5JROA

The crystal structure of azoreductase from yersinia pestis co92 in its apo form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
202
structure length
184
Chain Sequence
b'AMSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGTPTDLVVPYLRLFLGFIGITDVEFVFAEGADAKTLLAQVVAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-dependent NADH-azoreductase
molecule tags Oxidoreductase
source organism Yersinia pestis co92
publication title The crystal structure of azoreductase from Yersinia pestis CO92 in its Apo form
rcsb
total genus 57
structure length 184
sequence length 202
chains with identical sequence B
ec nomenclature ec 1.7.-.-:
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jroA00
1J9GA 1AG9A 1D03A 3ESZA 1KBQA 4GQIA 2WC1A 4U7HA 1FUEA 1OFVA 2RG1A 1ZWLA 4LAFA 4GI5A 2D5IA 1FLNA 1X77A 2KQUA 1AKWA 1CZHA 2HPVA 1BVYF 2OHHA 3OX2A 4XDHA 2BF4A 5NLLA 3TEMA 4DY4A 5LBUA 2QX6A 2V5VA 3R6WA 4C0WA 5A4KA 1I1OA 1CZOA 4FGJA 4PTYA 5FA6A 5LVAA 1CZRA 1YOBA 4N65A 4QOJA 1BU5A 4XDGA 4NULA 2FZVA 5LBTA 4FGLA 4FGKA 2BPOA 3KAQA 4D02A 2QX9A 3N39C 1AHNA 1J9ZA 1V4BA 3NHFA 3NHWA 1ZX1A 2KLBA 1QHEA 2FLVA 1YCGA 3LCMA 3OX1A 4DILA 4H6PA 1CZLA 2OHIA 2GSWA 4PU0A 1SQSA 5FUQA 3F90A 2BMVA 4QOEA 4ZVNA 1KBOA 1FLDA 1JA0A 5F4BA 3GFSA 3OWXA 1T0IA 4HEQA 2XODA 3L9WA 4LTNA 4OXXA 1AZLA 1D4AA 2FDXA 3HA2A 3LT5A 1YDGA 1RLIA 3NHJA 4ICIA 4DIKA 2X2PA 1RCFA 3NHKA 3UXHA 3NHYA 3FX2A 3OJWA 1AKQA 1SG0A 3EDOA 4QOFA 1WSWA 1J8QA 5LLDA 1AMOA 3NHRA 5JROA 1H66A 3N3BC 2FAXA 1DXOA 4QOGA 2Q9UA 4BMPB 2HNAA 1C7FA 1FX1A 1H69A 1YRHA 1F4PA 1YCHA 4C14A 2AMJA 3B6MA 2B3DA 3GFQA 3KLBA 4YAWA 3B6IA 3OJXA 1JA1A 3NFRA 1FVXA 1B1CA 5LJLA 2ZKIA 3JSXA 1OBOA 2HNBA 2QMZA 3G5MA 3KAPA 4ZVLA 3S2YA 4ESEA 5F12A 1TIKA 3TZBA 1QBGA 3F2VA 4BMOB 3NHLA 3ZHOA 1AKUA 1TLLA 2OHJA 2X2OA 3B6KA 3KEGA 3EYWA 4U7GA 4YALA 1QRDA 3K20A 1RTTA 3W77A 2BN4A 5EA2A 4LTMA 3NHPA 3U7RA 1RLJA 1XT6A 3O2NA 3D7NA 4QOHA 4N82A 5F51A 6NULA 3ES9A 4Y9RA 5LJIA 3OWHA 5TGZA 3SVLA 1AKRA 3L9XA 2MTBA 3OX3A 2FOXA 1XI2A 2Z9BA 3UXEA 1CZKA 5BUCA 5B3KA 1CZUA 3RPEA 3W7AA 3FJOA 3O73A 2V5UA 4LA4A 1CZNA 1YKGA 3HLYA 2ARKA 4LTDA 4QODA 4ZVKA 4PTZA 2MT9A 1D04A 1FTGA 2XOEA 3FVWA 3FW1A 1AKTA 3P0RA 2MWMA 1FLAA 1QR2A 2QWXA 2QX8A 5B3LA 1OBVA 1VMEA 5LMCA 1AKVA 3HR4A 3F6SA 1J9EA 3QFCA 5NULA 5ULLA 1FLVA 4YAFA 3FNIA 4QOIA 2V9CA 2QR2A 3NLLA 1GG5A 5EMNA 4F8YA 4YQEA 2A5LA 3B6JA 3W78A 2R96A 2F1OA 3NHSA 4H2DA 4S24A 4YAUA 1XYVA 2M6RA 1DXQA 2W5UA 2BZSA 1C7EA 4FX2A 4GR9A 3ESYA 4HS4A 1NNI1 3GFRA 5EAIA 4ZVMA 4CF6A 4CETA 3TE7A 1ZWKA 2FX2A 2QX4A 3ESXA 4N9QA 4YAOA 1DX9A 2Q62A 2QMYA 2Z9DA 4M0CA 3F6RA 2MOKA 3NHUA 4C0XA 2Z98A 4R81A 4Y9UA 2OYSA 2M6SA 1E5DA 3N3AC 3QE2A 4J8PA 4Y7CA 3U7IA 3K1YA 2Z9CA 3OVMA 2FZ5A 4NLLA 3GAMA 1T5BA 2FCRA 2R97A 4U7FA 4C76A 5FX2A 1WSBA 3QFRA 2FVXA 3W79A 1XYYA 1YCFA 2N1MA
chains in the Genus database with same CATH superfamily
4C6SA 2BEJA 4HDRB 2G77B 1F6BA 4BBJA 2R7LA 1G4AE 2QP4A 4MLDA 5J9FA 4PPYA 1YACA 1GFWA 4YJGA 3TIFA 1FFCA 4AW9A 4HQ6A 2SICE 4U7TB 1P0MA 1GXSA 1Y4DE 2MIIA 4D5GA 3MT8A 1K7FB 4I3FA 2J6IA 3Q40A 2H92A 4ZQFA 3TZQA 2PFSA 3D7KA 1HSOA 4G2NA 3GPLA 1A8UA 1VLZA 4UXIA 2YYYA 4ETMA 1JN0A 3ZXXA 2HLPA 5I7AA 5AW9A 3ZVLA 1BOFA 3KJGA 1M0TA 4PWZA 3DQPA 1E4OA 1PYOA 5J2TF 4LRUA 2UZ4A 5FUVA 2HK7A 4YEDA 5TMPA 1VLHA 4DPLA 2GJ8A 2V7QA 3N7UA 1FFXB 1MRSA 2FN3A 4G5QA 2R1TB 1X2EA 4MR8B 4R1UA 4JNKA 1PS0A 3RAJA 4MDEA 2CVOA 2JLCA 1L7BA 1X1CA 2JATA 1HE8B 4EB0A 4BQPA 2GZ3A 3JQPA 3EXHC 3H5NA 1DEHA 2OWDA 2QZ9A 1PWEA 2K2QB 4GKJB 1OW3B 4KAJA 5EEGA 2Y66A 4UUMA 3LFHA 1HT2E 3J7AC 1QGUB 5TJ9A 3WA6A 4TTTS 1XD2B 4QPZA 1CSEE 1OBHA 2CDAA 5DYNA 1JHQA 2PYIA 2BZ0A 5IDWA 1IQRA 5GZ6A 4B46A 1LNQA 3MLBA 4IY1A 1DMRA 1KS2A 2PKYX 1CE8B 1FPMA 2PMFA 3B8HA 1X7GA 4K46A 5DE3A 4C1BA 3G0CA 5G1PA 3V4PB 3JSXA 3Q7EA 4R5MA 2B25A 1W6UA 5B30A 3EVCA 3IOMA 5C5DA 4HUJA 2II6A 3U4CA 5K45A 1ZXLA 3VR4A 4GEGA 2I33A 4U39A 3L49A 3RROA 2BDTA 1EH5A 2DZDA 3OCXA 4GL4A 4MAMA 3RYIB 1OXVA 2ZFUA 1KR2A 2ZWVA 1H9AA 1WHSA 1MEEA 4MZDA 3D7NA 3WBFA 2CNLA 2Y1LA 1A5SB 1P33A 2R48A 1PSZA 1ORRA 2HF7A 2XLBA 4HMOA 2QQFA 4JLDA 5DTQA 4EL0A 1LC3A 2J3QA 2W9XA 3IUBA 3KXDA 1DBWA 4RMIA 1FSGA 1SD1A 2XA9A 3OM8A 4C30A 3LOPA 1F4VA 3QKUA 4INPA 4R01A 2FK8A 1T5OA 1KNXA 3WLLA 1L4UA 3PD1A 5CDSA 1MVLA 3M4YA 5JU6A 3HBMA 3I1YA 1BA3A 2QD4A 3IR7A 2FSHA 2XUOA 1ISFA 2KX7A 5IF3A 3EQZA 4HDMA 4ONEA 4P33A 4TN5A 3AM3A 2BGLA 3PI7A 3RCBA 4BFYA 3GT7A 4D81A 4YRMA 4NR0A 4ALNA 4LJRA 1XCMA 2HI0A 3GLTA 4N48A 4CMIA 5IN4A 1Z68A 3VR6H 4KHPB 1KETA 2EWWA 1KDZA 4FX2A 2ISCA 1U90A 4NCIA 4RSRA 4X61A 1Z5VA 3GFRA 5MFPA 1P7YA 3PHLA 1SIOA 3AVOA 5I3ZA 1TCUA 2NTNA 1U6JA 4GMFA 4ID9A 4CM9D 1I2MA 3LT0A 2ZIEA 4EPYA 1BS9A 1WVGA 3SSAA 3VYTB 1B1AA 5DN6A 3TXAA 4ZDKA 4HVAA 3PT5A 4NP6A 3HXPA 3TW8A 3KDAA 1YJCA 4A7PA 3TUIC 3KFXA 5F1PA 2FR8C 3RUPA 2ACWA 1K27A 2RHLA 5ALJA 3RC7A 1NOJA 2YNMC 4OQLA 3ZI4A 3KTFA 5EWLA 1ORIA 3JQAA 3TJRA 3GEBA 5TARA 4ALMA 4E5YA 2CHVA 1UQRA 3PGVA 4NBKA 3CEHA 3O92A 1P0PA 1QIGA 2JGDA 5SZKB 1RC8A 3LDUA 4KR6A 3L5KA 1GUFA 3UAGA 2DCMA 3D6AA 4HO1X 4NENB 1CUAA 1I1OA 3TLZA 4JITA 4HH1A 2J45A 1BU5A 3VX4A 2IWHA 1KH2A 2WE8A 3L77A 5JCJD 3STTA 3ANTA 1F06A 5C53B 5EKSA 2P2SA 1O9BA 1J09A 2XKAA 4OMFG 2F3UA 3K9HA 1ZOIA 3PEVA 3OX4A 2FMKA 3FUUA 2F1JA 4L51A 1SHKA 4OD0A 2G72A 1FMJA 3O3CA 4WH0A 2AOTA 3PX7A 1G42A 4TV8A 4GL2A 3AERB 5ETJA 3QOXA 2W6ID 3HDTA 3OLQA 3K0AB 3I39X 4DCUA 4NCJA 1EWQA 1ZM3A 4YI3A 4DJ5X 3KQVA 4MITA 4BNYA 3MRXA 1ABBA 2VDWB 3K8ZA 4J4BA 5FBLB 3F9CA 4AY2A 4A0QA 1BDHA 1EFUA 5F1OA 1UBKS 3IKTA 1ISJA 3EPJA 3V4SA 1YS6A 1YZLA 1RNLA 5AVQA 1IK6A 3NOQA 1DT5A 1TRKA 5AKYA 2GTIA 3TMKA 3A6GA 1F8YA 1HA3A 1QORA 1AO3A 3MF4A 5EP1A 3T1TA 5ICSA 2P4HX 3HJUA 4ND7A 3AB8A 1LJ8A 4WINA 1INLA 2JL1A 3VOBA 1DE0A 5DGXA 6CHYA 2C9MA 3B60A 4C3VA 1ST3A 3F71A 2RHOA 4IHJB 4LMPA 4IJKA 4WCDA 5GM2A 5AUOB 2QE7D 2W6JA 4PQEA 1KRWA 1I3LA 3I1IA 4JIMA 4R7ZA 4WKNA 1M1UA 1FYWA 2WF7A 1FUIA 3GVXA 3A4NA 4P4SA 3WQRA 1YVEI 2W2KA 5JJLA 2O3JA 4B76A 2EARA 4D92A 2CWWA 2PWYA 2YMPA 2E3JA 4YROA 4D6PA 1TFRA 1W1WA 1EVIA 3UWKA 4JT4A 3RRJA 4RGQA 3AI2A 3PWSA 1EUYA 1O94A 1KK2A 2A2ZA 1IVNA 1YE3A 3FW1A 2HSEA 5JSFA 1OWNA 5LWHA 1XJ5A 1XRJA 1Z06A 2EL9A 3Q11A 3E2PA 1BYIA 4L50A 3ECSA 4KIFA 2CYBA 1BH2A 1ZYUA 4F85A 3VI3B 4NAVA 3E5HA 4KU4A 4BBAA 2VZEA 3LT4A 4F1JA 1VE7A 3LC7O 5LSAA 1F6WA 4AG5A 3OCZA 1EJ2A 1NUUA 4RWEA 3S55A 5BURA 4Z9XA 5FKJA 2C7OA 1FX0A 3AVXA 4I3GA 3QQ5A 4PAGA 2H00A 1QR6A 2NZXA 4RCYA 4Q37A 4TMVA 1LI4A 1XNJA 2TRSB 5EFZA 1FW8A 3ODPA 1Y5IA 4DE5A 3B78A 4D5EA 3NI2A 5GTDA 3MHPA 3KYIB 1ZO8A 3I9JA 1KEUA 2B1IA 4ASUD 2PNFA 1SBIA 2ZUWA 4ZMBA 2OFOA 5TF4A 1Z7EA 4ZC8A 4G4SP 3C5EA 1Z18A 1JFTA 1ZIDA 4MRRA 3PQ6A 4A2CA 4HN2A 4EY8A 1D2RA 3FH0A 3ILHA 4YPVA 2ZAIA 3H8VA 4MGEA 4JUBA 2OM2A 4V2UA 4DLTA 1CR0A 4ZAZA 4DMKA 2HUPA 1AKWA 1GXSB 1CDDA 4UTZA 1ZJ5A 4OK3A 3AVVA 5FTLA 3NWJA 3KQYA 3DLHA 1WCV1 3C5VA 3JYNA 4GFDA 5T5QA 2CVZA 4EUEA 3UJ9A 1OFHA 3V2GA 1J24A 2H1WA 2CMHA 1KIAA 2OBMA 3AC0A 3NOVA 1P9LA 3EGCA 1EJBA 4I8IA 1BCRA 4KUEA 4YJ2F 5DP2A 3RIHA 4C4ZA 3AVTA 4LXYA 1NMXA 4Q16A 1R9JA 1FMCA 2UYOA 4ZI5A 4AO6A 1VXRA 1K66A 1WDLA 1NN3A 4ZOBA 3QX7A 4K88A 4DUZB 1T2FA 1ADBA 3JQCA 2P9EA 4IHQA 4YRJA 5C34B 2RGGA 3QF4A 1ZGJA 3DDZX 2C8VA 2Y1XA 3ZE6A 9LDBA 1YXMA 4JV5B 3H9UA 6ADHA 1NLFA 2QPTA 5F4BA 1P4JA 1ZH8A 4DMMA 3FKSD 2C2YA 4BQRA 4OXXA 3OZAA 3ZVNA 2ZXEA 5COQA 1VC2A 3AQ4A 1FZQA 1CU1A 2GBPA 3DBHB 1E2EA 3EC1A 4ZRNA 4F9EA 4CEIA 3TNLA 1R88A 1NVWQ 4WW0A 1E2HA 1MB2A 2OB2A 1WSWA 2AQHA 2PDAA 7REQB 4U3JA 4JBYA 3DE2X 1IXKA 2C7BA 1RI3A 3EBLA 2XDQA 2PUVA 1ZISA 3DONA 2GAOA 3T52A 2EZ8A 4H6WA 5J1TB 2B3DA 3KEMA 3A6EA 1Q1BA 1PJAA 2O2SA 2R6R1 4P9NA 2GJ9A 2H3EA 3D0RA 5E7JA 5JANA 1B2RA 1MAAA 4S1NA 3THWB 2O7VA 2OWEA 5TIIA 4AQYB 4US1R 3O8QA 1YVDA 4QWWA 2X0JA 1P2SA 1FSFA 4LVCA 4XWWA 3EPLA 2OBYA 2ZQYA 3PRHA 1FX0B 1K3FA 3F5QA 2ZUEA 1KAOA 5CEJA 5KTTA 1XOIA 3AR9A 4O4IA 4XLZA 1YDMA 3WRVA 3X1WA 4QPNA 4MQ6A 3VC1A 3ZOZA 4KGXA 3ZIDA 5T8KA 5J63A 2IHKA 2H0RA 4FE7A 1IU9A 2DPHA 3C1OA 3DOEA 4J91A 2FOXA 2Z57A 4Z0HO 2BKVA 2AI2A 4AZTA 3D8SA 2QORA 5KVSA 5AK0A 1JRLA 3LVFO 3HU1A 3UUGA 1TEHA 3P9NA 2VH2A 1ODLA 3HBNA 4NC9A 1SUBA 3L84A 4AJOA 2IXGA 9ATCA 3HM2A 4GX1A 4D8WA 3GNQA 2ZT5A 1QIDA 4HQFA 4IZIA 4I1UA 4US2R 1IBLB 4EO4A 3R3YA 3TJZA 3V8MA 5EOVA 4Q4JA 3ZV5A 1XEFA 2HWXA 3IQFA 1VHQA 1XVTA 1YJ5A 4I1IA 5BNFA 4CM8A 1K75A 5EMNA 5KTNA 1JHPA 2G1KA 1XMQB 3C4QA 3KOOA 3D3WA 2H4HA 3ZW9A 1W2GA 2REXB 2LW7A 2J08A 3AX6A 4WXHA 1N0IA 1T9CA 2OXEA 3TIIA 3LLVA 3A0RB 3CURA 2MHCA 3PDUA 5IDYA 3UJNA 2JBAB 1WBBA 5KQGA 3GGDA 4YDSA 1WOYA 1GUBA 5BOSA 3EXG1 3OEEA 3DOFA 4JQYA 3VDMA 5A0TA 4OVKA 3TLJA 2GCOA 5ALOA 5JD4A 2PUGA 4WK2B 4CF5A 1W36C 2FZ5A 2QPOA 1KRXA 1XK6A 5HBGA 2J9YB 1JG6A 2R8BA 3AOEC 3FDIA 3L93A 2PPLA 1F20A 2HO5A 4OQEA 4RVGA 3L7JA 1P5HA 2FSPA 2IUSA 4XUEA 4M0MA 4ZK6A 4ZYTA 4BFXA 2WQZA 3JQDA 5CDTA 1HV8A 1M1YB 1JFFB 1K97A 1SCKA 4UE3S 3RADC 3I9KA 3VR6D 1NR7A 5DIZA 4C01A 2CBGA 2C9ZA 4YGXB 4BZQA 3PZRA 1X7XA 1YHNA 1U0HC 4F04A 2EQAA 2LIPA 1MO6A 2ZBRA 3AHGA 3IRUA 1IPFA 3WK6A 2XMPA 5U4XA 5BV1A 5JS6A 3UBMA 1L5QA 5CX1A 4ZI7F 4A82A 1VL8A 1MA3A 2VDVE 2X3UA 3GCGA 1RI4A 3G17A 4WVFA 4KMMA 5CFLA 3TG2A 4JY7A 3BRSA 1Y8QB 3PUJA 3WLRA 3D1JA 3K0FA 3GJ4A 3SZGA 3GZ4A 2NN3C 1WZEA 1L9XA 3AW8A 2HA2A 3LF1A 4G0QA 4CM4B 1OIWA 1N2SA 1VG1A 1YUMA 3F46A 2WHEA 2CVHA 2MINA 3JWIA 4P4GA 3VHXA 3SS8A 2E2WA 4CM5A 3MD0A 4AMYA 2BGMA 3EDYA 2DBYA 5B2EA 4JVOA 4CT5A 1DBSA 5A1TA 2VF7A 3LF2A 2R6AA 1WY7A 4YJHA 2IHVA 3IX7A 3OFSA 4KR9A 1I4LD 1TECE 3PXDA 3NS7A 4RABA 5FCDA 1QK5A 2Q45A 4OBXA 1QKKA 3ICVA 4MCAA 3PP8A 1PR1A 1Q7BA 3EVGA 4ZC1A 4BMNA 3SEAA 3QLUA 1YHYA 1VGQA 5ELXA 1RKVA 1VL1A 4LISA 4O59O 3U80A 1EWYA 2JRCA 4LXHA 1AF7A 1X7DA 2AG5A 2Y1CA 1EA5A 4NK5A 2H8GA 5JPIA 1KDOA 2P41A 3OFVA 1D2EA 2B1GA 3JQRA 5AICA 4ZV7A 5SZHB 5CD1A 3I9LA 3GLKA 4JELA 4ITUA 5TQ0B 3AIIA 1EDBA 4PW0A 4XGIA 1T6XA 1YRQA 4Y2UA 5CMLA 4ZO4A 2MTBA 2X4LA 4LYJA 3R9IA 2JGNA 3ESDA 5CT4A 3UXEA 3ZJUA 2CLSA 2CL7X 3IEKA 2PN1A 4KQ6A 1KYTA 4KXXA 4XD7D 5FQOA 4B3IA 5EJ9A 4RFSB 1LQUA 2F3RA 1JHMA 3K9BA 3PIIA 1QR2A 2MYUA 4MV6A 3RAPR 4WZAB 1PVDA 4D25A 1HBJA 1RP7A 3BD9A 4RZXA 4RXTA 3L8HA 3WKDA 4XWOA 3QXHA 2YY6A 3RSQA 3B3JA 4KNVA 4CLDA 2I9KA 4C1NA 4C6TA 2GD2A 1FP6A 3MELA 2A9KA 2O7SA 1N36B 1GPH1 3ZCUA 2CNWA 4RDCA 4S24A 3LTEA 2L69A 1HPLA 3FCOA 2XA1A 1E2BA 2OUIA 2OGZA 4Y18A 4ZAWA 1XC7A 4IO0A 4QBTA 2B4KA 4WESB 3V2UA 4DDMA 5KDLA 3EGVA 1EBFA 1NQUA 1OUMA 5F35A 5K3SA 2A1UA 1PUXA 3F6RA 4M0CA 1FU8A 2PAAA 5EIEA 1RR6A 1JJIA 3C7KA 4ZAFA 2PFKA 3THOA 1AMUA 2GJSA 4PAQA 3MZ0A 5D2CA 3LO5A 4IIFA 1UXOA 2FSUA 4PXAA 3OZWA 3TOSA 5BWMA 2ZB2A 3P9QA 4S0XA 3USZA 3J7TA 3SJCA 3LWZA 3A3OA 5FV7A 3C5CA 3IIKA 4J16A 1MZPA 3KEOA 4UHBA 4YQYA 4M87A 3WIOA 2FQWA 3C2QA 1NX6A 2Z1MA 3IVMA 1YF3A 1DBQA 1XG5A 2A57A 1XZQA 3T34A 4POOA 3N28A 1A76A 1B42A 1E32A 1W4ZA 3NV7A 2PZGA 3UHAA 3UT5A 5CTJA 1X1EA 2J31A 2YBEA 1K5PA 3KLOA 1P2TA 3EF3A 4MO9A 2V6IA 2Z8YM 3R75A 3WX0A 5TQJA 5J2UF 3PQDA 3HFJA 5JWHA 3TZEA 4AY6A 1YK1A 1UK9A 1ZI9A 2OAGA 3G7SA 4X90A 2XUKA 3DPUA 3D2LA 1MOZA 1S7GA 4D1YA 1W0KA 1WB6A 1OZHA 4B4UA 4N3AA 1UOPA 5E7MA 3H5RA 1Y7IA 4Y67A 4ALJA 3OQBA 2A3NA 4RU1A 4BATA 1TK2A 2EU8A 3MUEA 3FPBA 4KBGA 2JH3A 4HEA6 2QUJA 1PJLA 2J9ZB 1Z5UA 2BKXA 2CHQA 4B75A 1Q95A 4LDAA 3DLPX 3LLSA 1XAHA 4I66A 4HDRA 4QDTA 3T7RA 5AM0A 3TBKA 3D5EA 4ZICA 1JEJA 5JH7F 3H1FA 4KB5A 1JAZA 3SBOA 4B7CA 5JZ9A 4CQLA 4C2UA 1JR6A 3JTEA 1A9OA 4LSWA 2WZCA 1JQJC 2I1LA 2VQ3A 3L1VA 3ZS9A 4Y1EA 1VDZA 3N0VA 1W5FA 5UKDA 4CIDA 5EMHA 1OH7A 1I51A 2AMJA 5FPHA 1P9NA 1Y6ZA 2Z5VA 2XYRA 4D82A 2NUTA 2XMBA 2PV0A 1DEKA 5B3JC 1NSFA 4BBZA 1EPUA 3G5MA 1MB3A 3QI7A 3R3VA 1J70A 3BMQB 4AJJA 1AY0A 1QZXA 2IP4A 1EGAA 3ZY4A 4V24A 5TPWB 2GKSA 1NSYA 2Q8QA 3LQ2A 3RR2A 5CB8A 1Y6RA 3KTDA 3H0CA 1MJGA 5KVVA 5KYYB 1QLWA 1L5OA 1PJCA 1K6JA 1LLUA 1SO8A 4AUNA 3C3XA 3JR7A 4U7GA 2AX3A 3M1AA 5FUYA 1VKZA 1NAHA 2OYRA 1COWD 1PSDA 1KY5A 2HYIC 3ZLJA 5K2MA 1JIJA 1UWKA 1VSUA 2CLMB 3I8XA 4K86A 3I5AA 2OQRA 5BN5B 2ZJZA 1FFDA 2E5LB 3ONDA 1L5VA 2D5LA 2VNSA 4B6JA 4XFJA 2PM8A 1L4KA 2O0HA 4ZVKA 5I48A 1ZGHA 2MMGA 2RHGB 2YOHA 3KT8A 4UAJA 1L9KA 3NHBA 1JU3A 2FQXA 1SJ9A 2HZBA 5EUMA 3KAKA 4P93A 1OBVA 4QT0A 2C77A 4ZHQA 4KJZA 2WSBA 3H2BA 4EGQA 3STWA 1QPGA 4PNEA 1U4OA 4EF6A 3OUZA 4OHOA 3K4PA 1XSEA 1X6VA 1GNPA 1YJQA 2QR3A 4HPJB 3I30X 4UULA 3VH3A 5BR1A 4NL4H 5AVZA 2X9LA 1QF7A 2F1OA 3HY3A 4KPYA 2ZRDA 1U04A 1PAUA 3A6LA 1X9GA 2X5JO 3K16A 4MJ7A 4RK5A 4UXHA 4EVIA 3L6EA 3AR6A 5I4BA 5JUWA 3VNAA 5K0ZA 5MHTA 2FX2A 2Q1UA 1G3MA 3M81A 3Q3JB 1Y0BA 4BJ1A 2G70A 2A5GA 3HCEA 1FJXA 5CM2Z 1UF9A 3UJ7A 4PR3A 1T6ZA 3UMRA 4EI2A 3EXEB 3UOWA 2VDPB 1NF9A 4H7EA 1AS0A 1J7KA 1K4KA 2J32A 3AEZA 3ZDFA 5KU7A 3I6QA 2WTNA 1LBIA 4OQFA 4A26A 3E18A 4WE3A 5I7WA 3VU9A 3T61A 3L6RA 4ZU1X 3CUYA 2PKQO 4X62B 4FD3A 3PEWA 5G0SA 3DG9A 3F47A 1KP2A 3GMIA 3QENA 5BV2P 5DDIP 1TF2A 3HNRA 5LB4A 1TQ6A 1JJAA 4PLZA 4R2LA 4BNHA 1UKBA 4W99A 1T91A 2LCQA 5A06A 1R4MA 2WF8A 2OXRA 3OPMA 4U7WA 3TPZA 4C4AA 3S8EA 1NQVA 4MPTA 3WLKX 3CU5A 1XTKA 1V6CA 2AN4A 3ZY2A 3L6CA 4UM5A 3OUTA 1WUJS 3HNPA 3H1EA 3AVUA 2P5UA 3AILA 3R8XA 2JFZA 3ELDA 4QJ5A 1FJGB 4FUTA 1SULA 2PZEA 1Z2DA 4G25A 3NO4A 3MCZA 3AZOA 1F2TB 2AMVA 1NNUA 2O52A 3E15A 2XNSA 1A1SA 1YRYE 3FR8A 2WVHA 3QIAA 3PRJA 3IAXA 4RVNA 3WO0A 4LCEA 2HUNA 3DBHA 3AVQA 1K6IA 1J2JA 1F1BA 2AI3A 4S1PA 4P5PA 2HPAA 1RZRD 1TMOA 1YS9A 5HZGA 2CB0A 5K0CA 3WYCA 2SBTA 1GZ5A 2AQIA 3CUEF 3JARB 1IN4A 3E05A 4QJ4A 5IEBA 1V1MB 1PFYA 1W29A 3LQ1A 3WLHA 3I5XA 2QQ0A 2VJLA 3EGDB 5FUBA 3ZLUA 3S2GA 1HK7A 4TV8F 3I23A 4UTNA 1Q11A 4KXWA 5LJLA 2VWPA 4J0EA 2JHAA 4QPJC 4KMOA 4PSVA 4Q24A 1EWVA 1JLHA 1IHDA 1UM9B 3CPEA 4BMOB 4K05A 3VVBA 1ZZGA 2P6UA 3L6BA 3KOYA 4ZCSA 1QBKC 1KEZA 3LC0A 1SVLA 4HGYA 4PYIA 5DGDA 3I53A 2QUBA 4RH3A 4IGFA 3EFEA 3ONNA 3TOXA 1G4UR 1P7WA 3TTVA 1WDKA 5A5EA 5LJIA 2F4VB 4RCZA 5AKKA 4F38A 4IRMA 4A23A 5IBCA 1M5RA 3DFFA 4AYTA 3PC3A 4PHFA 1ZUWA 1AQYA 2W4MA 3L5OA 3QTTA 1A97A 4G81A 4HS9A 1KQPA 1NUAA 4TKZA 4BVBA 2J5XA 3PJDA 2W6IA 4IICA 1EG7A 4M8IA 4WESA 4X41A 5GMOA 3LTNC 4L0MA 2I4NA 2OAP1 1TJPB 3OH8A 3TK1A 1S6YA 1I2ZA 1KZ7B 3EOAI 4UUBA 1LLQA 4R4JA 3LOUA 1CR4A 2WINI 2YIJA 2ENWA 1KAEA 4GM1A 2VUUA 1MVNA 4V03A 1OI2A 4IBOA 4HF7A 3VXKA 4CT0A 2R7KA 4YUAA 5H83A 3THXB 1Y8ZA 2B4AA 2C3OA 5AHWA 3AHJA 4ARZA 3KR0A 2Z2KA 1NN0A 1MC5A 5K4AA 2C84A 3R5XA 1M33A 2B7CA 4IDNA 1H23A 4FKMA 2DVMA 5C1BA 4XQCA 1S01A 2WA2A 3V1KA 2PYDA 1R18A 1O6CA 3IBFA 3QLEA 5DSXA 5K0SA 3F96A 4IF6A 4CL8A 3VKWA 3WKCA 4WZAE 4RF5A 3DXXA 1JHRA 3CYFA 4BE9A 1KEVA 3W79A 5LZ9A 4EWLA 2GRUA 2OMEA 3H1BA 3KFVA 3RC8A 3AOEA 1M1NB 3AF4A 3K2EA 3H9EO 4OLJA 3K9GA 5AM2A 2ALJA 2OVFA 3PQ5A 2HRRA 2Q28A 4OQDA 3VC3A 2ID9A 2QKYA 5EZYF 2FJPA 3H4VA 4G0YA 2WKWA 4ACAA 4AJLA 1KYWA 4PZYA 1NFQA 2OFFA 4BAGA 2HDOA 4L1KA 1NJGA 2XQVA 2AOUA 2X8AA 3CWCA 3QJGA 3A2NA 4NJEA 4AROA 4ZPJA 1J8FA 2B1RA 3DDHA 3HJAA 3NHFA 2KBFA 3OIDA 4JVSB 4O3FA 5BSGA 4CIBA 3AKZA 4E94A 1E2UA 3WYBA 2ZBDA 3GMTA 3U16A 4HGQA 4RXMA 4I5DA 4LN1A 3T99A 3A1UA 3HN2A 2I7VA 4MVCA 1SU4A 1QP7A 1FFGA 1CJSA 3E53A 2F62A 2Z5LA 3BK2A 2RBGA 1Q16A 4KSYA 5INTA 1BSVA 3IT2A 5KNDH 4KN9S 3GRPA 2VC2B 2PS3A 4YQFA 3RRBA 4UHJA 4QYMA 4LF4B 3DCYA 2XYHA 5SYNA 3HVUA 2XIQA 3W2GA 4IQ4A 3EIEA 1T3TA 3FAKA 5K05A 2P2LA 4KPUA 4P3YA 1FU4A 3PJRA 1A9ZA 5CDUA 3UENA 1V5EA 4K26A 1KYVA 3UK1A 5CCDA 2JFVA 2ZB3A 3RK1A 1B1CA 1T8RA 1EXVA 3KUXA 4DF3A 1F4LA 3QVMA 1JIQA 4G9EA 5LC1A 3WADA 3Q3CA 1A04A 3GFFA 3BTUA 2A58A 2JD0A 4CTOA 5GJVC 2HOQA 1L7PA 1DJMA 1RQRA 3QUAA 4YJFB 4BFWA 3BVPA 1W25A 4I6JA 5H70A 4D4GA 2XMGA 1BW9A 5BYKA 4GLFA 2PY6A 1RHUA 1SGWA 3QNWA 4B45A 4PONA 1HRDA 4B79A 3NYIA 1JFSA 1DXYA 2C3UA 3W6NA 1MD9A 4M49A 3LLMA 3UGTA 5I7RA 5JW6A 3GLIA 3SZUA 1XLUA 1E4VA 5EWLB 1V4NA 1KGSA 4R6WA 1YD7A 2X15A 1AQIA 1WHSB 4YP1A 4YRCA 1EDDA 5E9AA 2VF4X 1L1RA 1UMDB 1NW6A 2DY0A 3HY4A 4LIPD 4N5LA 1XZKA 3FPHA 1L4BA 3ZXYA 1M74A 1J8MF 4R9NA 2FDCA 3NFYA 2PL1A 1CIVA 4BQFA 5AM1A 3EZXA 4QNRA 1RWNA 4ZVRA 3ITNA 1MDFA 1ISSA 4FILA 1QPZA 5AOBA 3MA0A 4TQ9A 1TZJA 1GNRA 4WSOA 4BNMA 1E3LA 3GRRA 4TRRA 4CKYA 2I2AA 1C7EA 3ETDA 1RLTA 5FWYA 1ZVJA 2YXNA 4BCBA 1RCTE 2FTKE 2D13A 1D2GA 1C0IA 3DV2A 2HRCA 4CM4A 3F9IA 3D02A 3E3AA 3KKNA 5BN4A 4OMUA 2IV7A 3S70A 5C35A 3KFLA 3TRFA 4R9RA 4GMDA 5HJ7A 1H22A 5GGYA 3OLXA 3U4GA 5G3ZA 2DGDA 4L5AA 1BXZA 3CVJA 1EM8B 5M34A 3DE3X 3USCS 2X1VA 1YCFA 1E3QA 2N1MA 4FGWA 4X84A 3WGLA 4Z4FA 2F9MA 3RVPA 3SICE 1Z13A 2ZG6A 4OL9A 4ZYYA 1LBSA 4C06A 4ZREA 3TVYA 3SM9A 5AJYA 3PUYA 3F8TA 5EKXA 3UNXA 4KX5A 4NE9A 5DMHA 1L7EA 2FKNA 5JNWA 1AT1A 2VP9A 4KWCA 2ZBPA 4KVZA 2Q29A 5JBIA 1YOBA 3QKTA 2OSVA 1XZFA 2XUAA 1Y1LA 1V48A 2YMMA 1KIFA 3DZHA 4O2AA 4D6XA 4RY2A 3STHA 1A50B 2XCOA 2GT1A 3AT1A 3JZMA 3EEYA 4JA0A 5EJMA 4CF4A 3HYCA 1WETA 3K2IA 2K5UA 2RSLA 3DGEC 1SZCA 1KVUA 4OMDA 3A2LA 1U98A 4DUGD 1EB9A 1K6XA 4NPCA 5MFZA 1GCUA 2IEZA 4LY3A 1PKXA 5AO9A 4MP8A 2ZXFA 3O4VA 3AV0B 4FP9A 2QTAA 4KMSA 3ZDRA 2DU8A 1C50A 3G0GA 3MQ4A 3OO1A 4L5BA 4QECA 4CMAA 1NU6A 1SHLA 4DDWA 5KBYA 1M7BA 3GJ5A 2OD2A 3HPRA 2VG8A 4L7QA 4XIFA 5G53C 1PBNA 4HXEB 5GONF 4DIOA 5ICMA 1C0PA 3COVA 4JVMA 3FGOA 2HA6A 4LZPA 3THWA 2WAYA 4II3A 1CHNA 3VHLB 1D9ZA 1VSBA 4FFOA 3E3OA 3U44B 3UA3A 4IDAA 6Q21A 5EXSA 4PYRA 3DMGA 5DTRA 3GR6A 2PBFA 3HDGA 3ZJTA 1GDTA 1E8DA 4ESOA 4W5TA 3INGA 4DCCA 2C20A 2LP4Y 2G09A 4DR5B 4BEBA 2I8CA 2OHJA 1IUNA 1V45E 1BD4A 1FNSA 4YIHA 2OTCA 2WHPA 4X1KA 3CE9A 4ARSA 4F21A 2NADA 4CTKA 4S1WA 5JVDF 1XT6A 2ECOA 3K32A 4ND2A 6NULA 2AK3A 3D8RA 3LLCA 1Z0UA 3N05A 4HCJA 3REQA 3DJYA 2FR1A 2NTEA 5TNXA 3SSMA 5L3QA 2RHHA 1NURA 1WLSA 3BE5A 1W2WB 1LTKA 1IXSB 2G06A 5K0BA 1LFAA 1WIWA 4KP7A 1DC7A 1XTZA 1YB7A 5J59A 2EIHA 2WFLA 1XXLA 4CU5A 4XPIB 1JWBB 1UXJA 3GZJA 3W2TA 5DLEA 4CV2A 5KC8A 1N6HA 4DLPA 3U40A 4EVSA 3A9CA 1Y6GA 3DTVB 1GKIA 1U11A 1UPBA 4NWIA 3PNVA 3WGUA 2XDWA 3QXXA 4E33A 2GRAA 1NVVQ 1KPHA 2VQSA 2WG0A 2BP7A 4JLPA 4ND8A 4ZZIA 4IIEA 4B85A 2P9GA 3RTBA 3X1MA 5JDIC 5EQFA 4ZEVA 4KQCA 1MQ9A 3W04A 4JP8A 1VIVA 1P2VA 3IRVA 4QO8A 4ECEA 5LPNA 2C2HA 4WZZA 2VUHB 2HMYB 3G5TA 4HS4A 4MJLA 4PX2A 2C29D 1JXAA 3IA7A 4CFYA 4Q34A 4W5NA 1GYPA 1Y9ZA 2R87A 4MW5A 5AVJA 3PHGA 3ILVA 3GUCA 2XE6A 4AX8A 1OASA 3PLAE 4ND6A 4BVLA 4DKJA 1VA5A 1T1EA 4PVCA 4CKEA 3QPUA 1T4CB 4FHCA 1KWKA 3IE2A 4LK3A 1XNGA 3DV9A 1G19A 1K3UB 2CBZA 5AK3A 5E4TA 4YV0A 2OCYC 4NXMB 2PGNA 3OZ7A 2XZLA 1T5BA 5B4VA 3QBTA 4B4KA 2ADOA 1WSBA 1S1CA 2G9ZA 5KVCA 4Q00A 3MJVA 4QU5A 3D8NA 4JNCA 3AB3A 1T8TA 2UVPA 3C74A 3R9KA 1IIBA 1B0ZA 5FBQB 2R25B 2V74B 2R7MA 1IEVA 2I4IA 4B6QA 2IJGX 1P0IA 3U17A 2OHHA 2I54A 2VHYA 4QYIB 1Q1ZA 1ZRNA 3M9XA 4I6GA 3IUSA 4GGMX 1PNVA 1QTQA 1OX5A 3EWSA 1E1YA 1HLFA 2HF8A 4NYIQ 3ZY5A 4JR2A 5C4MA 1X8XA 2OHFA 3KYJB 4UUAA 1RWWA 3EA4A 4YJHB 2O2EA 5JFTA 4QYXA 2BLNA 1WSAA 3ZZUA 4CL2A 3BWBA 4Q3NA 4NJMB 2FLVA 3DAOA 4NE2A 1LVGA 1AQ6A 1NJ1A 3DOHA 1MA0A 2ZREA 3KQTA 4DUYB 2AQ8A 2YASA 3RB8A 3QUSA 3JTMA 3TXYA 1G20A 1NJSA 2AFRA 4MQMA 4RVDA 3QSYA 1BE1A 2E87A 3F7TA 4ZJYA 2IRWA 1KJJA 4L27A 1AGXA 1GPWB 5EMLA 3K05A 4RDHA 3SG0A 4EF5A 4LE0A 4NAUA 1J22A 4ZDWA 4JX9A 2CSUA 4F4DA 2W2QA 1XN1A 3OF5A 4DM3A 5B6IA 1E4EB 5MF6A 4OXKA 1PN3A 1PZGA 2VBFA 4E11A 1RABA 3OE1A 3PQEA 4BO4A 4F2GA 1FX1A 1Q0HA 1H69A 2BKLA 3L79A 1O95A 3AETA 3FBTA 3FHOA 4B34A 2FZCA 1NDHA 1TFUA 3ETGA 2I1QA 3V1NA 1AVTA 5CB0A 1N8TA 3UY4A 2V9ZA 2Y1OA 3G7UA 3QMWA 3OQIA 4QEKA 4QXRA 4AICA 4IMPA 1TQ8A 1C5KA 3NC0C 3MMPA 1XPUA 2C4TA 3OEED 1YMVA 3BAZA 2KJQA 2PRYA 4MWBA 4R68A 3KVYA 5ECDA 4TX1A 4EJ6A 2Q27A 1MRNA 3D4IA 4D98A 1BX3A 5C7YA 3M0EA 1AE1A 3IALA 1DX6A 4KWIA 1PWYE 2PWBA 3BCSA 3LUGA 3OEWA 4UHEA 5BQXA 3OZRA 5TGZA 2CCKA 4MRMB 1S9HA 1N5OX 1G59A 3R3SA 1V3VA 4L74A 2ZSJA 3AKEA 3CLSD 1RPNA 4HX5A 5KQRA 5BNWA 2BR4A 2VKQA 1BEZA 2C5HA 4I1PA 2K7FA 5ENDA 2W93A 3MPOA 5LP6F 4B2YA 4EBBA 4BZPA 3LPNA 1AKTA 1KXJA 1VG0B 4QYWA 4HI0E 4X63A 1Y37A 2B8WA 3WGTA 3HR4A 3TQRA 1IJBA 1QGED 1X7XB 2QTRA 1ZD9A 3IAM1 4YWJA 3L8EA 2ZSBA 5T3UA 2LKCA 3WE7A 1RD4A 5EYPA 3WOHA 1Z07A 4EQZA 2I7TA 1P1RA 2M9MA 3D0KA 2IHJA 2WSSA 3ZNPA 3TO5A 3EYAA 4DXAA 2EIXA 1B6RA 1GNLA 4M89A 5K7SA 2GS9A 3VNQA 1DJLA 1QQ6A 4MS3B 3WGGA 3QXGA 4P2BA 4COOA 4F84A 3FPFA 2GD0A 5FP0A 1OV6A 3H42B 2PU5A 3KAJA 1S2MA 2QMEA 3X2EA 3HZOA 4MQ4A 2ECPA 1J90A 3FSGD 1QCYA 3CGGA 3CKYA 2OD7A 3FZGA 1TADA 4AURA 3KZMA 2PEZA 2R00A 1UMCA 4WN3A 1FVHA 3W2EA 4BMCA 1KSJA 5E0OA 4EKEA 2WJPA 2W6PA 1DWQA 1TCCA 1U0NA 2FEWB 4UFNA 2OLJA 2J85A 3IERA 5IDXA 3ZI7A 4V02A 1VHJA 5JWOA 1MB4A 1NQAO 4UU1A 2WJ3A 1OCEA 3AKDA 3UFXB 2QU7A 5JS7A 2HBRA 3QHAA 4Y2VA 3A6HA 4X91A 3MOIA 4RMGA 4BRUA 1C7ZA 4E5MA 1OR8A 2GCPA 3K5IA 1GU1A 4EUNA 4CDGA 1HX7A 2CE7A 2NXJA 4ARUA 4OQQA 1J7JA 3FPAA 1AN9A 4QXMA 3G59A 4FEYA 4MQ5A 5HFAA 4TLLB 3H5IA 1ACLA 2BFEB 2XNHA 3HJGA 4LXQA 2RGXA 5CW1A 1JU9A 4L5JA 3G82C 4U2GA 4JI2B 3KT3A 4ZWNA 2H8KA 2HRQA 2Q46A 5DHRA 1YAHA 5DLPA 2OHIA 2JLWA 5DO9A 2PRKA 1J0DA 4IQFA 3ID6C 2C2KA 4GMKA 2QRUA 2H2AA 3IDZA 4II7A 1I1HA 5E9QA 2WTBA 3TI9A 3Q15C 3OE7A 3VZPA 2LRHA 1KEWA 3ZY6A 4BFLA 1ZM4A 4RM3A 3D3NA 5G1NA 3QSGA 3OA0A 4ZYVA 3GJYA 3KXIA 3OCYA 1XP8A 1NXPA 4X1IB 5EJEA 4B3RB 2AV6A 3JD2A 4QOFA 1FYVA 2B20A 4XVUA 1EK1A 1LRJA 5KNBH 1KC1A 3EFOA 3U7FB 1NVXQ 4J4HA 2O5EA 2QRKA 4GLJA 4RGVA 1D2NA 1THGA 2IYPA 2HNKA 3BSWA 4MEAA 3GOQA 4UBKA 3WR5A 1RTKA 1B16A 2VF5X 3CW2A 4N01A 1IY9A 5CK5A 1ZD4A 3R7LA 4OFWA 1E58A 1SBYA 4KEAA 4DV6B 1DQRA 1C3XA 1N3IA 4W9MC 3H1TA 1BWPA 4UXJA 5GM1A 4EFMA 1V8BA 5MGNA 5DCUA 2JAUA 1NASA 3EHEA 3OEHA 5A3VA 4NONA 3RT9A 1T35A 1ZU4A 1DRVA 1LPMA 3NT4A 3BN3A 4Z4HA 3I5MA 2A1TR 4D9EA 3E03A 1ZG3A 5LLTA 3DFUA 3E35A 1U99A 3JAKA 4HUTA 1RLMA 1WNFA 3A4LA 1NV9A 5JTUA 1XKXA 2G6BA 1JB9A 1E64A 1VYTA 1N1GA 2GD6A 1MV5A 2E85A 4GAEA 4K87A 3ZV7A 4BZXA 2FEKA 2GO7A 2L17A 1EE1A 4H1TA 1K5DA 1ZD2P 1WQ3A 1WV0A 4YJFA 1ZESA 4GYKA 4MYUA 5ILOA 3GWGA 3MJTA 3GOHA 4ZO9A 3S2EA 4KXUA 3BEOA 3QXSA 5IC5A 3AXSA 4GZ5A 2VHCA 2LZ0A 4E5DA 1FQOA 1XRSB 1KI6A 3H11A 4UZEA 1QQAA 4MB0A 1M8PA 1P6UA 2W00A 3I3OA 2QJTA 3HR7A 4B9AA 4DGSA 5LOVB 2XKKA 3WOVA 3T4UA 4PRKA 2YXPX 1N2OA 1VI2A 3HVJA 3EY9A 2BISA 3HZRA 4Z4IA 5L45A 5FHQA 4NECA 4DRXB 1I7NA 1K7SN 3IMCA 4XVRA 4U0JA 3EXIB 3ZE8A 3E4CA 5HX7A 3GT3A 2RONA 1GRQA 2XRMA 3R5JA 2JI8A 2FSIA 3DEJA 3R1IA 3IIMA 2JI9A 5FR2A 4YY3B 2PD3A 3IJEB 4NEQA 4P22A 4F96A 4L8LA 3GP5A 5CNMA 2GESA 4N9WA 5FR1A 4QJ3A 3GJ7A 3FCSB 5SYAA 2Q1WA 5T4FA 1ZK0A 2EJTA 1KZ6A 1Z6AA 4MW6A 1FZTA 3KJNA 1VRVA 2BM9A 3FUCA 3GQBB 5L4SA 3U4MA 3QWIA 2F3TA 2ZYVX 4FZRA 3S1AB 1THTA 2OQ2A 1VLQA 3FWPA 3QFSA 1I7LA 2C82A 4RXUA 4TVBA 4KVFA 2GAAA 3RFUA 1KQ3A 1KPGA 2D00A 2XMSA 9ABPA 5TB5A 2WK1A 2QOEA 3C4JA 3CISA 4YT5A 1FUEA 1YL6A 2VATA 4XEHA 5LA6F 2P9YA 3TQSA 2R65A 2Q5IA 4P7FA 4ID3A 4GOJA 2XADA 3E22B 4IVRA 4LOKA 3U3DA 4WOCA 3WL5A 4JBGA 3W4KA 4EJMA 4C0WA 1TU4A 5LVAA 4QOJA 3SYKA 3MAGA 2ZZKA 5CB6A 1K86A 1U3WA 3CZ5A 4FS3A 1VKJA 1J2RA 3T4XA 1P5FA 2QX9A 2XYVA 2R5FA 2CE2X 1I6KA 4E1BA 4ENPA 1L7OA 1P29A 1G3IA 4QL3A 3TNJA 3QVGA 2ISSD 3Q2IA 4QDZA 5JJ5A 1TM1E 1UJ4A 2HA5A 3GYBA 3BFJA 5SZIA 1AA9A 3EZGA 3QWFA 1KBOA 5J40A 2OZVA 1ECPA 4L5CA 1MRZA 1E9FA 4HJXA 3A05A 5EWMA 1Y98A 1T0IA 4QWMA 3ZQ4A 4D9GA 2WWFA 3I9NA 1MZVA 4H4DA 4EB6B 1B2LA 4DQVA 4WA7A 3LPCA 3E23A 1E9EA 2BFMA 1Y8RB 2GWRA 3A1DA 4YJDA 5FUMA 1ZA2A 1QYXA 1MORA 1CQPA 1Q6YA 4ZOEA 4F6RA 5DM70 5H59A 2BSAA 2X5XA 3AEKB 1KZHA 2BY4A 3EVNA 3WXMA 3ONEA 4K5QA 1MX5A 2EQBA 1E59A 3HYRA 3STVA 3V55A 2EGGA 1DKPA 4JJ4A 4HZUB 1FJHA 4RD0A 4U2DA 4QBHA 4A27A 2YWHA 3DMFA 1IXRC 3OPYA 1KC3A 1RWVA 1W85A 1JJBA 1KJ9A 4TLAA 5H81A 4BC1A 3WL3A 3EEOA 3A6DA 2TMDA 3G5LA 4NATA 4YCAA 4KQ9A 1UDXA 3EODA 1N2HA 3GLSA 4MX8A 1M2WA 2CLHB 2AYZA 3SEFA 3SVZA 3D6TB 4FSXA 2BE9A 2QSUA 2QRLA 4QKQA 5DPMA 2YRWA 3P1JA 2G4VA 3SMVA 5K6TA 1ZZEA 4QBIA 1XEWY 1LA2A 1NATA 1A5TA 1YAJA 4L8YA 4TZTA 1JSLA 2ZRIA 2GTHA 3OMXA 1LGYA 1CP3A 3JYLA 1Y7PA 3QHPA 4KI0A 2HQOA 1O9GA 3G1WA 4RAOA 4UTXA 1U9IC 1GLGA 4BLSA 1SXQA 2LCFA 4YCMA 3RS4A 4NG5A 1GV1A 1JMYA 5CYOA 2B8NA 3ZWDA 1KJYA 4FGZA 1XRPA 4MW4A 2W6CX 2QXTA 4TZ0A 4BB5A 4ENVA 1RM5A 1JHYA 2JI4A 1BHO1 3MJHA 3PA6A 4MW9A 4LRQA 4J0QA 4XLTA 4RZ2A 3QBEA 1Y3IA 2AZ4A 2CFRA 4N0EA 1TA0A 3TVDA 4Y2RA 3UAZA 1SBNE 1O0CA 1GYQA 5EN4A 4EPRA 2HC9A 1A2KC 1VP3A 4EFNA 1JUDA 4ZT7A 1XHLA 3T5BA 3DAHA 4OYLA 3TYXA 2WDPA 1SWVA 3R3XA 2RB4A 4FFMA 3VR4D 3KRTA 2O6HA 2WT9A 3N3AC 3RIXA 2H4WA 2JH9A 4AKTA 1APBA 4OHWA 2ZI4A 5HW0A 2FPLA 2WHQA 5FBKA 4LOHA 2PRJA 5IC6A 3UJ3X 4BFTA 1PZFA 5GONB 3HXTA 3LCUA 3Q7QA 4IFEA 2NX2A 3PX2A 5ALYA 1R15A 2EX0A 3FHJA 4U7HA 4ZQCB 1FQWA 1XZPA 3FCCA 4BLRA 1KVSA 3NP9A 1QNFA 4PZPA 4P81A 1OXMA 5CB4B 3QU2A 4RZHA 1ENPA 4CEHA 4DEYA 4TTJA 4GKAA 1QOQB 3V7WA 4Q02A 4FHDA 5I01A 1WNTA 2GEJA 3MINA 2IXEA 5IXJA 3JR3A 4V0RA 421PA 3OPYB 1QHHA 1ORWA 4TS4A 5JAQA 1T9BA 1UKCA 3C41J 2O2ZA 3SX0A 2BSQA 2BAGA 1TKCA 1N0VC 3SHOA 2GARA 2LIVA 2R5NA 1GZ3A 1EFVA 3JWEA 1ADCA 1PEDA 4MUJA 4PLFA 4RWZA 1BRTA 3KHUA 1CF9A 3HHEA 1K8RA 1O2DA 1Z0KA 5CA1A 1T2VA 3LX6A 5FRDA 3ROEA 5A6SA 1O4WA 5KI6A 2CMGA 2YHUA 2ZJ6A 3BE6A 3JWJA 5IASA 4EPTA 2SECE 1TQHA 5AOCA 1N2CB 4LXTA 1AB6A 4GPIB 4RENA 1J0AA 4WOJA 1XMPA 4NMMA 3RVQA 1CY1A 4BTVA 1YR2A 1P0CA 2CWDA 3DKVA 4XE5A 5A6VA 1EEXB 4MV3A 5TVGA 3O4RA 3H83A 2E89A 3SF8B 4NFSA 5IKXA 4P98A 5SY6A 4FBLA 4QJIA 3PLRA 1Z3CA 3BD6A 4BKPA 2NU8A 4KX3A 4LHXA 1A4XA 4WK0B 5JS8A 3FYUC 4L0QA 4DAOA 2O8BB 3IILA 4GOOD 3FPLA 3EIUA 4L85A 2BV3A 1I2DA 2C2BA 3PFFA 4RACA 4R1LA 3KZ1E 3ZZNA 3FDZA 5SV2A 3R7BA 2B34A 2Y77A 3L18A 3SZMA 3KVVA 2IBMA 5DVZA 5KYWA 1T9GS 2FPGA 3SVLA 5F5NA 2RGYA 4G1EB 4EMUA 4E09A 6ABPA 2C0QA 4DC1A 1ADYA 2AC2A 4J76A 4OXRA 5THQA 2H1SA 2G9RA 4RYDA 3L04A 4CUKA 4C5BA 3FWYA 3VSAA 3LBYA 4UU8A 1PJ4A 1Z26A 4EY4A 1KZYC 2DWQA 3HS3A 3D59A 2FOIA 3FYDA 2CHFA 3H4MA 1QG6A 5A1JA 2SHKA 1L4NA 4QDXA 1N6OA 2RK3A 3V6LA 4GPBA 1SD2A 1C0LA 2V3WA 1E98A 1YWGO 3NTUA 3O1HB 1GTSA 4RTPA 3GLGA 4I5IA 4JENA 1XTIA 3L02A 3T7SA 1G9SA 5DBGA 4LYHA 2IW1A 2Y1GA 2Q50A 1I01A 3KOMA 1OYYA 1QH9A 5EIXA 3G0OA 1M6EX 2DBRA 1ACMA 3REOA 1Q20A 1ZD5A 2Q62A 1TT5A 1K92A 1SRQA 5M3BA 1XZEA 4BVHA 3K8QA 2MSKA 4DCNA 1U0JA 5DM4A 4A0SA 4JJEA 1Y4ZA 2IUUA 1EX7A 1BCSA 2O0KA 1E6LA 1CUFA 4KR7A 2C2MA 5FX2A 4RESA 4E5SA 5TPZD 1L7RA 4BX3A 5AI8A 1VLJA 4X44A 2GVNA 4JCOA 5F33A 1A71A 4M38A 3TAUA 4W4TA 2ZYUX 2X8LA 5KYGA 3CLUD 2DP4E 2XAAA 2XZPA 3ROKA 3CRZA 3WMGA 4ZT6A 4UNSA 3CJTA 1ISPA 4G24A 4JOBA 1OWOA 1R6VA 3RSZA 4XDHA 4FMDB 2O20A 4O2AB 1EFKA 2LTAA 2X7JA 1CHDA 2GNAA 3I6IA 3IPYA 4TYQA 1S2OA 3P5SA 3W4JA 3T3OA 2D2IA 3GWZA 2VDMB 3INTA 5DWDA 3ZIAA 3WAGA 1LWNA 1KKLA 4B3HA 2NV6A 1IK4A 2HHLA 2JDIA 5K20A 2CXSA 2RHTA 1T2UA 1CYEA 4UNQA 4J2OA 1JXOA 3M89A 3TTUA 3MRVA 4I4TB 1OGIA 3YASA 2VEDA 3HKCA 4F4FA 4HQLA 1I32A 2AW3A 4HATA 3ACDA 1QV6A 5A04A 4KBFA 4EL5A 2V7PA 1VJRA 1QU3A 3ZJ5A 3D6VA 2YWEA 1TZMA 4JSTA 4ARVA 6REQB 1QO7A 1Z7GA 2QN3A 3DQQA 3GIDA 4MAFA 5I6DA 1SZDA 2KI5A 3DZGA 3EIOA 3CG4A 1SKUA 1Y5MA 2I2CA 4MVJF 2C42A 3SLRA 2IHZA 3FMFA 5FWNA 4UVIA 1AKQA 1T8PA 2DBVO 4AMUA 1EEHA 3UYLA 3WNBA 2CXRA 1NVTA 1ZNXA 3JD0A 5EJ4A 3UKDA 3HPQA 1JDPA 4HNAB 4L3OA 5H3HA 3IXQA 5K0TA 3VTFA 2F3SA 2WNSA 2ID7A 1G8YA 4RHFA 4CM6A 1FL9A 4DQLA 3V4LA 3WWCA 5ALTA 5K6AC 4Y2QA 3KDSE 4QO7A 1FTYA 4P3KA 1O54A 3L07A 4U2CA 2Q5CA 2LNDA 3FVRA 4JYPA 1BN7A 1Y1PA 2P78A 2FQ1A 1XLTC 4R2JA 3CNNA 2O8VA 1T10A 1FFAA 2GK3A 2OG1A 3OQVA 3CHYA 3IR6A 2GXAA 2H1FA 1E2DA 1PZEA 2AF4C 3H3JA 1ECFA 2DPGA 1ZJJA 2PTHA 3B82A 3GPCA 3ZY3A 1A8IA 1B8PA 1CIJA 3K9NA 3PKJA 2OCIA 1MJNA 3GRKA 5LA6A 4ENWA 2IC5A 4PNHA 1HZZA 1PR4A 3R4CA 4PTZA 4UHHA 1IHOA 5LXTF 4C0AC 1VCNA 2IPAB 3FTDA 3VR2A 5JTTA 2P5SA 4IINA 3LHIA 4RANA 5DI3B 4GDFA 1MU0A 4HH4A 2GI4A 5LWQA 5U9CA 1J8VA 4WCFA 1D09A 3G89A 3MCWA 2XAUA 5FI3A 1MNAA 4I2VA 2GPSA 3M3DA 1QK3A 4BJHB 1MABA 3A3KA 1GITA 3ELUA 3FG9A 3O8OA 2AXPA 4HLCA 4M1SA 4FYVA 4N8EA 2QLMA 3ZXSA 3OC6A 2JAOA 5DF1A 2CNBA 2YHIB 3TW6A 1X8KA 2G0TA 5I3CA 4M1TA 4OYRA 4YNBA 2VYNA 4WJKB 4MDFA 1IATA 1UM9A 1XDGA 4RAQA 4UAGA 1T3LA 2OOSA 3W7VA 3A10A 3OCJA 2RCYA 1EUCA 3OZXA 1PUIA 3NAMA 2H9IA 2VDQB 5LDHA 4OP1A 2PLRA 4KXLA 4FK8A 1GTZA 2ECQA 5KCZA 3NOXA 2G3YA 1LC0A 1W44A 4IP0A 5TPWA 1SIWA 2C58A 3MBOA 4CJXA 4DNOA 4RF4A 4NTZA 2H07A 3Q6MA 1LNSA 2Y67A 3S1AA 1RW4A 1AIPA 4RTQA 3OI7A 3UZUA 1P8AA 5J1SB 4D0LB 4AZVA 1MJGM 1WDTA 3KKMA 5BMVB 1IAQA 3OU7A 3LWDA 1UXKA 1Y4SA 2N75A 4TXHA 1K88A 4E7OA 4F71A 4JGIA 4FW8A 1QHHB 2VZLA 3KYDA 1EI9A 1K2VN 5CVUA 4EVQA 1CBUA 1DTSA 2VJBA 4DILA 4KG7A 3SOPA 1GILA 3LAWA 5H16A 1JI0A 3UPTA 2ZJBA 3MTGA 4A15A 4R3WA 3OLYA 1A2OA 1Y9EA 3CX6A 3TMYA 5KNDD 1JT2A 1H2XA 1DCTA 1KFJB 1EBUA 3LY7A 3UWDA 3HMKA 1H1LA 1M2JA 4R41A 1UH5A 1WQ4A 2XYGA 5DCWA 3P0EA 2OUKA 3GRAA 4NPAA 4M1QA 621PA 5JFGA 5C8DA 4DLVA 3I5UA 3EG5A 2X1MA 2VDNB 3EDOA 4LZZA 5K8VA 4YJ3B 1ZIYA 4ISBA 1H66A 3IUEA 1KY2A 5F5XA 4WERA 1W5EA 2JH8A 2F55A 2N47A 1EG2A 1TM3E 2BT4A 3AIMA 1L1EA 4G5XA 3BRWA 3RBXA 4MW2A 1GFSA 3TINA 4DS3A 5BN3B 1SU8A 3U9TA 3CJQA 1ORVA 1YRAA 3Q8WA 4WNCA 2B98A 4TUYB 1N8SA 3EGIA 3QNMA 3TF5A 1G0OA 1VIDA 2Y99A 3P0JA 1DQSA 2PRSA 3QOFA 1RTTA 4L9RA 3TLMA 5HK9A 1XWFA 1YB6A 2QLLA 1SCNE 3CPSA 4GOLD 5E7IA 4PLTA 3T5GA 4DWJA 3P9XA 1Z4LA 2Q4EA 4BTLA 4E51A 4V0KA 2FEMA 3SLGA 1A27A 1EP3B 3EJ6A 3LY5A 4TLCA 5C31A 3GBPA 1QFMA 2SNIE 1HDCA 3BWXA 1EK5A 3QVVA 4PFJA 3OJEA 4Q7LA 1FDTA 2OV1A 5IMBA 3SR4A 4DXDA 3BIFA 1H8ED 4CV1A 4N3NA 2JI7A 5L9AA 2FLKA 4BWYA 4H3VA 3V6MA 3U5ZB 1UOQA 1KH3A 4P58A 1ELOA 1QIJA 4ZPXA 5ULLA 4HNVA 3WMXA 1MT0A 3AUSA 4F5YA 4J3JA 4RADA 2EDCA 3PC6A 2YX1A 4MVXA 2QAGC 4I4LA 4IW3B 2OV2A 3C45A 4N9QA 1M34E 1OLUB 2JLZA 3A2MA 2PKRA 3H5VA 4PRZA 4D9HA 2ATEA 4BRZA 2XW6A 3NHUA 1YFZA 4I1RA 3DP7A 4UJ3A 1U7WA 5ALIA 5IK2A 3RV4A 2WB2A 1ZHHA 1C2YA 4PFSA 2F64A 2X4IA 5CA0B 1MAWA 3WIBA 1PF7E 3NAGA 5AJTA 4MQEA 3TR0A 4ML3A 2WABA 1RBQA 4Q7EA 4QTTB 3STYA 2FLWA 5AW6A 2RGBA 3ADPA 1FP4B 3MGAA 1IL0A 2DUUA 2JHFA 3NKLA 2GNOA 5IU6A 2C9OA 4ZI7B 4DYDA 5HRCA 2HA3A 3N5CA 5JATA 4RY0A 5LP6A 3VR3D 3BB1A 2R4UA 3IHWA 2BHRA 2OHGA 4M0UA 4IIJB 3QVTA 1FLNA 2FH5B 3FI0A 4R2XA 5K3OA 5KSOA 1TIBA 5D3KA 4TQUS 5A7HA 4BB0A 2O4UX 5AQEA 1CUZA 2DPXA 2BFNA 4EYOA 2YQ5A 3O4FA 2XDYA 4GS5A 4TWBA 1ONPA 2B94A 2FKAA 4O4HF 5FXMA 3AI1A 3MWLA 4NV3A 5BOSB 1E9AA 2IFTA 1LI5A 2HWYA 1N6KA 3CLUC 3DVSX 3NBQA 3A70A 4D9BA 4P3PA 1HR0B 3TUZC 2QW0X 3L6DA 3Q2KA 5ISMA 1GVHA 2HU5A 3OCCA 2QP9X 3TCKA 4LHVA 4PEVA 1I30A 2O8NA 3K6JA 2GSWA 5H3LA 2IEIA 1JVBA 4R8MA 3ZEIA 4QDOA 1PJ8A 3REQB 2CLOB 2ZYRA 3PUVA 2J67A 2VT2A 5ALXA 3MT9A 4ZJPA 3OWXA 3K70C 2X0FA 3IT1A 2IWRA 4JB3A 1KO8A 1UMBB 3PHIA 3F5FA 5FI0B 5JD6A 1YE5A 4FHEA 1FSPA 4PRLA 3IC5A 3BICA 1ECCA 4NDAA 3WHKA 3VR2D 2VYVA 4A8JC 4IH9A 2V7UA 2RBEA 1ZAKA 2C04A 4J0KA 2MYPA 2P9ZA 4I9HA 2WD8A 3U48A 3WGYA 1NP6A 5CX1B 2Q9UA 3OG9A 3H5WA 1KO1A 3QLJA 1PNRA 5L7TA 4X6YA 2JAHA 1I9CA 2H08A 4DQ0A 5KTYA 1H3FA 1ADJA 2ODEA 3CF4G 3I37X 4OA5A 2Q3MA 3VSCA 1XCGB 3S29A 3VZQA 2FSSA 4NIMA 5DHSA 4IDBA 5CRIA 5EIWA 5JMPA 3ROPA 4BKOA 5F73A 3KL2A 3TOCA 1C1XA 5AW2A 2R6JA 2G63A 3PC7A 4UCFA 5D3QA 3VOAA 1JV2B 5JV5A 2L0XA 2OEPA 2JPDA 5KNLA 1GNTA 2QV7A 2QZPA 3HUUA 1CX9B 5AIAA 4H1VA 1W19A 1QZTA 1C0EA 2D06A 1CS0A 4A91A 5C8YA 4OX9B 1G5TA 1MOSA 1MVOA 2RARA 3B2QA 5ENVA 1PR2A 1RWPA 4W7IA 4AXBA 3GA7A 5KYUA 3IAHA 1X80B 1NC1A 1SK8A 2I6GA 2NT3A 3PYXA 4IOMA 4O0LA 3W2IA 1E1LA 1ST2A 1PTJA 3C6XA 3DVQX 4JQSA 3MFYA 3RTDA 3WJ1A 4C0QC 2P9FA 3NHZA 4PHHA 2NVWA 2F3PA 2VQ6A 2CVPA 3ENNA 4UHCA 4UU7A 4DBLE 4CMEA 4Z3OA 1BMDA 3O6VA 3NBZC 1OWPA 2POQX 2Y2VA 3ADKA 3I83A 4M7PA 2ZIVB 1OKKD 3IPLA 1FP1D 1KMIY 3RRNA 1CNMA 2CXPA 3THYB 2NOAA 5B4UA 5JC1A 1BHSA 2PYZA 1TW2A 2GETA 4L8GA 3L0ZA 4NOMA 4RPCA 3R7WB 1WV1A 2MCFA 5F2EA 4D56A 4G1BA 3W77A 4GR9A 5LBIA 2R6HA 1V1RB 4O63O 3DM5A 2GBLC 2W2OA 3GW8A 3A4VA 3S2UA 1T34A 2ETVA 3DBLB 5JJCA 3LWBA 2IHUA 4YDHB 4B17A 1GCIA 2W42A 5F23A 2NO9A 1A2BA 3KB8A 1D5WA 5PGMA 4JROA 3BJIC 2QLBA 3T3NA 3S68A 1PEYA 1R5JA 2P77A 2V6FA 5KTKA 3UATA 2RH4A 1M1ZA 1PR0A 1SNYA 2A5YB 4LJ5A 5FFNA 1Q0QA 2JIPA 4F06A 4DZZA 2VDRB 2C1EA 4PXSA 5H9VA 2OO3A 4L22A 5G4KA 4QREA 1X1QA 1ZOOA 4BO8A 1JDBB 4ZI3A 1B93A 1BCSB 1SKAA 5KNBA 2BR5A 2E4UA 3FPJA 3G02A 3MUOA 1CB0A 3RU7A 1Z4IA 2R751 4DV2B 3RVRA 4XYGA 4DR3B 1RI1A 2RBKA 3AF5A 2IYNA 2EJWA 3UAOA 3QW4B 1E60A 1X42A 3VYSB 1LS1A 1UT8A 5E4JA 4Y6PA 2V7EA 3DD5A 1UP7A 1SHJA 3K94A 3EARA 3VU1A 4CUZA 4DGQA 3ZDDA 4C7OB 1Y89A 2WNIA 5CVJA 5FHRA 1G4HA 1GZVA 2OZKA 3B1KA 3GROA 4X6UA 3QV2A 1W4AA 3NGLA 1IB0A 3KALA 4R1MA 4DV1B 3RSFA 1CS0B 3IMFA 4EAAA 1KNQA 1JA0A 2BZGA 3C7CB 4RSGA 3WK5A 3QI2A 3BERA 3BJZA 3KJXA 3A32A 4UEWA 4Z4EA 3E8XA 1O94D 3WGVA 1E7SA 4F6RB 2Z2ZA 1E2GA 1GR1A 1E0DA 3D1LA 4J0GA 3SHVA 3SXJA 4KO1S 4LJYA 3HCBA 2I29A 1WE2A 2Q2QA 1U0OC 2PUJA 2P75A 4LVNA 4WNAA 3ODGA 3WIUA 1ZUNB 5H82A 1XRMA 4K6HA 5IVDA 4QTYA 2JB9A 3Q2OA 2Z3WA 1TA9A 5TJHA 2G07A 1ZMBA 4UD6A 3KETA 5CDFA 4PGMA 1G60A 1C30A 4QYIA 3T0GA 1HFJA 1NL3A 4FDMA 3S2YA 3S8YA 2Q2OA 3BGDA 5KU1A 2PL9A 1SIUA 4X8OA 2D0DA 2J7KA 3L4BC 4S12A 1QC5B 1XZ8A 3UMVA 3PEYA 2BMEA 1U3GA 2PAFA 2XHZA 1PT8A 3WIVA 1MJ5A 3FMIA 3C0KA 3AR8A 1EFAA 3OLVA 4TWJA 4W82A 1V7QA 2G7MC 4L8WB 4QVIA 2HY7A 3D4PA 3LPAA 3R76A 1M7GA 4LYDA 4DCOA 3NUZA 4I55F 2A1TS 3ZTTA 2P3LA 5JDCC 3HA7A 3SEQA 4EW2A 2PUAA 4BY9E 4Q4LA 1N2JA 5AFSA 2QUAA 4OKSA 2GHQA 4V0SA 2IELA 4U7DA 2E4WA 3I32A 3L7YA 4XPZA 3JX9A 1OYWA 3PT9A 4ACBA 2EBHX 1SKYE 2NZJA 3L7IA 4GP6A 4K7JA 5CHEA 3CY6A 3W3ZB 1FS6A 4KK4A 4KFSA 3SBDA 5DNAA 3EISA 4MVWA 2MYTA 1XTVA 2NAPA 3ZGYA 4CV3A 4CDRA 4YAUA 1HFEL 2M6RA 1AZSC 4AYXA 1PJRA 3AEUB 2VHZA 1Y5NA 1ZEJA 2IOHA 4NHEA 1WA5A 1BHQ1 2ZRKA 4B82A 4D9MA 3Q0EA 3FB4A 3K31A 2VSNA 1MXFA 3ECCA 4L6IA 4JXXA 2JK0A 3VDXA 1RAFA 1GTRA 4J1NA 1SBCA 2XUHA 1GKUB 1H2HA 5GGXA 4L0DA 4TM7A 2FHPA 1TTHA 4BFVA 2Q8NA 2OZEA 4QLOA 1DCMA 1QB7A 3AERA 3MTDA 4BNDA 4FU0A 1USKA 1UZAA 3GRFA 3P71T 5DLQC 2N3ZA 2VJCA 3HO8A 3OFJA 4A1OA 4ZVTA 1J9GA 1OC2A 1Z47A 5K0FA 2JVJA 2WC1A 3M4JA 2JLVA 2W2XA 4HGZA 1CUGA 3V4RA 3C6ZA 3CKMA 3F8SA 1PR6A 4BO6A 4CE6A 2C5EA 1RXSA 3IMEA 2I8AA 3U7JA 5CCXA 5E6RB 4HSGA 3G2HA 5IJ9B 4LXXA 1E3EA 3HKEB 3IVXA 4IF4A 3LYLA 1U8AA 2ZDQA 2ZROA 4P8RA 2WF9A 4HNRA 2ZJ8A 4ZHSA 2DPYA 3VU8A 1MB9A 3L43A 5GJWC 3G2MA 3T7KA 2I78A 1R9MA 5JQGB 1RZRA 5DX1A 4V0LA 4WTOA 4BZWA 4DPKA 4BEWA 1A7JA 5HZKA 1XVAA 3G0IA 1OI3A 1DJPA 2XMZA 1RC1A 4ZDIA 5IJ0B 3DOJA 2QW1A 3C3PA 5H4GA 4HNGA 5FWDA 3KYBA 2HHJA 4ICIA 1VZ2A 3MTQA 1ULAA 3FN4A 3OIFA 2Q5FA 2WUWE 5BT9A 1LDEA 2B6HA 5KX5F 2QRJA 1J8QA 1YO6A 5H80A 4DQKA 5DYYA 2J4CA 2PL5A 3MYRA 5JOQA 2VJYA 1O57A 4GMXA 1AXGA 5CH3A 4OREX 3E5RA 3RJZA 3EF1A 2Q1YA 3AUTA 1BXGB 2G1UA 5BRNA 1WMBA 1OPXA 2R6GA 4W5RA 3JRNA 1OA1A 2VJOA 1DAIA 2ANBA 4PN3A 1MP0A 3FI9A 4QX6A 3AEUA 1SXJE 1Z8DA 1I14A 1QX3A 5FNZA 4QGSA 1FMFA 3MXTA 4D3FA 1TAGA 2O8DB 1JALA 1ESEA 4IFBA 4HV4A 2O23A 5SICE 2QLJA 4TV8B 1JIUA 4A4DA 3OWHA 3VGJA 3RLIA 1T8UA 3LRXA 1EMDA 4HRAA 4DHWA 1U0LA 2A78A 2XA2A 3O8NA 3CEJA 3ZE2B 4IH4A 2G28A 3DHEA 1G5PA 2QD3A 3MUFA 5EE1A 1Q6ZA 3INNA 1M6VB 1M76A 2F1KA 4DSTA 2FZ4A 3CZCA 1X15A 1DIGA 4MARA 1H2FA 1Z2NX 4JBIA 3MPUA 2BTQA 4NZPA 5JCZA 3QFCA 1CW2B 1ISHA 3KWJA 4X60A 2V8BA 4B6PA 4YAFA 3U0VA 4MHOA 3KEQA 3IP5A 1DTEA 1Z08A 3EY4A 1LK7A 1ULUA 2DSNA 1FYDA 3MWEA 3BREA 1XVUA 1HG1A 1LLCA 1GRCA 3U2QA 5ER6A 1FFXA 1P61B 2OPBA 1KIMA 3P9KA 1VE5A 2VUIB 2ZYHA 3GXOA 1TK9A 1NBMA 1ZDMA 4HQOA 2TYSB 3I8SA 1P7PA 5H68A 4DLZA 3A6FA 2NPOA 3FWZA 4DB4A 1V95A 2HLDD 2IZ6A 2YFKA 4DCJA 5HDQA 4INJA 1F3LA 5ALLA 2LD4A 2W2NA 3NIFB 1O8CA 2PA3A 1JHOA 2X8WA 2ZRHA 3QU4A 5C18A 1OFUA 1UBUS 4LJ7A 5IMSA 3TXXA 3TRHA 3F6CA 2FCRA 3GCZA 4LHSA 5CHYA 5JAIA 1WPRA 3KQLA 4CFSA 4L73A 1XYYA 4CW7A 3KOZA 4HLNA 4B40A 5LZ8A 1T9ZA 3JATA 2ZRQA 3QE3A 1AQLA 3H17A 2XI4A 2ASEA 3ZWYA 1IZ8A 2ZPAA 3H9GA 3ICQB 2X9QA 3SYTA 1XL1A 3OX2A 3A58B 2AMLA 2RKWA 1HEUA 3LP8A 2B61A 1YGPA 2VJQA 3QG5A 4FKZA 4MP3A 3B1FA 3SE0A 3ZI0A 4HAZA 1V2HE 3NH9A 2JGAA 5JWRA 3K9CA 2NO4A 3QIVA 5IM4F 4UBIA 3WDSA 1FSZA 4JYZA 4J2HA 4P0PB 3AHDA 1DQZA 3PC8A 3VGPA 4QNMA 4KIGA 2CL0X 3N2KA 3PQ3A 4G65A 3JQFC 1E20A 1SBQA 5FJIA 2W83A 2JGKA 4ABYA 4I1YA 4RK0A 3MJ4A 2JCYA 2A9VA 4WZBE 1QRUA 4JHLA 3ZWAA 2GFHA 3KWLA 5REQA 4C7VA 3FNHA 4JL6A 4CZ2A 2B2CA 2FU5C 4DNPA 3HB1A 2Q4TA 2NGRA 3B6ZA 3BMOA 2FF5A 4HVTA 5K2OA 3ZX4A 4AZ3A 1AZLA 2VXYA 2FW8A 3VH2A 3ZQ6A 4AJEA 4ZIRB 2MMCA 2RAFA 2ZS7A 4TKVB 3W5VA 3C3WA 2JIDA 4AO8A 3VO1A 1T36A 1ODSA 1TAQA 4YCCA 1NBHA 2Z3ZA 4B83A 5FOUA 4NJEB 3CUSA 1K7CA 3OLCX 1F51E 5F9HA 4DR4B 1MAVA 1KQOA 4FVTA 4GHWA 1OKKA 3UAVA 1G5RA 1PV1A 2J3JA 1GY8A 1TVCA 3W8EA 3TB6A 1NF8A 3L1UA 1OSNA 3I2KA 1KO5A 3RU2A 4MTCA 2FRDA 3L7KA 1VL6A 1GN8A 1Z75A 2WYUA 3KEGA 4LMRA 2QW8A 4O1HA 2Q3DA 3R9WA 4IXTA 2XEDA 3JS5A 4FC6A 1RRFA 2NUBA 1E5QA 2DQSA 5FL3A 5IS2A 2J0QA 3O8OB 2FUEA 2WFLB 4JEMA 1XN4A 4QOHA 1PGPA 2ZRLA 2EFYA 3IEVA 3H9JA 2YQZA 4XRRA 3ANMA 2AZDA 4Z51A 4Z5XA 3CE6A 1RXIA 1PDWA 1ZGBA 5DI3A 4YUZA 5B3KA 1BC5A 3QBJA 4A10A 3B9PA 3NNDA 4TSFD 1G7SA 4TYMA 3WLNA 1MOPA 3H16A 3K5PA 5A9RA 3ND8A 1Z5GA 1E5TA 1X9HA 1VI5A 2CKMA 1MT3A 1VECA 1PNQA 2QWXA 4J94A 3QLTA 1YR7A 2R1VB 4S0ZA 1XQXA 4GMGA 2VNJA 3D54D 5ALNA 4CLEA 3JZDA 4DC9A 4TSRA 5LU8A 3Q41A 2GLTA 4JP2A 2Z4RA 4X1OA 4WADA 3NUQA 5AKZA 3IEMA 4UTVA 4G85A 3F6PA 5JH7B 2RGNA 2HK9A 1HL7A 2OC9A 1Q1EA 3FUWA 1GEGA 3H19A 4BNKA 3SC6A 3V7UA 4F9FA 4DKXA 5I7SA 5EXEA 1HH4A 2QMYA 2ATCA 1JQBA 1XK7A 2HXYA 1XO1A 4HXGA 4JP5A 4OAQA 4TT3A 5FYDA 1SG6A 2O8EB 2FWMX 3PIRA 4R8LA 4UM7A 3OJ0A 4Y9UA 3Q7RA 2H5LA 1OAAA 2BGNA 2LXNA 2OV3A 3GFPA 3OBBA 3ZWXA 1KAQA 1L3IA 1EWKA 2F48A 4PG7A 2ZTUA 2JEZA 3ECAA 1HLPA 4ZHQF 3FIUA 5AT1A 1V5IA 8AT1A 2WFMA 5K4HA 2LV8A 5C4GB 1YR9A 1UQTA 4JUFA 1H1DA 3GLIE 2G71A 1UMBA 3H4TA 3SKVA 4Z53A 4JBWA 3JQBA 2XGJA 3VTKA 3PRKE 3AEQA 3SF8A 4XWKA 1KSGA 1EESA 3BZBA 3CQ9A 1AB5A 4PPQA 2I87A 3U3JA 2QS9A 1OWLA 3GJQA 1QANA 1Y1KE 1E69A 1TLFA 4R9SA 4Z9AA 2CNWD 4D46A 4DCSA 2C9DA 1GZ7A 3GEDA 2AFIA 2KLBA 1EXDA 1TJ5A 4XYMA 1Z6TA 3FWNA 2GD1O 5EIBD 1Y80A 4IQ8A 3EH1A 1R64A 2ON6A 3EFBA 5KWEA 1W88A 4MS4B 3KZNA 4DIUA 4ZA2A 5A2QA 2GDZA 1E2IA 4OJNA 2QRQA 1L7MA 1I33A 3KPYA 1IN5A 3OZTA 1XE3A 2PCJA 2AFHB 5DXFA 3QVWA 1FDRA 4PC6A 4R2KA 3BMCB 1NLUA 2OILA 1BDJA 4JKYA 2WFAA 4HEJA 3E0QA 2CK3D 3NT2A 3RTGA 2A0KA 2XUFA 4R69A 4EFDA 1WP9A 3VI4B 2HMSA 3ZWKA 1YR1A 4JB0A 4WEQA 1Y81A 2GXSA 4R83A 2J0UA 4O4LF 2D4HA 2ZWOA 4OK5A 2FRVA 2ZYIA 4QA9A 4EFLA 4XGQA 4G1MB 5PNTA 3CF6R 4DXHA 1VM6A 3C39A 1O97C 1PFWA 2ZJ2A 1L3BA 3R5SA 5JJBA 1V43A 5J2UA 3PPWA 1N2ZA 2OO7A 4G5GA 4DLKA 4MWTA 4C4YA 5C51B 3ZXIA 4PX3A 1Y9AA 1OI7A 3LG2A 4KN6A 4D43A 3Q1KA 2Q2NA 2YJ6A 1IE3A 3WJ7A 2IIPA 4UPEA 4HAVA 4U6QA 4CEJB 5JZSA 2XVMA 3ZNOA 3P9RA 3P7MA 1M75A 3CLRD 3RPEA 4CMJA 1GAWA 5J5VA 3I09A 4HWRA 4OXQA 3IESA 3KJQA 2FN8A 2QLFA 1SQ0A 1MC1A 3HXKA 3IEXA 4GKKB 4GGPA 5JDCA 2BMJA 4WDRA 2PX8A 2RMKA 4JLKA 4LYEA 4LV6A 3ROZA 5BXYA 3PF9A 1RKXA 1GTVA 1M2EA 3GELA 3ZE0B 4QSHA 3ZOKA 4DJJA 4DEXA 2O2DA 3QX8A 4KACA 3TLYA 3M34A 3LVBA 4MRNA 1NUPA 3NANA 4Q01A 2TMKA 1KMCA 1QGOA 1UXIA 1ECLA 1GQYA 1J39A 4KXYA 4F8YA 1OOEA 4CODB 2PT9A 2ZSUA 3DEIA 1VMIA 3FTCA 3D3WB 1J1UA 4A1FA 1ZEMA 2NU8B 3SZOA 1GQRA 3AXTA 2P5YA 3I05A 4FR0A 4BO1A 5BRJA 5IFLA 4M22A 1HF3A 2JJYA 2QTTA 2J6BA 4AKGA 1KMQA 3HV0A 1ODFA 1IONA 4Y2JA 4AI6A 5K9ZA 5HG0A 2Q3JA 3OY7A 3DMYA 1W88B 2X7XA 4JC4A 1PR3A 2IIBA 4YJ3A 3TW0A 2GASA 3MTEA 4LNHA 1OZ0A 3BH6A 2C4NA 3L0OA 4XQ9A 4EMSA 1EINA 2OSBA 4XEUA 1C4OA 1P6QA 3U3MA 2XTNA 1OLXA 4B3MB 1SU6A 1W35A 4FFBB 1PDVA 5CURA 3LGAA 3MTIA 1SCAA 1S3FA 3VAYA 4UM9B 4U8GA 3RRMA 2FRDC 1VKRA 1T24A 2OK8A 2DR0A 4KO8A 5C5EA 1N5LA 2GM3A 5I7FA 3SXPA 1T4BA 2GR9A 3WL8A 1YZHA 4RJ2A 3DCNA 2BJWA 2D5CA 3G6WA 3R5KA 3X1YA 4BAZA 5C3MA 3ZU5A 1HL3A 4YPOA 1VHDA 3Q10A 3QKSB 1B6SA 4RQBA 5EUCA 4E30A 2A9RA 1L7DA 3ET5A 1ES9A 1DBPA 3PWTA 2BSXA 2IZOA 1MLDA 4D9FA 3DEZA 4TZ6A 3F4LA 5BR7A 3G88A 4GVPA 5DRYA 4V1CA 3FOEC 3PVSA 1PJBA 2IY8A 1X87A 3LGXA 1G8JA 4BMZA 2YJ4A 2DE0X 4UMFA 3D3KA 2YC2C 5T4BA 3RRXA 8LDHA 2ZSDA 3P0HA 4OGWA 3UC9A 5JCPA 5KNCA 4EKGA 2FG6C 1Z28A 1Z4PX 1NI5A 1J8DA 1OXXK 1S4QA 3LQKA 1A8PA 1IHUA 4JZYA 5D5PA 4PNPA 3CVVA 1EE9A 4I1VA 3FZYA 1J25A 1YI8A 4C14A 2ZPUA 1TT7A 1U0SY 3VX3A 3JAWA 4EX6A 2AL7A 1GGMA 4DCGA 1U1EA 1JPUA 2X22A 5TQ0A 3CSSA 4RORA 4C89A 5J4HA 4F4JA 3Q3GE 3UOAB 1OAOC 2OA0A 3U4IA 3TFWA 2HK6A 4R0NA 4YUYA 4W5JA 4Z0TA 1NPDA 4ZTUB 2I9PA 3LO8A 1EVJA 3EUAA 3H86A 3AM4A 3LHFA 3CR7A 3BD8A 4LTMA 4QXPA 4OXNA 1WW2A 4YLGA 3GMDA 2WZQA 5T57A 3SXUA 1XA3A 3IL2A 1D6MA 1SVSA 3PTZA 2O0MA 4ENTA 4DSOA 4F4UA 3EVBA 2INGX 1SBTA 3DE1X 2HJ9A 4TRMA 5BO5A 2WUDA 3D3QA 2JJQA 3RHFA 3FPCA 3OQIB 4O2LA 4RJIA 5A05A 2F43A 2VPIA 1S0UA 4B3JA 1Y4UA 2V7TA 5BWCA 1EP9A 4YUXA 1OAKA 1WTCA 3F67A 3G85A 4UHKA 4MA4A 2KHZA 2HSDA 4FHZA 4XTRA 1T1JA 5G3YA 2OFPA 3N8IA 2Z58A 5BSMA 5FPYA 4GSLA 1QYRA 2EX4A 3EEFA 4J3FA 5BVGB 5L6LB 3M5PA 2BW0A 2GB4A 3NLLA 2SCUA 4UQOA 3SFZA 3VYUB 3ELBA 4P36A 2ZVQX 3PA8A 2GYWA 2IYEA 4BNVA 4OP3A 1OBFO 2XUQA 3PNKA 3TSAA 5BORA 4GZMA 2AG0A 4L02A 4NK4A 4YAOA 5KSWB 4UEJA 3WLIA 2P62A 1S02A 1P1HA 3DFZA 5CGQB 4MA0A 3IQWA 3OQ1A 3ORHA 3RREA 3RSOA 3X1KA 3SHQA 1RHRA 3V00A 3OM9A 1UFKA 4LDJA 2FP3A 4Q21A 4J7AA 4AUKA 2BFDA 1GZ6A 1TC2A 4KPUB 4B43A 2DF8A 4Y2GA 1R8YA 4D44A 3CXRA 2FN4A 3NNNA 1YVUA 2H2IA 3V80A 4X64B 4F93B 4IHKA 3AIKA 1BEEA 2E1PA 2QLTA 3PUHA 2BFFA 5I7UA 1M34A 5B1IA 2X8JA 5IKEA 5EP4A 3AEXA 4ZQIA 2RGAA 3L0SA 4MWDA 2GK7A 1Q44A 3AYZB 1HQKA 4RS4A 1W30A 5L7WA 1LRLA 1TW3A 4KRGA 4PC3A 3ILSA 4CKCA 2DX7A 4R2MA 1ZGCA 4UOEA 3B52X 3MEQA 3EVAA 4W5WA 2J07A 4ZQBA 4CYMA 1Z83A 4RE6A 1VHTA 1S89A 2ZIWB