5JROA

The crystal structure of azoreductase from yersinia pestis co92 in its apo form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
202
structure length
184
Chain Sequence
AMSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGTPTDLVVPYLRLFLGFIGITDVEFVFAEGADAKTLLAQVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FMN-dependent NADH-azoreductase
publication title The crystal structure of azoreductase from Yersinia pestis CO92 in its Apo form
rcsb
source organism Yersinia pestis co92
total genus 57
structure length 184
sequence length 202
chains with identical sequence B
ec nomenclature ec 1.7.-.-:
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jroA00
5LVAA 3F90A 3F6SA 1YCHA 3NFRA 2Z9CA 4ZVKA 1CZLA 3U7RA 2Z9BA 2QX6A 2GSWA 1H69A 3EDOA 5FX2A 2XOEA 3NHRA 4CETA 2QX8A 2W5UA 1SG0A 3NHFA 2OHIA 4Y9UA 4QOEA 1VMEA 4YAWA 2M6RA 1RCFA 4YALA 1ZWLA 1XT6A 4NULA 2FZ5A 1E5DA 3EYWA 2QWXA 3GAMA 1AMOA 4QODA 1C7EA 5ULLA 1CZUA 1FLAA 1XI2A 1CZNA 4Y7CA 1J9ZA 1KBOA 4QOFA 2KLBA 3KAQA 3FJOA 4N82A 3SVLA 3B6IA 4HS4A 3OVMA 1XYVA 4PTYA 3NHPA 1FX1A 3QFRA 1F4PA 4LTNA 5F4BA 1ZWKA 4F8YA 3N3AC 4QOIA 1YDGA 3GFRA 5EMNA 4ZVMA 1XYYA 1AZLA 2KQUA 4C14A 1OBOA 3NHKA 1B1CA 1D03A 4YAUA 3OWHA 1YCGA 4QOJA 1JA1A 4LTMA 1QBGA 3NHWA 4LA4A 1CZRA 4PTZA 1FTGA 4N9QA 4J8PA 3NHUA 1CZHA 3B6JA 2FCRA 3OX2A 4U7HA 3LT5A 3TEMA 3W78A 1WSBA 1QHEA 4H2DA 3UXEA 1C7FA 5A4KA 5LBTA 1WSWA 2MTBA 2XODA 3N39C 5BUCA 1AKQA 3F2VA 2X2PA 3GFQA 2MOKA 6NULA 3K20A 3B6MA 1RLJA 1J9GA 2R97A 2FAXA 4S24A 1FUEA 5NULA 2BF4A 1FLDA 1T5BA 4ICIA 1GG5A 4FGJA 5EAIA 5FA6A 4XDGA 3HLYA 2FZVA 4U7GA 4GQIA 5LJLA 3ESXA 3D7NA 1ZX1A 3LCMA 1NNI1 2V9CA 1OFVA 4GI5A 3FX2A 4QOHA 3ESYA 3RPEA 2OHHA 2N1MA 1BVYF 2X2OA 2Q62A 4M0CA 3HA2A 4FGLA 5JROA 1DX9A 4D02A 1YCFA 3KAPA 5F51A 4Y9RA 3B6KA 2F1OA 2V5VA 3N3BC 2QMZA 4YQEA 4DILA 2HNAA 2ARKA 3NHSA 4LAFA 5B3LA 4HEQA 1D4AA 2Z9DA 1RTTA 4FX2A 2R96A 1AKRA 2QX9A 2MWMA 3L9XA 4NLLA 4U7FA 3U7IA 4C0XA 4ZVLA 4ESEA 3L9WA 3K1YA 3O73A 1DXOA 3F6RA 1FLNA 3NLLA 5F12A 4BMOB 3TZBA 4PU0A 5LBUA 1TLLA 3OX3A 3GFSA 3QFCA 3W7AA 1AKVA 5LLDA 1QRDA 1CZOA 4QOGA 1T0IA 3ES9A 3S2YA 1FLVA 2HNBA 1AHNA 4LTDA 1D04A 3R6WA 3OJXA 5FUQA 2B3DA 3OX1A 1BU5A 3G5MA 4CF6A 1FVXA 2FDXA 5LMCA 2WC1A 3OWXA 3TE7A 4OXXA 5NLLA 2BZSA 4R81A 3W77A 4GR9A 1AKUA 3HR4A 4FGKA 4DIKA 3FVWA 2BPOA 4C76A 2RG1A 1QR2A 1I1OA 1X77A 2OHJA 3FW1A 2ZKIA 4DY4A 1AKWA 3UXHA 2HPVA 2Z98A 2OYSA 2D5IA 1AKTA 1J8QA 1KBQA 3ZHOA 5B3KA 3OJWA 1YOBA 3P0RA 5TGZA 1JA0A 4ZVNA 4BMPB 2MT9A 2FOXA 3KEGA 2BN4A 4C0WA 3QE2A 3ESZA 4XDHA 3O2NA 4YAOA 1CZKA 1H66A 2Q9UA 4H6PA 1YKGA 1SQSA 4YAFA 2A5LA 3NHJA 4N65A 3KLBA 1TIKA 2FX2A 2M6SA 2FVXA 1YRHA 1AG9A 1J9EA 2QMYA 3FNIA 1RLIA 1DXQA 2FLVA 2AMJA 2QX4A 3W79A 2BMVA 5EA2A 1OBVA 3NHLA 2V5UA 5LJIA 2QR2A 3JSXA 3NHYA 1V4BA
chains in the Genus database with same CATH superfamily
4M36A 2HJ9A 1V6CA 4QEZA 3DV0A 7MDHA 2F4VB 3DQQA 3VNRA 1JDNA 2OV8A 1E9AA 1OTYA 2ZJ8A 5DN6A 1EJ6A 1Z25A 2ZUSA 1MQ9A 1WDTA 2RGEA 3CZMA 3L6DA 3LDGA 2E4WA 5JY6A 1Y7PA 1Y6FA 2FNAA 3WK5A 1P0PA 1J2JA 1YCHA 1KE1A 4V1CI 4G8BA 3ZTYA 4B0PA 5L3SA 1Z83A 3CX3A 3DM9B 4ZVKA 5JXGA 1CR4A 2ZYWX 2IVZA 4LUCA 3WSWA 1H9BA 3UUGA 3CLSC 5I9NA 5G41A 3LF1A 1E9DA 1IU9A 2MMGA 3B6ZA 5F1YA 5C51B 5DN6D 4PNHA 3HA5A 4B4VA 1DLIA 4L74A 4Z4GA 2RGAA 3G8AA 3MC1A 2XOEA 4E70A 2NSDA 1PJQA 4CGYA 4PYLA 1XLVA 4ACAA 1CW2B 1T4DA 2JI6A 2X19A 2ZUWA 3EAFA 3Q15C 4IIYA 4CIWA 4Q3CA 4RVSA 3P4XA 5FOQA 2F9FA 2XWJI 2JFXA 3WL6A 1JEEA 3QKSB 4IZOA 1P7PA 4REOA 1KH3A 2P5TB 1BMTA 2X2EA 3D6HA 3QBJA 4YRAA 3B13B 1U28C 3F73A 4C7XA 3I53A 3ZBQA 2B21A 2J46A 4EPYA 5A4JA 3VR5H 3PQCA 3MIIA 1E1CB 1MX3A 1P5RA 2X0KA 4I4CA 4WLEA 5I8ZA 1J0EA 1B16A 1L5HA 2GZDA 2ZYVX 3HKEA 3JALA 1SXHA 1YRQA 3D31A 1P6UA 3NBUA 1NMEA 4R1PA 1PZMA 3STUA 3A3KA 1TDJA 1Z5ZA 4MWSA 1KP2A 3W3AD 1YFLA 1VGVA 3DHNA 1LFDB 3NBYC 4ZPXA 3KO8A 1WHSA 3W4JA 3QF4A 1P1RA 1VE3A 2FN8A 4L07A 1HQCA 1E96A 1G20A 1YA6A 4PRLA 2XXJA 4NYMR 4YRSA 2CSUA 3B7GA 4HBZA 1Y4ZA 1UKBA 4QGBA 2IXDA 3ADDA 5D2CA 2FN7A 4RJTA 5I7WA 2VYQA 4JT8A 1VI6A 5AKYA 1L5FA 2L2QA 5DTEA 2DSNA 2YOHA 3D3KA 4HI0E 4HWGA 2L82A 1G1MA 3OQOA 2QRUA 2O8VA 3HKDB 2IEIA 4XWGA 1T3LA 1YRYE 2DY0A 3QUBA 2C2BA 2OLEA 3DEIA 4HC4A 4EDFA 1DL5A 4YCCA 2AC7A 2H4WA 1MAHA 1KMNA 1RHQA 4Y7CA 4HGPA 3RNOA 2F62A 2ZCUA 3REGA 3H19A 4WBSA 3CRNA 1V16A 4BS9A 4LV5B 2WIGA 3V4FA 5CVDA 3GUUA 2IDKA 3WWPA 1HDIA 3KVOA 3GJSA 5EQTA 3O8NA 2PFSA 5KOJA 1RZVA 3FMGA 4HXEB 5GJVC 1O54A 4PTYA 1Q0SA 1XNJA 4WCVA 4NPAA 4YA6A 1EFUA 1QUFA 1EIWA 1T8RA 1S2MA 1ZI6A 3HCBA 3QLUA 3LXXA 1I6KA 3ZXIA 4YV7A 2P9QA 2QAGC 3FFTA 2WILA 4KAJA 3KJQA 4Q24A 5HQTA 3K4HA 5A04A 4I99A 5JEDA 2BEUA 1H2XA 1P74A 2G8LA 4BLQA 4RH1A 2XYVA 2OD9A 2ZZKA 3IDFA 4I9NA 5K2OA 1AGPA 4PFSA 1SFRA 3VZBA 3T94A 3F46A 1NF8A 3TBKA 2Q9BA 2C2OA 3QKTA 2NU9B 2PKRA 1FQKA 3EZGA 3VYWA 5CBPB 1IN1A 5KMGA 1OIWA 4WI1A 1W0JA 4GXQA 4LVNA 2AZTA 4XUGB 1OJ7A 4DNOA 5K4HA 1QYWA 2VPYA 4WXRA 3ANNA 3MCVA 3KOXA 1B0AA 1J06A 4TQGA 3VPSA 3EPKA 3X2EA 3P5BA 3VBCA 1IXSB 4JI4B 2I22A 2EX1A 2J3IA 4GC5A 1PGPA 1SBCA 4U7DA 1OXUA 4KG7A 3U4CA 1EX7A 5DX1A 4M86A 4CMIA 1W0JD 3NNDA 2VF7A 3N58A 1MHTA 1HTTA 2AK2A 3QWFA 4PQEA 4X1YB 3G7NA 1UADA 1D2CA 3NHWA 3R1IA 1OFHA 3EODA 3QU5A 1HYBA 4BNUA 3M6FA 4BTEA 4LA4A 2OY0A 3UJ7A 2QENA 2Y1CA 1YULA 2RHRA 4Y8VA 1H4VB 4WASA 4H15A 3OX4A 4Q1CA 1U3VA 3ANLA 4G4IA 4DA8A 3DR5A 5JSZB 4CL2A 2XJ9A 3LVBA 5ERGB 1PDVA 2YQZA 4BAZA 5H16A 4CTKA 4MYUA 3RVLA 3T99A 3HMKA 5FNVF 1DB3A 4Y6RA 4GPBA 4FHZA 5PNTA 5H3CA 2PZKA 3NOVA 2EYUA 2BGLA 1J70A 4XYMA 3S2ZA 1EESA 1XELA 1GQSA 2ZVDA 3AGPA 4KC0A 5TIIA 1E0JA 4XQGA 5AIAA 4A8PA 1PR9A 4C5BA 2P9BA 3MJCA 2O8FB 3T1HB 3ZDRA 3K09A 4OBBA 4KDCA 3PIIA 4MMXB 4BN5A 1GY8A 1O5TA 1GPH1 2R7AA 4UBIA 3X1MA 4E15A 3OAAA 1N6KA 2IP1A 5BOSB 4LFCB 1FTQA 2C5SA 1EUDB 2PZMA 3O8OA 3MJEA 4TWAA 3RDPA 1C3VA 1M2HA 1VSQA 5ALRA 4ZYYA 4RFSB 2AOUA 2D13A 4P54A 2UVPA 2W8BA 1Z6TA 4P81A 4PRZA 3RV4A 2WLTA 3WIDA 4WZBA 5J1SB 1NQAO 4KR2A 3MWEB 2WIAA 3E1GA 2Q3HA 3GVCA 1VMIA 3LPLA 2W70A 2IX3A 3AY6A 1HI9A 2FFAA 1Q2UA 4RTPA 4B48A 1ADJA 1ONBA 1XL0A 2G08A 2C4MA 1BEEA 3EZLA 2I4RA 3FYUC 3JQRA 3VSCA 5KTPA 2NP6A 4AKGA 3LX6A 3LP8A 3Q41A 1SVIA 5K0EA 3H16A 3VA7A 3FUWA 1OXMA 2QRHA 2WAAA 3H2BA 3L7DA 4M0DA 4C2UA 4KPUA 1VKZA 4FKMA 2P4UA 5TPWA 1GVHA 3FAKA 1H93A 1HE8B 1NXWA 5KSOA 1CDZA 1JG7A 2ZKLA 1BAPA 1WCXA 1IZ8A 1RAGA 4LHZA 1XZIA 2BFBB 1M72A 2FPOA 1XFAA 2GJ9A 3GJXC 3GNSA 3OKPA 2NVBA 3UMJA 1XMIA 1J0XO 1CRPA 5B30A 4FLEA 4IKEA 5JSUA 1PEKE 4I6GA 1N2CE 1XXHB 4TWRA 1ZW1A 2ODPA 2RH8A 1LDMA 2PT6A 2PXCA 4FCTA 4NDAA 5HZMA 3IO3A 5KSPA 1LK7A 5HMMA 4N4AA 2VPTA 4ZWNA 2AJTA 5IABA 1A8IA 4MKXA 4BP9A 3RQIA 2FZVA 2AMVA 2FPXA 2YXLA 3TLKA 5LMNB 4MDHA 3EXFB 5LQCA 2G9RA 4DTCA 4GOND 3P4YA 2H1HA 4L2IA 1A5AB 3K5WA 3ESXA 5HBGA 1V6SA 2C3PA 3A1EA 2GHIA 3G2PA 1LPNA 3CRQA 3UTCA 3GA5A 1V5GA 2RGWA 3DBIA 3FRJA 4H7JA 4JB2A 5BN5B 1I6LA 3UT0A 3WB9A 4FFBA 2SKDA 3M9LA 4ALKA 3W6OA 5EJIA 2GXAA 3FWNA 5J5AA 3QPBA 4FU0A 2IX9A 2VZ0A 5FR2A 1JHQA 1KO8A 1BRMA 1Z35A 2R25B 4Q39A 1QQ5A 7AT1A 1QZUA 2EZ8A 4ZT5A 3IL2A 1NKTA 1RI3A 2XZDA 4NZMA 2F17A 2GNAA 2IPLA 3PI6A 1A50B 4DLUA 4DLYA 4DSZA 4LGCA 5JRZA 1DIBA 4C78A 4KZPA 1SQ0A 3ASVA 2C96A 1TCCA 2PGJA 4DC9A 2YWGA 4AZVA 4LYHA 2QVYX 3ERCA 3C1TA 4X6LA 4PO9A 3TLAA 2OORA 3TR5A 1MVOA 3ABRB 3HUTA 2ZB3A 1Y5LA 4IOJA 2EHDA 1ZSYA 2GK6A 4JJAA 1JBEA 5IKXA 4R9VA 4HPWA 4K9DA 2M2IA 2HTEA 3S44A 1W5SA 3HYNA 4LQLA 4Y9RA 2I6TA 2I1LA 4XWYA 1I3LA 4C2TA 2BMFA 2O19A 2Q27A 2R6JA 1LI4A 4L28A 1O7JA 1WZUA 2C9ZA 4DKXA 1Z75A 2XTJA 1LPMA 3GRYA 3O7MA 4YAJA 3TSAA 4DILA 5KTRA 4N3AA 4PG7A 3WIBA 4B09A 3S8YA 3AF5A 3OQJA 2ARKA 2YYYA 1A1SA 2CEAA 3PPXA 2V7VA 1Y5RA 1GCUA 3FWPA 3INTA 4RVCA 1LLUA 1EQAA 2R8OA 3UKOA 5ICGA 5F9FA 1KFKB 1RTTA 1RQNA 2WP0A 3MPUA 2R96A 5JJIA 2WA2A 4UC0A 3H97A 1NVUQ 2PGIA 4B7UA 3GI1A 4BV9A 4GKVA 1V0JA 5E2BA 1C41A 3JTMA 4OX9Y 2JGMA 2YV1A 1RYBA 3AR8A 3C3AA 4N0DA 3NBQA 5FEUA 1DCKA 2R62A 3T3GA 3GLGE 1RXWA 2ZB2A 2QAGB 5EPOA 4ESEA 2WVJA 5KI6A 4ER6A 5AVYA 3NUQA 1BE8A 3A9WA 4HAUA 1QGOA 1PL6A 1OWMA 1U3TA 4NZYA 1TNDA 4IDDA 1C9EA 3FBTA 1WEHA 2EAUA 3LP6A 3KLNA 1YQXA 2XQGA 3O1IC 3FPHA 3GT4A 4NBNA 5G0VA 4N1AA 3U2QA 1N8NA 3K96A 1AM4D 5L40A 1F60A 1P6QA 1J56A 2E4AA 1D1QA 2VYNA 4US0R 5LBUA 2EJVA 3ROPA 2CLCX 4B46A 2YJGA 3DF7A 1XIVA 3G2OA 2BMEA 3RS8A 5K0JA 2FWAA 2FTKE 5BPHA 3BH6A 3KZMA 4J7CA 7REQA 4TRNA 3AXSA 2XB6A 2B5WA 2JS7A 3O4IA 3IVMA 4L50A 1IRIA 3GP5A 2ANCA 2HUNA 2UZ1A 1Z0AA 1T0IA 2XMQA 3QI2A 4RV4A 1YZYA 4U6NA 1E5TA 4FGUA 1ZD3A 2EYQA 5TJHA 4DZZA 3THYA 4KH0A 5JVDF 2VYND 2MSWA 1LC0A 4FUTA 1KO1A 2ZU6A 1NHWA 2AJLI 4DR1B 1G19A 4RTLA 4CEIA 1X1EA 2G40A 2B8JA 2XCOA 4Y0AA 1SUAA 5DHUA 3V55A 4DV1B 2GFIA 3DMGA 4GDFA 1CX9B 1DTEA 3QOYA 2FHPA 5KTSA 2R85A 2MJLA 2LKCA 2M6KA 2FFJA 2LIPA 2GPSA 2Q4RA 1IQPA 2NW6A 1S2NA 4PS0A 4UFOA 1EUCA 2HCFA 2WC1A 5KU1A 3HJCA 1ZAYA 5LPNA 4M21A 4X20B 3L49A 2QQ5A 4OHWA 1VHQA 1U65A 2XADA 1CY4A 3KUCA 4FCVA 4MV5A 4RA6A 3L4JA 1M2NA 4Z3DA 4JKIA 3EQ8A 3ZW9A 2BMJA 4ID9A 3KXPA 2GESA 3EFOB 4PX9A 1FUYB 3QUSA 4RXTA 4TYWA 3FPLA 3LCRA 4R81A 3U4MA 2FSGA 5JATA 4LV6A 4BMXA 1ODFA 1QBKC 4ROTA 2G77B 1R8JA 1IY2A 4YDRA 2PUFA 5B57C 4G9EA 2FPIB 1YXMA 4J6FA 1COWA 3K6JA 4J49A 4O8CA 3RUPA 4AS3A 3DDUA 2CL5A 2V55B 2GXUA 3HRHA 3OFVA 4H4EA 5AM2A 1UM8A 3MILA 3OF2A 1B0PA 3UJAA 2Q7XA 1LU9A 3BWYA 3U3RA 1WZ2A 3WL3A 1TW2A 1EWKA 5ICMA 1XX6A 4ZJZA 2Z6AA 1CJVC 2DBYA 1JAZA 4D92A 3AF4A 1Z82A 3CN7A 2WA1A 4GSLA 1IY1A 1COWD 1YSCA 5DCYA 5EESA 2BZGA 1ARZA 2EC5A 3DMYA 5IF3A 1P17A 3K94A 2ODAA 3WDMA 5JSFA 3VTZA 4CF4A 2LR0A 4UUQA 2I2DA 1AUPA 2YWDA 3RSLA 5KYUB 2P8SA 1GYQA 1KR2A 2AMLA 2O6LA 4B82A 1JJFA 1SCNE 1KBQA 4XARA 1XTKA 2IODA 1OC2A 3C7CB 3K73O 9LDBA 2C5GA 1WQ1R 3R44A 4M49A 4ZO4A 3VPXA 3WRXC 4YAIA 1TKBA 1V6AA 2IOHA 5B3KA 3VDXA 2H6EA 3L7AA 2HO4A 1PSWA 1FBNA 1W5FA 5J5VA 1UKAA 3P0RA 5JNUA 4MKIA 3EZ7A 3T5CA 1JQ3A 3TW0A 1OZAA 1VJ1A 4DANA 1NE2A 2MT9A 5BQPA 3SAJA 3OEYA 1FFXB 2WWGA 4DWJA 3CGWA 3KQHA 1BWRA 4HL6A 1M6NA 2IYOA 4C4YA 4CKBB 2C2MA 3ZHCA 1ZVJA 2K2WA 5SICE 4G0PA 5BSUA 1XAGA 1TU0A 4C4SA 2DPYA 3FE2A 4XR9A 3RVRA 1T6BY 3V1NA 2GBLA 3A06A 3CN9A 1NPDA 3UZUA 4BWYA 2DETA 1UBHS 2FZLA 2PQ2A 3D8NA 3GRVA 3KZKA 1RZUA 1AS3A 3M1YA 3HVKA 1TB4A 3SJBA 1Y8ZA 3RVSA 621PA 2ORED 1DLJA 3VVCA 4PSAA 3INRA 1VECA 1GRNA 4NMWA 4RD2A 1ZNWA 4Y2TA 3BJZA 1PQUA 5HJ2A 3O90A 3TJMA 4BX0A 4JASB 3ACBA 3W5HA 4M8NE 2D1RA 3QLVA 1Z5PA 2QF7A 2Z3VA 3GJ3A 4C3UA 4KREA 4EPWA 2WAMA 1LTKA 5CK5A 4IZHA 2BDUA 3CVUA 1M2OA 5B53A 4E09A 2L42A 3T9DA 2CY0A 3MD9A 4J7AA 1TMGE 1LRLA 2MSDB 4UU8A 4WCFA 4ZD6A 1RHMA 5E4TA 3ZK8A 5JUWA 4EF4A 4P93A 4FYJA 3BDAA 3R3JA 1GSHA 3DOIA 4AC9A 5GZ3A 3EGDA 3VX4A 2YFHA 3W79A 4RS3A 3HYLA 2BTQB 1NG9A 1X7ZB 3GDOA 3PNMA 3OIUA 4V3CA 3BT7A 3OQMA 1L5MA 3JQBA 3DLCA 1SQGA 1BMFA 2CVPA 2FQ1A 3BQNB 5LZ5A 1U2RA 2PZJA 4LE1A 3G3EA 1VHDA 4AO6A 1E98A 3KQNA 4GAEA 3FUTA 3H2ZA 3E5MA 2JLCA 4EY7A 1UBRS 3L41A 1KI9A 2BELA 2OTCA 4JHXA 3DMDA 4FC7A 4R8KA 5T5QA 4R2IA 4EWLA 3GNQA 3W9SA 2W2NA 3TPFA 5C4MA 3W8EA 5JBQA 4AJ2A 2QP9X 2Z9CA 1WD7A 5AFSA 4OP1A 2AHOA 4B7ZA 5G0TA 3WB1A 3OE5A 4GMHA 2J5QA 2HSJA 4JWTA 4IGEA 2H8KA 2R79A 2YMMA 1EXNA 3H2GA 3OJEA 1H69A 2OB2A 4BVGA 2RBEA 1JI3A 4MWCA 3E0XA 1Z6GA 3GJQA 4LC9A 3PFNA 2DR3A 2Y99A 3BF7A 4MRPA 1P60A 4WXHA 4CKYA 2PGAA 5T4FA 4YCMA 4A8JC 4X95A 3I0NA 4KMOA 2RHLA 1F06A 2WF9A 3NDBB 3CX8A 1NW3A 1P77A 2ZI5A 2LKDA 2XBLA 3AVYA 5JH7B 4JLPA 3WL8A 3Q1LA 1E6WA 3BWMA 1DFGA 4WLFA 1JFTA 1J0DA 2VKQA 3FZQA 2O48X 3OTOB 2BP7A 2O9JA 4QU8A 1M2GA 2R84A 2C9MA 3LAWA 4UNSA 3ICQB 2JB9A 1XD8A 3GLHA 3I2IA 3OMXA 2YZGA 1XZEA 2ZIUB 3IQFA 5EJ4A 5JS1A 8ADHA 3VKGA 5AVKA 1Q14A 1FYXA 1GSIA 4E4YA 3PGVA 1F8GA 4O1HA 2X9NA 3B51X 1GZ6A 1S2LA 2Q0SA 1PZHA 3FGNA 4DT1B 1SCUB 3I3SR 1U1GA 3B82A 1RWPA 5DTQA 2EP8A 2CYBA 3L6UA 1P5JA 1CS0A 2HDNB 2ZI3A 4UHBA 4DJDC 4D9BA 5JXIA 4HYTA 4GP9A 3BN3A 4GIBA 4UXJA 5KVAA 2JC3A 2AJDA 2XNKA 3S4YA 1V26A 3KK0A 4E5KA 5FUMA 4J4TA 5C81A 2B4TO 4MS3B 3PE4A 2N0SA 4BGIA 5HILA 1Q91A 3NGLA 4I0WB 2F6RA 4HGNA 4YGXB 1ECCA 3OICA 1GTSA 2QW1A 4MWOA 2XECA 2Z8ZA 4GOOD 3R8XA 4NOKA 3IVRA 3FN4A 2PUCA 4F11A 5IK2A 1E2JA 2WABA 1GZ7A 4TRMA 1B8VA 3COPA 3DFZA 5FPSA 1FIUA 1QRUA 1OVGA 1CU1A 3OOYA 1M8KA 1IB6A 1O97C 3CU5A 3W06A 4DXAA 4CEHA 4FD2A 2YIMA 1VLLA 1UBGA 2VDMB 3QPVA 4IILA 4DMFA 4AMZA 2B1IA 1Y8RA 3DQZA 1HG1A 4UNPA 4BLPA 1R9NA 4P4UA 3QFRA 5IK2D 4FT4A 3CWQA 3L8MA 4Q82A 3IOMA 4AZ0A 3E3LA 3DE7X 3M6VA 2EDCA 4IJ6A 3HVRA 1BVHA 1GR0A 2UYHA 1GDHA 4B47A 1RJEA 4EQZA 5IAAA 9ATCA 5EJFA 3DFUA 2WTNA 2EJCA 3CVYA 4EI9A 4TYYA 2QY9A 3G0OA 4F2HA 2P0AA 3T9AA 4WESB 2OFOA 3BA1A 4YLYA 1HE4A 2HT1A 2TMGA 3OBIA 3KE8A 1NC3A 4CRWB 1KK1A 3FCYA 2D8MA 5I48A 4DVJA 1RKXA 4JELA 3DOUA 1LBIA 2FMIA 3NHKA 3PFGA 1LK0A 2HOQA 1BFKA 3SE0A 2HTFA 2PMDA 4WUVA 4DQLA 4F72A 1OT3A 4KGVA 1UOQA 2I2BA 1O94A 3ZEAA 3P9IA 2IIBA 1IBCA 1ZGBA 2HI0A 3B9RA 4JBHA 4PS1A 4KN5A 4FQ8A 3NRJA 4I50F 3ESDA 3SZGA 4DA0A 3KYDB 4QFCA 3QY0A 1ZO8A 2VDLB 1PS8A 4E32A 4WLUA 1W36C 1S7CA 2V7GA 2C07A 3H5IA 1O94D 3RKUA 4H0NA 1NBAA 4QKQA 1TYZA 4L0MA 4LOJA 4PY2A 2CVQA 1O0SA 3BCRA 4GX0A 4B71A 2UXDB 1L7OA 4A7PA 4W5WA 1KYZA 3EQ9A 5JHGB 1ENOA 2WTBA 1R16A 3RVPA 1ZN9A 4WZZA 4MK4A 3ZX5A 5E3JA 4Z4QA 2CNOA 13PKA 2WUGA 1WUHS 3HVHA 3LWZA 1DQSA 1QX3A 2V9PA 1J0AA 2VDRB 2VPZA 4S12A 1AQIA 5FWAA 5A4KA 3ZVMA 4UPEA 4TWBA 1L8AA 1XZNA 4HQKA 1AHPA 2G09A 2O8CA 3MUEA 1XF1A 1Z0ZA 4L75A 5LL6P 2O07A 4INAA 3PC8A 1RYHA 1I2MA 3OY2A 3PB3A 4LJ9A 3DKIA 3ZCQA 4DCUA 2HMVA 1OYOA 2ASVA 3D8RA 4URXR 2Q5CA 4ALNA 3HWWA 1OTHA 3MCUA 1XE3A 4F5DA 3GFQA 3EOAI 4K26A 1JGTA 3DOFA 5CVVA 5LKAA 4UEJA 4CM1A 2BFDB 1ZD1A 2PRIA 4FK8A 3TKLA 1E3WA 2PX3A 4IGFA 2HA7A 3PPYA 4PO8A 2ZR0A 1ZCFA 2I6XA 2R97A 4URVR 3FCUB 3HZOA 3IDQA 3MPOA 2V7QA 2M9MA 1T9ZA 4JYBA 4NDZA 1KZ1A 1Z62A 4O2AF 5G02A 3PHHA 4MYHA 4BV3A 4GC9A 1T9CA 5IVIA 1YMVA 3EZ2A 1QQBA 4OVKA 3H8VA 4YRJA 3N0XA 1FFHA 3L7OA 4OKNA 4ZARA 5THXA 4A27A 1JWLA 2A1TR 1IH8A 1PS0A 3OWOA 1CF9A 5JBNA 3HUUA 4FGJA 4MKFA 4TTRA 4QJ5A 3TRKA 2V7QD 2HW8A 3PWZA 3ANXA 2J0SA 1PFQA 1JSLA 3P0JA 3QPDA 1H2RS 2P65A 4HFJA 4BRWA 1KEKA 3DXXA 5TGTA 1GWNA 3BE6A 2F9LA 3HFJA 3PXEA 4FE4A 1A8PA 1PFUA 4GUAA 2OV1A 4RIHA 2QBYB 4XDGA 3QU9A 5DP2A 3UENA 4BYMA 3IIIA 1WUKS 2ZIEA 1LQ2A 1M1YB 2JGNA 2D7CA 2Q3LA 4RV9A 4X8HA 3S3TA 3J81A 2I8CA 3QWBA 2V3CC 1Y1LA 3RHZA 1TT7A 2ZR8A 1YTLA 2QRVB 4H35A 4I46A 1SOAA 4D3SA 2XB8A 1PVDA 3H5TA 5IW8A 3ETJA 4DCSA 3PGLA 4O1MA 4XGIA 3TBHA 1H2WA 5J9FA 1QDLB 4TS3A 1DHRA 4EGAA 3KETA 2C4VA 2IBSA 3IDSA 3Q7IA 3FFXA 4KI7A 1FVFA 4LF5B 4Z9AA 2YZKA 4HGQA 3KQUA 2GYWA 2R0QC 4GZ5A 3N2KB 2R8YA 5FFFA 4TTTS 1F0YA 1N0VC 3K0BA 3WL4A 1TU3A 2PANA 3KTDA 3FHCB 1SUDA 2X2OA 1OE0A 1O6CA 1UPBA 1ZNYA 2P2DA 2R6DA 2YY5A 3KPYA 1L5KA 2I5PO 4WKBA 2WV7A 1F17A 4N8SA 3F97A 2H07A 4NG5A 4YAEA 1MJGM 4RK5A 5BMOA 5JROA 5EG5A 2JFYA 4M1YA 4LZAA 4GD3Q 1MAWA 5FUBA 5EERA 3GQBA 2JFHA 2MCFA 4MAMA 3AETB 3QQPA 1CXZA 1DUSA 4E13A 3OTGA 4BE7B 1ADYA 1CQJB 2HQSA 4Q4HB 3SDSA 3BH0A 3DDHA 3PEFA 4G97A 3ZIDA 4DVGA 4EZIA 2WZCA 2G0NA 4EVQA 4G84A 5I7HA 1VBNA 3JQFA 3GRCA 1P2SA 1Q1GA 2OD7A 1MC1A 2VS1A 3EXHA 3BIWA 3OFNA 1KVRA 3DW3X 5TT0A 3UKDA 1FVOA 3RLFA 5ADHA 2JJ1A 5FLXA 4NCNA 1C9NA 2FGJA 2E85A 4UBKA 4D8WA 1X14A 2EFDB 4CQMA 1I0LA 1YJAA 1S3IA 4CU5A 1QK4A 2I99A 5KHLB 1KZ4A 4C05A 4F3TA 2R5NA 2YN0A 1ZD2P 3ZWMA 1I4LD 2WM2A 1TD1A 4XWTA 2BMWA 1P7WA 2YIVX 1IHUA 2RJOA 2P3OA 3OFND 1C4KA 1CNFA 1JTEA 2GPBA 3OJCA 1V39A 5HJ5A 3NHMA 2JJ1D 1EHCA 2E55A 3IELA 5CPBA 3ZLBA 4C20A 1I4OA 4B3TB 4YJHB 2R66A 3JZDA 5CD1A 4PE5B 2PQ6A 4QQRA 1VDZA 3FLAA 4KQEA 2XB4A 1U0RA 1GJRA 3IR6A 2E87A 2Z1MA 4GOLD 4BIMA 3H5RA 4O0LA 3NUGA 3BMNA 2A5JA 3PDUA 3RSSA 4JJIA 2CJXA 3C8MA 3TD6A 3WYGA 4CXMA 1TJ5A 2JH8A 2GT1A 2BTOA 4R2JA 1NM5A 1YBVA 1ZRMA 4FOLA 5BQXA 3WAKA 5E8RA 1Z26A 4B75A 5IDQA 1Q6ZA 3U6KA 2NUBA 4B83A 2PLAA 4M1MA 4PQYA 3ZBPA 3L07A 1GXSB 1BDBA 1R37A 3FOWA 3H11A 1NBME 1ZCZA 2PX8A 4LQCA 4XQEA 5IC6A 2G9NA 5I9MA 1X9HA 4GXNA 5JCOC 3LNCA 4N0MA 4MITA 4J03A 1IVYA 2ERYA 2O8EA 1WCYA 3NAGA 4CIBA 4D57A 1SHUX 1IOZA 3R5FA 4LNAA 1WW3A 5FBZA 3UAYA 2BI7A 3EGXB 3RF7A 4E30A 1PR6A 3HN6A 3UOGA 1PYOA 1WQ3A 2EZ9A 5IKOA 2D3WA 2C8LA 3F3MA 5COAA 4K87A 2FWPA 4A03A 1K1EA 3KXKA 5EIOA 4ZV4A 5AUOB 3GLRA 4X91A 1SKMA 1OR8A 4D4IA 3GGPA 4BQFA 2JG3A 1U3UA 1ESMA 4IHKA 2FHSA 5LA6B 5GM2A 2HZBA 2GCOB 1JL3A 2IZ0A 2R44A 1KKUA 4ZCPA 2VJPA 4FMCB 4KLNA 4U2DA 3B1VA 5GJBA 2IYPA 1NJ6A 1KJ8A 2JFBA 5LP6C 5JAMA 4ZYZA 1OH6A 1YHNA 4QDKA 3RT9A 4R0MA 3IE1A 5DJ5A 1KVUA 2AOTB 2ATIA 3DVAB 2TSYB 2YVKA 4MV7A 3LRXA 4G1EB 1YRWA 2AC2A 2XZLA 2QSZA 1RPZA 1QMPA 3DBHB 4TT8A 3JD3A 1G8FA 3IQEA 5AK6A 2NYUA 3F7NA 2G88A 4AY3A 1RYNA 3DONA 1VPEA 4QATA 1XEXB 1QZXA 2MYUA 3OZSA 3SVTA 2Z8YM 3GCGA 3U1TA 1TK9A 1QR2A 1JIJA 1LSSA 2H52A 2FG6C 2KS6A 2OV3A 2QRQA 5HTKA 4Z1MA 1TC2A 4JC0A 4CM7A 1R6VA 4RIFA 4I9UA 4L0CA 1MOZA 1ZYUA 4X60A 3WGKA 2FV8A 4L9WA 1KRXA 3G8CA 1Q19A 3IRUA 4MVJG 1S4QA 2VSOA 4BO3A 3D0OA 5LP6F 2CF6A 1MHPA 4BNKA 1T36B 2RJ3A 2OHJA 3MB8A 4IDPA 5HHTA 1Z2NX 1SUWA 4JUAA 4EYQA 2V7PA 2E4UA 3I52A 3OIFA 3WWCA 1KFJB 2PSJA 3I01A 4M7RA 1QIKA 4Z1MD 2QI9C 1UJCA 2QZSA 2AZ4A 2V7WA 2RGGA 1RBMA 2IYQA 4QXPA 4YI3A 3OQBA 1QHFA 4JJKA 4R1SA 3UXHA 4A6EA 1A9XB 1SOMA 1L5ZA 1NJSA 4FFPA 2TECE 5CX1A 2DPHA 2ZRCA 3ZHOA 4DLLA 2GCGA 2PM8A 2C4KA 5EXSA 2A1TS 4ZHQA 3JARA 3MCAA 4XW2A 1IE3A 4QBFA 3BXGA 1X0VA 2BR5A 1R9MA 2Q3MA 1YI8A 4KOEC 1QDEA 3E4DA 1Q3HA 3K30A 4M7OA 4RTOA 2BKLA 1W9MA 4HH0A 4ZEMA 5IASA 1QFSA 5IANA 1H5UA 3ND5A 4GH5A 5DT2A 4YP6A 5I4IA 4MQ4A 1M2JA 3PF9A 3D4BA 1UCFA 2WFLB 4MVWA 3ZZ0A 2ZAOA 4AF6A 3U19A 3C4JA 5BOSA 2XLBA 2I3DA 3LXMA 4U0JA 2C57A 3ZHYA 2JHAA 2X8WA 3TG2A 1ABEA 5LZ2A 3AHGA 3IV6A 1YKGA 3M49A 3IEKA 1SQSA 2AS0A 4GW3A 3D7RA 3JQDA 4RKYA 5TPZD 1L5RA 2OUKA 3NM6B 1EDDA 1GNTA 4OGFA 4R1MA 3PFCA 5EE1A 1YDMA 1YRHA 2GI4A 4CUZA 3H2SA 4I1YA 4MQEB 2ZT5A 2IRWA 1F48A 1N0HA 1RLIA 2AXNA 4NAHA 4QSHA 3PR2B 1FFSA 5C7YA 5I9IA 4YMUA 3SZLA 3HUFA 1GDTA 3BIOA 4RVHA 2C0CA 2PZLA 1Y8QA 2Q6TA 3C97A 4ZQEA 3WLNA 3EQ7A 3PQ7A 3ZDCA 3C5HA 1FDIA 3DGFC 2PRZA 5MGNA 5GIPE 1PNRA 1ZCAA 4TRRA 2BY4A 4OXNA 4QUGA 2HIAA 4OGLA 3KALA 1K5DA 1W30A 3U37A 4QOSA 4I3HA 4YJ3A 3L8GA 4NJOA 2ZJ3A 5JMPA 2AX3A 1Q50A 5GOZA 1USVA 1KMMA 1X1QA 4JH0A 2ZQYA 3OE7A 1UK9A 1SMKA 2W2LA 3AM4A 4JBLA 4QU5A 3AF0A 1V5IA 3LBFA 4HZUB 3DAPA 4WRRA 1WF6A 4C0LA 4NZPA 1WOMA 2O8DA 4S1TA 1LUAA 2MSNA 1F1BA 4P92A 1TKCA 2GEBA 2HAEA 2DBZA 2QNRA 1YAJA 2N75A 2HCBA 3F6SA 5HFAA 3UG7A 3O94A 3VHRA 2R8XA 1AT1A 5CLIA 4EAAA 5KREA 4C0SA 4ZPJA 1J6UA 4AJIA 3OE7D 2J07A 2I8AA 1XAJA 2AG6A 1W4CA 2YYSA 2Z9BA 2HFKA 3DFIA 4LECA 4EO7A 2HYIC 2DKOA 5JQGB 1G66A 3HXKA 2ZRBA 4RESA 4MX8A 3CUYA 4KSYA 3U61B 1IY0A 1KPIA 1M1XB 1MT3A 1KFBB 4HRAA 4MB2A 4RKWA 1Z4MA 4KQ2A 5FIUA 3VU9B 1PVOA 1GRCA 1LBHA 5CT9A 3K1AB 3AIIA 4W8GA 2CLFB 1ZESA 1MABB 2W5UA 2DX7A 2F43B 2FP4A 1QXSA 3B5IA 3M2PA 3IKTA 3RC3A 3U62A 1YDWA 1H4TA 2IKSA 3CZAA 1VCNA 5TE9A 2UXCB 1WX1A 2HMSA 3OE1A 3ZX4A 4DADA 3JPWA 4B7AA 4ZCSA 4D9GA 4K88A 1IN8A 3LNTA 3O21A 3HBJA 3T7KA 2WT9A 4TTPA 4WH0A 5CITA 3T34A 4UTVA 3IHKA 2GS9A 2AUTA 4YCJA 1R0BA 1U31A 4ZT6A 3HO6A 4YAWA 4Z7JA 1UKVY 4PN7A 3S2FA 4Q15A 4KRFA 3BCHA 1PZGA 1MRSA 3GCZA 5CPFA 3DEHA 1VOTA 4G67A 4C7KA 3IPXA 2AUMA 5F1PA 3P45A 1AQ6A 2FG5A 2DUWA 2VT6A 1N25A 4UTOA 1VXRA 3U7QA 2P69A 2CFCA 3G02A 1BOOA 5IRCD 3KVRA 3ENWA 1QE3A 1WV0A 1NYLA 2FG7C 2V6BA 3MFQA 3OZEA 4FS8A 5IDYA 2OYRA 2NUTA 3REQB 2PGNA 1JIVA 2KX7A 1NX9A 1YOVA 2PEYA 3L7KA 4CKCA 2B4YA 5DWQA 1EX6A 4MVJF 3GGOA 1SEVA 4S2UA 3ZGNA 2JFGA 2O5CA 3CX4A 1P1CA 5FBHA 4QWWA 3E23A 4O4JF 3HEMA 2F3QA 2QZZA 2IOFA 4HDSB 1ISIA 2ZLBA 3W5SA 5LD2B 1UQTA 2RAFA 3B3JA 3EZ6A 1OT5A 4M0LA 2JAUA 4PO1A 5SZKB 5TEWA 3VZCA 1SZCA 1LCIA 1J1UA 4JROA 3OO0A 4QOFA 3NOQA 2OCGA 4G37A 3G5LA 5EYPB 1YZLA 2QUHA 3MJ4A 4EJMA 1KRWA 1I13A 5THKA 3AV3A 4L85A 3I5UA 1Z8HA 3GLTA 2I62A 4UCXA 3ONEA 2AXQA 3HDJA 1SC6A 3CB2A 4TV9A 3N8IA 1I4WA 3T5MA 3AKZA 1TXGA 1A82A 3I9JA 3A1VA 4CT5A 2PYZA 1CQIA 5LNK6 3E2IA 2EJWA 2VYVA 3UFXB 3V32A 4ABTA 5H4HA 3DOCA 2R00A 4UNNA 2ZVJA 5DGXA 2SKEA 4RKRA 3LUDA 4LGMA 1YO6A 5ITWA 2V7BA 1CUAA 2YZ7A 1SOWA 3NEPX 3EG5A 4RF3A 3RANA 4UVIA 4N3CA 3R7NA 2IZ7A 3H9BA 5DGIA 4J4BA 2ONZA 1GEEA 3ETHA 2VYVD 2EX4A 2JVJA 3UO8B 3SOZA 3WBBA 1UANA 2CMHA 2JJMA 4Q4JB 5DB4A 4ZVMA 3TUIC 1Z12A 3EVZA 3O2SB 4XSGA 2O7RA 4WGGA 4KX5A 1PL0A 1UH5A 4CF3A 4HPJB 4C14A 1GZ3A 4KQHA 4XYLA 3BFVA 5E0KB 2OMEA 4G1UC 2VN8A 2XT9A 2ZS8A 3VGPA 5B1YA 2WIDA 5CTJA 1QUEA 4X3OA 1CF4A 4Q3DA 3LW8A 2X86A 2A9JA 2O20A 1YZTA 2ZYRA 4II3A 4CCWA 4H7DA 1YCGA 5ECYA 3C2QA 3TMAA 4CLOA 5E2AA 2Q5QA 4QYIB 3S8MA 2I2XB 3T7AA 4WXPA 1UXIA 2B1JA 3GNLA 3ZJYA 1QIEA 4BE4A 4E1VA 2VH1A 4EZBA 4F9TA 8OHMA 4FOSA 4BMSA 2ZCJA 4JV5B 1X74A 5CT8A 1I4DD 1R10A 3T5DA 2FCAA 1PP4A 3A14A 3KSAC 3HO8A 4ZCTA 2RHWA 4R40A 2FJ0A 3OZIA 2VJDA 3DE3X 4HNAB 2XAAA 5LQRA 2CDRA 1Y7LA 1H1DA 1PG0A 2JHGA 2OO7A 2Y27A 1T3TA 4KE8A 2XZOA 2AKYA 1A2BA 2B1RA 4URUR 2FPPB 1S2OA 3H5VA 4PNPA 5DLDA 3TZEA 2XMZA 1KNXA 2HSDA 4N5NA 3KQTA 4I4IA 4JLJA 3ZNNA 1P0FA 1P4JA 4PGHA 4BO0A 2Q5IA 4LS3A 1JLKA 4MIKA 1S02A 2GN9A 4ZRNA 1JX6A 1H6DA 3GLQA 3A4YA 3I04A 4BNXA 2GYUA 4FSDA 4PQGA 4W1PA 4ZANA 5T7BA 2XODA 3N39C 2G0TA 3O83A 2DB3A 1Y6RA 2ZE5A 3LMKA 4IMRA 1VIVA 4XIGS 5WRFA 5INTA 1ZMTA 4Q9AA 5HIMA 1S2GA 5DULA 5I7VA 1EFKA 2O1XA 1FPMA 1OVMA 1S2IA 2A5DA 4RVOA 4W1SA 3PEYA 2OHVA 3LQRA 1E2UA 2AR0A 1VL8A 4A1FA 1X0XA 1E1KA 2ZJ1A 5KKCA 5MHTA 2QN8A 1FFBA 3NIBA 1X1RA 2OECA 3LY7A 3VZQA 3GPIA 2XKAA 1G3QA 1S3FA 1GLVA 1U0TA 1KO7A 3K20A 4LRYA 5DYTA 2NU8A 2A86A 3RS5A 1NUQA 1Q1AA 1RAEA 2OKCA 4L4RA 2FW9A 2D1FA 4HWRA 1JI0A 4PV7A 1MVNA 2HWXA 5ILGA 5TVGA 4PC1A 5GOTA 5M5BA 1E9EA 3C14C 1II9A 4Y30A 3V1TC 3SF0A 2BDTA 5DXFA 5NULA 1JG6A 4JR0A 5FPHA 2NNWB 3SYRA 1F8YA 3R7BA 2HRRA 1E61A 1QAQA 2QRPA 4NNOA 1SRQA 3IOEA 4OLFA 4W63A 5DBFA 2AFRA 1C4XA 3IAFA 1Z0FA 3ORFA 5TDHA 5EIEA 2OBMA 1NUAA 3BVPA 2JHCA 2LCFA 3ZGOA 1ZC4A 4M0KA 4N0PA 1SXJE 1P4SA 3KZOA 1FSGA 3QELB 1K4MA 5D84A 4QO8A 4MMZB 5TT1A 5HX7A 3N5KA 3RBXA 2ACEA 3ICWA 3WLAA 4QRHA 1CUXA 1J8DA 1T13A 4URYR 5HF5A 3WQHA 4CR8A 2PH3A 3HDVA 3NPAA 3AQIA 3U7GA 2HU5A 2IEAA 1KARA 1FY2A 3I92A 3K3PA 2RK4A 3AM5A 1FMJA 1AOXA 2YCLA 1D7AA 4R7ZA 2WVHA 3SKVA 3VR6A 4X1KB 1KPHA 1XQWA 3HCOA 1GILA 1QV9A 1JEQA 2DFVA 8ATCA 1UPTA 2H1CA 1NMQA 2XE4A 4PLPA 5IJ9B 1Y4AE 4Y2PA 4QYWA 1FDRA 2PX6A 3H2IA 1WWKA 3MS4A 2WI8A 4OFZA 2CHFA 3E18A 3TLYA 2BSXA 2E3JA 3C3BA 1E4EA 1FX0A 2LCQA 5FBQB 4A91A 4N6NA 1DIAA 4L3WA 3VR6D 3COWA 4HDNB 1EB9A 3EN0A 4RJKA 3RPEA 4A15A 3CUSA 5G3YA 2XWBF 3GZNA 3PNBA 4GLBA 5IUJC 1IWBB 1URPA 3B70A 3MYYA 1FFEA 1DADA 2C2ZA 1HQYE 1ZK4A 2TMDA 4WXYB 5BRNA 2XXAB 1CHDA 1G291 4LQ4A 1DX9A 4IDGA 3NP9A 1JB9A 1AGRA 4TMVA 1EE2A 3G8YA 3PFBA 4GFDA 2NLOA 4GRAA 4XR4A 2PAFA 2YJTD 1ZA1A 4EHHA 3ZKWB 1VB3A 4FZ3A 5EIAA 2P6MA 3WWZA 4BMZA 1YT5A 1Y9EA 1HYGA 1J25A 4Y9SA 1ONNA 4EHLA 5KNDH 3LPAA 3WGOA 5IVKA 2J3KA 1MJHA 4H18A 3DJFA 2Q21A 4K9RA 2H2IA 3BF8A 3IVXA 1XZBA 3MRVA 3GEPA 4TMTA 4MIYA 3TIFA 2X5XA 3DKRA 2B4AA 1QHGA 1ECPA 2VCHA 5KYXB 1UFVA 4JD5A 3TN7A 3E7XA 4B4UA 1QONA 4PLZA 3OLZA 2M32A 1VL1A 3EGOA 1C3OB 1Q74A 2PA0A 3D3WB 1WO8A 2MSEB 2QX9A 4CVNA 3PHJA 2QRGA 2OAP1 1SC3A 5IJXA 1HDYA 1U1CA 3BKXA 1VJDA 3TL2A 3QX9A 2NN3C 5IAKA 2P7HA 1UBTS 2IOFK 4QDUA 1NWHA 3MUNA 1RJ9A 4YV0A 3ZLJA 4PLHA 1GZSA 1WCV1 3SEAA 5HKBA 3AILA 3AEUA 3H9EO 4NG4A 4P5PA 4R16A 3U4HA 3WL5A 1OH5A 1J8FA 2NO6A 4IM7A 3ZHQA 2PCLA 2WHRA 2XX3A 2VJMB 2PXHA 4MR7A 1UC4B 2JLQA 5C8YA 4KIUA 4NVRA 1G4HA 3AKCA 4IUYA 5KWJA 1AXRA 4FI3C 2NP7A 2BVNA 3PX2A 3I9LA 1QGUB 2GYYA 1PQ4A 2VUSA 5DVZA 1IDOA 1UXOA 4CLRA 2H2WA 3CH6A 1OC4A 4XYBA 1PD1A 5IUNC 1DU4A 2AKAB 1D04A 1XRRA 1SHJA 1SVSA 1E58A 2Y1KA 4NATA 4MHOA 3ZHBA 2QVGA 2BMDA 4EJ0A 1PI3A 1IG0A 3EWIA 3FVRA 3IPLA 5KWEA 2GAAA 2GM9A 1EVYA 1HTWA 3KT3A 4EG8A 1IBSA 3L7JA 5TSDA 3WMGA 5JZVA 4EYOA 3QNWA 2E4ZA 1M75A 3I2KA 1NIJA 3MCZA 4UARA 5E1DA 4AG5A 5B2FA 1PFKA 4CF6A 4YPVA 1KOLA 1QYRA 3NOXA 4V02A 2R11A 1AHIA 4IW3B 4TWZA 4JNKA 2B8WA 3TE7A 5BURA 4OQDA 2P2YA 5D8DA 2ETXA 2QA5A 1C8LA 2NV0A 5D5HA 2NO9A 5A02A 2P1DA 4IG4A 4OV6B 3QWAA 3WFJA 4LYYA 5IVPA 4NFYA 1LBTA 1A76A 1PT5A 1QPBA 5KHOC 2G70A 1YB2A 2BZSA 4K28A 4REMA 4EY4A 4MQ5A 3BBLA 3HGMA 2FPMA 3ESAA 1EUQA 2LZ0A 2K7ZA 5EHGA 4E5SA 3EQ2A 1NPTO 2QXTA 3A3YA 3A37A 1RMTA 2Y1WA 5M7EA 4GPIB 1R9JA 1UEIA 4WJZA 1L4KA 1SWVA 3QWHA 5E6UB 3R2JA 3VU0A 1IWOA 1RXSA 3GA0A 2QYTA 3DC7A 1UOPA 4C4XA 4IIEA 2H48A 2P9YA 3H5AA 3NIFB 4AECA 1XVTA 1OX4A 1XKLA 3LOPA 3CWCA 5KBYA 4HAVA 5K9ZA 2BI4A 5DSXA 2J1LA 4PPQA 2DLNA 4XB2A 1DFHA 1QIDA 1CUVA 2PHZA 1JIKA 3OZUA 4PYIA 5CAEA 2OBFA 4ME6A 3TLBA 5K51A 2JASA 2JA2A 5KJCA 2WYOA 1IULA 4GG1A 5CJPA 4ETIA 3IAEA 5JCPA 2C54A 3IAHA 4OA8A 1DINA 1YZKA 1WNFA 3SHWA 2HT6A 1ONOA 3L84A 4MS4B 2XIQA 3CQ9A 4LJ8A 3PNSA 4RNCA 2IW3A 3X1DA 1IJBA 1E9FA 1GG9A 3SR0A 2IS6A 2XA1A 4P86A 1PW7A 2PEZA 1BYUA 4Q9DA 4Y2QA 3RUAA 3FZGA 4ZMRA 2IC5A 1E1NA 2GBCA 5MGBA 1DI0A 1CUZA 2C2WA 1HMYA 1R8YA 1OPXA 2FMHA 3LKVA 4EY5A 4KIWA 2XKJE 2X58A 3GH3A 3VQTA 1YQEA 2ZYTX 3UK0A 5A6SA 2DERA 4NC9A 1ZRNA 4A2CA 2OILA 3BCUA 4QTUB 2Z5VA 1XBTA 3TL3A 5B6JA 1QG0A 4IOMA 3SIPA 1K5HA 1CIJA 4K9NA 4B7CA 1H66A 2ISSD 2WQ7A 1RC0A 1VA5A 2FVYA 1JHVA 4JP3A 2A4KA 4P33A 3T52A 3JQPA 4DRXB 2Q6KA 3AM1A 2E1RA 3F7MA 3Q11A 2E21A 4H6PA 4WA8A 4OUKX 1Y37A 3A3NA 6CHYA 5KYWB 4FMPA 1ZNZA 4EGFA 5EJGA 3E7DA 1G7SA 1K27A 1ZISA 4KRYA 2W22A 4MUEA 4UREA 4I4TF 4TYNA 1DKRA 4HSEA 4XLZA 4JB0A 2Q6IA 1H2BA 2ZT8A 3HC7A 2R4TA 3D3JA 3MF4A 5DXAA 1DEHA 1MR3F 3DAGA 5G2OA 2DOKA 4WK6A 2NAFA 3LBHA 3FOBA 5ELMA 5F64A 3EIUA 1XK7A 3EEIA 2A1UA 3S29A 3UMFA 4MDEA 1SIBE 5K0BA 1X1CA 2FXIA 2NO1A 3FNFA 3C6YA 1G21A 2IV2X 1YI1A 4A26A 4C7JA 1M5RA 4YWJA 4DMLA 1A98A 4PFJA 3SSOA 3W1VA 4G0QA 1DMRA 5BVHB 5SY9A 3HY6A 1I24A 1ES9A 1RRVA 3WO0A 3DG9A 1FUIA 1DTWB 1M7BA 2IY7A 2BMVA 4OUDB 2X9GA 4Z86A 1I1QB 5JG7A 1PJBA 2WINI 2H00A 3C5CA 4Z0NA 4FONA 5J58A 4U2BA 3TOCA 5JH7A 4BO6A 5L9AA 1BS2A 4JGIA 3L0BA 1UL1X 5EWJB 1XDBA 1T8SA 3LUHA 1T0PA 4IHQA 4KI0A 4NBUA 1WUIS 2C7RA 3VYRB 3BK7A 3DZJA 1CKEA 1O9BA 3LT4A 2ZIXA 4HDRB 5LM3A 3E48A 4RLSA 1JJBA 5JZMA 1VB5A 4P53A 4D0NA 3PNQA 1I33A 1QIHA 1JHXA 2MR5A 2XNJA 2GFHA 4FYXA 3KELA 2Y6VA 5BMVA 4Y0NA 2NZWA 2VFAA 4NDNE 4E7PA 4O4HA 5A9SB 3E8SA 3WK4A 1PO7A 2ZANA 1THMA 5H82A 4CETA 3I61A 2Q41A 1ADBA 2D1SA 1B8UA 1Q0LA 3PNOA 2HNKA 4IQ8A 3VJMA 1A7KA 2FUG6 1AF7A 1IZZA 1CP3A 2ADMA 2JPDA 3NAZA 1T2FA 2NGRA 4EOGA 3QVGB 5HRAA 1A8HA 1HZJA 5D6NA 5IZ4A 2BYTA 3NWEA 4JI1B 1KMHB 4DLRA 3K0FB 3HJUA 3ZV7A 4BOYA 3PT9A 3BD7A 4FE3A 4KVFA 1GQ2A 5FWYB 4BNMA 4FB4A 1L9XA 3IMFA 4NMHA 4E14A 1TC1A 2Y1DA 3E5NA 5JFOA 3R5SA 1Q17A 2CNWA 1RDFA 3K35A 4L9SA 1YR1A 4CM9D 3WWDA 1XQ6A 1VZ2A 3O8LA 5A4FS 5J4HA 1EM8A 2XRFA 2Q28A 3DBRB 1O58A 1SQ6A 4PYRA 5I7UA 3B3QA 2XTNA 4L8WB 5JR3A 4KTVE 3SC6A 4AUMA 4BV2A 4YT5A 2I1QA 4GVXA 3T7IA 3KR2A 4WBNF 1Y6JA 3UNXA 5HYVA 1SZDA 2DFKB 4GHWA 4PRYA 4UULA 2FW8A 4Q4LA 4XWAA 1PF7E 1Z36A 1W4LA 1FP7A 1XTPA 2CNWD 3KHKA 3RJTA 1N3YA 1SVWA 3IXMA 1TVKA 2C4TA 4F97A 3A9TA 1HE3A 1JTVA 3CINA 4J29A 2D2XA 2IIQA 4J1SA 1RJDA 3IEIA 3FOAA 3HA3A 3N7UA 4DGQA 5JD4A 1P2UA 5C1DA 1E89A 1WABA 3C8ZA 2EZTA 1ZHHA 5JDCC 1P61B 5BUQA 1U8FO 2C82A 2WUEA 3M1LA 3N05A 4N3GA 4UKDA 2DBRA 2IZ5A 1XI2A 1Q0HA 2YWJA 4PAOA 3DMTA 2WU0A 4AT1A 1TRHA 4PLYA 1A77A 1R4NA 3V2IA 3A1FA 2P90A 3KT0A 1L4LA 3WI7A 2IHUA 2JARA 2ZB4A 3AUFA 4OM7A 1S8FA 2E7ZA 1NXSA 4FYPA 4G01B 1DRKA 3PBKA 3WAJA 4G5HA 5H3HA 2BL4A 3PCXA 1U7UA 3GXOA 1LXCA 4KX3A 4HH4A 4ZO6A 4ER0A 3CLRC 2QP4A 1ESEA 4GVPA 4DGSA 1R5OA 2O5EA 1O87A 4OMCA 5FBLB 3NWBA 4YFYA 5FPTA 1L1FA 5KO2A 3P9XA 1BJKA 2CN1A 3SZOA 2C92A 3EIWA 1Y3AA 3ABSB 3OCVA 1DG3A 2C84A 3INYA 1CRZA 3CUWA 1T0BA 1N2BA 4GP6A 4MR9A 4LHYA 1RBYA 3O92A 1ZG3A 3CW2A 3FB1A 5ALGA 3KJFA 4M1TA 5CDTA 1EVQA 3PUIA 1LVUA 3AKDA 3V2UA 1D0IA 1ZC3A 4RSMA 3KOYA 3S99A 2R2AA 3VYTB 1F8FA 3GLVA 3N3AC 2AZDA 1RM4A 2JIPA 4LOLA 3U48A 1GPAA 4BJ6A 3ZV4A 3ER9A 4RCVA 1M1YE 3C3WA 3HFGA 4YQYA 5H83A 3CR7A 4NU0A 3OTHA 4Q01A 3KYCA 5C1BA 4AO8A 1R4AA 1ODCA 4ZKDA 1INLA 1S9HA 1YR6A 2HV9A 4R51A 4TXHA 3O8QB 1A2KC 4CMBA 4MPDA 2PV0A 2AR7A 3EZNA 2Z6UA 4D43A 3TECE 4NJMA 1BXKA 1EB8A 3MHPA 1XEFA 1R3DA 3T38A 3KTAB 5HKAA 4ENQA 4HN4B 3WZ2A 4ITVA 1K5PA 3FSGA 4LMBA 3B52X 5H02A 3ZDAA 1U7HA 1BW9A 1MQSA 2MIIA 3CEHA 4CL0A 1JXQA 1LLCA 4I4TB 2Q0XA 2P1ZA 3JY6A 3N2GB 1W5TA 4MQLA 5JD3A 1RLMA 2AJ8A 3OLQA 5JXWA 3NIGB 4BLWA 3LDUA 4JFRA 4Z9BA 5UKDA 4ZDJA 3RVDA 5HJEA 5KNLA 1UIMA 2ZPAA 1ZRSA 4I1VA 4ETMA 3ELUA 2PFKA 2CV1A 3LECA 3FSGD 2ZWMA 1F8UA 4LPKA 4QFDA 3A1DA 5EQFA 5ICSA 3PDCA 4ZCRA 2DUMA 5DI3A 3M6AA 1OLSB 1JDBB 3FPSA 4U7HA 1JHPA 1JZSA 1MO5A 1AGYA 1N0WA 2JEZA 2FF7A 1VA4A 1V2HE 1LI7A 1D6JA 3V4VB 4ZT3A 1E0SA 2I2FA 3FSRA 4UJ3A 1P0MA 3ZCVA 3PUWA 1D9ZA 2UV8A 3JATB 4PIPA 5HW0A 4ND6A 2UYYA 5FI5A 5LBTA 3GK3A 4A92A 3WIUA 4A23A 4YV2A 5FPKA 4JFAA 5IJ0A 4TN5A 1P2VA 5BSGA 1RJWA 5GQSA 4EIWA 3KM0A 5CB4A 1NN0A 1QQ7A 4GP7A 1CR2A 1GNRA 5KJEA 3WLLA 5HVNA 5BSRA 1R0WA 2GWHA 3NTUA 2FY8A 2WHEA 3CSUA 3PP8A 4MI6A 1F9AA 4CCYA 1D7OA 1Q7CA 1T4MA 3AEZA 3C8UA 3WRVA 4DCTA 4FE7A 2GBIA 2IT1A 3EVCA 3GFGA 2DHEA 4EW6A 4RMGA 1CUIA 3PD7A 5EZ5A 2A6PA 3ZJVA 4LF6B 4NY1A 1RLJA 4ZHQF 1NQXA 1TOAA 3UWPA 1Z5GA 2CHUA 2P62A 3E8MA 5H5JA 4HRXA 2HXYA 1PK9A 2JGIA 4E94A 1M6VB 2ST1A 2Z5FA 1M1ZA 3DKVA 4TKUB 3C39A 1CEEA 4FN4A 4V1CB 5JAUA 1CUGA 1QE0A 4PLCA 1BVRA 3SJAA 3LUJA 2V0GA 2AYYA 2P6RA 2VRWA 4ZI7B 1MZPA 3L7IA 4F21A 3G0HA 4RORA 3IBTA 3WDLA 1IXYA 2QV0A 3L18A 3EXIB 4JU9A 2X8JA 1I80A 1LW7A 2QNBA 3DWFA 4PX3A 4XJXA 4X66B 2RGRA 1HY3A 1BA3A 4G1CA 1OY1A 1LRKA 2PGLA 4YMSA 4CIAA 4P1ZA 1H1LA 1LS6A 1IK6A 4B3BA 4NCJA 2IXBA 1I94B 2ZZNA 3NYRA 5F2NA 2FJUA 4EI2A 3V4PB 3NVDA 3MBOA 4PANA 3GC6A 3AXTA 2ZBRA 3PS9A 3H6GA 1SBTA 5AKXA 4LOKA 4PSVA 4WBNB 3PDIB 3PRJA 1M8PA 2GXSA 3FCAA 3P2OA 3P9CA 3X0DA 5JOQA 3SWWA 2X9LA 2PX5A 4RQAA 1FP6A 2FMTA 4ZV7A 1E7WA 2V3WA 1KSHA 2PK3A 2WHXA 4CM6A 4DCJA 5LJLA 1C0LA 1UBCA 1QRSA 3QVJA 3DZHA 1ISHA 2WM9B 5FD8A 4QPPA 3RK4A 4TUYB 2XVMA 2LBPA 4L3VA 3H4TA 4W8OA 1FQWA 3TS1A 1IMJA 1ZX1A 4BB5A 2Z83A 3O3CA 4K8RB 2YIJA 1YS4A 3M4NA 4HO1X 5ALKA 3SPXA 4ZYTA 4K9QA 4ALIA 1ZN2A 3HV2A 2HGZA 3Q0EA 4QL3A 4MUKA 5L3ZA 5KQGA 1UZAA 1L4BA 5DN9A 4QOHA 4IMPA 4FFOA 2ZSEA 4YJ3F 1TM2A 2Y1GA 2XT6A 3M1AA 2I6SA 4LBZA 4LYDA 1RW4A 1V7ZA 3IUBA 4OIMA 1WZIA 3H86A 4I5DA 1T4GA 4ZHSA 5CNMA 3DNPA 1PDWA 3HCNA 3S6JA 2BLLA 2QW8A 4XLTA 1G41A 3R24A 3RSQA 4BNZA 1FP1D 2FKAA 4MICA 4D02A 1V8BA 4NEQA 3U7HB 2W6PA 5HQ3B 5B37A 2ABWA 3N8HA 4PYNA 1XRJA 2EKPA 2F1OA 3DZFA 4IF4A 4LVUA 1GQFA 2QMZA 4EG6A 3FMOB 3L8YA 4ESVA 4IX1A 3NC4A 3FMVA 1V3TA 2Y4OA 3NZEA 4F5WA 2NZ2A 1T9HA 4X92A 1I2DA 4BNGA 4YQEA 1SVOA 4UBOA 1Z16A 1CSEE 3CLUD 1RPAA 1TCAA 4Z7NB 4Z0TA 4K2HA 4UZEA 2I6UA 2ZBEA 1Q92A 4XGRA 5LU8A 3ISJA 4HUQA 5CT6A 1YB4A 4W6QA 2OVBA 1HL3A 1VL6A 4Q4AB 4II7A 4N41A 3R7WB 1E3LA 4L73A 4NOJA 4BO2A 3VR2A 1N3BA 1NW6A 3AJDA 4E5VA 2Z9DA 5ALIA 3FM9A 3T3EA 3EXAA 4MARA 1KFCB 2C4UA 4EMUA 1E3QA 3L9XA 4R4JA 1SH7A 3EUFA 3CG0A 1Y1SA 3LVFO 3Q2KA 2ZRMA 3HN7A 1G2QA 5ITZA 4OATA 3D3EA 2R1TA 3KJEA 3CR3C 3QE4A 1FYVA 2HIHA 4NZOA 1RQGA 3EUWA 3TQCA 1JKMA 5A3QA 1FFWA 3ML1A 3VR2D 1SCKA 2WMOB 1OYVA 3DO5A 3GLGA 1Y1TA 2E89A 3RU3A 4LOHA 4B43A 2WOOA 3F6RA 3NLLA 4MW2A 1RRKA 1CR6A 4D4HA 4CV1A 1TQ4A 2WG2A 2ZWVA 3K0CC 3QVKA 1GPYA 1QANA 1AS0A 3OZDA 4J0DA 1XNRB 2JAXA 5F9MA 4IIBA 2DFLA 3QV1A 1HDOA 3C74A 4TMYA 5EZQA 3TFWA 3TQSA 4CIYA 1VCHA 2PWBA 2OCPA 2FU5C 2VO1A 3LH5A 1JEAA 4Q3NA 1DWPA 5BN4A 1USIA 3K2EA 4RF4A 2ZIWB 3BMQB 1NUUA 2BFNA 3I0MA 1U0GA 4GVLA 1VQ1A 3MT0A 4GYYA 3WKEA 3QMMA 4LTDA 3R9KA 3H1GA 4HS9A 4CV3A 2G1PA 3VSEA 4QUBA 4PGAA 3IRVA 3GRUA 1N5LA 5AXDA 4AIIA 4YACA 2PVPA 4H1VA 1A4RA 1G8MA 3JAWB 3COJA 2BCGY 1OX6A 1A7UA 4I66A 3SI7A 3UMVA 2XI4A 3CC8A 5HPYB 5IFKA 3MTBA 3RC1A 1BU5A 3BMOA 3SR3A 1QO0A 2ZSIA 3OE4A 4TV9F 2WWWA 4MEBA 1G3RA 1CNMA 3T61A 1WY5A 3TM4A 3WDSA 1X7DA 1XR3A 5ICFA 3HDTA 1TM7E 3TQOA 4BNJA 3ISVA 2QE6A 4I6EA 2GCPA 5FUXA 5HF8A 2W4QA 3QEAZ 3DDNA 3NC0C 2JH3A 4KXUA 1VXOA 5CGQB 1Z45A 2YXPX 3EVFA 1T15A 2OZLB 1LB1B 3B9PA 5GGYA 4TKVA 1S96A 5EZ6B 4BDSA 4TMKA 2DLCX 1BDHA 3AESA 1QO0D 4CMCA 1P31A 3EAQA 1CJUC 1QF6A 4B85A 4EF5A 1R12A 4GNKA 1NJGA 1QYIA 2FWMX 1KQGA 1D9XA 3O1LA 2WWHA 4R8SA 6LDHA 1I6WA 1A5SB 3L1UA 5SZJA 1Q3TA 1VHJA 4U00A 5K3OA 5LWQA 1FNCA 3F9RA 3A2KA 3PC2A 5CR9A 4YP5A 5HF9A 1A9QA 3O0DA 1NQWA 2I71A 4PAMA 5IC4A 3O3MB 5IU6A 3O0TA 5KU7A 1XHEA 4OOFA 3D8BA 5F5NA 1RVV1 1A4UA 1SD5A 5ERYA 2VHTA 1F5NA 2FX5A 3E7FA 3QUQA 4BUJA 1EWTA 4XYGA 5AR1A 2CUZA 3OOJA 4F6LA 1L5VA 3DTVB 3MLBA 3SQXA 2IH2A 5KDDA 1TAUA 1DKLA 2FEOA 3UUEA 5DISB 1WUJS 2UVQA 4L7VA 1OSNA 2ZKIA 1Z34A 4WZAB 2SBTA 5FHRA 1POWA 1FVHA 3NBZC 1KEVA 1G6KA 5FLKA 521PA 4LN1A 2QTTA 1DQRA 1GGHA 1W0KA 3VSBA 4LYJA 2BE9A 3LZCA 4X8OA 1T3SA 3A6EA 3VNQA 3NJ8A 4DA9A 3OEEA 4JBIA 1GL6A 4RETA 3R09A 5LZ9A 3ZZ1A 1L3IA 3BDVA 1P1BA 3OJWA 5DYYA 1F20A 4GOJA 4Q19A 3WRWA 3UH0A 3II6X 2GPWA 3URKA 2AEEA 2QTRA 5J2UA 3AM3A 4XWKA 3PSAA 1J23A 3GNTA 1P80A 5C31A 3W5CA 2Q1UA 1W0KD 1KI8A 1OZGA 1T9BA 2FOXA 2OENG 1ZM2A 3BB1A 4M1WA 4PEVA 3OEED 4YI5A 3T7CA 3TW4A 1P2BA 2ZJFA 3B2NA 2H1OA 4EJ6A 1HDEA 4C7BA 1Z6YA 2GJ8A 3E9NA 4KGXA 4W7IA 2IPAB 4ALLA 1Y8CA 3MOSA 4NBSA 2NVUA 5CHYA 4DQ0A 1ID8A 1BXGA 1NY6A 2R4UA 3H99A 1KVSA 4JAVC 3I37X 3DF9A 5HOQA 4KWTA 4AIRA 1ORVA 3Q9UA 2UZ4A 2Q8QA 4J4HA 2I34A 2H0AA 1K98A 4B3HA 2ZI4A 3GQVA 4JJ4A 5P21A 2VJKA 5CNKA 5GVSA 4DWVA 5DDIP 2ZT6A 1Y4SA 2ZRKA 2ZITA 3JYLA 3TLEA 3PNYA 5B6IA 4RZ2A 5AK0A 1TT5A 3LA6A 4RD1A 3F8SA 2CVOA 3KS9A 3HXTA 4IH1A 1CEXA 1ZU4A 5EXXA 3NV7A 2WWVD 1XCJA 3ZE9A 4WCDA 2SCUA 2ZXUA 2RIRA 5AXCA 5A06A 1IONA 3UT6A 2ORIA 2TMYA 3L8CA 2JFUA 1G5TA 4MGKR 1ISPA 5G4KB 1I5RA 4PZAA 3VVBA 1Z47A 2AGVA 1OWLA 4RD0A 1FU7A 5J2TA 1QX4A 3U3KA 5H68A 4EQ6B 1Q0RA 2UZ3A 2Z57A 2NPFA 3V3TA 5A3VA 2ZUVA 2A0FA 4EMTA 2H92A 1JILA 1TM4E 2QSYA 4F6RA 4C43A 1KAQA 3VDMA 1JKJB 1DFIA 2J3EA 4J0IA 4UHJA 4D0LB 5JANA 4IRUB 3OFSA 3LX5A 1HA3A 5AP9A 1RZRA 2DQKA 1K0FA 3EXEA 4HQOA 3CTMA 1JG4A 2MINB 4OFXA 1WKCA 2JZOA 4QEDA 1K4KA 1MAUA 4TROA 4RGYA 1VE1A 2YVQA 1U0NA 3WNVA 1PFYA 1F2UB 4CN9A 4CT0A 4DBLE 4BAUA 1NHGA 2JFWA 3C5EA 1VSVA 3FUXA 2ET6A 4MA0A 2ZJ0A 3V9AA 3VU8A 4HQRA 4B74A 3RKRA 4Z9YA 3AL2A 1TF2A 5K8LA 3AUSA 2IPMA 4DQKA 2JGLA 4FINA 4IHJA 1XLTC 4BKQA 1WULS 1YNSA 2Z08A 3O75A 4NQZA 4C0HA 4YUYA 1C81A 3LE8A 2OAQ1 5FKJA 3FI0A 1Q11A 4WZBE 1YQQA 3EXG1 4GQBA 4MAFA 3TPZA 3O4JA 4OQQA 4P7BA 4A6PA 3D4NA 3PFWO 1G2OA 3CW9A 3ZDQA 3GLFE 2W6QA 2IUUA 1NN1A 3RBZA 1XA3A 2DZDA 4RDHA 5ECGC 5IFLA 4X8LA 4A0QA 4LXXA 1AV6A 1REQB 4D97A 5DM70 1QR6A 2RB4A 4WLNA 4HUJA 4PVDA 1K2VN 5HK8A 3VH2A 2RH4A 4LHWA 4MRAA 5D3QA 3SQWA 3I73A 5E3IA 3I09A 1X1AA 1JU4A 3Q7EA 2PD4A 5CT4A 1TCBA 2B8TA 5AKHA 3ZKAA 4C1BA 4DOMA 4EFDA 4Q7QA 5JNTA 1KMCA 1PU2A 4FXPA 2EP7A 2CV0A 1NJ8A 2HZ7A 4HJRA 5EMLA 2VOEA 2IU6A 4RENA 3WYCA 1RCFA 3EAGA 4C03A 4RZUA 1HL7A 4BO1A 2J0UB 1Y3IA 1ZCJA 3OQPA 2YQ5A 3FRHA 4ZCMA 2Z43A 4ZO8A 3SS7X 1E3EA 2ENWA 1L5OA 1NMYA 2H11A 4D0RA 1EGVB 1KH2A 2HMTA 2WOJA 3IB3A 3E35A 1U8YA 3LHIA 2G7ZA 4HKTA 4JLNA 3QXGA 4X9XA 2C7BA 4P5EA 3RYHB 4B2LA 3L1HA 4RE5A 3V2GA 4ZT2A 1TFUA 3LKZA 4B31A 4BQPA 1J9ZA 3RASA 3RUDA 4G0YA 3AF6A 4E3WA 3H04A 4IRMA 4KDRA 4N82A 3B6IA 1KI6A 3LBIA 5KNBH 3FTPA 4B87A 1NA5A 4LE2A 2Q3BA 2IEZA 1QTRA 3NBXX 5DM2A 1Z4LA 1ODLA 2B1GA 3NHAA 4B4OA 1SEPA 1TVEA 3GCDA 1U9JA 2CUKA 5BPFA 3ROXA 2UZAA 1ZD5A 3M4ZA 9GPBA 1X7XA 2DM6A 4GZ3A 4KAXA 2QBYA 1WSAA 2DFNA 1NURA 5C8YF 5GADl 1C1DA 1EDOA 1UIRA 4U2GA 3A6FA 4R1QA 2W2KA 2IVFA 2FN4A 4O2BA 3CXRA 2QTMA 3PNKA 4EX6A 1US8A 2XQFA 2YV2A 2PX4A 1X2EA 4ZIRB 1O9HA 3DDWA 2VVTA 2JCGA 2X8LA 1HEUA 2IYAA 1NQ5A 4Q16A 3VC7A 3ZE2B 1N1GA 1XKXA 3RCBA 1NW4A 1BE1A 3EIQA 2X9VA 5L3QA 2D5BA 2XRZA 1JPUA 3QTBA 3QMPA 2JCBA 4M0PA 2Q45A 4X1OA 3GFRA 2P5SA 3LFUA 3SMQA 4PO3X 1LBQA 4F2PA 3CVXA 1J33A 4G0OA 2WDZA 4TXLA 5DOVA 3TCXB 3KJZA 4Q00A 1ACLA 5E6SB 1TJPB 3H13A 4FZ5A 4IIGA 1KE2A 1OBOA 2X5JO 2WB4A 4YAUA 1P7YA 3R3WA 3QSYA 3PYMA 4MVJE 3U4QA 3EH1A 1DE0A 2WUWE 3AEKA 2YVAA 3EDYA 3GEIA 4OIFA 1X7WB 2BFCA 4W6ZA 4BWGA 5EJ8A 4F38A 2BEWB 1FNSA 2VP3A 1ZU5A 4MI3A 3JSAA 3RB8A 2QN6A 3OQIA 4LBVA 3VPFA 1UJNA 1TO2E 2CJFA 3A0UA 5LYJA 3L77A 4IZIA 1BFDA 3WLSA 5DHQA 1Y48E 2JD2A 3ZH2A 4N9QA 2OFWA 5C8XA 2IJGX 1XG5A 3OCWA 1GKYA 1KQPA 4G4SO 5ELLA 4BBPA 4YCDA 4DAOA 3CKYA 3G9XA 4TQAA 4WKNA 5JCXA 5LOVA 1YA4A 4RZ3A 3LCVB 4HLUC 1GPLA 1W35A 1MB9A 3RU7A 8ABPA 3UG6A 1SC4A 2W6OA 1MA3A 1TJNA 2EU8A 2J9GA 5CH3A 3M6MD 1QWSA 2I4OA 2LV8A 3KE9A 3OC6A 5JCZA 2OCKA 2HU8A 1MPTA 4GZ6A 1U2GA 4G1VA 1HEYA 3KWFA 4I14A 5M3BA 1HR0B 2B7LA 4BFUA 1WMAA 2PXXA 3EFHA 3IQGX 5HIJA 1Z4QA 1IYZA 4EH1A 3J81k 1XU4A 3A27A 4AU1A 2PSDA 2RG7A 3S5UA 4NE2A 3TCKA 2XD9A 1GPJA 3TMKA 1U5BB 3R5JA 3JU3A 1AF4A 1WM1A 1Z2EA 2BHRA 2GEUA 2Y2VA 2ZR7A 2J9FA 2XH8A 4MS1A 3GT3A 3M7IA 1T4BA 4ZVRA 4CG2A 2DLDA 4PZ9A 1CUYA 2MOKA 4H77A 4CTOA 4D4LA 1X80B 4DCPA 1D07A 2CCGA 3KPWA 5EJ5A 4JVLA 4UQOA 3GJ0A 3FCSB 3DCNA 3OLYA 3HSKA 3KZVA 3OT1A 3ZZTA 1JDPA 5FTJA 1E94E 1I7PA 2FAXA 3FLMA 2PMBA 1P0IA 3UJBA 4I1SA 3NG1A 5J1TB 2X0EA 1EFVA 5A62A 1YZUA 2MYTA 3RSOA 2XUIA 1LC3A 4YREA 4YCBA 1M3SA 1VL5A 3EZFA 5L6MB 1DBSA 1XCBA 4B81A 4RVDA 5L7YA 1GR1A 5C5DA 3U7FB 3PJRA 1EVKA 3GEEA 1W4AA 2BEKA 4OI4A 1DNPA 4EHDA 2ZWPA 4AJNA 4AWXA 4YRIA 2FSVA 2PD3A 2QL9A 1O6ZA 3LX4A 3COZA 4LE0A 4BWVA 5H3LA 1MG0A 4MW9A 3IHTA 4EHFA 3KKMA 1O5OA 1VJRA 4TVBA 4MKHA 4AUKA 2J30A 3ZWWA 5EIHA 4RWEA 3STHA 3HLYA 2VKTA 3GMSA 5K6AC 2Q4TA 3ZE1B 4D9MA 4A5OA 4KPGA 1AK1A 2RIPA 5B12A 1E1MA 1GRVA 1IHXA 4AS2A 2HPHA 5B3AA 4D5GA 4KIFA 3AQ4A 1PWXA 2DQ4A 1JE0A 4AUEA 1EP1B 4M1KA 1X13A 1XYGA 1VFNA 4G4SP 1QYCA 1YRBA 3IOCA 4XX0A 2A1IA 3DHVA 5DCLA 1JJVA 1OA1A 1W49A 1MEEA 1QP8A 3QXHA 4DBVO 2RE8A 2OZPA 3LFTA 1UWLA 1QC5B 4JJ7A 4YECA 3AI2A 3R74A 3B2QA 3IUPA 3W34A 1U0BB 3BB3A 4FR0A 4J76A 3UK1A 5L3VA 1G3UA 1V9CA 1DSSG 2ZYIA 3AEQA 4RLQA 5EZYB 4CT4B 4IDAA 3JD4A 3UYLA 5HZKA 1JBKA 4G5QA 2OOSA 2PS3A 2PZAA 4AF7A 1T3ZA 1YCFA 4H7HA 1WRBA 1L9KA 1TLFA 1SB9A 1VL2A 4AY6A 1WPQA 1K75A 1YZHA 5JXHA 3RSHA 2HB6A 2P3LA 2V5VA 4O08A 1QH1A 4QFMA 1W85B 2XUKA 1SZJG 1KY5A 1DT3A 1K7CA 4FW9A 5AM0A 3I01M 3ZVLA 5BMVF 3K16A 2FQXA 4FIZA 2V6MA 5B7QA 5JXJA 1TZ2A 4O4HF 2WTMA 2I9PA 4NCXA 4BNHA 1JDJA 1Q22A 1U2TA 1UC9A 1CE8A 4HRYA 3LDAA 2ZWOA 4JENA 4D2IA 3GFPA 1D1TA 4E2YA 3GJ7A 2HK6A 3AJRA 3K6SB 3WR5A 3E9YA 2HJVA 3KVNA 4KQXA 4YPOA 2IXAA 3A32A 3SQMA 1K6MA 1W5AA 3DL4A 1W48A 1D4AA 2WZDA 5HKLA 3ICCA 4B9EA 4F4JA 3EH2A 3JWHA 1U98A 4QPJC 4EARA 1MQAA 1VHLA 2A0KA 5E9QA 4ZYXA 5JECA 3FTFA 5ALFA 2MWMA 1MT0A 2XMBA 1THTA 1ZIPA 3FHLA 2XSZA 2PNFA 4RCZA 3RSFA 3UV6A 5FOTA 5JWRA 4JXZA 1AXEA 2G06A 2G72A 2C1EA 2POCA 4GWGA 2EBWA 1O1YA 4P80A 2R87A 3VV3A 4IJWA 5ENVA 3L40A 1G20B 3RUEA 2PUJA 2IITA 4G1FA 5I4BA 5DM0A 3M81A 1FLNA 2XSZD 3IAS1 3K8YA 2HDWA 2EFEB 3C7AA 1BX1A 5GV8A 2WW8A 4RTKA 1YRAA 4TZTA 1RIIA 4OCZA 1JQEA 2TRSB 3AG5A 4PU0A 3WNZA 3JYHA 4JSTA 5AKKA 4BMNA 4DCCA 3DV2A 3C3EA 5DLPA 1OAKA 2B69A 5HE8A 3ZCRA 1NBMA 1ZMOA 2LXNA 2O05A 2C5BA 4IIUA 3INGA 4TM8A 4WN9A 3VOSA 3WDKA 2D6FA 2DSTA 3C6XA 1FLVA 2Y1LA 2DKFA 2BGWA 1KK0A 2AG8A 3QUAA 1KORA 4R2HA 2YZMA 1UT8A 1WU7A 1F5SA 3C3YA 4UHFA 2X4DA 1NVTA 3ZWXA 2JRLA 2Y67A 4DREA 1Y9AA 4ZAXA 4NH0A 3MTEA 5KOJB 2JW5A 5ALOA 1JT2A 1II8B 1NBMD 3GGJA 3OX1A 4M0FA 1K66A 4X24A 2IEBA 3UC9A 5IC5A 2WU8A 1B7GO 3FZYA 3WSTA 5J3JA 2QUBA 3FJYA 1GGNA 1NW5A 4BU0A 5C7LO 1H1TA 3OTQA 3A9SA 3RG2A 1DWUA 2VSXA 3ONWA 1CQZA 3MBIA 2EIXA 3ZWAA 1HDGO 3OPQA 3B1XA 4X7PA 1E2FA 1HRDA 5AOAA 2XUGA 3U3DA 5BNWA 1HNNA 2N46A 1E1QA 1N6LA 4XD7A 1XTBA 2RHBA 1FS6A 6AT1A 2WJWA 1H65A 1IUNA 1YIAA 4L95C 4MLPA 3GEMA 5DK4A 5NLLA 5KMGB 4ZTUB 3QM1A 4HMOA 4FGKA 2PLNA 5K20A 3UPTA 2VNKA 4K6CA 4OHOA 4W7SA 4HMQA 2DUJA 1VC2A 3E7PA 4XGKA 5AHKA 5EWLB 4BX8A 2B4RO 2VP4A 3WNQA 1E1QD 1EQ2A 4XD7D 4ARZA 1SZPA 3F9CA 4G56A 2O2DA 3O8CA 1XOIA 3ORYA 2R6R1 3OBBA 4L4XA 1L4NA 4LHVA 4LXGA 4RKQA 3WG9A 1H22A 5I9LA 5DFAA 3I83A 4LX0A 5AJWA 1A9TA 3CSDA 5DNCA 3UQZA 1EUYA 2QMEA 3AO0B 3DZKA 4KN9S 3VNAA 4MPPA 2WHYA 4DQVA 1C50A 3ETGA 1BG6A 4RZXA 5AWFC 2HMAA 5FR1A 3QLEA 4NZNA 1OBCA 2F90A 2MHCA 3INNA 4GYKA 4EGQA 4UQLA 1L8OA 1I1HA 1WXDA 1KU6A 5K0ZA 1FYDA 3R7LA 4B6JA 2C61A 2PAAA 2COEA 5F2EA 1F9EA 3QMVA 1AQNA 2IEYA 4B8YA 1GCAA 1SJ9A 3QKSA 4MVXA 1RLOA 5EJAA 1O3YA 1UJBA 4Q7JB 4RVNA 4YRDA 3UW1A 4TRJA 3TRDA 2PQ0A 4E3ZA 2V7UA 3BH7A 3SZMA 3CJQA 3SBOA 1U7DA 1E1CA 5P8WA 2SNIE 1I9CA 2XDAA 1IZ7A 2AF3C 3RS2A 5KUTA 2ESRA 3ELBA 4RW0A 4Y98A 3IEUA 3G17A 2GJAA 1AUVA 1PUJA 3LGXA 3WGYA 4CODB 3P0EA 3PQEA 3AOEA 3NONA 3WY9A 5HK9A 1Y6GA 4RNDB 3RVMA 2HJGA 3GELA 3LRTA 2O3RA 2RAVA 1E8MA 5K8IA 5CB4F 1KZ6A 1CZKA 2Z2KA 3FRIA 3D8HA 3O8OB 1XVVA 3H1PA 1JLLB 4YDHB 1X39A 3V1YA 2AOUB 2FMFA 1AN0A 1EAMA 1TZCA 1HRKA 1VKJA 2AN4A 1FEZA 1MC4A 3DHEA 4K03A 4LYAA 1ZHOA 2FRXA 3KZNA 1AURA 2OZVA 3PHLA 1QDUA 1Y6QA 4KFCA 5MN6A 3PC6A 3SHTA 1WZCA 4UDOA 5BWNA 4LXUA 2QU7A 2HA2A 3N70A 2XCLA 3RIXA 3MWYW 3HKDA 4L6CA 4YJ2F 1G0OA 2FR8C 3LG2A 1JFLA 2JNWA 2PUVA 1HGXA 3GJTA 2D1TA 3DLTA 3WK7A 3TLJA 5KZMB 4CGZA 3P27A 1QH8B 4KL8S 1KGSA 2Y0CA 2C98A 2PWYA 6ABPA 1R6XA 3BSSA 3QJYA 2ZSHA 4GBED 4CCAA 3EC7A 5LSAA 3E15A 3PJGA 3Q2IA 4YONB 3MMZA 4GPZA 1JG3A 2D59A 4HLDA 5F76A 1YZQA 2ZT7A 4GX5A 1Z0IA 5A71A 2RH5A 3ROKA 3ZD8A 3KXIA 2HR1A 5D85A 2JANA 5AW1A 2O7NA 2ZRHA 3LRPA 1HWYA 1I36A 1PKEA 1ZOSA 4LRTB 5AW8A 4QUHA 2PBRA 4N3BA 1SWWA 1SNYA 4PZ0A 4DDUA 1RYFA