5JROA

The crystal structure of azoreductase from yersinia pestis co92 in its apo form
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
202
structure length
184
Chain Sequence
AMSKVLVLKSSILATSSQSNQLADFFVEQWQAAHAGDQITVRDLAAQPIPVLDGELVGALRPGTALTPRQQEALALSDELIAELQANDVIVIAAPMYNFNIPTQLKNYFDMIARAGVTFRYTEKGPEGLVTGKRAIILTSRGTPTDLVVPYLRLFLGFIGITDVEFVFAEGADAKTLLAQVVAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-dependent NADH-azoreductase
publication title The crystal structure of azoreductase from Yersinia pestis CO92 in its Apo form
rcsb
source organism Yersinia pestis co92
molecule tags Oxidoreductase
total genus 57
structure length 184
sequence length 202
chains with identical sequence B
ec nomenclature ec 1.7.-.-:
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jroA00
2A5LA 4QOIA 1TLLA 1FLNA 3K1YA 1FVXA 3HA2A 1YCFA 2V9CA 1J9GA 2QMZA 1T0IA 4LTDA 2KQUA 1J8QA 4Y9UA 1H66A 2BF4A 4CF6A 4QOFA 4HEQA 2ARKA 2RG1A 1CZNA 3F2VA 3NLLA 4YAFA 2Q9UA 3GFRA 2QX8A 3L9WA 4XDGA 2AMJA 1D04A 1AZLA 3FVWA 5FA6A 3NHYA 1OFVA 3F90A 3OVMA 5LJLA 2Z9BA 3JSXA 4C76A 3KAPA 3FW1A 1WSBA 4QOGA 3QFRA 4BMPB 2GSWA 1FLVA 1XYVA 3G5MA 5F51A 4FGLA 2FAXA 3NHJA 4XDHA 4QODA 5A4KA 2Z98A 2FCRA 4ZVNA 1T5BA 1KBOA 4GR9A 2HPVA 1YCGA 2BMVA 3EDOA 2FVXA 3KAQA 2B3DA 1ZWKA 5ULLA 3NHLA 3QE2A 5NULA 4FGKA 3L9XA 4Y9RA 5NLLA 4LA4A 4QOHA 5LJIA 1D4AA 2QMYA 2XODA 3N39C 3NHRA 1E5DA 3FJOA 3K20A 3TZBA 4FX2A 2FLVA 1AG9A 3P0RA 1SQSA 1AKVA 2OYSA 1FTGA 3N3BC 1D03A 1RLJA 1CZUA 3HR4A 1AKTA 1AKWA 3W79A 5FX2A 1DXQA 3ESYA 5F4BA 3U7RA 3ES9A 3ESZA 4NLLA 2FZ5A 3OWHA 4C14A 1BU5A 2OHIA 3F6SA 2X2PA 1QRDA 2MTBA 4C0XA 3OX1A 3EYWA 1CZRA 2KLBA 2OHHA 1YOBA 3KEGA 4ZVLA 2M6RA 3LT5A 1FX1A 1YKGA 5F12A 3S2YA 3FNIA 1AHNA 5LLDA 2FDXA 2F1OA 4GQIA 1RTTA 1XYYA 2Z9DA 5B3KA 6NULA 1OBVA 3OX2A 5LVAA 3U7IA 4PTZA 2HNAA 2W5UA 1XT6A 3NHUA 3OX3A 4U7HA 2V5VA 3D7NA 2R96A 2QX4A 4LAFA 2FZVA 1XI2A 5BUCA 1NNI1 3SVLA 2QX9A 2HNBA 1C7EA 4N65A 4R81A 3GFSA 3W77A 3NHFA 1QBGA 3ZHOA 3GFQA 4DILA 3B6JA 4Y7CA 5EAIA 2XOEA 1ZX1A 3NFRA 1J9ZA 4QOJA 3W78A 3RPEA 2X2OA 3OWXA 5LBTA 3B6MA 4N9QA 1AKRA 2QX6A 1RCFA 2MOKA 1I1OA 3QFCA 3NHKA 4D02A 1CZOA 1CZKA 4YAWA 5EA2A 5LBUA 2BPOA 1AKUA 3FX2A 4HS4A 3O73A 1JA0A 1DXOA 3GAMA 1J9EA 1JA1A 1FUEA 2D5IA 4PU0A 1FLAA 2BN4A 5B3LA 1FLDA 4BMOB 4C0WA 1H69A 4F8YA 4LTMA 3OJXA 1WSWA 2R97A 2Q62A 4YALA 2QR2A 2MT9A 1V4BA 1ZWLA 2Z9CA 3OJWA 4ICIA 1RLIA 4M0CA 4H6PA 1CZLA 1VMEA 2ZKIA 2N1MA 1B1CA 4PTYA 3ESXA 3R6WA 4H2DA 2OHJA 3NHWA 3W7AA 1QHEA 1AKQA 3N3AC 4LTNA 5TGZA 1F4PA 3NHPA 3HLYA 2FOXA 2V5UA 3B6IA 4ZVKA 4CETA 4YQEA 4DY4A 1YRHA 1AMOA 4FGJA 3O2NA 3B6KA 4QOEA 2M6SA 3NHSA 3F6RA 5FUQA 3TEMA 1BVYF 1YDGA 4U7GA 3UXHA 5JROA 3UXEA 1OBOA 1KBQA 2MWMA 4YAUA 4DIKA 2WC1A 1CZHA 2BZSA 4ESEA 2QWXA 4J8PA 1QR2A 4GI5A 1X77A 1SG0A 4S24A 5EMNA 4N82A 5LMCA 4YAOA 1DX9A 4U7FA 1C7FA 4OXXA 1TIKA 1GG5A 3LCMA 2FX2A 4ZVMA 1YCHA 3TE7A 4NULA 3KLBA
chains in the Genus database with same CATH superfamily
2E7ZA 5J2UB 4YGYA 2WIBA 4Q7QA 1X7XB 1MW8X 2JNWA 1J9GA 1P5ZB 3DMPA 3N0WA 1TIPA 5M29A 5LZ4A 4P4TA 1NMZA 3AOGA 4C0HA 2VH1A 4P1ZA 3OIDA 1NSFA 1FNNA 1W44A 3ORHA 2PA3A 4K46A 5AUQA 5L3ZA 2G9NA 3L18A 1SXPA 4ZOLF 5AO9A 2GBPA 4C4TA 2MMGA 3O82A 2QP9X 1CJSA 2JGJA 4JIGA 2O7SA 2CZGA 4L51A 5H9WA 4FINA 4BNHA 1PI3A 2PMFA 1EZZA 2QT0A 4NMWA 4REQB 2OUIA 2PZ8A 3ABOB 3SJAA 1X87A 2JD1A 5BN5A 1HTBA 3OCCA 4D8XA 4IIEA 4LWPA 2O8CA 1RI3A 1CB0A 3E4CA 2VT3A 4ND6A 1UJ2A 3NUQA 3PXEA 4NPAA 1UKAA 1FUKA 5AD1A 3EIXA 3L7DA 3PITA 4UBKA 1H2HA 2RHHA 5JCOA 5FV4A 5LSAA 3L1HA 1IHPA 3B9BA 1RE0A 3BCUA 1KAEA 1Z36A 3PQ7A 3DVLA 3P9ZA 3IBFA 3K2BA 3TTSA 1E2BA 2Q7XA 1D04A 4J7XA 2PR7A 4EEZA 4GEKA 1QVAA 4I50B 4JJZA 3H2SA 4FDMA 4D9MA 1MF7A 3EASA 4D8WA 3TQCA 2O3UA 5GONF 3GLRA 5DLYA 4NV3A 1SG6A 1WEKA 4KOAA 3G8AA 3DULA 1LRLA 2N9UA 4JLAA 1JSXA 4IQ0A 4Q6BA 4JZYA 5CW2A 4KMOA 4YRBA 2C54A 4JOQA 4OXIA 3NP7A 2TMGA 4AZ0B 4WBNF 4JXXA 2UAGA 2KB0A 1K4KA 3HUFA 5TC4A 4BLTA 1V43A 2YV4A 4E5KA 3EUAA 2QA5A 3IMEA 4M7RA 1W8DA 2GK6A 5EXTA 5F51A 3U7QA 5JMTA 1SXQA 1O54A 4N12A 3UMJA 2EJBA 2P6NA 2IDZA 1P4HA 1UMKA 4KACA 4MO2A 4XQ9A 5EP4A 5FNZA 5LU9A 4F46A 2JGNA 3QLJA 2ZVPX 4LOIA 1E1CB 5EI5A 2B1IA 2FWIA 3NATA 3DO8A 3NKFA 4UNQA 2JFOA 3QLUA 4JBYA 3PGKA 1QG0A 3BFKA 3O26A 5CLGA 2Q5OA 4YH1A 4B4KA 3CUTA 1DB3A 2A5DA 4J16C 3HXLA 4LXHA 4IICA 1ODLA 2HPVA 5DHSA 2F1JA 4M86A 1Q3KA 4P08A 3KCNA 2QYOA 5BSGA 1W4BA 1KEEB 1XV5A 3KOYA 1NP7A 2MR6A 2QK4A 4ECEA 2CLKB 3WV5A 2QQ5A 2C3OA 1JXQA 2I9KA 2ZSUA 2YIDA 1DHTA 2HFKA 1J8YF 3HTXA 3ITEA 2BISA 3IAS6 4IRXA 3PE3A 3WIOA 2DTDA 2FPKA 5FI3A 5JYDA 1VECA 4BGEA 5LNK6 3L9XA 4BLPA 4L5JA 4LC9A 4LSMA 2I2CA 1UOQA 3KQKA 4REOA 4LC0A 3R5KA 3TTTA 4AROA 4CL3A 4EHDA 2F62A 2P79A 4Y3UA 3GX1A 3UJPA 5KC8A 3VDQA 1ZQ9A 3QPVA 1V16B 4LBYA 1IZ7A 1FEZA 1QCCA 3WYFA 2CMGA 2BMAA 1JQ3A 1WZIA 2EWMA 4RSMA 2PDAA 1M8KA 1T0UA 1KGDA 1O2DA 2FR1A 2OM2A 2FPGA 1C9YA 3K4QA 3DBVO 3ZTTA 5KOJA 1F38A 1USIA 5A5VA 4OX9Y 5KYKA 3RYIB 3SEAA 2OXFA 3E48A 1K2WA 1A7UA 4AU1A 1K5PA 1I1NA 1SUWA 4BGVA 2HCJB 1RI2A 3FCAA 4O2AA 2YZNA 4WACA 3UJ9A 3VVBA 2FK8A 5BSRA 5LUBA 5L4SA 4DR3B 4U2EA 4JL5A 1B14A 3D7RA 2G4LA 3RS2A 1GPMA 1I3OA 1XRLA 2OECA 1G1AA 2OT3B 2J07A 2R7LA 2XY4A 3AWDA 4NE9A 4PICA 2ZJ2A 4KPEC 3EIUA 3L1VA 2AKAB 2J6IA 3LWBA 5E9QA 3I37X 1Y34E 2R5WA 2Y4NA 3OIYA 4CL0A 1EGHA 4L76A 1X7YA 2JKYA 3OZIA 3FPSA 3Q8WA 1JEQB 4GP9A 2QRHA 1AKWA 4K8OA 4QO8A 2Q3DA 3C5WP 3RGGA 5I6DA 2FFHA 1RABA 2YVLA 4TLDA 5AKLA 1PS8A 2WOOA 1K0UA 2ORED 3WP1B 3ZDQA 2RBGA 1DARA 1UDWA 4DT1B 4NNPA 2YZ2A 5FA5A 1PO7A 5JNRA 3KTDA 5CLQA 1XU7A 2LCIA 5FHQA 5FEMA 5K0LA 2PH3A 1RLUA 1MRZA 3TFWA 1KYTA 1PK9A 4CYMA 3L5KA 3EGOA 4EY7A 1XE3A 5IYZB 4OQEA 2FR8A 4P5EA 3WA7A 4LSGA 1GCOA 1JFRA 5DU2A 2WWIA 4MR8A 3TBFA 1XFDA 4F04A 1EEXB 3DBOB 1W52X 3P5BA 4A0HA 4PRYA 1L5FA 4ZFNA 3OT5A 4V0LA 4EHIA 4MYHA 3RYTC 5TY0A 2BYTA 5DIFA 2V58A 4PCLA 4DG5A 4QM6A 1JR3D 3G6WA 1D2AA 3PDCA 4Q82A 1HT0A 3IAXA 3N53A 4G5QA 1IJFA 2D5LA 3K31A 4HGNA 3TQIA 5IUNC 2Z6UA 5LUAA 3LRTA 3MTJA 1A7KA 4B6PA 4NNJA 5KVQA 5CJJA 5CM9C 4HDMA 2ATCA 2AK3A 2IYVA 2J5RA 4WA8A 4M88A 2KLBA 3KT0A 2HSDA 5I7VA 1C29B 3CKLA 1DIHA 2H4FA 4GH5A 3NEYA 4FILA 4J9UE 4N3NA 2V6MA 4QICA 4UVIA 4FMDF 3RFCA 3CIFA 1BCSA 1NW5A 3RR2A 2VOJA 2CC2A 4MV1A 3C0KA 3TLEA 1KORA 3ZLTA 1NF8A 1TPZA 2FPPB 2Z8ZA 3IHWA 3QF7A 5AXAA 4A3SA 3M9LA 4EA7A 2IYUA 2F59A 5C4MA 1YBHA 4YP1A 4I1UA 4UCFA 5REQB 1OQAA 4ZI5A 1NFFA 3TZEA 3OZGA 3QEMA 1XHLA 2VG8A 2A92A 3AETA 1C7RA 3BZUA 1D6MA 4GDMA 5GOZA 3S27A 4EF5A 3B6ZA 2WF5A 1G5QA 4GMDA 4O4HB 2NU9A 1QGUB 3L6EA 2BP7B 5IFKA 3FIJA 2YICA 2AZXA 2V45A 4CM8A 1QCDA 3JW8A 2ORWA 3LY9A 4WT7A 3UHFA 4JJ8A 3THXB 3T15A 2XZDA 5ALKA 4Y30A 4HNUA 3SQLA 5KVCA 1IIBA 1R5BA 4YWJA 1X7GA 1G4HA 5JAZA 2KSQA 4DIOA 4CG0A 3DZDA 2D5AA 1P9NA 1X1AA 4RDIA 1T5LA 1WW3A 1Z4QA 4NAVA 4JOCA 1HYEA 4TZKA 5JG7A 2GBCA 5TB5A 2XE6A 1P1HA 4J0EA 2HNAA 3ST7A 1Z73A 2H06A 2P4SA 3E6AA 3L4EA 1L5LA 3VPCA 1HRDA 2DQ4A 1EVJA 1YRYE 2NO6A 3M33A 4H3SA 5A06A 2XA9A 1JDVA 2Q5QA 2QE7D 3WYBA 1PS0A 4PWZA 4X3PA 5JQWA 1LUAA 4MULA 3JSAA 1QH1B 2G8LA 2QW8A 3N07A 1FJHA 1GRVA 2ODTX 4DRYA 3ELYA 4WBXC 3UGJA 1WUYA 1DWQA 5DBHX 4D46A 4EPVA 3M5PA 2VRBA 4OI0A 2JC3A 2IYEA 2H2FA 3I09A 4D6YA 4D5EA 3V34A 4ILEA 1KY5A 2QX9A 3TEFA 4LNUB 1P2SA 1JG6A 1S2IA 1G16A 5FO0A 3VTZA 2Z4SA 1N9GB 4GLOA 5CLHA 4Q1AA 3TECE 5FHRA 4A8PA 3KQOA 2QI9C 3T3IA 2OO5C 1C14A 4TYQA 4PO8A 3UMBA 2QMUA 3ETCA 2C8JA 1QAOA 1YNOA 1JYEA 2VA8A 3BGIA 4ZQCB 2C7VA 3DMNA 1H85A 2HWXA 2ZWAA 4MGHA 5DHAA 3ZXYA 3TIFA 5A7HA 3PJEA 1T6BY 4DIMA 4Y7CA 3BBPA 1RWKA 2GWHA 2WVHA 3DUFA 1VMAA 4PY2A 1CEEA 4LDPA 4LYHA 3GUUA 1I32A 3LQFA 2JA2A 3C3MA 4QJ4A 4HAYA 4E2ZA 5ALRA 2G80A 5EE0A 5I7HA 1TAUA 1L8QA 1IPEA 1J97A 2O5CA 1P39A 1GNLA 5B64A 3KTOA 2E21A 2WSMA 2Z4RA 3CUSA 3G0CA 5GINE 4WN9B 4C7VA 3MD0A 3DV9A 1P1IA 3OZXA 4R1UA 3VO8A 1JKIA 4DMHA 4NECA 3U1BA 3L7KA 3I61A 3ZHCA 4JVLA 2CXXA 3E84A 4QHTA 4ARZA 4C87A 1PJSA 3NHKA 4ZARA 3KYCB 3TPFA 1FDSA 1KU6A 5DM70 1KQNA 1DMRA 4FDAA 1DKPA 3BQNB 1S3FA 1IHOA 4J0GA 4NYIQ 3JAMA 3BL5A 4UFOA 5FBQB 1IQRA 1XCGB 3CEHA 4HTFA 1A9ZA 4L8GA 3U7FB 4NCNA 2VNKA 1S96A 4FDTA 2VHVA 2O07A 4F6RA 1XD2B 3HKDA 2EL7A 1CNMA 3VX4A 2Q3CA 1EVYA 1U1EA 3U4GA 2O1WA 3VVLA 2PV0A 5BYAA 2PUAA 1ODSA 3C70A 2EGUA 1FUEA 3UMYA 2C61A 1PP4A 3FZGA 2GJ9A 3BD7A 3EOZA 1P2TA 3DFZA 1DAOA 3QYAA 2JLBA 3K0CA 1N7GA 4WGGA 4LYGA 4Y2YA 2QZ9A 3U7GA 1C1DA 4RPGA 1YQXA 4M8SA 2CB9A 3NYIA 3ZBUA 3R4VA 3SEFA 3ZGOA 1L5HA 2G9QA 3AESB 3NTOA 4OSEA 3T7CA 4PAQA 4R69A 4QBKA 3LTEA 2WE7A 4O4LB 2QM7A 4YO7A 3E18A 4UCWA 4B6JA 2GLTA 1JG1A 1FMJA 2ZIWB 3EF1A 4RL6A 5FJJA 1S5PA 2QPAA 3FBTA 3MPOA 4Y2SA 3RVDA 1L4NA 1EP9A 3CJQA 2YXBA 3GT3A 1ZD4A 3AOEC 2E5FA 1FJGB 2BH2A 3WKEA 2QD4A 1QZTA 2AN5A 5IW8A 1CUAA 1VIVA 3P4XA 4XLLA 2A9QA 3H3FA 3UK2A 3W04A 1DBVO 2W6NA 3FI9A 3SSNA 1SNYA 3LHKA 3WBBA 1UC4B 3I5XA 1U9JA 3AVQA 1QVRA 4P22A 5GZ3A 2JFNA 4IXDA 3PXCX 5I01A 4ESVA 3QVUA 1YI8A 1L5NA 2JFXA 5IAGA 3BMQA 4Q4CA 2JBWA 1IM8A 4LPSA 1DT5A 3BC1A 4JYAB 2REQA 2FW0A 4KZKA 5JAIA 3F96A 4PHFA 3TO5A 1W75A 3AUKA 1TGVA 4MJ7A 4I5IA 2QTMA 1W93A 2OXEA 1A8UA 2RHTA 3DM5A 3ADOA 3PFCA 5HF9A 2MDTA 4H35A 5KYVA 3DMTC 4FMPA 4F56A 2Q21A 1V1MB 2RHLA 3FCSB 5ARDA 3AWIA 3L6BA 4WEOA 4EBFA 1E9RA 1YA8A 3K2QA 1P62B 2N42A 4NYJQ 1FJXA 2JJ1D 4UC0A 4C06A 4B83A 4EG8A 3VHRA 4U3JA 1KMHB 1LC0A 1E2EA 4EJMA 4NEHB 1MAHA 1DAIA 5CEEA 4D80A 4PVCA 5EQJB 5L3VA 3ZIAD 3NTQA 1X7HA 3AUJB 1JUDA 3MJ4A 3VI4B 2JAXA 1K75A 1V6AA 3FWHA 4F4IA 1L8AA 4N3GA 3G85A 4AWBA 4GKAA 4LHZA 3DV0A 4P93A 2G1UA 3SICE 1PZXA 3GROA 3KEMA 1ETHA 2B99A 2ZYUX 3VNAA 2IY9A 3SCZA 4DLAA 3IJRA 3R3HA 4GI3A 3TNYA 5EHIA 3F6CA 3U3JA 2ZYAA 1RBYA 4MJ3A 3TOSA 1AKMA 1CRQA 1VA4A 3COZA 4TQAA 4FFNA 4K6CA 5ITWA 4YAUA 5BN3B 3HGQA 1Y9ZA 1EUYA 3ZI0A 4A1OA 4P5PA 4I55F 5ICMA 3L8ZA 2HQBA 4UHBA 4XSHA 2F4VB 1O6GA 3JVVA 3BFXA 3MGKA 4K6FA 1G9SA 1A69A 3LMKA 1WQ1R 1PYGA 1R6XA 3M5DA 3QI7A 4OYLA 2R60A 1DP4A 2PNFA 1CY8A 1C9EA 5SZKB 2R7MA 1TZMA 4MUXA 2V4ZA 3ZTWA 1TZ2A 4B74A 4E2YA 5AVVA 1OTYA 4LMBA 2QN7A 1QS0B 2BMEA 4INOA 5ECDA 3AI1A 5JS8A 2IP1A 1TMKA 4M0KA 4GLLA 4JDPA 1GEEA 3NALA 5IJ9B 3A4YA 5C5DA 1NY5A 3EMDA 1P7VA 2HMUA 3P0FA 3PRHA 1X77A 4Q03A 3PRYA 5KC9A 1M33A 4FMCF 4S24A 4C01A 1K9VF 2ZS9A 4RK6A 5FWDA 5HA5A 1ZSYA 3PC4A 1IBKB 4X7PA 5JFOA 3BIWA 5LMCA 3T5PA 1W0KD 2O0KA 3FMVA 2AQHA 1NBAA 2AR7A 2FUEA 2IEYA 4OKSA 1CSEE 2DBVO 2IYLD 3CUYA 1KZGB 3DAGA 4Y2TA 1NP3A 4LGCA 4BN4A 4EUHA 4UREA 4JQCA 1EFKA 2JATA 3CCBA 3C1UA 3MTAA 4ZYXA 2PKRA 5BV7A 2J3LA 4UDOA 2WNSA 2NNLD 3D5TA 4YLGA 1U0FA 4WESB 3SX0A 2ZCJA 4FBMA 1I0IA 2Q6OA 4MLDA 1XMJA 2D5BA 4AYXA 5G0VA 5C8XA 1KFEB 2FDCA 4CN9A 2QZJA 5KKAA 1D3AA 4YAEA 2ZAMA 1MO6A 2B3TA 4ECAA 3LOPA 3EWNA 2ZAOA 3U09A 2P5UA 5KINB 5D84A 2JDID 4DB4A 4QOIA 4D98A 2HJHA 1UBFA 2ZIEA 1PCXA 3GF4A 4IRMA 1I4WA 1KMNA 3KT6A 3E70C 4P3KA 3T9EA 5AM3A 5JO0A 5C81A 4D57A 1NMYA 4IIJA 4UZSA 5H0IA 5EKUA 3V9PA 5AW4A 3WX0A 3ZDXB 4NU0A 3DTVB 3IBTA 3UFXB 3BSSA 3PVCA 3SBDA 5ALQA 1XDDA 5KYUB 1PR2A 5BSMA 4R71A 1N5IA 3FYUB 4LY0A 5HEKA 5AW0A 5LOVF 3TSOA 1E96A 4XCXA 4YAJA 1EINA 2QG6A 3HVJA 1B7GO 3DZBA 1SCBA 2O2HA 2XVZA 4Z49A 3DCYA 2R6GA 4BTEA 1ECCA 2YJNA 4RDCA 2JANA 4IJWA 5B58T 3ML1A 3OCYA 4DWOA 3AF1A 2BM1A 1I9CA 3UWMA 3BAZA 4N6GA 2Q7OE 3WQRA 1ZOSA 4HH0A 1YB4A 2D1FA 3C43A 3PC6A 1SBNE 1XEFA 1W25A 2P6OA 3R6DA 5AK3A 4ZQEA 3P2JA 5K7SA 1H23A 1CQJB 1N1DA 1UL1X 3GELA 2BM8A 2DR3A 4IGKA 4HZIA 4OQZA 3RTDA 1RKBA 1Q57A 2YWDA 4AG3A 3OPVA 4HL6A 1VL0A 3KWFA 4U2KA 3KZOA 2J0QA 1RJ9B 2LCQA 4JJGA 4KFCA 2IE0A 3MUNA 5DI9A 3M6WA 3WAJA 5F7JA 3RRMA 3W3AD 1PX2A 2AOTA 4KODA 2YV1A 4OOEA 4E1BA 6CHYA 2R00A 1RXSA 4RMGA 3M4JA 2EKLA 3MCVA 1N57A 1HZJA 2I3DA 2VBIA 5EEGA 2BM9A 1H1LB 2Q3BA 1FQJA 1JQLB 1TA4A 2P0EA 1ZIPA 3DBRB 2XIQA 4JLPA 5K4AA 1LWOA 1BDMA 1R8YA 2XJ4A 2XLBA 2PFGA 2LWIA 5BXQC 2XGGA 3WRXC 1S3IA 1L4UA 1ZGHA 2H3HA 3WHKA 2Z09A 4WDQA 3NAMA 4DQ0A 3ZJUA 3O9VA 5PGMA 2GARA 3ICQB 5GQSA 2Q07A 3OE1A 5K3BA 2MCFA 2A94A 1NXTA 4HRYA 4IDOA 5BOSA 3GIDA 4AULA 4DCGA 2QROA 2PZLA 2E89A 2JJ2D 3GLQA 2ZR8A 5DN6D 2FJUA 3G9UA 2ZRBA 3IHLA 3G0OA 4RCYA 3CEPB 4Y2HA 3VZQA 2P62A 5EIOA 4U1RA 5IH7A 4MYRA 2JF0A 3OTGA 3HJNA 4LE0A 4MRMB 4UTRA 1O0BA 2B3DA 4CU2A 5JCJD 3LX6A 5ULLA 3NHLA 1QTRA 2HMVA 4H3HB 2VSNA 2ORYA 1NONA 3TNJA 5JRDS 4HDKA 1WMSA 4RXUA 3WLIA 2RMKA 3U5TA 4ZCQA 3TRKA 5NLLA 4RADA 4MVJH 4CMGA 1N9ZA 1TI7A 1ZOIA 3GAAA 2Y1CA 4GSKA 1D4AA 2PGDA 2XODA 1JBKA 4Q9KA 4L8WB 1J0CA 1YR3A 5AI0A 6REQA 1KGSA 1SIWA 2JI4A 4KQWA 2OV3A 5F7XA 1X1TA 3MTDA 3WYCA 3FJOA 4MR9A 4D3SA 4IWXA 5JDCC 1RPJA 4DV7B 1GOTA 2QUZA 2VSXA 5TPWA 3QFSA 4UM9D 3MGBA 3A05A 5CB0A 3MWFA 2NIPA 3VTAA 3SKXA 5EKSA 5B1IA 5EE3A 3DHWC 2IU3A 3KZKA 3GEIA 2MSCB 3CVOA 3M4ZA 2C4TA 1JFLA 2G7MC 1US8B 2QQ0A 2R1ZA 1N4AA 1G8HA 5AW1A 3QUQA 4A8JB 3TJZA 2LVBA 3M6VA 4XIGS 2OYSA 3EYAA 2EYUA 3D59A 1BW9A 4Z6KA 2QBYA 4JYBA 3ZGZA 3O8BA 4H16A 5KX5F 1LF5A 2H9IA 1YRLA 4LQDA 4TSFD 2A4MA 2V7BA 3IBGA 3I23A 4I1OA 4WZBB 2DTEA 3FRJA 4RW0A 4WCVA 3TTUA 3UOGA 2XMRA 1A7JA 4M87A 5GIOE 1U4OA 4CCSA 1P75A 2HEIA 1QF6A 1NA5A 2P9JA 4D8TA 1OXTA 2X9QA 3A9VA 3HFJA 1Z29A 3CNQS 3HUEA 3V42A 3OY2A 2CD9A 1G8SA 2GA8A 2HUNA 1W48A 1LC3A 3H8SA 3TQQA 4HCJA 4HFJA 1WBJB 4JR2A 4UEJA 1L1QA 3OPMA 3ZZTA 4ZZ3A 1HR0B 2QZZA 4PG6A 3TVTA 5K2MA 1N3LA 4OA8A 3EB9A 4JI6B 3AVYA 1L7AA 2XQFA 3E1KA 2GTHA 4GQBA 3BCSA 1Q83A 2XZTA 4JITA 4Z9FA 5T6BA 1QQ7A 4QEDA 3TSWA 3WNVA 4CKYA 1U31A 2PL9A 2H18A 2VC2B 4OX9B 3A9TA 3LCRA 4CT4B 3AU8A 1A0OA 2KJQA 3G23A 5CA1F 3NYWA 4DBLC 3QPAA 2BUAA 2H1FA 2BBOA 1IONA 2ZP1A 4MUHA 4TV9A 1BYUA 2NSHA 3CVWA 1XA0A 1QRDA 3TLBA 3DTTA 1M5TA 4C0XA 3IUEA 2XHZA 4XTRA 1XNRB 3AR7A 5FNVA 3MB5A 3EQ2A 1T0PA 1UJMA 1JPVA 3OEED 2OC9A 3AG5A 3RU9A 1HNXB 1UAYA 3GVHA 3Q7IA 4ZC1A 5AI6A 1Z0IA 4FTWA 3D2LA 3WG9A 2HHHB 2WM9B 4W7HA 1QZXA 3GLGB 4KYIB 1T2CA 3L5OA 1LB1B 3KKLA 4RD0A 4C0JA 1HRKA 1YKGA 2Q99A 3MOGA 5E8RA 2DETA 2CKDA 1N1GA 1RXEA 4ZCPA 5KQLA 1JJFA 2CXRA 3LDHA 4Y2GA 1AHNA 1AS0A 1PFWA 5EWJA 1IN7A 4BNDB 3MWGA 3IVXA 3GNTA 1IVSA 1P9LA 4QWWA 1Y8CA 2N3ZA 2QD1A 4X41A 1TC1A 3S2GA 3ZWVA 3N05A 3JVIA 1O9GA 1T35A 1M1XB 1X7DA 2BMJA 2OG2A 4BMSA 3PBKA 5DI3A 3DAOA 1JDUA 1YONA 3GUVA 3LP5A 1FBTA 2BKEA 2QUJA 5T64A 3S70A 1E8MA 4GLJA 4TVOA 1XMQB 1ACMA 3DTNA 2HTFA 3FA2A 1L9XA 2CNDA 2ZQ5A 3QOYA 3L8GA 2GK4A 3K0SA 2O2YA 2DYKA 2R1UA 1QX4A 4TOIA 4Q7EA 1U4SA 3DAPA 2WYHA 3RSLA 2AEEA 3F1KA 3NMUF 2ZJAA 3JAKB 2P68A 3LLVA 1G8FA 1U3VA 2Q0HA 2NAFA 2PGAA 2RI6A 2VL7A 2WT8A 4FQ7A 5FOXA 4Y6GB 2D8AA 3GNQA 3MM4A 1QO0D 2A33A 1OX4B 1KI2A 2BFEA 3RRXA 4EYGA 3L6DA 3OOWA 4K1XA 4M1MA 3NCTA 2HK8A 2GNAA 4GLBA 5EZ6B 1E3SA 2V5VA 2P77A 4X1IA 4X54A 1UDAA 3H5IA 4Y0AA 3A4IA 5AR1A 1GUZA 1IXSB 2WF9A 1W47A 3FPHA 4ZVQA 5TQVA 2CUTA 4HT3B 2EBHX 3DNMA 1KKMA 2CDCA 3KQLA 3E81A 1YMQA 1J0BA 4KP7A 4TXLA 3KL2A 1XZIA 1MOQA 5J1TB 4EY3A 4AJHA 1RMTA 2FRDA 1E2DA 3PNPA 1H1DA 4B2LA 1C8KA 2AW3A 2V4MA 3B51X 5T8KC 2MYTA 2QKYA 3R9WA 4QTXA 2XDQB 3R7AA 5AVXA 3GLFA 4N65A 1T2DA 3AR5A 4O0LA 2NT3A 1T9AA 2BEWA 5CPFA 1YRQA 1Z74A 4YRNA 2G1JA 1MABB 1HA3A 1O95A 3LBFA 3GHYA 4ZO6A 2ZJOA 4HAZA 1KO1A 3W77A 1U3WA 1WETA 4RVFA 3RTGA 1QPBA 1ULUA 2FLWA 3I5UA 4DQKA 4YXWD 1XJ5A 2NUPA 4YS6A 1W85A 3AEUB 3GFQA 4B80A 2JIRA 3PUJA 3QELB 4JK3A 1G9TA 2B9EA 1KVSA 4YCAA 4EQZA 1PKXA 2VRCD 1J07A 1Q7BA 3DLTA 1EK0A 1ZM3A 4EPRA 5KNDA 1J9ZA 5EJ5A 3LUHA 4U7PB 4O2BB 1N25A 5KJ1A 2O7QA 4O4JF 3JU3A 3PT9A 1U7DA 1TFUA 4J1NA 1TRHA 2BSAA 2XBUA 2FMIA 4RZQA 2XNDD 3WMEA 3MINA 1ESMA 1G21A 2WEKA 1AKRA 3UCEA 1Z2OX 3DO6A 4DCMA 2VQEB 1I1OA 1Z68A 2W8ZA 1A8HA 1BZYA 4KQ2A 3VH1A 1M2VB 1UMBB 4KE8A 4WUTA 3LGXA 3BDAA 2LXNA 3R0ZA 2BPOA 1Z62A 2XADA 4W99A 1THTA 1ZRNA 5J5CA 3V7YA 1KVQA 4CLHA 4BJ5A 2PUCA 3IPRA 2QTWB 2DY0A 2NO0A 4V39A 3T06B 1TM2A 4DG8A 2CXTA 2NO9A 3EIHA 3TSAA 5EIXA 5IT0A 1MD9A 3K0KA 3B1ZA 1ZUNA 4MPRA 3T6KA 4ZCRA 1LLUA 4ZOEA 3HYLA 3Q6IA 1YU6A 5L4NA 5LQKA 4PONA 1VJ0A 4CKZA 5C46F 2C7RA 4BB6A 5COQA 2HA0A 3W5HA 3GEDA 1TW3A 3EC2A 1RZUA 3UAVA 1AUPA 1OI2A 3IJ5A 5L4LA 1WOMA 3CNHA 3RFTA 3TX2A 4TXNA 1WG8A 3PDIB 4ZDWA 1H93A 2GTIA 4FZJA 5B7NA 2XOKA 4F5WA 1OFIA 2QB5A 4C0WA 2GPNA 1RQXA 3O1IC 2A0UA 5CVUA 3TQSA 3U3KA 2AMVA 1BKSB 1CJMA 3VGPA 2F00A 1R4MB 2BOVA 1K3FA 3H99A 1EJ0A 2RB5A 4EKGA 2I34A 1JBQA 5E3HA 4BNUA 2Q62A 3HYSA 1BYIA 5JVDF 8MHTA 2DQSA 3L05A 1DBSA 3Q8MA 1X70A 2MT9A 2BHSA 5ALNA 3VH2A 1FCJA 4RH0A 1YB2A 4UU7A 1C4WA 1Y7TA 3R0JA 4ZOBA 1V2HE 2UZIR 4D26A 1C2TA 5FLKA 3I39X 2Q5LA 3FLAA 1JSRA 3GD7A 3RYFA 4B3BA 3GHHA 1ARZA 1LS1A 5JJBA 1IRIA 4Z0PA 1BDBA 2DOKA 4PPFA 3T7IA 5ERXA 1FFDA 1N6LA 4H7PA 1I30A 4HG2A 2C2BA 2LZ0A 3QKRA 2B1JA 1QHEA 2XHEA 3BREA 1H6BA 3C3YA 3HQ4O 5F7ZA 1M7HA 4BLUA 5CK4A 1Z5UA 1DKOA 2NSYA 3UK6A 2YYZA 3GP3A 1UKZA 4QGBA 4B4UA 3KQVA 4Q3AA 2D7DA 1QTIA 4MP3A 3KT3A 4TS4A 2CZQA 4QRIA 2AF4C 1FW8A 5B58C 1SA0A 1G8JA 2H65A 2X7XA 2YN4A 4L3VA 4UASA 3VR5H 5LYJF 3VZSA 2Z6AA 3H9EO 2D3TA 4XSGA 1ZOLA 4ZVKA 4K40A 5C5CA 1NC3A 2HBYA 2H16A 4MW1A 1QGDA 3W5CA 2HV8A 4DR4B 4DDKA 3HSSA 1CS0A 3W5BA 3LDGA 3D6JA 1RBQA 4OBEA 1KO7A 5LQJA 3W8EA 3HZOA 2K7FA 1LW7A 4UAVA 3DKIA 1CUDA 1H2RS 4ZTBA 4UUAA 1GNRA 3VNUA 3F1LA 3L0IB 1P61B 1U94A 3QE3A 1E2UA 2H1IA 1D6SA 1SVUA 3HEAA 3IUQA 3RK1A 3W9SA 4B6QA 3UMSA 2QRGA 3LZ6A 4B8ZA 1ZJJA 3IJPA 2AGVA 2VH2A 3ENNA 2ZXUA 3AFHA 5LA6F 4DMUB 3LX5A 2SKDA 2ZQYA 5DWVA 1XCJA 3PTLA 2P7HA 1GL9B 1Q21A 4B8WA 1VYUA 4XASA 2O1XA 3AFOA 3MLAA 3RFXA 5DX8A 3T1NA 2H4YA 1AU9A 3E2MA 1IPHA 1ZISA 1WXEA 3WWEA 1LJLA 4D9IA 4IX9A 3G1WA 3RBXA 1Z6AA 3F7TA 5CB4F 1UJNA 1AVTA 3PPVA 4ASUD 2HA2A 2AG1A 4MIEA 2IYWA 4CR6A 2XYQA 1JXAA 2PEZA 1BWSA 3NH6A 3KPWA 4N54A 3VR4H 2OQIA 4BAGA 5B7PA 4NBRA 3HO1A 1Z17A 3EVDA 3IUYA 4QLBA 5TS2A 4OHFA 1CQZA 1NVGA 2Q29A 4FS8A 3KJFA 3FOFC 2HK6A 3GEBA 121PA 4M0PA 5IDYA 3RF6A 4GIBA 1VC2A 1YRBA 4M2LA 4UHFA 1MB0A 3C39A 3QFHA 1TO1E 5F52A 3ZUPA 4RYDA 3OKFA 7ABPA 1KXJA 1DDOA 3CZQA 2ZRGA 4IIUA 5I4IA 3V1TC 1VIYA 2ZVDA 2E4VA 1MORA 4OMCA 3EPPA 2ZJ6A 5DNAA 2VQDA 1JSCA 3CA8A 5IVDA 4AP9A 2Y77A 1GG5A 1DIBA 3I5AA 2UUPA 3K6RA 3W4IA 1ZAKA 2POCA 4JJ7A 1EXMA 4N5NA 5FD8A 3AJRA 2J59A 4ZVMA 3TUIC 3WICA 3TE7A 2BDTA 3BCRA 2IBTA 1VMIA 3OBIA 5EUBA 4WK0B 1KKLA 3FRHA 4IH1A 2ROQA 3A14A 4EYKA 1DRKA 1FVXA 1RM3A 5ETJA 2AXQA 2XEDA 2A88A 4RKWA 1YFJA 1DAPA 3ZK7A 1H2EA 4WA7A 3K1TA 1SHZA 1TK3A 1UK6A 3H1AA 1DJNA 2AJBA 4PC7A 4ENWA 2W2VA 3C98A 7ADHA 4C03A 2W7TA 3KOOA 4H9GA 3ELUA 3RC1A 2VIIA 3NGLA 4Z53A 1KY4A 4HMQA 1NQXA 1EFDN 4Q4HA 2RI0A 1H94A 2DULA 3KZMA 1EKXA 3K30A 2GUWA 2Y2UA 3G5AA 2IVZA 3N0XA 3NHMA 1EQAA 1EFLA 2YASA 4QDJA 3L92A 1U3TA 1XDUA 2CXSA 3EPRA 1MQSA 4K9PA 5HTOA 3DEAA 3HCEA 4AM8A 2RHGB 2YV2A 5IZCC 4YAFA 2ZIXB 2CJWB 4M37A 3WQHA 4F72A 5DRYA 3PWSA 4K6OA 1P33A 5ER6A 4HXYA 5EZQA 5BO5A 4N41A 5KOHB 3DVAB 2UV8A 1UBJS 4HX2A 1TUGA 4HLCA 3EGDA 2QVYX 4R2IA 4KBGA 2E3JA 2J0VA 2RDMA 4PG8A 2PNJA 2R8BA 2ODNA 2BWJA 1OBCA 4L4SA 2Q2OA 2RHRA 2RJNA 4EMBA 2O48X 4F11A 1AQJA 1SVIA 1PHRA 1P81A 5CXUA 1EWKA 2BLLA 2NYUA 4V02A 4XUCA 1KARA 1R16A 2Q45A 4LE2A 3NC0C 4A1FA 4B17A 1NYRA 1P1CA 1T1JA 4N5MA 1FVFA 5B55A 3B3JA 4EGFA 3LBHA 1N7IA 1OIXA 5ISMA 1D0VA 1BXGB 1DAGA 3FUWA 3JCZA 1T36B 2OCIA 2PVSA 4H1HA 4JUFA 1SKBA 1VHJA 2XYGA 2CYCA 4QRHA 3PG5A 2AJLI 3HY4A 2NZWA 3PNLA 5LMUB 1U3GA 4KR2A 2V8OA 5CXXA 3DZJA 4KQ1A 3WWPA 3B1KA 1GNPA 1HE5A 3BJRA 3RVJA 4OLJA 1Z7YA 4R1SA 2FMKA 5JFTA 1MNQA 3MB8A 2BEJA 1T8WA 1AMUA 3EUWA 2H8KA 3I53A 1VPEA 4G85A 1OTXA 3WRYC 4X95A 1PRYA 3A6HA 4J1SA 1SBHA 4RVUA 2IUSA 1KBOA 3DE6X 1PFYA 2PUGA 5AYVA 2EW8A 3ZD9A 3WWDA 4UU0A 4P80A 3BMNA 4B6EA 3DBLB 1I2ZA 2PZFA 4RHEA 2ZUBA 5JQGA 5K8CA 3KLNA 4EL5A 3H84A 2ZWOA 1YB5A 2ZBRA 1VPVA 3BYZA 1P44A 4UUQA 5DISB 3U13A 4PN7A 3G2IA 1Z5GA 2PL1A 4GGOA 2Q5HA 4AF6A 3E9YA 2UYCA 3IUNA 1VFNA 2V74B 1WS6A 3CGWA 3I83A 5DTQA 2IT1A 2V6JA 4HQ0A 3HXQA 2ATIA 4RHFA 1E9EA 1A9OA 1SRQA 1E8DA 1HEIA 1NVVR 2Z4TA 4P9NA 5JLAA 3U19A 4OEHA 4E5DA 4ETMA 4QTYA 2EEZA 3R23A 3TQHA 1CY6A 1XRNA 3ZK9A 3PTZA 1PR3A 1UBCA 2TMKA 2WIGA 1ND5A 1XX6A 3NV7A 1M83A 1YR9A 5L45A 1JDPA 1VG1A 1P0MA 3EPJA 1XTBA 3TFQA 1B2LA 2G0TA 1GRCA 5GOTA 4E5VA 3AM1A 5LDDC 1IG3A 1XMPA 4P0TA 1GTVA 2WF8A 3EMVA 5C37A 1WXXA 3DD5A 4PR3A 5SY4A 4IDPA 3TXXA 4RV9A 4F86A 1QTNA 3VR6H 3OF3A 2HIHA 4I4TF 4DSAA 5IBCA 2HT1A 4CLEA 2W2OA 4YJFB 1S2GA 3BD9A 1B76A 4J2TA 1C0IA 3FI0A 1DO8A 1AIPA 4YP0A 2HKIA 1Y3IA 5ALOA 1OLSB 4KYVA 3AH8A 4J7CA 2G06A 4EYQA 1CNEA 4PQFA 1O3YA 3ZY3A 4YMHA 4MROA 2RHWA 5ECWA 1UT6A 4XJXA 3ZE1B 5HIAA 5LP6A 1DUVG 5AVRA 1SUPA 4MA4A 1USWA 1N2CA 2J31A 5AH0A 4WDRA 2DLNA 3DZGA 2Q5EA 2RCYA 1E4EA 4FDVA 3UANA 3BH7A 4M9ZA 2JLSA 3JQGA 3ZQUA 4KUHA 4U8GA 1FTWA 1THGA 2A78A 4Q18A 4YEDA 1MV8A 1QYIA 2VXCA 4HWKA 4E30A 4DR5B 4IW3B 4IF4A 4YMVA 2YRXA 4E15A 5T5QA 2DY1A 3OZFA 4NV1A 2RH5A 4U2CA 1GLNA 3PCXA 4TMVA 1DJOA 1P2UA 3NNSA 3WMFA 1KOLA 5A04A 4GX5A 3N2GB 3JD3A 3OMWA 3DOEA 3P27A 1XZGA 5BURA 3GLFE 1UXOA 3H16A 2WJ4A 3NX4A 4J75A 4YP5A 4ZOQI 4JJIA 4WY8A 2HJ9A 5DT9A 1EB8A 3IP7A 3K0AA 1VOTA 3V1NA 3H2YA 1RRPA 3SF0A 1EVZA 4BLVA 3QBEA 4LYFA 2H85A 4IWYA 4YJ3B 1VBKA 3PNKA 1BG6A 4ACBA 3IS3A 1X2EA 4I6GA 2WYOA 4BFXA 4EGSA 3KE9A 3DFMA 4U8HA 4O5OA 2VJQA 3MYRA 2J6CA 1AQLA 2F4NA 2PD3A 4D5GA 1QP4A 4HSGA 3VKVA 1QP8A 4ZVLA 1PHPA 4MGZR 2BJHA 1TQ8A 3WK6A 4NARA 3S2YA 2ISCA 4RQTA 5BR4A 3FFBA 4BTVA 1QH9A 2WZQA 3B1FA 1IUPA 4YYEA 1G21E 4CR7A 1DQZA 3QVGA 3ZV6A 1EVLA 2J3JA 2OZVA 4TLEA 3JQCA 4ZV4A 2ALJA 1RIIA 2C3YA 1LH0A 4KXWA 5CT6A 3S2ZA 9ATCA 5KTMA 3KAKA 3F74A 2CNWA 4RHYA 4ZYYA 2J9FA 1MO5A 3DW1X 1DOAA 4M9XA 3NNNA 3P9NA 5A6SA 1OF1A 1VKZA 1RTTA 3CSUA 1ZITA 2AF3C 4YRJA 4KL8S 2XWJI 1SOWA 3V4LA 5A3JA 5IM4A 2XMZA 1IXRC 1Q91A 5C18A 3WSTA 3EA4A 3NEPX 1N5DA 4J91A 4E3ZA 3RC2A 3G1UA 3HEMA 1RMYA 3OUZA 1RYZA 2MJLA 4BVLA 2R8EA 3DC2A 3LH5A 1YWGO 4X85A 2DLDA 1GU1A 4ZT4A 1A4UA 5FBHA 1IJKA 3H2JA 4LDAA 1KYIA 2D4AA 4IYRA 5J2TA 2PUHA 2IHVA 2HH9A 2WWFA 3R9KA 3ZLUA 4A27A 4DLPA 5THQA 1F2UB 1UBNA 2GH1A 4DVJA 1NOJA 1ZCAA 3EVBA 2Q49A 1KP2A 2X23A 3CN7A 3R3VA 5AOCA 4AY4A 3PX7A 1TM5E 4X1YA 2C9YA 3I12A 4G5FA 3BMXA 1SJ9A 3UV3A 3LT0A 1B2RA 3ZU6A 1L6IA 3UGQA 4HQ6A 3VUFA 5K03A 1RCTE 2JLRA 5E6RA 4DLXA 4TUYF 4CI9A 4JELA 3B9QA 1E4YA 1K89A 3S1LA 1OYVA 2ONYA 5KSZA 1PL0A 3HCPA 4PRKA 3AINA 1J4AA 1TEHA 1IN1A 1Y9DA 1IN6A 2HMWA 1Z0DA 3N9IA 1E92A 4B87A 2JFGA 2EKQA 4XX1A 4D8YA 5K8JB 2L69A 1E3MA 3QI2A 4N3AA 1G20B 2P9ZA 3O31A 4GBED 4FKMA 1INLA 2WINI 4BC0A 4KGVA 1Y63A 1TTQB 1N8TA 2WUDA 3SVTA 2AHOA 1TQ2A 2H9YA 1OH7A 1U90A 1BH2A 3DAFA 5DZSA 5CVDA 1N9KA 1O6CA 3AJDA 2F1HA 3ZWWA 1NJ8A 1DC3A 3KNZA 2RGNC 4JUDX 4YHHB 2OCGA 3FNGA 4E4TA 2FN4A 1K7FB 2VEOA 3KXIA 4CV0A 1QB7A 3S1AA 2AOVA 2HLNA 3IEKA 4F06A 2BFPA 2ZS8A 4G1VA 3D3WA 1X8JA 3W78A 4BP9A 1UQRA 2MINA 3HVKA 1ZM2A 5EPUA 4PXSA 1YS9A 2JAOA 2WHPA 4JR0A 1G4AE 4WCFA 2Y76A 3SZLA 3UY4A 4AX8A 4CTJA 5G3ZA 3UAZA 4ZZIA 4RTNA 1SBIA 1GNTA 3CUEF 4MIYA 4HAOA 3D31A 3GGPA 1NY6A 1YD7A 3WGTA 5EIBC 4UTVA 3K2IA 1OGIA 4P8RA 2C20A 2WIDA 3BGOS 1I4TD 3QFCA 1F8XA 1JTFA 3WS7A 3Q1KA 1KPIA 1C30B 1PN3A 1P2VA 2RKOA 1J5XA 3R1IA 4N0DA 2XRYA 1J70A 4R2JA 8GPBA 5FO1A 3OLQA 4PV7A 4FBLA 3WGZA 1I80A 2FE1A 2GCEA 5HKAA 2WSYB 1E7QA 5TR9A 2JJQA 3EDQA 4WUVA 4J0DA 2YUTA 2Z08A 3WLQA 2CLFB 4EG5A 2O4CA 5DW3A 5H59A 1VIDA 5FA8A 2HQSA 1C7JA 4MUEA 4QGFA 2JRCA 1GQYA 1Z4LA 4IIFA 4ID9A 1SCUA 4MUGA 4UHDA 2OP1A 1UP7A 5C2JB 1E20A 2J7KA 4NBTA 4XR4A 2P3OA 5KYXB 1E2PA 2AJ8A 3PK0A 1JIXA 2FSVC 2O5RA 4PAMA 3GP5A 3H5TA 3LOQA 1F12A 1LPSA 2CF6A 5KB3A 4H18A 1ZP6A 4CLXA 2BGKA 1H4TA 3BE6A 3TNLA 3HUDA 3R7FA 3RSHA 2P5YA 3T9CA 1MIOA 3MMZA 3SI7A 1KWKA 2W2TA 4C5AA 3WGQA 3HJHA 3FAZA 1U0HC 3BRWD 4JUBA 1VB3A 1HWYA 3QJ5A 4NDZA 3EXFB 4Q4AA 3NIBA 2GILA 5M7EA 1K6EA 1LPAB 2DFKB 2IOFK 4K3VA 4RSHA 5IT5A 2WSIA 3UO8B 3D8HA 4LRWA 1EP1B 1M1NB 1GFSA 1R6VA 3ASUA 1JKXA 1GAJA 1U0NA 1KZ1A 4GWGA 2G82A 4HFRA 3S8EA 3LCUA 5TMEA 1B3RA 3A04A 3KUDA 4NE2A 2NO5A 4CV2A 1V5WA 3M5WA 3P7MA 2QYHA 1MZPA 2FEOA 4UM8B 3V8NA 1GN9A 2R2AA 3M82A 4R7GA 3BGDA 3E0QA 3SFZA 1CUSA 4TL9A 4G1CA 3ZDDA 4REMA 1YR7A 2G6TA 1ZJYA 2GHQA 3LBYA 3MWDA 2ZBVA 4LC1A 4R9VA 5ALGA 1LF0A 4BVJA 2AJCA 1RWNA 3T61A 2ZRDA 2GFQA 2IUEA 5J5VA 5EIBD 3TSYA 3EGEA 3GJ6A 4FHGA 2GX6A 3R6TA 4RD2A 3GMDA 1X1RA 3VU9B 1NQVA 1TK2A 5DYYA 1FU7A 4RGBA 4A82A 4PGAA 1Y33E 3EVFA 4FSDA 4ZYLA 2HU7A 2QW1A 2M6KA 3Q8XB 5MFPA 3FNHA 3ILVA 5I3CA 2PT9A 1PNTA 2IZ1A 2ZVQX 5U9CA 1PDVA 1UEIA 5GMOA 2WB4A 4BASA 2V5UA 4DA8A 2O8EA 3JZFA 1C3XA 4X7RA 2CEAA 4J16A 5A02A 1E7YA 4KO8A 2CMKA 4JMLA 4ZU3A 5JATA 1ZJ5A 1DQSA 2VATA 4WNYA 1OVMA 1VPDA 3DZFA 1RPNA 3E9MA 2JLCA 2BKAA 2WJAA 3IE0A 3THSA 3T4UA 1L7DA 1UPBA 3L7IA 3ND9A 4I9GA 4RULA 1XJQA 2HFJA 4C5CA 2NU8B 5D5HA 1LDGA 3D6HA 1EFTA 3QY0A 3B6KA 2WU8A 3HGTA 5H83A 3T7SA 5ELXA 3GGJA 4NS1A 2A1IA 3KK0A 1Q84A 3AQ4A 4IZOA 1WHSA 2NAPA 3BGWA 2Q4DA 3N7TA 4G8JA 3FR7A 5FBKA 1L5GB 3BMOA 1T5TA 1C81A 2ID9A 4XVHA 1IE3A 4WECA 5DB4A 2V65A 2WDPA 4OU5A 5IDVA 3UEOA 3KOMA 4E33A 4EO4A 3HACA 3SGLA 1CJUC 3MCAA 5TX7A 2D2XA 5TS3A 1TD1A 4WIAA 1A9YA 5IN4A 1CRWG 1CUIA 2JS7A 3AV3A 4NPCA 4BCBA 4GT1A 1NW4A 1EWQA 3DHNA 1O1YA 1F8UA 1A5SB 2IYYA 1YO6A 3RYHB 1BA2A 1NRWA 4JLJA 4TMZA 2OBBA 3I04M 2Y0BA 3EVNA 3LBAA 4U00A 4ZO7A 4DUPA 3FDXA 4U63A 3EFHA 3RS0A 1HG1A 1P2BA 1QH0A 1GV0A 2Z2IA 1UZAA 3EVZA 1XRRA 2D3WA 3GAZA 9LDBA 2FW1A 3V80A 3VPFA 4G1UC 2M1ZA 1R0YA 2IY8A 5CTAA 1PNVA 1TMYA 3NJRA 1P1FA 3C3WA 4I1PA 1RHRA 4WZZA 2B7LA 3PZBA 1YHZA 2BFCB 1QO7A 1SG0A 1U7TA 3MS7A 3SYTA 4DMRA 2H52A 1JBEA 2XCOA 4K9MA 1PJTA 3AUAA 4KNVA 4NOLA 2OAQ1 5ED0A 1XRSB 4N82A 1FSSA 1I3LA 4R8MA 3UWOA 1KMCA 4AS2A 4EECA 2AE2A 4BFUA 2PKQP 2NADA 1L5YA 3KTAB 4RV4A 1H2BA 3SYLA 1K86A 4CLRB 3BXXA 3IQIX 4NFYA 1SBQA 3RYHA 2XMPA 2GDJA 4FU0A 1UPAA 1I7NA 4QVGA 4ER7A 4JXJA 4YACA 2XRFA 3A6ZA 1R4NB 4R8LA 1IXKA 5CNJA 1B8NA 1U1DA 4BYGA 4U2FA 2OHOA 2QP4A 1YCHA 5KAPA 3GLUA 1F0NA 1N5MA 1FE8A 1NZFA 3FZQA 4M76B 3RT7A 4CKEA 1SEVA 4RHCA 3QKTA 2PL3A 3TINA 5BQ3A 3IMCA 3U4HA 4HRVA 3L1UA 4HR7A 3UCXA 4AVYA 4ZZ0A 1Z0ZA 5B4UA 2KYRA 2GZ1A 2GPYA 2O8BB 4WJKB 1DFHA 1QHYA 4HZUA 1JG3A 4PYLA 5G4KA 1LLFA 2HDNB 2XQVA 2XYRA 3D4BA 4NYMQ 1GT6A 1Q7TA 5E3JA 3X1ZA 1NZJA 2ZIGA 4EYOA 2QE7A 3PR3A 4F6CA 4PNEA 3EGIA 4JC5A 5JJLA 4OVKA 4TMYA 4KYTA 1KRWA 4CFYA 1T0IA 2X42A 2KQUA 3ZV7A 3QP9A 1G3QA 6YASA 3SDBA 5DM60 1BCRB 4CRWB 5C5EA 5IT9A 1UWVA 4BFWA 5K0BA 5KQPA 3SQOA 3KR2A 4DIEA 4PPQA 2D2FA 1LV7A 3BEDA 3HK2A 3DV2A 1EZ1A 1M2NA 1XFAA 1ULZA 3C6BA 1UWCA 3IEXA 1DQRA 1ORHA 3S5JA 1LVUA 5J43A 1W1IA 5K3CA 1HM5A 1FFXA 4Q7KA 1G8PA 2HRRA 4U6NA 2WJPA 2FPXA 4RLSA 5T4EA 1KDTA 2GASA 4MS1A 1GPAA 1LQTA 3L9WA 3KKOA 3PQDA 2WAAA 4KR6A 1MVLA 1GQRA 4X65B 4S35A 3DLHA 3LZCA 3RAJA 3LCVB 3E9DA 5HX7A 4GL2A 1TXGA 4TV8A 1EG7A 4C9BA 4L7VA 2VRNA 4Q9NA 3K6KA 3N8NA 3P2KA 1O5TA 4RESA 2X0RA 1AQ6A 2R44A 2WF7A 1MO4A 1D9ZA 3PU6A 4EZBA 3GJ0A 2IV7A 4C2TA 4O6VA 3WBKA 5BNZA 1ZR2A 2H4XA 4XQEA 4W1QA 1CULC 3DT9A 5EIAA 4R1PA 5IDXA 2FN8A 1N2CE 2IQIA 1A8PA 2YC4C 1UBOS 4BMPB 4YAIA 1YAHA 2GS9A 3OBBA 3QUSA 1YZLA 3V7UA 4AD8A 2ZYSA 3L7OA 5KMGA 1BDIA 1Y8RA 3V2IA 4IXWA 3FPEA 3GJTA 1Y3FE 4UTZA 1X7WA 2HADA 3ZIUA 2FZ4A 1L7PA 1ULBA 4B4WA 4YDQA 5AKYA 4AYWA 1TQHA 3OTIA 4MVXA 3GJ8A 2P65A 3H1BA 1W5BA 4FS3A 1X0VA 2IYAA 2HIMA 3B7PA 3K1ZA 4H59A 4F84A 1I5EA 4MR7A 4D4LA 2JI9A 2GMWA 2GPTA 2AB0A 3B5JA 2BMVA 4FEAA 4CGZA 4NG4A 3ZVKA 8ADHA 1DT3A 3QVJA 1HH4A 1FMTA 1ZWKA 4IIVA 1W88A 3VM6A 3T35A 2RIPA 4LMAA 4WFQA 1QF7A 2C9OA 3H5AA 2XKAA 3WB0A 4CMJA 4C7MA 1F06A 4EM6A 3KEQA 2CXHA 1Y7LA 1W2WB 2VUIB 3RIGA 4ROTA 1ESNA 3U4CA 3WL3A 4CEIA 1Q22A 1QXSA 2QIOA 5MF6A 1PL7A 2JIZD 5FYQA 1T0BA 5LJIA 1U7ZA 1RQRA 4DV5B 5B4TA 2A8YA 1QG6A 2DVMA 2HPZA 4AKGA 2RGAA 1U8XX 2OO5A 3I8OA 2C88A 4X1KB 3JQ8A 3PWZA 1PX0A 2BV3A 2G71A 3S2UA 1XVIA 1GKIA 4TKUA 2W8BB 4BAZA 4HV4A 1T2FA 3O8RA 4AJ1A 3RAFC 2W2LA 3IE1A 3N2LA 3EDRA 1UFKA 4L75A 2BCGY 4CKWA 5BUSA 3NC1C 2PSFA 3OU6A 4F6LA 4KQHA 1H2AS 1YDFA 4P3YA 4U5QA 4YRDA 4YMUA 1DO0A 3ZWXA 3IAAA 1CQWA 4HGQA 2A7XA 1XG5A 1ATIA 2IS1A 4NDAA 1JT2A 3F73A 1CE8A 2O9JA 4TMWA 1NDHA 3I2IA 4AWXA 2VS1A 3U5ZB 1NLZA 1E9AA 2H7XA 3B36A 4ZPJA 5DLEA 2JGEA 3O4RA 5GAJA 1EAMA 3AZQA 3I2GA 1ZI6A 3DDNA 4B0PA 2DH5A 1TJ3A 4LGMA 3TRFA 3P8ZA 2Z2JA 4M1WA 2G5CA 3I2FA 5JANA 3AO0B 1HFKA 2H1LA 3ZX5A 3MQFA 1BC5A 2Z3VA 5TVGA 4F9EA 1F7UA 1XUOA 2FZCA 3HN2A 3L06A 4MQLA 5A1JA 3U6BA 1CEYA 3T52A 5FX2A 3X1MA 5K4GA 2HU8A 4JBLA 1UQTA 3F4BA 3PDWA 1R6DA 5GONA 5JTTA 3BWBA 1EVIA 3ECCA 1NJ6A 1XZCA 3G9XA 3LLSA 4UUNA 3U7RA 3BRSA 3UMCA 1W5FA 4AJKA 5CD1A 1QHFA 4R4JA 4UHEA 3MLEA 1BA3A 2OGWA 2QLFA 2VP2A 2Y6VA 3QEKA 1VPWA 4IDDA 4RMJA 3E2PA 3S2EA 2HHCA 3U39A 1TNDA 4QUDA 2OBFA 2QLJA 5L53A 3O0TA 4XYMA 5K0SA 1YL5A 2AI1A 4HB0A 4RTOA 1SU8A 1ZMRA 1ZOOA 3UAWA 3M9XA 5C80A 2BFFA 2VQFB 1Z8NA 2AD1A 2W43A 3HB4X 821PA 1DMSA 3VAZA 4HN2A 3WLTA 5ITZA 3AF2A 2JBAB 4MSUA 1CF9A 1OGJA 3FTEA 2SNIE 1R6UA 4DLVA 2FPIB 3CNNA 3F6SA 3H5LA 3V4OA 5KNCA 4QO7A 1J1UA 3UVEA 3NYQA 3MTBA 5AHKA 4BN0A 1DNPA 3NTVA 2F6RA 3AOEA 4WKBA 5DHUA 4DBVO 4BJ3A 3SC2B 4DTCA 1ENZA 4LHYA 4O1HA 2KM1A 2OFPA 3MWEA 2PWZA 2XEXA 4XPIB 4BWFB 3JWHA 4F5YA 1KK1A 4F93B 2JVKA 2FNAA 3QG5A 3EIFA 3OQNA 3TRDA 4QSHA 1SOVA 1XTSA 2D06A 3LIIA 4KV7A 3KP1A 1SK8A 2QRVA 1IYZA 1OT3A 1GUAA 3AR9A 2WFMA 2AMFA 3KJXA 2J87A 4YUXA 3CEMA 4BUJA 2P6RA 3QU7A 2WWWA 4WINA 5B7GA 5FUXA 4H1UA 4DA6A 1XXHA 2L2QA 2YVAA 4FWTA 4NOJA 4LWQA 5H80A 4JP2A 3VOAA 2QAIA 2RIRA 2JHPA 3ID6C 3I05A 4KWCA 1BOOA 2NW6A 3BE8A 2FUG6 1HMYA 3PF8A 3DMTA 4DFDA 2J4DA 3EZ6A 3DEKA 1LW6E 1TZCA 1IK4A 1WF3A 2EWVA 2HQOA 2I80A 2VLIA 3AEKB 5B3KA 2YJGA 4Y2JA 5JJ5A 2IWRA 2FN9A 4OXQA 1GXSB 3LDAA 2H31A 3GGSA 3UK7A 5LKRA 2OILA 1D1PA 3YASA 3LS2A 4C4AA 3S7TA 3STTA 2X3UA 3G88A 1FDTA 1N78A 1IBMB 2FFAA 2HLDD 2JB9A 3BHMA 4QJ5A 2VSOA 4YHBA 3TKAA 2PH7A 2JDIA 3E9EA 1UXGA 4MP8A 5C8YF 4OXYA 1XCMA 3R9IA 1ZVQA 1QOZA 1Z6QA 4C0AC 2I29A 1D5WA 1WXIA 1JVSA 1LKZA 4K6GA 1ZOPA 1SQ0A 4TYYA 1X2BA 3TYXA 2ZWVA 2A9OA 5AVSA 1P19A 1VE7A 4PXYA 3RAPR 1NBMD 3IVGA 3IE2A 2WAOA 4HVTA 4WX2B 2X40A 5HJEA 3A1TA 3KSUA 3WLPA 1YL7A 4XVRA 1UAAA 3HY3A 2AIRA 4U2DA 4WVFA 4G1FA 2G5GX 2HMAA 1M2OB 1YR8A 1EM6A 2Z5VA 3UKDA 1WVGA 3SD7A 4N7RA 1WF6A 4DSTA 3LUKA 1OWNA 1CUUA 2HCFA 2WJZB 4WMLA 2HAEA 2ZWIA 1TU3A 3ZKAA 3OKCA 1TDJA 3AL2A 3FNBA 1QRSA 4B3FX 3JTEA 4L50A 3J7TA 3B82A 4R81A 5ADHA 1NKTA 2PWYA 2HW8A 1VM6A 2ST1A 4KMRA 3VO1A 2IU6A 1TM7E 2ONKA 2XUZA 4WTOA 4CR8A 2VDWA 3F71A 1L7RA 3IRVA 3ACBA 1Y9JA 1JIKA 4XGQA 1J22A 4PLTA 5SV2A 5DK4A 2VXYA 4ETIA 2E5WA 1U1CA 1HYBA 2ANCA 4FOLA 4LXYA 3UA4A 1W4AA 4D79A 3ZE7A 1U3CA 1I01A 1SKYE 4O5AA 1FZQA 4YJKA 4ZV7A 1FP6A 2FRVA 1EUCB 5I9BA 4EY4A 4PQGA 2XCSB 3W3AA 1SURA 4OI1A 4E5NA 2X0JA 2IUYA 2C4UA 4UBJA 3HRIA 2ICAA 4M6WB 5DBEX 1T6NA 4N8DA 2HF8A 4PPNA 4HBZA 2HLPA 2XB6A 4FGSA 4R16A 1RACA 4JWTA 4FYYA 1YUNA 2W2QA 4AZTA 4X63A 3LNCA 1BIFA 3LXMA 1TUIA 4C2UA 1RXYA 5EIWA 5IHXA 3RADC 4D02A 2QXTA 2Q1UA 2WTBA 2EERA 3H9QA 3WI7A 2WM8A 3GA0A 4WLNA 5DK6A 5F5XA 1CD5A 5LBUA 4P4GA 1D2GA 5F33A 1ZXBA 3U6KA 1ZVVA 2VTBB 4XFDA 2XE7A 4TTTS 4D9NA 3FOAA 3I32A 4DJTA 1JF8A 1EP3B 4Z8XA 5GJCA 1WVMA 5JFGA 3K9CA 3LSTA 4B9EA 2JJ2A 1LK7A 3CPEA 4FYPA 5DN6A 2NGRA 2WHYA 3BTUA 3HZHA 3LFUA 2XCLA 1E0JA 2GEFA 3FZNA 3NZEA 2QY9A 2D1RA 3PNSA 5CDGA 3P0EA 5KCZA 3LDUA 1AZWA 3O6VA 4YYZA 1K5DA 4P3XA 2DPHA 2XGMA 3DZHA 1WD5A 3SDSA 3TPCA 4L27A 4CF3A 4UFPA 5HQ3B 3KHTA 4KDCA 1G66A 3N76A 3F5FA 4P4UA 4F96A 3C16C 2PS0A 3L0BA 1TVCA 4G84A 1E0AA 2J0SA 1WXGA 1DQYA 1V9LA 2JBHA 4I6JA 3K9NA 2CVHA 1G8MA 2VF5X 3CPSA 2ODAA 4QAJA 3ZX4A 4BX2A 1Y9AA 4C0KA 4EOGA 1U9YA 3LQRA 4HUTA 3SXUA 4NR0A 5AKJA 4LNAA 3UWDA 3WO0A 4M8NE 3D6FA 1J6UA 5CXQA 3FPGA 5C35A 1XLTC 4M1EA 3TGPA 2GD0A 3UWKA 3BULA 5HBRA 4KTVE 2FEAA 1ZSVA 5CA0F 3IA2A 2R97A 4OK3A 1WU7A 3L8DA 3T1OA 4D4HA 1WE2A 5EJMA 3X1WA 1EFRD 1AGPA 2Q5JA 2VEDA 1GFIA 4LCJA 2IU4A 4P58A 4A6DA 5D7BA 5ESWA 5KTNA 2PT7A 1IY9A 1R4ZA 3M49A 1W87A 1BMTA 3A6GA 3H1TA 2IIVA 4CDGA 2G5PA 2PPVA 2QORA 1Y4UA 3OM9A 3P32A 4G0NA 3ZXSA 4ARBA 2XKKA 5H3HA 1I1HA 5LPNA 3U44B 4Q16A 1J2YA 1T15A 1F8FA 1KVUA 3PEYA 2JFBA 3REQB 4XKJA 4BB0A 3ESXA 3R7WB 1C9MA 3SZMA 3VJMA 3JWIA 1RWXA 3QVVA 3SY8A 1WU8A 3IUJA 3UHJA 3WRXA 3W7AA 1SVKA 3RS7A 2PGXA 4GYYA 3USZA 3N6VA 1GEGA 2X1MA 2Y1OA 2ZCVA 3DGEC 4FHZA 1FTNA 3Q0TA 4YN3A 3JD0A 4JP8A 5ICSA 1NW7A 4PYNA 5KTOA 2Y0EA 2YW9A 3WXBA 1SUCA 4NBSA 4UEQA 2IYQA 4KI7A 1YFKA 4QUBA 4XWYA 5DPMA 3OT1A 3K70B 4EH1A 1BX3A 4ZAGA 3NW9A 4BBZA 1GGEA 1OKKA 1KEPA 3V2HA 1KJIA 3I52A 1O87A 1A4XA 1UJ5A 2YJ4A 3ZCVA 1KJ8A 4UPVA 2VDQB 2HYIC 1V9CA 3DOHA 3C97A 3PGA1 4QTTB 4HDRA 3ZCXA 3M2TA 5BWLA 3WNBA 3HBFA 3HJTA 4BQOA 5DSTA 4DYHA 1H4VB 1ODCA 1G41A 4KUEA 5JROA 2IUUA 1YACA 1HKHA 1E1KA 5CVTA 3GT7A 4C6HA 4NESA 3SQMA 2PGLA 4LQ4A 1S3GA 1X1QA 3GRZA 5BUZA 1U2DC 1D9XA 1N2JA 2APJA 1V1RB 2V4UA 2HJGA 1E9SA 2CNOA 3OEEA 3V4SA 1WQ4A 2BF7A 3DLCA 5GGYA 5JDCA 3M83A 2I62A 3DSRA 3WSWA 4DL9A 3IO5A 3WGNA 4JEIA 4EPXA 1LQUA 3CM0A 3H17A 9MHTA 5C3MA 3SYMA 3VR1A 5AJTA 4JNCA 3GBVA 3QQ5A 4GS5A 4P31A 2WD7A 1XA4A 4YRCA 3DG9A 3GCGA 4HEJA 4QYSA 2ZPUA 3ODGA 3OFJA 4HN4B 4S3MA 3SLGA 5LQDA 5HCIA 4X60A 2PAFA 1NLUA 2FW6A 5HXAA 2OCYC 1YQWA 2Q9CA 3K16A 4JB8A 3UC9A 2V7PA 3KG2A 3GMTA 5BW6B 4UM5A 4DSOA 5IF3A 3CLKA 4WLUA 2OA0A 3A9RA 1NVXQ 4NL4H 4R9NA 3L01A 3ZV5A 4BFVA 1I4OA 2IITA 1VHLA 4EVRA 1V6CA 2H29A 3KSMA 5G0SA 4KRGA 2QYSA 4MCHA 4RANA 4AKEA 1SM4A 1DJQA 1CRPA 3UKOA 1A5TA 5DGCA 1N1MA 4PHGA 5DTIA 1JQ5A 4QLAA 1NFRA 2JKZA 4PANA 3OQHA 4ND8A 5U4QA 2AOWA 2FKAA 3LHSA 4L22A 5FT9A 5GPBA 1E3JA 3EPHA 1TAQA 3GN1A 3OESA 1KMQA 1SRRA 5HG0A 4MV9A 3AIOA 3AM3A 2B21A 1KDRA 2A9FA 2EJUA 1JFFB 1QO0A 2IU0A 4A5OA 5IRCD 3SFVA 3GXBA 4IFTA 5JCXA 2FN7A 1D1TA 5K0ZA 4OD0A 1XVAA 4JP3A 3SJUA 5L7WA 1WBDA 3K53A 4M0UA 3RSGA 1DV2A 4RTMA 4LBZA 3RJMA 1QHXA 2HOQA 5DE3A 4AC9A 1ZGZA 4PSUA 5EP3A 3T99A 2F1KA 3UKJA 1OAKA 4H31A 2BL4A 3WGIA 4ZEWA 3Q7RA 4ZV9A 1GGHA 1J8QA 3W6NA 2ZETA 1A96A 3CF4A 3RHTA 4IV5A 2PX5A 3DZKA 4B6GA 1CUYA 1TEVA 4RTSA 5AKHA 5E95A 1GKUB 3E5HA 1TTTA 1UBKS 3LVRE 5JPDA 1M8JA 3KRTA 4R8SA 5JH7F 3A70A 5IX8A 1N5OX 1NXSA 1W29A 4K87A 1JLLA 3HSKA 4MGKR 4PFSA 4RD6A 3H65A 4TVKA 1J1ZA 4RU1A 2Q9UA 2NTYC 3TR0A 5IZ4A 3V1YA 4GMGA 2Q3HA 1WKBA 3GEMA 3IFSA 1FXWF 4WXHA 2EJWA 4DMKA 3QVXA 1XQ9A 4LZWA 4DKJA 1RXCA 2VRCA 4K28A 4F7WA 4EJSC 4Y6SA 4YO8A 5EWMB 4ALKA 4Q9HA 2P9BA 2TMDA 2PKQO 1OX4A 1YS4A 3N2EA 3SKVA 1Z2PX 1CUCA 2ZSIA 3WLJA 1ZHOA 3LX8A 2WBLC 3L7BA 2Z9BA 5EWLA 1BJTA 3QBTA 1UT8A 1J2TA 3LM8A 1RZ3A 2XT9A 3KAPA 5KYTA 4M9RA 1KI6A 2XNDA 3OUTA 4I55A 2O0HA 3FPKA 5ICGA 3JD2A 3VKHA 2MSWA 4PR0A 1PSZA 1NG1A 5IN5A 3Q5EA 3L4BC 4MINA 1CUGA 2PKXA 4I5GA 4Q12A 1HURA 1ECPA 3L1JA 4B46A 3HM9A 3QEOA 2JGRA 4QEZA 4G8CA 2FOIA 2GTPA 2P9HA 3ZUGA 1XZQA 1JQDA 3NHZA 1K08A 2FSPA 5BN5B 2B0JA 4OB7A 3IAS1 3GD5A 2CYAA 3LHDA 4RYLA 4GP7A 1UODA 4N7MA 5EE1A 3RSFA 5LNK1 1ZIDA 4ZRDA 2CT8A 2NSDA 1OXUA 1GTSA 3DMDA 1FL9A 2EL9A 1NR5A 4M21A 3E82A 1E8NA 3ANLA 3I42A 3KKKA 4P33A 2WQ6A 3HBLA 2P3QA 1YZNA 1YQGA 4QU5A 4UHKA 3CE6A 1IM2A 3RJZA 1Z75A 2ZEJA 5AKIA 5DM1A 1QGAA 4E5PA 4NZPA 1TQ6A 3WE7A 2OD7A 4YP9A 5IJ0A 4BJ6A 3FB1A 4OB8A 1WPRA 4EUKA 2NQ2C 4YRKA 4J49A 5I48A 1RXWA 1GAWA 1FFGA 1L4EA 2ZXFA 3PC7A 2QL7A 3QV1A 1LZKA 2QS9A 4X91A 3Q9LA 1M8GA 5T8KA 1SCNE 2X86A 4MVJG 2WWVD 4EKYA 3GN2A 1HMPA 2Q8PA 3M1YA 2H07A 4ND7A 4R7TA 4QPDA 3D43A 1GITA 4KAJA 4HNVA 1PD1A 1PQYA 1U8AA 2PD6A 3HCBA 3U7QB 2BUBA 2AYZA 5HP4A 2Q2NA 3CH6A 5HRUA 3V32A 4C3VA 5LL6P 2YJ3A 5JC1A 4WVLA 1ZD5A 4JQSA 5JWOA 4PAGA 3TUJC 3KOWA 1XXHE 2G25A 1HDZA 1IOZA 3TJRA 4DCVA 2HO4A 3KR0A 3GEHA 2WUFA 4IJ5A 2DXIA 1EI9A 5HFNA 1PZEA 2NNWB 4UKDA 4YMIA 3SP1A 2XSZD 5B1DA 1XK7A 3AT1A 3Q2IA 5LOVA 1ZI8A 1AKVA 2I1LA 2W2PA 3DNFA 3OCZA 1MPTA 4JI5B 3N3BC 1PEAA 1O9BA 4INJA 3CRNA 4PNPA 1GDTA 5FRDA 1DEAA 3PHCA 3U48A 3K8YA 3AEYA 1DI0A 1XAHA 4H6VA 3RIXA 1USGA 4G0YA 5MDHA 4UUOA 4NZMA 3SQXA 3K4PA 3HO6A 3HO8A 3DDUA 3IILA 2JI6A 4KIGA 2FXVA 3TKLA 1G2OA 1MB3A 3QV2A 4MMXB 4UBIA 2A9JA 5EC8A 7MDHA 1R6AA 3NM6B 3TG8A 3CW8X 4G56A 5IAAA 1FFYA 5K4HA 1QRAA 2JCXA 4NKRA 4X3OA 2GZDA 4N0EA 4ZYWA 1KEVA 2FPGB 3QWBA 3UBMA 1VG9B 2GI4A 3BB3A 4PFKA 5KOJB 3SKYA 4GPAA 5BQFA 3TAHA 1T8RA 4WKOA 2W00A 3OHPA 4MTCA 4S04A 3DH0A 2CNNA 3UXYA 3ZU4A 3IOEA 1JHZA 1T1SA 3FWZA 1G7RA 2OO7A 4O2AB 3TW8A 5JBQA 2RHCA 4RAQA 2VYQA 4BO2A 3LPDA 5KS2A 4YRZA 1Q2XA 1XMVA 3DM9B 4V2IA 2W0SA 4HEHA 1CF2O 4L4ZA 5DP1A 2WQZA 3EEOA 2H2HA 1Q1AA 1XR3A 3RTAA 5GP1A 4C4YA 3ZG6A 2X2PA 1OFUX 4MW7A 2R25B 3AIIA 4LYYA 1I6KA 3VVCA 3PQEA 4RUKA 4UZEA 4C07A 1E5TA 1X7YB 3P9KA 1FMCA 4C4RA 1COWD 3CUKA 3U9SA 2H1CA 2G9RA 3H3JA 4DIUA 2HXSA 2XUKA 3KQMA 4YFYA 4C88A 4YRMA 5JNWA 4DA0A 3ZWDA 1L8LA 3KEGA 3H5OA 4MV0A 4NFHA 2NO4A 5P8WA 3CG4A 4CFZA 2M6RA 3FGZA 3I04A 1QYCA 5I51A 3F3SA 4UHCA 4W8OA 4DEVA 3J81k 1PK8A 2HIGA 2JJYA 2VP9A 1FQKA 4PW0A 1M8PA 3BAFA 4G36A 4GWKA 4PLFA 4BE4A 5DP2A 2Q5CA 2IHJA 4NZZA 1HV8A 1T5DX 2OHFA 1YHNA 2VBCA 4NRDA 3ELWA 2H51A 2O5VA 3CEJA 5JEDA 5LYYA 1HGXA 1PR9A 1VSVA 4JMPA 4MR8B 5HOQA 5A9SA 4XX0A 1M2JA 1CUVA 3EBOA 4LRUA 4S1OA 3H2BA 4YAGA 1WW2A 4K9OA 1G291 3UATA 4XIJA 4ZK6A 4YBZA 1MTZA 2FPOA 2Q1WA 2PBRA 4C4SA 1IQUA 1SB8A 3BZBA 4L5YA 4H3VA 4WKNA 3AKCA 3OIUA 4HDMB 3UH0A 1BX1A 4F92B 2RC6A 5IVKA 4YRLA 4RK0A 4AY3A 3GGOA 1TYCA 3WK5A 2HCRA 1XYGA 3U9LA 1TJ5A 3LL4A 1BCSB 1UK9A 1X42A 1YDMA 2QYTA 1F6WA 2A35A 2OE2A 2PQ2A 3CR8A 5J9FA 4HXFB 5HK9A 1VYTA 3L93A 3QTLA 1IRXA 1TU0A 1DPFA 5KX5A 5I9SA 4OSPA 3MYYA 1Q95A 1TT5A 2GBIA 3G9TA 5AVZA 1FSPA 1SKQA 3GI1A 4DYDA 1ESZA 4BNMA 2NZUG 2P90A 1SQ6A 3L6OO 4BFSA 4QD3A 4U6SA 1NNI1 4GLFA 3AETB 4OMUA 4B32A 3GP8A 4J7UA 3WGUA 3OX4A 1H9BA 4D4JA 2Y4OA 4NJEA 3CISA 2NU9B 5B7QA 1M5RA 4I3FA 4EENA 1EFPA 2EFYA 4O8ZA 1A8QA 3H11A 4LFCB 2GT1A 3MERA 5B1HA 1D0IA 1UDCA 2RARA 4B09A 4OQPA 4CM8B 4UCQA 1XQXA 5I7OA 4UTNA 5AMXA 1ADGA 1O03A 4UMDA 3OCXA 3TLKA 2NVWA 2HA7A 1C80A 4UUBA 4QYMA 4IDBA 5JXHA 4AJLA 3SDZA 2WKWA 2LIVA 2DG2A 1ZLXA 4FMBB 4EI8A 3ZY5A 1IY0A 4US2R 3ZVMA 5CA1A 3GQVA 1MBZA 3PD1A 3ZWKA 4EZEA 4G26A 4BNNA 4R5HA 3EBLA 3PCTA 3R3SA 2X2OA 3WY9A 4FE3A 2G0NA 2VFAA 5K20A 4EHKA 3R74A 3ZHQA 2HDHA 3DMGA 3RJ9A 4GPEA 3I76A 3PSAA 3VU1A 5HKKD 4OB6A 1XN4A 5K3AA 4JBWA 4JYCA 4LECA 4BPBA 5JJKA 2VJLA 1WUJS 1GGJA 1MRSA 1NUSA 3WISA 3C4VA 2C4VA 1AUVA 2PK3A 2JIPA 3RK0A 4CT5A 4ZKDA 2J85A 4N5LA 5HCUA 4NYIR 3ZBQA 1ONBA 1SD1A 2BI8A 3FNQA 3WHPA 1M74A 4CIAA 4Z54A 1E99A 5TSDA 4PM4A 1NR1A 3A6LA 1KSGA 3IO3A 2DHEA 4IO1A 5L3SB 3ADDA 1XTRA 3HWX1 4JSTA 3N28A 3PVSA 1KK3A 2SICE 4KUGA 1CR4A 4LBWA 3QVLA 4QJBA 3RKSA 1X1EA 1JW9B 3SM3A 3FBWA 4EW2A 5KNBA 4EGJA 3DGFC 1KNXA 4R98A 3C85A 1VI6A 1YT5A 3AK4A 4E2XA 3OC0A 4Q4DA 3DUFB 5AXBA 3OQOA 3VZCA 1FZTA 3NVMB 3OI7A 2N1BA 1TUBA 4EITA 5C7LO 1CWUA 4YQYA 2PKCA 4BMOB 2VDRB 4CWAA 3O0DA 3P9RA 1HC7A 1R8XA 2O14A 2VAVA 1LDNA 1SBZA 1HBJA 2DC1A 2PMCA 5EL0A 3L0SA 5IZCA 1M72A 4IS2A 4LMPA 3ZHUA 1SCDA 1ML4A 4QARA 3HJAA 2JPDA 4ARZB 2B37A 2XUQA 4TLAA 4F60A 2VNIA 1KAHA 5KREA 1SUAA 3HDJA 1YOVA 3HKCA 4FFOA 3EF0A 1WMFA 3H5WA 3ZN2A 4FYHA 3IPLA 4JS0A 5T3YA 2YWCA 3W3AH 4CM1A 1RJWA 1IN5A 3H8VA 1DSSG 4B4OA 4HTFB 3Q3CA 4WSOA 4XD7D 3V8QA 2C7QA 5A3SA 2A67A 1DKNA 4F6RB 3HKDB 3QPCA 4PYRA 4CNBA 4FUQA 3UWPA 1G5RA 2GN0A 3H19A 3GNLA 4H6PA 1YASA 4NZ9A 4MNTA 3PV0A 3EQ8A 5TGTA 2W6CX 2JIQA 3C5EA 1M2KA 4HX9A 2Y93A 4JKYA 3KVVA 4LPKA 1OXMA 1Q0SA 4GC9A 2HUPA 3VC2A 5L3RA 3V1LA 4C3UA 4GICA 3OSUA 2C99A 5AI5A 3R6WA 2XQGA 1VSQA 3DWGA 3HHPA 4MO9A 4UNPA 3L40A 3NIGB 2VYNA 5HF5A 1VCNA 2QZSA 1IHDA 1XWIA 1C1DB 3A28A 2WHRA 4K2HA 2OENG 3LECA 1L5HB 4B5KA 1I3CA 2OL4A 2V59A 1GSIA 2RHOA 3HLYA 3O03A 4NYJR 3WRYA 2FW9A 3EJWA 1ZHFA 2FQWA 4EF4A 3LZDA 1BD3A 5T67A 1PD0A 4XGNA 4IYJA 3G79A 4DBLE 3ZCPA 5TMPA 2YVQA 1ZUD1 2VWQA 1VP9A 1B0AA 1GZUA 4J2OA 4JJ6A 3ZHXA 3ND8A 1H6CA 3F7MA 2R8YA 3HGMA 1JLKA 5C3UA 3IQFA 1UXKA 1C3JA 4GPBA 5CX4A 4W8GA 4S1NA 1TVKA 1WZNA 1XL0A 3JD1A 3GRRA 4BV3A 5BSEA 1LTQA 2X0IA 2YV5A 1C9NA 3PPXA 3UXEA 1FS6A 4Y2XA 1L3BA 5BWMA 1NVUQ 3UT0A 2FHSA 3BMQB 4OHCA 1E9BA 2EFHB 3IT3A 1ORRA 2REQB 4DMGA 4MI6A 1TD9A 4QBTA 3WGLA 2RE8A 1UPFA 3A6EA 1G59A 2RHJA 4EI9A 5EJEA 3BXHA 1YZ3A 3EWSA 2ZR0A 3GGCA 3A9SA 3RFUA 3EZFA 3TOVA 1Z39A 1HFWA 3ENWA 1ODJA 2XWQA 4HDQB 1XHFA 2DBRA 1VB5A 3G0IA 3BICA 1RD4A 1Z5NA 1KJNA 1JXOA 3NIDB 3WHLA 4DLTA 4U3JB 1XZMA 3O8LA 2PANA 4G0XA 4YQFA 2R7KA 3LWZA 2EP8A 3ON5A 3HRHA 1IL0A 1STOA 4FNGA 4N5HX 4NZNA 4I36A 4QXMA 1KSHA 4PXAA 5D3MA 3S2SA 1CPYA 4PGMA 2I87A 3E1SA 1VL8A 4KX5A 1T9DA 2AUMA 3CLSC 3DV0B 3GOHA 1K88A 3UW3A 4YAOA 5LXTA 4S05A 1V45E 3WV4A 2JJMA 3SSAA 3KU1A 2IFTA 4OXKA 5IVPA 3GJ4A 5FR1A 3O8QA 1XF9A 2MMCA 3FFTA 4YCMA 3EG9A 1AF7A 5EJ9A 4AMVA 1RM0A 1GUBA 3OP1A 5D7NA 4EGCB 4R8KA 2H1OA 2V3CC 1U9ZA 4FN4A 7AT1A 5IKMA 3OZWA 3TZQA 4EB8A 4BN5A 3RFVA 1B26A 3CTMA 4FNAA 4HQFA 1FRVA 3F5SA 1V5EA 1U99A 5CDSA 4ZHSA 2CJPA 4HWOA 2V0CA 1SVNA 5ANRB 2A5YB 4EHNA 2O8FA 1C50A 2EJCA 3CLRD 2PTGA 4Y2RA 3SR0A 2Y71A 4CEHA 3V4PB 3MC1A 1T3SA 5ALHA 3QX9A 4F5EA 5AFSA 4ARCA 4TYWA 2MU1A 4FLMA 4O2LA 4F4JA 2LGJA 3NASA 1DINA 2XIJA 1ZNQO 4KW7A 4DC9A 1NUTA 5FV7A 3IDFA 3W5IA 1Z28A 3G2OA 2D00A 5FTWA 2FXIA 1FUYB 2C57A 3HN7A 1V47A 4K86A 3W0LB 2GAIA 4CMCA 1UP6A 5DF1A 4J0KA 2ZTVA 4G0UA 3H75A 2CFRA 3R3YA 5HJ5A 1P31A 3FBGA 2EDCA 3BQMB 3COYA 1L7BA 3Q85A 5DXFA 2BEUA 4W1PA 2HO5A 2LTAA 4JL8A 1DX4A 1JZQA 5IBRA 1E6UA 3LV8A 4MKHA 5FL7D 1L5KA 3ROMA 1OUMA 2A0FA 4D6PA 2YJ5A 4LF5B 4NJMA 2D7JA 5LYJA 4PHHA 4HEQA 4HVLA 4GYWA 4QT4A 2C1EA 4E3WA 3ORQA 3E8SA 4E7PA 3EH1A 2A5FA 4HFMA 4BRSA 3K09C 3P26A 5CNKA 3OEHA 2JEOA 1FX0A 3VYVA 2ZTHA 2L19A 2QTCA 3HXPA 4F8EA 4LJ6A 3NPAA 4XDGA 1AZLA 1U7WA 5LWQA 4TXHA 4R9SA 5JBNA 3MLBA 3NVDA 1IUKA 1YVRA 1FRZA 1K9SA 2UVPA 3B1JA