3M2PA

The crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
294
structure length
287
Chain Sequence
SLKIAVTGGTGFLGQYVVESIKNDGNTPIILTRSIGDYEYRVSDYTLEDLINQLNDVDAVVHLAATRGSQGKISEFHDNEILTQNLYDACYENNISNIVYASTISAYSDETSLPWNEKELPLPDLMYGVSKLACEHIGNIYSRKKGLCIKNLRFAHLYGFNENYMINRFFRQAFHGEQLTLHANSVAKREFLYAKDAAKSVIYALKQEKVSGTFNIGSGDALTNYEVANTINNAFGNKDNLLVKNPNANEGIHSSYMDSSKAKELLDFSTDYNFATAVEEIHLLMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine 4-epimerase
publication title The crystal structure of UDP-N-acetylglucosamine 4-epimerase from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 106
structure length 287
sequence length 294
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2010-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3m2pA00
2X9GA 4YJGA 1NPDA 3JD4A 1R4MB 1VL6A 4G65A 1AHHA 3KEOA 4AJLA 2W2KB 5F3RA 1CJCA 1LRJA 4Q3BA 1B16A 3BZUA 2CFCA 1JU9A 2GR9A 3WSVA 4EEXA 3G1UA 1QLHA 3GF4A 2QQ5A 1UP7A 4KDFA 8ADHA 1I3KA 3L77A 3MJVA 1SOVA 3EHEA 4PZCA 4DC0A 1KS9A 5TRTA 4CM5A 4N5MA 4DL9A 2ZIZA 3MJCA 4RPHA 2Y93A 3WOHA 2B4RO 2VHYA 1M75A 3NKLA 3T7CA 1WDLA 1BW9A 4WUVA 4CLEA 1K0UA 4AJOA 4N5LA 3VZPA 3TWOA 1WXDA 2XPCA 4MVJI 1N9GB 5CDYA 1LDEA 4FC6A 3T4XA 2O3SA 1BMDA 1LSUA 5DDIP 3OICA 4A7PA 4BNYA 5IZCA 4K6FA 3AY6A 4LK3A 3WJ7A 3CZRA 3JQ9A 4I1IA 4YT8A 1DJQA 1ZJYA 3MOIA 3FR8A 3H4VA 2GO1A 4IZIA 3VKVA 1RJWA 4MVJA 3CIFA 2HK8A 4IMRA 3OJFA 4XJSA 1XQ6A 4QSMA 3UGKA 1GD1O 1N5DA 4NK4A 3FSRA 4CV2A 5KVSA 4TRMA 5G0UA 9LDTA 4J9VA 3GH3A 5JW6A 2IZ0A 4BNTA 4J4BA 4NQZA 5IZ4A 2AEMA 2VUTA 3PHHA 5DF1A 1A9ZA 3RI3A 3OSUA 4D0RA 6ADHA 3KLMX 4ITUA 4E2XA 3MOGA 1BG6A 3EVTA 3FD8A 3IJRA 3KLPX 4Z9XA 3DONA 1GEGA 1A4IA 2I65A 3FHLA 4MIYA 5B4TA 1Q7CA 4U6QA 4FFRA 1WAMA 2OBYA 4CMAA 4YWJA 1DC3A 1JAXA 3BMQA 2AEJA 4HFNA 1YBAA 3HFSA 3OIDA 3GR6A 2Q50A 2WEKA 3H9EO 2PKRA 1WP4A 3KV3O 4M87A 3ANLA 4B7UA 2JFHA 2D2IA 2C7VA 1EE9A 4J2HA 1ISGA 1UP6A 3NAQA 4AJPA 4YDRA 2GN9A 3G79A 1U9JA 5L7TA 4I9NA 2BF7A 3UAGA 4XB1A 4YJGB 4W4TA 1XHLA 3HQ4O 5JAQA 1ZK0A 1PGOA 5JDIA 1DAOA 1LDBA 1LDGA 3DO5A 3UCEA 4D46A 5JCJA 2GPTA 2R6JA 1LDMA 5KJEA 3FNFA 3D64A 2PKQP 4PG8A 1LBEA 1SNYA 3OJ0A 1XEAA 3DC2A 1LDYA 4DPKA 1SPXA 1B14A 3BMCB 4ND1A 2YFHA 4O0LA 4XZ3A 4JK3A 2XF8A 1DHTA 3OP4A 1BW9B 2DTDA 4DTIA 4E2ZA 1DOHA 3DAFA 3AUAA 2POQX 4GX2A 1L7DA 5EESA 1H6AA 2BELA 3AOEA 3HDQA 4L73A 4LVCA 3QVTA 3Q11A 2FPIA 4OJNA 4DQVA 3STHA 4W6ZA 4ZVVA 2HCTA 1Z82A 1PU2A 1ZK2A 4E5NA 2GLXA 1JKIA 3QHAA 4BO5A 2ILTA 2CSUA 1FF9A 3ZNQA 4ZRMA 2AQKA 3D5QA 3ADPA 4WOKA 4J90A 4CM7A 1UZMA 2X7HA 5AXDA 4JIGA 4CL3A 1CEQA 1ZEMA 4PVCA 4R54A 1HDOA 5EINA 1UXIA 2D5CA 3KO8A 3WGHA 1GZ4A 4KDEA 4BKOA 2DTXA 3VZSA 3UKOA 1F12A 4BNVA 1TI7A 3E18A 4ZQEA 3C7DB 3OF2A 1YO6A 3V8BA 4CR8A 3WGIA 3WTCA 4ND4A 1DEHA 2ZB4A 3PJGA 4KUEA 3E6AA 5KCZA 1IY8A 1PIWA 2YZ7A 4WLVA 4J1TA 3BMQB 1DRVA 3QIVA 2VHZA 3EYWA 4NIMA 1I10A 4GKVA 4YAIA 3RFXA 1XU7A 5HRUA 2P4QA 3DL2A 3O8QA 2P9GA 1U3WA 1R0SA 5GZ3A 2VHXA 1HDXA 5CPFA 1IYZA 5ER9A 3ST7A 5ILOA 4OKIA 2HMSA 2DUWA 1KY4A 2ZQZA 4W7HA 4R69A 1QLJA 2J3JA 4JCOA 3CEAA 3CE6A 4FFMA 4LISA 4UEJA 4YQZA 2EP5A 2DBVO 4IZHA 5JAIA 4ALIA 4RV9A 1ISMA 1JDJA 3LSYA 2OO5A 4NBVA 4RPKA 2Y1EA 3KYCA 1YJQA 3EC7A 2GNAA 3C24A 4OOEA 2EG9A 3D4OA 4OXKA 4I08A 2X9VA 4FFOA 1NVGA 3L4BC 3D5TA 5DCWA 1GPJA 4A2CA 4JBHA 2QIOA 2HK7A 3JQCA 2G5CA 3MJSA 3EVNA 3LDHA 3SXPA 4BS9A 2V6GA 2PY6A 4XEHA 1X1TA 1A27A 3TF5A 4S1VA 5TSDA 3NX4A 2Q1WA 4E13A 1HE3A 4Y6RA 3HSKA 2PZLA 1NPYA 1I3MA 5CDGA 3AU9A 1E3LA 1LSSA 1HYHA 1B2LA 3OJLA 4P4GA 2DBRA 3IS3A 3ZHBA 1EQ2A 4B8WA 5JY1A 4XRRA 2JD1A 5I9MA 1XGKA 3RU9A 4IDBA 4ZN6A 3K6JA 1KVTA 1YL6A 3JD2A 4WEQA 2ZYGA 2OOSA 1S6YA 3PYXA 3MTGA 3ZU4A 3GZ4A 4UVGA 2OZPA 4EW6A 3RSHA 5FWNA 3O38A 1N7GA 3K73O 4FGSA 4E3ZA 1V0JA 3ENKA 3ONEA 3DMTC 4CM4A 1MC4A 5IXYA 1EMDA 2O23A 2Y0CA 4NZ9A 4DMLA 4J2OA 4R51A 2VCYA 2VT2A 2YDXA 1VL8A 1D1TA 4F46A 1MC5A 3JQBC 1Y8RB 4Z0TA 2J6IA 4F6LA 1E5QA 5ICSA 1EEHA 4DC1A 2RHRA 3U9LA 5B4VA 4P38A 4EZBA 4WLFA 2Q2VA 1TEHA 3C85A 3QQPA 3LQFA 4YQYA 5F5NA 4WLNA 3O8QB 3BA1A 4PRKA 1JVSA 3INRA 3JYPA 4TMFA 3TN7A 3K8ZA 1Q7BA 5T8KC 3C1AA 1N92A 1PWZA 3DR3A 4MVJD 1AGNA 2Y0EA 1PL6A 1NNUA 2ZKLA 1DSSG 4BNXA 5EMHA 2Y66A 1AXGA 5CEEA 1CWUA 3BIOA 3PGJA 4BB5A 3H8VA 3PEFA 4RPJA 4IGFA 4YTEA 2C7GA 1C0KA 4FBGA 4YRBA 3KYCB 3PP8A 1ADGA 1Q7GA 4Y98A 3DMYA 3E9QA 4MINA 2E6UX 3R1IA 3T4EA 4O1MA 4PG7A 1SC6A 3U4DA 1QRRA 2X58A 4UUMA 4CMCA 5L95A 1R16A 1Y9AA 5AXAA 2AMFA 3H5AA 1DB3A 2NACA 3JQFA 5CHEA 1KBZA 3WNVA 2YDYA 3TOXA 5JBIA 1ZSVA 3ZWOA 3SC4A 1LC0A 4J9UE 3GNTA 4KQXA 4KWHA 3RFTA 3PWKA 3UUWA 1J6UA 4ZU3A 1ISJA 5BNFA 3JYOA 2WJPA 1E3IA 4R01A 4JROA 4D79A 4QFCA 1P74A 2HJRA 2H5LA 4BNZA 3ITDA 1ONNA 4GGPA 4XCVA 3JQ7B 4CLXA 2IDZA 1UP4A 4J49A 4IXTA 1ZIDA 1D3AA 4J16A 4KOAA 5GY7A 1X0XA 4JLWA 1O6ZA 1YE3A 4XQ9A 5G2OA 4CMHA 2EIHA 3DOCA 1Z7EA 4NI5A 4DA9A 4DXHA 5JCJD 2X9NA 1PEDA 4HY3A 4M55A 2CNBA 2B35A 4GVLA 5L4SA 3I4FA 4MO2A 4XYGA 3ZNNA 2ZCUA 3HFGA 3LF2A 3EW7A 2JAHA 1EUZA 1E1LA 1HDGO 2BFOA 1U1IA 2GGSA 1P77A 3GPIA 3W4IA 4CM4B 3FN4A 3QY9A 3ZW8A 4OMUA 3KXDA 5AXCA 4D0SA 3I9LA 3LT0A 4PLPA 4IIUA 3AY7A 2BI7A 2AG8A 4AJIA 1CDOA 2AE2A 5A04A 1WWKA 3HZZA 3GGOA 3NGXA 2ZTMA 1X14A 1XWFA 4PLYA 5JSFA 4M1QA 3GMSA 4CQMA 3F4BA 3FWNA 3FNHA 5A06A 1F17A 5A9SA 5CFZA 3F5QA 4B3HA 1R0LA 2OL4A 3VPGA 1R37A 2GYYA 4DBVO 4K1LA 4B3IA 1MX3A 1OOEA 3FNEA 5AVOA 1O94A 3BMOA 1KVUA 1VJ1A 2FPPA 4XGKA 4CV3A 4GSKA 1ZW1A 4HP8A 2EERA 3PGXA 3AOGA 1LU9A 1VPDA 2NVWA 3IKVA 3L4SO 3LT1A 1O0SA 4JXKA 3DZBA 4U0KA 1HL3A 4F45A 1UDBA 1IB6A 2I3GA 1K6IA 1HLPA 3V2HA 1G0OA 1B7GO 3GNSA 5A05A 2EV9A 5DBFA 2BGKA 1EDZA 5EPOA 5FI3A 1XYGA 1QYWA 1HE5A 4IDFA 3DBVO 3C3XA 2A4KA 4DRYA 5KTKA 4XIYA 2BFMA 1T1RA 1U7HA 4Q3CA 4L0QA 1QMGA 1HXHA 1VKNA 1ZKMA 2C2YA 3NRCA 3V1UA 3G1TA 2O2YA 2B69A 3AI1A 3H2ZA 4EJ0A 2J5KA 1FDUA 2FOIA 4IQGA 1HSOA 2H9IA 4P4NA 3FPCA 4GWKA 3ROPA 4JJGA 3GC6A 1P9LA 3W8DA 2HMUA 1QYVA 4Q3AA 4MP8A 2P9CA 4AG3A 3P19A 1NYTA 3IC5A 1I2ZA 1J49A 3AUUA 2OXIA 4OYRA 1ISFA 1P0FA 3B20A 3QJ5A 4YAGA 3PLRA 1GU7A 3ZWPA 5L53A 1SO8A 1XA0A 1HRDA 1X0VA 5BSGA 1YKFA 4P4LA 4XX0A 3ZV5A 2GD1O 3Q6IA 2Q99A 4II3A 1IHYA 4PCVA 1N7HA 1IE3A 2RH4A 4JP3A 3D3WA 4L9RA 4WKGA 3H65A 1MLDA 3DZFA 1AUPA 5TNXA 3PXXA 2XAAA 3DZHA 4URFA 1LLQA 2ZYDA 5EIOA 5IXSA 1Z45A 3JCZA 3RASA 2O7SA 3ZWYA 1DHRA 4BVAA 4CQMB 2FPGA 4WOJA 4RORA 3DTTA 1C3VA 4CODB 2CVQA 1OZAA 1C0LA 1NVMB 5A9SB 3NJ4A 4B4UA 1YXMA 1LLCA 1SAYA 3OECA 2PH5A 4MVJM 3WWYA 5HTOA 3TOZA 4JP2A 3PJDA 1DIRA 1HZZA 3ITKA 3QV1A 3BMOB 3TZHA 2EKLA 1T2FA 2BLLA 1WDMA 1ZSYA 2VWQA 3BTSA 3QA9A 2QYSA 3BYZA 1I5RA 1F06A 4NJOA 1PTJA 3HWRA 1S7CA 1KEWA 2HMVA 3IUPA 4RCVA 4ZICA 1DC4A 3WICA 4RF2A 1F0YA 4EGFA 4TSKA 4MJLA 4JJFA 1PZEA 5CDSA 2HK9A 2ZTVA 2QZZA 3AW9A 4I9UA 2EF1A 4WNCA 4LVUA 1I33A 2CDAA 1Y9EA 3QRWA 3VVCA 1UR5A 1LX6A 4OO3A 3VPHA 1Y1PA 4J4TA 4ZJUA 4BNKA 1OMOA 2DQ4A 3L6OO 2F00A 5A9TA 4L4SA 4BNIA 3UH1A 3BTOA 3CTMA 3VPFA 4WJZA 4CPDA 3TSCA 3GZNB 1I30A 3TFQA 1SEVA 2VZ0A 4IINA 1H6CA 2NWQA 1DIAA 1NWCA 5JMWA 2WSBA 3PJEA 1YQGA 5F1KA 3E48A 2UVDA 4MVJE 1BDBA 3WXBA 3K92A 1K2WA 1BHSA 1XSEA 3PFWO 1P1IA 4BNFA 5IDQA 4EUEA 4DIBA 3I4CA 1D1SA 3W8EA 4IDDA 2X6TA 2D59A 1HDRA 4J1QA 5DBIA 2C5EA 2FZEA 2X5JO 4QECA 4YT5A 4YT2A 2Y1DA 1ZCJA 1CRWG 3WBBA 4TVOA 3AJRA 3H3FA 4HKTA 1VSUA 4KTVE 3SEFA 2GSDA 3WS7A 3ZHYA 3VTFA 2PGLA 3SX2A 4GH5A 4YVFA 2C82A 2J8ZA 1T26A 3D3WB 4ILKA 4P22A 3CKYA 1ISHA 1LTHR 2NTNA 3CXRA 4CR6A 1GUZA 3ETEA 5KKAA 2NV6A 5K6AC 1DFIA 1A4UA 4M89A 4FFNA 4FDAA 4J3FA 3VAZA 1DIGA 1NXQA 3BHIA 1DIHA 2UDPA 4O6VA 5DOVA 4RF3A 4QFDA 4ZA2A 1X15A 3U4HA 4E4YA 2A9FA 2BMAA 3G49A 2DTEA 1HLDA 4INAA 2WWRA 4CR7A 2DAPA 4OXYA 4PLHA 4EDFA 4N54A 1QG6A 1PX0A 3RBZA 4BGVA 2P2SA 2A92A 4YT4A 1K6XA 2W90A 5COBA 3WX0A 5U4QA 5IF3A 2IEDA 4H7PA 1A7KA 2B0JA 4D3DA 1GUYA 3GAFA 1E6WA 1NASA 3MWDB 4NBRA 3W8FA 1LSJA 2HMWA 5JPIA 3JQAA 3MJEA 1U3VA 4PGFA 4CMEA 3GFGA 4FR5A 3E82A 4XQCA 3D3EA 3JSAA 1C1XA 4CQLA 1PJCA 4MIEA 3RVDA 4FC7A 4GLOA 5TGDA 4UAGA 1JKJA 2GF2A 4BIIA 2ZJ0A 4E5PA 3HG7A 1YDEA 3ON5A 3NDIA 4CQMD 5I7EA 2OBNA 2VT3A 1WNTA 1VLLA 4AICA 1H9AA 4ZD6A 3S2EA 5IDWA 2XXJA 4FS3A 3F1KA 2VHWA 5LC1A 3TNLA 4Q3NA 1I3NA 1U28A 5ILGA 2SCUA 4GX0A 1V35A 4LRSB 1N1GA 3GK3A 4AFNA 2B5WA 2AE1A 4BQPA 1T4BA 4DYDA 1ENOA 4FPXA 1P0CA 1SEPA 1YB1A 1YQDA 3ANMA 5JC1A 4BUCA 2X22A 3T7EA 3BTVA 3W1VA 1EK5A 4YPOA 2VOJA 2X5OA 2UUOA 4H3VA 4CMIA 2Y1CA 3HDHA 1Y7TA 3EZLA 3Q0EA 1U7TA 1SB9A 4DIFA 3WQRA 2Q1SA 2H6EA 1UZLA 4BV8A 1PSDA 3ZV6A 1JAYA 4R1TA 3ZHZA 2GN4A 4WEOA 4BNMA 1O9BA 3TZ6A 2E37A 4YRAA 3LU1A 1AN9A 4R1NA 2BKAA 2G17A 3GG2A 5TLSA 4K28A 2W4QA 1PL7A 2PTGA 3CMMA 3A14A 1NR1A 2Y68A 2CVZA 3DQPA 1ORRA 3OA2A 1JWAB 1DLJA 4G2NA 1ZSNA 3ZV4A 4YJFA 1KIFA 3UCFA 1E92A 4GMFA 4MP3A 1GR0A 2WYWA 1EUDA 3RCBA 3AM4A 1GYPA 3TPCA 4D42A 1VL0A 3E9MA 4ZQHA 2FZWA 3V1YA 3NYWA 4PLGA 4DMMA 3H9JA 1BWSA 4EBFA 4Q9NA 3L07A 1UUFA 2WD8A 3R6DA 4HADA 3INTA 3WNQA 1AE1A 1YB5A 1ZO8A 2VRCA 4WCDA 3JD1A 2EHDA 1B3BA 1N8KA 4ZHSA 1YGYA 3E03A 1MXHA 5H82A 2X5KO 5HS6A 3JQAB 3M6IA 4NFHA 1EDOA 4FOOA 2IODA 3OA0A 4IJVA 1C1XB 4J4HA 4WE3A 4CQLB 1M6HA 5B12A 5C5IA 3KETA 4FCCA 4OL9A 3WIEA 3BTUA 1UDCA 2BFPA 1KEVA 2I5PO 3D4NA 3I9KA 3PRJA 2WYVA 6LDHA 4XDZA 1JN0A 2JFFA 1IL0A 2P4HX 3NTRA 3ZWBA 4NK5A 4BV9A 2WE7A 1GDHA 1ONPA 4IGEA 3H3JA 2NADA 3LZ6A 1B15A 4KZPA 3RROA 4DLBA 2OP0A 1M6WA 3BHMA 3ZCXA 2HRZA 3I5MA 3GT0A 3HADA 1E1MA 1RM5A 3F4LA 4HFJA 3RBXA 3DMTA 3ROQA 1FMCA 2UAGA 4DQXA 1JA9A 4HNGA 4CUZA 4R3WA 3MCVA 3GAZA 1LQUA 3ANNA 1YQXA 1RYDA 4PLZA 5JO9A 1ENPA 1MFPA 3JQBA 3ORFA 2B37A 5JMPA 4DPLA 4CM1A 3JTMA 1SB8A 1H5QA 1VRWA 5CAEA 4PZDA 3DOJA 4CJXA 2BFAA 3KOUA 4CLRA 2DU8A 2NU7A 4FJ2A 4PLVA 4BOYA 3EDMA 2UV8A 2W2LA 5B37A 2OHXA 4Y8VA 4DWVA 2C2XA 4GL4A 4NDNE 5JS6A 5IZCC 4HWKA 1EK6A 1GCOA 3ZH2A 4BO8A 5G4LA 1J5PA 4D45A 1HDZA 3JQ9C 3K2EA 2PZKA 1K6JA 3L0DA 2GZ3A 4AJEA 4QXMA 4FFLA 1ZK1A 3M1LA 4ZQGA 2RHCA 2Y1FA 3GHHA 1JQBA 3A9WA 4Y9DA 3LC2O 1YH3A 2B36A 4FJ0A 4XYBA 5L7YA 4BO2A 1E7MA 1OBFO 3B6ZA 4DGSA 3PI7A 2Y1OA 1Y5RA 3E1KA 1VM6A 4YJFB 3F9IA 2Z5LA 5CP8A 4I8XA 1U8XX 2G82A 4GX5A 4MPDA 1SOWA 1HT0A 1XU9A 2P5YA 2ZK7A 2I66A 3DFZA 1RKXA 4IUYA 5CDUA 5IJZA 1D7OA 1P45A 1PZGA 3KTDA 3R0IA 3EY4A 4OKNA 1ZXBA 3BMNA 4XDYA 4IDEA 2C59A 4RVGA 3WYEA 5AQ1A 1L1FA 3RUCA 4FN4A 2AEFA 3ZWNA 7MDHA 1MGOA 1B26A 4RZIA 4R1SA 1QXSA 2A35A 2E48A 3WMXA 3AUTA 3RJ9A 4D41A 3DDNA 4EYEA 3HN7A 4BNNA 2DT5A 4XYLA 3AU8A 5ITVA 3F6YA 5C7IO 3V1TC 1K5HA 4ONEA 3PLNA 3WLEA 1H2BA 1WDKA 3FRJA 4RPLA 1DC6A 2PH3A 4U7WA 2ZB7A 2CUKA 1VC2A 2ZB8A 4UUPA 1H6BA 2YHIA 4ZRNA 2ZTUA 3B1KA 2DUUA 4E33A 1GYRA 3VTZA 4DBZA 4RF5A 4R68A 4RDHA 4XGNA 1NFQA 2GERA 3WG9A 1NTOA 2PGJA 3EAGA 1ONOA 2Q2WA 3PWZA 2VHVA 1QSGA 4WCFA 3VZQA 5KNLA 4DIOA 5IFLA 3AUSA 3LF1A 1ULSA 1E3WA 3ZHXA 4B3JA 1DFHA 5JYEA 4R9RA 1TLTA 1E6EA 1PS9A 5CPBA 3WBFA 2DPHA 5MDHA 1Q1NA 5EN4A 4N18A 4G5HA 3CSDA 4YYZA 3PFFA 1E1NA 3JQAD 1EVZA 1LXCA 1Z73A 3AI3A 4E5MA 2PZJA 2VTEA 1NQAO 4GVXA 3QWHA 3UOGA 3SBOA 4B79A 1T25A 4AJHA 1X1EA 4ALKA 3K5PA 1YB4A 4II2A 1HEUA 4E2WA 4WNIA 3D4PA 1GFSA 1WLYA 3LT2A 4ROSA 1M2WA 3VH1A 1U8FO 4B7CA 1KYQA 2GZ2A 3PHLA 3P5SA 3GPDG 1QV7A 1QKIA 4D3SA 4HNHA 5A5FA 3Q2KA 1PQPA 4LN1A 4E31A 1EE2A 1XLTA 3MWEB 3RQSA 2NM0A 1OC2A 4UULA 3TL2A 4F3YA 1XQ1A 4GPD1 1Y5MA 1BRMA 1XKQA 2AG5A 1MP0A 2FSSA 2LDBA 4OHUA 2GDZA 1IPFA 4R1UA 5H83A 1UXGA 4DUPA 4J43A 1UAYA 3O4RA 3TJRA 3N7UA 4HFMA 3VPXA 5DT9A 4WPGA 4ALMA 1IHXA 4UVHA 1PJLA 1HDCA 3BMNB 5DULA 2WM3A 2CF6A 1P1FA 4M8SA 2VUSA 4P8RA 4PRLA 3WGYA 2GN6A 4KMSA 3V2GA 1GADO 4BHTA 4K9DA 3U0BA 2EEZA 3NT2A 3RJ5A 1DPGA 3C7AA 2OP1A 1MFZA 2CY0A 4L8VA 1MUUA 2G0TA 3U5TA 2VYVA 1MXFA 1ZUD1 1P44A 3FCOA 5KOIA 4L74A 2FR0A 1UXKA 4O59O 5G0VA 2I99A 5IDXA 1EBFA 2E4AA 4RVSA 3LC7O 3PIIA 4OIMA 2CF5A 3M2TA 3GN2A 3LVFO 1YDWA 4BKUA 2YHIB 1MB4A 2O3TA 1YOVA 3FR7A 3QE3A 3QSGA 1RM3A 2HO5A 1EFKA 2PV7A 1GEEA 2P91A 3K30A 4Q3EA 3ZNOA 1JKFA 1O89A 3JQDA 4JBIA 1I2BA 4NFSA 4RPGA 2GZ1A 1NM5A 4L76A 4LSWA 3N58A 4E5KA 3ROMA 1C1DA 4WCFB 3VC7A 2AXQA 1RWBA 4XB2A 1PGNA 1E3WB 1DJNA 4QT0A 3TZKA 3I3OA 1FDSA 3DBHA 4RQUA 5A02A 1JLLA 5DNAA 2VRCD 3P7MA 4QX6A 4RVUA 5G0WA 1PZHA 3OM9A 3OIGA 4TVBA 3RUHA 4BO6A 4BNHA 3QWFA 4GX1A 3F46A 1SBYA 5BSHA 1GQYA 4BO3A 2YW9A 3W6UA 1B8VA 3AM5A 4LMRA 4M54A 1T1SA 3GVCA 4PG4A 3RIHA 3ZWVA 1P1RA 2V6FA 4GWGA 4NR0A 4Z0PA 1YL5A 2IE0A 3HE3A 3TRIA 3VKUA 3JD3A 5T6BA 4BGIA 3Q1LA 1I3LA 3DBRA 4U5QA 4UREA 4BQRA 2JHGA 3ONFA 5JFOA 5FF9A 3UW3A 1U2DA 5ENDA 2PWZA 1X7HA 1YL7A 3PQEA 3RC9A 2YUTA 3DOOA 3RD5A 1PL8A 4NFYA 4A03A 4BKQA 1VE9A 3ADOA 3NJ8A 3QVOA 2GASA 2V65A 5F21A 5L7WA 1T2CA 2I9PA 2WYUA 2DBQA 2NSDA 1PJ3A 3KSZO 3U3XA 3GY0A 4MDHA 3JYLA 4E5YA 1PJQA 2Q1UA 2DVMA 1UZNA 1GV1A 2FN7A 1NWHA 2C0CA 4GAEA 1XDWA 3WB9A 5HM8A 4WGGA 2JCXA 4MKXA 4FW8A 3H2SA 2HAEA 5C37A 4IJWA 2W2LD 1PJ4A 3WGGA 1U2GA 2HU2A 4KP7A 3LK7A 5FFFA 5T67A 3RKRA 2F1KA 2ZJ1A 2RH8A 3VH4A 1ZEJA 4JBGA 1GZ3A 3OQ6A 2NU8A 3KYBA 4IQ0A 4E0BA 3C1TA 2EGHA 1TT7A 1LJ8A 5A9RA 1GCUA 2AQIA 3C1OA 2Z1NA 1PQUA 3DFUA 1IZ9A 1NPTO 3VZRA 3ZWAA 4WASA 4R41A 3GDOA 5L51A 1E7YA 3WDSA 1F14A 3W4JA 3ASVA 1C1DB 4TZKA 2Q1TA 3DEYX 4JJIA 4Z9YA 4YAEA 1BXKA 3AFMA 3TDKA 3KUXA 3EMKA 3NUGA 3CH6A 3FPLA 4J7CA 1MA0A 2O50A 2O4UX 3DBHB 4IS3A 3UN1A 3GEDA 5BSFA 4W99A 3OH8A 4IMPA 4ND5A 2OMEA 4XKJA 3I52A 4XYEA 3RWBA 2EKPA 5TX7A 3DWFA 2PR2A 4S3MA 1NR7A 4J91A 4AVYA 1FK8A 2EWMA 1NQ5A 5I7SA 4QQRA 1GQ2A 3IDSA 4JNKA 2NLOA 2XOXA 3LC1O 5L3ZA 4PN3A 4YBZA 5JY6A 3DXFA 4FIZA 3H7AA 4AL4A 3DBRB 4EUHA 3A1NA 2D8AA 2Q3EA 3CINA 1DBVO 1H6DA 2BGLA 5KKCA 5GZ1A 2FP4A 1WW8A 4FFPA 3ETDA 4TQGA 3PZBA 1ZNQO 4FD3A 4JX8A 2OFPA 1KVQA 1RM0A 3SLKA 3RC1A 4PIVA 4IXWA 2G76A 2PKQO 3GDFA 5CG2A 3I23A 3UFXA 5T57A 2DFVA 3CZMA 2DFDA 1NQOA 4N7RA 5F1OA 4CMKA 1J0XO 3GRKA 1JVBA 2EP7A 1OI7A 1PJTA 3ONDA 3P2OA 5DN9A 3VHRA 5MGBA 2WD7A 1XCBA 2RAFA 4YAJA 3E8XA 2H63A 3UF0A 9LDBA 1R66A 1VJ0A 3K2BA 1HE2A 5HS4A 2PD6A 4NNJA 2W2KA 4PLTA 4WLOA 3D0OA 3MJ4A 1F8GA 4W9NC 2JJYA 5TS3A 1DLIA 3NDJA 5L4NA 1JWBB 5TF4A 3B1JA 4NMHA 1O5IA 3OQBA 5KVQA 4CV0A 4N5NA 3DZKA 1E7WA 1HTBA 3DHNA 1ARZA 2HUNA 2VN8A 3S55A 3W6ZA 4TROA 2NUAA 3NT4A 1MV8A 3Q2IA 5C3MA 1K89A 3KSDO 4L4RA 1TB4A 5CG1A 1OAAA 4MVJH 2NU6A 1HETA 3RBVA 2YV3A 2YFQA 4QEDA 5BT9A 4OM8A 3GG9A 3WSWA 4FGWA 4UVIA 1NFRA 2PD3A 2IRWA 2YJZA 2ZCVA 1CETA 4BO1A 3S1LA 1RYEA 2VZ9A 3ZZNA 1E0DA 4KUGA 5DP1A 4R3NA 1ZVMA 2DLDA 2EXXA 1HZJA 1LRLA 4GSLA 4J0EA 1N2SA 5A1TA 2NNLD 2NQTA 3EGOA 4CM8A 2NVUA 2V7PA 4J7UA 4DYVA 5U9CA 2IZZA 4OQZA 5JO0A 2VYVD 1ULUA 5CDTA 2WTBA 2HLPA 1CIVA 4AJ4A 2X0RA 2HSDA 3QVSA 5G0SA 4MVJG 4XGIA 3EZYA 2OGUA 1GZ6A 2O3QA 2HRBA 3MJTA 2J5RA 1Q0LA 5TIIA 4BL5A 2IXAA 1SCUA 1QYCA 3H9QA 1B0AA 4UUNA 2FSVA 2X23A 2C5AA 1LQTA 3DZIA 4JN6B 3ROKA 1G1AA 5G0TA 2HJSA 4PG6A 3GVXA 4BMVA 1TVEA 3AWDA 1TT5A 4A10A 2PZMA 2J3HA 1LUAA 1EVIA 1PGJA 1CQJA 4RVDA 4RGBA 2JCVA 2V6BA 5A5EA 3I6IA 2R00C 3S8MA 4HXYA 2I6TA 3I6QA 4MIOA 1Y8QA 3ZGYA 5CEJA 5BR7A 3K96A 3E9NA 3NT5A 3HJAA 4WECA 4GKBA 1MG5A 3OJEA 2WMDA 2YQ5A 4OH1A 2E82A 1M67A 1ZFNA 4TRNA 5DCUA 4KQWA 3HHPA 3O26A 1GY8A 4AJJA 3NDRA 4X54A 5IN4A 1D8AA 1U5AA 3WFIA 4CM3A 5LCXA 4XD2A 4BMSA 3RC7A 3SVTA 3GGPA 1PWXA 3A06A 4RO0A 4IDGA 1GQQA 2X1HA 4OXNA 4RLSA 1BDMA 1H93A 3VOSA 5HBRA 1EFLA 3ICPA 3BMCA 2Q4EA 3OBBA 4NJMA 3OFSA 3RUEA 5L9AA 5TJ9A 5TT0A 3FF4A 5H81A 5FEUA 2JFGA 4RLHA 3ZWMA 1KOLA 5JC8A 2QRLA 1IPEA 1IUKA 3RUDA 2VQ3A 1ML3A 2VWHA 3EK2A 2IEBA 5JE8A 3UICA 2NU9A 2DM6A 1GL3A 3L9WA 2J3IA 4XA8A 3WGQA 5ICMA 2YV1A 2VWPA 5JDCC 4GMGA 3BXXA 1M76A 3AFNA 1R6DA 2NTJA 4ZQBA 1PR9A 4BNJA 2VUUA 2O4CA 4ND3A 5IAAA 2VYNA 3S2GA 1BGVA 3D1LA 3LT4A 3Q9UA 4TZTA 5I8ZA 3HDJA 4IDCA 2JCYA 2O2SA 4CM8B 3TFOA 4CL8A 2NVUB 1ADCA 3DZJA 5ER6A 4PLWA 3ICCA 3E5MA 3X2FA 4YJHA 4LRTB 1ZK4A 3KB6A 2AA3A 4R5HA 3U62A 2PK3A 2CDCA 5TC4A 1I36A 1NQTA 3G3EA 4IQ8A 2QYTA 3CUKA 3MZ0A 3PIDA 1FXSA 5C7OO 3O9ZA 1GUFA 3P2YA 2HQ1A 2OUIA 3JYNA 5THKA 3PK0A 2BH9A 1WZIA 1TT5B 1WPQA 2HKIA 4E12A 2BRUA 5G4KA 5TQVA 4IY1A 3L4BA 1PJBA 3WQQA 1L7EA 2QRJA 1R4NA 1IZ0A 3IMFA 1U4OA 1OFGA 1KC3A 1ENZA 1Y8QB 5JLAA 3WYBA 3WYCA 1T2DA 1HSZA 1RM4A 3FTNA 4R16A 3IUSA 5A3JA 1LRKA 3U4IA 5I9LA 4PLCA 1ZBQA 4CLHA 2C29D 4QTZA 1NHWA 1X7DA 2RBEA 3NTOA 4TRJA 3RU7A 4R4JA 3TZCA 1XG5A 3H9GA 3INGA 2W8ZA 5KJCA 5I7FA 3GRPA 1ZMTA 3IAHA 5EJ2A 3SC6A 1W6UA 2WDZA 3QP9A 3OHSX 2AQ8A 4I9HA 4OQYA 3S2IA 1QORA 1YONA 1P31A 4GBJA 5A03A 3ABIA 2VWGA 3SJUA 3PVZA 5A3VA 4EITA 4M49A 1A9YA 3S2FA 3PHIA 4NBTA 4BO4A 5COAA 5IDYA 3BAZA 3WQSB 1HF3A 1NAIA 5K0ZA 3CMCO 1GTMA 4NJMB 4EI2A 4IIVA 1ZK3A 4ZGWA 1XIVA 2Z95A 1VSVA 2YY7A 5I7VA 1FDWA 3HB5X 1P33A 5AYVA 3ZN2A 3WWZA 1YVEI 2AQHA 4Y6PA 5F5LA 1IULA 5C7LO 5T64A 3U49A 2X8LA 3WJAA 4BNLA 3KRTA 1Z75A 4NH4A 1UAGA 1CF2O 3H9UA 1HE4A 5HA5A 1ID1A 3PHGA 3I83A 3DAPA 5F1PA 1MG0A 4D7AA 3AY3A 4CMEC 3PYMA 3R3JA 4CMIB 1J4AA 1ADFA 2O7QA 4BO9A 4CM9A 4FSHA 1KETA 3LYLA 1GYQA 4CLDA 4YXFA 3I9JA 4IJKA 4MKRA 4AJNA 3F3SA 1HYEA 5ENVA 2IZ1A 1YRLA 5T8KA 3ZU3A 1P1JA 3UXYA 2O3JA 3PYLA 2Q2QA 4XR9A 3I9NA 1BVUA 5L40A 4YJHB 1QR6A 4ALLA 2O3UA 4DLAA 5BSEA 3IQDB 2DPGA 1X13A 2Q4BA 3KHUA 2IYOA 1C0PA 2HDHA 4Y6SA 4CV1A 1I0ZA 2FR1A 4DQUA 2O3RA 1DC5A 4MVJP 5GMOA 2J3KA 4AJ1A 2ET6A 2YV2A 4XRGA 5B1YA 2BD0A 1DFGA 2B4QA 1AXEA 5J23A 2YHUA 1Y8RA 5KVCA 4BO0A 1YBVA 4MOWA 5GZ6A 4EUFA 2W98A 5G4KB 5JYDA 3JD0A 3L9XA 4K26A 4DVJA 1E1KA 2Y0DA 1PS0A 1LNQA 4YA6A 4YR9A 1R4NB 1WZEA 1A72A 1E7SA 4W82A 1W0CA 2DKNA 3GVIA 1FDVA 4XYMA 4ESOA 4NBWA 1O95A 3AK4A 4AJ2A 4KUHA 4BNGA 2DC1A 3ENNA 4U0JA 3WMWA 1PJ2A 2QZ9A 3WFJA 3MTJA 3TZQA 4GGOA 4AJKA 3H6KA 4LCJA 2GRAA 3VPSA 5THQA 3UVEA 3DHEA 4CMGA 1UJMA 2Q49A 5AOVA 1FDTA 2I67A 4HFRA 2PA3A 4C4OA 3VH3A 1XR3A 5DBGA 4PVDA 2BI8A 4Z9FA 1W4ZA 4H16A 3RUIA 4EJMA 4GI2A 3QWBA 3GUCA 4HX5A 1HDYA 5JDIC 3HDYA 3AI2A 3FI9A 5EL0A 4B4OA 1NBOA 5U1PA 4RJTA 3GFBA 2JD0A 4OSPA 4XWYA 3HN2A 2YYYA 1ZH8A 3ZV3A 5JNLA 3ZU5A 3DZGA 4LGVA 3GA0A 1HYGA 2YQ4A 4K6CA 3WGTA 3PTZA 4CLRB 1B3RA 3H5NA 1H94A 3JQ7A 2CMDA 3KM0A 3ZWCA 1PGQA 1TA4A 4B4WA 1ZZEA 3AOEC 3ASUA 3JQ6A 1F8FA 2G1UA 1LA2A 1E5LA 4IPTA 2X0IA 3I9MA 5B4UA 3HUDA 1C0IA 1KVSA 1T4DA 3C8MA 4KWIA 4LMPA 1H2HA 4NPCA 4CLOA 4MVJF 4ND2A 2X4GA 3K31A 3NGLA 1DRWA 2VNAA 4UVDA 3NEPX 1B8UA 1PZFA 3IP1A 1YBMA 2VOEA 1YS4A 5I9NA 4FQ8A 4U8GA 1U4SA 3DAGA 2V6MA 4D44A 1ZJZA 4FOSA 7ADHA 4YB8A 2QRKA 1FJHA 3AM3A 5JXWA 4HBGA 2P68A 5KVVA 1R15A 1NFFA 5CEFA 2C54A 1V8BA 2D3TA 1VJTA 4QO8A 4CM6A 4H15A 3ZWXA 3M2PA 4YJDA 1NP3A 1NHGA 4PZEA 4E30A 2LDXA 2O48X 3UCXA 4J7XA 1Z74A 2UYYA 2VYND 1I01A 3COSA 8LDHA 1JW9B 1EZ4A 2FMUA 4R9SA 3F5SA 5EQDA 1Z6ZA 5LDGA 2B5VA 2NTVA 2FWMX 2ZQYA 4E6PA 1PS8A 1Q0HA 1QV6A 4IS2A 4A26A 3NV9A 3M1AA 1P3DA 4TRRA 3SLGA 2Q45A 3TL3A 1AHIA 4RQTA 3RFVA 1E3JA 1HKUA 2OORA 1DIBA 3QWIA 2D1YA 4NG5A 1E7RA 1PR3A 4OGWA 3KEQA 1IOLA 4Z3KA 3K9QO 3PZRA 1LSOA 2AW5A 3CPSA 3ZNPA 5T5QA 1EVYA 1UXHA 4BNUA 2PFGA 4D3FA 1QYXA 3WLFA 3G17A 2IYPA 5KWEA 4ALJA 2VTDA 1XELA 3LLSA 2NVBA 5EERA 3KBOA 2ZATA 3FWZA 2RCYA 1SMKA 3GHYA 2TMGA 1E3EA 1KEPA 4TWRA 2E49A 4A5OA 3OETA 5KJ1A 3GGGA 4J1NA 2BHLA 5KJ6A 2EW2A 1KERA 4O5OA 4UVEA 3C7CB 3R3SA 2EKQA 3QVWA 4IBOA 1DAPA 4XIJA 3DTYA 2XXBA 3WR5A 4BO7A 1E7QA 4RF4A 4XJTA 3PQDA 4IJUA 3D7LA 3U4CA 3ULKA 4FB5A 3Q9NA 3N74A 2EW8A 1I24A 1DRUA 3VH2A 3W4KA 4CLOB 1N1EA 2D0IA 1Y81A 4OOFA 5L4LA 1E77A 4WCFC 2JKVA 3JQ8A 4RVFA 2FRDA 4D43A 2CVOA 1T2AA 3GQVA 1GAEO 3PHJA 1BSVA 4LCEA 4Z0HO 1EUCA 4QUKA 4YRDA 3FBTA 1E3SA 1WMBA 3RC2A 4C7JA 4Q39A 2Z1MA 1Y6JA 4J0FA 1DXYA 4U6SA 5KJFA 2GN8A 2HMTA 2X0JA 4FJ1A 4W9NA 1X7GA 2Y67A 1Q2XA 4I5FA 3GDGA 3EUWA 1LI4A 3GOHA 4BB6A 3JQGA 1BXGA 4NU5A 4CM9D 4DREA 4PFJA 3V5NA 2D5AA 4B7XA 4IDAA 2VRBA 3IKTA 4JQCA 1ZXLA 4A73A 5DOZA 4DLLA 4F6CA 4NU6A 4CMBA 4DPMA 1UXJA 4XR4A 5JAZA 3DBLA 3OEWA 5KIAA 3GMDA 3OMLA 4QO7A 4C7KA 2B4TO 3FBGA 4BKPA 4J6FA 3OQ1A 2PGDA 2TMDA 1WMAA 3RKUA 1U3UA 4EEZA 1UDAA 5LDHA 2PD4A 4LW8A 1YOVB 1HWYA 1KEUA 3O03A 5A4DA 1DDOA 3JQEA 2Y1GA 1KVRA 2QHXA 5BQFA 3JV7A 1JTVA 5ITWA 3HNPA 1OC4A 1LEHA 4OSOA 1G6KA 1NX6A 2D4AA 1M66A 4OAQA 1V3TA 4HV4A 3G0OA 4WLEA 3OJOA 5FI5A 3FTPA 3GZNA 3RUFA 4YAKA 2GUGA 3PDUA 1SZJG 4YCAA 1VKOA 5K6AA 3JQFC 3X2EA 5TT1A 3GNQA 3QWAA 3GEGA 3FNGA 4CUJA 1RPNA 1I8TA 3RAJA 5JAMA 3MEQA 2AHRA 3OEYA 3KYDA 1CYDA 4RL6A 3WGZA 3ZU2A 1BXZA 2WE8A 3PQFA 4ALNA 3L6DA 4W7IA 4Z6KA 4UUOA 2FHSA 2EJWA 3HB4X 3WGOA 3VDRA 2R00A 1V9LA 3KSUA 1P1KA 4MKZA 3JQ8B 3L6EA 3A4VA 3I9OA 3WTBA 2P9EA 2RIRA 1ENYA 4E21A 4M86A 1PQWA 2JHFA 1BVRA 2QX7A 2DBZA 2JD2A 4LSMA 5ES3A 1ISIA 2B83A 1Z7BA 3IOYA 4Z3DA 1V3UA 3GUYA 2ZTLA 1YWGO 2J5QA 2H1SA 2A94A 3QVXA 3PPIA 3ZW9A 5I8WA 2CDBA 1PGPA 3PDJA 2C20A 3F1LA 3DHYA 3H5RA 4G81A 1NAHA 1PJSA 1QYDA 4IM7A 5DZSA 5COQA 3JQGB 3B70A 1BXGB 3U09A 4R5MA 2FR8A 1V3VA 1T24A 2NQ8A 1H0KA 4L75A 3SJ7A 1LC3A 5IG2A 1R4MA 3RUAA 4TKLA 2QW8A 3ETGA 4RZHA 1TXGA 1EVJA 2GCGA 1W8DA 2Y99A 1I32A 1A71A 3DBLB 3I1JA 4NHEA 1CERA 2Y05A 5BNIA 2FY8A 3VDQA 3ZWWA 2IXBA 4A0SA 2EJVA 2R2GA 1NVTA 4GQAA 2CD9A 3QW2A 4EJ6A 1A5ZA 4JGBA 1R12A 1WVGA 4UEOA 4PG5A 3PWSA 2BGMA 3IP3A 5DCYA 5JDCA 3OIFA 1UH5A 4BGEA 1DO8A 2JL1A 4B8ZA 1Q0QA 3GVPA 1ADBA 1A7AA 4RVHA 4E2YA 1N9GA 2EGGA 5L45A 1ZMOA 4KTTE 1H9BA 2X86A 5AXBA 1C14A 5JCXA 4ID9A 3VVBA 3TQHA 4I5DA 1EBUA 1U3TA 1D4FA 1V6AA 2I3AA 2QG4A 2PNFA 4O63O 2C07A 3Q3CA 4NBUA 1LLUA 1GPDG 3A28A 4WK6A 4CUKA 4A27A 4YACA 4BGUA 1BTOA 2PLAA 3GEMA 1CQIA 4I5EA 3JYQA 5BNTA 1P1HA 1LLDA 2X0NA 2CZCA 1K3TA 2I76A 3V2UA 4Y67A 3GN1A 5IN5A 3ZDFA 4L4XA 2JAPA 4PLFA 3WIDA 3B1FA 1VI2A 3ZI0A 1U5CA 1B8PA 3KYDB 4XQGA 1T2EA 4XQEA 1YJ8A 3NTQA 3GLQA 4BKRA 1W73A 3PJFA 3DB2A 4E32A 5DP2A 2UUPA 4CMJA 4BMNA 3BHJA 1G0NA 1LDNA 2Q46A 3KVOA 3E5RA 4HUJA 1EQUA 4UEKA 4Q3DA 4TKMA 1R0KA 5FYDA 1KY5A 4YEDA 3UHAA 3IL2A 5HWSA 1KC1A 3LLVA 4ZQFA 3IJPA 4I5GA 1QP8A 4WLUA 4J1SA 2P5UA 2ZB3A 5TJHA 2ZYAA 4BNWA 5K9ZA 4B4VA 3F47A 3KZVA 1GV0A 3QLJA 3GVHA 4MP6A 2VNSA 3IIEA 1E6UA 1O8CA 4RDIA 5EQFA 2VZ8A 4GLLA 5ADHA 1I2CA 2WD7B
chains in the Genus database with same CATH superfamily
1P91A 2VEDA 2IVZA 1NR5A 2Q21A 2P30A 3PPWA 1K4MA 3TLJA 5HSGA 3FDXA 4Q4AB 1L4YA 3ZE2B 4BN4A 5EJ9A 1VYVA 4OK3A 1AVTA 2VPYA 3TOVA 3CGWA 1V4BA 1EAMA 4DILA 1YZVA 4YJ3A 3L0PA 1HO3A 3WSVA 1CJCA 1K5PA 1EXWA 2CFCA 2MYUA 3GU3A 5EXSA 3G1UA 3ILYA 4QRIA 3GJZA 3VTKA 4RTKA 3TCKA 4PZCA 1NTRA 2NN3C 1KS9A 5TVKA 5TRTA 4BTVA 2WZCA 2ZIZA 3MJCA 4RPHA 4HNUA 5FT9A 4WMLA 2BTQB 3EZ9A 3V4OA 3DD5A 1WDLA 1T9HA 5GONF 1CRQA 5EJEA 4N5LA 2AI3A 4H1HA 3T54A 5DV9A 3VZPA 2OCGA 3TWOA 3VFDA 4AQYB 3ZQJA 1YKGA 3MT8A 1N9GB 1XTPA 4MPTA 4LY3A 1OX6A 3U3OA 3W05A 4OX9B 1LBQA 2CB9A 1LSUA 4N8SA 3OICA 4IHJA 4RPIA 1Z4QA 3HA5A 1NL3A 4JOBA 4RGYA 4E08A 1P7ZA 5A6SB 2W71A 2I0FA 2IH2A 2E18A 1QVRA 4ZO6A 2WA2A 3U4MA 2OHHA 3MOIA 1GN9A 3QYAA 5HKOA 5G3ZA 1DKMA 3WL8A 1RJWA 4US0R 1E8DA 4MVJA 2HK8A 4IMRA 2P3OA 4RGVA 1XQ6A 3V8PA 2QMYA 5LJLA 1W5AA 1JE0A 1GD1O 1M2EA 1ZL2A 3QLTA 5KB3A 3O3CA 4YAOA 5LMZA 1D6JA 2XVZA 4GE0A 1YCGA 1NKTA 4MV8A 4Q1CA 4TRMA 5AI8A 2IZ0A 1B2RA 2B98A 1D2AA 4EI9A 2MOKA 1NVUQ 2Q5OA 3WGVA 5JZMA 2C4NA 4LSZA 1A9ZA 3F8TA 5CA1A 5EZ6B 4KX5A 4HQOA 1KKLA 3OSUA 3VDXA 3O8LA 2BFEA 1EFDN 1EFAA 6ADHA 2ZYVX 5FOSA 4E5DA 3EVTA 4EEKA 3FD8A 5FOWA 4A8JA 3DE5X 2X0FA 2V8OA 1A4IA 1RXEA 3EUAA 4FOPA 4GP7A 2WJYA 1H4QA 5CM8B 5B4TA 1Q7CA 2H4XA 4GD3Q 1U2TA 1UBCA 4MKHA 4QOIA 4UOEA 4PFQA 2OBYA 4A8PA 3PSHA 1SU8A 4YWJA 3U31A 3BMQA 1V25A 1XZLA 4R84A 5C0OE 3UMGA 1AF7A 1RKBA 3OIDA 5L6LB 2R6AA 3F78A 1WP4A 3KV3O 1MQSA 4M87A 3LKBA 3BIWA 1YRAA 4L57A 1EE9A 2XTNA 4YCJA 1UP6A 2O6LA 1HQDA 2HHLA 2IEGA 2OAEA 3NB0A 2XNDA 1NZFA 4HAVA 3ZWQA 4C5BA 1QO9A 1VHTA 2HF9A 1KIMA 3HJCA 4OBXA 5BXYA 2BY4A 3G79A 4YONB 3TXYA 3U7QA 5L7TA 4YRKA 4I1SA 1H2WA 4EMUA 3LOQA 4JQZA 2BR5A 1QS0A 4W4TA 2JLVA 2XHEA 5B1DA 1ND5A 3T9EA 4UQOA 4DDVA 4NEQA 5B1SA 5JPCA 4YHHB 1ZK0A 3SHVA 3UCEA 2ZITA 5JCJA 2CUTA 3MELA 2GPTA 2R6JA 1LDMA 2ILVA 2R4QA 3BERA 3E53A 2WSYB 4FMPA 3HKDA 5KJEA 3ZQ4A 3ZX4A 3RRYA 3P1JA 3O94A 1XP5A 2PMWB 1XEAA 4AMGA 2CBZA 3HO6A 5FJIA 4GOOD 4FT2A 4M2LA 4XZ3A 1TM7E 1C80A 2AFIE 3SSNA 2DTDA 4G8BA 1IZZA 1L3BA 3D3QA 3KD3A 4BP8A 1P5FA 5JSZA 5CCDA 4G1CA 3CT4A 2FW9A 3DAFA 4RZSA 3AUAA 4IKPA 2RK4A 2V6IA 1T8PA 3ZDRA 2WSMA 1L7PA 1SD2A 2NU9B 3OAAD 1L5HA 2CLHB 4GUDA 1L7DA 4ES6A 5SZHB 3K70D 4XEUA 1XCMA 1E2IA 1YFLA 4LVCA 2YOFA 1NBMD 3O9VA 3O2SB 3TB6A 5ITSA 2FPIA 5KVAA 3AF2A 5TDHA 4R1PA 4W6ZA 5HKBA 2HCTA 4UNRA 4CEIA 1IQUA 1JIVA 2XTZA 1TA9A 1YBHA 1J8YF 2ATVA 2HO4A 2PLWA 4GXTA 4KC0A 4F2PA 3QHAA 2ILTA 4QQKA 4PTYA 3TB4A 4D97A 5IH3A 4OX9Y 1A7UA 2PQMA 4ZRMA 3VMMA 4CM7A 1ZD9A 5AKKA 1RFGE 2X7HA 4ZYVA 2XT9A 4AU1A 2A4MA 3C70A 5IH7A 4Q6WA 3X1KA 5P8WA 5HYVA 1BWPA 4CL3A 1CR0A 4JODA 4R54A 5EJ8A 4ENVA 3I61A 1P29A 2PG3A 3GYBA 5CM9C 2CNOA 2D5CA 3KO8A 4BKOA 4RQAA 4WFKA 1TFRA 2PEYA 4B7ZA 3WMFA 1ZUWA 2BFEB 4OQMA 3K6RA 5LZ7A 5AHRA 1U6KA 3AL2A 3M4YA 1H9CA 3K0BA 1TZMA 1ZQ1A 2R4TA 2PU7A 3DQZA 2AF3C 1G7TA 5IJ9B 2VPTA 2ZB4A 3GFRA 3PJGA 4BEJA 4HLUC 3VR5A 1QO7A 1W36C 4JP8A 3UFBA 4J1TA 3BMQB 5CGQB 1NXOA 3EYWA 5FHQA 5JOQA 2CE2X 3HR4A 3OPYI 5HTKA 5ICMA 2CV0A 1XTJA 4V2UA 3D2CA 2P4QA 5J5AA 1LVUA 2JAOA 5FTKA 3C15C 5B36A 5JU6A 2FN9A 3CW2A 1TM2A 3B78A 3U7QB 3W5SA 1H2FA 1PR5A 4KU4A 5CPFA 5ER9A 1Z4LA 4Z9AA 4O4JB 2O1XA 5FBKA 3MJRA 5JZBA 1WMSA 4Z4FA 1E2GA 1P5HA 1Y9JA 4BLTA 5F1YA 4WTOA 2NZYA 3FFAA 1QLJA 4R69A 4UEJA 5HF9A 2VO1A 1FRQA 5EGNA 2HWYA 1TU0A 4ALIA 4RV9A 1ISMA 2Z2YA 2YWJA 3HKDB 5FWXA 4RPKA 5ARCA 2Y1EA 3HXOA 1A2OA 2X6RA 2W4IA 2H11A 3C24A 3TW4A 4KGXA 3IT1A 2EG9A 4XJXA 4E22A 3WB0A 2R6GA 1FL9A 1IWOA 3GJ6A 2X9VA 4OH7A 4OXKA 2NPFA 4LOHA 2V7GA 3B52X 3L4BC 1I51A 1GPJA 2ZRFA 1FMJA 4BE4A 4GQBA 2Z08A 3KQUA 5JSZB 4QDZA 4YXWA 2IPAB 2V9ZA 1ODKA 4HN4B 2PXAA 2HK7A 5HDQA 4ARCA 3UMFA 2EFDB 2NUTB 3LDHA 2IYNA 4QODA 3ETLA 1BJKA 4JQYA 1D4AA 3IILA 3DG9A 3KJXA 3MILA 1U0SY 1A27A 3CY6A 5JYEA 2PZBA 5TSDA 3GJTA 2HSEA 5DX1A 3RS0A 3VR3A 1G7RA 2DCMA 2H5EA 1WUIS 4ZAGA 3IIJA 4CEIB 3OO0A 4KQ6A 4Y1EA 1Q11A 3HSKA 5AUOB 2QTTA 3VU9B 1NT2A 2W2XA 4UU7A 3AU9A 2P4UA 1W5FA 5CDGA 2IHZA 3R5TA 5KYKA 3HBFA 1OKKD 5DNYB 1EQ2A 4MZXA 1Z47A 2WTNA 3PDHA 1Y98A 4H1TA 2XDAA 5I9MA 1LFDB 1XGKA 3DL4A 3RU9A 1QZ3A 1VDZA 2ZR8A 3F9CA 4BE9A 5FB3A 4G63A 1IIBA 3INYA 4L02A 1G59A 2JLWA 1YIAA 2RH9B 5D7BA 1J2EA 3ZU4A 3LQYA 1SRQA 3LS2A 4DB2A 1BJTA 4E3ZA 1M1XB 3ENKA 2AC4A 1G7SA 3DMTC 3E1GA 1UDWA 3DKIA 2D0DA 3D3KA 5LQJA 1MC4A 3FFBA 1EMDA 5F78A 4NZ9A 1QR2A 3MHTA 2R3SA 1YU9A 1YBFA 4R51A 3L7OA 4GI7A 2Q4OA 2YDXA 3VSEA 1WF6A 1JT2A 1CIPA 1TO2E 3H9CA 3UWPA 3I05A 3ICVA 4JLBA 3U60B 1USWA 2FFHA 3OT1A 4U02A 1P3Y1 2AN1A 2C9MA 2RHRA 1KZHA 3Q8KA 3BE6A 4HUTA 2VSFA 1AZWA 1L7XA 3E2IA 3O8BA 3ZVLA 1GKLA 3GJRA 5HRAA 3BCRA 1SOUA 1F2VA 1NLZA 3KJZA 2WNIA 4GOLD 3KR0A 4O25A 2GTPA 1NUQA 2GHTA 1DCKA 3HRIA 1X38A 5AUNB 1YZYA 4JI8B 4TXNA 2RGUA 2WILA 3C1AA 1N92A 3GWGA 4ZOAA 5ALSA 2HQBA 1F5NA 1RACA 1RZUA 4MPRA 3ZBUA 5AD1A 3BQMB 4HJRA 4URUR 1DSSG 1HQKA 4YRQA 3VKFA 4BNXA 4GSYA 5HZHA 3FDZA 3BKXA 3OCWA 5GVRA 3U17A 4KH0A 5CEEA 1F60A 3CZ4A 2QAGA 4IFBA 1BC5A 3PGJA 1UPFA 4X41A 3AR4A 3PEFA 3HVUA 5KQPA 3QH4A 5FWXB 3L6UA 1XYVA 1JA0A 3CU5A 3IR7A 1Y4AE 4BLOA 4XUGB 3NRJA 2LV8A 3GDHA 5BOVA 2PPVA 4Y98A 4ACBA 3PGLA 4BVGA 4V3CA 1GQOA 1LBHA 4MINA 1QNFA 2IU3A 3R1IA 3IAS1 4PG7A 4NP6A 4I55A 4Z51A 4NCHA 3VV2A 1WEHA 4R6WA 2GRJA 4TN1A 5FTNA 3MAGA 5AXAA 1VE7A 1IG0A 2AMFA 3H5AA 1AKWA 3VNSA 5DTQA 2J0EA 1KBZA 3TOXA 1V96A 1ZSVA 5EUQB 1AD2A 4OXQA 3NKVA 2VQDA 1LC0A 5EMNA 5LNK1 3GNTA 4DLSA 4R81A 3IULA 4UTOA 3LQQA 2JGNA 3KOOA 5DXFA 4TMVA 1EG2A 1NRWA 4K9SA 2F3RA 4BFZA 3CXUA 3R9IA 4EY4A 4D79A 4EG7A 3C43A 4B3TB 1I94B 1ABFA 4HQRA 2QTMA 1QQBA 4I1VA 2WUDA 5BQPA 4QOEA 4UDNA 1ZIDA 3VR4D 1UIRA 2JIDA 3P9ZA 4P7KA 1VIVA 2X76A 4JLWA 3TXXA 3QUAA 5G2OA 1GTL1 3TNJA 1YUMA 3Q5DA 4HMQA 3G68A 3O93A 3SR3A 4ED9A 5K45A 2CLSA 2FFJA 1RLTA 4N3CA 3F5DA 1D4ZA 4GVLA 4MS4A 3CKLA 2FW7A 4NS4A 4BQEA 5L4SA 2IBSA 1XZKA 2JA2A 2DFTA 2AV6A 2CL7X 3QOFA 4FMCF 5KMGA 5DWVA 4TLLB 1B73A 1T5OA 1RWWA 4AIIA 1ULBA 2W42A 3AZOA 2GGSA 3R0JA 2WNHA 3W4IA 2I2BA 3GPIA 1E2BA 4WDQA 3FYDA 3MUOA 5FA6A 4A15A 2Z8YA 3QPUA 4QAQA 5AXCA 4D0SA 1EI9A 4G41A 4OEHA 4PLPA 3AY7A 4L07A 4F6RA 2BI7A 4JUDX 2AG8A 2J7KA 1CDOA 5K7SA 3OT1B 4ADSG 5A04A 4YDSA 4LVNA 3QMVA 1ZGJA 3OZ7A 1Q7TA 3NGXA 3P2KA 3QA3E 4M83A 4RXTA 4NCBA 3JR3A 4OAPA 3IEPA 1SXJD 4BAZA 2F17A 2I3ZA 3F4BA 3FWNA 3BFJA 5EJ7A 1EWKA 2EJTA 3FNHA 3DFKA 4NMMA 4ZTBA 3LUAA 4B3HA 5A9SA 5CFZA 4UBKA 5TMPA 2CHQA 2WFAA 4OGFA 5KQRA 1R37A 2WZBA 3WYDA 1JLKA 4LJ6A 3RNLA 4B3IA 2N1BA 1Q3TA 1MX3A 3FNEA 2WV9A 4UBIA 3BMOA 4XGKA 1ES9A 2O5EA 4CV3A 1I4OA 4RTQA 3U1BA 2QAGB 4RZQA 1ZW1A 3PQ8A 4RHYA 4YC7A 5AKYA 1Q5PA 3IAXA 4DA4A 4F92B 1PRYA 2DFNA 3IIKA 3IKVA 4QOHA 5JRJA 2X14A 1O0SA 3DZBA 4EZIA 1UDBA 5CH8A 2J3MA 1T9BA 1AG9A 4JI6B 4OK6A 1HLPA 3GNSA 3LXRA 3FDJA 5A05A 5JJCA 2O5CA 3OKAA 5DBFA 2I4NA 4D80A 4M7PA 3ICEA 4RK1A 4I55B 4ZO9A 4FGUA 2BGKA 3KZXA 3KQVA 5EPOA 1MMFB 3H86A 4BLWA 1W88A 1XYGA 4QT4A 5D3KA 1CVIA 4KLNA 1HE5A 1J23A 3DBVO 3V33A 1UBNA 1T9GR 2L82A 1P19A 3C3XA 1MQ9A 1P2VA 2ZR9A 3RVPA 4I1PA 1U7HA 1DV2A 1X86B 2FKAA 3WNDA 1EFHA 2GFHA 5EOVA 1AQJA 1N33B 1M0WA 2B25A 4NCIA 4TKZA 2MR6A 1WQ1R 4LXIA 1SM4A 5EE5B 5GP1A 1EJ0A 1I2DA 1N57A 3OO1A 4IQ4A 3G1TA 1JDVA 3A0RB 1JZQA 4IEFB 4LSGA 1DO0A 3SN6A 1MTZA 1T8WA 4OB7A 1L5GB 2JGRA 2BI4A 2JJ2D 5A4FS 2CNKA 4HV4A 2I7CA 2ZSBA 2J5KA 5HM6A 1OIVA 2FOIA 4G0ZA 4IQGA 1AMNA 3EB9A 4XWOA 1WCYA 1QK4A 4GWLA 4Y6LA 3RT9A 2HMUA 1NRXA 1QYVA 2WP8J 4JJ7A 1NYTA 1ZGBA 3SD7A 2OXIA 1I6WA 1N5JA 2Q8PA 1ISFA 4MS4B 3QJ5A 1P18A 4YAGA 3PLRA 1UC9A 1YASA 2X9QA 3VUFA 2VKTA 5AESA 4AYTA 5EIEA 1FYDA 5L53A 1SO8A 5AW9A 2XNKA 4PYMA 1RXVA 5BSGA 2ZWOA 4MQBA 2C1ZA 2R6FA 2F8MA 1ZP6A 4WKPA 3L5OA 2GD1O 3O1LA 2Q99A 4ZXPA 3ZHQA 2IYUA 1G3UA 3C16C 4ZO8A 3VYVA 2RGNC 1Z26A 1IE3A 3AR8A 4JP3A 3WL4A 2P40A 4BLPA 4BO0A 1EUYA 4WKGA 1JJVA 1LPAB 4O33A 3CCBA 2E5LB 1KYXA 3DZFA 1XHEA 3G13A 3OKPA 2XAAA 3PXXA 4H31A 1CP2A 1LLQA 4B9EA 3AKEA 3MFYA 5IXSA 1EVKA 3M9WA 5B3AA 2OYRA 3RE1A 3DBIA 2RJ3A 3IQXA 5BWCA 2QY9A 2O7SA 3ZWYA 1TDJA 1DHRA 4RY2A 3UMBA 7REQB 1UWLA 3DTTA 5FUQA 2CVQA 5A9SB 1I4DD 3FOCA 4B4UA 2L17A 1DMSA 5K4AA 3OPQA 1SAYA 1VIYA 1XVIA 3LHSA 3ZLVA 4CFZA 3BS4A 4MVJM 3BE4A 3Q2OA 3GLIE 1S89A 1KMQA 2FH5B 4JEUA 4KGZA 4QPJC 1HZZA 3IP6A 3P20A 4AUKA 3QV1A 3BMOB 4IOJA 3GFPA 2PX6A 3PGMA 4RK5A 2ODQA 2WSSA 2H57A 3V1LA 3QXCA 2BLLA 1WDMA 1ZSYA 4NARA 4XVHA 2QYSA 3RS3A 1O1YA 2BSAA 4ZO4A 2EAUA 4NJOA 3D2BA 2R7KA 3DYBA 3DOUA 3MWDA 1KEWA 4AF8A 1Z0DA 1O87A 3PUKA 2QN7A 4ZICA 3R8XA 2VNJA 1DC4A 4BDTA 1B74A 1LNZA 2GTIA 2XEXA 4LJ9A 2COEA 3ASZA 4UM5A 5CJ2A 5THXA 3SSAA 2N46A 4DXDA 5CDSA 3SYMA 3GP5A 4EH1A 1W88B 1BVHA 5BW4A 2CDAA 2WJAA 3DA8A 1Y9EA 3QRWA 3VVCA 1UR5A 1LX6A 3OC6A 1FFCA 1OMOA 1MAVA 1CJKC 2DWUA 1R5BA 2OAGA 3VC2A 3BHNA 2F00A 2ZIUB 2VYCA 5GV7A 5A9TA 1G5PA 3TMKA 3TMAA 1XKTA 3J7TA 3WK7A 4JY7A 3GXBA 1Y82A 4MW9A 4WJZA 1HOTA 1T0PA 3TGWA 2COUA 4OG2A 3U80A 1Z83A 1KH2A 3DLTA 3EAFA 1I30A 2QQGA 4Z7OB 1YQ9A 2ENWA 3TFQA 1SEVA 3TIFA 2ZG6A 3TTYA 5BRNA 3QU5A 1EHYA 1QOZA 4TMKA 1GNSA 3OF3A 3T95A 1YQGA 4LJYA 1ODLA 2UVDA 3KHKA 2JW5A 2PUJA 3IEIA 3PCXA 3PF8A 4DS3A 2RJOA 3WXBA 1V5FA 4CIWA 1NI4B 4Y2QA 3PXBA 2PM8A 1MD9A 3KB1A 3I4CA 5D7NA 5EP1A 4IDDA 3W8EA 4D8YA 2D59A 4LXYA 2I6UA 1J42A 3EPHA 4H0CA 1A9OA 3B7PA 2Y1DA 5EHNA 1CRWG 1Y3BE 3WBBA 4ZJZA 2JIQA 5KTNA 3IELA 4CG1A 1GZDA 2P0YA 3H3FA 1U8EA 3BN3A 1K9VF 4KTVE 4LC1A 3ZHYA 4D96A 1GFZA 4F9FA 5CDHA 1R9JA 3G5AA 3G8YA 3SX2A 2C7OA 1YS1X 3MRSA 4L5IA 1VIDA 3S2UA 1ISHA 2FFBA 3LRXA 4RVOA 2X8AA 4KR7A 2WWTA 1K5GA 2R1TA 1PFWA 2NV6A 2YHAA 4ZJPA 2IS6A 3CZQA 2FJPA 4R8SA 4X24A 5K6AC 4M89A 1J99A 2ATXA 2GZDA 1L5OA 4FDAA 4FFNA 1DIGA 1HUQA 2QR2A 4GO1A 4U7DA 4S04A 2IU6A 1YCDA 2CXRA 4OQ4A 5F64A 2AJTA 5E3IA 5B30A 821PA 1X15A 3K09A 3U4HA 2HB6A 2A9FA 2UKDA 2XOEA 2DTEA 3SHTA 2ZSIA 3WSTA 2DAPA 1NF2A 1J5XA 2YXPX 4PLHA 5BYJA 2XRMA 4QQ8A 3WOVA 4YRLA 4F72A 1N34B 4V0LA 2H1OA 1QE3A 1RLMA 2QTNA 4C4ZA 5IM5A 1RZRD 1MF7A 3PA6A 2JH3A 3ZLBA 4FEYA 4QD3A 1K6XA 2W90A 1P2TA 4MUMA 1ZCZA 4FZRA 2J0SA 5E6UA 5K0SA 1NW3A 1Y3FE 1KDYA 2AB0A 2IPLA 3EEYA 3EGEA 4I9FA 4KQ2A 5IF3A 5A5VA 2VJLA 2VJYA 1N9ZA 2O07A 1UJ6A 3M34A 3LWBA 5CIQA 5D1HA 2OC9A 3MWDB 4D92A 3W8FA 2HH9A 5DMXA 3N1UA 5TB5A 3DDUA 2AEEA 3U44A 2ZPUA 5B64A 4RTSA 3PXEA 1JPJA 4DY4A 2AMYA 2JIBA 2ZT8A 3E82A 4P36A 5SY9A 3D3EA 1C3EA 4C89A 2X2OA 4QDXA 1C1XA 2A57A 3K3PA 2HYDA 3FMPB 2XT6A 3PNPA 4GLOA 1I7LA 1QFJA 3CS3A 4MV7A 1C7EA 4WJKB 4N0EA 1JKJA 2GF2A 1NN0A 3ID6C 3QI7A 2IBMA 2WK1A 3NDIA 2FPWA 1EGQA 1K92A 3SY8A 5EWLA 1VLLA 4F0JA 4L9AA 2E87A 1F7VA 3OEHA 3S2EA 1CQIB 2PS1A 5LP6A 5IDWA 2XXJA 4FS3A 3FI0A 4Q1DA 2EQBA 2G06A 5EHXA 1VXOA 5LC1A 1I6KA 1U2EA 1I3NA 1B8NA 1QDEA 2IGTA 2WV7A 1O94D 2O20A 4AZSA 2XQIA 2JBAA 2CJYA 1BMTA 3QMWA 4BQPA 2F1IA 1YB1A 4B3BA 1YQDA 3WGNA 3Q5GA 1GITA 2X22A 4L5JA 2F1HA 1BXRB 1HY3A 2R8OA 2WHEA 3W1VA 1X92A 2OV3A 2VOJA 3AJEA 4PZAA 2HNAA 1P17A 4OHVA 4U39A 3A1EA 3HCNA 1FSZA 2PCLA 4XLLA 1MN6A 5B6JA 1FPQA 3K4HA 1U7TA 1SB9A 4KEAA 1TO1E 4DZTA 2R9VA 2N9UA 5H0IA 1CS4C 1ZJJA 2JI9A 3B36A 5HX7A 3DZCA 5DMHA 4QARA 1FUUA 4AO7A 2I2WA 1JAYA 4R1TA 3ZHZA 1ZU4A 2GN4A 3TR5A 5DHTA 5FPQA 1G8GA 3U4GA 3TZ6A 1E0AA 1E4EB 2E37A 2KLHA 2OV2A 2R1TB 1M0TA 1RJEA 5BSRA 4ZTZB 5JQGA 2IS2A 3G9TA 4K28A 1QZTA 2F6RA 5MN5A 2W4QA 1DUVG 3A9SA 3KAPA 2P0AA 4QEZA 2NTYC 3CMMA 1NR1A 1R88A 2CVZA 3DQPA 1XO1A 4N3AA 3X44A 1Y6ZA 3G59A 1ZSNA 4G2NA 5E1BA 3E0XA 2J41A 1J1UA 1HFKA 3BQNB 3HLYA 3V8VA 3CX8A 4LG1A 2WYWA 5M7EA 4W5OA 1GYPA 1WKVA 3OFVA 5LXTA 2QN8A 3B2NA 3Q98A 3E9MA 3OE7A 3V1YA 4H7HA 4FYHA 3VXKA 4CIXA 5HZMA 3DPIA 4HQKA 1M2KA 4Q9NA 5E6UB 3GXOA 1YQEA 4D8VA 2PAFA 4K0RA 4EY7A 3GCDA 3AT1A 2VRCA 1E0SA 4F9EA 1SBIA 1B3BA 2KQUA 4ZVRA 4ZHSA 3U44B 1K4KA 1YGYA 3E03A 2CW5A 3CCFA 5EHZA 4U1RA 3RYIB 3CW9A 4A0QA 3WWOA 2CMFA 2KW5A 4QDOA 4ZKEA 1V8PA 4UOQA 3N28A 1JZTA 2HNBA 2XITA 3V8QA 5IK2A 2HQSA 3ECSA 4LC0A 2IODA 3OA0A 4GYWA 2K2WA 3V4PB 3BRCA 4ECAA 1C1XB 4J4HA 3IP9A 4WE3A 1M6HA 2FZGA 4B45A 1GRQA 3AF0A 4YCCA 4PAGA 5A7GA 3VYUB 1XRMA 3KETA 5D5HA 2I5PO 2QLFA 4LCBA 1DQNA 1GT6A 1M8FA 3D4NA 2WYVA 2ZKIA 1QB7A 1S8FA 1G291 1JN0A 1JKJB 1YS2X 1MRNA 2FMXA 2JFFA 2VQSA 2BT4A 2C8LA 3ABQB 1QIMA 3NTRA 4NK5A 1WNFA 4TLCA 2WE7A 3RK0A 1YQWA 4U2CA 3KPWA 1IK6A 1N5RA 1ONPA 1S8NA 4IGEA 2RHLA 4PX3A 3ZUPA 5EWLB 1BD3A 2NADA 4U2EA 3O4VA 5LP6B 4ZANA 2Q5HA 3NOVA 4YUAA 3QMPA 3OEEA 4JJ8A 1B1CA 1NYRA 1SUEA 3FMFA 1H4SA 2PSFA 5FRDA 3RBXA 2ZJYA 16PKA 1FMCA 1SKYE 3B9BA 2JBAB 4FE7A 3FZYA 2CV2A 4DQXA 2PMDA 3MGKA 4CUZA 5A0TA 2AC2A 4ERNA 5CLFA 1LQUA 4KRGA 3H2HA 4MYTA 1WU7A 3U7IA 1RYDA 2HA4A 1MFPA 3JQBA 1E2KA 4DPLA 1UBLS 1J0BA 3PEUA 2ZZNA 1N8NA 3BIJA 3NTVA 3LA6A 4PHHA 4M7OA 2BZ1A 3GUVA 2FF5A 1A96A 3K0HA 4X7RA 4YJ2F 1OFTA 2W2LA 1X1DA 4C4TA 5IC4A 4ZQIA 2OK7A 3OY7A 4HWKA 2OV4A 5IF9A 1XQYA 3ZH2A 2IH5A 4BO8A 4D45A 2DMRA 1RHUA 2PMBA 3WHPA 4RKEA 2OCKA 3EZ7A 4RDCA 4RKQA 3UKJA 2VF5X 4X7MA 4ARSA 2V1UA 2HT1A 3AJAA 1BS2A 3M1LA 3UKDA 4MARA 3R75A 4C01A 5JNSA 5JQGB 2RHCA 1M33A 3RU2A 1XHFA 4H60A 3LC2O 4FS8A 4FJ0A 2P9FA 4Y9DA 5L7YA 5JAHA 1GGKA 1OBFO 3PI7A 3RS9A 5DH9A 3MWEA 3GJYA 3TSWA 1FP6A 3BSWA 4PQGA 3USCS 1JJIA 1H42A 3A10A 3NXKA 4I8XA 4KXMA 2G82A 1Z17A 2JFXA 2Y4NA 3PQ2A 4GX5A 4MPDA 4QUJA 5EFOA 5LXTB 4URYR 1TAQA 2FP3A 2P5YA 4J6EA 1MO4A 3RVNA 1H3EA 3E81A 1GN8A 2O0KA 5CDFA 4S1PA 5IJZA 3VX4A 3MQ4A 1XVTA 2RDMA 3KTDA 3R0IA 1NVBA 4GLJA 4JC5A 5HXAA 1JFFA 1U7XA 3BMNA 2G1AA 4DDMA 4F96A 2C59A 2G09A 3WYEA 3AB8A 2JCBA 4EHNA 1B26A 4RZIA 3AJ8A 2IEIA 1JHMA 1PNRA 1D2MA 2ZJ8A 4D41A 4L0DA 3ZYCA 3HN7A 4EYEA 1Q1AA 2BF4A 3AU8A 4G23A 4WERA 1XPOA 5FH9A 2Z8YM 4FOTA 3KTAA 4XGQA 4ONEA 3RABA 1JG7A 1OU4A 1UBEA 4Q1VA 5F3WB 4LAFA 4C2AA 4RPLA 3EVEA 4M9QA 2OECA 2BUBA 4UW9A 1BU8A 7ABPA 4U7WA 1P7YA 2A3NA 2C4KA 2JLSA 3F4KA 3ROTA 3WK6A 2ZBGA 3LUKA 4AZ3B 5C8ZA 4JT4A 4UUPA 3HL0A 2J33A 3RSLA 4QBHA 3TNDA 1X9GA 4CG3A 3JX9A 5AI6A 1AX9A 2WF9A 2ZTUA 5F3DA 3AEZA 4TYNA 1NNEA 4F9GA 5LKRA 5GJCA 4DBZA 4R68A 2O2CA 3CQ9A 4HDRA 5IAEA 1NTOA 3N75A 1VL1A 1TJ5A 4JSTA 2XUPA 3PFBA 1JHOA 1CRZA 1A8QA 4HPXB 2JFPA 4HDAA 4DIOA 2W6JD 3AUSA 5EVCA 3LF1A 1ULSA 1FUYB 2Q3MA 2GHIA 5DGXA 4PNEA 3IBSA 3JWGA 2GBCA 1CB0A 2HJWA 2WR8A 4B3JA 2E1PA 1VBKA 3I76A 4R9RA 1TLTA 2FN4A 2QD2A 5EIAA 3W2FA 2FXVA 1XZNA 3WBFA 4NCAA 2P2GA 5MDHA 4IQFA 1M74A 3PFNA 2O7VA 3FVTA 2Y1KA 4N18A 1GGEA 1FBTA 4Q4DA 4G0PA 2FQQA 3OZUA 1L9XA 4BU0A 5B3JC 1PZNA 2PZJA 3EPLA 4GVXA 1WOYA 3LP8A 3FCEA 1A8HA 3HM9A 4DJEC 2NTEA 1VYHA 3AFOA 1X1EA 4C0LA 2IUSA 1PVDA 2P2DA 1YB4A 4JENA 2WMNB 3UHOA 4P33A 3DQQA 1HEUA 3FGNA 3LO8A 3Q4GA 2YZKA 1GFSA 1VBFA 1L7AA 4WNIA 3AKZA 2W93A 4PYIA 4B7CA 4D9IA 2ZTHA 2ZRBA 1H5UA 1ZHOA 1QV7A 3GZTB 1E98A 2Z2JA 3WLLA 2WWHA 3F5MA 4JS0A 1PG0A 2QDXA 4QXRA 5A71A 4HNHA 4QPDA 4QRHA 3SJZA 3WHIA 5CFRA 5KZMB 3KD2A 3EXHA 3EGVA 1XLTA 3MWEB 2NM0A 5E4TA 3TL2A 1AQYA 1C8LA 3BH6A 2PVCA 4GPD1 4CCYB 1JR2A 1BRMA 3FOWA 5H83A 5ADHA 1M3SA 3AHJA 4LV6A 2I54A 1BX0A 3FIUA 3D6NB 4BGDA 1Z12A 2HPHA 3I73A 3TQOA 1H05A 1GUAA 4MV5A 1FS6A 4LF4B 1YK0A 1IHXA 1L5SA 4C21A 1PJLA 3BMNB 5DULA 5FBZA 5JALA 3RF7A 1W36D 3RV3A 1YNSA 5CA0F 3VAAA 2FGKA 2X4LA 1MO5A 2ZDHA 3PNBA 1TJNA 4XWAA 5T6MA 4BAGA 3DYIA 4PRLA 3W5JA 2GN6A 4KMSA 3ZH9B 4CF3A 3NHPA 5FEMA 4D25A 5IT0A 4R0NA 1WG8A 4LXHA 4R2JA 1FP7A 1R0BA 1MJGA 1IHUA 2W22A 4NCXA 5KNDH 3GLGA 1YKSA 4K86A 1RYFA 3KTAB 2OP1A 1MFZA 1KSGA 2IXFA 4YV2A 4YUYA 3MD9A 3FB4A 1U80A 2G0TA 3AR5A 2CYBA 4WY2A 4N39A 1Z8NA 1ZUD1 4F4JA 3FCOA 4BLSA 3I09A 3ZEAA 4D9KA 1AS3A 1GGMA 1XZQA 3IP7A 1DX6A 2E4AA 4FDTA 1OI2A 1PL0A 2W2MA 3RAPR 2N3ZA 2VXBA 4AECA 1PNVA 3LVFO 1AY0A 1ETHA 1Q12A 4P54A 4BVHA 2UUAB 3QE3A 1VDMA 1VMDA 3U7JA 1IVYA 4U4AA 1RM3A 2LW7A 2PGAA 4CEJA 1AHPA 4AY5A 1I2BA 4HDRB 4NFSA 4EG4A 4Z7QB 1IIRA 1MRZA 1JEJA 1DCMA 1D9XA 3MRTA 4G07A 2Q9CA 3EFHA 3AETA 2VTKA 1C1DA 3A4MA 2HMAA 3ROMA 3G0CA 1V1JA 1OA1A 2AXQA 4G5XA 4XI9A 1RWBA 4N5DA 4G4SP 3ZHUA 3G7UA 2R66A 2C1XA 4HX9A 5HZKA 2YOHA 2XUIA 2F62A 3QU2A 3VDMA 4DV1B 1P1CA 1E8NA 3ZY5A 3KK0A 1JLLA 1UBGA 3EGDA 3M6XA 5DNAA 3V4ZA 3P7MA 4MVWA 1M10A 4ZKDA 4FFVA 2YRFA 1ZHHA 4UMFA 1RJ9B 4U3JB 3QWFA 4GX1A 4TV8A 4BNHA 3HSSA 4ZCSA 2N75A 4IGKA 2YW9A 4LMRA 3SHOA 4MGIR 1VB3A 1B6TA 1VJDA 2AWNA 2X8JB 3RIHA 3ZWVA 4JUFA 4RHEA 1P1RA 1JDSA 2H92A 3EIXA 3H8WA 4W8HA 1FZTA 2PGIA 4Z0PA 3CSSA 2IE0A 3CX3A 3OKCA 3TRIA 4P35A 2NSHA 2O2HA 3PI6A 5T6BA 3VKUA 4BGIA 2C78A 2ON6A 3LVBA 1CQXA 1DINA 1MEEA 2A0KA 5TGTA 3T7JA 4B2PA 3TI7A 2N1MA 3A9RA 1Y8CA 5E2BA 5FF9A 1RHRA 5KYXA 1G9XA 3LYAA 4EYQA 1XJQA 1M8KA 3E2PA 1QIIA 1SBQA 1G8FA 1X7HA 2R6HA 4BX8A 3OOHA 3TCNA 4IZOA 4BKQA 1GNPA 3EXHB 3OESA 5HIIA 1VE9A 1KI8A 2CGEA 2SBTA 2GASA 3E0QA 4KNVA 4MRRA 4OD0A 5BNZA 4FDLA 3N2YA 1T2CA 3FW1A 3ZS8A 1V5GA 4PU0A 1QU3A 3VNQA 3KSZO 1PJ3A 4CL0A 1KK2A 5AKEA 1DAFA 4M53A 3QFHA 3GY0A 3KTOA 1QUFA 1I7PA 3K94A 1I7DA 4EG5A 1KK1A 1M1UA 1NMSA 1PJQA 2JKZA 2VHTA 3PUHA 2DVMA 4HEHA 4XE5A 1YB6A 2DPXA 1J21A 3ESAA 3QXJA 1RHJA 4ZU6X 3NYQA 3RVRA 2KPOA 2H54A 3HCBA 3PCRB 2JCXA 1JAHA 4HL6A 3RVKA 5KNBH 5IHPA 1NC1A 4RMIA 5H9VA 1SA0A 2HAEA 2XD4A 4B3MB 1J1ZA 1D8TA 4DR3B 1XRLA 4M8KA 1FP1D 4RELA 3OPVA 1Z08A 3T9DA 4INJA 3T94A 1Q15A 5I4IA 1C2TA 2HU2A 3LKDA 2GJ4A 3QUQA 5T67A 2F1KA 3S1AB 4CE6A 2RGAA 1EK2A 2PRJA 1U9IA 3LGAA 1ZEJA 4MRPA 4IVNA 4OA8A 3VH4A 2OV6A 4EA9A 4EI7A 2WQ6A 1ML4A 4Z1MD 1XAHA 1TO6A 4W5TA 2YZMA 4IQ0A 5FOVA 4E0BA 2G40A 3CRNA 1Y42X 4L3WA 3C1TA 2PKCA 5D01A 4O2LA 2EGHA 1CY4A 1J90A 1TT7A 4YMGA 1E9AA 2GA8A 5DGDA 5KBYA 3UWSA 1IZ9A 3KTFA 4CEJB 2CLDX 4TYWA 2YW2A 4OUDB 2ZDGA 1GXSA 2FEWB 2BZ0A 5K3AA 1E64A 3BG5A 2LZ0A 3EA5A 1G4HA 1OGIA 5L51A 4NJEA 3LUBA 3KS9A 3VJKA 3FLEA 1M72A 2ZRMA 1W75A 1C1DB 3AETB 3W04A 4FW9A 4B3CA 3LVQE 1R8SA 1SUAA 2ODNA 4JJIA 3JWJA 4RACA 3TDKA 3KUXA 3Q3IA 3NUGA 1JDPA 4J7CA 1WL8A 1MA0A 1NNSA 1VG9B 2XDQA 4W1QA 2QVYX 2YYSA 5BSFA 1KDPA 1JLLB 3ABSB 3EGDB 4OB8A 3RWBA 4FLMA 4JQSA 1G8PA 4AMYA 4F4HA 5TX7A 1VPTA 2FEOA 5G1NA 5B2EA 4TV8B 2M2IA 4FUQA 4HDMA 4J91A 3C6BA 1JHAA 2I22A 2FFRA 3UYKA 4BP1A 2IF0A 2EWMA 5I7SA 2KYRA 3LWZA 3A2KA 4MVCA 4B33A 4ZGBA 1KARA 4UE6A 5C8YA 1NY5A 4WADA 3TQQA 4BFXA 4A92A 5I4KA 4PYQA 5JY6A 2P0EA 2EFCB 2UXCB 1AGXA 1WZCA 1KMMA 2CLFB 2TRSB 2YVLA 3ZC3A 4D3ZA 1V4VA 3CF4A 1DBWA 4FMDB 3V4SA 1LS6A 4FYPA 2YCBA 3Q15C 3LPCA 5BR1A 3SM3A 5HGXA 5KYXB 5AVUA 1MC1A 2C9CA 2V03A 4II7A 5ALFA 4UEQA 1L4MA 2VK1A 3ETDA 2CCJA 3MCZA 4JWTA 4IWXA 5J4KA 3IEXA 1STOA 1ZNQO 3BFKA 2OFPA 1KVQA 4RFVA 1SBHA 2A1TS 1RJDA 3JWEA 4V3BA 4RVNA 2WWWA 2O1WA 1KDRA 3RC1A 1JDTA 1OV4A 2EC5A 1RVV1 3DO8A 5ALZA 2OKCA 1GPKA 2RARA 5HGJA 1MH1A 1WP9A 2C61A 1WXHA 5BR8B 4KIGA 1GQRA 3EMBA 3TW6A 5FQOA 1RC0A 2WI8A 1SR8A 3HXQA 3IV7A 5GONB 5IHXA 1BA3A 2PR7A 3WQHA 3UFXA 4DNFA 1JIQA 2GBPA 3BC1A 4WKCA 3CZMA 4YK7A 4NVRA 5T57A 2VP3A 2HJHA 4IMIB 4N7RA 4WAUA 3VR6D 2O54A 3GRKA 1JQLB 3DV0A 1OI7A 1JALA 3P2OA 2R65A 2WD7A 1SA0B 2A5DA 3HVRA 2PRSA 1JE1A 3OE4A 9ATCA 5IVPA 3ZBQA 3UF0A 5F9MA 2E85A 1HE2A 2R97A 3D7SA 3H4MA 3HCDA 4QNMA 2V0CA 2GK6A 2XGGA 2PBRA 3BX1A 4A91A 3IMGA 3WK9A 5LU8A 1KAMA 1BHQ1 3GIDA 4PLTA 2NO4A 5HOQA 1F8GA 1NUSA 2Z2IA 4PO1A 5EE1A 3W5CA 2ZYIA 2PUWA 3B1JA 2C9DA 1O5IA 3OQBA 5KVQA 1LV7A 3QOWA 1HTBA 2DUNA 2PEZA 4AF7A 3IVAA 521PA 4C88A 3D1JA 1CR2A 1ARZA 1E99A 3W6ZA 1KAEA 2YFYA 4EHAA 2FGJA 4KNWA 3E9ZA 5T41A 3WLOA 2ZI5A 2H1CA 4C0HA 2BIFA 3BH7A 3N05A 4TOIA 5DGTA 4F04A 3H99A 2EATA 3BWCA 4PPQA 5CG1A 1IN7A 5EIBC 2ZPAA 3GUHA 2NU6A 1HETA 2ZRLA 3RBVA 4NJEB 3LRTA 3W2GA 5CA1B 2QG9A 5FPSA 4HGPA 4P5EA 4OM8A 4FGWA 2QT1A 4O4LF 4UVIA 3QKIA 4X92A 1AQNA 5DM4A 2QVBA 3OCYA