5JROA

The crystal structure of azoreductase from yersinia pestis co92 in its apo form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
202
structure length
184
Chain Sequence
AMSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGTPTDLVVPYLRLFLGFIGITDVEFVFAEGADAKTLLAQVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-dependent NADH-azoreductase
publication title The crystal structure of azoreductase from Yersinia pestis CO92 in its Apo form
rcsb
source organism Yersinia pestis co92
molecule tags Oxidoreductase
total genus 57
structure length 184
sequence length 202
chains with identical sequence B
ec nomenclature ec 1.7.-.-:
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jroA00
3N39C 4Y9RA 2QR2A 1YCFA 3F2VA 3GFRA 1KBOA 1H66A 4YAUA 2WC1A 1AKQA 1VMEA 2OHHA 2Q9UA 1X77A 3W78A 3W7AA 4F8YA 1AG9A 3F6SA 3NHPA 1T5BA 1KBQA 6NULA 2QX9A 2QX8A 3D7NA 4C14A 4GQIA 3ESYA 3OVMA 5LMCA 3NFRA 2HNAA 4YAWA 3GFSA 4QOJA 1GG5A 2R97A 1ZWLA 3NHYA 4LA4A 4M0CA 1DX9A 1FLVA 4U7HA 2A5LA 1FTGA 1AHNA 3OWHA 5A4KA 1FVXA 4ZVNA 2N1MA 2V5UA 1D04A 2QWXA 3TEMA 4FX2A 4XDHA 4QOIA 5EAIA 1I1OA 4ZVMA 4J8PA 2HNBA 1AKTA 1XYYA 2V5VA 2BF4A 2FOXA 3HR4A 3K1YA 5BUCA 4YAOA 1OFVA 1XI2A 2Z98A 1ZWKA 5F4BA 2BMVA 4N65A 2MOKA 4PTZA 1RTTA 1E5DA 4D02A 3O73A 4FGJA 2X2OA 5NLLA 1V4BA 1QR2A 4CETA 2MT9A 3NHWA 2M6RA 3KEGA 2XOEA 2MWMA 4C0WA 1AKVA 1CZLA 4YAFA 3U7RA 3NHFA 2FZVA 3N3AC 1JA1A 4QOEA 2ZKIA 2AMJA 3FVWA 5LBTA 4XDGA 1TIKA 4NLLA 4S24A 1WSWA 2OHJA 4GI5A 3EYWA 1YRHA 3UXHA 4FGLA 2F1OA 1J8QA 5LJLA 3FNIA 3FW1A 2FLVA 2KLBA 1OBOA 1FX1A 3W79A 4U7GA 3HLYA 5NULA 3GAMA 3ESXA 4C76A 1YOBA 1D03A 3NHJA 4QOGA 3QE2A 5B3LA 4CF6A 3KAQA 4ICIA 2FZ5A 5F51A 1J9EA 2BZSA 1XYVA 3B6JA 1SG0A 4Y7CA 2Z9CA 2R96A 3FJOA 3P0RA 1AKRA 4GR9A 4LAFA 4PU0A 1D4AA 1QHEA 3F6RA 4HEQA 2W5UA 3U7IA 2FDXA 2OYSA 2ARKA 3S2YA 2GSWA 2QX4A 3K20A 1AKUA 2FCRA 2MTBA 4ESEA 2Z9DA 1CZHA 4PTYA 2FAXA 4LTNA 3NHRA 2QMYA 3NHLA 1AKWA 1YKGA 3UXEA 1H69A 1J9GA 1CZKA 3OJWA 3OX1A 3GFQA 2X2PA 1FLNA 2FVXA 3RPEA 2M6SA 1YDGA 4YQEA 4C0XA 4H2DA 2Q62A 4DIKA 4DY4A 1TLLA 3OWXA 2RG1A 3W77A 4N82A 4QOHA 1YCHA 1RCFA 4ZVKA 4U7FA 4LTDA 3OJXA 5ULLA 5EA2A 5JROA 4H6PA 3L9XA 2OHIA 4LTMA 1WSBA 4R81A 2FX2A 2QMZA 3B6MA 3FX2A 3OX3A 2B3DA 2QX6A 1NNI1 1SQSA 4NULA 4OXXA 1FLDA 1F4PA 3F90A 5LLDA 1BVYF 3NHUA 3R6WA 3LCMA 1QBGA 1C7FA 4Y9UA 1DXQA 5FX2A 2V9CA 3G5MA 4QODA 3JSXA 1RLIA 3NLLA 3EDOA 4FGKA 5B3KA 5LVAA 3O2NA 5TGZA 3KLBA 1OBVA 1CZNA 1J9ZA 3KAPA 1AMOA 3TZBA 1FUEA 2HPVA 4HS4A 1FLAA 1YCGA 3N3BC 3B6KA 3L9WA 1C7EA 1XT6A 1ZX1A 5FA6A 5LJIA 3ZHOA 3B6IA 3QFCA 1CZOA 3TE7A 5FUQA 4N9QA 4YALA 4BMPB 2D5IA 1B1CA 4QOFA 1BU5A 4DILA 3NHKA 1CZRA 1JA0A 1T0IA 3ESZA 2KQUA 4BMOB 1CZUA 3LT5A 1DXOA 3ES9A 2XODA 1AZLA 1QRDA 3QFRA 5EMNA 5LBUA 3HA2A 1RLJA 4ZVLA 2BN4A 3OX2A 3NHSA 3SVLA 5F12A 2BPOA 2Z9BA
chains in the Genus database with same CATH superfamily
1Y9DA 5CCXA 3TGLA 1T1SA 3PKJA 4TLBA 3ZGOA 1ZD2P 4I36A 2CE2X 3PWKA 2RE8A 4JUFA 3UMFA 4KFUA 3S99A 3MJEA 1M2HA 3EIWA 5FTKA 3V8VA 4DA9A 3CO0S 3I39X 3AYXB 1GKKA 4DZTA 1A77A 1D6JA 1JW9B 2CK3A 2WKWA 4W5WA 4UPEA 1IOVA 3F4BA 4G5QA 3KELA 5L3SB 2ZE7A 5AI4A 1OFTA 1K7XB 1X9GA 3NP9A 2IYQA 3IPXA 4UFNA 2X2EA 3N0VA 4PZ9A 4BLPA 4TKVA 3D02A 3NATA 2E1PA 5LBIA 1ZSYA 3OEEA 4BZQA 2QN9A 1G3MA 4AJLA 4IJKA 4QFBA 1Q21A 1U65A 1PFUA 4KUGA 4CKWA 2DERA 1W9HA 4KWIA 1VHJA 4DCUA 4O4JA 3EQZA 3KU1A 1RWPA 3NOQA 3EUWA 3W90A 5CTJA 5L3RA 2PFGA 4XM2A 4UW9A 3BD9A 3VFDA 3O8RA 2ATCA 4EYOA 3I73A 1T1RA 1LY1A 4DEXA 1EE1A 3O8BA 4O08A 3IGFA 3JAWB 4DSOA 4DUGD 5BRAA 1KEEA 4I1YA 1DGQA 4Y2JA 5J2TA 1IY8A 2PH1A 3HKBA 4KN8A 1F2UA 1LX7A 3Q7PA 4YPVA 3EXEA 4HNUA 3IVCA 4LRTB 2IEAA 2ZI4A 3T3IA 1A4RA 4G8BA 4CMEA 1Z2OX 3Q15C 2M6KA 2YXLA 2G9NA 3WV4A 3GL9A 4IUBS 4BUCA 4AROA 5IZCC 3MEQA 2AFIB 1JDVA 2AK3A 1DELA 1H0SA 1V5FA 2D06A 2ONKA 1IXSB 3NCTA 4HOYA 4OQPA 4ZDWA 1L4LA 1X7ZB 2GESA 3QXGA 2P75A 2D2IA 4FCCA 4U7HA 5FUYA 1WSAA 4CFZA 4I8XA 2HSZA 4DT1A 1D8AA 5MHTA 4V0KA 2WV9A 2A3NA 5CVUA 5AW3A 1H0HA 4I1SA 3W5VA 2GZ3A 4IMRA 2R6JA 4JK3A 5DJ5A 2E4XA 3WR5A 1W0KD 1FVHA 5KWSA 5KYNA 2R9VA 2BKVA 1X7DA 3BIJA 2O6LA 3OHSX 3GGJA 3H6GA 4HLDA 1I14A 4A91A 3E9CA 2I87A 1Y7TA 4E4YA 3U3XA 3ND5A 2QF7A 5GPBA 1U81A 1V0JA 3WZ2A 4BNGA 5JDCA 2QTGA 3A1VA 1A7UA 4B6EA 1RLUA 4PCLA 1TJNA 1PS0A 1JKJA 4PN7A 5A4DA 4KXVA 4PLZA 2FSPA 3O4HA 1N2CB 3UA3A 5C4GB 3VPBA 1QPBA 4KL8S 1Z4QA 3IELA 4UARA 1UJ5A 1YE8A 4UHEA 1CQJB 3A6PC 1UMDA 2QTZA 2WMOB 1N6PA 1N2GA 4YP1A 4RANA 1UPFA 4JJ6A 1LC3A 3DKKA 4G4SP 2AOUA 4LYGA 3MJ4A 1QLJA 1XMOB 1GGHA 2YWGA 3H3JA 5DX8A 2DWCA 4BGUA 1DKUA 2Y1OA 3AB7A 4DADA 5JCOC 3TG2A 2IH2A 3D2BA 3M81A 3TNJA 4DLKA 1JR2A 3ZS8A 1M6HA 3F3SA 2VJMA 1J56A 1L1RA 2AWNA 4MIOA 1F6DA 2QL9A 4ZVTA 4YP6A 3WO1A 3C74A 3WSWA 1G291 2OGWA 4DB4A 1BGXT 4MDYA 1LQTA 3N7UA 1UOEA 2FJ0A 1VG9B 1BDMA 3ASUA 1KZ1A 1KOFA 4JQZA 4MPDA 5SY9A 3PEFA 4EG4A 1R4AA 4X71A 3EAGA 2J7PD 5CAEB 3O0DA 3GLGA 2ZI9A 4TTJA 5CU7A 5EKSA 3NKVA 1SOMA 4HN2A 2O2DA 5H5JA 1HR0B 1WTAA 2AFIA 1F0PA 3PWZA 1Z0FA 5H70A 3NHWA 3O2QB 4ZARA 3QVGB 2WDZA 1OI3A 2XKAA 2Q4BA 4WH0A 4RACA 1LRJA 4M98A 3Q85A 1DLJA 5BOSA 4OU5A 2EOAA 3K9LA 4JDUA 2AN3A 4PFJA 3RAEC 4ZYXA 1N5DA 1GXSB 1UPUA 3VYRB 4K0RA 4LC1A 3U4QB 3PIIA 2H51A 3HU3A 3MQ4A 3E9MA 5ENZA 1E0JA 2VUSA 3AEUB 3KUCA 1GFSA 2ZRJA 1JLKA 3D6JA 2AV6A 1L5OA 3S4YA 4J75A 2ID9A 4HLCA 1SBZA 1F12A 4NQRA 2JGEA 1VPDA 4UKDA 5JYEA 4ARCA 5LBTA 1DIRA 3B82A 4ZEVA 1TIKA 5G41A 3ABQB 3JAKB 3BMNB 3WIDA 4X41A 5EZ5A 2NV2B 4G0QA 4G0VA 5KQSA 1Q12A 2C8LA 1UQRA 2IYEA 1QZXA 3PNOA 3I9V1 4FCWA 4GI5A 4GMFA 4S12A 5H4HA 3HFJA 4J16A 1XVTA 3K32A 1YFJA 2HCBA 1SBCA 4R51A 4HWSA 4QDTA 2OECA 1TGYA 1JU9A 4B82A 4NFLA 5IJAA 3IMEA 4TGLA 1JDUA 3KU4A 3UGJA 1PZMA 4BNZA 1IJBA 3ZPXA 4ZDIA 1Y1RA 2FLVA 3S40A 3EOAI 4DANA 1YZTA 4H3VA 2QLJA 4KMOA 3W6PA 2C0CA 4P7GA 1MPXA 1X7GA 2B8JA 4GSLA 3D7KA 4FFDA 4I3HA 2B2NA 4PC6A 5JH7B 1OTYA 1QO0A 4I5FA 5JD5A 2Q5HA 3DW1X 2O3TA 3I53A 2HHJA 4P5DA 2I6SA 4QULA 4WKGA 1UXKA 2UVPA 3G0GA 3QMPA 5H82A 5ILGA 2ZU0C 4Z4GA 1TQ8A 3A9WA 2I78A 3QHPA 4O4IB 4IOKA 3QUSA 4P81A 2NV6A 2FK8A 1Y3FE 2YOHA 4ZAYA 3QE0A 3QJ5A 3ZXUB 2C2MA 1WMAA 2ZBFA 5EFOA 4K9RA 4B83A 5GZ1A 1C1DB 3WGGA 1UBTS 4MRRA 2FWJA 1KJIA 1CUUA 3OTWA 3D4NA 2B4QA 4WNAB 1S4MA 3MBKA 2VP3A 4A0RA 1JJVA 1C0KA 4I55A 3SIRA 4HAWA 4MYRA 1L5KA 1A97A 1DWUA 2G6BA 4RJ2A 4N8SA 2IV3A 3GIDA 2XGMA 3UF0A 1XEWY 2NUTB 4FMCB 2HU5A 1K8YB 3UJ7A 1M0TA 4JJIA 2D0IA 3NUQA 3N7TA 4G5SA 4KACA 3KEFA 4KXQA 2J3DA 1RC8A 4C0KA 4CIAA 3EGWA 4QARA 4KU4A 4V24A 3FFBA 3BMNA 3LYHA 3DMRA 3UHOA 3BPSA 3COSA 1K7SN 5DIZA 1DMSA 1CCWA 1RAIA 4UVEA 1JDZA 5HM8A 2G82A 4B6JA 2EU8A 3E84A 2OGUA 1TYBE 4K87A 4BQPA 3LF2A 3OPYI 5AHXA 2O50A 5B6JA 2YVUA 3AFMA 3UMRA 5CNMA 4BVLA 2GSWA 5BT8A 5C7LO 5IHXA 3SIXA 3IAS6 4EHAA 2FLKA 1AUXA 4DLPA 1RLOA 1QHXA 1N6OA 4JR0A 4EKIA 3C6MA 1W88A 1QGAA 2VOJA 4NHEA 5BYAA 3AR5A 4RS3A 1FRQA 4M0UA 4AXXA 1W8IA 4DAOA 4U0KA 1NE7A 2QUZA 1M3SA 2X22A 4Y2YA 2JFVA 3NHRA 4CUKA 2FPSA 1OWLA 2W83A 1SM4A 3P9PA 1MAUA 3TRFA 1QZUA 4FSDA 2REQB 4IF6A 1ZNZA 3RWOA 4CLHA 2DEUA 1KI9A 2HL6A 3DQQA 3WKAA 2GHRA 2NADA 3UW1A 3MTGA 2O48X 2J5QA 5KNCH 3TR0A 1UOOA 1L6RA 1VKNA 2ZCVA 4KRXA 3D1VA 1VDZA 1EFAA 2PK3A 4YMVA 3PL5A 2WDPA 1M66A 1IJEA 1SD1A 2GGSA 3MINB 4I08A 4YP7A 2DPHA 3IJEB 3S5UA 3T9DA 5CYGA 3MQFA 1XN4A 2VRCD 4OHVA 3TTSA 1HYEA 1OAKA 1PWZA 1XDSA 4HMOA 4I2NA 3CZQA 4I4IA 4L4YA 2E3JA 1R4NA 3CZRA 4EMSA 2K2WA 1Q7BA 3FWHA 3RPEA 3NDBB 2HA4A 4LGYA 3PUIA 4LI3X 3UMBA 4X6UA 1GQYA 2CJYA 1Y5NA 2WBLC 3E3MA 5LLDA 1BFDA 4BWGA 4R0MA 5DVZA 1SB8A 5KCZA 4TQAA 2X8WA 2YFQA 4IZ6A 4Z3OA 2COEA 2YIVX 3KQYA 2QD3A 2FUCA 2UVDA 4NG5A 3SQMA 1RJ9A 4JX8A 1ZVVA 2LP4Y 3ICWA 1XDWA 3R4CA 3C7CB 3KV3O 3N5CA 1UPTA 3EGEA 4AG6A 5I7WA 2AFHB 5FBWB 2YV4A 4W4TA 4GX1A 2O7QA 3OETA 4BO0A 1YJQA 4OATA 3G2HA 3N86A 3K73O 2CJPA 2GNPA 2D2EA 2GN0A 3WXMA 1Q7TA 1ADCA 1DCFA 1E7MA 3DD1A 2GHQA 2GXQA 2JIBA 2PANA 4NPCA 4PSAA 4UC0A 2P35A 3IOCA 2ZPAA 2Z43A 3MHPA 1ZLXA 3MS2A 1SQ5A 1UIMA 1N5IA 1YJBA 3O91A 3AF6A 1B16A 3AVUA 3VDNB 1TUBA 2OORC 3CLUC 5CBPB 5IW8A 1YR3A 2FZLA 3ME5A 4BV2A 1R9MA 2RGEA 3PGMA 3FWYA 1R7RA 2BGNA 3MRSA 1FRZA 1PR4A 2HA2A 2RGYA 3OJXA 1QFSA 3R9XA 2WJYA 3VUEA 3TN7A 1KNQA 2PU5A 4BS9A 4EW6A 2F3TA 3A7DA 1XU4A 4HKTA 2CK3D 1KE2A 1E63A 1S1CA 3AERA 2QY9A 1BKSB 1EIZA 3THYB 1FJ2A 1NQTA 1ATZA 4L8LA 3MTIA 2Q29A 3B5EA 4NABA 3SHOA 4GZ3A 2GM5A 3ZVMA 1VMIA 3DDOA 3JPYA 1X1RA 2BGJA 4MHSA 1U0FA 1JIXA 1WSDA 4FYKA 4HDNA 3MUEA 1Z4JA 1OLUB 4HLUC 4OYRA 3OEED 1IZ7A 1D1QA 5JAOA 1OXBB 4MUAA 2AVDA 5G02A 2BELA 3J81k 1UFVA 4TXLA 4ZO7A 3UWSA 3B1ZA 4ECAA 1JA9A 1C3OB 4NMLA 4EG6A 1SCNE 1U1DA 4J6EA 3BJZA 2Q1WA 1Y6ZA 4L07A 4H1VA 4JVNA 3MXTA 5AHKA 1U0BB 3TM4A 3HRHA 2B37A 5HIMA 4FGKA 2GDZA 1DKNA 4QDJA 1FP2A 1EVEA 3HCCA 4XJTA 1MC1A 1C30A 4HXGA 4MEAA 4YH1A 4YAKA 4JGGA 2OAEA 4B6QA 2JRCA 5DM70 3E9NA 3QLVA 3FNHA 4IJQA 2EGUA 3WGQA 3NO4A 2AFHA 5EP2A 5M3BA 1U2EA 5HUQA 2J3LA 1Q2UA 5KYWB 7ADHA 5JJKA 1IL0A 2X9LA 4G97A 1YRYE 1GGKA 3BHIA 2YVAA 1T1JA 4UTRA 4JZKA 1O57A 1YNSA 4IUDS 1XTSA 4B3BA 3AM1A 3Q2OA 3S5JA 3LC7O 2C7OA 3JVVA 4JP2A 1VJTA 2VUIB 2Z3VA 3TW8A 3DP9A 3TIVA 1B3RA 4ZV4A 2A0YA 1YRBA 1YCGA 3L1HA 1FFXA 1DDOA 1DRJA 1JXOA 2R6HA 3CWCA 2JD2A 3KYCA 4HJRA 3KSZO 5FXMA 4AU1A 5DO9A 3OC6A 3U7FB 4OM8A 2H4WA 3DBHA 3FHCB 4YUXA 1PGNA 2AG5A 1IZZA 1X2EA 1AE1A 1MRNA 2Z5LA 3ZCUA 1VIAA 4TUYF 2P78A 2GJKA 3O5AA 5CITA 3BJIC 1TOAA 4XPIA 3IEVA 1J49A 1PRYA 1CUSA 1Z33A 3N59A 3OPYA 2XNDA 2WAMA 4O3MA 4GP6A 2A59A 4ZTUB 1Z4MA 1LRLA 5IM4A 1GAQA 3WL4A 4W7HA 5GJWC 5IARA 1UBOS 5KOYA 4Z8YA 4OHPA 1GRRA 1GT91 1LBQA 2FXIA 3KZNA 2AYYA 4BNYA 4CL0A 1UBLS 1C80A 1D0SA 3MIIA 1TZBA 1C4WA 1D4ZA 1TU3A 1LPNA 3H0CA 3VR6H 3LT5A 4MKRA 1YRWA 2R2AA 4ZQHA 2AQ8A 2D54A 1AGNA 3W5DA 3C97A 5DIFA 2Z2YA 2O7SA 3HP1A 5F64A 1GQSA 5IAOA 3OOYA 4JIMA 2BBTA 4HDKB 1DTEA 1W8DA 5CK5A 3EPKA 3KJGA 1E2LA 1QRDA 1Z3IX 2NV0A 4S1TA 4XFJA 1A50B 1QOZA 2PL5A 3O26A 1EP3B 1R0SA 2WMYA 1AB5A 3AQ4A 3G13A 4NFYA 4ZC1A 1N4AA 2ONJA 2QW1A 1TJ4A 2H11A 1XQ1A 3DTVA 4PQGA 4JI6B 3ROGA 2UZAA 3M4NA 3PXUA 2FEAA 3TZEA 3X0DA 2GRAA 3BQMB 2XTZA 1ZIDA 1YBAA 3QWFA 4NATA 1K7FB 4EX7A 5CURA 2XWBF 1DBVO 1D9ZA 1XAIA 3AIOA 3NHSA 3OO1A 4XX1A 4TTAA 1JEQA 3OKAA 2IV7A 4BVJA 4ZYTA 5F12A 4QYMA 4NAUA 4CN8A 4NJEB 3X2SA 1T9KA 2QXTA 3INRA 4J0EA 3LXMA 1T36B 1NYTA 1AGXA 3LDAA 5EJGA 3WKCA 3HSSA 5K8UA 1U3GA 3DB1A 3B5IA 1X38A 3ZHZA 3S81A 3KIPA 2YHAA 4RVDA 2WSYB 1WVMA 4P3XA 1FW6A 1IG0A 1BVRA 3L4EA 1SGWA 3KXIA 5TDHA 1Y37A 5AESA 1P7WA 3ZGLA 1EUCB 4LGMA 4MEJA 4DC9A 2ZAMA 3AZQA 3EBPA 3OQVA 4TTIA 1R0YA 3X2FA 3QQ5A 5E7IA 4FPXA 2F3QA 1FS5A 4YAGA 1OZ0A 1ZI6A 2I29A 2WU1A 3DBRA 2P2ZA 3K1TA 5DOZA 3TJRA 4J49A 2H2AA 4ALLA 4ZK2A 1OIVA 1VMEA 1ZO8A 3KYDA 3PQDA 4FC7A 4D5EA 8AT1A 1USWA 1XV5A 4PLYA 4YJ2A 2ZZNA 3DPUA 2QLFA 4WOCA 4BVGA 3PE3A 1LJLA 5DW3A 3AF4A 5A5FA 3JRXA 5F73A 3KKKA 4W7SA 4M8IA 4MB6A 3PNKA 3FPCA 5EY5B 1JHXA 1ORDA 2FDRA 4HUJA 1G8KA 1F60A 3QVVA 2YRFA 4PQEA 1JKFA 2FR8A 3UY4A 3V1MA 5FO0A 4C14A 1RXVA 2UZ1B 2QENA 3HE3A 3SAJA 1FNNA 1LA2A 3WBKA 2VRBA 1ADGA 2B1GA 1G17A 3RAGA 4WK2B 2Q2VA 3PNLA 4U9IS 4YT5A 1C50A 1N9GB 1G7CA 3C2QA 2WYUA 6ABPA 5MDHA 2XGJA 3TTUA 4U8GA 4YS6A 1E5VA 3A4VA 5JT1A 2B4RO 4BMXA 1GV1A 3AVQA 1Y8QB 3FMVA 2HNAA 2V03A 4ZZ2A 4PX3A 4MUXA 1CBUA 2YYYA 5AKYA 1Z56C 4UXJA 3EYAA 3VR6A 1ADBA 6LDHA 4ZAGA 2GPYA 1IZYA 2DPMA 2NVBA 3C5VA 3O31A 5IEJA 1A9YA 3KWMA 4I50F 3WTBA 1HURA 4K6HA 3IO3A 4CV0A 4KPYA 1KFEB 1CUJA 2Q5QA 2WKRA 1CB0A 5AXAA 2C5BA 2BFDA 5I3ZA 4ARZA 2FW8A 1T36A 1CQWA 3OPMA 4OHCA 4PYIA 1V16B 2JJ2A 3GCDA 3B9RA 4KKVA 3H13A 2NU8B 2FFHA 1XTJA 4GXQA 3I62A 3EC7A 5LKAA 1GGJA 2PX2A 2P1DA 5F3DA 1H6CA 1XHLA 1FQKA 4W8HA 1UT8A 4ZKEA 1QHFA 4DV7B 2E5FA 1J1ZA 3F0TA 2NP6A 2HF9A 3U3OA 1L1EA 1N6LA 4RNDB 4ABTA 4Y2TA 2VWHA 1C3LA 3T99A 4H27A 3QTTA 4UEKA 2ET6A 1KDPA 5CM8B 2G80A 1GTRA 4B3XA 1OZHA 3JZDA 3AESA 1O9GA 4G8JA 3TLMA 3TXAA 4H3HB 2C95A 3LSYA 4QNMA 4XDHA 1F2TB 5CJ2A 4D43A 2F2TA 2GTIA 4MVXA 3L8HA 1WCYA 3WVNA 1TDJA 2EJVA 4K9LA 4CEJA 5SZHB 1NW5A 4RZUA 1P17A 3LY7A 2IEIA 4U5QA 3OZDA 2AXNA 2Z98A 4NCXA 2Z2KA 1ZWKA 3FTDA 3H5AA 3ZK7A 1S6YA 1W1WA 5A6SA 2J33A 3UC5A 5KYXA 4N65A 4LOKA 4EECA 1YASA 2PUFA 3GLQA 5AW9A 5FOUA 2HO4A 4WBSA 1YI8A 5H16A 4MYSA 4OQXA 4W1QA 4D4IA 1QZTA 5LP6A 3UUGA 4B3IA 1DC7A 1FY2A 1G6Q1 1CEQA 4GUAA 4W99A 4CBVA 3ENZA 2WHPB 4XQ0A 1FP1D 3HCNA 3TZLA 1KYIA 2VJYA 4GGPA 5DHFA 1WBJB 3PUJA 4LNHA 4QU0A 4ZT7A 4D2IA 1C4KA 2CXUA 3L0CA 1TZMA 3F7OA 1P0PA 1P2GA 3LOQA 2ZBDA 4XIGS 3ZCPA 1N57A 1RFGE 4ZV7A 1C9JA 3QX3A 3UZUA 1SHJA 2NAPA 3B1JA 3B89A 3KZVA 4FEYA 3NWEA 1NVDA 1BOFA 1E1LA 1U28C 2MWMA 1W36D 1I7SB 1N6KA 1QNLA 1TPYA 1QTQA 1V16A 1T3GA 2GO1A 1ORVA 3RC2A 3IEXA 1SCUB 3H4MA 1FA9A 3OAAA 4K03A 4RPLA 2OXTA 2MYTA 2LWIA 4OGLA 2X0FA 5T6MA 3UPDA 1E1KA 4JJFA 2HRBA 5IASA 5JFTA 3S8MA 3QUAA 3LHIA 1YQGA 4ENVA 4FFRA 4Z4EA 4OFXA 4TQUS 1RYZA 1YR1A 5AJTA 5DNEA 4DBVO 3WWCA 2X5NA 3IE0A 1J5EB 1T4DA 4S24A 2BMAA 5ECDA 3B1VA 2OHJA 4V0SA 4XAQA 5ALQA 2HA3A 4L5JA 3U62A 5MF6A 2RGNA 1SVMA 1F2TA 1OA0A 2F8LA 2P0YA 2I65A 2C3PA 4NQZA 2JEOA 3C1TA 2N0SA 1KMHA 4ER5A 2QBYB 4JLNA 1FX0A 1RYNA 4CEIB 3U7HB 1MGPA 3EQ8A 5A71A 4UPDA 2HWKA 1IBLB 4B40A 1PR9A 1QGDA 3S28A 1EFPB 1OLSB 1Z2AA 4QBFA 4BQEA 4JMPA 2ZXFA 2H48A 2KLBA 1H2YA 2A1TS 3EK2A 2W9XA 1J2EA 4IX1A 5HGJA 4L57A 3RANA 5DRYA 1CR4A 1G5IA 4O6VA 3ZD7A 1FQWA 2D0PB 3DT6A 2VZ0A 4TTPA 2YV2A 1CP2A 3TL2A 1MFPA 4GM0A 2FN9A 2BC9A 3WGTA 4EVIA 2ZQYA 4E5YA 1QPZA 2PCLA 3A2LA 4ZT2A 3VV2A 3FTFA 1JHPA 3A4IA 3EJWA 3H5VA 3RR2A 1R00A 2OBXA 3R75A 2RGBA 1DJQA 3D0QA 3QG1A 4RELA 2HLDA 3VTZA 3MYRA 2A30A 2ZZKA 2WJ6A 1BDIA 1Z8HA 5BSEA 1PL6A 3K9QO 4MV8A 4IEEA 3O21A 4ZYLA 4URYR 1MO5A 4LZZA 5AW7A 2QIPA 2FPPA 4EH1A 4WACA 1PZEA 1FYDA 2A9JA 5DCWA 4C4AA 3HTXA 1V4NA 1BDJA 3T5MA 1YDWA 4Z7JA 1XMJA 2GX6A 2IITA 3BMOA 3KJQA 4OBBA 5ALMA 4ZT3A 3TOVA 3UKOA 3ULKA 3VAZA 3R7BA 4D0LB 3TI7A 9LDBA 1KZGB 4O0LA 3AKEA 1EZ4A 1QHSA 1N0WA 4X3OA 4AQDA 5AJYA 2BE7A 1BCRA 2CJWA 4XWOA 1XTIA 3P0RA 4NTZA 2XMRA 5DE3A 1IRXA 5FTJA 1HT2E 5KNCD 2W2XA 1IYZA 2JKZA 5B4VA 5K0JA 3JD3A 3BHNA 4IPTA 2R7LA 3BMCA 1N6NA 4B76A 3WL5A 1Z7EA 4D4GA 3L01A 3GARA 2WINI 1T9BA 4WADA 1YE3A 3QOXA 3SZOA 1KP3A 4MCAA 3KS9A 2A35A 1V4VA 2SKEA 3CX3A 3JALB 2XZLA 3TSYA 4M9ZA 2XUDA 1OB2A 1CLEA 4XUGB 1LNQA 4RTRA 1J97A 4OKIA 2C0PA 2RSLA 1OU0A 1KAMA 1RS0A 5CD1A 2BR4A 1PJZA 4AY6A 5KSZA 4MIEA 1HDCA 2DT5A 1K66A 4DC1A 1PX0A 2C57A 2XWJI 5BWOA 1S0UA 5L53A 4YDHB 2LIPA 5EIFA 1KVQA 3ETLA 2AR9A 3RRJA 4ID3A 1NG1A 3PXCX 3C4QA 4PNHA 4MW5A 2HEIA 3UFXB 4DJ5X 4Y2GA 1X1AA 3QMVA 1HXHA 2AI1A 1WQ1R 4KRGA 2QMYA 4WLVA 5E2AA 1I2ZA 1JU4A 2GAIA 3N2IA 2Y76A 4LGCA 4WW0A 4WCFA 3D7LA 3PQFA 1VGQA 2PWAA 1YC5A 5KYGA 5ENVA 3LZCA 2JLAA 1JI0A 1PJ4A 3A1WA 3GWZA 1YDEA 1JR4A 2ZSHA 3U09A 4Z4QA 4MB0A 1J8MF 3SQLA 1WPQA 2XNDD 3ORHA 2IUUA 1J9GA 5JXJA 4XA8A 1JPNA 3GBPA 3V1TC 1I7QB 3L4BA 1G8PA 2BRUA 4FR0A 2B5WA 5CTAA 3PJEA 5EZSA 4OI4A 1DJPA 2D0OB 4YRCA 2NUAB 1Z38A 2QQFA 2G5PA 3ZDBA 4BP8A 2O5RA 3IBSA 1NAHA 2HSWA 3AP3A 1MIOB 1LTHR 1VMKA 3BBPA 1WQ4A 3EQ7A 2PLFA 3KQSA 1SXIA 4N7JA 5KDLA 3WGUA 4QZVA 4BAZA 1Y1TA 4FR5A 1IPHA 5DP1A 3RFCA 4KFCA 1WM1A 2NSYA 1Z6XA 1Y80A 4KPFC 4D9IA 3ZHCA 2XXAA 4JI5B 5JW6A 2VWGA 3GRPA 3D7MA 4NBKA 13PKA 3HZHA 2PRSA 4JVSB 3V7FA 3OCZA 1P39A 2EYUA 3A14A 3DTVD 2BEWA 3B9PA 3E1SA 3QLUC 2WJ4A 2HY7A 2UZ0A 4J6FA 5EWLA 3LGSA 2X4LA 1EGVB 4EUHA 3HXMA 3VU9A 2I2AA 1ETHA 4WN9A 2NU6B 1UINA 1VYVA 3B13B 5CXXA 4IIJF 4Z3DA 2I76A 4EM6A 1U7XA 3HXTA 4U7FA 3H4VA 3T15A 2FI1A 4P4TA 2BH9A 4RFVA 3WQQA 1FJHA 3PEYA 1TO2E 1ZZGA 3JRWA 5CYPA 2LVBA 3MN1A 3SC3A 5FBKA 4ZOBA 5ALUA 1UK6A 1Z4LA 2HRCA 2OGZA 2I33A 4AUMA 2PUCA 1L1FA 1W93A 1LB1B 1V5GA 1M34B 2HZ7A 5H81A 3W6UA 2XQIA 3IKVA 3LP6A 4OOEA 2HCFA 1R74A 2RGXA 3E22B 3K0CA 4GGMX 3WBBA 2LBPA 4PZLA 3VR3D 4NVRA 3FX2A 3GZ4A 1V6AA 1W7AA 1LW6E 2C78A 5L51A 2YRXA 4RBNA 5AK4A 4AKIA 4GOMD 4A8JA 5JQGF 1BVYF 3SSNA 2IV2X 1FSFA 2FY8A 2ZWPA 3QYJA 3SZGA 3VISA 3ZDYB 2ORIA 1WIWA 2GPBA 4NENA 1DJMA 2EYQA 3V55A 2RBKA 2TECE 1CS0A 3EXG1 4PG4A 4PSDA 3U16A 2DSTA 4LF9B 3LP8A 2VIIA 3PGXA 1NXXA 5KTYA 5ISMA 3KEMA 5F35A 3HCBA 1HE3A 1ZM3A 3L8FA 5DBHX 3Q3IA 3RBZA 2NOAA 4FZ5A 2IW1A 2P4HX 4C7JA 1ODTC 1UP6A 2O2HA 2AC7A 2QUJA 1QSGA 1I2AA 2VLBA 3NONA 1TJPB 3C1AA 4FHZA 2Q1YA 4WZBB 2PBFA 2WKPA 3AF5A 4NL4H 3ZXSA 1LLDA 1PV1A 4IXTA 4OHZA 1JHRA 1JJBA 3E0QA 3FWNA 3GJRA 3I5YA 3ABOB 2Y1WA 4TMVA 2Q8PA 3DB2A 2R65A 1XMQB 5JSQA 1M2VB 4GE0A 4LSWA 4QLOA 4MPRA 4O2AB 2ZJFA 3SF8B 1AMOA 1Z12A 2O8FA 1EHIA 4CQLA 4LVUA 5FOVA 3VR6D 1TU0A 3OTIA 2CV2A 3NIFB 1OX4A 2VHYA 3K5IA 3FGNA 3KCQA 2O2SA 1JJIA 2XB4A 2OEPA 3KXKA 3QK7A 1G59A 3E35A 1E60A 4MV6A 4M7RA 4B3SB 1UM9A 4ZQCB 3NYRA 3WK6A 2P9GA 4YQFA 1KR5A 3BBLA 1MVLA 3ECAA 3KZXA 4JDPA 5CHYA 1TAHA 5B1HA 3GOQA 1JBQA 1Q7CA 2JAPA 2J4FA 1JZSA 1N2IA 3N3BC 4J1TC 5CNIA 4AVYA 5KYTA 2AJCA 5H02A 2H7VA 1KY5A 1L7AA 3KLOA 1H6AA 2PWYA 1MW9X 4M53A 1UOPA 3IODA 2QRVB 4D99A 2FZKA 3Q7TA 3RYTC 4EDFA 5FYDA 3GVCA 2QA5A 2RH8A 3HCFA 4IHAA 4NYMQ 2Q41A 3HH8A 5J1SB 3EAFA 4HAXA 1HYQA 4PBRA 4U3JB 2E6UX 2PKYX 1OGYA 1IULA 3WP0A 2QQEA 2G71A 3FLEA 3LPAA 2B1JA 1E1RA 1X1SA 2AKAB 2GUWA 3GUUA 1BU5A 3IP8A 4G0XA 4IFIA 5IT0A 4AAYA 1EFDN 1AM4D 1UXJA 5CX1A 1NQOA 4FQ7A 3NT2A 5JSKA 1XJ0A 2B36A 3DLTA 2X9GA 3N8DA 4FJ2A 2BDEA 2WHQA 3I09A 4UEWA 5LIRA 2W71A 3JD0A 1AMUA 4ZJZA 1PR6A 3KOXA 2GEFA 1ZXLA 4LRUA 3T5CA 2XHEA 4D5GA 3CHYA 4JKYA 1V8BA 2O3QA 2SHKA 3JTMA 1SZPA 4YGXB 1UKEA 4LJSA 5EEGA 4L5AA 1M8GA 5K6AA 1Z28A 3H5WA 3UWMA 5KJ1A 2I8AA 5MN6A 4JU8A 4BV3A 1MUUA 2Y92A 1ACLA 2WIFA 4YRBA 2Q5LA 1JALA 5FT9A 1TYAE 4ZVLA 5J40A 2OFFA 4BP1A 1VG0B 2VCEA 3OJEA 1VKHA 1WZ2A 3SF8A 2XTAA 1G20E 2PJUA 5JO0A 3KALA 3SVLA 3W5CA 1E6MA 2IEDA 2EV9A 3H9EO 1EK2A 5H1YA 3W5IA 2OV8A 1JL3A 1U3UA 1WDTA 2VKTA 4KPUA 2HSGA 3WK7A 4Y1EA 1D7OA 1E4EA 2EJBA 3AJAA 3DDZX 1CUXA 1MX9A 3ETDA 1I4LD 3EFOA 4JVLA 4RVSA 3TX6A 2PL9A 2ERYA 4CM1A 1LBIA 1VCNA 1P2FA 4ZHSA 2ZREA 1ZW6A 4MTLA 4HFRA 1FNBA 5LNK1 1GZ6A 3I2FA 1W87A 2GSDA 4EA8A 5G0VA 2J07A 3OAAD 4MP3A 2BUBA 1JKIA 1L7EA 1SMKA 1WU8A 4BXOA 2X3FA 1C8LA 3C3DA 1O7JA 3N0WA 4RPGA 2HPAA 4MRMB 3RUIA 4EBFA 3QU2A 3OE5A 2ZE8A 5CGZA 4J4BA 2VUUA 1E7RA 3BXEA 1H66A 2FWPA 2P9ZA 1W5TA 4X7MA 3HKDB 4O5AA 5HEKA 3SLRA 5C8DA 2YYSA 3I12A 4QPNA 1U8XX 2G5TA 1NYQA 3MRVA 1SBYA 2R84A 1GPUA 4RGYA 4U3JA 4F4FA 3W78A 1IJFA 3DQPA 3EG5A 3SDZA 2C1ZA 4L74A 5K05A 1H2EA 2RG7A 2PXAA 2XVZA 2RONA 3DFMA 4QT0A 3RUPA 3U0VA 5JYCA 1DIAA 2KI5A 1SCJA 4CLEA 1P77A 1NJ1A 3L2OB 1OXXK 3AM5A 3E9QA 1U3DA 2HSJA 2GK6A 3E3AA 3GLSA 3MFYA 2C82A 4CTJA 4WOJA 3D8SA 1K27A 3AILA 4G5GA 4EABA 3DYVA 1X80A 3FFXA 1U3TA 5K3SA 2PX8A 3C8ZA 1HRDA 2J9ZB 2YQ4A 5AVRA 4WEOA 5EVCA 3QOWA 2WIAA 2P68A 1NWCA 1Z4OA 2BTQA 3CX8A 2GOYA 2INGX 3EIQA 3IQZA 1JLSA 4MR9B 1RIIA 2K2QB 5IT9A 2B7CA 5E9WA 5JZMA 1HYHA 2D2XA 2Q2NA 3GGSA 4UNNA 4UVIA 3WB0A 4MS4A 1LSSA 1P7YA 2OM2A 2PLRA 1E0KA 3PHHA 3OBIA 3NEYA 1XKTA 2DB3A 2DE0X 2HH9A 3ROQA 3VRHA 3FCAA 3MRXA 4BB5A 2FR1A 4IGFA 1JIQA 2XB6A 3PPWA 4J03A 2PHZA 3DMGA 4MNTA 5A4MS 5HIKA 3UBTA 1QYIA 1YR2A 3EZGA 4HB2A 4HDOB 2BKUA 3JQFA 1QTIA 3TZ6A 1CY8A 1Z7WA 5JASA 1NP7A 2A67A 3EIHA 1XNHA 3U81A 2CBXA 4PHCA 4AWBA 5GAJA 2H06A 4K7JA 4MO2A 4JZYA 3UWPA 1UKYA 3IH5A 3H9UA 3IOEA 4B6OA 4OJMX 1MABA 1E2GA 1U8UA 4YRZA 1G5HA 3RSFA 3K0HA 1L5HB 2EKBA 2GD0A 3NTOA 2DQSA 1U0TA 5ITSA 1CJUC 3Q0IA 4GL4A 2OENG 4YUYA 1JIIA 2B6HA 4GI7A 4K1XA 1AQYA 4P08A 1QQAA 4E2WA 1GPWB 3HQ4O 2VJCA 3UAYA 3RVBA 5AQ1A 2L2QA 3K94A 4YUWA 2AFVA 3L7OA 3M83A 4P4NA 1K8RA 3K9BA 4XTCS 4EAQA 5JVDF 4UAJA 3WIVA 4L5CA 3FTPA 1FB5A 1QZ3A 4W5HA 2FPKA 2C29D 3OZFA 4F6CA 1S2GA 2QUIA 1V11B 3EVBA 4Q3KA 4Q16A 2QZZA 5U4XA 1IXZA 4OY3A 3HSKA 3VZSA 2HU7A 3OJ0A 5FA8A 1IOLA 3VJMA 3WBJA 4G37A 4X6LA 3A70A 5DDIP 3PQ2A 3DLBA 3K1YA 1RWOA 1MB9A 3CNLA 4GRDA 1Y5IA 4L50A 4EJSA 4PLFA 2PSDA 4ZZ3A 3P9ZA 4ZXPA 4KXXA 1Q0RA 4OK6A 3RIMA 4QEZA 1PFWA 2CWDA 5ALKA 2WQ6A 3FAKA 3SGLA 2R60A 2G25A 3OY7A 3ZWDA 5J5CA 3SICE 2EKLA 1LQ2A 3PJRA 3H0KA 4ZRMA 4YA6A 3STVA 2YMPA 1Y6RA 1Y8RA 3H1TA 4ONEA 5AR1A 4FIDA 2G04A 5C52B 2JGDA 1Z6AA 5FD8A 3RRYA 4CIXA 3RYCB 4F56A 4QUIA 3KE9A 3DV0B 1GU0A 2EP7A 4F4HA 4P80A 4G1UC 3N2EA 1BFKA 3EUFA 1YBHA 2ODPA 3AEQA 4LDAA 2CVQA 2NO0A 3A37A 1FXUA 2R5FA 4CLDA 1L5WA 1RRMA 5GONF 1U4NA 4TMTA 1K9VF 1WA5A 3P20A 3FM9A 4H7FA 1CX9B 3T7SA 2JFFA 1KP9A 1G2QA 2JIQA 3CC8A 4HY3A 4JXKA 4PR3A 1OAAA 2PR7A 1XRNA 3KTAA 2YN4A 2ZYUX 3EMKA 2QQ0A 5C8ZA 3UPUA 3UH1A 4AMZA 2G70A 1CP3A 1LRKA 2C2GA 1ML4A 2ZLBA 4Q9HA 4AKHA 1J33A 2A9OA 3CU5A 4M9CA 1KSHA 4IX9A 2HGZA 1UIRA 1X8XA 2D13A 1W2HA 2E4WA 3PI7A 1XDUA 5IFLA 3TKAA 5DGTA 1OPXA 4KH1A 2QN2A 4EYSA 5EIEA 5KQPA 2NYRA 3EGCA 5HRAA 4JBYA 1HEUA 4LWPA 2JGNA 3HVIA 1T8PA 3WA6A 4C01A 4FGSA 1VYHA 3DSRA 3SYKA 4BZZA 3FBWA 2VA8A 2D8AA 1JHOA 3FNIA 2EC5A 3N2KA 4FFVA 5E2BA 2RAUA 2P7IA 3G7UA 2ZJZA 3H1AA 5LXTB 3DD5A 2NMVA 3KWJA 3P0HA 5JZVA 2EFJA 2B61A 3Q9NA 1WUKS 3LRXA 3ABRB 5C7YA 4UM9D 3UYKA 1I3LA 4DUYB 3A3YA 1L4GA 1H6DA 3HUTA 3KSBC 1A1SA 3ESXA 3GRYA 3DJFA 2JBHA 4K05A 4G86A 3W2GA 3ZTWA 2AXPA 2JCBA 1KVUA 1MGOA 2VTBB 4FHCA 4HSEA 1U0RA 1R64A 2C54A 5HK8A 3UK1A 1D03A 4OTZA 4CM8B 5CA1F 3LQ1A 1T3LA 4QJIA 1P1CA 3AONB 5M7EA 4GKJB 2QZSA 4JGBA 5D1NA 3DHEA 5HF5A 5B3LA 4UTOA 3SC4A 4BNHA 2Z2IA 4EY5A 3NGLA 7MHTA 2REBA 1T2UA 3JVUA 2WVGA 4UMDA 5FOWA 2JGJA 5J5VA 2DULA 3TOXA 3H1EA 1VMDA 3EIXA 1FSZA 4RZ2A 1XTKA 4EVQA 2HR1A 3WLEA 1W4RA 1X14A 3Q87B 4MS1A 3U1TA 1MOSA 2R8RA 1E2UA 3GJ5A 1KARA 2ATXA 1YGYA 2HMWA 2XE4A 4Q19A 5EXDA 3S2SA 1TYEB 3CJQA 1O97D 1WW2A 3BAZA 3G2LA 3ZXYA 4FQ8A 5HOQA 3ZE6A 1U0LA 4M8NE 2VF2A 1JJAA 4I3GA 1FYVA 1KI6B 3JARA 2ZBGA 2BGTA 1SK8A 1V25A 2H1CA 4E5KA 4G0WA 2ODBA 4NMWA 4XUDA 3U7IA 3UEOA 2O2JA 5CDUA 3BYZA 5D85A 4KC0A 1FXWA 2NP7A 4N0QA 4TTQA 3W9UA 2Q4DA 1I8TA 3K1JA 3I64A 1XZAA 3LIPA 4HX5A 4QWMA 2VS1A 5AKKA 2VQFB 2ZJOA 1C4XA 4MWSA 5HFAA 2XBMA 1KVSA 4G4IA 1W5BA 3HJBA 1CIPA 4ESEA 1DMRA 5J4VA 5LOVF 3EZ7A 1P74A 5KVQA 1ZUHA 1XJQA 2RAFA 5CDYA 5G0WA 3IMFA 4JVMA 1A9XB 1W4LA 3LKBA 2ZSFA 3CM0A 4I9HA 4PZAA 5TJ9A 4AO8A 1YMQA 4HD8A 3DLAA 5BQFA 3FKSA 3LKZA 4C5AA 3JW8A 1XZCA 4DB2A 2ECQA 2CVZA 4MV3A 4WK0B 2A5JA 1QYWA 4IVPA 4MQEA 3LK6A 3Q3VA 2FWAA 4LJAA 5EQTA 2WSIA 3WJAA 3VZRA 4JY7A 2QRUA 1MVNA 4Z4IA 1TA0A 1CU1A 2H29A 2DFVA 1U1EA 3N2NA 4HPXB 1BAPA 1SKAA 1TUGA 5TQ2B 4CLRB 4PYJA 1XAGA 5E8RA 3DS8A 2CHUA 4P54A 5J2UF 1YI0A 4FE7A 3ZJTA 2HK6A 2J3MA 3WI7A 2AUNA 2R4QA 4BDSA 2F1KA 4OJTA 1ESZA 1G20A 1E1RD 1WHTB 1M8KA 2I3DA 2XTNA 3L7LA 3OJWA 3OX1A 1UWLA 2NYVA 4KO4S 4YP9A 5A7HA 1J39A 1VJRA 3TTYA 3RLFA 2C9ZA 3LLCA 4BNWA 4QUEA 1E6KA 2OXCA 1VHTA 2H85A 2R47A 4JFRA 3NBKA 2C5GA 4MTCA 4TLEA 3T8YA 3DE5X 3R9KA 5KWJA 4IL5A 4RCVA 1HV8A 3WKDA 4B6SA 5BN5A 5K4AA 1YDGA 3MB5A 2QTCA 3MJSA 1NR7A 2VT7A 2XA1A 3RU3A 3D9QX 1M74A 4IM7A 3V1KA 4EZBA 5IU6A 3LWZA 1IFXA 3AEKA 5BYKA 1WBBA 1P9NA 1S2NA 2C2OA 3CINA 3G89A 1UFRA 3PVSA 1PR5A 4RDCA 2OOSA 3MD0A 1TEVA 3V8MA 1UPXA 3IIMA 2YCLA 3K0SA 4K9KA 1PLLA 2IYSA 2ZRFA 4MA4A 4FDLA 3PXBA 2OD9A 1OAOC 4MV4A 4CM7A 4YCDA 1L7RA 1XHFA 3ZW8A 1DWPA 2PTHA 5HDQA 1M1XB 4BFUA 3CLRC 5A7FA 4F4UA 2QRMA 2C98A 2E4ZA 3DYIA 4I6GA 3T7AA 3RSZA 2GCOB 3OLQA 4YMSA 4YEDA 1V7PC 3QXHA 3G5AA 4GKAA 1EGQA 4RMGA 3AM3A 3I37X 1R0XA 2DH5A 2HB6A 1FDTA 2GPAA 1M5RA 2F17A 4H6WA 4HH0A 2H2DA 2CYAA 3GPBA 1MH1A 4ND3A 5I8ZA 3VJLA 1QXSA 4AN4A 2W4IA 2BDUA 1I9GA 4C04A 3BXZA 1XLVA 1JHAA 3C41J 5IZCA 3MCWA 3H42B 3A32A 3I52A 1SAYA 2JLSA 1PKEA 2ZTSA 4RXUA 1FMJA 2R7AA 4LMBA 4IJ6A 4MS3B 3CSSA 5IBQA 4Q37A 2ZANA 1AA9A 1FFBA 3NUGA 1DKPA 2QX7A 5F78A 4B4OA 4ZYVA 5JYDA 2JNWA 7YASA 2MYUA 4D56A 1SBNE 1WDKA 4HNAB 3BICA 4M1SA 4ZCIA 4IDAA 1VMAA 4YRJA 4X3CA 5FI5A 2W6CX 3ZQ6A 2WQZA 2H1OA 3W5SA 4ZHQA 5KB3A 2VZLA 1HKHA 5CYFA 3IVMA 1DRWA 2BP7B 2Y27A 1K3FA 4F1KA 1PZFA 2MJLA 2WLTA 3NU1A 2FPOA 3MWYW 5JR3A 1E2MA 3KXLA 3AFIA 4R1NA 4AQ7A 3U4MA 1Z4IA 4CR6A 1C4OA 2V7WA 1ODLA 2JFQA 4TWZA 2P9TA 3JD4A 3QKRA 2G1JA 2IHZA 4ZZIA 2AN1A 5ICFA 4HRXA 1OBVA 1FDOA 3MJVA 5EP4A 5EJ6A 1UXIA 5HKBA 5I8PA 1TLFA 2FGKA 3O4VA 4JCCA 1V5IA 3L18A 5DSZA 1CVRA 5T4HA 1LVHA 3G8AA 3MRTA 1NOKA 3VH2A 1II0A 3KQNA 2B1QA 3VPFA 3SXPA 1SHKA 4ARIA 3MZ0A 2NZWA 3EZ9A 3MGAA 4PLWA 5EQDA 3TL3A 4B5LA 3WAGA 2QVLA 5T3YA 3R40A 1K08A 4RGBA 5K03A 2J3JA 2AW5A 1AK1A 3NP7A 4YUAA 1LNSA 4HDMA 3E05A 4CYMA 5C18A 2CL5A 5DRTA 3U6BA 1KDZA 4OMCA 4YROA 5EMMA 1XELA 2FPIB 1IWOA 4H35A 4J7UA 1SWWA 4CTOA 1ORIA 3L1UA 1EFUA 3BGDA 3L43A 3QLEA 4EO9A 1P45A 2V7QD 1GSOA 4RK7A 3X1WA 1V47A 4LV5B 4HEJA 4RK4A 1L7XA 5AOCA 4J0JA 1Z18A 1JG4A 3PNPA 4DBLC 4DTIA 2Y9MB 2O19A 3MMPA 4NG4A 3KKQA 1P5FA 1P1IA 4XQCA 3WG9A 4PZEA 2PUVA 1VGRA 4IGKA 4V38A 4C7MA 5IKEA 4RTQA 2RCYA 4DQ0A 1JFTA 3VYVA 4DLVA 3HZRA 3AY3A 3MOGA 1O54A 4HATA 1EK6A 5FCDA 4G4SO 5CK4A 2NZ2A 3G0IA 4GYKA 2A1UA 1BW9A 4RDIA 3AL0C 1NXTA 1YU6A 3O94A 3PUXA 1KI3A 2OZKA 4R3NA 2WWRA 1C9NA 3K70C 2R1TB 2QZ9A 2XCUA 1BDBA 2MMGA 3SQOA 3WV5A 4K6FA 4DE5A 5HR5A 2AMFA 3WISA 5AVUA 4OHOA 5CNJA 2D6FA 1KZ4A 1J20A 1TECE 5CW2A 1IEXA 5KJCA 3QFSA 2K6GA 3CRNA 2XDYA 4KIUA 5K99A 5DYGA 4IGIA 5I7HA 1W2WB 3F1KA 3MLAA 1GL7A 3MS4A 2VTVA 3PSAA 3WLMA 2F1HA 3UOGA 2RHWA 3FCOA 5AM5A 2KB0A 3ZCRA 3UYLA 2ECKA 2COKA 4HDQB 3SFVA 4EKDA 1GNSA 4YP0A 1XD2A 2X7HA 4PYRA 2PQ2A 3ZCTA 2I62A 4TTSA 3D8TA 2JCSA 2Q99A 4L72A 2IUYA 1SD2A 2WILA 3V00A 1Q7EA 2ZJ5A 5BWCA 1Z2CA 5FBRB 1XPJA 2JI8A 4HAIA 5D84A 2YVQA 3OMWA 1NZJA 3VDMA 5IYZB 4HMQA 4OXNA 1CDOA 4NCJA 2JLQA 2VAMA 2C2ZA 3ONDA 1J0CA 1IK6A 1VJDA 1A04A 1G9XA 4MPPA 2PX0A 4X5OA 3G0CA 2DP4E 3T1VA 3K05A 1ZOIA 2F1RA 2QR2A 5ALWA 3BX1A 4B43A 4M37A 5DYNA 4CQMA 3BSFA 4IGAA 1GGVA 4PLVA 4YHBA 1LFAA 1ZK3A 1ESCA 3UV3A 1XTQA 3F5MA 4QWWA 2X7XA 2ZWIA 1P1KA 2EW1A 1L5YA 3KLNA 4JODA 3HVJA 2RC5A 4F5DA 1RWKA 3LLUA 2IQ5A 3KHTA 1YZVA 2QTFA 1L4NA 2PWBA 1E2QA 3R3SA 4DCPA 3BFVA 1V45E 2EZTA 4CKBB 5FTLA 2QYTA 4UHFA 5JS2A 1WXXA 5KX5F 3OESA 4WE3A 1U99A 3M5PA 2M9MA 5CEJA 4H7IA 1I0IA 1B2RA 5HFJA 3H04A 1KQOA 2BHTA 3EXFA 4GKVA 4H7KA 1KBZA 5ALOA 1O5OA 2IEYA 1S1MA 2W00A 1GKIA 1SVIA 4HJXA 1E89A 1NN1A 4E5NA 5HQTA 1B26A 1M8PA 2H5EA 3JTEA 2V3CC 3K0AB 4CGZA 1VIMA 2TYSB 2IY7A 2OMEA 3TTXA 1G4AE 4QOSA 1BXGB 4LXHA 3GJ8A 4YRNA 5ITWA 4Z49A 3OWOA 4PLTA 1JLLA 2XB8A 3TLBA 4B6PA 4OHYA 3OVMA 4HEA6 4GX0A 4R8RA 1XL1A 4RQBA 2X0DA 4AZ0B 4CM6A 3WDMA 1GPAA 1YZKA 4KQKA 4RS4A 1E79A 2TRSB 3G17A 4MWOA 3LBIA 5HZMA 2D3TA 2GCNA 1Q0TA 1PGPA 2AFRA 2C8KA 5HJ7A 4RJIA 2HLPA 4M46A 5DTIA 5FPQA 4LDPA 1VPLA 1TNDA 3DUWA 2YV3A 3ER6A 3FWZA 3HUEA 4L9SA 4QOJA 3REOA 1CW2B 1R6BX 2DHRA 3ZWMA 5BR4A 1U2TA 4K9QA 3WIEA 5CXQA 5JWRA 4X90A 1EU1A 2FW7A 3ZU4A 1QJCA 1WZNA 3HVRA 1B73A 5AJZA 2YZGA 3ZX4A 7REQB 4YVFA 4F92B 1YXMA 1XCJA 2DR0A 4G5XA 4E3WA 2J31A 2CE7A 2NTEA 4TWRA 2BD0A 4YJGA 4J91A 4FOTA 2CKDA 4FHDA 3GROA 3NJ4A 1A9RA 1H8ED 2FHPA 3UMVA 2GI4A 3E8SA 1RM0A 4JJAA 4BGDA 1Z16A 2H1WA 1YB6A 4PC7A 4J94A 3OM0A 4U2EA 5I9BA 4R7ZA 1WU7A 2GN6A 1PG2A 2Q5EA 3LHFA 1PEKE 1RWMA 3ETGA 2QWXA 3QBTA 4XQGA 5AQEA 3TEMA 3HXOA 3S2IA 3A25A 3QEKA 3Q1KA 4PCVA 2ADFA 5EG5A 4OA8A 2YIJA 3B52X 4J8PA 4XX0B 2H07A 4C6TB 5BMVA 5BN4B 5K8IA 1QHHA 3AF0A 3AJEA 4OQFA 4CT4B 1VLJA 2BFFA 2BEUA 4U6NA 2DBZA 5CBKA 1QB8A 1Z37A 3P27A 3IIIA 2XMGA 5CDSA 5J58A 1LF0A 3LCUA 3HR4A 1CIJA 4YI5A 4CKCB 1W1IA 3N76A 5EZ6B 5EL0A 4ZWNA 3VO2A 3VX3A 4GS5A 4ETNA 4CDNA 6REQB 3G02A 5F4BA 5JZOA 3WYGA 2O2IA 1VKZA 3OUTA 1KS2A 2XGGA 4NU6A 5CG1A 3QELA 2ZRPA 3GA5A 3Q3GE 5T5QA 5I9IA 2JHAA 1X7XA 5CEEA 1FFDA 3CSDA 1JT2A 4UTPA 5BV8A 3A3PA 1OFUX 4QBIA 2IIVA 2Y1LA 3F5DA 3JQRA 2JIDA 4KDEA 4RY2A 4B4UA 4DHWA 5KQLA 4EEKA 1IY9A 1KKLA 3NBXX 1TL7C 2FW1A 2PLNA 1KWGA 2ZYAA 3KKZA 1ADFA 3OPVA 1T5SA 4G09A 3GZNB 4WVLA 5CJJA 3RW9A 2AF3C 4MIYA 1UEXC 4UU7A 1QAMA 2WTNA 5JAQA 5A0TA 1Q1EA 3QEJA 4WXRA 4AS2A 3OA2A 1KRXA 1HGXA 2OORA 1EVYA 3DO5A 2AXEA 4JB2A 1Q14A 5BORA 1X7YA 4ZOLB 4WNIA 2GXUA 1B93A 1HDYA 3TQCA 1KZHA 1PI3A 5EFZA 3RODA 4RORA 2QUHA 2WM2A 3NOXA 3L6RA 4BWFB 3RYIB 3B1YA 3WGKA 1RLTA 4U7WA 2JF0A 2GZHA 2MINA 1KQ3A 3H9CA 2J08A 4BZPA 3RADC 4ZYWA 1CEYA 2AMYA 1BX1A 2AHRA 4EUNA 1R8QA 2J0UB 3QNMA 5HZHA 2H9YA 4LCBA 1ZD8A 3BORA 4NC9A 1SOWA 3R0IA 5GOTA 3M6XA 1EVIA 2ZK7A 1ZD4A 3KRTA 4MUNA 4P3PA 4M1WA 4NS4A 3EMVA 3NKFA 2ZI6A 4GPD1 4UZSA 5L9AA 4C6RA 4H7DA 4X1IA 2PV0A 5EHQA 5G0UA 4MW9A 3RYHB 3G49A 4I1RA 3Q6NA 2ZJ4A 3VU9B 3OCVA 4CNQA 2OILA 4B81A 3EIEA 3CNEA 1D9XA 1J8QA 3LI2A 2ZYWX 1IXKA 1QG4A 2NZUG 1YI1A 3VZCA 4RXMA 1NSYA 3I9JA 2GTPA 2A5YB 4IZOA 4Y2QA 2TSYB 1GM5A 1OT3A 4AP5A 4YCLA 2BI4A 5A1JA 1L4BA 4QU9A 5FHQA 1BDHA 2XD4A 1SN7A 3BA1A 2C42A 3LUBA 5AUNB 3QY9A 3OM9A 5E6SB 1N36B 1LZKA 2XKKA 2ASEA 2PYDA 4LHYA 1QHNA 4YCAA 4Z2YA 5TQJA 3NV9A 3HYTA 3BSWA 1NAIA 2C2XA 2ZVQX 3MBOA 3OO0A 5CLLA 3WRYC 3P2JA 4M60A 5JSZB 4WZ6A 1T8SA 5DV9A 4MW0A 3ZD6A 2O1WA 3WFIA 5CR9A 4FYIA 1CXZA 2E7ZA 4WBNB 1E3SA 4QASA 1WJGA 1FTQA 3LIIA 3EPJA 2Y66A 2ZVDA 4FMBB 2XTMA 2ZIVB 5TS3A 1XYVA 5FBLB 1XHEA 3D31A 2ATVA 3B1WA 3Q7RA 2GPJA 1P7PA 2YQ5A 5D3ZA 2FZGA 2QGZA 1ZN8A 1H42A 1A2QA 2VTDA 3RIEA 4ENRA 1X19A 3GH3A 1SXPA 3T12A 1B8NA 3CF4G 1SUBA 2GJ8A 2C97A 2I7TA 1L7DA 2OY0A 1UPAA 3MT9A 3V2GA 1Z63A 5BSUA 4M1ZA 5EHNA 3QXCA 4D3ZA 1KVTA 4KXYA 2OVFA 1QF7A 2V6BA 4LHVA 4AMVA 5CFMA 4BO3A 1P9OA 1ZKMA 3G85A 5FTNA 5LWQA 4LAFA 2I6TA 3BK7A 4TTRA 1MJGM 3LX4A 4WXPA 4FS3A 4RETA 4MX8A 4ZAWA 3LFUA 4KWHA 1JHZA 2O8EB 3CFYA 4RH0A 3I58A 5SYAA 1Z88A 2PGDA 4I1OA 4TRMA 5EWJB 4D98A 1AQNA 2J30A 4Y6OA 1EJ2A 5IBPA 3BSSA 3CONA 3A1EA 2R3SA 5LMZA 2V58A 3A7EA 3FD8A 3ISTA 1DEXA 2AX4A 4RHCA 3U61B 4C30A 4ZIRB 3IQGX 4DSAA 4CZ2A 1AJEA 2ZBRA 1L7MA 1S4QA 2A88A 3RUHA 4WMLA 5KTMA 2YYZA 3T3OA 5AKEA 1DKLA 1I4TD 1LH0A 1GGFA 1I3CA 1P0CA 2HV8A 2VPTA 1C9EA 3KM0A 1TQ4A 1W49A 4EY3A 3KOMA 3TLJA 4ZYZA 3E18A 3KBOA 2HUPA 2P8JA 4D45A 4IIXA 3VYWA 4G0OA 4R3WA 5I48A 1SC1A 1A8HA 4E6EA 2XAAA 7MDHA 1ZM4A 3V7NA 5H83A 1IEVA 5C5DA 1V1RA 5K4GA 1B7GO 1E5TA 3COJA 2PJRA 2A0KA 3KO8A 2Q5OA 1EWQA 1BEUB 2P9BA 4ER0A 4R54A 4UZEA 1V6SA 4YT4A 1ZGHA 3PF8A 3FFTA 4DMFA 2REOA 3UAXA 1VBKA 4OG2A 9LDTA 2IX3A 3VNAA 2BGWA 1NN0A 4EQZA 1QIGA 1XVIA 1OXTA 3HO6A 5DYWA 1QLHA 1FMFA 1DTWA 4YMWA 1M1ZA 4QFDA 3W7VA 1D2RA 2J3EA 1WKBA 4HDSA 2QVXX 1ZOPA 4F7WA 4X6YA 1MRSA 3M89A 3LFHA 2QROA 5DX0A 2VH1A 5H4GA 1F38A 3GQBB 4HFJA 3Q9SA 3TW6A 3TYXA 1T6YA 2FVXA 4F21A 4YRGA 4CTNA 2AR0A 3GT0A 3MF4A 4UAUA 3H11A 3I4LA 1J00A 5TIIA 1YQQA 2XQFA 4ITRC 5JMPA 1RAGA 3H97A 3D2AA 1CR1A 4QGAA 4AUKA 4QQRA 1OH5A 1P5ZB 3CTMA 2ZZMA 1DLIA 1WDWB 2IPAB 2DUJA 3K1ZA 1N9ZA 2PAAA 3G2PA 1QWOA 1B23P 4DIMA 3FNEA 4WJLA 5CVEA 3GZJA 4IV0A 3SE7A 4C0AC 4LE2A 4LX0A 3E5NA 1DE0A 1KKUA 3OWXA 4Q3NA 1S2LA 5FPHA 1MNQA 4KQHA 4N9WA 5EZYA 1Z8DA 3I9NA 4RMIA 4W5OA 3HACA 1YCHA 1K6IA 4NAHA 4AJJA 5DN9A 1E1QA 2GEBA 4U2FA 2QYHA 1HRKA 5JHGB 4G84A 1L4FA 4KZKA 2V0CA 4LYDA 3RV4A 4LE0A 1NOIA 1K6XA 4NYJR 4LW8A 2HGSA 1GQOA 4B32A 2I5PO 2YX1A 1PG0A 3DAPA 2XMCA 3BTSA 4CQMD 2V65A 2C4WA 3QX7A 3HY3A 1IB6A 4AY3A 3A2NA 4RVUA 1PT9A 4PRZA 2DTEA 2I4OA 5DK6A 1M2NA 2WG1A 1JXAA 1BROA 2FSVC 3VR2A 3KQLA 4OB7A 1TT7A 1XO1A 3AR7A 4FOLA 3V5NA 1K3UB 1C7ZA 4LGVA 3PYMA 3LUPA 4V3BA 4ARSA 2W4MA 2AUTA 2OC9A 1DBIA 2ZYDA 3HB9A 4B1FA 5GJCA 2KX7A 1P91A 1RNLA 3Q72A 4Y67A 4PEVA 2QRZA 4BMVA 3PHBE 1T9CA 1A4UA 2WF5A 1Z2DA 4TLMB 5FNVA 1YQUA 3TAXA 5JRZA 3PFWO 3ZHYA 4BNNA 2WV7A 2YFKA 3C7AA 4N8EA 2V9CA 3G5MA 3K4QA 2E9SA 4BKPA 2G8LA 2YXPX 3GJ4A 3I72A 4BPRA 5LN1A 1QYVA 3HB1A 4MGZR 5B3KA 1WNTA 4PX2A 3T7RA 3Q1LA 1HZZA 3FHJA 4Y6RA 5BSGA 1S2OA 3UJ6A 3G5TA 1DO8A 2QR3A 2QJWA 3HYNA 4EGFA 1BJRE 3I6IA 1E79D 1UC9A 4KB5A 1WZUA 3P4YA 4Y98A 4DW8A 2F55A 1C1XA 5THKA 1XGKA 4W9NA 4J1SA 4OXQA 3EGVA 4JCOA 2P7HA 3TZBA 1RZRA 3IQWA 3JQBC 2O57A 2B5VA 4EK9A 1SH7A 1XD9A 4YLEA 3NC1C 1BHJA 3EGDB 5AI8A 2EIHA 2JIOA 3R1IA 3FR8A 4FFBB 4K9SA 5KREA 2PLAA 2G08A 1I3NA 4DIOA 2UVQA 5D86A 3UMCA 1ES9A 5CB4B 1XDGA 1ISIA 1XZNA 2BR5A 2VSNA 4D6YA 3JWHA 5U1PA 721PA 2ESRA 5LYYA 2PS0A 1EE9A 3SXJA 1O2DA 1ULBA 3QYPA 1GZ4A 1WP9A 4HLQB 3SJAA 5GINE 3NIDB 4CCWA 2VHXA 1I1NA 3B2QA 1GIAA 4UE6A 3ZN2A 5C8VA 3HJFA 3JYPA 2ORVA 3ZWYA 3KEQA 4CG1A 4GP7A 1M34E 2JL1A 3OZ7A 1QH1A 2GEJA 3FLAA 1R0CA 5FWYB 1ZM2A 2B1RA 3IAHA 3QNWA 5AJXA 3R3VA 4YALA 2FHSA 1KS9A 2D5IA 3UHPA 4O29A 4EEZA 3SEFA 2H2GA 2V7TA 1Q1QA 1CZRA 4MWBA 4AIRA 4YJ3B 2X42A 5ICEA 2ZSKA 1G0NA 3C6ZA 2GFIA 4IDHA 4C0QC 3R9WA 2QY6A 1QORA 4J0DA 4NPHA 2QT1A 2WAYA 3UT0A 3CTPA 2C5FA 2QSZA 2XF8A 2R1UA 5AVTA 3U26A 3DMTA 3P2IA 4TN5A 4JUIA 4ZYUA 1R0WA 2B8WA 1PR2A 2PCJA 1XF9A 3DAOA 3MCTA 2WJ3A 4IDGA 3VBCA 3BGOS 4HVCA 3K53A 4LRQA 2XNHA 2FMKA 4GO1A 4ILEA 4MW1A 4NYJQ 4BVFA 3K5WA 3RJZA 1JKMA 1AZLA 4JJZA 4AWXA 3HB0A 4RMNA 2O8CB 3BJEA 4QJBA 4BASA 2JH9A 3HI4A 1KQGA 1E6CA 2PJZA 4KYIB 1QU3A 4N41A 3LL7A 5DWVA 5CM2Z 4D26A 1YQWA 4LC0A 2OLEA 3LKVA 1TCAA 1L8OA 3KFXA 2CC2A 3KXDA 4LQLA 4D4KA 3NHZA 1TB4A 1QRUA 1MJ5A 4QM7A 1LPOA 3BA6A 1KAOA 3PQEA 3RWBA 1NOJA 1KMNA 4LK3A 3SIWA 3EGDA 3DOOA 1G3UA 4R5MA 1YFLA 2Q8NA 2I1VB 4X1YA 2ZRAA 5DXJA 3CLUD 4MKXA 2IUSA 4JUAA 3LWNA 2XOXA 4XFKA 3F2VA 1SELA 5HF6A 3C98A 3SKXA 1YRAA 1COZA 1J09A 4TMWA 1D09A 1FE8A 4JL8A 1KBOA 4ZV9A 3D6MA 4DM4A 3QSYA 1JPVA 4LFAB 4XB1A 2OK7A 4OQEA 4BEVA 2CNDA 4I9UA 4X97A 3P0IA 4L4ZA 3EGXA 3U17A 3MCUA 3IS3A 3I5XA 3F7NA 3ZX5A 2ECFA 2DH6A 5E0KB 1YVPA 1U9JA 4GECA 4G1VA 3T54A 3ZCVA 5JAPA 2QTBA 4K6KA 2FE1A 3W6OA 4D4LA 4DKXA 2YIDA 1Q6YA 3OQ6A 1H1LA 1XZHA 2FWRA 3BTOA 4FSHA 2B0CA 4TKUA 1EB8A 2RI1A 3C1UA 521PA 4YJ3A 3ZNOA 3LBHA 4YRAA 2JGLA 2J9YB 5LB2A 2JLZA 3E7FA 1ISFA 3CLVA 3OQMA 2Q2WA 2X0KA 2W2MA 4KXNA 1NDHA 3HUFA 4Y2HA 5IH3A 1GTJ1 1U9CA 4KRYA 2WUVA 4QTZA 4GOLD 3WNBA 3WLRA 4Q82A 3U37A 3LT1A 1NVMB 1Z5PA 1ONSA 2CXHA 5JH7F 1O3YA 3K8ZA 3RABA 2WFLB 1VL2A 3E53A 2HREA 1XCGB 4F06A 3BF7A 5A6VA 3JU3A 5BQPA 4YXWA 4C4OA 4O4IF 2CXSA 4F97A 2C20A 4JAVC 4O4HA 1CSEE 5IHPA 5JI2E 3RM3A 1CQPA 2P0AA 5FAKA 1GDDA 1GG5A 3ZGNA 5JIBA 5L4NA 4HVLA 3DVSX 2YWHA 1QUEA 2D3WA 3U56A 2J1LA 2OWEA 1Z5NA 4EHKA 3QW2A 1BX3A 2CB9A 4OYHA 1U7UA 5HHTA 3K3PA 2QN8A 4UDXX 3RBVA 3RS9A 1OH8A 1T2NA 2O20A 2QTWB 1DC8A 3L6UA 2IDZA 2J9GA 4EZIA 3AIIA 1MEOA 1P18A 3LT0A 3PC3A 3PC6A 5EXEA 4FMCF 3QG5A 1VCHA 1CUGA 2JC3A 3GGPA 2I66A 4OQLA 1G5FA 2B8EA 5F7ZA 5TMEA 3IJRA 4C08A 4ZVNA 4G07A 3UJ8A 3DE7X 1C0PA 1SOVA 1VA5A 1D04A 3EN0A 3NQ41 4CLOA 2PT5A 2YJGA 3FKQA 3AXTA 1TC2A 5EPUA 3FPFA 5JFOA 1JHVA 2QN1A 3V4RA 3AH8A 4XWTA 5FWXA 4MH0R 3CRRA 4P3NA 4G0ZA 1J25A 5TPWB 1D5WA 3I2KA 3BH6A 3I32A 4HAZA 3IOBA 4K6MA 1KDRA 2WZQA 2H9AA 4P9NA 3TLGB 4CMEC 5HWSA 2CXPA 3ZWBA 2IPOA 3GGCA 4KQFA 4NCIA 1DOHA 1PHRA 1M6VA 1XEAA 1FDUA 3HJGA 5DHUA 4XYGA 3SR4A 2NTJA 1DINA 3NT5A 2AJ8A 3KQPA 1WO8A 2P91A 4RU1A 3TEJA 3Q8KA 4U7TB 1NMSA 1VJCA 2NAFA 2RB4A 4MZDA 1EUDA 3NHAA 5CT8A 4E51A 1T4BA 4LQDA 3QXSA 2OBBA 3ZHBA 2F6RA 4UVHA 3TPZA 5CYOA 1T5TA 1FU7A 1U1CA 1E8NA 4QUJA 5I9MA 2VDNB 4Y2PA 3U80A 3SZMA 1SZDA 3FDZA 3FSEA 4M8SA 1NLUA 4O3FA 1RU3A 3QLUA 5LDHA 2BGUA 4FFMA 4AJOA 5T67A 5JDCC 4EJMA 1Q77A 2NU7B 4F3TA 2ZIWB 1KU0A 4C20A 2OFXA 4H0NA 2ZUSA 1XJWA 3FMGA 2PUEA 2AYZA 5G4KA 5KHAA 1V5WA 2OO5A 2W2QA 3S44A 4DJEC 2CMGA 1X74A 1MF7A 1N8NA 1RAEA 4NFSA 4HUQA 2I8LA 4M1TA 1IBRA 3LLSA 3OKCA 1Z25A 1ZD3A 4TV9A 2VDKB 2ZM5A 4R1OA 3KZKA 5REQB 2F1JA 4DXHA 1EDZA 5C8YB 4MUBA 3NTUA 2RH4A 3F7TA 3RLIA 1UC8A 4JP3A 5EVJA 4BQQA 1SUPA 3AEZA 5K3CA 4XWWA 1NJFA 4L5BA 4ND8B 1XVVA 4G5HA 3QVTA 3GCXA 1IM8A 2PX3A 3U19A 2CVPA 5H3CA 1R15A 2HKIA 2VDWB 1G8HA 4FUQA 5EMKA 3K71B 1EXNA 1Z83A 2AG6A 4TT8A 1E3MA 4MYTA 3BE8A 3WLSA 3EXHA 5I4KA 4FT4A 3K6KA 4KCGA 5GM1A 2X5OA 3CG4A 3TB6A 1KAQA 2E49A 3AJRA 4XDZA 1IPFA 4B9EA 3HEBA 4KZPA 1JG7A 4D3SA 4JP8A 4CF5A 4FMDB 1MVOA 3T95A 3WJ2A 3UXHA 4DA6A 2PR2A 3P7MA 1M5TA 4J9UE 4YASA 1HG1A 2FMIA 3N58A 3MWDA 4LMAA 3DBIA 2B5OA 2Y0DA 2AOVA 2RGAA 4OPMA 5DPMA 1W75A 2IHVA 2XWSA 1C3EA 4GRAA 4I19A 5GV7A 1YB7A 4DR3B 2QAGB 2IELA 5DNDA 3A6HA 1VI5A 4UVGA 5BW5A 3DCIA 1P0QA 1E1QD 5E0OA 4NPAA 1SXHA 4KLCA 4YAEA 5JATA 2Q5IA 4LJ5A 1W35A 2CLKB 3ZV6A 1GEGA 3HGQA 4NH0A 1JMYA 3P5SA 4N7RA 1Y63A 4BCBA 5AVWA 3HABA 1R9JA 4RO0A 2GZ2A 2H31A 4LRXA 3O84A 3T9CA 3QEMB 5IT4A 3VZDA 2VBFA 3WLKX 1MC5A 2EL9A 4FDUA 5DNWA 4QOGA 1GG9A 2UYYA 3TD6A 4BFWA 4PBTA 1Z74A 2V1UA 1JPJA 3IBTA 3ETHA 4KQ1A 4MVJE 3VPGA 1T1GA 1GKYA 1CQXA 1L4EA 1UANA 4IHJA 4TLLB 4R1SA 3VR0A 2HX1A 3W1WA 2PV7A 4ND6A 4J16C 3VR2D 3L4JA 2XUIA 1L7BA 4FN4A 5ARDA 4KMSA 4DMHA 1FYWA 4F72A 1PCXA 2HLNA 3R5SA 2BW0A 1WWKA 3REQB 4WL0A 1RRVA 5B4TA 1NBMA 3H1BA 4J1TA 4QO7A 4XSHA 5C8YA 4PLHA 4DWWA 1MU0A 4B75A 3M3PA 4OMDA 4BO1A 2ORED 1Q15A 1A76A 1V9SA 2D1YA 2PBLA 3QKSB 1M2JA 3DW3X 4MYDA 3ZKWB 4BB0A 5E7QA 2P2CA 3IR6A 4HDRA 1UDRA 4LS3A 4OAOA 4W5JA 5C32A 1TUIA 3P4UA 1QP7A 4JI8B 3W3AH 5EOVA 3AUXA 2ZPTX 3MTAA 1VQ1A 4Q1BA 1IQUA 2NSHA 2R48A 4MW6A 4MV0A 4QTTB 4Z51A 2GLUA 5FWDA 4DC0A 1ZBDA 3RUEA 5F5NA 2B8NA 2IHJA 3X1JA 2RARA 1FVOA 1UBRS 4DDVA 1E9BA 3PIDA 2IOHA 3DLIA 4M0KA 3WWDA 1IM5A 3OTHA 4RZ3A 5ALFA 2JJ1A 3PX3A 3GAZA 3L1VA 4YN3A 4ZI7B 3S2YA 4LF7B 4Y0NA 2BONA 2WYIA 4CR8A 4RQUA 1RZRD 3L6OO 4KHPB 1UZAA 1DOAA 2PUJA 4UFOA 4XOUA 2O7VA 5HF9A 1VSQA 2HHLA 1W52X 2A0WA 3EF1A 4A10A 3ER9A 4WECA 3AG6A 4A82A 1DJOA 1W48A 1EWRA 1U9IA 4PS1A 3AVPA 1SPXA 3GFPA 3BULA 4GBED 4J1NA 4URFA 5IBRA 3Q40A 4IUCS 1ZGBA 3QOFA 1YUMA 2V97A 4WZAB 5ABPA 2EEZA 1H9AA 1DQNA 3I2JA 1R6TA 1GDTA 2SCUA 2ZJ6A 5FF9A 3IPAA 4IOMA 2DUUA 1JAHA 1M1YB 3O7WA 1U4OA 3SXUB 5L45A 5JWOA 3AXSA 2WYOA 2FPWA 4OGGA 3TMAA 1N0UA 2ZFUA 1Z0JA 3H99A 4DSNA 1X70A 4IIYA 2C61A 2D1TA 3RARA 4KXLA 4UCQA 4BQFA 3ZOKA 1KL7A 3TJMA 2CF6A 1UAGA 1Z5ZA 3G8CA 3FZEA 5T57A 3QSGA 2G9UA 3ZQUA 5AW8A 2C9CA 3RGGA 1CY2A 4RPCA 2CFRA 2WZDA 1JG3A 1SB9A 2AGVA 2ZRKA 8GPBA 3TAUA 3DH0A 1EDOA 3SHTA 3ADCA 3CF6R 1N3YA 1Q2XA 2HCTA 2YV1A 5EPOA 5KYYA 1KGDA 3SEQA 1ABBA 1S7GA 2ONCA 3YASA 4NZMA 5HZGA 3JR3A 1QTNA 3JWEA 1J07A 2IYWA 1ZCZA 1T2CA 4LDRA 2OBYA 2G28A 3HHPA 4IVNA 3AY7A 4FINA 3L5OA 4LVNA 4OB6A 1CT9A 4YBZA 3V7UA 4C78A 2JH8A 4AY2A 3VNVA 3P2KA 1VE6A 1E2BA 2PH7A 4QGFA 5CB0A 3LF1A 2L82A 3HY6A 3BRSA 2IS1A 1H05A 4N5LA 1XN1A 2OCAA 3G7SA 1GUAA 5FNVF 1FZTA 1AS3A 4RK1A 4B46A 3MJHA 3PUHA 2DBYA 2DFNA 2G36A 2DY0A 2IPMA 3CN9A 2Z2JA 3AL2A 2ZRBA 3D6NB 3IP6A 4TTTS 3W3AA 5LYJB 1W36C 5BV1A 2WQ7A 2EERA 5EP3A 1EGHA 5EMJA 4B8WA 5KTTA 2Q3JA 4PZZA 1C81A 4BN0A 3WNQA 1OHHA 1YFKA 2G83A 2YCBA 1BG6A 3G68A 5ESDA 1T2AA 1SU7A 2OT3B 3D3JA 1Q0QA 4RZIA 4DV0B 4AKSA 2FPGB 4FKMA 1NASA 4ENWA 1WULS 1BKYA 3L1KA 3N0XA 4R9NA 1RQ7A 3N9IA 4M9QA 1B6RA 1KEZA 4JUCA 3CVYA 1J23A 4Y8VA 4YMLA 1SC4A 3WYEA 3L9XA 3FDXA 1N2BA 4B80A 3JAMA 3OOSA 2UZ4A 3KDAA 5BNZA 4I1PA 2BGKA 2JFOA 3LGAA 3OSUA 1DWQA 3P0FA 1QUFA 5BOVA 4AI6A 1EXMA 1ZG3A 1RJWA 4NU5A 4UZFA 3FYUA 1BGVA 4P3OA 1H5NA 2EEPA 3RTBA 1MCZA 2XI4A 4G9BA 3WQBA 1WD7A 3LP5A 3WK5A 4E70A 1WV1A 3QPDA 4ZRNA 1H3FA 4BUZA 3V1NA 4FE3A 3WAJA 1G9TA 1GRQA 5HZKA 4LG1A 3TOSA 4XYMA 3D7SA 4D4JA 2P4UA 3CW9A 1JVBA 4KIGA 1ISGA 1C29B 2HHAA 3LE8A 1PF7E 3GP8A 4HG2A 4B4DA 3CUTA 2CLEB 2B99A 4PRKA 4ERXA 3ADBA 1Y8ZA 1WB6A 1JX6A 2QD5A 1EDEA 3EIFA 2ZUFA 3EEIA 3O2NA 2XT9A 2Y0BA 5LDDC 1NXPA 5K2OA 3M4YA 3G59A 3U9TA 1K8ZB 3UATA 1U0NA 3NXKA 1TFRA 1CV2A 1NVBA 3C8DA 3DE3X 5IC5A 1MXFA 1ZQ1A 3O8OA 1XFAA 3SQNA 4BJ5A 4N1AA 3M1AA 5KKNB 4NOKA 3CRQA 3K0FB 4IKEA 3L8ZA 4MVJP 4XVCA 3KQKA 2GWHA 4YXWD 5ECGC 1W85B 2EW2A 3S2GA 1UR5A 1XNQB 2R8EA 3KUXA 2BTOA 1CY6A 5CDFE 6PFKA 3CLSD 3PI6A 2JANA 4YT2A 3HWX1 4PGGA 4ZMRA 5ALRA 1SULA 1E62A 1BCSB 4CVNA 5KKAA 2DKNA 2PT7A 4GAEA 1SHLA 4Z9FA 2DWOA 4B74A 4Q3CA 4UU8A 1Y8CA 1JGTA 2QORA 2VSOA 3M6VA 3UXMA 4IUYA 3D0OA 4AMBA 2VSXA 1XCBA 3W4KA 3H5TA 4LBYA 2FPGA 1LXCA 1Z2EA 5TARA 2P9EA 1JDBC 3O92A 4N54A 1ZRNA 3G8BA 3LCVB 4MQFA 4WX2B 5BWLA 4AICA 1DAFA 3NRBA 2HDWA 4QBGB 4BE9A 3FTNA 1WOYA 3I5MA 2FSFA 4N0PA 2JG3A 3G6WA 1CQIA 2YH2A 1L2TA 2AOXA 1ABEA 4HBZA 3E2MA 1X3LA 4H7HA 4MRSA 3L04A 2R5WA 3MTBA 1EH5A 3IOYA 3Q3HA 3QLVC 2XNKA 4RD3A 3ZZ1A 2XRMA 2A3RA 4Q3LA 3ZW7A 4H59A 3RU2A 2JAQA 2PXHA 1TF2A 1DCMA 4QOFA 3NGMA 3H9QA 5JECA 4K40A 2YN0A 3RT7A 1LS6A 1EDBA 2VN8A 4YCCA 1U31A 1U90A 1H9BA 2ATIA 3ESZA 4CG0A 2GZDA 3B7GA 1NI4B 2X5KO 2JAXA 2ON6A 3PFNA 4G36A 3SFZA 3MJFA 2N42A 1DJNA 1HORA 1Z4NA 2OSBA 1N25A 2FH5B 1K92A 2WIKA 2FSHA 2G6TA 2OUKA 2YXDA 3IERA 1RYDA 5E4TA 3HEMA 4NXMB 1RQLA 2DOKA 4FWIB 5KYUA 3WYNA 1G5PA 3FPHA 3ICPA 3RO7A 3V7YA 1SK9A 5ARCA 2O1SA 4PAMA 5B2ZA 3ORQA 1WMEA 3QU9A 2HMYB 5JCJA 5F7OA 5IKOA 4XVUA 4KSCA 5KKCA 1VI2A 4B3CA 5J1TB 5K0GA 4LHXA 1RXSA 2WABA 4YMUA 3LZDA 1RADA 1B8OA 1FUYB 2YY5A 5AHRA 3VPSA 4EB8A 1XCMA 1RLJA 2B94A 4IILA 4TL6A 5ANRB 1BHQ1 3MWKA 4E07A 2H7CA 4MKZA 2ZUTA 4PZPA 1II8A 2DUWA 3AW8A 1E6LA 4WPGA 3WNZA 4AG5A 1VP3A 1VE9A 1XXHB 3KVNA 2BPOA 1D0IA 1T2DA 2VP5A 4D81A 5BYJA 4F4DA 2QRPA 1UJ6A 2DWPA 2H92A 3H75A 2VP2A 4QEKA 1KAEA 4PHFA 1I3MA 3KSDO 4QDKA 4D44A 2W48A 4BDTA 2NT3A 1AKEA 1XYGA 1F1BA 3LYUA 5I6DA 2IZ1A 4TWIA 2O3UA 2V7PA 4RF3A 1A9ZA 1M2OA 2P6OA 1DVRA 1FDWA 2H2IA 2ACEA 3AJ8A 5C37A 5KU7A 1V41E 3A27A 1TTHA 1PYOA 1QM5A 1SQGA 1EGMB 3SC2B 3TIGA 4B7ZA 3ROFA 3KYIB 1GO2A 4NJMB 4O33A 1E77A 1PFKA 1PW7A 1QP8A 2AC2A 4XOIA 2NO4A 2OCGA 1Z17A 4B4VA 2CLMB 5T8KA 1I5RA 5HBGA 3SZUA 2PEYA 1GJRA 1AKQA 1ODCA 2FEMA 2IBMA 2OB2A 1DUSA 2Q9UA 4FD3A 4U39A 1R18A 4X62B 5B57C 4G9GA 3E1GA 4HAUA 2OD7A 4OHWA 1OWMA 2I7CA 2IF2A 1IPEA 2IEBA 1Y4AE 3M5WA 3UAOA 4YRIA 1AG9A 4MVJA 5KNBH 4C4XA 3IVXA 3PUKA 3ZE8A 5G3YA 1KBQA 3HMKA 2OO7A 1XRPA 2Z6VA 1CPYA 2AL7A 1W4AA 3L0YA 5T64A 2HDOA 3QMWA 2NZVG 4V03A 4G2NA 3PITA 1Q0SA 3RRMA 1M6YA 2Q3HA 4GQIA 1NJ5A 4Q3DA 4ZO6A 4B6RA 4G85A 5KVSA 3WRWA 2IU6A 3HBFA