA 1SNYA 2YR0A 1C0IA 3K3PA 4OMUA 4M1MA 3TSYA 4X66B 3W9BA 2P75A 4MX8A 2O7QA 4C7OB 3Q9LA 2FKAA 3MFYA 4DBVO 2WI8A 5T3UA 4JBXA 3T3IA 4C05A 3FKJA 2XKBA 4M36A 1NSFA 3C87A 5ECWA 2IU3A 1G63A 4K1XA 1T29A 3R7NA 5BRAA 1C4KA 4MA5A 4LYDA 4JB0A 2HUPA 3IR6A 1E9FA 1K8YB 2IHVA 4GE0A 4C0BA 3BH0A 4UD6A 1RQPA 4ZT6A 1NNSA 2GX6A 1U4SA 3IT1A 4PSVA 1GSIA 4M89A 2BI8A 3DKVA 3ESXA 4GOOD 3L6DA 5HUQA 1VPWA 1CUWA 2D00A 1V71A 4V0NA 1VE7A 3SDSA 4B84A 3SYRA 1NDHA 1ZU4A 1OQAA 3AUYA 5G1OA 4G0XA 2XMCA 4EG0A 2WM2A 4Y1RA 4PLZA 4HXFB 5JS6A 4MYUA 2BM0A 2P67A 1UKCA 3LQRA 4ENSA 1DRVA 2ID4A 2PV0A 4QYWA 2FSVC 4M0FA 1YDHA 4LRUA 4U3JA 4WKBA 1WV0A 3E1GA 3WYBA 2D59A 1W88A 4RQTA 3ICPA 4MWBA 4F4UA 3UWSA 1WMSA 2H08A 4EEXA 1T2VA 1QMGA 2IHUA 2V3VA 3IAAA 4PYQA 3WRWA 1XEWY 3M9XA 1XLTA 3KLNA 4ZOLB 5JLAA 5BSEA 3Q7QA 2Q9BA 7REQA 3F0TA 5DMXA 5HUJA 2JLVA 1TADA 1PGPA 1IOZA 1J2EA 3IT3A 3LW8A 1FPQA 1XMPA 2QIPA 4HAVA 4Q4JB 4RKRA 4UUQA 5I5GA 3U9SA 2GPTA 3S1LA 1I6MA 2R8YA 2HQOA 1E2EA 5LIPA 5AVJA 4ZVUA 5LBIA 2PCJA 3V2IA 3UJNA 4DCTA 2AUNA 1S0UA 1JBEA 1P1FA 2A1TS 1TJPB 2ERXA 2H1RA 2LP4Y 3KDAA 3LY8A 4E94A 1C9MA 1RP1A 1VQ1A 2G25A 1MVOA 1ZMTA 3EIQA 4Y2PA 3H9UA 3HZHA 3ST7A 2ZXEA 4R2IA 4ZJZA 5M5BA 3MGBA 4GLBA 2RB4A 4KN5A 2OV8A 4PO3X 5H68A 3W8NA 2JIZD 5JH7B 3CVXA 4C3OB 1GPDG 3FWPA 3DLPX 3NS7A 3VH2A 2FK8A 4IS2A 1QGOA 4Z4HA 2BZGA 3KQHA 3COPA 2UXDB 4AKEA 1ELOA 2R8RA 2I66A 4LBVA 1ZG3A 3AM5A 4TTAA 2R6FA 3LNCA 1UPUA 1F2TB 1IC6A 2PX5A 3EISA 3QWFA 4LHZA 4Q3KA 1BXGA 3HKCB 5H02A 1QTIA 2B5OA 3QBEA 4FS8A 2PS1A 5FP0A 1G59A 1TNDA 2AI2A 4FFPA 4NMHA 2X9GA 3UF0A 2H1WA 4L4RA 4OK5A 2QD2A 3T7RA 4JDUA 4YAWA 2FLVA 1CE8A 1TA4A 3I6IA 3TNYA 2JJ1D 3WSTA 1CJCA 5FPQA 4FM9A 3IDOA 1FQJA 2YHAA 2A0WA 3KUCA 3DTYA 4BB9A 1RE1A 4ZXPA 3QXHA 3A6EA 4I0WB 1V5GA 2QLBA 2ZAMA 2ZUFA 1XRSB 2GAAA 1VHQA 3EDYA 4AZWA 4N41A 4KQFA 1SU4A 2BFFB 2QRHA 5BWBA 3CIOA 5BQXA 2GM4A 1UFRA 4RNDB 1DJLA 3W5DA 1T9KA 3AB7A 1SCUB 4W82A 2IYZA 5THKA 3CKLA 2PEZA 3IR5A 4DANA 1DL5A 2W2MA 1RYNA 4FS3A 3EVGA 4F9GA 2VNSA 2DR0A 3TQTA 1VYVA 7ADHA 3G5LA 1FFWA 3H84A 3OIWA 3QUSA 4MUNA 5JNVA 3TZQA 3MJTA 3H8VA 1H3NA 2OBLA 2XQGA 5KTYA 1HSZA 3HG7A 1WDLA 2HLDD 3OOJA 4N54A 1D2RA 4GMXA 4K6HA 3HU2A 3U3DA 3G59A 4HP8A 1E2FA 4B81A 1GGKA 4P32A 3CLUD 1NQWA 3DB1A 3ENWA 2FPUA 1XTUA 3I5XA 3C8HA 4TMWA 2RIPA 2Z6AA 3V4ZA 2P5UA 3D8HA 3M83A 3X43A 2BMAA 1GKIA 1U98A 2GUWA 3K5IA 1TGYA 5FEUA 4RF5A 2ZIFA 3ONVA 3UICA 1UBTS 4NY1A 3B3AA 2IYXA 1KI6B 3EZ9A 1A8QA 3N76A 3ZNPA 4QJ5A 1I2MA 4QYSA 3ECSA 3D8RA 5I3ZA 1SUCA 1QC5B 3IGFA 2YXDA 5H59A 2XUJA 3S2IA 5M29A 2C9DA 3RH0A 1N7HA 2ZIXB 4ZRNA 2GNPA 4J4TA 4UU0A 5CT4A 3NRJA 1EP1B 1GA1A 4EY8A 3HU3A 2O0HA 5A3VA 4AZVA 4J0FA 1Y3HA 1JALA 3PDUA 2GRAA 4G4SO 2GD2A 1OXVA 2DXIA 1TFUA 1RLTA 5JBNA 3S8YA 1WWKA 3LL4A 2XA2A 1PP4A 4MEBA 1TQDA 2Y77A 4LGMA 3UENA 4DIUA 4FSXA 2MSDB 1E3MA 1MHTA 3U3OA 5JHHB 1FYWA 1XEXB 2SNIE 5KTSA 1U2GC 3S5JA 3R24A 1NT4A 4M8NE 1FA9A 3RAEC 1D2AA 1CP2A 4H3HB 5GJVC 3F5QA 4R1NA 1U2DC 3QYAA 2VZ0A 3N7UA 4BNVA 4CMHA 1K86A 2PH5A 2W8BB 5K3SA 1AUXA 1REQA 1X7WA 4FD3A 3NEPX 1PT8A 3P0RA 1ANKA 2GH1A 3IKMB 3A6GA 1NQUA 4AG5A 4G0QA 2MSLA 1SVKA 2RBGA 1ACMA 2HRBA 1IM8A 1JMYA 1LLUA 2HK6A 1P80A 3OUZA 2OBBA 2R7MA 4PCAA 3WRYC 4BKUA 2LD4A 3SMQA 4MS4A 1QK5A 1QH8A 2BR3A 4RL4A 1OGYA 2D0IA 4YCCA 5IVPA 5TQJA 3PGVA 4L78A 1SQSA 2OZLB 3DCIA 1Z36A 2ZSBA 1UBMS 1P2FA 1BQ3A 3E9DA 4KWHA 4G23A 2V8BA 2B36A 1ENYA 1DAGA 2H1FA 2O1EA 1SCBA 4WLVA 5HR5A 3ZQ4A 3QUQA 4FKMA 2POQX 3DLIA 2CMDA 3AOGA 3SD7A 1MFPA 5ESWA 4PLVA 3RYTC 5GP1A 4AM8A 1U02A 4IYRA 4LOHA 4IWYA 1UXKA 2DF8A 5G41A 1T0PA 2QXYA 3BFVA 2BJVA 1H66A 1XZNA 5EWMB 4DSOA 3DOCA 1ND6A 3SGLA 3EPLA 1DBRA 1XAGA 3D6TB 1L4LA 1ZIXA 9ABPA 2XWQA 3O8BA 4JCOA 3PLNA 1Z68A 2Q3EA 4YAIA 4YAOA 1F5NA 1VBFA 1FFCA 3TLGA 4EYOA 3BCHA 1LCIA 3MQFA 2RKBA 3O4RA 1NX9A 3OSZA 4DYVA 1GFSA 1APBA 1NM5C 2AYZA 4HQ6A 4P08A 1CTQA 2G67A 3KYCA 4EEKA 3AP3A 2FHPA 1DUSA 1RCFA 3I32A 4BX0A 3LRPA 3MAGA 4PIVA 2G7MC 1EH5A 1LV7A 1E58A 4EY6A 1EK5A 3KSBC 3H8SA 3KOYA 1BCSA 3IPCA 4NV3A 5JH7F 1UKAA 1WX1A 1F38A 2D2FA 1XQXA 3DBIA 2R8EA 3WYEA 1VCIA 4PGMA 3EMKA 1R3DA 4V38A 2W0SA 5CDHA 2B2CA 1E0KA 4C4PA 3TTUA 1UZAA 4MUFA 4V3CA 2VHEA 1OTXA 1JEDA 4QREA 4GMGA 1GWNA 1NIPA 1R6AA 2QIOA 3E2IA 3MB5A 3DDNA 4ZQEA 4YLEA 1NASA 3K4HA 5F9FA 2VUHB 1B7GO 3QHPA 4NCNA 3AYXB 1T9DA 5AKXA 4EG7A 4M1QA 4HAYA 4A03A 2I9KA 2QTGA 2DPMA 3N2LA 4CLEA 4AQ7A 3N8HA 4QM6A 1XU4A 1YA4A 2BEUA 4OGFA 5TXGA 4YMUA 4NCBA 1NQXA 1T0BA 3L02A 1YZTA 3IAM1 3PFNA 5DNAA 3KQUA 3B60A 2OHHA 4AJOA 3SBOA 1MG0A 5ALYA 2ZAOA 4YQZA 3TK1A 1A1VA 1EK6A 1J2YA 1TUEA 1GJRA 1LJ8A 3FVQA 3LYLA 3GC6A 3I23A 4XB6B 2C8LA 2Q1WA 2R60A 3DYVA 3RYHA 4BMYA 2AH5A 3MOIA 2DRIA 2HPVA 1YMUA 2NOAA 2QVZX 5C53B 1W8DA 2XNDD 4AMVA 1QGUA 4DIKA 4BVLA 5I01A 1EFDN 3BF7A 4U0JA 1SO8A 4D99A 3RS0A 3MWDB 3N6VA 3OWXA 4GM0A 4HF7A 4P54A 4FE4A 3SLGA 4DNOA 1W52X 4MVJI 2I6TA 2W4MA 4ARSA 5JW6A 4GS5A 2F1OA 2MMGA 2QW8A 2QR5A 3WGYA 5ELXA 1W73A 3L79A 2C0QA 4IJQA 4UD2A 5F2KA 2XKAA 1TE2A 4OSEA 3KT6A 1X7HA 2ZCJA 3FHCB 4BN5A 4FYPA 3ZWCA 4LI3X 4PHHA 4R9VA 3O0TA 4ZQCB 5CA1A 5C8YB 3IVCA 5IHPA 3OQNA 2XUIA 1NVEA 1F06A 3D7RA 4A10A 4W7SA 5TGZA 2NAPA 4ER6A 1U5CA 1QVVA 4Q6BA 1I0LA 4P34A 1PL8A 1WSWA 3AL3A 4YACA 4YV7A 3NIBA 3SSMA 3AVWA 2HA2A 3FRIA 1K8ZB 3BGIA 3H87A 5BYKA 3HH8A 4BC0A 4DUPA 2FW8A 3ZI4A 3LQKA 4MIYA 2A84A 5DK4A 1EI9A 5G3ZA 1U7UA 2I8CA 3HB4X 1P7ZA 3ZU4A 2BZ0A 3U4QB 2C9CA 2NXCA 3S7ZA 5BR7A 1T15A 2WYOA 2XD9A 1Z5UA 2Z2YA 1L4UA 2WLTA 2JIBA 1BA3A 3CLTD 4YV0A 5KMGA 4W5RA 2P65A 3DE7X 2W5UA 4PO1A 1NFFA 4PRZA 2X0KA 5DI9A 5IMBA 4BWFB 2FEKA 4NJEA 1YZYA 2ZUEA 4CMIA 3K6SB 1YJQA 2MT9A 3TLEA 2BH2A 3GJ5A 3WOHA 4FN5A 2VJAA 5E6RB 2O57A 4HHEA 2JA1A 2OK8A 3V7NA 2VP4A 3RB8A 2PTGA 2PWBA 4MGKR 4BVBA 4OAOA 3SZ3A 4KPGA 4C6TA 3R5JA 4BZPA 4COOA 3BAZA 1ZUD1 5HHTA 1ZJ4A 1UDXA 3C3AA 3MIIA 3PNVA 4D3SA 4EI7A 4L9SA 1U8UA 1J2TA 4FE3A 2CDCA 3X0DA 2RAVA 5D01A 4E5VA 4MIEA 5CXUA 4F96A 5KNDA 4BLTA 3R8CA 5FX2A 2HA6A 2YRFA 4GLOA 1JN0A 2IIQA 5KKCA 1MORA 3HBFA 2GN2A 4FGWA 4KXWA 5AW0A 4MQFB 1RXVA 3ICQB 1JFVA 3BKWA 1Y33E 3EXEB 2OHFA 3R4CA 4RAQA 3VO1A 3C6BA 3WL8A 1FYDA 2NLOA 3TL3A 3P2EA 2LVBA 2GEBA 2YIDA 4IH1A 4HQRA 1SQGA 4DRZA 1WV1A 1GM5A 1DEXA 4J91A 5ARDA 2R79A 4MPPA 4B2IA 1U8AA 4U8GA 2P3LA 3SSNA 4A82A 2A67A 3NGXA 5I7EA 2ZLBA 2F3UA 3FTEA 4LVCA 4OXNA 1G21A 1EPUA 2AMYA 1MUUA 2ECQA 2EQAA 2PXCA 2RGAA 3C7DB 2GWHA 1V6AA 3CH6A 3W9UA 5KNLA 5EIXA 2E5LB 3O2QB 1OX4B 2WD8A 4H1TA 3SYKA 4D0RA 1SZJG 1V8DA 4FOLA 3R7WA 2CLKB 2VHCA 3KQYA 1DDOA 1N2CE 1Q0RA 4L74A 3IQZA 4UQPA 2Q3LA 2AVNA 4C20A 1CK4A 1TFRA 3F2IA 3LKDA 4RMIA 5KDOA 1V8ZA 1FNNA 2ZI3A 2MYUA 4IHJB 2WYWA 3N8DA 1DX9A 1EUDB 2KB0A 4URXR 4B6QA 1RJWA 1RXCA 4U9HS 4GKVA 2HK9A 2PFSA 4ENTA 1ZN7A 3FFBA 4X1IB 4MMZB 3F67A 1CUAA 2X8LA 1HKHA 1KEPA 1RLOA 1QO7A 1T6NA 2YZ7A 2X2PA 3EDCA 1JWLA 4PG6A 1L5MA 2YTZA 4YA6A 5NULA 3ZEAA 2WEKA 1SK8A 2G77B 3CO0S 4Y9TA 1XDSA 3V3KA 1FJHA 1R0SA 3WBFA 4XR9A 2VQSA 1P8JA 1AKNA 1O89A 1ONBA 1Z2DA 2V97A 1PHRA 2OHGA 1P2VA 2RHJA 3RRJA 1OF1A 1ORIA 1DJQA 2I7VA 2V8OA 1W44A 3KQVA 4A8TA 1QP7A 1SQ6A 2WC1A 1NW6A 2QN6A 4KE9A 1J2UA 4EOGA 1EJ6A 3I3SR 4EVQA 2ZT5A 4N5LA 4O2BB 3EG9A 4WACA 1A4XA 5D3MB 3U3XA 1EP3B 3PTAA 5LMZA 2P8SA 1DBPA 5L45A 1Q2UA 1YOVA 3VC3A 2IGTA 4FBMA 1PZEA 1OFGA 4JOQA 4KWTA 4BP8A 1J8YF 4X6YA 3B6EA 3MTJA 3QVMA 2XGJA 2O1SA 1F48A 4WKGA 3DDUA 3PWKA 3R9IA 5F4BA 1B6SA 3IVGA 1GZHB 4MW5A 4W8HA 3ADKA 3D4LA 3SVTA 2A7QA 2CXXA 4N0QA 3V1TC 1VL8A 4O4LA 3RHTA 4EPYA 5CLFA 4R8MA 1QLWA 1IHXA 1UMKA 2FFJA 4GMDA 4AYWA 1AMNA 2VPIA 2D1QA 3SX2A 2OV1A 2IS4A 1R6UA 2WIJA 5KBYA 3T3EA 4ND7A 4BUCA 1VJRA 3K09A 2A9FA 2OAP1 2FHSA 1NURA 5ER9A 5FR2A 1SHUX 1Y7LA 5D84A 3FCOA 1V9CA 1H0SA 1OAKA 2ODAA 4RHUA 5F4ZA 3RODA 1J1IA 2HW8A 1QUFA 3CCCA 3L8HA 3FZQA 4LTMA 3RRXA 2CXTA 1H2RS 3Q5DA 1U1DA 5FO1A 2XRMA 4ZOCA 4EW1A 5ICFA 1P81A 2OZKA 1Z0IA 4NSNA 2AXQA 4FR5A 3ZXSA 4F91B 2QUHA 1SKYE 1P17A 4KH0A 3W05A 3G1UA 4KYUA 1EBFA 1UP6A 3A6ZA 3MT9A 5C8YF 4BNZA 3EASA 1BE6A 4RPHA 3TNFA 1XEWX 2SHKA 1JEYB 5G0VA 5K0SA 2JAUA 2OSVA 2PAFA 2Y27A 3L7BA 5BVGB 2R48A 3QU4A 4XYEA 4ZYVA 4X7BA 1YL5A 1ZGHA 3HXLA 1X0XA 3P52A 5KSOA 2YIJA 4NBTA 2PMBA 4O4JB 2HO5A 4OLHA 1NBAA 1W35A 3F7TA 4FFOA 1F51E 2YMMA 2WMNB 1Y1KE 3OE5A 2EF0A 3UO8B 4F38A 1J09A 3GNSA 2AFHB 1L5HA 3ZGOA 2TMGA 2Y68A 3BMCB 5ITWA 2NTYC 2XUPA 3EEBA 1A27A 5F73A 5L9AA 1OFUX 5KHAA 1TZCA 3PR1A 3S29A 1SIUA 2FPKA 2IUTA 3L05A 4QTXA 3BJIC 1MO3A 5DTMA 5B1DA 4J9VA 2J48A 4GP7A 4Q48A 4WNCA 2GETA 2LZ0A 4AVYA 3ET5A 1OXKB 3LX4A 4QOHA 1JLMA 2IDZA 1XJ0A 3KWFA 5EKSA 1KDVA 5AT1A 4CKWA 1EM6A 2W0MA 2G08A 1ZYUA 3QI2A 4MP8A 1T3TA 1E3WB 2Z8XA 1R6DA 1TCBA 2Q4OA 2ZULA 3C14C 1MO6A 3FNHA 1FXWA 4XOUA 4AKSA 3C3CA 3CNBA 1T13A 4X95A 5TV2A 3U49A 4E03A 4N3AA 2F9FA 2EU8A 4XXHA 4ZI7B 1EU1A 2ZG6A 4PSDA 3THYA 3LFTA 5KQPA 2PUEA 2H9AA 1WQ1R 2RK6A 3A9UA 5JD4A 8ADHA 4BS9A 4AF8A 4NEQA 1KJIA 2R8ZA 4NIMA 1NUUA 1IWPB 3KKKA 4LVUA 2HH9A 3UIEA 4B7UA 4PQEA 1T6XA 1YE8A 4P7BA 2GKOA 4HDMB 4HH4A 3QF7A 5SYNA 5FCDA 1PDOA 4MS1A 5DHAA 2X9NA 4XCVA 1TTHA 3HB1A 4J0DA 4LFBB 3QIAA 1M5UA 1Z4PX 2ZE7A 4ZYYA 5E4YA 1W87A 3DBOB 3OZWA 5HX7A 3AR9A 2IEYA 4FNOA 2FP4B 4WE3A 2HNBA 1Y4ZA 3LC7O 5CIQA 2BTQA 4ENUA 1NYRA 5F12A 2C9MA 3CSDA 4IHKA 1CZUA 1C3LA 2IHNA 4WZAB 1EYZA 2FR8C 1HDZA 1TL7C 3G88A 3MUFA 3RHFA 4C07A 2HR1A 4F21A 3F9RA 5DW0A 3CO5A 5E9JA 4DLYA 1IHYA 1OXMA 2CF5A 3CF6R 5BN3A 3OG9A 2NZWA 5K4AA 2UZ1A 4AJ1A 5U1PA 4EG8A 1OLXB 1M10A 1Y63A 2AMVA 4FYWA 2Z0MA 5L3SB 4CEJB 3CBQA 4U7FA 4ZODA 4E70A 3R09A 5AOBA 4O4IA 4EHHA 3TGLA 4Q3EA 1UDBA 3T9AA 3L1KA 5JAHA 2YXNA 3T1OA 2J09A 2RJNA 1LH0A 1UZUA 4Y2XA 2XQJA 5DH9A 2Z2ZA 2NQTA 2D54A 5BSKA 3GLFB 5G3YA 1GILA 1KE1A 1VYUA 1D4AA 3K0BA 3FTDA 3RJ5A 3H7IA 3PUKA 1LLCA 4KQGA 1OH6A 4QNRA 1JJVA 2UKDA 4LAFA 5AVUA 3T3OA 1PKXA 5THQA 3QVLA 4R9UC 3TR5A 3IA7A 4KE8A 4WA7A 1H6CA 5CXQA 4XGRA 4J0HA 4BV8A 4C76A 4CI0B 5GVSA 1CVIA 1QO0A 2SECE 2O8DA 4ZYXA 3O94A 2A94A 2GZRA 4JIGA 2H7VA 4FKZA 3LC0A 5EZYA 3X2FA 2BM1A 2JS7A 3Q87B 4ZRMA 5J23A 1GNVA 3FYDA 1K63A 1QTQA 5I4IA 5EVCA 3VNUA 1T35A 5DFAA 3DUWA 2H2DA 1JAIA 3K53A 3B3FA 4O2BF 5AVYA 4UE3S 3QX3A 4YH1A 1FDRA 2FGJA 2IE0A 2QRZA 1AD2A 1TO6A 1DI0A 2BC9A 1PW5A 4TXNA 5M3BA 5AUNB 3GPCA 1R9GA 1TVMA 2CFRA 3W04A 4DCCA 3WGJA 1DJMA 1GR1A 2EZUA 2OGSA 1K6XA 3ZJ5A 1SELA 1GCAA 4KXNA 2XSZA 4IIGA 5B30A 1V5WA 1C4WA 1TPZA 2BHSA 2COEA 2AE2A 2VZLA 4JQYA 3IQHX 3ILSA 2X0FA 3WLPA 4IDPA 3VU0A 4DVJA 4HT3B 1Q7RA 1SCNE 5CA0A 4GXQA 4M1SA 4GG1A 4H7JA 2L2QA 3THRA 1VHJA 3OQBA 1D8TA 2XYQA 3HKBA 3V7WA 3VR2A 1LFDB 5J9FA 2NO0A 5BNFA 1N78A 2RHHA 2DY1A 4Q4AA 3TCNA 6Q21A 1NJGA 3EVAA 2QM8A 3NOXA 1D3AA 3L8MA 3AEKB 4EHJA 2HJGA 3D5EA 1YA8A 3WBKA 1P0IA 3NUZA 1J0BA 2WD9A 1KMCA 1TT7A 1XAJA 3C3XA 3PK0A 4JSYA 5CITA 3KDSE 3B6KA 4N9QA 2JFBA 2V55B 1NUQA 4HYTA 3RTEA 4G1BA 2DULA 3MRXA 5KNCA 2WJWA 5I7UA 4ZQHA 1ESEA 2HUNA 5EXTA 1VLMA 2AOTA 4A26A 4JT2A 1K98A 4RWZA 3G5AA 2K87A 1IN5A 2Y1KA 3RIGA 2IYTA 1DP4A 3JWHA 3LKVA 3KYBA 1F8GA 3Q1LA 4RH3A 3VAZA 3B2NA 5B6PA 3LD9A 2UUAB 4LF7B 1PR1A 1XOIA 3TIFA 5C7LO 1P9NA 1XEFA 2YICA 4EX6A 1DC5A 3FTFA 4KJZA 5K8UA 1WUYA 4KQIA 4ZZ0A 1UZNA 1NZDA 4E31A 5F5LA 4OVKA 3C7KA 3VBCA 4R1OA 2OECA 3KKQA 2H18A 5BT8A 3MMSA 3FZGA 1Q2XA 1UQTA 3NPMA 3NW9A 1JHVA 4M1TA 4B3GA 4GZ6A 2X9QA 3QOXA 5FIUA 4RW0A 5EQJB 4MTLA 1Z0ZA 1L4HA 2W6IA 2I2BA 3LK6A 5I9NA 2C83A 4FJ2A 4L76A 4LOJA 4DM3A 4KX5A 3EWNA 4ETNA 1XRMA 2WJGA 1OGJA 2P90A 3DHEA 3RSZA 2OWDA 4GFDA 3UWDA 3VPXA 1PU2A 1H05A 1KETA 3RNOA 3QKRA 3THWA 3G2OA 3PIIA 4IDFA 3RSOA 1NWCA 3GLQA 2AYXA 3D8TA 3KPWA 2VDWA 3GCXA 3DS8A 4YMSA 3DZFA 1R8JA 3V7FA 1E3TA 4B73A 2ZEJA 4G89A 1E1NA 1VI5A 1V1RA 4IMJB 4LS3A 4K87A 1OV6A 1HEUA 3KSZO 4K28A 1LBEA 1LVGA 5F7OA 1G19A 2JIQA 3MWFA 2OORA 2RGWA 1EVQA 1HDXA 4M1ZA 4LQLA 1DTWA 4KP7A 1NVTA 1OIWA 5C3MA 3GZ4A 2V7QD 4L3WA 4QDJA 1DNPA 1VJCA 2Y4OA 3C70A 3QPWA 2BDTA 4CM1A 2WDPA 2CHVA 4F5DA 4MUGA 3BWYA 4MARA 2J9GA 5A71A 1OMOA 1OY1A 4L6IA 4L57A 3I5UA 4DDTA 1T24A 1R0CA 5IXYA 1W36C 3GWGA 4DJEC 5BMVA 4QXAA 5EIEA 3IQDB 4Q3AA 4ALNA 3RIHA 1JS1X 3UG6A 1X7YB 1JNXX 3HN7A 4HDRB 5L40A 2EFEB 4I7EA 1GZVA 1LDNA 1U90A 1ZW1A 3H5AA 2I8LA 3AIKA 4PVDA 5TRTA 3LLSA 2ZUTA 1X38A 5CFRA 1MX1A 4M1EA 4O08A 1TUGA 3CW9A 5K3CA 3BXPA 4NH4A 1XYVA 2AG5A 3F5SA 3K0SA 3I9LA 3PHBE 1G5QA 3AJEA 2BRUA 1YS4A 2FR1A 2HF7A 1TT5B 4WHMA 5KSYA 2EEZA 2P9QA 3R3WA 1Z4LA 1UEIA 2LDXA 2ZKLA 3OA2A 1TQ6A 4DNPA 3H9QA 1PEKE 4Y8VA 4I6EA 2QKYA 2WF9A 4LGCA 4ND3A 5BRNA 3F5FA 1T5DX 3FGPA 2HBQA 4C2TA 1OFVA