2AVNA

Crystal structure of a ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from thermotoga maritima msb8 at 2.35 a resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
247
structure length
247
Chain Sequence
HMKLRSWEFYDRIARAYDSMYETPKWKLYHRLIGSFLEEYLKNPCRVLDLGGGTGKWSLFLQERGFEVVLVDPSKEMLEVAREKGVKNVVEAKAEDLPFPSGAFEAVLALGDVLSYVENKDKAFSEIRRVLVPDGLLIATVDNFYTFLQQMIEKDAWDQITRFLKTQTTSVGTTLFSFNSYAFKPEDLDSLEGFETVDIRGIGVMEYPDERISEREETIFRLEQELSRDRNIIWKADHIFFVLKKKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquinone/menaquinone biosynthesis methyltransferase-relate
publication title Crystal structure of Ubiquinone/menaquinone biosynthesis methyltransferase-related protein (tm1389) from THERMOTOGA MARITIMA at 2.35 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 88
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2avnA00
5HIMA 3O31A 2ZIEA 1INLA 3OU2A 4AZWA 3MHTA 3G2MA 5CIYA 1NBHA 3PT9A 3SM3A 3PB3A 2VZ9A 4CXMA 2YTZA 3GCZA 4HGYA 1TPYA 1NW8A 3QV2A 1SQFA 3KU1A 5HZMA 1PRYA 2AOTB 3DOUA 4OQDA 1HMYA 3NMUF 2AOVA 4E2WA 1YFJA 2IH4A 2O06A 3EPPA 3DLIA 1ZKDA 3AY0A 2B9EA 3PVCA 3Q87B 4BLWA 3FPJA 1BKYA 2XVAA 5LQRA 4YV1A 3UWPA 2ZLBA 4RTSA 2OY0A 3KPYA 3EMBA 4IWNA 4M37A 1JR4A 5EOVA 5E9JA 5F2NA 4BP3A 5DTRA 2BM9A 3G2OA 3KPVA 4YUZA 4YUVA 3P97A 2EFJA 3ME5A 1N7IA 2ZSUA 3JWGA 1FBNA 3OFKA 2PVCA 2PXCA 2AOTA 3GRRA 2E5WA 4A6DA 3FTDA 5DTMA 5FUBA 5DSXA 1JTEA 1XCLA 5D1NA 3HCCA 3M6WA 2ONZA 5EKXA 3NVKI 4EVIA 1SG9A 4V0QA 5IKMA 3HVJA 3DUWA 5K0GA 5EKUA 2AVDA 2H00A 2I7CA 5C9ZA 3ID6C 4C07A 2O07A 5EG5A 2NXEA 2XVMA 5E1MA 1F3LA 5H02A 5FCDA 5E8JA 1L3BA 2OZVA 2EX4A 4GC5A 1ZG3A 3DTNA 3G89A 2WA2A 2PJDA 1KXZA 3FUTA 4PONA 5E1OA 4NECA 3DH0A 2EJTA 5K0EA 3ERCA 3M6UA 1X1BA 2VS1A 4P7GA 3PFHA 4BLVA 3BGVA 4M7RA 2ZULA 2IPXA 3DXXA 3HCFA 5FA5A 4RTMA 4FT2A 2ZW9A 1QYRA 3NW9A 2PXXA 3HCDA 5DLYA 2PY6A 1ZGJA 4E30A 4DA4A 4BY9E 3UJDA 3FPGA 2IDKA 3HVHA 4MWZA 2DULA 3I64A 3EVAA 3BGDA 3UZUA 1G60A 3EVZA 5DXAA 2ZIGA 3C6MA 4P7KA 5EHGA 5EMJA 2QE6A 2XYQA 3OU6A 4BLUA 5FHQA 4WXHA 1YUBA 1U2ZA 2AOWA 5CUQA 2P40A 1KHHA 3T7TA 2Z6QA 4QDKA 1SUSA 3PFGA 1KIAA 2GS9A 5C0OE 2YQZA 1ZHFA 2FPOA 4POOA 5K01A 4C4AA 2ZWAA 5CD1A 2HR1A 2ZZMA 3SGLA 3I58A 5DM1A 3SSOA 4X63A 3ANXA 3AXTA 3BZBA 5LQKA 1L3CA 3P9KA 2I6GA 4E31A 2BR4A 4PYMA 2YVLA 2JHPA 3ELWA 3PS9A 7MHTA 5EPEA 1IM8A 4FS8A 2PV0A 1B42A 5LQCA 2GA9A 1SVUA 5EHIA 3SMQA 4FT4A 1X1DA 1ZGAA 3VC1A 5E8RA 4BP1A 2YXLA 4MIKA 3VYWA 2B2CA 4DCGA 2PX5A 1XDZA 3BWBA 2P35A 4C05A 5BW4A 4PYNA 1N2XA 2GAFA 4PYOA 2K4MA 4QPNA 5EEHA 4HTFA 4YV2A 4OA8A 1FP2A 5JUWA 1JSXA 3D2LA 2CWWA 2FCAA 3GO4A 4HH4A 3IV6A 4EK9A 5FULA 1R6AA 3B7PA 2EG5A 4RX1A 4WVLA 2B25A 3BKWA 3KQWA 3GRZA 1KYWA 1Y8CA 5EC8A 4CKBA 3HTXA 5K0LA 3A7EA 4O29A 1Z3CA 5DM4A 3THSA 5U4XA 3VC2A 3OZSA 4U7TB 5CM2Z 3TM5A 4LG1A 5EZSA 1WXXA 2B78A 5E2BA 3NJRA 2OBFA 2C7RA 3DXYA 4R8SA 1L9KA 5IH3A 3CJRA 3MERA 5DTQA 4MTLA 1QZZA 3FRHA 2PWPA 3B5IA 5EMLA 3TQSA 4PNEA 3KQPA 5DX1A 5K05A 1P39A 2OPBA 3LCCA 5P8WA 2ONYA 4AZSA 2VDVE 2ZBPA 3KPUA 4RVDA 2ZVJA 4ZTBA 5K0CA 3TM4A 4GF5A 4FZVA 4R05A 5CVUA 2IH5A 1D2HA 4GUAA 2AOXA 4DKJA 3P71T 2ZFUA 4E2ZA 4LECA 5EMKA 4PIMA 4KDRA 4DQ0A 3PLAE 3UJ6A 2WK1A 3C3PA 1XDUA 3OPNA 4IV8A 4PYJA 4YUWA 4QTUB 4QDJA 3UJ9A 4C08A 3LSTA 4HG2A 4U7PB 1FP1D 1KP9A 3HA7A 3OZRA 1V39A 1O9HA 4C04A 4QTTB 3O7WA 3LGAA 5GWXA 3B89A 3OZTA 1NT2A 2BH2A 5K0BA 3CJQA 2OKCA 3TRKA 3TR6A 3TKYA 2IP2A 3EEOA 3LDGA 1RI4A 1NE2A 5MHTA 1VPTA 3NWBA 4GOOD 4PGGA 1P1BA 5EIFA 4AUKA 4R6WA 4YUYA 2VDWA 4GC9A 2NXJA 2H1RA 2HMYB 2QRVB 3DULA 4FGZA 3FTCA 3KQTA 3HEMA 3I5UA 2OB2A 4M36A 1XVAA 5HIKA 2JHCA 2ZBRA 1IXKA 1VE3A 3M6XA 4RV9A 4ISCA 1O54A 3MTEA 4OBXA 4RWZA 4KIFA 4RTKA 3EVFA 1O9GA 1M6EX 1JTFA 5GINE 1YB2A 1KPGA 3E05A 3GNLA 5LQAA 2QRVA 1WS6A 4F85A 1EQAA 4DMGA 4EKIA 2Z6UA 3B3GA 3P8ZA 2IBSA 4ER5A 3KR2A 3P9IA 3FYCA 4OQEA 2YX1A 8MHTA 4KDCA 3JWHA 1R74A 2ZCJA 1BC5A 1QAMA 3ELYA 4FP9A 4YV0A 2IIPA 4EMSA 4HC4A 4P7JA 4PYKA 1VL5A 1JG4A 3LL7A 4DF3A 3L8DA 1KYZA 3A27A 4PCAA 2FRXA 1VP9A 3I53A 3DXZA 4XUCA 3LBYA 4JXJA 3C0KA 1I9GA 4V0RA 3MCZA 5GM1A 5CVDA 4IV0A 4C03A 3FTEA 1UFKA 3K0BA 5F2KA 5LR6A 2XYRA 1YZHA 2CMHA 1SKMA 2YXDA 3LKDA 5DT2A 3EMDA 5EMMA 4PWYA 4PINA 3DMFA 4RVFA 4RYLA 1X1CA 4PCLA 1BHJA 2IDJA 4F86A 2KW5A 3B3FA 2BM8A 3GRYA 2ESRA 3E7PA 3KPWA 5GIOE 2R3SA 1G6Q1 1RI3A 1NV8A 3UBTA 3GXOA 2N47A 3CC8A 1KPHA 3BWMA 2PT6A 3FPFA 3IHTA 5KYGA 3LBFA 3VSEA 3DP7A 5GIPE 2ADMA 4RVGA 3SX0A 3MQ2A 5ICEA 3P2EA 4AZTA 3UJCA 1IY9A 5CVJA 5D1HA 5EGSA 5E9QA 1WG8A 4HRAA 4ER0A 1JQEA 3OE4A 4RTJA 3AJDA 4RVHA 5FQOA 5FTWA 1T43A 4PYQA 2HNKA 3BUSA 4FSDA 2PX8A 4CTJA 4Y2HA 3NDIA 5G02A 3TMAA 2AZTA 1NBIA 3KQVA 3UJ7A 4FSXA 2O0LA 1G55A 2Y1WA 2ZTHA 1UWVA 3AXSA 4G56A 3FZGA 4QVGA 4GEKA 4KVZA 5DM2A 1D2GA 1PJZA 3CGGA 2IBTA 3TFWA 3LDUA 1UIRA 4OA5A 1DL5A 5FWAA 5K0FA 1MHTA 2PGXA 5KQSA 1FJXA 1EAMA 2P7HA 4R8RA 2P3OA 1L1EA 3G8AA 1BOOA 3R6TA 5K0NA 5C1IA 5KQRA 4A6EA 3FUUA 2CL5A 3DLCA 3HNRA 2GPYA 5CCXA 1JQ3A 1NW6A 5HIIA 1ORIA 1RJFA 3OFJA 2IFTA 2OO3A 3TPZA 1KPIA 4PIPA 1M0EA 1ORHA 3PX2A 5E2AA 4ER7A 1FPQA 3FPEA 3OU7A 5KS2A 4FR0A 2NYUA 3KKZA 5DSTA 5DX8A 5K03A 3QOWA 3SXJA 5K09A 5GM2A 2LD4A 1NW7A 3EVCA 3LECA 1SQGA 2C7QA 1DCTA 4XUEA 4R6XA 2BZGA 3UA4A 3U81A 2PLWA 3NTVA 3BWYA 3P2KA 5FHRA 4RTOA 3HVIA 5KVAA 3EVGA 1NV9A 3WSTA 2R6ZA 2FYTA 2QM3A 3FPHA 2QYOA 3P9NA 1SUIA 5HEKA 3HA3A 3KQSA 3AWIA 3M4XA 3KQQA 2ZIFA 5BXYA 2GLUA 3C6KA 5LQNA 5JR3A 3M70A 4CTKA 4B17A 3LPMA 3ELUA 4IKPA 3KQOA 3PX3A 2UYCA 5BW5A 2HWKA 2PKWA 1RI2A 1NKVA 2AOUB 3V8VA 4YUXA 1EJ6A 1WZNA 3EVEA 4KWCA 1YZ3A 2ZWVA 5K8VA 3LKZA 1WXWA 2ERCA 2G71A 1VLMA 1P91A 4EQZA 3S68A 3KPJA 3JWIA 3MTIA 4PYLA 5EQJB 1QAOA 2QY6A 4GBED 4KW7A 4HGZA 3B3JA 3G88A 1G38A 3G8BA 3BKXA 3IYLW 9MHTA 2PBFA 5LSAA 3T7RA 4Z2YA 3G2QA 1R18A 5T64A 5K0JA 1JG1A 2BR5A 2O57A 3LCVB 3HM2A 3I9FA 4P58A 2F8LA 3NDJA 3EVBA 3EVDA 3Q7EA 1Q0TA 1RJDA 3MGGA 3RODA 3R3HA 4GQBA 2UYHA 3A26A 3JWJA 3MAGA 1Q0SA 4X41A 5FWDA 3HCEA 3NVMB 3T0IA 2G1PA 3CKKA 3IEIA 1XDSA 4LWOA 2AN5A 2OB1A 2UYQA 4X61A 4F84A 2FK8A 1DUSA 5HOQA 1AV6A 3HVKA 4CKEA 1JSZA 5M5BA 4Y30A 3V97A 3CVOA 1VIDA 2V7EA 1XJ5A 2YR0A 2YUIA 1N7JA 4X1OA 5GOZA 3C3YA 4E70A 4M38A 2BR3A 1JG3A 3G5TA 3FYDA 3OE5A 3UJBA 4DM3A 3G5LA 2JG3A 2JJQA 3BXOA 3TOSA 1TW3A 3LHDA 1I4WA 2JHAA 4RTQA 3HP7A 2XBMA 4C06A 3EGEA 3KR9A 4CKCA 3GIWA 1EIZA 3BWCA 4ATNA 4EKGA 3DR5A 5DM0A 4QQKA 1HNNA 5DRTA 3CJTA 5EVJA 1RJEA 3GWZA 4LWPA 3SSNA 2VDUE 3TLJA 4KIGA 2P3LA 2P3QA 4ER3A 5F2OA 1JG2A 3DMHA 4E33A 1AF7A 5CVVA 3FTFA 2Y1XA 2YXEA 2PT9A 3MCTA 2JH9A 3E23A 4OBWA 1ZQ9A 2WA1A 3EGIA 2FHPA 2VP3A 3F4KA 3GDHA 2IGTA 3T7SA 2ORED 4RSRA 3KHKA 5B1SA 3UA3A 4CWAA 2UZ4A 2C7OA 1I1NA 3R0QA 3KR1A 3K6RA 1AQIA 3CBGA 1G8AA 1RI1A 1NW3A 3FUWA 2PSSA 2AVNA 4QPPA 1X19A 3KQMA 3KQYA 5FA8A 3RW9A 3X0DA 2AS0A 3LDFA 1H1DA 2GB4A 5GP1A 2EJUA 4E2YA 3R24A 4PYIA 2DPMA 1D2CA 1MJFA 1VP3A 2AN3A 4QQNA 4XUDA 3SVZA 4YMHA 3GRVA 4ER6A 1M6YA 4HSGA 1L3IA 4MQ4A 1VBFA 2ZZKA 5DXJA 2P41A 3EEYA 5E9WA 2ZZNA 1WY7A 2Q41A 1QANA 5ICGA 3TKAA 2I62A 3R9XB 3A7DA 3FUVA 3FRIA 4OX9Y 4AX8A 5CCBA 2FK7A 5ICCA 4DZRA 3ER9A 5ERGB 2I9KA 1JQDA 2XYVA 1RI5A 5EEGA 2GH1A 2PX2A 3HCAA 5EIWA 3M33A 3O4FA 5DRYA 2G72A 4HTFB 5HIJA 2PWYA 1XXLA 3HA5A 10MHA 2NP7A 4RTLA 3GRUA 2A14A 5LQUA 2AR0A 3MB5A 5T6BA 5BP7A 2CMGA 3A25A 3LX6A 3OCJA 3BT7A 4K6MA 1EG2A 2P8JA 2HV9A 4QVKA 2OYRA 3REOA 3UJAA 3UFBA 1YF3A 3EGVA 3CCFA 4XCXA 2V74B 5E1DA 5FADA 3SR4A 1P1CA 5E1BA 2AN4A 5CVEA 4RTRA 4GOLD 2ZBQA 1VQ1A 3SSMA 1KR5A 4RTNA 2OXTA 4RTPA 5T67A 3ER8A 4X60A 3GGDA 3DMGA 4UOEA 3M6VA 5ICFA 4H0NA 1YFLA 2JH8A 3H2BA 3E8SA 2NXNA 2NP6A 4P7FA 2PX4A 1XCJA 1XTPA 3RIEA 4AZVA 2CKDA 2P7IA 4E32A 1R8YA 5EZQA 4GOND 3THRA 3UJ8A 3QOXA 2NXCA 4MHTA 2G70A 2UYOA 1TW2A 3PTAA 5DX0A 3HCBA 5LQJA 4KRGA 3KR0A 5DWQA 5HFJA 4DCMA 1F38A 2H11A 2HTEA 3A4TA 4E2XA 2IH2A 3P2IA 3G7UA 1AQJA 1G8SA 1NW5A 1R00A 2G8NA 3ELDA 3GJYA 2NNWB 3FUXA 4L7VA 4YMGA 2C7PA 2P1DA 3P9CA 3LCUA 4PGHA 4GOMD 3ORHA 2AOUA 3G2PA 2Z6AA 5DPMA 3GU3A 1EJ0A 1R8XA 1RJGA 3NWEA 2PXAA 1X1AA 5FQNA 5HILA 1OR8A 2O05A 3BGIA 2B3TA 1QAQA
chains in the Genus database with same CATH superfamily
3EDYA 1UOPA 4FKMA 4RQTA 2PL9A 3CU5A 3A1DA 3HYNA 2YH2A 3S6JA 1BJTA 3OCUA 3EQ8A 2C3YA 4HGYA 1NW8A 4JJEA 4F2HA 1PRYA 2ZYAA 3NZEA 3WDSA 4A27A 3ZHUA 3VNRA 5IZ4A 3BWDD 1PNOA 2O4UX 2X9LA 3HXPA 1ZEMA 3PUIA 4G3XA 1ZKDA 4IUDS 1BZYA 1NVMB 4OXKA 3MMSA 5T5QA 1I51A 5BSWA 1F3OA 4MP3A 4DHWA 3VOTA 1ONSA 2H2DA 1PYOA 4NBUA 4TTJA 3JARB 5E9JA 4I4CA 4R1SA 1GPJA 2EJCA 3LO5A 1T9ZA 3DMYA 4S12A 4BVLA 4RL4A 1QP0A 4B6FA 1W30A 3PDJA 4DV4B 1SG0A 2C2KA 4WZZA 5D1NA 1QH0A 4HK4A 1CUDA 3IPCA 2ZRMA 3KLNA 2FRVA 2LP4Y 5EKUA 5EUBA 1X14A 1DQZA 3VC7A 3ZCQA 3U3DA 3WAJA 4PVDA 1EXWA 4KRYA 1DO8A 5E8JA 5FCDA 5F52A 1X9HA 4FS3A 4MYCA 4S0ZA 3FUTA 2REQA 1MLDA 3OPVA 1H4TA 2DQKA 3LH5A 2Y3IA 4TKUA 4QG7A 2QN9A 3FPLA 2HQOA 3ZDXB 1FIUA 2TRSB 1G6KA 3NNSA 3GOQA 1RVV1 2E49A 2K2QB 3QPUA 4J4HA 1P77A 4G5OA 1FU7A 1RMTA 4PZZA 1BGXT 2TMGA 5FI3A 3OBIA 4J90A 3QMWA 1V35A 5JW6A 2IYTA 5FBKA 1TVCA 2E85A 1MP0A 2QZ4A 2HU5A 3L6RA 1KAMA 4M0FA 4CZ2A 4ANFA 1OH5A 5KSZA 1CQPA 1QU2A 1VCHA 2FJPA 3KWMA 1DGQA 3BH6A 3AQIA 4YX9A 4N3CA 2KM1A 1OAOA 2E37A 2AG5A 4NE9A 1C2YA 3SMVA 1TA9A 3VI3B 3ENWA 4AY5A 5B4TA 3K4HA 4XSGA 5BMVB 2AI3A 1VRVA 3DHYA 1D2NA 3ECCA 2JS7A 4FYXA 1U3FA 3C7AA 3JZFA 3WP1B 3QHPA 4CCWA 3E5HA 5BT9A 4BQIA 2CLFB 2C4MA 1OLUB 2JAUA 4FBLA 4Q1AA 4B83A 1X2EA 4EVQA 1LUAA 5DEOA 3R75A 1F8UA 3QWAA 1LPOA 1T3LA 1MW9X 1U7OA 2DT8A 2L69A 2PQ0A 5ENZA 4ALLA 2V8OA 3LQQA 3GPLA 1ZJYA 5BORA 4EFKA 3K92A 4FMBB 4CYMA 4FS8A 4P0QB 2O5CA 4D82A 3L7OA 1L5KA 2QJOA 4BVJA 4D41A 3FFAA 4CTOA 3WLRA 4CLEA 2V3CC 1OGIA 4MIKA 4OGLA 2GETA 4OM8A 3BWBA 4IIXA 4C4XA 3EA4A 3SEZA 5BW4A 5KTPA 1C14A 1QU3A 1EHIA 4HNSA 3K2QA 1M34A 1QVZA 3DMTA 2PBRA 4Y9RA 1JSXA 5F1OA 4C5AA 1J8MF 1NONA 1SCKA 2O7NA 2FG7C 2G08A 4URVR 4Z54A 4G8DA 3HJFA 4IDFA 2XEDA 1H1LA 4CV2A 4YB8A 1AB5A 5C2JB 3OPYA 3L7CA 4KAAA 3UC9A 1LPPA 2FEAA 4HLDA 4JP5A 3SC3A 4NRDA 4C7KA 2C78A 1G4AE 4P7BA 4DDTA 1HEYA 4GDFA 1S89A 4LJ5A 1NR1A 4P5PA 4CLHA 2B78A 2JANA 3NJRA 4ENSA 3OA0A 3E2PA 2PN1A 1OGJA 3HU3A 5IH3A 2IV2X 1GTVA 1KYIA 1WXIA 2IUSA 2V7QD 3WLTA 4DIBA 2Q0HA 4XDYA 4EUEA 1ZNQO 4HMOA 2AX4A 1KA9H 5AWFC 2EX1A 3RWOA 1E3WB 2V4UA 4L5YA 2UZ1B 4KDFA 3IVGA 1ZLYA 4Y2PA 2NGRA 2IK8A 2UV8A 4G4SP 4MI1A 1QX3A 5KJEA 3JX9A 5JBNA 1Q0PA 4AN1A 2BGWA 1LX7A 1D3AA 2WD7B 4U7FA 1WZUA 3TRJA 1U4SA 3CXRA 2Q4DA 4ZVLA 1J97A 5FFNA 1XTTA 2VDWB 4G1CA 2BFPA 3GRAA 1SUCA 1ZM2A 3HN6A 4IGAA 1R0KA 2JDID 3V4SA 4I4LA 2XXAA 3WLSA 1RADA 3E18A 2Z56A 3SEFA 2VNHA 1MNAA 4RY9A 1QVRA 5ADVA 2BFWA 3KUKA 1ND5A 3I6IA 2Y1EA 3BPSA 3I09A 1GPH1 1WXHA 3JAKA 4D3DA 2ZTMA 4LQ4A 2BKAA 3EUFA 2C29D 3M4NA 4M98A 1XVTA 3ZBPA 4EY7A 4JYMA 3QIVA 5EIFA 1TQ4A 4R6WA 3QNWA 2MR5A 4EPTA 1K5PA 4FNGA 5B1HA 5C5DA 2Z58A 2G4VA 2COUA 5HFNA 1OH7A 2VJAA 4WT7A 4I5FA 1D1PA 2B2NA 4XYEA 3IMKA 3Q8KA 2JB9A 1JIXA 2YKGA 1U1EA 2ZIXA 4NBVA 1BXZA 1LLFA 3GEPA 4RVSA 5E6RA 2NQTA 1UAGA 3NTOA 2DFLA 1U9JA 2PPVA 3THOA 1J8DA 1SKBA 2H2IA 1OASA 1IL0A 5DO9A 3WI7A 3ZIDA 2VI5A 2C61A 4TMFA 3GRFA 4N65A 3CCBA 4C0KA 4MICA 4UATA 4GX1A 3T35A 3FNHA 1TKRA 3BCRA 1E2UA 3GD5A 3KR2A 5HCIA 3OO0A 1Y7PA 1Q2UA 3QW4B 5DGTA 3GLVA 3EF0A 1EXMA 1BXKA 1SU6A 4RQAA 5CTJA 3AC0A 2D8AA 2BE7A 4NU5A 5M29A 1M8PA 3IE1A 3H0EA 3K4PA 4K03A 2F1KA 3T5PA 3DYBA 4DLBA 2MTBA 3LHFA 3MWKA 4UM9D 3ZQ6A 1UKYA 1J2RA 1KWGA 1OFIA 4M4SA 3DC7A 3NC0C 1JGTA 4FN4A 4NFLA 1SKAA 2IXAA 2V7XA 4CLOB 1WE2A 1KYTA 4IEEA 2V6MA 5CA0B 2CT8A 1L4NA 1R37A 1UZAA 2P2NA 2Y93A 5JQGF 5LP6A 1PJ8A 1UCFA 2ZBGA 4ALNA 2H4ZA 1NLYA 1FNSA 2BGLA 1IDN1 2IIVA 2Q99A 4L27A 4QOJA 4U2FA 4F6RB 1C7JA 1CRPA 3KEMA 3L0DA 2BMAA 4XCQA 2O19A 5FUQA 3HKBB 3KPWA 4S3MA 1I1HA 5BMVF 3BFXA 3RTAA 2WMOB 4BJ1A 3LM8A 3FKQA 3UB3A 3IHTA 4BNUA 3LUHA 4XCVA 3KB1A 3GEMA 1C9KA 4MHOA 4V2IA 3AIMA 4C4TA 5ICEA 2R97A 3P2EA 2YW9A 1ARZA 2C2YA 3FGZA 3OC0A 1WM1A 3OBBA 3D3QA 2HFJA 4HRAA 3SY8A 1T0PA 3VUFA 1FTQA 2FSFA 4FN5A 3ZVRA 1BVUA 3U4DA 1C8BA 3ZJUA 3UUGA 1DT3A 3B5JA 3LDAA 4TWAA 3KT0A 4ZWNA 4Z9BA 5G02A 4ZI3A 3X1JA 5HQJA 5JJIA 4L2IB 4MKRA 1FNBA 2O0LA 2Y1WA 3R6LA 4LJ7A 1I0LA 1N5KA 1UWVA 1Z2OX 2XWSA 1OBOA 2QVBA 5ALNA 1MC8A 5AKEA 1NBMD 3CGGA 5DBGA 4JSYA 1WLYA 4MIYA 5C34B 5JNLA 3D4LA 3G13A 3I9KA 4RZXA 4R3NA 1WF6A 4YACA 1FJXA 2P3OA 5DSZA 2J9ZB 4L57A 2OHIA 1EIWA 2ZB4A 3EWAA 2PKRA 4L85A 2HX1A 5HMMA 1ZVQA 2TECE 1JQ3A 4FFWA 4UHCA 1ZIOA 3F47A 4DGQA 3ISVA 2G80A 1OC4A 3AL3A 2VKQA 4OOFA 4PW0A 2FVXA 4DCSA 3MJFA 2F1OA 2P62A 2Y4NA 4I6EA 4ZGWA 2IHTA 4MV9A 1DZIA 2HLNA 2R84A 1NJ1A 5KNCH 3ANNA 3DLTA 2AXEA 4U7GA 3PJFA 2BMVA 4GZ6A 4N0PA 2NZYA 5D3KA 3D6VA 2CC2A 3V3KA 3KOZA 2GUWA 1KGSA 2HJSA 1D2EA 3BILA 3CUWA 2R2GA 1H0SA 2R1UA 2R6DA 3RYIB 5BURA 1GTRA 3OM1A 3MSXA 4JVOA 3EVGA 3GFVA 2ENUA 3MCVA 3WSTA 3GFRA 2WFLB 4JKIA 5KPDA 3WYNA 3FCOA 1W76A 2QUAA 1NZFA 2X8WA 3QLVA 4G1MB 2SICE 3WLMA 2C9ZA 2W71A 4LK3A 1ZXBA 3BB1A 3X2EA 1XDGA 3IVCA 5JR3A 5LXTA 5FD8A 2J9RA 2BKUA 4FFDA 4PZCA 4ALKA 2KLBA 4IY1A 3DVAA 1KERA 4FYVA 4Q66C 1GA1A 3G9ZA 1KNQA 3F5SA 5BW5A 4WNAA 3AYZB 1WZNA 2BC9A 2ZB7A 3NJ8A 3VZPA 1I3LA 2X77A 1DV1A 1XZEA 2J30A 4ZYWA 1WXWA 1WPXA 4YAGA 1TT7A 3W5IA 1JX6A 1BS2A 1VLMA 2P6PA 1DC6A 1JLLA 2WIFA 3A14A 1PAUA 4IJVA 4P83A 5FP0A 5KU7A 3K16A 5TR9A 4KW7A 3PXUA 3U39A 1A2QA 4QEDA 3V3TA 1LA2A 3JY6A 2HPVA 2XCOA 1J0XO 3BKXA 1XU9A 3M81A 3PRKE 1GOTA 2CKMA 3DE1X 3VPBA 4KQJA 5HUJA 4DS3A 3LCVB 4MYRA 2GTIA 4M46A 4C3OB 1MZPA 4JL5A 4TV8F 2OZLB 5JSHA 4TVSA 3RSCA 1MV5A 1V16B 3RODA 2MSWA 1E0KA 3KS9A 2AF4C 5HM8A 3A26A 3MAGA 3LVFO 3L9WA 4H7EA 4YRIA 1GKUB 1NDHA 1E0SA 4XDHA 2QRJA 3KAKA 3INTA 2NW6A 4F84A 2MWMA 5HOQA 1AV6A 1NSTA 2ZI7A 1F2TB 3D8TA 2NU9B 1OREA 1XEXA 4PZDA 1IWBB 3CVOA 2Q1SA 3PVZA 5JANA 2FUG6 1BDJA 5T8KA 1KZ7B 3R5SA 1YE8A 2UKDA 2Z2XA 3MOSA 4M7WA 2AGVA 3U44A 4YRTA 4ZCSA 1EGQA 2QW8A 3ZS9A 3GCDA 5BRJA 3K3PA 3LHDA 1RWBA 2P2CA 2A9VA 2WM2A 3BE6A 3RS5A 1GTMA 2VWQA 1P4GA 2X76A 1Q1GA 1XDWA 1X7ZA 3IAFA 4CG1A 3OETA 2YXBA 3RROA 2ZBFA 3B7GA 2ZWPA 4TN5A 4PFSA 1VSUA 1XYYA 5KWEA 1FMCA 2YASA 3AHFA 2JAXA 5B1EA 4D9MA 3D4OA 2I2DA 4G0ZA 4J2TA 3WDLA 3GVXA 2A33A 5IKEA 4HXEB 1V5IA 4N4AA 4C87A 4DLSA 5L9AA 3I12A 2XUJA 4RZQA 2Y1XA 2FOLA 3JQDA 5BYJA 3IUPA 3L0PA 4PLVA 2CXSA 3WLOA 1Z47A 2CLSA 1TVKA 2XW6A 1BEZA 4LC9A 3UK2A 1UPCA 3I3OA 3T7SA 3LQFA 3P4YA 2JGAA 3R7SA 5JSUA 5KWVA 2UZ4A 1IBMB 2C0PA 2VK4A 2FX5A 2Y9MB 3ANYB 3K6RA 3LBNA 3W3AH 2IXFA 2OBNA 5DN6A 4F12A 3GY0A 3S1AA 1G3UA 1U6JA 3BIWA 3WSWA 2AVNA 5DE3A 4BV2A 2CW5A 1YBVA 3X0DA 1LJUA 4ARZA 8GPBA 4D9FA 3UICA 4YPOA 2D5LA 4B4OA 4CGYA 1PQPA 1FFXB 3RC3A 4RHXA 5FOXA 1YDMA 4D9CA 2JJ1A 3ESRA 3C5WP 3GELA 1P1HA 2ZB3A 3ZDFA 1UZNA 3BK7A 4AULA 1Z7EA 1RAFA 3KBOA 1L3IA 4OL0A 2G40A 4ERNA 4C4ZA 2W83A 4UTVA 3AHEA 1NY5A 1AJEA 1M10A 4UCFA 2ZZNA 1WY7A 4RC9A 1OFVA 4WQMA 5U4QA 5J4HA 3J80A 3AP2A 4DC9A 5B7GA 1ODSA 3KVRA 3VHXA 4FE3A 4A6PA 2I9KA 4ZI5A 2UUOA 1Z4NA 4QZVA 1GPDG 2FEXA 2NT3A 4L4UA 1ODJA 5AKYA 2HMSA 1ZAKA 1VPVA 5JCOC 2VXCA 3H9UA 4PG8A 4DR6B 1TAGA 1VA5A 4F5EA 3L0BA 4RL6A 2FMFA 2O2ZA 4M87A 2XD9A 1RXUA 3EY9A 5A1TA 3FHOA 1LW6E 3NUZA 4MJ7A 4KNYA 5A62A 2JIZD 4TLCA 3ONDA 2Y67A 2HV9A 3SIPA 1A4RA 3U7QA 2BYTA 2ZAGA 2FZGA 3ECAA 4MVJH 5KC8A 5KDOA 3RK1A 5ELLA 1BSVA 4EVSA 1SA0B 1AK9A 5FADA 3I9OA 4V2UA 1QMPA 1UJCA 3GHHA 3D6HA 1JAXA 1HT2E 3FOWA 1JB1A 4Y0AA 4Y2UA 2TS1A 3AV0B 1UKBA 3DMGA 3QVGA 4CQMB 3QSYA 3LLMA 4YUAA 3K5PA 1UPTA 4DV7B 3HZOA 4H9GA 1BWQA 2YHBA 3RU3A 2GK7A 4QYMA 1XZIA 2AFVA 3DL2A 1Q12A 3IAUA 1X0XA 2C2MA 2CKDA 5GJWC 4A8JA 4YCNA 4B3GA 4BNVA 4IDBA 3THRA 4XIIA 3OX4A 4RH0A 2G70A 4M0UA 3K8ZA 3HRIA 4TWBA 4W6ZA 4BP9A 4WXPA 2G5CA 3VTFA 1A9TA 4OQNA 1KEZA 4HVTA 2WTAA 3KB8A 1D5WA 2VHJA 1Z07A 4FFRA 2WLSA 3GRCA 2OPHA 1XNGA 3DM9B 3JVIA 2JJMA 4A2QA 4EX7A 3EG9A 1GT6A 3N2GA 1A50B 4HYTA 1E2JA 1Z45A 2O52A 3P5BA 5IAKA 4DSNA 3UW1A 3AM1A 3GJ0A 1ADBA 2H8KA 5CK5A 1Z22A 1Q11A 5TY0A 3RU2A 1XZFA 3O4RA 1LVUA 2C58A 4AL4A 1OR8A 3GQVA 4KSYA 4KL8S 2ZR9A 2II6A 3GX1A 2O2DA 5HIMA 3Q11A 1V1JA 3I1YA 4G5RA 1QTRA 3E48A 1CV2A 4N12A 5D5QA 3STWA 2APJA 3T3GA 1LLDA 3NO4A 4IMIB 4Y6PA 1GR1A 1TO6A 2CNNA 2D4HA 2JFVA 2OM2A 2QDXA 4R1LA 4DG9A 1IOWA 3N05A 2Z6QA 2Z5GA 4FHCA 3ZHRA 2FJ0A 1ZD4A 4KNWA 4PPFA 4TMTA 1HQDA 3URMA 1XD8A 1VCIA 2HWXA 2OO5A 2ZS8A 5GONB 5K4GA 2YMQA 4X62B 4X8MA 2BM9A 3AVOA 2VNKA 3O84A 3L6DA 4YMTA 3P97A 1TFUA 2C00A 1N7IA 2KHZA 1U3VA 2DJIA 3DF7A 4V0LA 2A1IA 1WVMA 3ZD8A 4YJKA 1JPNA 4D26A 3WLFA 2E5WA 4ZAXA 2XQJA 5DTMA 2PUTA 3HCCA 1E7MA 4XD7A 1SVOA 4LDRA 1NU8A 4FONA 4DA0A 3P20A 1M7GA 2DQYA 4Q3NA 2NUAB 5K0GA 1JWLA 4QELA 5DNDA 4DNQA 5C9ZA 3E8MA 4RABA 2O07A 3DUFB 3DMTC 3JARA 4XFJA 3T7JA 3HDHA 1VXRA 4G0MA 2B5VA 1DFHA 2FWAA 1WUYA 1EFLA 2EX4A 3WMXA 1Y3BE 2ZJ7A 4E6PA 2VTKA 3RRNA 3SJUA 3V80A 2D2IA 1PJSA 1X1BA 2P5YA 2FWPA 4UE2A 5CU7A 3ZI4A 4AG3A 5IAEA 4XM1A 3T4UA 4FT2A 1VFPA 1QYXA 1L7NA 3SE0A 1QYRA 1P2DA 1W6RA 1N2OA 1UOQA 5CH5A 1Y81A 2B83A 1ZK0A 4QXPA 5AOBA 2HD4A 3DFIA 1MBZA 1M34E 1ZK3A 2DTXA 5DMHA 5I5EA 2MSDB 3AVYA 3I9LA 1TYAE 1U3WA 4BFLA 2V7TA 4KSBA 5CLIA 1F7VA 1TC1A 3BE5A 1BIFA 3I9JA 3T5BA 4HWKA 3OU6A 4MVJA 3ZWQA 2F1JA 3CKLA 3LUDA 2B9VA 3FOBA 3QBJA 4YCCA 2AMFA 1PFVA 2NTVA 5TX7A 2ZU6A 4WK4B 2QK4A 1ZC3A 5CDHA 4CCAA 3H2YA 1Q0UA 3FMGA 3QLTA 3UPDA 4ARAA 4W8HA 8ADHA 4RA9B 2XB2A 1LBSA 3B6JA 4I9GA 1LXCA 1SKYE 3KOXA 1NMQA 4LXYA 3L40A 5EIOA 2G25A 4Z49A 1ZOIA 1M1XB 3P9KA 5BMVA 1NU6A 1SB8A 3H65A 4TMKA 4WUVA 5DV9A 2AZXA 2R65A 1L5SA 3DAOA 3NBZC 3P4XA 1CUJA 5AOAA 1Q50A 3LQ2A 2HF2A 3QEMB 2G88A 5HR5A 2WIBA 2GA9A 1DAKA 1N92A 3SMQA 3UFXB 1RYFA 1K1EA 2CLKB 3C41J 5KSOA 3TQTA 5K0ZA 1AMNA 2DH5A 4J9VA 5GPBA 1WZIA 4DEXA 4ZT7A 3UHOA 1U0SY 3M5DA 3IXQA 4IMPA 2GKGA 3LNCA 1QXSA 4NARA 4UUMA 4D45A 2GAFA 1QH8B 4PYOA 2PNJA 2ZRPA 3I3SR 3L04A 5F7JA 1G9TA 1YKFA 1EG7A 4BBAA 3VSCA 3WJ2A 3P9SA 4JU9A 2XE8A 3M9WA 2G1AA 1DG3A 3PCRB 4WVLA 4PPGA 3UATA 2IITA 4HB2A 5TQ2B 4KO2S 5H0IA 1EE2A 1WJGA 4HQRA 3U9TA 3DG9A 2JI8A 4ZOLF 5ENDA 5U4XA 3RSOA 2QTMA 2EBHX 1IZ8A 4UDXX 3LT2A 2BZ0A 4B34A 3DDUA 4NU0A 2XNSA 5BV8A 4JUDX 1KYQA 3CS3A 5E7QA 1DX6A 3CVXA 2Q3HA 5H3LA 3EOAI 2HCJB 3G3EA 2QSUA 1S7GA 1K88A 2M6KA 3HNOA 3JQFA 4A03A 2P78A 1M2EA 1DP4A 2XUGA 4PF1A 1ZN9A 5CJPA 5DNEA 4GF5A 4A6XA 3WGJA 4DR3B 2FOIA 4G0UA 1ZX1A 1OAKA 5EE5B 1MGOA 2QTNA 4YRBA 2VO1A 2H5LA 4PYJA 2HIAA 4TMVA 3BMXA 1F8YA 4ZT3A 3F71A 3A6LA 4FVTA 5FNVB 4EHKA 1GY8A 2M6RA 4N8SA 1WCWA 3DC2A 4TT3A 4QXRA 1IH8A 5A06A 5HMLA 1E3WA 2HXGA 1LLQA 2UZ1A 3LV8A 1H2ZA 4TOIA 2JI7A 5LPNA 1MC1A 3H4TA 3ZOKA 3N7AA 3I2JA 2WD7A 4TVBA 3TCKA 5MHTA 1RKBA 1YQUA 2ZPTX 3MXTA 3NWBA 3OZ7A 1C4WA 2MINB 4A0HA 2VDWA 3H8VA 5TGDA 4IIHA 5A3JA 2O8EB 3DPUA 3RIMA 1JHRA 1WPRA 4PAMA 2FUEA 5FJJA 3D7MA 2DP4E 2ZRFA 4B43A 4MDEA 5ECGC 1CUZA 1W4ZA 1YC2A 2AEEA 2GFHA 3K20A 2CUZA 4QJ4A 4R69A 2CVOA 4IDEA 4ZOBA 3W79A 3AVWA 1K4KA 2HV8A 2CGEA 2IUUA 3C3DA 4D8YA 1O54A 3BAZA 3EMKA 4KXLA 2XVXA 2YUTA 3BDIA 3Q6MA 1I3NA 2XKBA 4EW2A 1GD1O 3FYTA 5E1OA 3E3MA 5IH7A 4OYYA 2GBLA 2R751 3NGMA 4H7DA 3AR8A 2IVFA 8MHTA 3QEKA 4D02A 1A8HA 3BIJA 3C7KA 1DCKA 1Y82A 2AI2A 4MGKR 1UJBA 4YC7A 3GLFB 1MT3A 2GNOA 3KKOA 3NBFA 3QRWA 4QPZA 5IZCA 3Q1LA 3A27A 2ZIUB 3RYHB 1UQUA 3ENVA 4L4SA 5AVQA 4DV0B 1ZLXA 4Z3OA 1Y3FE 3Q9NA 3SBXA 2DPHA 3W4JA 1VJGA 1Z0JA 3VPCA 1W85B 2HK8A 1QONA 1SEVA 1UC4B 1YVPA 3R3SA 1NFQA 3IAM1 2DBQA 4MOWA 3FLBA 3FDXA 5DULA 5DT2A 3AIKA 1OYWA 4ALMA 5CFZA 2R25B 3BE8A 3OF2A 4KLCA 4D4HA 3ECSA 2I78A 2JF0A 2QYHA 3EEBA 1X77A 2Z43A 2VBFA 3E1GA 3EHEA 3EK2A 3GRYA 3IUQA 1YCHA 3HYLA 3V00A 2CXQA 2ZJ5A 1B6SA 4EG4A 2P90A 3TJMA 1J1UA 4CLOA 5CA0A 1U0FA 1SC6A 2QP3A 2GXQA 5EQDA 2ADMA 4M1QA 3HO8A 5T6MA 1P4JA 1E2HA 3ITEA 4UOQA 4XYMA 1KQNA 1BJKA 1V3VA 2P9GA 2W6CX 1EM8B 3MIIA 4MVJI 3FOAA 4B33A 1Z83A 1LU9A 2C5HA 3EC7A 3EYAA 3LRPA 5D1HA 4XGKA 4F6RA 2BGNA 5ALFA 4MGEA 4AURA 3OMWA 5FTWA 5TF0A 4MAFA 1LJLA 3HKBA 4XQCA 4DQLA 2IYSA 4Y2HA 1V11B 3MEQA 3LPCA 4DIUA 3GEEA 2AZTA 3VFDA 1PGQA 2W4MA 2WNHA 1U3TA 2RGNA 2ZTHA 2YZKA 2I4RA 3COWA 4LDAA 2VTVA 4MA0A 4TLEA 4QVGA 4QDXA 1ESNA 1JHPA 1QO9A 3KJGA 3ONWA 4AP9A 4OA5A 1L1QA 3IDAA 3U16A 1E2GA 1ECGA 3B3QA 1CEEA 1OGYA 2JLRA 2FQ1A 3FKSA 4UBKA 1TD9A 2HSWA 2J3IA 4A6EA 5IDWA 5LWQA 3TTVA 3KB2A 1TIKA 4UKDA 1U0JA 1AB6A 4J94A 3LUKA 4L2IA 5T8KC 3V4RA 3EDOA 3TPZA 1JXOA 3GMDA 1UP7A 5I8PA 3PX2A 1AQ6A 3FCAA 3TWOA 3ODGA 5C1PA 4KLRA 4O1IA 4QJ3A 4YAJA 3VR6D 3BD9A 4NABA 3ILYA 5KWJA 2ERXA 5IDYA 1TA4A 1SXGA 1UPBA 1GTZA 1TPZA 2C3UA 3FHLA 3LECA 1IMOA 4NAVA 4XUEA 5H4HA 5J3JA 2BZGA 5JS2A 1PP4A 1TXGA 2O1XA 3NTVA 1KXJA 3DBLB 1ODIA 2FB9A 3QITA 3FSJX 2WAMA 5MN5A 2ODNA 2R6ZA 1DAIA 3TD9A 1YD7A 2NSHA 3ILXA 3KQQA 4ZEOA 3RVJA 2FWRA 3O2QB 5AQEA 4GRDA 1A7JA 4Y2TA 2EKBA 5AUOB 3M70A 2PGDA 3E9RA 4CTKA 1H2EA 3Q72A 2XWJI 3FLEA 4FGSA 4JQSA 1D2MA 4LHYA 3RYIA 1LV8A 1RI2A 3WWEA 3ZDYB 2CXXA 3EVEA 1UBRS 2RKBA 1YZ3A 4JLNA 4DDHA 1OXVA 1YJCA 3SZUA 4J0DA 1AHIA 2DPGA 2WFLA 5FNVF 1GA4A 1N6IA 1OMOA 3JWIA 3KPJA 4CFSA 1WMDA 4EI9A 4HSEA 3OO1A 3UYLA 2R62A 4LE2A 4PC1A 2ISQA 4EOGA 2P0AA 4PC7A 4YO8A 2JLYA 3TIFA 5I47A 1AO0A 3FVTA 2F8LA 3O9VA 4GS5A 3Q7RA 3ZE0B 3AL0C 2HT1A 2PZLA 5EJ6A 1GRCA 4GG1A 1U6IA 4Z7OB 4GPIB 2OAP1 4HWGA 4R9NA 2A30A 1E2PA 1Q7EA 4WFJA 1JRLA 3UHPA 1BDIA 2UYQA 4OLBA 1CVIA 3FDJA 2DE0X 1G2OA 4IICA 2AWOA 2QB5A 2YWDA 5CYPA 4Y1RB 1TM2A 2VSOA 3S2SA 4L9AA 4PCVA 1T91A 1XJ5A 1MX1A 3G9TA 4OUDB 5AVRA 1NN3A 2OZLA 1JA0A 2ZREA 3F3MA 1V16A 3NASA 4FILA 3CKYA 5DK4A 1TAUA 1CFJA 1XMPA 3RF6A 3ORFA 3P9ZA 1XJQA 3ENZA 5D5HA 4HAZA 3EPJA 4GL2A 1GUYA 3HUEA 3ELBA 1L4HA 2JFUA 4IVRA 3GJRA 2XGJA 1DOAA 1E2NA 1SXJC 1F2TA 2NU9A 3SZLA 4OLAA 1OFTA 2EG9A 1X3SA 1JAHA 3AFIA 4Q9LA 4DVGA 3LVBA 1VHQA 2XGMA 3CJTA 4DSZA 4O3FA 2VNSA 1JV2B 1RJEA 2DF8A 4OAOA 4Y2RA 1GNTA 1V7PC 1P2SA 1NHWA 3LT4A 4AYWA 2B5OA 4XASA 3C70A 4IG4A 4FM9A 1FJ2A 3DMHA 4DG8A 5HPYB 3DP9A 4NESA 4PPQA 3H5LA 1ZRSA 2BGGA 1U81A 3UG6A 4OBWA 1PEYA 2QE7A 3CSDA 1ZCJA 1SXJE 2IL1A 2IGTA 4A8JC 3KHKA 1PJTA 3OQHA 2K7ZA 1UK8A 2WG2A 2A5FA 3CUTA 1I1NA 1G7RA 4CBVA 1I9CA 4RY8A 2VJOA 1GAWA 3E5NA 4FDUA 4ZCTA 1TF5A 3UGKA 2PVPA 5JPCA 1OBFO 4EGQA 3CQ9A 4ZPJA 5EJ7A 1QDLB 2R47A 4L0QA 4QWMA 2N42A 1OVMA 4L3VA 4PYIA 4RD4A 3S29A 1STOA 2HRRA 3INNA 3TZLA 2GXSA 4E6EA 4MK4A 5BNTA 1Y7HA 1C3XA 4YMHA 3QUQA 4P3OA 3VH2A 4I3FA 1SB9A 3MJSA 4U8GA 1OT5A 4QUJA 2QENA 3RASA 1ABEA 4PR0A 1O58A 3WWPA 2WU3A 1CC1S 1ZVJA 1ZY2A 2OL4A 1O08A 4GP9A 4GRIA 1ZRHA 4OGWA 1M6WA 2ZYIA 2PE5A 4HXFB 1FK8A 3U40A 2W2XA 4LQLA 5IAOA 2PKQP 2VYCA 3D3JA 4LYFA 3QE3A 3W6ZA 1W59A 1NNSA 3F67A 4Q9DA 2QVXX 2I8CA 3QOYA 3MWLA 2QRKA 1HM5A 4LYAA 3ZHXA 1P3DA 4WOKA 4D0SA 3IBSA 4KYUA 2XGOA 4IIUA 3O4VA 4N03A 4BMYA 2ZQ5A 1GGHA 4NBWA 3O8BA 2I4OA 1MOPA 4KX3A 4Q5IA 4WBNB 5A0VA 4RGYA 5CCEA 3UFBA 1FMFA 2R1TB 4HNAB 4DCPA 4QOSA 4ODIA 1VLQA 3EGVA 4NZMA 2ZR7A 2IUTA 1NUAA 4LHEA 2FN7A 3W9BA 1YRHA 1POWA 2JA2A 3KWLA 1VQ1A 2OGTA 3CUKA 4QUAA 5L3QB 4AZ0B 1MXFA 1ZFNA 5D2CA 1CEXA 1CZUA 3ANSA 3LA6A 1HFJA 3K53A 1WKCA 1R1DA 5H3HA 2DJ5A 4DV2B 3NIFB 5JCPA 2Y05A 1EVIA 4AD8A 4BGUA 3MTDA 2P7IA 4EW3A 4G2TA 4DR4B 1NVGA 4RNCA 2G5GX 3GPDG 1SA0A 1N8NA 4Y8VA 2F7SA 4MZDA 1QM5A 2J4DA 2FGKA 3RUEA 4MHTA 1T2NA 5K6TA 2GYWA 4IQFA 4LFCB 3W8NA 4I4NA 5JS1A 4CQMA 2E2WA 3DFFA 3T5MA 3HCBA 4BFWA 2L42A 3KJQA 3WE7A 5A2GA 2VXBA 2N3ZA 1XKTA 2IZ6A 2Z98A 4C7XA 5FPKA 5BN5B 3MPOA 4FOOA 2JEYA 3FZNA 5CT9A 4YO7A 3WLEA 5L95A 1BFDA 1T2DA 5A3RA 1TU3A 1USWA 3LPDA 2FPGB 3UXHA 4DTCA 4MR8B 1I5OA 1UJNA 1QQ5A 2Y0DA 4LJ8A 3GU3A 1FVFA 4FDTA 4RD1A 3UUWA 4YPVA 5JXHA 1EBUA 4QGBA 1QAQA 4X64B 4D6XA 1AGPA 2A5GA 2NZ2A 3OU2A 2EIXA 3IGFA 3VSAA 4BGDA 3MRXA 2Q8QA 4XJXA 3BGOS 1A04A 1OLOA 1DE0A 3TW6A 4DCOA 4B7ZA 3D8HA 4UPDA 1JBQA 3EWNA 4GPAA 2JJ8A 4UC0A 2C4KA 2WZBA 3RS3A 1XRLA 2ZRLA 2AT1A 2B9EA 1ZXLA 3CO5A 3GG9A 1KZ6A 5CGQB 2WE7A 4HS9A 3VQTA 4YV1A 4Y1GA 2ORVA 1ZNYA 5CW1A 4WESB 3EMBA 5T3UA 2Q6LA 3FFTA 2NN3C 5FL7D 5DNAA 3WYBA 4BL5A 2C5EA 4RXTA 1MA0A 1TUBB 3RKRA 3T9AA 1YOBA 2V5AA 5F4BA 4D0NA 5EP1A 1WMAA 3WMGA 4AF6A 5I7AA 2ZBDA 4MROA 1DTSA 4B81A 4YBRA 5BN4B 4GW3A 4V0QA 3TBHA 3OZGA 5EUCA 5F3RA 1BN6A 1WW2A 1SC3A 1T3TA 1DAOA 1VJ0A 5GONA 3TO5A 4FOPA 4N0MA 4B2PA 1J00A 4FD2A 1K5GA 1JDZA 1JJ7A 3IA7A 2WA2A 3NT4A 3DFMA 2A5YB 4Q3OA 3SEAA 5IM4F 1DQRA 3KSUA 4BO4A 4PWZA 4LVUA 4D74A 4YLGA 3AVTA 1EINA 2VK8A 3CEAA 1BRMA 2R5WA 2V1XA 1T8RA 2Z2JA 3A1SA 4IIDA 4M7RA 4R1QA 2IXDA 2NUAA 3QELB 4JS0A 3S40A 3L06A 3OD1A 3IJEB 7GPBA 1IBRA 3BS4A 3LE8A 3DUFA 4BY9E 1AUQA 1NBEA 2JGFA 3I32A 5FYQA 1DRWA 4MB2A 1CY0A 2IEYA 4CMJA 3L82B 4O2LA 5JCXA 1CUXA 4RCZA 4ZC8A 4GPEA 5M04A 1EEXB 2H5EA 4DJFC 2XNKA 3OIWA 4N6GA 2HPHA 4BNKA 3C6MA 3HGQA 4Q4HB 1K2VN 1KMCA 2PX3A 2QLTA 3W7BA 4NWIA 1RQNA 4II3A 1FYFA 1LSOA 1NQWA 1QFZA 3P7MA 4BATA 2MSLA 5I8ZA 3KALA 1E6WA 1XKXA 1OTYA 4MW9A 5A1JA 1RYZA 3CRNA 4JQOA 4D42A 4QUIA 2GKOA 3K35A 1TI7A 3NTLA 2XUIA 4Q34A 3OJXA 1XWFA 2XE6A 4QUDA 4NMXB 5HHTA 2EF1A 1FMTA 3ANXA 2AEFA 2NTYC 3HVUA 1KI4A 3BZBA 3BMCB 4LZOA 5KNDD 3PF8A 3LC0A 1Y1SA 4CMGA 2BFDB 4B71A 3QA9A 1E9SA 1FDWA 2VPIA 3D7KA 1HKHA 1Z4KA 4MW5A 4X24A 1PSDA 1LI5A 2FRDC 3FWHA 2PV0A 3P9XA 4ZEWA 2LIVA 3M1IA 4WJLA 1YJQA 3D8UA 2EEPA 1M1ZA 2R6AA 2ZI4A 4RA9A 1IZ0A 4F3KA 4QUHA 4PS0A 2YXLA 4OKSA 3PLNA 4EHNA 2WF7A 3MWEB 2PH1A 3P9YA 4Q4LA 4RANA 1SXQA 2P35A 3FR7A 3RC2A 1Q21A 1CZRA 3ZU5A 2QVLA 2FR8A 1W1UA 3QX8A 4K8OA 3IB3A 4A1FA 5JD5A 3QEAZ 4R40A 2HEIA 4NCXA 3PFWO 3GO4A 2QTZA 5AHWA 2VQSA 3M6LA 4UEKA 4YQYA 3QEMA 3ZGNA 3ZY2A 2J5RA 5COBA 3B7PA 4CM9D 1KYXA 3UFXA 1N5LA 2Y0PA 3DTVB 3HTXA 1Y98A 1QIHA 3P0IA 1CNFA 1N2SA 4PAGA 2QF7A 1N2GA 4LVOA 2QD4A 5DYIA 5IWCA 3FGNA 3P52A 1QHFA 4IF4A 1TT5B 4MYTA 1E2IA 3L1IA 1QH8A 2Q0XA 3GFBA 4L5JA 4NCKA 4RAOA 4JYZA 2C7RA 4LGMA 4UUBA 3OMLA 2NZWA 4JX8A 1XQYA 4QXQA 5IZCC 4ENTA 3FY4A 2BFFA 3NHPA 3QXHA 1JALA 1R8JA 5TQ2A 3KYIB 4C43A 1XZAA 3BHJA 3HKEB 2JIPA 4JEMA 1VIAA 3AOGA 3TM4A 3W8RA 2V7GA 1FRNA 2BM1A 4D92A 2AOXA 4YLEA 2C88A 1WP4A 4BOYA 1NSYA 3GCXA 1UBGA 4N8EA 2C4HA 1JNYA 3I1JA 1LZLA 1XIVA 2RJOA 3D64A 2OBBA 2V8BA 3CUSA 3KTDA 1V39A 5DASA 4ILKA 4FZ5A 4AQYB 1PJAA 4BKUA 2R4QA 1OX5A 3IIKA 2YHAA 3DXFA 2GGSA 5EKDA 3ZKWB 4WL0A 5KNBD 1SC9A 2IHZA 4INPA 4DY4A 3RI3A 1ETHA 3AIOA 1N33B 2REBA 4N3GA 1RI4A 2NU6B 3KOMA 1EP3B 5HJ2A 2AMVA 2MHCA 2GEVA 3U5TA 1UJMA 1OJLA 2EJWA 2OZKA 4IGKA 1OX6A 3Q8MA 1BEEA 3LX8A 2HYIC 4IDHA 3L9XA 4MDYA 1SUAA 3DEYX 3KJIA 4OHVA 3ETGA 3PEVA 3PXGA 4N5LA 4UTZA 1IXKA 4JBIA 2ACEA 5DGDA 1X0VA 3NI2A 2ZM5A 2DBZA 3H5TA 3ODPA 3ZC3A 3RYCB 1SURA 2B4YA 2BHRA 4OH7A 2HW8A 2MINA 4RPHA 1T9GS 2WKQA 4Z3KA 4XD2A 1SK9A 1XLWA 2O8EA 2POCA 2O8DB 5BRAA 3TNDA 5INTA 1PR5A 4MV6A 4NK4A 3NM4A 4JUAA 2HDOA 1GFIA 4L16A 1L5FA 5EJGA 2PPLA 1W2GA 4V03A 5ITZB 3IEUA 4ZOEA 4RKEA 1CUAA 1AKRA 1VOTA 3AHGA 4NYJQ 1JG4A 1A3CA 4PYKA 5CVCA 5EA2A 2B37A 3JZMA 4RIGA 5DCLA 5LWHA 2BIFA 1FE8A 1HYEA 2JCVA 2OV4A 4Z1MA 2ACVA 5C8YB 1T4BA 4W9RA 1BD3A 2WWGA 4MJLA 1BD4A 5A4JA 1SG6A 5TMDA 5FTLA 1N5DA 5DHPA 1D7AA 3S44A 4FZRA 3LP5A 1JIJA 1YRYE 4DA9A 2OHJA 3GLFA 5GADl 2VZEA 3U13A 1V7ZA 3ZVMA 2GK3A 3SEQA 4ZJPA 3RYHA 2ZI3A 1MORA 3I9V1 5GIOE 3U6KA 1I6KA 2ZITA 5SZKB 1G4HA 1C81A 4Q3KA 2CJYA 3TLZA 4DFDA 1LSSA 3G8YA 4R01A 1KPHA 1LS1A 2VYVA 3QNUA 5AQ1A 2VTEA 3B20A 3WRXC 1P2FA 3KTAB 1AC5A 3I6QA 1E1CB 5A4IS 1CR2A 1RBQA 3VZSA 4MP8A 1A1SA 1G21A 5CIWA 2ZCUA 1OKKA 2X41A 1TM1E 1ORDA 1JQEA 1QF7A 1DT5A 3TCNA 1C7RA 2J0QA 1MVLA 3RJ9A 4QIHA 2OAEA 5IVIA 3GA7A 4BGIA 5HW0A 1TYCA 5F9HA 1KTVA 1DBWA 3IDFA 2GZMA 1PFUA 3DKIA 3H5IA 5IBRA 1OVGA 4UREA 1F2VA 2QTAA 2ZGVA 3CO0S 4TWRA 2YJTD 4E51A 1EM8A 3TFWA 4LA4A 1NI5A 5HG0A 4OMUA 4KGVA 2PGXA 1PW7A 3CZMA 1BDHA 1T6ZA 1D2AA 1SUFA 3UJ6A 3AG6A 1C8VB 1NVVQ 2VDKB 3BD6A 3G8AA 2AFHB 3W9SA 4MA5A 3CZAA 2RHHA 4B6JA 1P1IA 3CNEA 5DYGA 4F6LA 1V11A 2WD8A 5HIIA 3FGOA 1U2RA 1OWPA 3AW9A 2R86A 3EDCA 3S99A 3OLCX 1ZWLA 3C45A 3CG4A 4RHYA 2GXAA 4C2AA 1M6VB 3DBHB 4C22A 3ADDA 5ALTA 1B41A 1ZIPA 1QVAA 2A4KA 4S2EA 5JTUA 1KJIA 3LJKA 1QHIA 4RK1A 3GN1A 2C7QA 1D1SA 3GJQA 4MKZA 5CG2A 2GO7A 4FE7A 5F98A 4RV4A 1NXWA 1RLUA 2G7MC 3RFXA 3SDSA 3UWMA 3C16C 1Z4LA 4A73A 4AKTA 2XQGA 3ABIA 5KTSA 2HHCA 3OT4A 1KJQA 3RVQA 3E35A 3IB6A 3HH8A 4A0QA 3HV2A 3NRJA 4PZYA 1A9RA 8OHMA 5LQNA 4NDNE 4ML3A 1Q20A 5F5XA 2G1JA 3F4BA 2RAUA 4IKPA 3EFEA 1KEKA 1N1GA 3CRW1 4DLZA 1UXIA 4UXHA 4FWBA 2AOUB 3PL1A 4IIGA 1BDMA 3PNOA 2ZJOA 3DBLA 4UVGA 5BSKA 5JATA 4M53A 2ZKLA 3AYXB 1R6DA 4B6OA 1UAYA 4LJLA 2X3UA 1A98A 1GZHB 5JARA 4MH0R 2QVYX 1SH7A 3FMIA 4GBED 5JCJA 3RTGA 5B7PA 4HGZA 1UZMA 2DHQA 3JZIA 1Q0ZA 2CMKA 1QK5A 3DOIA 1QDUA 1N5MA 4HRVA 4Q24A 1R18A 4TN1A 3T7RA 1M7BA 2Y71A 3IT0A 4U6NA 1JP7A 4TRNA 3FFWA 3KWFA 2FPIB 4ZQGA 1JLKA 2ZSJA 1HOXA 3MK31 2NO9A 1R27A 5CCDA 3TJRA 3IE2A 4DV3B 1BE8A 1TGYA 1Q1NA 2I1WA 3ZV7A 4WY5A 1G3QA 1P0PA 1W8IA 1RXSA 4YVFA 1G2PA 5B55A 5LBTA 2PNFA 4MRVA 1FTNA 1H5UA 4BLRA 3KDAA 3MG9A 1KK2A 3NETA 4X1OA 4CU2A 5HXAA 4CM5A 1CWUA 2OFPA 3ROXA 1GV1A 1KZ4A 4G9EA 3ZWAA 4FWTA 3FYDA 3ZE9A 2D54A 2UVDA 3G5LA 4M9UA 5JMOA 4GZ3A 1I33A 2FWJA 4CG2A 5JXJA 2W37A 1G5FA 3CGWA 4M9XA 2IYNA 2QZPA 2WJ3A 4YJDA 2KLHA 2QMUA 5AESA 2PL3A 4ATNA 4Y1RA 2J5BA 2GD2A 2PR7A 4DYHA 1C30B 3E7WA 4OUDA 2YWEA 2LDBA 2PUCA 1XGKA 4KXMA 4QG3A 1KKUA 1R5OA 2J6BA 2WSSA 4MXDA 2JH3A 1TB4A 2W4QA 3PNPA 4BBZA 3AKCA 1KMHB 1ORVA 1L7VC 3SSAA 1YCFA 4CM8B 4K88A 4B9AA 1UJ5A 4US2R 3H2GA 3VKFA 3FTFA 2ZYVX 3TR5A 1NMZA 2CDBA 3FHCB 2Q49A 3GXBA 4NP6A 1I7LA 4X1KB 3SX4A 2E9SA 1ULUA 1Y9EA 4G9GA 4H6XA 2AUTA 4QBGB 2X0DA 3NWOA 3QGMA 4WKPA 4NJOA 3IKJA 2A9PA 4P3PA 1ESZA 4Q3EA 2BEUB 2W2TA 3KR1A 4Q3CA 5IM4A 4BGVA 1G8AA 4NCBA 2FR1A 1NMSA 2AYYA 4YBZA 4TSKA 4EY8A 1T24A 4KPFC 4KQEA 2AX3A 3NBMA 4E7OA 2Z5VA 4TKLA 3TTYA 1ODTC 1WBDA 2J7PA 2QRLA 5EUMA 2WVGA 5SY4A 3HGMA 4GVPA 1K2WA 4R2IA 4QYWA 2B7LA 3A11A 3GJ5A 1YJBA 1Z82A 4HDOB 3B85A 4UM8B 3SYRA 1RHKA 2RBGA 1FQWA 4HSGA 3WR5A 4BFYA 3IAS1 3MJCA 3KL4A 4EUSA 1IXYA 1NX9A 3CONA 3EPRA 3EEYA 3K9QO 1VLVA 2XNCA 1E6KA 5EP2A 2UXDB 3NKFA 2IHNA 1N2CB 2OV1A 1BKDR 2DFNA 1RAGA 2IY9A 2CLMB 1WB5A 2EKDA 3H3XA 4KAFA 1IPFA 3CEMA 4BN0A 4PIVA 4CIXA 4B4UA 3QKRA 1R6XA 4RETA 3P9PA 5LZ4A 5HIJA 3N8NA 4EARA 2BEWB 3WKCA 1VKRA 2PYIA 1KQOA 5BNWA 3B48A 1SM4A 1W94A 2O2EA 3N3AC 4RZ2A 4F71A 3AUFA 3I92A 3KBBA 3WGMA 2C31A 2GYVA 1OXUA 1XTJA 2CF5A 3QBVA 3WNQA 5G1NA 5KQGA 2BUAA 3BT7A 4D3FA 1NPYA 2D2FA 2MYPA 1J8FA 1NTOA 1XELA 4GAEA 4XUGB 1NTRA 2QL7A 1P17A 2NO1A 4XCXA 4DW8A 3F6PA 4R9SA 3QV1A 3OQMA 5LYJF 1EA5A 2ZP1A 1OFUX 4BV8A 3SSMA 1U63A 4RTNA 2OXTA 5T67A 1NFFA 5TDHA 2V9CA 5TGTA 5CB4B 1XZBA 4LJYA 2CFSA 1NDUA 2F17A 3NFYA 4WBNA 5CT5A 4LE0A 1OAAA 4U0KA 1XTPA 1SNYA 5JC1A 1CQZA 1DAGA 2R1TA 4HNAA 1CJUC 4MLCA 2GEBA 4RDIA 3TJZA 3A2LA 4FHGA 3HDVA 1K4YA 3EUAA 5L3QA 2PRZA 4QO8A 4TRJA 1IVSA 3JD3A 4EPVA 1KOFA 1UWLA 3MBIA 1MENA 3HLKA 3LUPA 3OI7A 4OXIA 2H11A 1K4MA 4A8PA 1OILA 3P2IA 2EFDB 1U1FA 4Z9FA 3TQHA 4EAAA 1Z5ZA 3ET4A 3OM9A 3UAXA 4I2VA 3D0OA 5HZGA 1CF9A 1YBMA 1NM5A 4L7VA 5E0OA 2P1DA 4U3JB 3P9CA 4MKGA 1ZD8A 2CNWA 3AF2A 3C5HA 4ZVVA 4CIWA 2HI0A 2GM3A 3LO8A 2HLPA 3MC1A 3NWEA 1PX2A 1GUBA 4TWIA 1WU7A 4NZPA 2IJGX 1NI4B 1T5OA 2QJRA 3P2YA 4AZWA 3RGWS 1ADCA 5BN5A 1OB2A 3B6ZA 1Z2DA 3DL7A 3Q5DA 4HAIA 3QF7A 3PNLA 1U3DA 3KU1A 2YVUA 1OZHA 1B7GO 2O1SA 2RSLA 2FPGA 3V6LA 1I2DA 1VBMA 3V8QA 4AMBA 1MX5A 3OF5A 4ICIA 4E4YA 4RDCA 4P84A 3OA2A 4PRKA 5G41A 5CNMA 3ZE8A 1R2QA 3VTKA 4CLDA 4UDYX 3P2OA 1CTQA 2PCLA 3KDPA 3FPKA 2Z2KA 3QFSA 4NLLA 1D8TA 4BP3A 4OHYA 1BXGB 1IATA 1JDBC 4XIFA 3RIXA 3SJBA 2FAXA 4E5DA 4EZEA 4MB6A 1T9HA 5HKAA 1M6HA 1H23A 3DWIA 1GAXA 5JSZB 5I8WA 5IT5A 2BMWA 5A5EA 2H92A 4KZPA 4QNNA 1G16A 1QV9A 3DUWA 1YRQA 2ZUUA 4B47A 1XAGA 3ZH2A 3ICPA 3V1UA 1RMQA 2W2LD 4WESA 1NBWB 5HWSA 1B8OA 4C07A 2BDEA 1OXSC 5JYCA 3PC8C 1HNWB 1O7JA 5LQMA 1BCRB 3LY7A 1TUBA 2QMYA 4AJKA 5EPOA 4DUYB 1GU0A 5BUQA 4C20A 1UBJS 4L76A 3QVVA 1ZNXA 3LCRA 4G0OA 4FGKA 4LC1A 1P9RA 2C5SA 1YOVB 3LIIA 3LQ4A 1M0TA 4FYKA 3VRHA 4MINA 5BN4A 4UE3S 3D1JA 2CV0A 1BMFA 1H05A 1WDTA 2I66A 1WCYA 2ZW9A 1SQSA 3C8UA 4H7FA 4QASA 5JNWA 4XGNA 3K0SA 4HH1A 3RD5A 2Q29A 1Z37A 4Q3DA 1PGJA 2QY9A 3R7WB 1XFDA 3PZBA 5DIZA 4PM4A 4BUZA 1OBVA 1QLHA 2RHWA 3QZUA 5B2FA 4EAQA 1Z5VA 4P7KA 3JQPA 1F48A 1QNLA 2AKAB 2XYQA 2X0IA 4BLUA 4OI0A 3MSCA 1Y4DE 2AJLI 3QELA 2ZUTA 1VC2A 4ACAA 2X3YA 5L7YA 2R85A 3K0HA 3WL8A 5JFOA 3HR8A 5GZ3A 1FX1A 4OQLA 1FYVA 3T3OA 1QV6A 3WRWA 1P0IA 1Z13A 2HR1A 5HNKA 2ZZMA 5CD1A 2ZWAA 4IJ5A 3ZZMA 3E9DA 1E0DA 5J4VA 4UFPA 1U5AA 2WBLC 1DKLA 1QO0A 2HT6A 4YIKA 2FFJA 3SN6A 5DN6D 2CVQA 4Q4HA 4EJSC 2D1QA 1HXHA 4CLRA 1SIBE 1JL3A 2VRWA 3CRVA 3KCQA 3L0IB 4YMSA 4TT8A 4JZKA 4AWAA 5K8UA 4Z53A 3HM9A 3PLRA 2OXFA 5KNCD 5JJBA 4JXZA 1PWXA 2YWCA 4UBLA 3O21A 1OC2A 3PEYA 4LGVA 3LWNA 1QYIA 2O1WA 2RGXA 5DWVA 3NC1C 2KSQA 3M4ZA 4I14A 3FPBA 5E8RA 3KSBC 1VYVA 3QUSA 5DOZA 4A0FA 5JZMA 5SV2A 4CQNA 5CFNA 3I2YX 4IIEA 1EGHA 1GO2A 2RC6A 5H4GA 3WQRA 2GJ4A 5I5GA 4EY6A 3CX6A 2BFDA 3U3KA 4K9PA 2I65A 3MTGA 3IV6A 2G7ZA 2XIQA 3LT1A 5FBHA 4CU5A 1TO1E 4EK9A 5CITA 2DERA 1XU7A 1WB4A 4J91A 5L3VA 3PNVA 1AZWA 3QX9A 1POXA 1EX1A 5TEWA 3TX2A 4EJFA 3L6EA 4EM6A 4KWIA 1Z3CA 5ALWA 2OD2A 4BZPA 3THYB 1JWAB 2ZANA 3MWEA 4KG7A 3RRBA 1RRCA 3ETJA 2OLJA 5E9AA 3VBCA 4CQLB 5LKRA 4H7HA 5SZJA 1C0EA 1C3JA 4AKEA 5J4KA 4N6NA 3NTRA 1UQRA 2D1SA 1MV8A 1J1IA 1ZD5A 3NCHA 4QFCA 5AJVB 3V8RA 3IMCA 2H2AA 5K05A 3SLGA 5HF9A 2A1TS 1SQ6A 3KQPA 4K46A 3OTOB 2AQ8A 3DTVA 3HB1A 4IUYA 4YXWA 4ZZ0A 2ZVJA 1N6LA 1RKUA 1W29A 4QGGA 4FZVA 2N0SA 4NZYA 4ZI2A 1CUBA 3S2GA 1TT5A 3OKCA 4OV6B 4JI4B 5LIRA 2HKIA 5EI5A 4PIMA 3GRKA 4J2OA 4U2BA 3CLVA 5EMKA 3IQDB 4JR1A 4EB8A 3TG8A 2Y8EA 4HG2A 3DJYA 3IBCA 4J0QA 5AW7A 3M7IA 1IN5A 3SS9X 3H4VA 3ZLVA 5FH9A 2PWAA 3GCWA 1NMYA 4L9SA 5G0UA 4F4UA 3HKEA 3IPXA 4ZZIA 3HGTA 2DUJA 4M49A 5I3ZA 3OEYA 1AHHA 3BRSA 2XXBA 3MJDA 1YHYA 2ADFA 4U6QA 2J3LA 2C04A 3VV2A 5KOIA 4YT5A 1NE2A 1FDUA 3MYRA 1A8UA 4PGGA 2AJBA 1KI7A 4PC3A 5CM8B 4WN9B 4F46A 2ZXFA 2XUKA 4FW8A 1E8MA 2BMEA 4R98A 2IXTA 4ZRMA 3RH0A 4FXPA 5L8VA 4RZUA 4U63A 1RZRA 2R6HA 1K8RA 1XVAA 1XVUA 1V9SA 4XM0A 2Q6VA 4YLYA 3T95A 1Q0QA 4JR0A 1GPNA 2NU6A 3ORQA 4P3XA 3KZNA 5J5AA 2VDLB 4HX2A 2PD6A 3PJRA 3O8NA 4K6OA 3HK2A 1B00A 2Z6UA 3RJMA 4J1NA 2R8ZA 3TF5A 5IC6A 5AXBA 3COYA 1SHKA 2XCRB 4TROA 1EE9A 4M1OA 2WMYA 3LY5A 3TINA 1GDTA 5B3JA 4BX8A 3W3AD 1CJSA 4C78A 4MS1B 3E15A 2GXUA 4HCJA 3F6BX 1CY2A 2VHYA 4K3VA 3VPHA 4A2WA 4ARVA 3RYCA 5HDBB 3HBNA 5AYVA 2C07A 1K6XA 1QMGA 4YAOA 1ZRMA 3G2JA 4X6YA 1E3EA 2QLJA 4WKCA 4G09A 2O8DA 1KSHA 4XD7D 2RGUA 1X1RA 2BGTA 3OIYA 3EASA 3JQ9A 1CUFA 2WAXA 1M2KA 1M8JA 2I3DA 4FC6A 3PXEA 5ITZA 3ZD7A 1VE9A 1KH2A 4JLUA 3CVJA 4BNTA 2P6UA 1LRLA 5AUNB 5I7UA 1A8PA 2Q5LA 4WZBB 2AC2A 2Y68A 1HE4A 4KYTA 2ZS9A 1P0FA 1GKLA 3ES9A 2J0EA 5JTTA 2BM8A 3D2BA 1XTBA 1XL1A 3E7PA 1R8QA 1OI4A 2VN8A 3B6EA 4OREX 3GGCA 5C8YA 4E5SA 3RYFB 4H27A 3LRTA 1DAFA 3VDXA 2I2FA 4QPJC 4DKXA 5DN9A 5BV2P 1NC1A 2XWBF 1L5HB 4L9RA 2M6LA 5CFMA 2F4VB 1IY9A 2QQ5A 1JHMA 1TF7A 1T2EA 1S2MA 2WM9B 3MT8A 2L82A 3GA0A 1KMQA 2QNBA 3OT1B 3A3PA 1FFWA 4MVJD 4EMTA 1JI3A 3RHSA 2J9FB 2PZ8A 3GLTA 3KOWA 2AN1A 2EWMA 3AXSA 4X1YB 4LJ9A 3ZZTA 1PR3A 5HGJA 1EWRA 1KFJB 2D5AA 3D43A 3KE9A 3MGAA 4RYDA 5DKFA 2C4NA 4JQYA 5EMHA 4A5OA 1UIRA 4PGAA 4KO8A 2AZDA 5ITVA 1P7YA 1VM6A 3RRZA 1L7MA 4Q7KA 1UXGA 5CXUA 4W1PA 3B38A 2IY8A 2I4MA 1K89A 1XXHE 5AUPB 3HNRA 3RFTA 4XLLA 3Q2IA 3R1IA 1DAHA 1I4OA 3ZK9A 2OO3A 4PIPA 1ACMA 5KAMA 1QIDA 1SZPA 1Y8QB 4KMRA 1TUGA 3LT5A 1P62B 5AMXA 2WF9A 2ZTSA 2SKDA 3G68A 3KKZA 4LOKA 4KQMA 4MW2A 3FBGA 3K8QA 2YICA 1G20E 3RS2A 4CMIB 5I9IA 2C8JA 1YZKA 1EFDN 1ZBQA 2ORIA 5KOJB 3GFQA 2ZQYA 4JKOA 5BUCA 2Z2ZA 2V97A 4ZARA 2PJRA 1JBEA 4GOXA 2R7KA 2GFIA 4R71A 2NZUG 2PL5A 2R7NA 1CDZA 2NVOA 5JJCA 3E0QA 5J63A 1M6VA 4D8XA 4HDSB 4RAQA 1D5CA 2ZIFA 1IBKB 2GPTA 1OHHA 2HK6A 3R0JA 3M6IA 5C4GB 3IO3A 3GDOA 4OXYA 1QCYA 3BOSA 5J40A 4EA6A 3TOXA 2UYCA 1UC8A 3CLSC 4YT2A 4HLUA 5FNZA 5DNCA 2VFAA 1JJVA 4LQDA 3L77A 1GITA 2RGGA 4OQYA 3WL7A 1B74A 1HYHA 1TJPB 3QA3E 3U56A 1PG5A 1G6HA 4LVNA 4E5KA 2IS2A 3N53A 1TLFA 3VPFA 1D0SA 4DB2A 2R8OA 1YTUA 1WQ1R 3U2QA 4F06A 5GQSA 3TTWA 1DKMA 2QM8A 3RS0A 4MR7B 3I9FA 2JLAA 1Z5GA 2ATXA 3KVNA 3EVBA 4ZXFA 4FOLA 3WISA 2ZSIA 2C1XA 3BHMA 3H42B 1A4IA 2ZSHA 3ROMA 4IRXA 4MJXA 5F2EA 3SXPA 3O8RA 1GG2A 5CM9C 4BCDA 2QOEA 3LWDA 2DPXA 1E94E 3K6KA 2AN5A 2PSEA 4FEAA 4LWOA 3F6EX 3UB4A 3VJMA 4AROA 3QU5A 5LOVB 1XROA 2Q9CA 4JGGA 4UXJA 1OFGA 3QUAA 5DHRA 4WNIA 5HBRA 4EITA 2ZUEA 3RAPR 4CV3A 1ECCA 1ZUD1 4ROTA 2HN9A 1YB7A 3DAPA 3QFCA 3WNZA 1J90A 3RVPA 1GNRA 2FPIA 2DG2A 2F62A 3RNLA 4KFRA 3PDCA 3OE5A 1DG1G 4X44A 3STYA 4GBGA 1G9XA 4FU0A 1FYXA 3KP1A 2XBMA 1Q44A 2EKZA 4OLHA 1GPWB 2BGJA 3SHQA 4JNKA 2RBEA 5AJYA 3BQMB 1V8ZA 2ZUWA 1EFAA 3PA8A 3UMGA 3OJCA 1I2ZA 4Q4CA 4KE8A 4KITB 3DR5A 3QKWA 1E4EB 4OI1A 2EQBA 1NAIA 3V34A 3GWZA 4TKMA 4JJFA 3EOZA 4G0QA 4YMWA 3L7NA 1R5NA 4M21A 1EWYA 1VL8A 2E4WA 1E7QA 1R5JA 3C7DB 3U31A 4DUPA 2C7BA 1M5TA 2FUCA 2VNAA 4IDGA 4P32A 1THMA 1VL2A 1PTKA 1L5GB 1I5EA 2QU7A 3EFHA 5EJFA 1C30A 2OK8A 1HR0B 4IZHA 3Q1KA 1RHJA 3X1ZA 4LCBA 1MAVA 3QFHA 4ALIA 2A0FA 4IDPA 5ALOA 1Z6PA 2AQIA 2YHSA 3GVIA 4AWXA 4HYQA 5IJ9B 2IU4A 5K51A 1KMHA 1AT1A 2ATVA 1AH2A 4ZO9A 4CM8A 3WB0A 4E13A 3RUPA 1ZH4A 1W19A 1Y6QA 2XT0A 3E7XA 1AVTA 3AR4A 3LDFA 3IV9A 3L05A 2X5OA 3FTQA 4J4BA 3RTEA 4X1KA 3Q8XB 1Q16A 3SVZA 2ERYA 1KARA 1DX9A 2E4AA 2Z6VA 4DLTA 2GJSA 3VBEA 1HRKA 3VAZA 4GBMA 4B31A 5BQFA 2BEUA 3QK7A 3QW2A 4ZHQB 5IXYA 3O03A 4PQEA 2UVPB 1M54A 4FYYA 1IEWA 4Z99A 3ZCRA 2PS0A 1A8IA 1JS1X 1V9LA 1MJ5A 2P91A 4KRXA 3VO8A 4JIMA 4OX9Y 4PLGA 2IDMA 3G82C 4EB6B 4AYTA 1KBZA 2C94A 4OGFA 3WK8A 5MGNA 2IHYA 2VYFA 3L18A 5IMSA 1Y9JA 4XWKA 4JBNA 1J5EB 1YUNA 2CLEB 5EIWA 2QPOA 1E77A 4F5ZA 1YQQA 4KP7A 5JDIC 1RRPA 3GGGA 3T0GA 3KOOA 4RTLA 3HVRA 4LSWA 5F64A 1EFTA 2FW6A 3LPNA 4HFNA 2E21A 3ANMA 4MPJA 1JSCA 1UANA 4YAIA 1KK0A 2CLDX 4HBGA 4IHAA 1RLMA 5LBUA 1N2CA 3GB9A 2EYUA 5LLSA 1XTIA 2PZJA 1E3TA 2DFPA 3U19A 1EZ4A 2YV4A 4K6GA 1UBNA 3ANLA 1NIJA 2QQGA 4YJ3B 5JYBA 1I94B 5LA6B 1PS9A 2VPWA 2Y1LA 1EUDB 5MN4A 4QTYA 1KO8A 3ND6A 3LK6A 4HOYA 2LKDA 3FTPA 1DEAA 5EFZA 2Q1WA 2BEWA 2VPPA 4HY3A 5CLLA 3LYLA 4H0NA 1LFAA 4EA9A 3D5QA 1R0BA 3LYAA 1ONPA 5AM2A 1PCXA 3AJEA 2GD1O 4P7FA 5KSPA 2R7LA 3O0DA 2WPDA 4PC6A 1H3EA 2F1RA 3PV0A 2BPOA 2J7KA 2IDZA 3NTXA 2P6MA 4DHEA 3D8SA 1R8YA 2CJWB 4W1RA 3ACCA 1ZL2A 1D0VA 2QSJA 3EF3A 1LQUA 3LLVA 1VSVA 2W6PA 2C82A 4JJ7A 3RS8A 1JDNA 4C76A 1MB9A 1GJRA 3DL0A 3KZCA 1SN7A 3F8TA 5LB2A 4W1QA 5CB4A 3KYCB 1ZONA 3ZY4A 5LQJA 2B36A 5CJJA 5I9LA 1F1BA 1E6MA 1KDTA 2ZYRA 5B6PA 3VI4B 1NUHA 3ELDA 3FUXA 3TCXB 1P0QA 3KU4A 4CI0B 1F12A 2FX3A 4UBNA 3PHHA 3VVMA 1Y6GA 3WLNA 2Z6AA 3BL6A 3EDQA 4MRAA 1LLUA 2C4WA 2VG8A 2GOYA 2X1VA 1J33A 2YJGA 4FYWA 1QKIA 4YDRA 4LJKA 5EN4A 3WL6A 1OXTA 1ANKA 2V3WA 1RJ9B 4U6SA 1INLA 1JHAA 3EXG1 4JUIA 5B1IA 2Q07A 3IKMB 3SVTA 2KB0A 4P4SB 4RGVA 1W4AA 3GCZA 2D0IA 4INAA 5EERA 3VA7A 2CFOA 4FLEA 7ABPA 1FS5A 4U3JA 3FJYA 2C4UA 1WUIS 3HJNA 1G3IA 3WFZA 4F3CA 3EPPA 2WWRA 2RGEA 1RQRA 2AC4A 3ISJA 3CKMA 3I5AA 4BLPA 2ZSBA 3WIOA 2FY8A 2OY0A 2P27A 1YJ5A 4I1OA 4OXQA 5EOVA 1YJXA 2OLEA 4WRRA 5KPJA 4IRMA 1LPAB 3C8ZA 1L4FA 4H7JA 3K1TA 1W2WB 1XVLA 1KL7A 2YYYA 4OI4A 2EQ5A 4IS3A 3JWGA 2R8XA 2GHTA 3GPBA 3OEWA 3OQ1A 4H7PA 5CX1B 4KR2A 4A6DA 2YRWA 4KNVA 2O9JA 1T9KA 1EDOA 4IJMA 4RS3A 3PFFA 6YASA 1JR3E 4B8WA 3KIPA 2W42A 4G0WA 5E1MA 1BXGA 3LBAA 1EK0A 4HDKA 5BR1A 1Z25A 1BS1A 1N3LA 1UIMA 4ECAA 2JGNA 2J3QA 4ZXPA 2XZLA 3IAM6 4O2BF 3E9MA 3FPAA 5AD1A 5JSZA 2QVGA 3DNPA 3M6UA 3ZK7A 1CIPA 4GQIA 4CL0A 5ALPA 3DXXA 1YIAA 3MS2A 3DQQA 4J6FA 4P3NA 2VJYA 1RABA 2IXBA 4BJ6A 3M89A 1BCRA 2QR5A 1CETA 1U9IC 2DULA 2WFAA 4B2IA 2Y1CA 5DXAA 5JNRA 1RQGA 1S0UA 3OTWA 4JP1A 1DPFA 3HFJA 4MEJA 1J42A 3CUEF 4MVYA 8ATCA 5JU6A 1SUEA 2J3MA 2R66A 5IBCA 1YOVA 1N36B 4X8LA 1W36C 4Z9AA 5F33A 2YMPA 1R6BX 3TVYA 3STVA 1X9GA 2ZU0C 4E1VA 5BR8B 3BERA 5KVQA 3R7WA 1SUSA 2CXNA 5AW8A 4A7PA 1M2JA 3AL2A 2QAJA 4OXXA 2IX3A 3PU6A 3I58A 3BX1A 1C0LA 4MITA 2EZ4A 3H5OA 1UBFA 3MMXA 4XIGS 5IAGA 4BMSA 3BD7A 2FW9A 4WZAE 2JIBA 3L43A 1BFKA 3M5CA 1AKUA 3DEHA 4E31A 3BIOA 4JK3A 1WAMA 2G17A 1YZFA 3JQ7B 4R3UC 3PS9A 4YP7A 4OHXA 1XMOB 4P4NA 4BFXA 1BAPA 4DMUB 3L7DA 3RT9A 1RKXA 4FHFA 1SVSA 1CUWA 1YFZA 2D00A 4BP1A 4JYAB 2HM7A 2OOKA 2XF2A 4AW9A 1KBOA 3K0CA 4Q21A 4Z0TA 2GJAA 2XOKA 2HB6A 5AVTA 1L7QA 2DEUA 1QWOA 1LS6A 3ETHA 2K4MA 2NYRA 1QQ7A 3U7RA 4EMUA 4OP1A 3C24A 4YRCA 4B3BA 3TECE 1C9EA 3AU9A 4S04A 1T1EA 4FQ5A 5HCUA 4KR3A 1CRLA 2XAAA 5LA6F 4W7SA 3BSSA 3HADA 4EG6A 4R1NA 3W5DA 3L8HA 1R0SA 1NRXA 2WMNB 2ZSKA 4AJHA 4M8KA 3ZHOA 5BNZA 3GLSA 3S8EA 2O8FB 1JIQA 1IJBA 4QOFA 3EEFA 1CZNA 3CLRC 4HFJA 3OZFA 5DOVA 5EP3A 2YDXA 4EJ0A 4LRTB 2CL0X 3HZZA 2V9ZA 2Q8NA 3UK1A 5IFKA 1WMBA 5K4HA 3K9NA 2O5EA 3MS4A 4O25A 5FUWA 1E3LA 1U8CB 3E03A 4XYBA 1QZZA 2ZSAA 3KK0A 2CCGA 5F73A 4ENWA 1GL6A 5IWAB 2YCLA 3CNLA 3FETA 1M0SA 3CMMA 2AXNA 4LRWA 4CL3A 3FLMA 4J16A 3HXQA 2XDAA 1IDOA 2GLXA 4FTWA 4I81A 1E1QA 1PU2A 3THYA 1EVJA 3C1UA 3EBLA 3LQKA 1QFXA 2H1LA 4CQLA 4JGBA 4R16A 5IG2A 1TYBE 3BYZA 4B85A 3KQKA 4CMCA 2O6HA 1Q92A 1L5LA 1ENZA 4DLNA 1MO4A 4C08A 4UAVA 3PEUA 1FEZA 2XLCA 4WFKA 3WADA 4ZC1A 2HO5A 3AM5A 5ES3A 1LW7A 1XYGA 3PQCA 2WKSA 1R8SA 4QTXA 1KEPA 1KK1A 4CQMD 4GUDA 3HYRA 4ZT6A 1RKVA 1XPUA 3CE9A 1AXEA 3AOEA 2JGEA 2XT6A 1YR3A 3CW2A 4JL8A 1I13A 2BEVB 2KYRA 2RHBA 1U8FO 3U62A 3VR0A 3PPWA 2BBWA 3IODA 4ZO4A 3SC6A 3I5UA 4EDFA 4I1UA 5LM3A 3D6MA 3ZHSA 4DIEA 1IY8A 3ROTA 4C2TA 5ABPA 3NYRA 2J41A 4B4DA 4LZNA 1FQKA 5JWOA 1YJAA 2HDHA 3U48A 2PZGA 2A57A 1E6CA 3R20A 2XGSA 3WNBA 4TTPA 3U37A 5GINE 4WN9A 3S8YA 1KPGA 1O95A 2DM6A 5E38A 2OXEA 3EGOA 1TE2A 3MBOA 3SBDA 4X65B 1OH8A 2PAAA