3M2PA

The crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
294
structure length
287
Chain Sequence
SLKIAVTGGTGFLGQYVVESIKNDGNTPIILTRSIGDYEYRVSDYTLEDLINQLNDVDAVVHLAATRGSQGKISEFHDNEILTQNLYDACYENNISNIVYASTISAYSDETSLPWNEKELPLPDLMYGVSKLACEHIGNIYSRKKGLCIKNLRFAHLYGFNENYMINRFFRQAFHGEQLTLHANSVAKREFLYAKDAAKSVIYALKQEKVSGTFNIGSGDALTNYEVANTINNAFGNKDNLLVKNPNANEGIHSSYMDSSKAKELLDFSTDYNFATAVEEIHLLMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-N-acetylglucosamine 4-epimerase
publication title The crystal structure of UDP-N-acetylglucosamine 4-epimerase from Bacillus cereus
rcsb
source organism Bacillus cereus
total genus 106
structure length 287
sequence length 294
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2010-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3m2pA00
2BF7A 3E5RA 4PG8A 3P19A 1LLCA 2BHLA 1GAEO 5I8WA 3U09A 1CEQA 2J3IA 3JYOA 3K31A 2PD6A 1I5RA 4P4NA 4PZCA 1PWXA 5H82A 1JTVA 4HXYA 3RJ5A 1GQQA 3TZ6A 2FSVA 2V6GA 1C0IA 4IZHA 1E1MA 5EMHA 1HZJA 2Y0CA 2E82A 4RDIA 2Z95A 1YL5A 4TZTA 4WCFC 5EL0A 3VPSA 3HNPA 5L9AA 3EYWA 2R2GA 2B83A 3LF1A 1GCOA 4CLRA 2EGHA 4K28A 2VWPA 1O8CA 2C59A 3ZWVA 5K6AA 1Q7BA 1HSOA 1JU9A 2DTXA 2O7QA 1ZEMA 3GDFA 4XR4A 4YTEA 1WLYA 4IGFA 3VPFA 5HBRA 2WD8A 4IIVA 3C1AA 2R00A 3WBBA 1LDNA 3JQ9A 1V8BA 3IP3A 3TZHA 4DC0A 4FS3A 2X5OA 4PRKA 4PLFA 1PJSA 3TRIA 2VYVA 3WGQA 4O6VA 5A3JA 2JCYA 3KSUA 1X13A 3VTFA 2HMWA 3NT4A 2PFGA 2DBRA 1C1DA 2J5QA 1UZLA 3QWFA 4DIOA 3KYDB 3PHHA 3P2OA 1WMBA 3WJ7A 4BMNA 4UUNA 2YFQA 2O3JA 5DOZA 3H3JA 4HP8A 3LT4A 2RCYA 2VZ8A 4IDCA 3PJEA 1EUZA 3LVFO 4JCOA 2QYSA 1ENOA 3TN7A 1VSVA 3VDQA 4TVBA 1K89A 5JXWA 5HS4A 4XQCA 1XLTA 3E8XA 3VZQA 4BGVA 3W8DA 4XR9A 1ZBQA 4KDEA 4EDFA 2GR9A 2Y99A 3DBLA 4WOKA 3S2FA 3DHYA 3GEDA 2FPGA 4DTIA 1ONOA 4YJDA 3D3EA 1C0PA 4A73A 3ZWAA 4IDGA 4CM7A 4M89A 2V7PA 4EEXA 4BKPA 3FNFA 2ZCVA 4K9DA 2EP5A 1YDWA 1M67A 2GASA 4YRDA 5MDHA 5DBFA 2HJSA 4IY1A 3RSHA 5GMOA 2EF1A 3EDMA 1Q1NA 3PEFA 1N92A 2VTEA 2WSBA 1L7EA 4M1QA 1E3EA 4AFNA 3H7AA 3NTQA 2VN8A 1QYXA 3LQFA 5JNLA 3PHIA 2RH8A 3DMTC 2I6TA 3AWDA 4M87A 5DP1A 2PA3A 5ENDA 5IXSA 5BSGA 4MVJE 1Q7GA 1ZW1A 3VC7A 1NVMB 1QP8A 3P5SA 2DPGA 3COSA 3K5PA 4XJSA 1R0LA 1YKFA 2D1YA 3VOSA 5A9RA 4L75A 2ZB8A 3FR7A 4R1SA 3ROQA 4CM6A 2ZK7A 5JDIA 1WDLA 3BHJA 4CLDA 3WGOA 4E33A 1B8UA 3GGGA 4YPOA 4TRMA 3STHA 1Q0LA 4XCVA 3JTMA 4PLWA 2Y93A 4TROA 1ZK2A 3BMQA 2VTDA 4LW8A 1B26A 1R16A 1ZJZA 1IHXA 1GUFA 4ZQEA 2P5YA 1MG0A 4XKJA 3ZWYA 3OF2A 2Y1GA 1SEVA 3B1FA 3PRJA 1PQPA 4CLRB 5EERA 4A10A 1OAAA 4RPJA 1B16A 2PH5A 3N7UA 2WYWA 4NFSA 5COBA 1HZZA 1ULSA 4CMKA 2O3TA 4BKUA 1T25A 1Z7BA 1E3LA 1U7HA 1LEHA 2O3QA 5T5QA 1WMAA 3SC4A 1KVUA 2POQX 4HKTA 1H93A 3ZWMA 3ADPA 4YBZA 2CNBA 1E7YA 3WQSB 2HRZA 2DFDA 3VZPA 4YQZA 4IDEA 2ZKLA 3FTNA 3KYCA 5C7OO 3QVOA 3EK2A 5KVVA 3K2BA 2YYYA 1XA0A 1R0SA 2BH9A 4J4TA 5L53A 4JBHA 3UGKA 4TRNA 2PR2A 3U4HA 3L77A 3PYXA 1DLJA 1T2DA 2H9IA 2ZATA 3KSZO 4FFLA 2WYVA 4XYEA 3GUYA 3OQ6A 3QP9A 1SNYA 3PGXA 3OETA 4XYLA 4URFA 1RM0A 1PL8A 1XWFA 3OBBA 4DLAA 1RM3A 5CEFA 5KCZA 4ZA2A 3DZGA 3ASVA 5KOIA 3GUCA 3DBLB 1H9AA 3OIGA 4R1TA 3GRKA 1QR6A 3KSDO 1HDOA 1PIWA 3BHIA 3C3XA 4BB5A 3RKUA 1I32A 4RVHA 1V6AA 1D1TA 2HUNA 4U0KA 1ZK0A 4I5FA 3GNSA 2HKIA 3GN1A 5AYVA 2IEBA 4RPHA 5C3MA 3NT5A 4DBZA 3HE3A 1M66A 1GV1A 4Z0HO 3T7EA 5CDSA 4BGIA 4D44A 1YBMA 2ZTVA 1GR0A 3IJPA 5KVSA 1ISHA 1PJQA 3HB5X 4B4WA 5JSFA 1BMDA 5JCJA 1PJTA 3KEOA 5IFLA 1SC6A 2D4AA 2WYUA 3ICPA 3W6UA 4NNJA 3NDIA 4CM3A 4DYDA 3N74A 1WZEA 2QZ9A 4BB6A 1JVSA 3BTOA 3GFGA 3KUXA 4EJ6A 3O8QB 1DC4A 3NKLA 1UZNA 5CG1A 1O6ZA 1GUZA 3GPDG 2X5JO 3EY4A 1PGOA 1VJ1A 2D8AA 3ICCA 2X9GA 4YWJA 4RORA 5FWNA 4CR7A 4L4XA 4YVFA 4J0EA 5G2OA 4FDAA 4II2A 4FIZA 2X58A 1HRDA 1H0KA 3I9KA 5KVQA 4DL9A 4U5QA 3RU7A 2I76A 4FJ2A 2B69A 2J3KA 1O95A 2PZJA 3CPSA 3LLSA 1HE5A 1NAIA 2JD0A 4GX5A 2W2LD 4IXTA 2W98A 4ITUA 1U8FO 1Y81A 3UAGA 4JJIA 3I9OA 4Y6PA 4MOWA 4TKMA 1B8VA 4G2NA 3KYCB 4E2XA 1R4MA 2VRCD 5EIOA 3ETEA 1IL0A 2ET6A 1NQAO 4NIMA 1X1TA 1Y8RA 4TRRA 1SPXA 1U7TA 4WOJA 4GMGA 4CM1A 4EZBA 2XOXA 4AJPA 2AEFA 2EW2A 3PJFA 1NVTA 2AQ8A 2EG9A 1C14A 5EINA 1LC3A 3X2FA 3IKVA 4ESOA 3KOUA 4FC7A 4XJTA 1HDZA 2DPHA 4BO4A 4P38A 1AE1A 2XXJA 1DIGA 4LSMA 1T1SA 4BQPA 3OECA 5IN5A 2X1HA 1PGNA 2JD1A 3MEQA 3S2GA 3H2SA 3CZMA 3PHJA 2VT2A 2O48X 2VOJA 1Y1PA 3QVWA 1HDCA 4HX5A 5LDGA 1ZMTA 4N5LA 3B70A 5EN4A 2PH3A 3DZFA 1TLTA 2VUTA 5JLAA 4RQTA 4AVYA 1GQYA 2IRWA 3CIFA 1EE2A 4J91A 3IMFA 4BQRA 4CL8A 2IYOA 2WE7A 4HY3A 3W4IA 4R54A 5TNXA 1WAMA 4QFDA 4WLEA 4I9UA 1XYGA 3GOHA 1DIRA 1XEAA 1ISGA 3H6KA 2ZB3A 4J3FA 4PIVA 3MTGA 1JKFA 1TT5A 1YQXA 1TA4A 4ND5A 4F45A 1FDWA 1ENZA 3WJAA 4YT8A 1I3KA 2PZKA 4MKRA 4W7HA 2GN9A 2TMGA 1JLLA 3H3FA 1PU2A 4B79A 4I5DA 4WKGA 3VKUA 3TWOA 4DUPA 3TF5A 1PGQA 3JQBA 5CEJA 4DVJA 1FMCA 3G3EA 3GVIA 3AOGA 5EQDA 4D79A 2I66A 2J5RA 1HE3A 5F1OA 4U7WA 2TMDA 2WDZA 2O23A 3WNQA 4J9VA 1J5PA 1UAYA 1K6IA 1LSJA 2CVQA 4GAEA 1BG6A 4NU6A 3DWFA 4CUKA 3MOGA 5TLSA 4WLVA 4RVDA 3GGPA 2EJWA 4KWIA 3ETDA 4BO1A 4GPD1 5CDUA 1DRWA 2VNAA 1LLQA 4QT0A 1KERA 4FFPA 3ZCXA 1K6XA 4E5PA 3QSGA 2CDBA 3K9QO 1N9GA 1XSEA 4CMAA 2AG8A 4QFCA 1BXZA 1JKIA 2RAFA 3INRA 3UICA 3UVEA 1Q0HA 4NK5A 5LCXA 3H9GA 5K6AC 1MXHA 5TF4A 3OJEA 4G5HA 5AXCA 4CL3A 2JHGA 3MWEB 1Z75A 2Q4EA 2VHZA 1SOVA 2EEZA 1DPGA 1WXDA 3OICA 4RCVA 5CPFA 3IP1A 5H81A 3WTBA 2R00C 2OMEA 3JQ9C 3HN7A 1E5LA 1XQ1A 2PLAA 2ZJ0A 3GZ4A 3PZRA 3MTJA 1R4MB 3FPLA 1PTJA 1SB8A 4PG6A 1Y8RB 3C7CB 3W1VA 3ZW8A 2G76A 3D64A 2C2YA 3L6DA 3ZU2A 1UP6A 3UOGA 4CUZA 4AJOA 2C20A 3TL2A 4D43A 3WICA 2BI8A 4LVUA 4G81A 5F1KA 3RUHA 3ZNOA 2CMDA 5G0VA 5IN4A 3AI3A 4OXNA 4BS9A 3IOYA 3WGGA 2NACA 1DOHA 3GHYA 1V3VA 2E48A 2VHXA 1GL3A 4LSWA 2OP0A 3V1YA 3PXXA 1E1KA 3AFMA 3LT1A 4EUFA 5KTKA 3RC7A 1LX6A 3GPIA 2E4AA 4CQLA 1ZUD1 3W4KA 2P4HX 1LSSA 2BD0A 6LDHA 4XA8A 3WS7A 1YXMA 1HTBA 4AJ4A 1KS9A 2YDYA 1KVQA 1XU7A 2ZB4A 3ANNA 3HFSA 5A5EA 2VRCA 1PGPA 4GX2A 4JK3A 4E5MA 1PS8A 1TT5B 4IJVA 1D3AA 4XQ9A 3ZDFA 4ROSA 5BSFA 4PRLA 4LCJA 3GMDA 1ML3A 2HRBA 3PQFA 3CZRA 4C4OA 5JCXA 2ZCUA 5I9NA 4O63O 2Q4BA 1NBOA 1J6UA 2J5KA 2JFHA 3VH3A 5I9LA 3HB4X 3H2ZA 3PIIA 4ALNA 4PLPA 3RUCA 3I6IA 3B1KA 4CV3A 3NX4A 3EAGA 5JDIC 2NTJA 3W8EA 4CMEA 4BIIA 4YB8A 3A9WA 3NEPX 3DL2A 3QQPA 1LSUA 1R6DA 3BZUA 4PVCA 3L4BA 4ZRMA 1AN9A 3RD5A 2IYPA 2O4UX 3UCFA 1MP0A 4YACA 4R1NA 3GEGA 1LI4A 3P7MA 5THKA 1X15A 4QQRA 2GCGA 4BNIA 4EYEA 5F1PA 1GZ6A 4DPMA 1QV7A 2YQ5A 5U4QA 3NTOA 4XRRA 3MJCA 4XIYA 3G1UA 2CDCA 1N9GB 4CMHA 4Q3NA 4PG7A 2P91A 1NYTA 4L76A 1M2WA 2QG4A 3WLEA 1VSUA 4AJJA 4PLZA 4BL5A 4JLWA 2Q2QA 1M76A 3JSAA 4E3ZA 3EVTA 1H9BA 4KOAA 4RGBA 3DB2A 5G0WA 3WSWA 1WZIA 1EK5A 3JQAB 1TEHA 3C7AA 4BNXA 4D3SA 4YQYA 1PQUA 2X9NA 3WX0A 3IKTA 4NU5A 2PTGA 4FJ0A 4P22A 5JW6A 4RZIA 1I3NA 1P45A 1QMGA 3OQ1A 2I99A 3QW2A 1UDAA 4J2HA 3ANMA 4P4LA 3FD8A 3DHEA 5IF3A 3BMOA 4LCEA 1HL3A 3RUEA 4Z9FA 2VZ9A 1YWGO 3IDSA 2UDPA 1EBUA 1T1RA 4D3DA 3P2YA 2OL4A 3RASA 3WSVA 4E0BA 5AQ1A 2PGJA 4NK4A 3ETGA 4OOEA 5I9MA 1NQTA 1UXKA 4KDFA 4GVLA 1W6UA 1SEPA 3OJLA 4NDNE 3MJTA 2I9PA 4UVGA 1UXJA 5CP8A 2NNLD 2NU9A 1A72A 1N7GA 1CRWG 1K5HA 3H9UA 4ND3A 4BO7A 3LT0A 2IODA 3BIOA 3G17A 1DIAA 3ABIA 3JQEA 4MP8A 1YB4A 3I52A 3DOOA 4YJHA 1CJCA 3RAJA 4ALKA 4CQLB 1P3DA 1S7CA 1LDYA 1ADFA 3AM4A 4I9HA 2NU8A 3VHRA 1OZAA 3D0OA 4A26A 1QORA 2D59A 3C1TA 1R66A 2GPTA 4RF2A 8LDHA 5F21A 1H2HA 1NQOA 4QSMA 1ZSVA 4FGWA 1ZK3A 1A9ZA 3HDJA 4CMCA 4FOSA 3WFIA 4WLNA 2EJVA 5I8ZA 1UP7A 2YUTA 2QRJA 3F5QA 2PKQP 5U9CA 2QX7A 1SO8A 2CY0A 2X8LA 4R51A 1GYQA 3FTPA 5HA5A 4MKZA 1FDVA 2CVOA 1GUYA 3AI2A 2F00A 4DMMA 1MXFA 4GX0A 3ZNNA 4YXFA 3KLPX 2Q1TA 4BOYA 4CV1A 4D45A 3KVOA 3PZBA 3DAPA 1WW8A 1JAYA 4DBVO 1DC6A 3JQGA 4RJTA 1WDKA 1XIVA 3ZWCA 3ST7A 1O89A 4PLYA 3GK3A 4BO9A 1Z7EA 1DEHA 4KWHA 4B3HA 1O0SA 1ZO8A 2EHDA 2RHRA 3KYBA 4L4RA 4XQEA 1T2CA 3DZKA 4WLFA 4AJ1A 1KVRA 1DFGA 1A7KA 1XCBA 1OI7A 3E82A 4Q3EA 3W4JA 2FZEA 1ZKMA 1KEUA 5TX7A 1UDBA 4I9NA 4FJ1A 4OYRA 2PGLA 4LMPA 2NQTA 1LXCA 2RH4A 4FFNA 4J0FA 2ZTUA 1E3SA 3WGHA 4R4JA 5FI5A 3ZN2A 4MJLA 2D5AA 4BO5A 2J3HA 3O26A 3WNVA 1IZ9A 2J8ZA 3ZU4A 1V3UA 1GYPA 1C0KA 4ZQHA 3I9LA 1PZGA 3K73O 3L6OO 1BSVA 3C85A 5KJCA 1LC0A 2Q2VA 3U0BA 3Q0EA 4B3IA 3TJRA 4D46A 5G0UA 1WPQA 1E7SA 2WEKA 3OFSA 3QWHA 1LA2A 4A2CA 1DSSG 1YGYA 1ZIDA 3RUAA 1C1XA 3RCBA 3GRPA 2B35A 3V2GA 2BGLA 4FFRA 2GZ3A 3BMOB 4YEDA 4RQUA 1LQTA 4BKRA 3O03A 3Q11A 1ZEJA 4XDZA 1XELA 2NV6A 4ILKA 2JCVA 5ADHA 4O0LA 1E7RA 3GGOA 3HJAA 3TL3A 1CQJA 4TWRA 3I9JA 3D3WB 3E1KA 3E6AA 3GVXA 4YAGA 5JYEA 1O9BA 2IXBA 2Q1UA 3GFBA 3L07A 3RJ9A 3TSCA 5L7YA 1JWAB 1G0NA 2GSDA 3UH1A 1ZJYA 2CUKA 3PHLA 1GU7A 3H9JA 2DVMA 2WJPA 3PWSA 3WIDA 3TQHA 2XXBA 4NFYA 4EJMA 1EZ4A 1PZHA 3I83A 1LDEA 2JFGA 3E9NA 4KUGA 1VM6A 3K92A 3SX2A 5IDWA 3FRJA 3VPXA 2JL1A 2EIHA 3UXYA 4WASA 2BLLA 4IDBA 1U4OA 5COAA 3RI3A 1HF3A 1PX0A 4NJMA 4UEJA 2BELA 3OM9A 2VUUA 3F9IA 1P0CA 3JQ7A 3JQ8A 1YVEI 4FD3A 4RVSA 2R6JA 5IDYA 4LMRA 1U5CA 3PJDA 3I9NA 3I4CA 3MJSA 3ZV4A 4A0SA 3BXXA 3RQSA 2NQ8A 1P74A 5A9SB 1WVGA 3JQBC 5TJHA 4Z6KA 3ZHXA 2AQHA 3JQGB 2Q46A 3KXDA 3VH4A 2WD7A 2HMVA 1H6DA 4NBRA 5AVOA 4GLOA 4Q3BA 1I2ZA 4NPCA 3BTVA 3CXRA 5B4VA 4CJXA 3WMXA 5JO9A 1FXSA 5L95A 3FNGA 4MP6A 1DC5A 1RWBA 1I30A 4FW8A 4NQZA 4L4SA 4PN3A 1I3MA 3W8FA 2GN6A 1PJCA 1IOLA 3HHPA 3V8BA 2QIOA 4CMBA 2WWRA 3DEYX 3UW3A 2EERA 3S8MA 4GKVA 3F1LA 3JD4A 1PQWA 2QZZA 1KY5A 2VZ0A 5T64A 3H5RA 1BWSA 2G17A 3NJ4A 4NG5A 2B4QA 3R3JA 2CSUA 3TPCA 3AJRA 5JAQA 1N5DA 3FR8A 1VRWA 1F06A 4KQXA 1IYZA 2C7VA 4B4VA 2ZIZA 4Q3CA 4BNYA 4BNUA 2XAAA 2DBQA 2WMDA 3R3SA 2Z1MA 3PWZA 3CKYA 4NI5A 3G79A 4GSKA 4IQ0A 4N7RA 2AQIA 5JMPA 4N5NA 2VWGA 2CVZA 3GAZA 4IJKA 3ZNQA 1BVUA 1C1DB 3GEMA 1B3RA 4NMHA 2RBEA 4FR5A 2PKQO 2DM6A 3S55A 1JDJA 1Y9AA 4OJNA 5KJ6A 3NAQA 1Y5MA 4CQMD 1W0CA 4DQXA 1I0ZA 3E03A 3SC6A 1LRKA 1EBFA 2HK8A 4PG4A 4O59O 4JJFA 1QYCA 4IDDA 1FDTA 5ITWA 1NPDA 2UUOA 4PZEA 5ILGA 4WUVA 1A27A 2C07A 2LDXA 3TDKA 3AY3A 2VHYA 3JQCA 4RPKA 1QYVA 3RC2A 4PGFA 4CLOA 4RF3A 1J49A 3DXFA 2FOIA 4N5MA 3OH8A 2QRLA 1CYDA 4RL6A 1B14A 2D2IA 2OP1A 3A06A 4BNTA 4E12A 3WGYA 4CM9D 3IAHA 1T2FA 1PL6A 1SMKA 4JIGA 3WG9A 4OKIA 4O5OA 5I7FA 5A9TA 4K6CA 3F6YA 4BUCA 4FC6A 1QKIA 3U4CA 2ZYDA 4NJMB 4PFJA 4CLXA 1DFIA 4MINA 3JQ7B 4IQ8A 1WDMA 4H16A 1I8TA 3HUDA 2B37A 3O4RA 3AI1A 3H9QA 5AXBA 2ZB7A 3M6IA 3A4VA 3AK4A 3OSUA 1YE3A 4WGGA 1DAPA 2FP4A 4IJWA 3OP4A 4F46A 4E13A 4ND4A 5GZ6A 3VH2A 4XZ3A 4ZHSA 1HYHA 2WD7B 4XQGA 4DC1A 4CMEC 1NASA 1U2GA 2X6TA 4F6CA 3R1IA 3M2PA 3BMQB 3L4BC 1F8GA 4BNKA 2JHFA 3NDRA 3GMSA 3GNTA 5JC8A 1KETA 4GQAA 4UEOA 2Y0EA 4BNZA 5IG2A 1I2BA 3OMLA 1QSGA 4GVXA 5A1TA 3QWAA 4UVEA 2C82A 3RBXA 2FR8A 3CINA 1U3TA 4GI2A 1JW9B 5FYDA 4JGBA 4D42A 3NYWA 1MX3A 3ZW9A 3JQ6A 3ENKA 4E5YA 5FFFA 1YO6A 4QEDA 4LISA 1X1EA 3BHMA 1PZFA 3PDJA 4QECA 4XB2A 1R37A 2FMUA 3DDNA 3GN2A 3KZVA 4GMFA 5TC4A 3TZCA 4IM7A 4J2OA 1JAXA 1UZMA 1UXHA 2AA3A 1RJWA 4ALLA 5F5NA 3ZU5A 4H3VA 1P77A 3K30A 4ZU3A 4WJZA 3I3OA 5L45A 4DPLA 5HTOA 2GGSA 1NFQA 2ZYAA 4W6ZA 1BGVA 5AXAA 4ZICA 1SAYA 4HFRA 1UJMA 1YL7A 2IZZA 4IPTA 5H83A 4F3YA 3WR5A 1ARZA 3L6EA 1GEEA 1HYGA 2W90A 3RC9A 2P9EA 4Q9NA 3DC2A 1IZ0A 4FGSA 4U8GA 1VJTA 1U2DA 4MVJI 3T4XA 2VYND 2P68A 4C7JA 2UAGA 1HDYA 4IJUA 4AJLA 4ONEA 1XR3A 5K0ZA 2AEMA 2YV2A 1LUAA 3GG9A 2OBNA 1H94A 1E7MA 4OMUA 4M55A 3QIVA 1E1LA 5HM8A 1W73A 3B1JA 2IZ0A 2PD4A 3GLQA 4YAJA 1A9YA 1SCUA 1GYRA 3LSYA 4HFNA 2JAPA 2X0NA 4HADA 1WP4A 4JQCA 4TMFA 1VLLA 1ZXBA 2BKAA 4TZKA 1KVSA 3A28A 3IUPA 4HFJA 4FCCA 3PLNA 2V65A 2Y1OA 2FPIA 3AUSA 4QO7A 5T57A 5TSDA 1JA9A 4YJGA 3ZWPA 2NLOA 4JBIA 4WECA 3ZGYA 2Y1DA 1NWHA 2NSDA 1ZNQO 1SBYA 3G0OA 3PFFA 4MVJM 3TOXA 1UUFA 3C7DB 1A4UA 1FDSA 3C24A 3EHEA 5AOVA 4ZRNA 4RF4A 5TRTA 2XF8A 3B20A 1SB9A 2VUSA 4FFOA 4BNVA 1QLJA 4Z3KA 2Q45A 5TT0A 1DO8A 1ZCJA 1HETA 1Y8QA 1Q0QA 2OOSA 9LDBA 4GKBA 2O7SA 4J1QA 5CDYA 4FOOA 4RV9A 5L3ZA 5ILOA 1PR3A 4BNWA 1KEVA 5CG2A 1TXGA 1RM4A 4BO2A 3OJFA 4YA6A 4RO0A 4JROA 3HN2A 4ZN6A 1P0FA 3GR6A 1P1KA 4R1UA 4RPLA 5ES3A 4S1VA 3CSDA 2Q1WA 1C0LA 4L9RA 3CEAA 3H9EO 3JYPA 4FB5A 3Q1LA 1BHSA 2NUAA 3ZWWA 1ZSYA 3PFWO 4W4TA 1I10A 8ADHA 2Y1FA 1N1GA 3WLFA 4OXYA 4K26A 3HDHA 1BXGA 1EEHA 1YJ8A 2I5PO 4ALMA 3NTRA 3AU9A 3DMYA 3LK7A 2BFPA 5G0TA 4DLLA 1Z74A 2AQKA 3DOJA 2EXXA 4CLHA 1LBEA 1MFPA 1NNUA 1OC4A 3I23A 2AEJA 1K3TA 1LRJA 4PG5A 4DA9A 1NHGA 4D3FA 5GZ1A 4WEQA 3FCOA 2OXIA 1WWKA 2E37A 1CERA 4N18A 2OHXA 4AJHA 3B6ZA 4RZHA 5A5FA 3O9ZA 1HYEA 3R6DA 5IJZA 4HV4A 2C5AA 3WTCA 4Y6RA 4YRAA 2H5LA 2GD1O 3D1LA 1V35A 3HFGA 4HFMA 2G0TA 2Q1SA 1HE2A 4IMPA 3SXPA 4P8RA 1RKXA 3WWZA 2VQ3A 4PCVA 1EQUA 1KC1A 2NTVA 3HDQA 4QXMA 2PWZA 4ZVVA 4B7XA 3PDUA 2YV3A 4DGSA 4BO0A 1LLUA 4NJOA 1EE9A 3ONDA 5T67A 4M54A 3HQ4O 3C1OA 3GH3A 4DMLA 1YB5A 4UVIA 4XYGA 1YS4A 3DZIA 1QYWA 3IC5A 1C3VA 1ENPA 4UVDA 3G1TA 1G0OA 3U49A 5L51A 5DBIA 2Q49A 3BAZA 1HLPA 2W2LA 3NRCA 4FN4A 3Q9UA 4UULA 2SCUA 4D0SA 4DQUA 4CMGA 4WE3A 4CMIA 4E2YA 1ORRA 1Y9EA 1AUPA 1E1NA 4J6FA 3WGIA 4EITA 2DTEA 1EFKA 5DCYA 3F5SA 3K8ZA 4BKQA 4YJGB 2Z1NA 3TZKA 1CQIA 2YDXA 3UCEA 1QRRA 2NU6A 3RUIA 1TB4A 3WDSA 1O94A 4B8WA 1HWYA 2G5CA 2YJZA 5KJ1A 5J23A 1HSZA 2WM3A 1MC5A 4XEHA 1BXKA 4R41A 2VYNA 4AG3A 5LDHA 2DU8A 5C37A 3EMKA 5KKAA 4AJ2A 2VCYA 3AM5A 3AM3A 1AHHA 2JD2A 1Y8QB 4IIUA 4AICA 3AUTA 1BTOA 2ZJ1A 3ON5A 4NZ9A 2W2KA 3JV7A 2HQ1A 3V1TC 1P31A 2Z5LA 4XDYA 3ROMA 1E3WA 1PJ4A 4S3MA 5G0SA 3V5NA 3QVSA 4AJIA 3OIFA 1MC4A 4E2WA 4R68A 3ZV3A 5IDQA 1HXHA 1H6BA 3SLKA 3UHAA 4MVJH 2IEDA 4CR6A 2VWHA 2X86A 3IJRA 4J7CA 4XIJA 1IY8A 1EVZA 3Q2IA 2X0JA 5JMWA 1BXGB 4BGEA 4YCAA 1E77A 2P9CA 4A7PA 1U28A 2B5VA 4IUYA 1A4IA 4R01A 4W7IA 4AJKA 2AMFA 3CUKA 3EGOA 3JD3A 5DCUA 4F6LA 3LYLA 4IXWA 1AXEA 1D8AA 3VDRA 4CMJA 3UF0A 5C7IO 4LK3A 1LDMA 2QYTA 1GTMA 3SVTA 4HNHA 3NJ8A 4NBTA 3WBFA 5BNFA 3LZ6A 1ZMOA 1GV0A 3DTTA 1HT0A 1E6UA 1Y7TA 4LRSB 4QX6A 3DTYA 2FPPA 3GA0A 3I1JA 4WEOA 2UUPA 4ALJA 5L7TA 3JD0A 4WLUA 2A94A 3RUDA 3FWZA 5BSEA 5C5IA 2AE1A 2CF6A 2E49A 2BFMA 5GY7A 2H1SA 3RWBA 5ER6A 1GDHA 5EESA 5FF9A 1ENYA 1NR7A 1Y5RA 4CUJA 1MGOA 4Q39A 3WIEA 3GG2A 3HZZA 1X7HA 1GPJA 3SJUA 4J7UA 2B4RO 1V3TA 2X23A 4E21A 1U8XX 5ER9A 1DIBA 3ROKA 4M49A 5L4SA 2HCTA 1XDWA 3SLGA 4W9NA 1I2CA 3VH1A 4IDFA 4II3A 4UEKA 3UUWA 4IINA 1LDBA 4H7PA 4NH4A 3T4EA 1U3VA 2EKLA 3BTUA 3DOCA 3F3SA 3M1LA 2OZPA 2PY6A 5HS6A 4NBVA 3QWIA 4WCDA 4JJGA 1YB1A 4CODB 2WE8A 4HWKA 2FR0A 3K2EA 3ASUA 4WK6A 4I5GA 1OBFO 1MFZA 4JN6B 3DAGA 4K1LA 1E3JA 5GZ3A 1B15A 1I01A 3MWDB 3TFQA 5L40A 5A06A 3PLRA 2O2YA 4INAA 4Z9XA 2FRDA 3HWRA 1GPDG 1MB4A 1NAHA 3LLVA 3PWKA 1E5QA 2I67A 3CH6A 1VI2A 1ADBA 3Q6IA 4TSKA 4X54A 2W4QA 5IAAA 4WNCA 4IZIA 5CDGA 2VT3A 1E6EA 1E3WB 1YBAA 4YDRA 4Z0PA 4Q3DA 1DAOA 1YQDA 3TOZA 2GDZA 1TVEA 2X22A 2AXQA 3U3XA 4L0QA 3PQEA 4BNJA 1YH3A 3QV1A 4LRTB 2DFVA 4PLGA 2F1KA 3V1UA 3WQQA 4BMSA 1DHRA 4FQ8A 4A5OA 1PZEA 2Y05A 3CTMA 4OOFA 5DOVA 3WYEA 1D7OA 1J4AA 3MJ4A 4BO3A 4MIEA 4DIBA 2OGUA 3IIEA 1DRVA 4GL4A 1KYQA 2DBVO 3VZRA 4YAIA 1BVRA 2A4KA 1W8DA 3F47A 5DP2A 2IDZA 2IE0A 2PD3A 3WWYA 3D5QA 4MIOA 3ZNPA 2JKVA 3ORFA 1OMOA 2I3AA 1I33A 3FWNA 3QVTA 1MUUA 1KOLA 2X7HA 5TQVA 3ULKA 2DUWA 5DDIP 1R12A 3ITKA 2BMAA 4CPDA 3OQBA 3O38A 4J7XA 1HKUA 4TRJA 3ONFA 1IE3A 3L9XA 1ONNA 3FNHA 1L1FA 1XKQA 1K0UA 1EVYA 5CHEA 3OEWA 3AY7A 3M1AA 4Q3AA 4U0JA 1A7AA 2ZTLA 1F14A 1Z82A 1PR9A 1PWZA 4BNMA 1VL6A 2FY8A 3CE6A 5U1PA 4KQWA 2O4CA 2HU2A 1HEUA 4ND1A 4OHUA 4BHTA 4CV0A 1EFLA 4XGNA 1EDOA 3F1KA 3MZ0A 4YJHB 1ZFNA 4J4HA 3ZU3A 1R0KA 2BGKA 4XX0A 2GZ1A 3BMNA 5BSHA 2JFFA 2HMTA 1MV8A 3KO8A 1R15A 4IS2A 4R3WA 3ZZNA 1D1SA 1P1HA 2PKRA 4YT5A 5DBGA 5JCJD 2YV1A 3I4FA 3RROA 2GF2A 4BNFA 3OEYA 4DYVA 4EBFA 1K6JA 1GEGA 2VHWA 4IDAA 4J4BA 3WMWA 3ANLA 4LN1A 3DQPA 3ZHBA 3RFVA 3RUFA 2H63A 2J6IA 3PK0A 2JJYA 4JX8A 3JYQA 1LU9A 2DLDA 1H2BA 1OFGA 3VVCA 3T7CA 5KNLA 2I3GA 4L73A 4XD2A 1KVTA 3RKRA 4OIMA 4GX1A 2PV7A 4RVFA 3VPGA 5TIIA 3MJVA 2Y1EA 4P4GA 4MP3A 4CM8A 1LSOA 1DJNA 1PS9A 3E18A 3JYLA 4Z3DA 4WLOA 4CLEA 2HLPA 2DTDA 3VAZA 2FWMX 1BDBA 3GVHA 4AL4A 1MLDA 2PK3A 1P1RA 1E0DA 2DKNA 4QO8A 1I24A 1RPNA 3JD2A 3AOEA 3AY6A 1H5QA 3ENNA 2DQ4A 1KY4A 1HDRA 1NHWA 2BRUA 3QE3A 4OO3A 3KLMX 4Y8VA 3QHAA 1B2LA 3FBTA 1E7QA 1I3LA 4BVAA 1P9LA 2J3JA 4XGKA 5T8KA 4AJEA 2QHXA 1ZZEA 1L7DA 1T2EA 3KV3O 1X0VA 3O8QA 6ADHA 3D4NA 2Y1CA 2Y68A 4E4YA 2O3SA 1X7DA 5CFZA 3CMCO 3PYMA 4I8XA 4KTTE 3VTZA 2B4TO 1KEPA 3PYLA 4IQGA 4GWKA 2Q3EA 2NU7A 1UXGA 3N58A 5BNIA 1C1XB 3KEQA 1NPTO 3RBZA 3GF4A 4JP2A 1F17A 1LNQA 1QV6A 3WYCA 2Q2WA 3IS3A 4Y9DA 3WQRA 4U6QA 2VOEA 4EUEA 5DULA 3Q9NA 2X0IA 1FK8A 3PVZA 1NWCA 2VWQA 4JXKA 4W82A 5L4NA 1YBVA 2P4QA 4YT4A 3PJGA 4I5EA 1KEWA 3VVBA 4CV2A 4EJ0A 5JO0A 1MA0A 1M6HA 1IB6A 2YHIA 1FDUA 2D5CA 1VKNA 1YL6A 4B8ZA 2X9VA 3A14A 4OM8A 3U62A 1KC3A 2BFAA 2OUIA 4OSPA 4CM4A 1Z45A 4G65A 1ISMA 1XU9A 4ZD6A 1FF9A 2DBZA 3FHLA 2WTBA 2C7GA 1BDMA 1VPDA 1DIHA 2AHRA 2B36A 3BMNB 1WNTA 4RF5A 4MDHA 3ZWNA 2OBYA 4YAKA 3I6QA 4RDHA 5TJ9A 3WFJA 2BFOA 5A04A 3VPHA 2IXAA 3KBOA 3INTA 5L4LA 3E48A 4IS3A 1OC2A 3VKVA 2O3RA 3NDJA 1A71A 1UXIA 3KETA 1GY8A 1B0AA 3BYZA 3OA2A 1CWUA 1NFRA 2HK9A 3KM0A 4XWYA 1EUDA 1QG6A 3F46A 1XHLA 3TZQA 4EEZA 2O3UA 3PI7A 5ITVA 2EKPA 3JQ8B 3HG7A 1AGNA 4UUPA 3WB9A 3QJ5A 1DC3A 1KIFA 1ID1A 1DJQA 5JBIA 1DFHA 2ZYGA 3GY0A 1Q2XA 3ROPA 5A4DA 1N2SA 1DLIA 3GHHA 1YDEA 4CM8B 3JQFA 3E5MA 4MIYA 2ZQYA 3FN4A 4OKNA 4W99A 4E5KA 1EDZA 4FBGA 1I36A 3FPCA 2NVBA 5COQA 1EUCA 4XRGA 3S2EA 4J1SA 1B7GO 4PZDA 3U4IA 3D4PA 3ZI0A 5L7WA 3DBVO 4B4OA 3KTDA 4MVJF 4UREA 4EI2A 1SZJG 2I65A 1PL7A 4L74A 1PJBA 5BQFA 4KP7A 4Z0TA 4B3JA 4MVJD 5IZCA 2LDBA 3JQAD 3KRTA 4ZQBA 4BNLA 1T24A 4ID9A 4QTZA 3D5TA 2EP7A 3OJOA 1PS0A 4Z9YA 2A92A 4EW6A 2GO1A 1VKOA 5JDCA 4TKLA 4D41A 1ADCA 2PZLA 5G4KA 5C7LO 3QWBA 1TT7A 4DWVA 4J90A 2EGGA 1JVBA 4BGUA 2P9GA 4K6FA 3ZHYA 3GZNA 5JY6A 4TQGA 2C54A 3PGJA 5EJ2A 4ALIA 4DIFA 2V6FA 4J49A 4AJNA 3IQDB 4WCFA 3NGLA 2O50A 1PSDA 3HSKA 1ISIA 4PLVA 2UVDA 3G49A 1EMDA 4PLCA 5EQFA 2NADA 5K9ZA 1V0JA 3TNLA 4BKOA 4ZQFA 2AE2A 2QQ5A 3H8VA 1NTOA 3DO5A 1NP3A 1HLDA 3JQDA 3PPIA 5KVCA 1YRLA 1FJHA 3E9QA 3QRWA 4GH5A 5BR7A 3DZJA 5IXYA 1S6YA 5JAMA 1GCUA 1IUKA 4E6PA 1CIVA 1Y6JA 2YHIB 3KB6A 4RLHA 4BV8A 3RFXA 2D0IA 4NR0A 1R4NA 4CM4B 1T26A 2Y67A 3D7LA 5B37A 1DRUA 4PLTA 1E6WA 2UYYA 5IZ4A 1ZVMA 3NV9A 1N8KA 3LC1O 4CLOB 4HNGA 4R3NA 5CAEA 3WYBA 4UUMA 1X0XA 1HDXA 1Z6ZA 3LF2A 4W9NC 5JAIA 3UFXA 1BW9A 3MJEA 1GZ3A 3GVCA 2PZMA 3FF4A 1E3IA 3C8MA 5MGBA 3EC7A 5I7SA 1UDCA 4GLLA 1DHTA 4ZQGA 4B7UA 2AW5A 5DT9A 3UN1A 3K6JA 1DXYA 3LT2A 4B4UA 4A03A 4MPDA 4FSHA 3WGZA 4OXKA 5CDTA 4XYMA 1NM5A 2VRBA 4YRBA 1PGJA 3U5TA 4CQMA 3HDYA 3L0DA 2NWQA 3JYNA 3M2TA 5BNTA 1U5AA 4PLHA 4Y6SA 4JNKA 7MDHA 2GNAA 3NGXA 3U9LA 2BI7A 2G1UA 4LVCA 1EVJA 3OIDA 3SBOA 1CDOA 1UAGA 1HDGO 2C29D 2HJRA 4KTVE 4DRYA 3D4OA 2DC1A 3H5NA 4B7CA 2V6MA 1BRMA 4IMRA 2JCXA 3AW9A 5DF1A 3ZH2A 1D4FA 2YZ7A 3DMTA 1LDGA 1T4DA 4IBOA 1CETA 2GN8A 4XGIA 5JFOA 2FHSA 1EVIA 4CM9A 2NM0A 3EVNA 2OFPA 1LRLA 2GRAA 3AUAA 2C2XA 5T6BA 3S2IA 2VHVA 3H65A 4D0RA 5CEEA 4BNGA 4R5HA 3FSRA 1YOVA 2HMSA 2Y66A 5G4KB 4UUOA 5IDXA 4E30A 3FI9A 1B8PA 4M8SA 2B0JA 4DXHA 1DDOA 3KHUA 1VL0A 3GZNB 5EPOA 3AU8A 5ICSA 4GWGA 4R9RA 3L9WA 2GERA 3GNQA 4OQZA 1LLDA 1VC2A 3OJ0A 4A27A 5LC1A 1N1EA 3JCZA 3F4BA 3GDGA 1F0YA 4WCFB 1P1IA 5JPIA 1Q7CA 4LGVA 4YJFA 4GBJA 2B5WA 4OL9A 4RVGA 3V2UA 9LDTA 5B12A 4KUHA 3RFTA 1IULA 1NVGA 2NVWA 2QRKA 3EZLA 3JD1A 1P44A 3VZSA 1YQGA 4MVJP 5A03A 1LJ8A 1B3BA 1U3UA 4JBGA 2GZ2A 2V6BA 4JP3A 4RLSA 3EUWA 4FPXA 3ZV5A 3DR3A 3WOHA 4PVDA 3ADOA 4MVJA 3JQAA 4IGEA 3PTZA 3FNEA 3LDHA 4XB1A 1R4NB 3BTSA 3RBVA 4DQVA 2YQ4A 4GGOA 2O2SA 4NHEA 1DB3A 1GADO 5CPBA 1RM5A 3DAFA 1UR5A 3GC6A 4GGPA 1QXSA 3ITDA 3GVPA 3DZHA 1LQUA 1VJ0A 4M86A 2Y0DA 1E7WA 1M6WA 4CR8A 3DBRA 2CZCA 4BO6A 4EGFA 3TFOA 2NTNA 5JC1A 5B1YA 1BW9B 4YYZA 2D3TA 3I9MA 5KWEA 4BNNA 4E32A 1MG5A 3H5AA 2CD9A 5ENVA 1NQ5A 3QLJA 1QLHA 4OAQA 3ZWBA 3CMMA 5ICMA 1UP4A 3GQVA 1HE4A 3SJ7A 3GAFA 1EQ2A 1GQ2A 3QY9A 7ADHA 3DONA 1NPYA 1ULUA 2UV8A 4H15A 1NX6A 4I1IA 4KUEA 5DCWA 4CQMB 4I08A 2EWMA 2OORA 3DBHA 1H6CA 1JN0A 1W4ZA 4R5MA 5G4LA 3K96A 2PGDA 1SOWA 3E9MA 1ONPA 1F8FA 3NT2A 5DZSA 4MKXA 2X0RA 1CF2O 5I7EA 3R0IA 3AFNA 2HAEA 5I7VA 4ZJUA 4J9UE 3Q3CA 3ZWXA 2DAPA 1TI7A 1XG5A 2NVUA 4OQYA 3OA0A 1IHYA 2EKQA 3AOEC 4KZPA 3DZBA 1RYDA 2X4GA 1Z73A 5TT1A 2FSSA 4R9SA 3L4SO 3FBGA 1NFFA 4E31A 4J1TA 5A05A 2RIRA 5JAZA 3BA1A 4BNHA 1IPEA 1EK6A 2VYVD 1ZH8A 2DUUA 4XYBA 3UCXA 1QYDA 3MCVA 4R16A 3I5MA 3BMCA 5AXDA 5T8KC 1YOVB 1GD1O 1X14A 4ND2A 2W8ZA 2A9FA 5DN9A 2OO5A 3RIHA 1XGKA 2Q50A 4J43A 4BV9A 2PNFA 3ZV6A 3F4LA 3DHNA 3ZWOA 2G82A 4R69A 2ILTA 1X7GA 2GN4A 1DBVO 5A3VA 5TGDA 3LC2O 3S1LA 3U4DA 3GT0A 4YT2A 2C0CA 5BT9A 3GDOA 1E92A 3ONEA 4YJFB 5F3RA 3INGA 1NXQA 1IPFA 2YHUA 4OGWA 1ZK1A 1AXGA 3IL2A 1U9JA 3NUGA 1P1JA 2IZ1A 2FZWA 2Q99A 3PQDA 4NBUA 1F12A 1O5IA 4BO8A 2YFHA 1U3WA 5TS3A 1PJ2A 4NBWA 1NR1A 4BMVA 2GLXA 1ISJA 4YAEA 1JQBA 2DT5A 3Q2KA 4TVOA 1T2AA 1RYEA 5JS6A 1LTHR 1K2WA 2ZTMA 3RC1A 3LC7O 3QA9A 2VNSA 2HMUA 3SEFA 2HO5A 4YR9A 5JE8A 2JAHA 1YJQA 3DFZA 3QVXA 5KIAA 3H4VA 3DBRB 3WXBA 2XPCA 4WPGA 4J16A 1G6KA 5DNAA 1UH5A 1JKJA 5JYDA 1GFSA 1JWBB 3KYDA 4UAGA 4C7KA 1PEDA 4CMIB 1AHIA 2CFCA 4U6SA 4QUKA 2E6UX 2H6EA 3D3WA 2X5KO 5FI3A 1ISFA 4FFMA 3EW7A 4MO2A 2HDHA 1GZ4A 1A5ZA 2GYYA 2RHCA 5A02A 2CF5A 1M75A 5THQA 2BGMA 2YW9A 1T4BA 2EW8A 5B4TA 4WNIA 3ZHZA 4EUHA 5KKCA 2QW8A 1VL8A 2A35A 2YY7A 1ZK4A 3RU9A 1P33A 1ZSNA 1XQ6A 2FR1A 3DBHB 3HADA 1U1IA 3PHGA 2EV9A 4MVJG 3UKOA 3LU1A 4Y98A 4E2ZA 2HK7A 4OSOA 5HRUA 4NFHA 1ADGA 1H6AA 1PJLA 3X2EA 4N54A 2C5EA 4Y67A 3JQFC 1J0XO 3PP8A 5HWSA 1KBZA 3W6ZA 3V2HA 1P1FA 3IUSA 2W2KB 4DREA 1U4SA 4O1MA 4RPGA 2AG5A 4RVUA 4KMSA 5F5LA 5KJEA 3WGTA 2ZQZA 4D7AA 5B4UA 4OH1A 4E5NA 3A1NA 1VE9A 2P2SA 4GSLA 2NVUB 2GUGA 4HBGA 5KJFA 3PIDA 4UVHA 5JY1A 2FN7A 3RVDA 1OOEA 4CM5A 1N7HA 3DFUA 4J1NA 4L8VA 2CDAA 5A9SA 4HUJA 1V9LA 4DLBA 1PJ3A 1YONA 5FEUA 5IZCC 4ZGWA 3AUUA 1ZXLA 3MOIA 1G1AA 2HSDA 3BMCB 5JDCC 3OHSX 3EZYA 4DPKA 2P5UA
chains in the Genus database with same CATH superfamily
4BWFB 2QY6A 2IQ5A 4BFSA 1GAEO 1DDIA 1DUIA 4ZOEA 1ZAKA 1F3OA 1ZRHA 3GFFA 2J3IA 4DADA 1T0UA 3JYOA 3SR4A 1UADA 4BAGA 4BQQA 4U00A 1LZLA 4P4NA 4H4EA 4IL5A 5LD2C 3TZ6A 2XCRB 1FNSA 1OLUA 3HVUA 1XL1A 1QDEA 4JLOA 3L0BA 4L51A 4G0OA 4UM8B 2PE5A 5EMHA 1HZJA 3KP1A 4PZ9A 2O1XA 5B2ZA 3ZHSA 2Z95A 4TZTA 2EFJA 3IMCA 1ZM2A 4B84A 3HNPA 2WJVA 4FU0A 4NYJR 1QS0B 2R2GA 4KBYA 1ECCA 4N48A 4JUBA 4HGOA 1ZCFA 3BK1A 4K28A 2QVXX 4EENA 3ZWVA 1P0PA 2FMKA 1JU9A 1PUXA 4YTEA 2ZITA 2UXBB 1RT9A 2IHYA 3JARA 1UMCA 2PJUA 4R8RA 1YS7A 2RBKA 1X1AA 3NZEA 2IUYA 2PKEA 3WBBA 2ONJA 1E0JA 3TZHA 4BX9A 4FS3A 3URMA 4DC0A 2H00A 5KDDA 1H3FA 3B51X 2IFTA 4NAVA 5LZ4A 4PYIA 1O6CA 1JG6A 4N3GA 4O6VA 1T3GA 3LO8A 1XMSA 3EFBA 1X13A 5EHIA 5KYVA 3S2YA 2DBRA 5FTKA 1C1DA 5IJ9A 3V3KA 2UYHA 4BGDA 3IEUA 4ZCTA 3EPJA 4G97A 3CB4A 1OQAA 2NO0A 3V46A 4WBNB 3K0FB 4PHTA 4KFTA 3NWEA 3PHHA 4GR4A 4FDMA 2K4MA 1OTYA 1KTIA 4GI5A 1QCDA 4JQYA 1LGYA 1GZSA 1VKHA 2YFQA 2O3JA 1T91A 4HP8A 2P1RA 3SYKA 1JLMA 2RCYA 1C29B 2ORWA 4IDCA 2QGNA 5CJ2A 4DTCA 2QYSA 2XMSA 2QJOA 3JRWA 2IITA 3QUQA 1VSVA 2QTZA 3SQLA 1K89A 2D2XA 4DMRA 5BW8A 4HAOA 4JNCA 5HS4A 2HA2A 3EVFA 3U7RA 3E8XA 3KKNA 1P6UA 5FUWA 5SYMA 3KKZA 1JR3E 3GLGA 4DM4A 4C0QC 5E2AA 1YUNA 1AUVA 2PUCA 2A3NA 4DUYB 2WKQA 3REFA 3ZGLA 3CW8X 4YJDA 4QJ4A 4CM7A 1KNQA 1QHFA 3P96A 4IDGA 3TLAA 4J0JA 2V7PA 4CIAA 4F93B 3PT9A 4BKPA 3IBFA 2FEWB 2ZCVA 1M67A 1N6HA 4Q19A 4QEZA 5DBFA 4ARBA 1SU4A 3BB3A 3IHTA 1JS1X 3NAMA 4NICA 4DBLC 2BTQA 1G7CA 1ZNWA 2R47A 3RS8A 1T5OA 3G2IA 4TS9A 4JGIA 4RKYA 1L7EA 1T6NA 1E3EA 3G82C 1DRJA 4PBRA 2QE6A 5EPEA 1YE5A 2H5JA 2F3PA 4RD1A 2RHOA 5ENDA 5IXSA 1UT5A 4A6PA 1O95D 1FBNA 4BAUA 5JSUA 3WWEA 1Y48E 1ZHFA 1KZ1A 2DPGA 2ZPAA 4G24A 5EMMA 4LYYA 4WXEA 1R0LA 2D1YA 1XUOA 3QY0A 3VOSA 1HLGA 1GT91 1T2NA 5A9RA 4YP0A 3ROQA 4R1SA 1AKRA 3CZ9A 4GXNA 4RCYA 4Q1DA 3EMBA 2QUAA 4HGNA 4WA7A 1Z37A 1M34E 4NVRA 1YR9A 2VS1A 4MR9A 3STHA 3C7TA 3H16A 4L02A 4X95A 4G5RA 2HSGA 3JTMA 4XCVA 4ZOAA 3S99A 4TROA 3WA6A 1ZK2A 5DBOA 2QWXA 4X60A 5CITA 4A15A 1RJEA 4KI7A 3EVCA 4EZEA 3MTAA 1SBTA 3QUTA 5BSRA 3T7JA 1ZJZA 2QI9F 4A82A 1DEXA 1PJZA 1OY1A 3HRKA 2B34A 1OVGA 3P0RA 3E2PA 3V9AA 5K4HA 1P5FA 4DMHA 4RJLA 5AUQA 1V4NA 4ZZ1A 3BKXA 4R71A 4DDVA 2VDJA 3DL4A 3K8OE 1G8FA 5CCEA 2OECA 5EERA 1OAAA 3BDAA 2RFLA 1RR6A 1QRSA 3IBYA 3VR0A 4BQSA 1H0SA 1N0VC 1POWA 3AHCA 4D8VA 1ZA1A 3RSCA 5C8XA 2H57A 5T5QA 2O3QA 4BBAA 1FVOA 1Z8FA 4KR0A 4PTYA 3N5CA 1B43A 1P29A 1OUMA 3W3AH 4PPNA 1IU9A 1YR3A 3HWX1 4YQZA 2FI1A 1G9TA 1JVNA 5D6OA 4BLTA 5AW0A 3QVOA 5KVVA 2FWPA 3BRSA 1FVXA 3G6KA 3GBSA 3K2BA 4Y2TA 5ALIA 5E1OA 5KTMA 3BFJA 5B1EA 1DQZA 2WTMA 2QLLA 3AT1A 3KR9A 4LQ4A 4QULA 2QXYA 5JASA 4JBHA 1TUEA 3PUWA 3F7NA 4LNHA 5K3AA 4MRAA 4F4IA 3RAGA 2PUDA 2UUBB 2KSQA 1XTKA 3QBJA 3H0KA 5DM1A 2V7UA 3GRYA 4H4CA 5BQ5A 4DCPA 1Q1GA 3QKWA 2IOQA 4NE2A 1TA0A 1VE5A 1XWFA 1Z15A 1RM3A 3RT1A 2FPMA 4C4ZA 3DTVA 3DZGA 5KOIA 2ZBFA 3PUJA 1SHUX 3TGWA 1LVUA 2OY0A 3A2MA 3T3GA 1KA9H 3UJPA 2WBLC 1Q0TA 1M2OA 4FZJA 3B53X 4ZO4A 2PWYA 2I6GA 4I6EA 4M1TA 4W1PA 1BDJA 1VFPA 3VISA 3DBLB 4NFLA 3VR4A 1RKVA 5KUTA 1A04A 1QR6A 2IYUA 1HDOA 2B2CA 4QFBA 1BHQ1 2VK4A 1QHEA 1GNSA 2HUNA 4HOYA 2P2DA 4I5FA 4Q4HA 4RETA 5B3JA 1UWCA 1WPGA 1XTSA 2OAEA 2AKEA 3AJDA 2HKIA 3NEAA 1PFWA 3D7RA 3MS2A 4RPHA 5C3MA 2NUTA 3HE3A 4N39A 4TV8B 3ANTA 3R74A 1XTBA 3R3UA 3G0DA 3STXA 2E4XA 1Y6ZA 4HXFB 4L15A 3BSFA 3IP5A 4EJSC 4RYDA 4P0TA 5DNDA 4ZAXA 3IJPA 3A9TA 5CVUA 4BTVA 1QU3A 4JLKA 3ROZA 6REQB 1SKYE 5JSFA 1AKYA 4NMMA 1JECA 4W8OA 3UWOA 3ZHOA 1KF0A 5HW0A 2ID7A 3T41A 2PWAA 4RFLA 1F4PA 1W87A 5J4YA 3THXA 3WKCA 3FPAA 3BBPA 4NNJA 1A9XA 3V34A 2CYBA 1PWEA 5LA6F 2WG1A 3EFEA 1DQSA 3HZHA 5DIZA 3O8OA 1R3DA 3GFGA 3KUXA 4GNRA 3EPRA 1KP2A 4OP2A 2GN2A 3L7YA 3OE5A 4MI3A 5IHXA 1ZH2A 2QQEA 1EDDA 2XUFA 4WY5A 4DT1B 2Z6AA 1UZNA 1LPMA 5TPZD 3NC1C 2HPVA 4RKWA 4LUCA 2ODTX 2W48A 1NU6A 2NZYA 1N3IA 3GPDG 3NCTA 4JU9A 3R9KA 2BFBB 1PGOA 4CEHB 1GPUA 2ZETA 5EJEA 4U2DA 4OKSA 3DE2X 1S8AA 3PQ5A 4YWJA 4EGQA 5FWNA 4G5XA 3R7LA 3TLBA 5HF9A 2CUTA 5CIWA 2H8GA 1EGQA 5TGTA 1QOQB 2PX4A 2QTNA 1YFJA 1FDOA 2X58A 4MLZA 1KJ9A 1RBQA 5KWSA 3F6CA 4ZPXA 2OLJA 3JXEA 2J32A 1ZA2A 5CYOA 3RU7A 2B82A 4MRSA 4TWBA 4B43A 2I76A 4FJ2A 3OZWA 1Z0AA 2J3KA 2H29A 4RHFA 3DMHA 3Q3GE 5F33A 3BFPA 2AUMA 1VI5A 5I7HA 3MWEA 3OJXA 1M1YE 4IXTA 1U8FO 3L1KA 5AP9A 3UAGA 2C42A 4Y6PA 4Z4FA 1FFXA 3G9ZA 4M9RA 4NYIR 4OJYA 5TVGA 3PQ4A 2HXGA 4HDQB 3PNKA 5DNEA 1J9ZA 1U7OA 1R4MA 4O2BB 5HK8A 4GW3A 3C6YA 4HGQA 4EQZA 1U7TA 3B6JA 4PONA 4JP8A 3RSLA 3BDVA 3SJAA 4EZBA 4EKYA 4AKHA 3T1TA 3FWHA 2AEFA 3PJFA 4WZAE 2A6PA 1P2UA 2AQ8A 4J16C 4ZALA 4TMXA 4AY4A 4YRMA 3COJA 5BMVB 1OIVA 2JIBA 2DULA 1EUYA 2X3YA 2IUUA 5JXHA 1MV5A 3ZGNA 1AE1A 2XXJA 5KOJB 5DYYA 5FNZA 3GT3A 2DG2A 5ALYA 1SUWA 3EVBA 1DAHA 4TN5A 4GPBA 1FSSA 1BN6A 2FU5C 2FVYA 2JATA 1V5GA 2O48X 5LDGA 5KSYA 4FE3A 5CD1A 5EN4A 2VAPA 3JZMA 4DZTA 1C2YA 1U2ZA 3T5CA 3WK8A 3CVOA 2Z2IA 3DFKA 2IDKA 4AVYA 2PR7A 3A1SA 4E5UA 2YNMD 1O0BA 4V3CA 1LPAB 5B58C 3V6LA 4UQLA 4MQFB 3T7DA 3VHXB 4IKEA 4H60A 1VE1A 2UZ1A 3OIVA 2VDRB 2WE7A 2ASVA 2SICE 3BQNB 4HNAB 1ETUA 2WNHA 1QVWA 2W93A 5DW0A 4AULA 2WDPA 1JRLA 3VR3A 1EHYA 1MRZA 1VDZA 2P35A 4QFDA 5BR8B 2FE1A 3CVVA 2NYUA 3H6KA 1H2ZA 2WFLB 1EUCB 3OUZA 1IPHA 1Z6YA 1OASA 2CXXA 4PIVA 4QA9A 1TA4A 3H9BA 1C80A 1BEEA 1A1VA 1E61A 1FDWA 2EYUA 2Y27A 1GUBA 3LVRE 2DMRA 3PC6A 2JGAA 4P0PB 2PZKA 2VBGA 4W7HA 4KXMA 1FDRA 1JLLA 2TMGA 1PU2A 4PICA 4DIDA 6Q21A 5K6TA 1O96A 1W0KD 3ED5A 3P9NA 1MJHA 4HLCA 2CWDA 3L7JA 5CEJA 2B1QA 5CX1A 3E15A 3J81A 1FMCA 3G3EA 3GVIA 5EQDA 3I9V6 3N8IA 2HCBA 4L6IA 4WWHA 3SX4A 1HE3A 1X94A 2D5BA 2XMZA 5F1OA 2WDZA 4ZCRA 3NP7A 5C31A 4G5QA 3OMXA 4L8GA 2PJDA 1J5PA 621PA 4EYQA 2V55B 3ETLA 3NALA 1VMEA 3CU5A 5LPNA 1HT1E 1MNAA 2RBGA 2GAOA 4YQFA 2Z58A 3F74A 1RXVA 3KDAA 4Q3KA 4A36A 3DWGA 4WLVA 4UHBA 4KWIA 3BH7A 2QT9A 1EYZA 2FSVC 1S2DA 2A7XA 1P18A 3ZOKA 3IQWA 1LLQA 1CY6A 5DWQA 3EPLA 4ZZIA 4OLAA 1VXRA 3RU2A 4JB8A 1K6XA 4E5PA 2H7VA 1J2UA 2XT6A 3K9QO 3WNZA 3QE0A 1PD1A 5REQA 1JKIA 1R64A 2FPXA 1ND5A 3H5OA 3R41A 3DV2A 4JMLA 1KI2A 3UVEA 3GLGE 4NK5A 5LCXA 4QLOA 1RQNA 1CS0B 1SXJC 1NN0A 3AHHA 1IRXA 3MAGA 3OCCA 3OWOA 4G5HA 4ZDIA 2JHGA 3OICA 1JTEA 3HUUA 3IP1A 1JUDA 2H48A 5LMNB 1W5SA 2PLAA 2BP7A 1R74A 3GZ4A 3BQMB 1DADA 2RG7A 1TM5E 4QPCA 3DE1X 3B1VA 3EH1A 2GCPA 5HM6A 1Y8RB 4LAFA 1RKBA 1Z39A 3RYIA 4ME6A 1C9EA 1GRVA 4YCSA 1RU3A 4YUXA 5K3EA 1L4LA 3KJIA 5EWMB 2YFYA 1UP6A 3QKIA 3P27A 4CUZA 2W42A 2EQBA 5DHFA 2HCFA 3W77A 3DDWA 3V1LA 1E1QA 4D43A 2FAXA 3WICA 2BI8A 4OHRA 4LVUA 3UA3A 4WK0B 5L3RA 1NOJA 1H8HD 3VU0A 3AI3A 5A6VA 4CXMA 3IOYA 4DLRA 4EUNA 1G9SA 3CSSA 1BZYA 1XCJA 3OESA 3VYSB 3QF7A 5ALVA 4RMJA 1M8GA 1J7KA 4RXTA 4Z7NB 1IBCA 2VHXA 1GL3A 3L41A 4RA9A 2ANBA 2OP0A 4ZGBA 4ZI2A 3SIWA 4DNQA 1CUXA 2KM1A 1XZGA 4EUFA 1XLTC 1X92A 3LKBA 2LXNA 1CUHA 1H1TA 3W2TA 2YZKA 4MZDA 2WUWE 5EXEA 1QHXA 4KVZA 3GCDA 5IAOA 4KREA 2QUBA 2BM8A 3F98A 5ERXA 3ZWKA 2O8CB 5LDDC 1HTBA 2QAGA 4TZ0A 1DAEA 1JP7A 1IG0A 4QIHA 3CH4B 4IWXA 3D0RA 3ANNA 3SOPA 2FEKA 3BWYA 4OB8A 4X24A 2VRCA 5IYZB 2XEDA 1R5OA 3HU2A 3JVIA 3V8RA 5C1OA 3A0UA 2H9AA 4JK3A 3ZY4A 5LLTA 3TI7A 4E5MA 3H1FA 1TT5B 1JEQA 5KDOA 1YDGA 4LS3A 4ROSA 1R0ZA 2ZIAA 4F84A 1ZLYA 1HY3A 2QN3A 2YJNA 4US1R 3GMDA 5B7NA 1FXUA 1ML3A 2GA9A 4I7EA 3PQFA 1CUYA 3QLUA 3IVCA 3P52A 4CT0A 3ETCA 2GB4A 4O63O 4PINA 4V0OA 1USKA 3H1GA 4MUGA 1F4LA 3ZZTA 5CVCA 1I4TD 4L2IA 1V8ZA 3OAAA 3H2ZA 3PIIA 3RTCA 4ALNA 3FMGA 3ZE6A 3NX4A 5F7JA 4OCZA 5D00A 3DLAA 5FTLA 3S8EA 3TMAA 4MV4A 2WD9A 3UTDA 2QYOA 2Q6KA 3AVQA 5JNRA 3QQPA 4ZRMA 3IDFA 3PNYA 2MCFA 3RD5A 2O4UX 2QNBA 1M1NB 1LI7A 4I36A 1I6MA 3BD7A 1GZUA 4R1NA 3I64A 1JR2A 1LI4A 1YJCA 4Z0NA 1X15A 2UVPA 3RIYA 2GBCA 4C2BA 4YJ3A 2HLDD 3BHNA 1IVYA 2NUPA 5HPYB 4DV1B 3GLRA 1VKZA 3MJCA 3KTFA 4HH3C 1GT6A 4M0UA 4XIYA 5DYNA 3T7IA 3F9CA 3H8SA 4Z54A 4P84A 3ORSA 4IVNA 3U60B 4QUEA 2GA8A 3DH0A 3T5PA 3RWOA 1E6LA 1A2QA 4MV8A 5D51S 3WLEA 3R9XA 4W7SA 1Q1QA 2QRMA 1IXKA 1CHDA 1K63A 1WL8A 4RWZA 1W46A 2Q2QA 5DEIA 4E3ZA 4QICA 1R6AA 3B3JA 3EVTA 2OV6A 5FIUA 3C6ZA 3UHFA 4C4RA 2AZTA 2CT8A 1BJKA 4RGBA 1W2WB 3DZDA 3FGZA 3L1UA 2QTTA 4OU4A 1WZIA 2I87A 1CQPA 1EK5A 4OATA 5AHOA 1TEHA 3C7AA 4BNXA 4D3SA 4YQYA 1DKQA 1SKQA 5C52B 1EX6A 1U0SY 2Q28A 3CNBA 3IKLA 2OV2A 2PTGA 3GJ8A 2XE6A 3I2HA 2WT9A 2Y2VA 3AEUB 2C4KA 2FLWA 2I99A 1UDAA 3B9PA 3OQ1A 4G41A 3HKCB 4KHZA 3WWDA 5KHLB 3MAJA 2FG7C 2ERXA 1TQ2A 2RHTA 3DBIA 3JRNA 2HLNA 1YWGO 2RGWA 1GP2A 3BJRA 3E1GA 2VZ9A 3MQ4A 4FSDA 4IDQA 4R8MA 3ZLTA 1QE0A 3AYXB 2HA0A 4FNGA 1PFQA 4NK4A 1LLFA 4C22A 1DX9A 4NOMA 3TRKA 1W6UA 4NDNE 4OHFA 4UVGA 3CEPB 3V8NA 4AI6A 2NNLD 3GD7A 1ETHA 2GXQA 1HNNA 4FNOA 1FLDA 1N7GA 1QHSA 4GR5A 5A4IS 4U3JB 2VDQB 3KOYA 3LT0A 4ZP1A 2JJ1D 1Q44A 3G17A 2X9LA 4G84A 1DIAA 2RHGB 2OILA 1J0CA 4F6RB 4UU1A 1THMA 4MP8A 4INPA 5DLYA 4KIUA 3UO8B 1KDZA 1D4ZA 1YB4A 4DDTA 4WN9A 1XQWA 3EY9A 3RF6A 4CQLB 2CJWA 3AR9A 3V48A 1V8FA 2NU8A 1CV2A 2D0OB 1OZAA 3D0OA 3WL3A 1QORA 5T4EA 1SGWA 3C1TA 2VNKA 3IP9A 2GXSA 8LDHA 1H2HA 1ZK3A 4QDTA 2J31A 4QHSA 2I2DA 4MWZA 4FOSA 4F8YA 2ZU6A 4IWNA 4WLNA 1L4KA 1U31A 3D6VA 1JQ3A 4X41A 4UNRA 3ZQ6A 3HR7A 1HL7A 5U9CA 4W5NA 2QX7A 2HWUA 3TGLA 2X8LA 1QK3A 2A1IA 3ILHA 2A8YA 3N2YA 1C3LA 3ABRB 3EXHB 3ZEAA 3E81A 5JTTA 3A1CA 1RWXA 1XLVA 3MD0A 1L7XA 4FCTA 1GUYA 4L8LA 4EHKA 5AO9A 4C5AA 1MXFA 1BEZA 2B78A 4QGGA 2F4VB 4GP7A 2GBLA 5H3CA 1U9IA 4KEAA 3KLPX 2IK8A 2Q1TA 4FMDB 4IFIA 4NNPA 4NZNA 4WKNA 5D01A 4S1TA 3KVOA 3IP6A 1WW8A 4MYRA 4JHXA 4DWWA 1OWMA 1KSHA 4NRDA 5ALSA 4YCNA 3WGMA 3ZS8A 2L0XA 3AESB 1DTEA 1Z8NA 2WFAA 1EFCA 4JH0A 4Q9KA 2HSZA 4GS5A 1E1CB 4B3HA 5LIPA 4LJKA 4LXTA 4J2TA 3O93A 5HIMA 1KVRA 3KOWA 1FZQA 3R8CA 1XTIA 2YHAA 4RHYA 4H1TA 2YXDA 4BMZA 1EM8B 1JSZA 4FJ1A 3FROA 4KR9A 5CUQA 1B1CA 2HF2A 4RK6A 4XWAA 1JE0A 1YE8A 1KMNA 4R4JA 4RQBA 4C2AA 2VSOA 3G2HA 4EMSA 1PYGA 5EZ5A 1FQOA 2ZQ5A 4MJLA 4HQOA 1Z4JA 5AHKA 5ESWA 4B87A 5HIAA 3LPNA 3O26A 3IPRA 1V3UA 2WJWA 1GYPA 4O4LA 2IKSA 4NZPA 2RB4A 2XWJI 4RFSA 3VR5A 1PZGA 1WB6A 2FEOA 1V6SA 3K73O 4DF3A 5HRAA 3VPDA 2WR8A 2IXGA 2ZRFA 3MJDA 4F2DA 4ZXFA 1EB9A 2Q2VA 1E69A 3U0BA 4GDFA 4YRKA 4LY9A 3G9XA 5BUQA 3SC2B 2C7OA 3CUTA 1DSSG 1YGYA 2BGTA 3KSRA 1M7HA 1TEZA 3GRPA 1YR6A 1EFRD 4FLMA 7GPBA 2BGLA 1Z16A 1HQDA 3WK6A 3KWMA 1R8XA 1ZGZA 3ZIAA 1NJSA 4CE6A 3IHWA 3ODGA 1R88A 1OT5A 2QXTA 3GLHA 1G38A 1ZEJA 4RIHA 1UZUA 2GYWA 2GM5A 3C5HA 4ILKA 4Q7LA 5ADHA 4DLNA 3HM9A 3ZCPA 3KL2A 3FPEA 5IS2A 3AL2A 1DKMA 3HJAA 4K9QA 1CQJA 3NHSA 1NMZA 4X3OA 3S70A 3U7QB 2AOTB 4D6YA 4LYJA 4E5VA 2GRUA 4QUAA 5DHUA 2HZBA 3E6AA 2JFBA 2DH6A 4HXGA 1U1FA 1A1SA 1YJ5A 2AFIB 2FPUA 2R5NA 3DEJA 4O02B 5KAPA 4QLAA 2XDWA 1ZVQA 1TMYA 4F2HA 1JWAB 1QAMA 3NI2A 3FA2A 3TR5A 3HDTA 2WJPA 4M60A 3FCAA 3LWNA 4FGZA 4YO7A 2IHNA 1WCIB 3MMNA 4WDRA 4NFYA 1L8XA 2OBFA 1P7WA 1EZ4A 3EDOA 2HF9A 4HAWA 4KXLA 1RADA 3I83A 3NVDA 3QLEA 1XV5A 3SX2A 1VM6A 3UKJA 3VPXA 3WRYA 1JHXA 2EIHA 2OR3A 3BF8A 3CLTC 4WASA 2BLLA 3GRCA 3VYUB 4IDBA 3F8SA 3I12A 1U4OA 4REQB 1T9BA 5COAA 5ALNA 5DO9A 3G8DA 1PX0A 4NJMA 3HXOA 1JMVA 2BELA 1UBHS 5FQOA 3WOVA 4B46A 2EBHX 2QY9A 3JQ8A 1M2NA 1TE2A 1X77A 1DJOA 1FUIA 2A0XA 2R6JA 4JASB 4KQCA 2W2MA 3NVKI 4HRXA 2VA9A 1UMBA 2VYQA 3I9NA 1FL9A 4NTZA 4RMGA 3ZV4A 3OKAA 3PD1A 1E5VA 3RQSA 4E7OA 2HSJA 4H0FA 4KVGA 5CFQA 2O2XA 1WVGA 1TW2A 1PUIA 1IMOA 3OE1A 2PX5A 3JQBC 5TJHA 4ZREA 4Z6KA 3ZHXA 3B3AA 2I9KA 1FP1D 4OUDB 2AQHA 2IIQA 3A10A 3JQGB 4HT3B 5KNCH 2Q46A 3KXDA 4KG7A 1N6PA 3VH4A 2IGTA 4B31A 4F97A 5AVOA 1Y63A 3GPLA 4BQIA 3D8SA 3WVNA 4QYWA 1XNRB 1UIRA 1Q3TA 1FTSA 3BMXA 3FOWA 3K9LA 3MPOA 1FXSA 5L95A 2VHEA 4N7BA 3ZGOA 3PC7A 1V4VA 2IYTA 2WWXA 4NQZA 4HZIA 4PZPA 1I3MA 4PN3A 5BQXA 3Q3IA 5F3WB 3HHPA 2RAPA 2BYTA 2QIOA 4I2NA 2C7QA 4CMBA 2GS9A 1C4KA 4LRUA 1PJRA 4DVGA 1PQWA 2OBXA 4EYOA 3QLVA 3WNCA 5AKXA 1BIFA 2WVHA 1E60A 2ADMA 2YYAA 1E2UA 4RKFA 4C3ZA 2VZ0A 2VP5A 3H5RA 4CEIA 3NJ4A 4I4CA 3M9XA 1T5DX 2B4QA 4RSRA 5AT1A 1TD1A 1JHMA 2GZMA 2PSFA 4GEKA 2ZP1A 3DG9A 3FOBA 3QU4A 1N5JA 4JWTA 4KFSA 3WXMA 4D4HA 4C4PA 3KZNA 4HDMA 2WSSD 1IYZA 2C7VA 1NVVR 3RVRA 1BH2A 2IIVA 4BNUA 2XAAA 4J76A 4MB2A 3ZE2B 5LZ2A 3LDGA 2OD9A 2I34A 3AM1A 3P4UA 2WPNA 4B0PA 4E09A 3RRMA 4KAXA 3QXSA 3I05A 3JASA 4C20A 1G21A 4EPXA 3EA4A 4IQ0A 1JT9A 1DJPA 1ODIA 1TM2A 2HU8A 2HJWA 3UZUA 4AO8A 2HBZA 4YYEA 4CIXA 1BVUA 4RH1A 1A2BA 1NR5A 5CB4B 3L0IB 1D7AA 4JSTA 2H85A 1Z2CA 2OG1A 3N8DA 5KJ6A 1Y1QA 3RSSA 5IF9A 3NAQA 1Y5MA 3U31A 4YXWD 3FVRA 1YS6A 1WHTB 3COPA 3RV3A 1EFPB 3E03A 4RCZA 4D9BA 4ENUA 3V80A 4O59O 2XW6A 4JJFA 2OBMA 5ITWA 2PT7A 4S1NA 4HXEB 1RZRA 3A4TA 4ITVA 1OLOA 1X80A 4OFBA 1RBZA 4WUVA 2YYZA 2RGEA 2AL7A 2Z2XA 2C07A 5JCZA 3HFJA 4JC4A 4Q9IA 1MABA 2IVFA 3NTLA 1GZDA 1T3TA 3RC2A 2OM6A 3KQMA 4QQNA 4RF3A 4ZANA 5TXGA 5E1DA 2H08A 3RK0A 3DXFA 4N5MA 2F8MA 1Z6XA 2NAPA 3EN0A 3IBSA 1P7YA 4JY7A 3RJTA 3IMEA 4F5YA 1LPPA 1Q0SA 1W5FA 1Z35A 1KQNA 1IBMB 3RVJA 3TAHA 3QX9A 2QR3A 2PSEA 4YAFA 3IAHA 3TLXA 1DI0A 4JIGA 5G41A 2Q3DA 3QUBA 2J4FA 4R3UC 3WG9A 2FW7A 4ETWA 2H0QA 4WK4B 3FKSA 5I7FA 5L6LB 2XKKA 1P8JA 2OKCA 1N32B 5A9TA 5G3ZA 4XSVA 4BUCA 3GARA 1E9BA 4MW2A 3HJHA 5ALUA 2BT4A 1QRAA 2QTRA 2VSQA 2VJDA 3VV3A 4CLXA 3P9ZA 5JI2E 1SIUA 1N34B 1PAUA 1T4MA 1U0JA 1A5AB 1SUEA 1IHUA 2ZAOA 4H16A 5NLLA 1NKVA 3BCUA 2B37A 5AXBA 3M6IA 1JEYA 3A4VA 3AK4A 2RAVA 4HRYA 2FUG6 4DRXB 1EGVB 4DLPA 2K2QB 3WAGA 4I9FA 4WGGA 3Q3EA 2IHVA 4UTXA 3TSOA 1FCJA 5FUQA 1ILEA 4JGGA 2R6DA 3R2JA 4E13A 5CFMA 1VLQA 3Q0TA 2G0AA 4ND4A 5GZ6A 3VH2A 1PWHA 2NO4A 4XZ3A 1P5ZB 1HYHA 2EL7A 3R4CA 4LGCA 4MQUA 4YREA 4EGJA 1CR0A 1RQRA 1P4GA 1NASA 1U2GA 1XNJA 2EZTA 2X6TA 2FFAA 4F3CA 1BKYA 1JIUA 3R1IA 4F91B 1R5BA 2XD4A 1W4RA 1T4CA 1NRXA 3OTWA 1FE8A 2JHFA 3PRHA 4UOZA 1Q92A 5JC8A 1XZKA 3CT4A 4MUJA 2XXAB 3JATB 4KMOA 4RPIA 1VPEA 2XB2A 4BNZA 1IH8A 1B76A 1I51A 4QGHA 1P39A 1Y4AE 2WYHA 3OMLA 1E2EA 1KGSA 4Y9SA 4EFLA 3W5VA 5A1TA 2VTBB 2J30A 1XI2A 1L5RA 3QWAA 4M0FA 3ENWA 3RBXA 2QR5A 5TEVA 4RJ2A 1RDFA 1ZOLA 2BCJQ 1JW9B 2J5BA 2Z83A 3FSEA 4MUEA 1DNPA 4WQMA 1E8MA 1RHRA 4EB8A 4JGBA 1UPTA 2EKZA 4NV3A 5DGCA 1E62A 2XE7A 5CBKA 1WXQA 4MKHA 1UC4B 1WXIA 3I9FA 1WTCA 3G0GA 1NNLA 5FFFA 2KWIA 4QEDA 4LISA 3ZX4A 4JVOA 5IAKA 4ZIRA 4K2HA 3LLCA 1PJ8A 3NUZA 3PDJA 4S24A 2VRNA 3UV6A 3GN2A 1NBMD 1OWNA 3EXG1 4M6WB 5D5QA 4LFCB 4IM7A 4G8CA 1BCRA 4XFKA 5SV2A 1M1XB 4M8KA 3VSEA 4MW0A 3T9EA 5FUXA 1JG1A 2H54A 4BFTA 2PBFA 5FAKA 5IVHA 3OCYA 4Q4JB 4F4JA 5BWBA 3ZIDA 5HTOA 4X9XA 4ZICA 2YJ5A 2OD7A 2ZYAA 4LF7B 1TQHA 1A7UA 2K7ZA 2NV2B 3NFRA 4HFRA 5KYGA 3OVMA 4LOJA 4IEEA 3FNQA 2YZGA 3RPEA 4F3YA 4F5ZA 5GTDA 2GJSA 3DNMA 5JQGA 2VJAA 4ZAFA 4QNNA 1ARZA 3AXTA 3F71A 1GEEA 4ESEA 4N8SA 3IV6A 1G8PA 4XUGB 4J0KA 4Q9NA 2G25A 1IZ0A 4GU5A 3SDZA 2D06A 1V1RB 3KQSA 5P8WA 1KEEB 4LZPA 2NPOA 3TLGA 5I47A 5HZMA 2OGSA 5HKBA 4IJUA 1DPFA 4ONEA 5KREA 2X8WA 2F67A 4EB6B 5HKLA 3U61B 3GEHA 1KOGA 1RPJA 4GYJA 4OMUA 3QIVA 4E7PA 4QG3A 2E3JA 4N76A 5JNUA 3N76A 2SKEA 2PD4A 1NVFA 1WXFA 2H0AA 3GLQA 3HDGA 4G1VA 1T29A 3JZDA 4KQ9A 2ENUA 4AC9A 1XCPA 3LSYA 2CMGA 2E87A 2WZBA 3QBTA 2JAPA 3OQIA 4HFNA 4KMMA 3EQ6A 4OQMA 1XTUA 2YC2C 4JQCA 4ZYLA 4MWEA 1KVSA 1GHTA 3A28A 5GJWC 1JSCA 1ACMA 1FTWA 3MSCA 3P0IA 4GWLA 5CXXA 5BXYA 3PLNA 3H1TA 2R1UA 2IS2A 4RMIA 3AEXA 2XZOA 5AJXA 4E14A 2FPIA 5TMBA 2ORIA 2JS7A 4I1YA 3LFHA 5TSDA 1D6NA 1UBLS 1A9QA 1TGYA 1V7PC 3KAPA 3FLEA 1UFVA 3FYTA 4GPIB 5D3ZA 2A5YB 3JWGA 2EEPA 2NSDA 2SKDA 2Y1DA 2FWJA 1S8NA 3FYUC 3SJZA 3URKA 4YJKA 3GAMA 1I3OA 4R8LA 5FOSA 2V7VA 2XDQB 2FP4B 4ZRNA 1M74A 1YR7A 2A1UA 1BYUA 3ZDCA 1JFFB 3C3EA 3OM1A 4ESHA 3ZDBA 2WK1A 1A4RA 3OX3A 4FFOA 4QWWA 2G1PA 3X2SA 1ZL2A 4BNVA 3FHOA 2PQ2A 2OEPA 2Q45A 1ZCJA 4HAZA 1Y8QA 2C57A 4EX6A 3NAZA 2RI1A 4JDPA 1OX4A 3S7ZA 5I9TA 3A6GA 4FOOA 3OTOB 3LDFA 3NYIA 3ZTYA 1SURA 1QCCA 5J4VA 4P82A 2HRCA 3OJFA 3TI9A 3VAYA 1TUGA 2HHJA 3G9TA 3IIIA 1L4BA 2PBRA 3IJEB 4S12A 4QKQA 4TKVA 2WZCA 1R0XA 1J00A 3HZOA 4U2BA 3KQTA 5DSXA 2VDKB 4S1VA 5EWLA 5H1YA 3GJQA 1D2RA 4S05A 4NXNB 2AMJA 2Q1WA 1TCBA 4L9RA 4G67A 5DHSA 4B09A 2C83A 1NI4A 2E2WA 2FEMA 2JGIA 3QKSA 3L04A 2DQZA 2E5WA 1SHZA 2REQA 1IM2A 3LHIA 4HQRA 3SR0A 1I10A 3T0IA 4EI7A 3PNLA 2ZIWB 4BE9A 8ADHA 1G2PA 2A0YA 2YJ4A 2BGNA 1MQ8B 3II6X 3TTYA 2F9MA 2R11A 4M1KA 4UBMA 1BXGA 1GLGA 1E2GA 1YJ8A 2FQQA 3EOAI 1AKVA 1NP7A 3O8CA 1QB8A 2I2CA 3OZTA 1F20A 2PUFA 2NZVG 1LS1A 3E61A 3NYRA 4LY6A 4YNBA 4DLLA 2CW5A 2DF8A 4RTOA 2FTKE 3W3ZB 2A14A 3EOBI 1DBPA 2V7QA 3N2GB 3X1KA 4CLHA 1QU2A 1LBEA 4M1WA 1NNUA 3I23A 1KFBB 1Z0UA 4B4KA 1K3TA 5H5JA 4N6NA 1BFDA 2V1XA 1TYDE 3FCOA 3OIWA 5GZ1A 1ZGHA 3JWIA 3K0AB 1PFYA 1CERA 1EVEA 2BFCB 2O06A 2ZYIA 3QMPA 4UTZA 3IIJA 4AJHA 3B6ZA 3P9RA 5LA6A 4RZHA 2XGSA 1L5FA 2ROQA 1ZOPA 3LDUA 4B40A 2O6HA 5IJZA 1X7WB 1NLZA 2FW8A 3F8WA 3Q7QA 3WTCA 4ERXA 4DAEA 4YRAA 1C9NA 2GD1O 2NZWA 3D1LA 4CHTA 4QRHA 2Q1SA 1HE2A 2D7JA 1W7AA 1LBIA 3LS2A 4Q6WA 5CDFA 2NP7A 2G83A 4KI0A 2FNAA 3DVLA 1RKXA 2QVGA 3CWCA 4P7FA 3WWZA 2VQ3A 3S3TA 4PCVA 4P58A 4KNYA 1II0A 2QN2A 4HRAA 4EUKA 3PFBA 4BO0A 1UQTA 1BS2A 4RXUA 1EE9A 1ZS9A 3ONDA 4M54A 2ATXA 3HQ4O 3V8QA 5HKKD 4GD3Q 3GH3A 2Y2UA 3DDUA 5DVZA 1TD9A 5F7ZA 4UXJA 4DMLA 4UVIA 4XYGA 3R8XA 1OI2A 3TW8B 3DZIA 5DE3A 4BP9A 5JNSA 5IWAB 4KPGA 1T3SA 1UBSB 3IDAA 3U49A 3M4YA 4NU0A 4AS2A 1SCUB 1EBBA 3OX4A 5L51A 5M7EA 1HFJA 5DBIA 3BAZA 3P9PA 1HLPA 2JH9A 1TVMA 2C9MA 2Y9PB 3BFVA 4EA6A 2IXFA 3A4MA 3EEBA 4JHLA 5ALTA 2XUGA 1AUPA 3O8DA 3D6JA 4J6FA 3WGIA 4MPTA 3A6PC 2DTEA 2Q5LA 4V0LA 3K8ZA 2RHJA 4ILEA 5CM8B 2Z1NA 3VC3A 1E1RD 2ZJ6A 1CQIA 4NS4A 5MN5A 2YDXA 3BWEA 4Q18A 1LWOA 1LKZA 1Z25A 3R5KA 3ZBQA 4G0NA 1MOZA 1OB2A 3DDHA 2ZYHA 1O94A 2QGFA 2OHGA 4BV2A 2DERA 1HWYA 4IIJF 4C05A 2PU5A 4YS6A 1NVWQ 5IK2D 4GMKA 5KJ1A 1FP4A 1MC5A 1U2QA 1C7JA 1B4DA 2AUNA 2PKWA 4YV7A 1OKKD 2WLSA 2ZSJA 3PD7A 4FHFA 4CKBA 5HUHA 3I92A 3DXYA 4AJ2A 2VCYA 2XYRA 2AD1A 2CXOA 1YUMA 2QLTA 2JD2A 2AYYA 1XJCA 1G21E 2GEFA 1LV7A 3LH5A 4IV0A 4R0VA 3AR7A 4IIUA 3TQRA 4C4SA 2VXBA 2ZJ1A 4NZ9A 3DE5X 3IX7A 1Z2AA 1NNI1 4DANA 4EKGA 3ZJUA 3JV7A 5AKJA 4TL7A 1J33A 4S3MA 1YVRA 5FXMA 1GN8A 4TLAA 5AM4A 2BC9A 1A9PA 1KJJA 4YO8A 2EP8A 3C5VA 3OZGA 2XGGA 1SOAA 4EKIA 4JJ4A 4ZC8A 2QPTA 3ZV3A 2GD0A 2Q5OA 4L0DA 5IDQA 4FIDA 5AOBA 2P77A 1WTAA 1H6BA 1UPFA 4PQGA 4QDOA 3L1IA 4MVJH 5CVVA 3SLKA 3TRDA 3UHAA 4UHHA 5E6SB 2ZDHA 1YK0A 1NYQA 2V7WA 3SHWA 4MUHA 4J7CA 2HEGA 2JJ2A 1EVZA 4MULA 2IWHA 1V37A 1RXWA 2PANA 5G3YA 4PR3A 1YDHA 2P9CA 2YW2A 1U28A 2D1QA 2F3RA 1JL3A 2WJHA 1A4IA 4IUYA 5FOWA 4B6FA 1AQ6A 2P9FA 1JB9A 1ABFA 1SUPA 2O8FA 3EGOA 3KEFA 1EK1A 4EY6A 1QG0A 2X3UA 3HCDA 4X1YB 3N2ZB 4IXWA 1D8AA 2XCUA 2QM7A 2PS3A 3UF0A 4YJ2B 4C5BA 2O0KA 4CMJA 3PCXA 1LDMA 4BWGA 3ISJA 3D8TA 4UE3S 5EFZA 1OXKB 4LOLA 1GTMA 1CRZA 3NJ8A 3B5JA 1FP7A 1IEWA 2CMFA 5ED4A 5DGDA 1PDVA 2QN9A 3ZK8A 2XIJA 3T5TA 2I2AA 3FMOB 5LZ5A 1ZNZA 3TTSA 1E6UA 1Y7TA 3EXFB 2FPPA 4CVNA 4PYNA 4URHA 2QE7A 2QAJA 1M0WA 2A94A 2Q4OA 3RUDA 4PNEA 1TUBA 2WILA 1U7PA 4RK1A 1ISRA 2V6IA 1IHPA 2GMWA 3C3DA 4MMYB 4II7A 5ER6A 1GDHA 2PMEA 5F77A 3G2KA 2PVSA 1W4CA 5AQEA 2VPYA 4YY3B 4GP6A 3GG2A 4U7GA 1ULBA 3HZZA 2K7FA 1TTQB 3ZZUA 3BG5A 5GJBA 5AH0A 3OHPA 3ZUPA 1PEKE 3N7TA 4H77A 5ER9A 2Q7XA 5D3MA 2HCTA 5C1DA 1XDWA 4U2GA 3CRQA 4MEBA 4P53A 3DEKA 3B6EA 2OKGA 3VH1A 3AC0A 1IUNA 1OXUA 3H1AA 4IDFA 2WHXA 4II3A 4MR8A 4UEKA 5CH8A 4YAOA 4HH0A 4Y0AA 1RHQA 2YIMA 3NW9A 4LV6A 3MTQA 4H7PA 4NH4A 3T4EA 3L0YA 3C0KA 1U3VA 2WC1A 3M1LA 4OAOA 4Y1GA 4YR7A 2OZPA 2PY6A 2OUKA 2V97A 4FWBA 4M7PA 4QPDA 1AKUA 4WCDA 1YB1A 1P75A 1KAEA 5LUBA 5I3CA 5CRIA 5KYWA 2WE8A 3G0IA 4HWKA 4FHDA 2SECE 4CEJB 4MEJA 4OH7A