3M2PA

The crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
294
structure length
287
Chain Sequence
b'SLKIAVTGGTGFLGQYVVESIKNDGNTPIILTRSIGDYEYRVSDYTLEDLINQLNDVDAVVHLAATRGSQGKISEFHDNEILTQNLYDACYENNISNIVYASTISAYSDETSLPWNEKELPLPDLMYGVSKLACEHIGNIYSRKKGLCIKNLRFAHLYGFNENYMINRFFRQAFHGEQLTLHANSVAKREFLYAKDAAKSVIYALKQEKVSGTFNIGSGDALTNYEVANTINNAFGNKDNLLVKNPNANEGIHSSYMDSSKAKELLDFSTDYNFATAVEEIHLLMRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylglucosamine 4-epimerase
publication title The crystal structure of UDP-N-acetylglucosamine 4-epimerase from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Isomerase
total genus 106
structure length 287
sequence length 294
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2010-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3m2pA00
4FOOA 3PGJA 1LQTA 5BQFA 2LDXA 1MV8A 9LDBA 1E1KA 1LX6A 1U7HA 4GKBA 1M6HA 1YBVA 3FNGA 4GGOA 2O4UX 4EEZA 5C5IA 4UEOA 1IHXA 2IEDA 4ILKA 5FWNA 1A72A 3M1LA 3TZHA 2DUUA 4URFA 1PL8A 1GEGA 2PZLA 3JQAA 4A7PA 5HTOA 5JS6A 1ISFA 3WYCA 4AJPA 3T7EA 3IOYA 4IQ0A 4RZIA 2GZ1A 1Z45A 4BO9A 3KSDO 4JJGA 1H6AA 2DQ4A 3ASVA 3V5NA 2O2YA 3LK7A 3T7CA 1IOLA 4E5KA 4MKRA 4IDGA 1KEPA 4IIUA 3BTSA 2TMDA 3HWRA 4QO7A 3GY0A 1YOVB 2Y1CA 3X2FA 3O8QA 3WTBA 2PGJA 1GUYA 3ONFA 3KLMX 1P9LA 1D1SA 1T1SA 1DAOA 1LSSA 4RPGA 4IMRA 5BT9A 3ICCA 3CH6A 3OJFA 1PGPA 3H9QA 2FOIA 4XQCA 1PIWA 3ZHYA 3EC7A 1LSOA 1E7RA 4YJGB 4WUVA 4C7KA 3Q2KA 3D4PA 2FSSA 1M75A 3DZFA 3DO5A 2CF5A 4ALLA 3KEQA 1LSUA 4LK3A 4WEOA 1N7HA 4A0SA 4JJFA 1BW9B 1F0YA 3JYNA 3I5MA 4JLWA 2NVUB 2QIOA 3RJ5A 2SCUA 1ONPA 3IAHA 3PHGA 4MVJI 4TKMA 2BLLA 4DWVA 1JW9B 4Q3EA 3GVCA 3U4CA 3S8MA 3ZWXA 3KYBA 3PJGA 1NP3A 4J90A 1NFQA 3RJ9A 3DBLB 5JDIC 1GUZA 4IJWA 1Q2XA 2HUNA 3GLQA 3SJUA 1C1DA 5TLSA 3E18A 2WE7A 5F5LA 2BFMA 4E13A 3DR3A 3JYLA 3MOGA 1B3RA 4BL5A 3OF2A 4FFNA 1NQ5A 1GD1O 4R4JA 4CLHA 3FD8A 4IXWA 5CP8A 1XYGA 2ZQZA 4TSKA 5ER6A 1PS9A 4YTEA 3ZWAA 4IS2A 2Y1DA 4N54A 4P22A 4AJLA 5JDCA 1R0KA 1R0LA 1LRLA 4R1TA 5GMOA 1QYWA 1GPDG 4HV4A 1QXSA 2C29D 3GVPA 1OOEA 1MA0A 3L6OO 4RQTA 3H6KA 1HDYA 5IZCA 2B4TO 4NFHA 2VUTA 4I5DA 3VPGA 5I8WA 3OFSA 3TN7A 3KEOA 2HMSA 4JGBA 3EZYA 3D3WB 1U5CA 6ADHA 4XKJA 2PKQO 3NDRA 1F17A 1DIBA 3DMYA 2VUUA 5JLAA 1N7GA 3G17A 3GGOA 3ZW8A 3C7DB 1T26A 3W4IA 3I9NA 1MFZA 2HMUA 4JNKA 2O3RA 3R6DA 4RQUA 2B0JA 2PK3A 3IIEA 3IUSA 4XB1A 3VH2A 3D4NA 1A7AA 2BGKA 3ITKA 2PD6A 2VZ9A 4AFNA 3BTOA 4D0SA 3KYDB 1IE3A 2PFGA 4PLHA 4BS9A 2JFGA 3B70A 4TZTA 3N74A 1V3TA 4TRRA 1NHWA 4PG6A 1DRVA 3VPSA 3WGQA 2W8ZA 5KWEA 3RUIA 3JD4A 5KKCA 4K6FA 2Y1GA 3SLKA 4WPGA 2I99A 3GEGA 5FF9A 3I9MA 4C4OA 2JHFA 2DT5A 3RUHA 1VSVA 1JKJA 5THQA 1A27A 4HP8A 2OP1A 1C1XA 4PLWA 4QFDA 3BXXA 1O0SA 3U0BA 4XYLA 1GY8A 1I24A 4M86A 2B4QA 2PH3A 1R4NB 4HNGA 1MXFA 3P2OA 3K31A 5ICSA 1K2WA 3WGYA 3WGHA 3LF1A 3TZQA 4M55A 4J91A 3R0IA 3GF4A 4OKNA 1UZNA 1N8KA 3WSWA 3Q3CA 1JWBB 4IS3A 1T4BA 5G4KB 5IXYA 3VPXA 3BTVA 4FJ2A 1DFHA 3V1TC 5JAMA 2B4RO 2WYWA 4R3WA 5A1TA 4R1UA 4E5PA 2BFAA 2DVMA 4J0EA 1EQUA 1OMOA 1DXYA 1LU9A 2P9EA 1CQJA 2WD8A 3PHIA 2IODA 5IFLA 1LLQA 4MKXA 3ROQA 4Q39A 3PVZA 3PYXA 1TI7A 3UCFA 5IN5A 3RUDA 2VHZA 4FN4A 3UW3A 1IPEA 4DTIA 5A5FA 5BSEA 1KEWA 4KUEA 2C82A 3OIDA 4TROA 2DBVO 3ZNQA 3RKRA 1B14A 1DO8A 4JBGA 3UCXA 1EEHA 3D4OA 1FXSA 3GHYA 3BZUA 4R5MA 2Y0DA 1NQOA 3KO8A 3ZV3A 3AJRA 5IDYA 5T5QA 2ZB3A 4BNMA 4Z9YA 1XWFA 2Y67A 3T4XA 2BGMA 2Z5LA 2BHLA 3WJ7A 1CYDA 1EBUA 3SX2A 1EE9A 1NFRA 3KHUA 4DYVA 2O3TA 3JQ8B 4QSMA 1HSOA 4W99A 4D3DA 4UUPA 3OA0A 4EUFA 4J43A 3UICA 5F1OA 1XU9A 4HNHA 4Q3BA 1HDRA 2H1SA 1D8AA 2EP5A 3R3JA 3SXPA 3DWFA 1EDZA 1QSGA 2W90A 1H9BA 4WCFC 1I36A 4IZHA 2NLOA 4IDDA 1LLDA 2DKNA 2DFDA 4Y6PA 1KVUA 1GDHA 1A71A 5BNFA 2DC1A 1PX0A 1MB4A 5TT0A 2J6IA 3QY9A 2NVBA 8LDHA 1JDJA 3IL2A 5G0SA 2HU2A 5ER9A 4J0FA 1EVJA 2JHGA 1NR1A 2Y93A 3JSAA 1GZ6A 3WTCA 4B3HA 3VTZA 1ZNQO 4J3FA 4WJZA 3DL2A 4HKTA 3QRWA 2NM0A 3HB4X 4HUJA 4BNWA 1BGVA 3GR6A 4ZQEA 4B4OA 1JU9A 1DIHA 5CPBA 1HDGO 1AGNA 1PJLA 4DMLA 4YAGA 4XGNA 4GAEA 1GV1A 1Y81A 2X86A 5COQA 4CMBA 1NFFA 4I5FA 3VVBA 2NUAA 2X9NA 1KC1A 4ALKA 4E2ZA 4RVGA 3I4FA 1ISGA 1SEPA 1BXGA 1S6YA 2D4AA 4GL4A 3ONDA 1GAEO 1I33A 1ENOA 4QX6A 4LW8A 1EBFA 3TWOA 3ORFA 4MKZA 8ADHA 1E1LA 1YB5A 4YYZA 5HS4A 1XIVA 4ZA2A 4PN3A 1HZJA 2JFFA 3GA0A 1Z82A 3ANLA 3ROPA 3GDFA 3UFXA 4L8VA 5GZ6A 3TFOA 3M2PA 3R3SA 4RF4A 1IULA 5DF1A 2GERA 1ZJZA 4J4BA 3PGXA 4NK5A 4B8ZA 1C0PA 3ZWBA 1PSDA 4PZDA 2VNSA 4TVBA 2CUKA 5KIAA 3TOXA 2CMDA 4CQMB 4EJ0A 5JMWA 5CEFA 1DC6A 3IS3A 1NAIA 5IF3A 5JDIA 1ZUD1 2IXBA 3ABIA 1HF3A 1YONA 1AN9A 3OIFA 3TQHA 4GMFA 1T25A 2IYPA 2P4QA 4RCVA 3WS7A 2GRAA 3KXDA 4B7XA 3PP8A 4DGSA 1WZIA 1R12A 4PLZA 4OM8A 3MCVA 5EPOA 2YYYA 4U7WA 1E5QA 5KOIA 2BKAA 1NAHA 4RPJA 1PGNA 5EMHA 1PGQA 3QV1A 5DT9A 4XYGA 3H9GA 1ADBA 4HFNA 2A92A 1ONOA 3WGGA 1MP0A 4M8SA 4P4LA 3WIEA 4EJ6A 4JK3A 1UJMA 5JAIA 4BB5A 1FMCA 3VZSA 1GADO 2W2LA 3QWFA 5I7EA 1PS8A 2HMTA 1NNUA 3GNQA 1YXMA 4IPTA 4R16A 2FPGA 4YT2A 3ZNNA 4IDFA 2VUSA 2RIRA 3U4DA 4EI2A 5A04A 3ETGA 4RV9A 2Q46A 4OH1A 1FDUA 1P1RA 2X23A 5DOVA 4ZRMA 4DA9A 1R0SA 2XOXA 1HE5A 4AJ4A 1H2BA 4CMAA 3WGOA 5B1YA 1OBFO 2X0JA 3KUXA 2FSVA 4TKLA 1QKIA 4OAQA 3VC7A 4GPD1 3FNFA 4FFRA 4CMIA 1GV0A 5LDHA 4ROSA 4UVGA 5KJCA 1J0XO 3K5PA 3LZ6A 5EQFA 2XF8A 3C1OA 4TRMA 4RVDA 2FZEA 4FIZA 1JKFA 4A5OA 2C5AA 1XEAA 1AXEA 5T67A 2WYUA 3D0OA 2V65A 1R15A 3GVHA 1B16A 1G1AA 2W4QA 3BIOA 4H7PA 4YJFA 1N9GA 4IINA 1A7KA 3KM0A 4YRDA 4TWRA 3BMNA 1QP8A 3FSRA 3FTNA 3TZKA 4FFLA 4L4XA 4JP3A 1KIFA 1F12A 4BNTA 3WR5A 2YDXA 1UXJA 5TIIA 1VL6A 4D44A 3PIIA 3DMTC 3S2GA 2PLAA 2VYVD 3GG9A 5G0WA 1E3IA 3GFBA 1ZSYA 4CQLB 2R6JA 3INRA 4I8XA 3GHHA 1K0UA 2OHXA 3LT2A 2OBNA 2OORA 1WDMA 1T2AA 1TB4A 4UVEA 5CDYA 5L45A 3CKYA 4CMEA 2J8ZA 3EDMA 3PWZA 3WGZA 2GPTA 2VRCA 2X7HA 1SOVA 2JCVA 3GGPA 3QHAA 2YHIB 4OYRA 1I3KA 3GAFA 2CD9A 2OGUA 4RVUA 3LLSA 3I83A 2GUGA 3INGA 3U5TA 4R9SA 3AK4A 3GEMA 1PGOA 1VSUA 5LC1A 4HFJA 1PQUA 5JCJA 4ZQGA 4J1QA 1E0DA 1WWKA 3H5NA 4BNLA 3DONA 1SB9A 4NH4A 1Q7CA 2AQHA 4QECA 4MVJP 3AY6A 3GZNA 4ZQFA 1SC6A 2GO1A 4WLUA 4PLYA 2X6TA 3I6QA 4O6VA 4PLCA 1Q7BA 4R5HA 3ZWVA 1CDOA 5BR7A 4FOSA 4NBVA 5AYVA 1IUKA 4CMHA 5AQ1A 3GGGA 2QG4A 3NGXA 4YAJA 1OC2A 4Z9FA 4JBIA 3MWDB 3VTFA 2AG8A 3HN2A 5A05A 4LVCA 1PTJA 2OOSA 3CE6A 4I5GA 2B5VA 4YAIA 3AI3A 3NT2A 3E48A 3GDOA 2D0IA 4WCFA 2X5OA 2YV2A 3G49A 1ZJYA 1H2HA 4YRAA 5B12A 1U9JA 2Q2VA 1NM5A 1I3MA 2FY8A 3F47A 5I7FA 3GMSA 2O3QA 1C14A 2O3UA 3OECA 2B5WA 1ZCJA 1U8XX 4OQZA 4IDBA 4XQEA 4XEHA 3KB6A 2Q1SA 1WLYA 1B8PA 2CY0A 4AVYA 2AG5A 3FTPA 4F46A 4IBOA 1Y8RB 1Q7GA 2OFPA 2GD1O 3MZ0A 3C7CB 1B8UA 4N5MA 5T57A 2NTNA 2D3TA 3U3XA 2ZB7A 5T64A 2DBQA 1V8BA 3RWBA 5KNLA 3QW2A 1EUDA 1O94A 3TPCA 2EJWA 5EL0A 4GVLA 2GR9A 5G0UA 4JQCA 3AOEC 4BNGA 3TNLA 3Q9UA 4P8RA 4RVHA 3RBVA 2AW5A 1P3DA 2X0RA 5AVOA 4E2YA 2POQX 5CDUA 4R51A 2PZKA 5B4TA 3QWBA 3EY4A 4L74A 5G4LA 2EXXA 5CFZA 2FPPA 3L4SO 3F5QA 4YCAA 1R4MA 5L53A 3E9QA 1NR7A 4XJSA 3KV3O 3AUUA 4R01A 4DIBA 4IDAA 5JO9A 1N1EA 4BNIA 1SCUA 3ZU3A 5AXBA 5IAAA 1SEVA 1DHTA 3LDHA 4BKOA 3S2IA 2AQIA 1NBOA 4BO5A 3JQCA 2VWPA 3ULKA 5JBIA 4YDRA 2YZ7A 5ES3A 4BVAA 4C7JA 3VZRA 3PFFA 4J16A 3DEYX 3PHHA 3DZIA 3RFVA 5J23A 1Z73A 5DP1A 3VAZA 2A94A 2EP7A 3UCEA 2FRDA 3OICA 2IZZA 5A3JA 2Q1TA 3ZN2A 4NBTA 3AFMA 3WFJA 3DBRB 1Y5MA 2C54A 3MWEB 2IYOA 1RPNA 2ZCVA 3I9OA 4IJKA 4WNIA 1YL7A 3W1VA 4J1TA 1P74A 3JQFC 3DHEA 2IZ0A 1EUCA 2G1UA 3VH4A 3GVIA 4BKUA 5IZ4A 3O4RA 4YR9A 2NTVA 5KJEA 5G0VA 2YY7A 2OP0A 1AUPA 1PWXA 5EINA 1YS4A 1FK8A 1PJTA 4RORA 4XYBA 3RASA 1DJNA 2IXAA 4FFPA 3B1FA 3ENNA 4FJ1A 1I2CA 4OJNA 1GZ4A 1LC0A 3HN7A 4PLGA 3ROKA 4J49A 5TT1A 4CODB 2X8LA 3WYEA 5DBFA 3JQBC 4AJIA 4IUYA 3BYZA 4BNXA 1E7SA 3IC5A 3G0OA 2NVWA 5CPFA 4D45A 3ZV5A 5L7TA 1DBVO 1E3JA 1QV7A 5BSGA 4PGFA 4GVXA 3S1LA 4YBZA 4LMPA 1B2LA 1I0ZA 4WLVA 2CDAA 1RYEA 1GTMA 1YDWA 3AY7A 4BO7A 3VOSA 1U4OA 1EVYA 2HO5A 5DCYA 3RC1A 3GK3A 3I1JA 1E3WB 4J9VA 3HE3A 1ENYA 1Q1NA 3RFTA 4BV9A 2Y0EA 4KDEA 4CL3A 3QWHA 4W7HA 2BI8A 4I9UA 1EFKA 4KQXA 5KVVA 1VM6A 2E49A 3GT0A 4XGKA 2JFHA 2X9VA 2NSDA 1DSSG 3BMQB 1LBEA 3DZJA 3MJ4A 4BNUA 4RJTA 1BWSA 3GC6A 3JTMA 4IM7A 5IDQA 5G4KA 4Y9DA 1Y1PA 4LVUA 1L7DA 4OSOA 3BMCB 1EZ4A 2RBEA 2Y1OA 3DOOA 4G5HA 1I01A 1HSZA 3B20A 5COBA 3WNQA 1LA2A 1N1GA 2AEMA 2UYYA 3AWDA 2O4CA 2CF6A 5KVCA 3GRKA 3MTJA 4FS3A 2ZTLA 4GQAA 4O59O 5EIOA 3BAZA 2C07A 3DMTA 5LCXA 5A4DA 1UDBA 2DTDA 2I5PO 3H2SA 4P4GA 4Z0HO 5DP2A 5ILGA 4BMNA 1MC5A 2UDPA 4FJ0A 1P31A 2UV8A 4W6ZA 4ZICA 3BHMA 3WXBA 2CDCA 3JQGB 4ZJUA 2Q1WA 1ML3A 5ENDA 3H9UA 3ZU2A 2HJSA 3ZU5A 4YA6A 4Z0TA 4NZ9A 3AU8A 3AM3A 1V0JA 3PQDA 4OXKA 3PI7A 4OOFA 3RC7A 5JAQA 4W4TA 3PJEA 4BKRA 2VTDA 3NTRA 3UAGA 3ON5A 4JROA 1HTBA 3JQ8A 1H0KA 1IB6A 3WQRA 1ZXBA 1F14A 3ADPA 1MLDA 1LXCA 4EUEA 4J2HA 5A5EA 2JD0A 4NBWA 5CG1A 3WFIA 1U4SA 3H3FA 1DC3A 4Y6RA 4XD2A 3H5AA 1PZHA 5ILOA 1GCOA 5F5NA 1RM0A 2GGSA 3AOGA 2D1YA 3BA1A 1XU7A 1EE2A 1UXGA 3JQEA 1QYCA 4CV3A 2X5KO 4YQYA 2VYND 2AMFA 1BDMA 2Y1FA 3LLVA 4K6CA 3QE3A 4B4WA 1CIVA 1GCUA 4D3SA 5C7OO 1PJ3A 3KYCB 1PZFA 3JQ7A 2GN8A 4MVJD 1I30A 1ENZA 2NV6A 1VJ0A 1CERA 1P45A 1I3NA 1D3AA 1XG5A 5KJFA 2YFQA 3RROA 4KQWA 4DC0A 3ZDFA 4ZGWA 3TZ6A 4D46A 3K73O 1KEUA 1HE3A 3E5MA 2XAAA 2HJRA 3RI3A 1Y8QB 3OIGA 1PJSA 1D4FA 2J3JA 4KOAA 4OGWA 4UUMA 1K3TA 1MFPA 4CLOB 3C24A 5C3MA 4E3ZA 4OMUA 1ZZEA 3L9XA 3ZWYA 3JQAD 9LDTA 5U4QA 2QRKA 3HUDA 2ZTVA 4EDFA 3U4IA 5BNTA 1AE1A 1PZGA 3OMLA 1HT0A 2OMEA 3EYWA 3HSKA 4GX2A 3NT4A 4U0JA 2I67A 2OO5A 4YJHB 1F06A 2PGLA 4HFRA 3WQQA 4IGEA 4GLLA 2PWZA 3O03A 3PTZA 2H63A 3UH1A 2ZTMA 1JA9A 2QHXA 1NVGA 3AOEA 1PQWA 3RUFA 3WX0A 3ASUA 5DZSA 2NTJA 3FBGA 1Q0LA 2QYTA 1X0XA 1UXKA 1P77A 1PJ4A 2O3JA 3ST7A 2VT3A 1U7TA 3JQAB 2O7QA 3ZU4A 2RHRA 2GN4A 3FNEA 3GAZA 1KEVA 2EJVA 3WGTA 3I9LA 5DBIA 1E3EA 4BNYA 1NTOA 3RBXA 4D42A 3PRJA 3IJRA 5A9SA 1H6DA 5AXAA 4ZD6A 4DLBA 3JD0A 3NTOA 3B1JA 3AM4A 4DC1A 1N5DA 5DNAA 5JO0A 1JKIA 1E7MA 1XA0A 3O8QB 1C0IA 1WDKA 1YRLA 4JCOA 2IRWA 3ZHZA 1LLCA 1P1FA 1M2WA 1JQBA 2NU7A 1BSVA 2NACA 3PK0A 4E32A 3U62A 4PZEA 1W73A 1K6IA 3GZ4A 4NIMA 4BQPA 2GLXA 3FI9A 4HADA 2Q45A 1NPYA 1ZEJA 3OA2A 5EJ2A 4A03A 2YW9A 3D5TA 4BUCA 1DC5A 1M76A 1WW8A 2QW8A 3JQFA 2DBRA 3MTGA 4CLRA 3OJOA 1JVSA 2GN6A 1WVGA 1MG5A 1VJTA 3DFZA 3CMMA 3ENKA 1ZW1A 3P5SA 2GASA 5A06A 3BMOA 2EERA 4NG5A 3UUWA 1HDCA 2FR8A 1W0CA 4WLOA 2Z95A 2O7SA 3GPIA 3L9WA 3N7UA 1B0AA 2WYVA 2JCYA 4UVIA 3E1KA 5JXWA 5L40A 1E7WA 1P44A 2RH8A 1IL0A 1F8GA 1DHRA 2GDZA 3CSDA 2VRBA 3L4BC 1YQGA 3JQBA 5F3RA 1TA4A 4EUHA 1C0KA 1C1DB 1QYVA 2VWGA 3FWNA 5JC1A 4HWKA 3NX4A 3NGLA 4II2A 3AW9A 1CQIA 4OIMA 1ADFA 5U9CA 5JY1A 2NU8A 4AJHA 3GDGA 5MGBA 5FYDA 4HXYA 1YJQA 5HBRA 3P2YA 1YO6A 4NK4A 2DAPA 2C7VA 3HDQA 3IP1A 3QSGA 4FW8A 2WD7A 4UEJA 4R9RA 1Z75A 3WG9A 3PQFA 1DIAA 2HKIA 4L4SA 4TQGA 4CM4A 3VH1A 3W4JA 2PD3A 3HZZA 3PJDA 4CLXA 5BSHA 3SVTA 4IXTA 1YQXA 1PL6A 2I65A 2WWRA 1A4UA 1D7OA 1P33A 3DFUA 4GX5A 1ZKMA 3KTDA 4CL8A 4CQMD 1ZVMA 2VQ3A 1BMDA 4CQLA 3DZHA 3K96A 3GMDA 5CAEA 2FHSA 3DBHA 3IKTA 4GLOA 3NTQA 3GRPA 1HYGA 2OBYA 1HE4A 1HKUA 4PG5A 4YT5A 1E1NA 1FDVA 2I9PA 3I9KA 2AQ8A 4WEQA 2X1HA 3RSHA 1ZEMA 2EEZA 5GZ3A 5GZ1A 3LT1A 4AG3A 5I7VA 1Q0QA 4FD3A 1SPXA 3DBVO 1YDEA 1O6ZA 1N2SA 3DHYA 5B37A 5ITWA 1JWAB 1GFSA 4CM6A 1DLJA 3GG2A 2VYVA 1I2ZA 1XGKA 1FDTA 4M54A 1KYQA 2PNFA 4EGFA 1WXDA 4B7UA 3PHJA 1IZ9A 1E3SA 2VHWA 3SEFA 3EGOA 3LF2A 3OH8A 1NASA 5HS6A 3MOIA 5K0ZA 4RPKA 1HRDA 2HK9A 1ISHA 2FP4A 3A14A 4K28A 1SB8A 3E5RA 3C1AA 1EUZA 2Q4EA 5JYEA 5JMPA 4CPDA 3DZGA 4ZVVA 4J7UA 1QORA 2PD4A 4FC6A 3V1UA 1PJ2A 1ORRA 1NX6A 4D41A 1HLDA 3NUGA 4DLAA 1E3LA 3CTMA 3DC2A 3GN2A 3ROMA 4BOYA 1KETA 3V2HA 1HYHA 3ETDA 2RAFA 5I9NA 4L73A 5ENVA 1G0OA 3PZBA 3QWAA 2VWQA 4CMJA 4AJ2A 2BGLA 1LRJA 2GF2A 3F5SA 3SC6A 1L1FA 4RZHA 4WLNA 3QLJA 1UAYA 2EGGA 2Q49A 2PR2A 5KCZA 2EW2A 4FBGA 4FPXA 4ZRNA 4Q3CA 4DLLA 1WDLA 3DXFA 3FHLA 4L75A 5A9TA 3RFXA 4XGIA 4NPCA 4CV2A 1C0LA 2A9FA 1RM4A 1KVQA 1TEHA 1T4DA 4XZ3A 4LSWA 3CIFA 1E92A 3AUTA 4ZN6A 4QQRA 4CR7A 2UUOA 3I9JA 3OBBA 3KBOA 1ISJA 3KSUA 4ND5A 4J4HA 1LI4A 1NQTA 5T8KC 4DMMA 3D64A 3ANMA 2CVQA 5A03A 4MVJM 4JP2A 3GN1A 2R00C 1T2CA 2HLPA 2J5QA 1I5RA 2H9IA 3JD2A 3L77A 4NFSA 4Z6KA 4GI2A 1J4AA 1YKFA 1VKNA 4E21A 5L95A 1LSJA 3VDQA 4GGPA 1CEQA 2PKRA 4DBZA 1EDOA 3ZWOA 3S2EA 5DOZA 5TX7A 2EIHA 3V8BA 3S2FA 1XHLA 3TZCA 1UXHA 2D8AA 2FPIA 4MP8A 4R1NA 3X2EA 3VZQA 1PJQA 2DPGA 4XIJA 4BHTA 3TOZA 1YQDA 1UUFA 5TJ9A 3M1AA 1R16A 4E5NA 4MIEA 1T24A 3QVOA 5B4UA 1RJWA 2JAPA 3EHEA 2QRJA 2PH5A 3CINA 1PGJA 1H5QA 1U3WA 2Q3EA 4RLHA 4XX0A 4Y98A 3RUEA 4AL4A 1K6XA 4P38A 4B7CA 3WWYA 2NADA 4BGUA 2HMWA 4ZHSA 3RCBA 2JJYA 3VPFA 4CLDA 5HRUA 1Y6JA 1I8TA 3MJCA 1XDWA 5JW6A 1K6JA 4A73A 4E12A 2E6UX 4D7AA 5K9ZA 4IY1A 2VTEA 5THKA 5I8ZA 1HLPA 1LC3A 1MGOA 4ID9A 1SNYA 3FRJA 3LYLA 3ZV6A 4JXKA 5FFFA 2XXBA 3WB9A 5TS3A 1BXZA 4NJMA 3I4CA 1GYPA 2CZCA 1P1KA 3KLPX 4EYEA 1V9LA 4XQ9A 4PVCA 4I5EA 1MUUA 4Y67A 4BMVA 1DJQA 4QFCA 3GVXA 4JIGA 3KETA 3CXRA 2ZJ1A 4CMGA 3HB5X 1BTOA 1X13A 1BXGB 4F3YA 3RC9A 1T2DA 1GYRA 2YQ4A 3UHAA 1DEHA 1I2BA 1EK6A 3HG7A 2Q1UA 2C2XA 3QVWA 4MP6A 4U8GA 4O1MA 1GQQA 5L4LA 2GZ3A 2AXQA 2BH9A 1IZ0A 3EVTA 4GWGA 3F4LA 3IDSA 5DCUA 1EQ2A 3K6JA 4A27A 1JLLA 4LMRA 1C3VA 3K9QO 3H9JA 3WJAA 1OAAA 3I3OA 4Q3NA 2D2IA 5IJZA 3JQDA 3MJVA 4Z9XA 3WDSA 3RIHA 2X9GA 3B1KA 3L4BA 5DN9A 1W4ZA 1YOVA 2ZKLA 3RVDA 2WE8A 1S7CA 4D79A 2CVOA 4G81A 1UP6A 3NJ4A 3FPCA 4FGWA 4FR5A 5L9AA 3E03A 4OL9A 3KVOA 2EW8A 1QR6A 4BNNA 3OP4A 2RCYA 4S3MA 1HL3A 3ITDA 5TRTA 2E4AA 3PYMA 3HJAA 4YJGA 1X1EA 2RH4A 2ET6A 3SJ7A 4FC7A 1ISIA 2X4GA 2QYSA 5G2OA 2VCYA 1PEDA 2W2KB 1T2EA 3V2UA 5L4NA 5ICMA 4K1LA 2Y0CA 3GH3A 1BW9A 1GPJA 4L76A 4NI5A 2NVUA 1P1HA 3ADOA 4D43A 4MP3A 4BQRA 4PVDA 4E33A 4Q3DA 4PLPA 1ADCA 3LC7O 2XXJA 2IZ1A 3MJEA 3ZV4A 3DBLA 3PJFA 2DM6A 2X58A 3P7MA 4ONEA 4YAEA 3NEPX 3C3XA 2GYYA 3Q6IA 2F1KA 1DRUA 4L9RA 2Y66A 4YQZA 5TQVA 3ZNOA 2X22A 4CMIB 3FNHA 4J4TA 2J3IA 5KVQA 3OEWA 1SAYA 1P0CA 1ISMA 4BMSA 1LDEA 3CUKA 1QLHA 1UH5A 2PGDA 3KRTA 1F8FA 3HNPA 1ZK3A 1UZLA 1DDOA 3WMXA 4OQYA 3TRIA 3AI1A 4XQGA 5GY7A 1ZBQA 4DYDA 2ZCUA 4HBGA 3F9IA 4FB5A 1LQUA 1TT5B 1SZJG 4EJMA 1XR3A 3FCOA 3RBZA 4XR4A 1GZ3A 3PDJA 2DU8A 4YJDA 4RO0A 3UXYA 4YJFB 3FBTA 1N9GB 2V7PA 5H83A 1ONNA 2YHUA 4PLVA 2VOEA 3QJ5A 5ITVA 5U1PA 1O9BA 1DIGA 4D3FA 5I7SA 3A4VA 3OHSX 2B69A 2BRUA 4HX5A 4DQVA 3WGIA 1EFLA 1CRWG 1OFGA 1U2DA 3D7LA 1VPDA 1YWGO 2DPHA 3F1LA 3OQ6A 7MDHA 4F6LA 1X1TA 3GPDG 3D3WA 3DHNA 3BHJA 4CUKA 4IJUA 2TMGA 3COSA 1KY5A 4PLTA 4Z0PA 2QRLA 3L0DA 3ZWMA 2B83A 3G1UA 3U4HA 4E5MA 5B4VA 3MJTA 5IDWA 1VE9A 4J1NA 4CUJA 1X15A 5KVSA 2H6EA 1YE3A 3QVSA 1R6DA 1VJ1A 2EGHA 3NDIA 4BO1A 4J7XA 4CLOA 2VYNA 1XSEA 4K9DA 4EEXA 2JKVA 2VZ8A 4WASA 4F6CA 3KYDA 2HRBA 2CSUA 2GN9A 4JJIA 4YEDA 3INTA 4MVJA 1G6KA 2CVZA 2ZATA 4PRLA 5FI3A 1GQYA 3P19A 4WKGA 2J5RA 1RWBA 3IMFA 1U3VA 3VZPA 4CM9D 1CJCA 2ZYDA 4A26A 1V6AA 4L4RA 5T8KA 4Z3KA 2PV7A 4BO8A 4FFMA 4MVJE 3PHLA 5TSDA 1H6CA 4XRGA 4Q9NA 4WGGA 2R00A 4NQZA 1QYDA 3K8ZA 5BNIA 3GZNB 2C59A 4ZQBA 5JCXA 1ZXLA 4PLFA 3U49A 2Q50A 4GH5A 4XCVA 1WP4A 1XELA 3L07A 4DREA 3W6UA 4DXHA 3ZH2A 5CDTA 1R4NA 2P9GA 1IHYA 2AE1A 4BO0A 3G1TA 1ZFNA 1XQ6A 4O63O 1ZK4A 4M87A 3LU1A 4R54A 2BFPA 2ZK7A 5CG2A 2NQ8A 3JYOA 1X7GA 2Y05A 4J1SA 1P1JA 4U5QA 2ILTA 2FZWA 2P2SA 1KERA 3K92A 1QRRA 4GMGA 1LDMA 1YL5A 2A35A 2I6TA 1Y9EA 2XPCA 2GNAA 5EN4A 1ZMOA 1I10A 4P4NA 4OHUA 1E6WA 4WCFB 3RU9A 2G17A 5JAZA 5F21A 5L51A 1OC4A 4WCDA 4RDHA 3NV9A 4ND3A 3IUPA 3CZMA 1GEEA 3PLRA 4INAA 1E5LA 1TXGA 2J3HA 5TJHA 1UDAA 3UGKA 1BVUA 4S1VA 2F00A 2O3SA 4CM3A 1X14A 4BO2A 1Z6ZA 3EAGA 1ENPA 3GEDA 4UVDA 2NWQA 2ZJ0A 1KOLA 3QVXA 3AFNA 1X7HA 3JYQA 5JC8A 3WBFA 4YAKA 2WSBA 1HXHA 3JD1A 1TVEA 4XB2A 1OI7A 3WMWA 4L0QA 3QQPA 2IE0A 3E9MA 5A02A 3LT0A 2ZIZA 5JY6A 4GSKA 3WQSB 1FDSA 3PPIA 4FGSA 4OXNA 5IDXA 4XIYA 1W8DA 4FQ8A 4IZIA 4M1QA 2X5JO 5F1KA 3KSZO 5K6AC 1BVRA 1LEHA 3F6YA 1EK5A 1FDWA 3NAQA 3DAFA 4MVJH 4XYEA 3TDKA 3OETA 1R4MB 5TC4A 3PDUA 3UOGA 4QT0A 2P9CA 5BSFA 4G2NA 3ZHBA 1HEUA 4QEDA 4AJOA 1O8CA 4EITA 4ALMA 1M6WA 4CLEA 4NFYA 5A9RA 4MIOA 2PY6A 4PCVA 4E31A 1E77A 4XR9A 1KC3A 3DB2A 5C37A 1NWHA 3WLFA 1JN0A 2YV1A 2DTXA 4KZPA 4EZBA 1HYEA 4CM1A 4J9UE 3RUAA 1DAPA 4AJKA 4NHEA 2FR1A 2V6BA 2ZB4A 1GR0A 3D3EA 1KS9A 2BD0A 2AQKA 1JTVA 3CMCO 4DQXA 1A4IA 3OQ1A 3VDRA 3ZWWA 4ESOA 3MJSA 3W8EA 1OZAA 2P4HX 5F1PA 4BO4A 4W9NC 2DUWA 4X54A 1R66A 3IJPA 4IQ8A 1U28A 1SMKA 2O23A 4NMHA 4WE3A 4A10A 4CM8B 1N92A 5H82A 2P91A 1ARZA 4NR0A 1DOHA 6LDHA 3JV7A 4BGVA 4RF3A 1X0VA 1QLJA 4Z3DA 4NDNE 3GNSA 3L6DA 1CF2O 3AUAA 5TF4A 2R2GA 1NHGA 2EV9A 4DIFA 7ADHA 3C8MA 2YFHA 3ONEA 2X0IA 1UAGA 4I1IA 1NQAO 3D1LA 2UUPA 1RM3A 2NQTA 1DRWA 1VRWA 3H7AA 4IMPA 4CQMA 4YVFA 4BO6A 3A28A 2YQ5A 3HFSA 4B3IA 1DLIA 4KDFA 4LRSB 1SO8A 1YB4A 1WMAA 4J6FA 1H9AA 4E0BA 4AJNA 3EZLA 2I3AA 2CNBA 1DB3A 3RC2A 4GSLA 3SBOA 3WYBA 4LN1A 5EERA 3OJ0A 1I32A 2DFVA 1YL6A 5I9LA 3GFGA 2C20A 2ZQYA 3NKLA 3PZRA 4NJOA 3Q11A 3I6IA 4DVJA 1D1TA 4KUGA 4WK6A 3F1KA 4IIVA 1P0FA 2WM3A 4XA8A 1A9YA 2O2SA 3EMKA 1I3LA 3G79A 4U6QA 3PWKA 4ZU3A 1H93A 1LJ8A 1RKXA 2EG9A 3EVNA 5AXDA 4I08A 3NYWA 4UEKA 4N5LA 4WOJA 2OXIA 5A3VA 1M67A 4B79A 4YB8A 3VPHA 4JBHA 4IJVA 2C5EA 1V35A 3H65A 1A9ZA 1EVIA 3E9NA 1FJHA 3EK2A 3R1IA 4WLEA 1HDXA 5H81A 2J5KA 4B3JA 1WPQA 2IEBA 3GNTA 3EUWA 4ZQHA 4MIYA 1TT7A 2ZB8A 4CMEC 4J2OA 3JQ9C 5DCWA 2HCTA 3AUSA 4IDCA 4ALNA 5FEUA 4NU6A 4D0RA 2UAGA 3LC2O 3QVTA 4NNJA 1BDBA 1W6UA 3JCZA 1UZMA 2Z1MA 4CR6A 3LVFO 1PQPA 2BF7A 4W7IA 2PZMA 1PR3A 4WECA 4ALJA 2HSDA 3QWIA 3W4KA 4MPDA 4KTVE 1VC2A 4GX1A 4BNHA 1YB1A 3W8FA 3E8XA 4I9NA 3PLNA 3ZWNA 3S55A 1RM5A 1G0NA 4YACA 4FDAA 2HRZA 4ND4A 1LUAA 1DFIA 4KMSA 1B7GO 1E7QA 1LNQA 4YWJA 3O26A 3F46A 4DL9A 4CMCA 4O5OA 2FWMX 4OOEA 1PL7A 3ZI0A 2PKQP 2I76A 3LC1O 5HM8A 2QZZA 2VN8A 2G82A 1QMGA 3VVCA 4DPMA 4RVFA 2Q2WA 3H3JA 4WNCA 1E7YA 3C1TA 2BFOA 2E37A 2JD1A 2YDYA 4RPLA 1BHSA 2EF1A 3OJLA 3DOCA 5L4SA 3WLEA 1TLTA 1JAXA 1IY8A 1ZSNA 1MXHA 4GKVA 4H16A 4R3NA 1YGYA 4B4VA 2VHXA 3WBBA 1T2FA 1HE2A 1L7EA 4RF5A 1GUFA 3ZZNA 1GYQA 4UUOA 3M6IA 5IXSA 4DPLA 3HADA 2VHVA 3ICPA 1PZEA 3JQ7B 2EKLA 3DOJA 5JPIA 4CV1A 2HK7A 2VWHA 2NU9A 2O48X 5IG2A 1MG0A 1V3UA 3E82A 3ZW9A 3NJ8A 1XQ1A 3GUCA 4N7RA 2Q2QA 3VH3A 2YHIA 3ZCXA 1GQ2A 4TRJA 5FI5A 2HAEA 2D59A 3AY3A 4HFMA 3SLGA 4BNZA 2PTGA 4ALIA 1UDCA 1M66A 1SBYA 3NT5A 3WICA 3WIDA 2EKPA 3CEAA 2VOJA 2E82A 4KUHA 4B4UA 1ADGA 2WDZA 4DBVO 2D5AA 5CDGA 1PJBA 4R69A 2JAHA 1KVTA 3SC4A 3M2TA 1ULSA 2ZTUA 4UUNA 1UP4A 3A1NA 4PIVA 1ZK2A 3V1YA 1IYZA 1KVSA 3ZGYA 1BRMA 1Z7EA 1U1IA 3N58A 4UULA 3Q1LA 3K2EA 4LCJA 3RQSA 5CDSA 5KJ1A 4PG7A 3BTUA 1WZEA 4Y8VA 3AM5A 2AEJA 3AU9A 4RPHA 3WWZA 2HQ1A 3KZVA 1ZH8A 3PEFA 1GU7A 2FMUA 1C1XB 5K6AA 1NVTA 3LQFA 4QTZA 4TRNA 3O9ZA 1XLTA 2Q4BA 3CZRA 1ULUA 3U9LA 5CHEA 4MDHA 1VL8A 3KOUA 4RDIA 2WEKA 1K89A 4OO3A 4PRKA 4ND2A 3WOHA 1LLUA 1BXKA 1PR9A 4RGBA 1Z7BA 1ZSVA 4MO2A 1U5AA 2P68A 3TF5A 2AHRA 3I52A 4AJJA 1NWCA 4DIOA 5A9SB 4BNFA 1B3BA 4UVHA 3FR8A 2DBZA 2JD2A 3F3SA 2BI7A 1UXIA 1ZK0A 3IQDB 4MVJF 4J7CA 3RUCA 2HMVA 1UP7A 4XJTA 3TFQA 4CMKA 2Z1NA 4XRRA 2RHCA 1Y8RA 3HHPA 2BELA 1U3UA 2QQ5A 3OSUA 5DDIP 3DAGA 3OJEA 4CM7A 1R37A 2W2KA 3DTTA 4GBJA 5LDGA 3UF0A 4PFJA 4H3VA 4R1SA 4IGFA 3QP9A 1B15A 2NU6A 4M49A 4N18A 2J3KA 4E2WA 2IDZA 1J49A 2EWMA 2GZ2A 1BG6A 1J6UA 4OXYA 3JYPA 4W9NA 2P5UA 3LT4A 1FF9A 4OSPA 2OUIA 4BIIA 2FN7A 5HA5A 1DC4A 4CLRB 4E6PA 3HDHA 1E6EA 3Q9NA 4ITUA 5JSFA 5KTKA 2X0NA 1X7DA 4N5NA 4XDZA 1YBMA 3BMOB 1AHIA 5COAA 1YJ8A 4BGIA 4BKQA 3JQ6A 1VKOA 3CPSA 2C2YA 3ANNA 4PG4A 3F4BA 4ND1A 1KY4A 3RKUA 3U09A 2CFCA 4BNKA 1XCBA 2D5CA 5L7WA 1GL3A 1QG6A 2V6MA 3DAPA 5AXCA 1E6UA 1LDYA 1CWUA 2UVDA 5AOVA 4OKIA 1H6BA 5IN4A 2P5YA 5HWSA 3B6ZA 3NDJA 1TT5A 4R41A 5I9MA 1EMDA 2GSDA 3EW7A 3TSCA 5G0TA 3K2BA 3VHRA 1DPGA 2I3GA 3HDJA 1YH3A 2G76A 4EBFA 4AJ1A 2BMAA 2B35A 2OL4A 3DBRA 3MEQA 3RAJA 4O0LA 5TGDA 3UVEA 4DUPA 5JE8A 4EW6A 1MX3A 1VL0A 2DTEA 1VLLA 2VT2A 3DZKA 4MVJG 3HFGA 1LDBA 4FSHA 1ZO8A 4LISA 3RD5A 2WMDA 3DDNA 1NYTA 5CEEA 3LSYA 2V6FA 2AEFA 2WD7B 3IKVA 4WLFA 3TL3A 4BKPA 2VZ0A 4A2CA 2Y68A 2A4KA 3NRCA 5KJ6A 2OZPA 1E1MA 4CM4B 5CEJA 3H4VA 2Y1EA 4BNJA 2B36A 2Y99A 2O50A 3FWZA 3QA9A 4QO8A 3DBHB 1LDGA 3FF4A 1HZZA 1LTHR 3I23A 4NBUA 4TVOA 1ID1A 3ETEA 1RYDA 3A9WA 2LDBA 3JQ9A 5C7IO 4W82A 3IP3A 3GOHA 1NPDA 3ZWCA 2G5CA 3WSVA 1HETA 3Q2IA 4LGVA 1V3VA 2PZJA 2ZYGA 2JL1A 1HWYA 3OM9A 5JYDA 2VNAA 1NXQA 3TL2A 5DULA 2V6GA 4FFOA 2I66A 1WMBA 4FCCA 3FR7A 3VKVA 4RL6A 1HDOA 3A06A 2W2LD 5JDCC 3ZNPA 4CUZA 1E3WA 3H2ZA 5KKAA 2NNLD 1Q0HA 1U8FO 4E2XA 2GCGA 1LRKA 1AHHA 4KWIA 4TZKA 1XKQA 3AI2A 4H15A 4PG8A 3C85A 3E6AA 2ZYAA 4AICA 1SOWA 3ZHXA 3VKUA 2HDHA 4E5YA 3Q0EA 4JN6B 1PU2A 3BMQA 1QV6A 3HDYA 4WOKA 3QIVA 4YPOA 4II3A 5IZCC 2E48A 1HDZA 3G3EA 4YT8A 2B37A 4CM9A 4XWYA 2W98A 3UN1A 4QUKA 3BMCA 3L6EA 2EKQA 2CDBA 4RF2A 1ZIDA 3DTYA 5TNXA 4LSMA 4RLSA 4UREA 3PFWO 3RU7A 5T6BA 3T4EA 2Q99A 2WTBA 3H8VA 4AJEA 3W8DA 3UKOA 4CJXA 1Y5RA 1KBZA 3D5QA 1IPFA 1H94A 1K5HA 1U3TA 4CR8A 1QYXA 3PYLA 3HQ4O 3C7AA 4I9HA 4DQUA 4KWHA 3DQPA 5MDHA 4GWKA 5EQDA 3JQGA 5L7YA 1PWZA 4YT4A 1A5ZA 3BHIA 4XYMA 1B8VA 3FPLA 3PWSA 2WJPA 1WNTA 2YV3A 1KVRA 3PIDA 3WNVA 4YXFA 4LRTB 5JFOA 3DZBA 4F45A 4KTTE 4K26A 4E30A 2C7GA 1NVMB 4LCEA 3GUYA 1DIRA 5C7LO 1B26A 1JVBA 4MJLA 2VHYA 1O95A 1U2GA 4NBRA 4BV8A 2JCXA 3OQBA 2EHDA 3STHA 5JNLA 2C0CA 2YJZA 1Y9AA 1LDNA 3K30A 4CV0A 2QX7A 1Z74A 1DFGA 4CM5A 4B8WA 3ZWPA 4JX8A 4E4YA 2FR0A 3BMNB 2DLDA 1EVZA 1PS0A 3H5RA 2AE2A 3O38A 5ADHA 1MC4A 4UAGA 4U0KA 4MINA 2YUTA 3JD3A 1YBAA 3KYCA 4BO3A 2VRCD 4NU5A 2AA3A 3GQVA 4M89A 4TMFA 4G65A 4Y6SA 3V2GA 4DRYA 1Y7TA 4BB6A 4MOWA 4RVSA 2PA3A 4QXMA 5L3ZA 4R68A 1VI2A 5JCJD 5DBGA 4KP7A 1UR5A 1Y8QA 3OEYA 4GX0A 1YVEI 4BGEA 1JAYA 1P1IA 1O5IA 4IDEA 3TJRA 4XDYA 1ZMTA 4Q3AA 1PJCA 1O89A 3H9EO 4U6SA 1J5PA 3PXXA 2QZ9A 4CM8A 3W6ZA 1ZK1A 3FN4A 3PQEA 2H5LA 4DPKA 4HY3A 1T1RA 4YRBA 4NJMB 4YJHA 2G0TA 1AXGA 4IQGA 5EESA 4PZCA 4BNVA 1CETA 1NPTO 2HK8A 1WAMA
chains in the Genus database with same CATH superfamily
3HDVA 4FOOA 3PGJA 2ZXFA 5EWMB 5LD2B 4KMOA 3ZYZA 2WP8J 4OG2A 2QJOA 2R4TA 1UJBA 2GXSA 4WK4B 1H0SA 1PT6A 1LX6A 1M6HA 3ZG6A 4BP1A 2BR3A 2Y1XA 3W5IA 2VJQA 4L9AA 1NVDA 1O9GA 2A9JA 2NAPA 3VKFA 4FZ5A 1A72A 2XUZA 3RU2A 3GCGA 4JGGA 3TZHA 1XN4A 1GEGA 4IQ4A 1C8VB 2R8XA 1RRKA 2ZRHA 3BJZA 3A6FA 5HTOA 2VFAA 4Q02A 3WYCA 3KJNA 3TSOA 1U8YA 4M9XA 5T4FA 2I4OA 4Q47A 2WAYA 2GZ1A 4CKXA 4BO9A 3KSDO 2R3SA 3A3PA 1H6AA 4JLNA 5HKKD 1HFWA 4O5AA 2HA0A 2VI5A 3L0IB 1IOLA 2HHAA 1I6MA 4MEBA 4MKRA 4IDGA 4YRSA 2QVYX 3VPBA 4IIUA 4B9EA 2HWYA 4X8OA 4H08A 3ROZA 4AYWA 1XZCA 2JFNA 3HWRA 2VZEA 4ZK2A 2P3SA 5BSVA 1FS5A 4MS4A 4BEVA 3ZBTA 1XMVA 1ZUHA 4LY6A 3B5EA 4H4EA 5KYXB 1NL3A 5HOEA 4F4IA 3ICQB 2J3MA 3PSHA 2QD4A 3O6VA 4IMRA 2IITA 1I4EB 1SOAA 1UOEA 3KC2A 3VSBA 3ZZMA 5F23A 1PGPA 1PWEA 2R1TB 1N2IA 3LW7A 4LA4A 4S1PA 3DP7A 2CDNA 3QJGA 4OP1A 4XQCA 5LSAA 3CW9A 3HNRA 4IOKA 5FJJA 3SOPA 1OIXA 1J07A 1E7RA 1XA3A 2FWRA 4O1IA 4JOCA 4Y2YA 4ZODA 1K8YB 4E1VA 4GMKA 3D4PA 3DS8A 5LJIA 4S05A 1MC8A 2O20A 4AG6A 4B3TB 1M75A 1L4KA 1Z0FA 2WF5A 3HUFA 1Z34A 4NFLA 4V3BA 3QFSA 4LK3A 2VDQB 4A0SA 1ND5A 3ZKWB 5LXTA 1RXWA 1MEOA 1I0IA 3DDHA 3AESA 1F0YA 1JAZA 1WP9A 3JYNA 4MROA 2NVUB 4EATA 3T0GA 5ALPA 5ULLA 2KLHA 2W2MA 4Q1BA 3RJ5A 1FP4A 3IBCA 4LZWA 1YHZA 2RHBA 4EF4A 5HX7A 3B3AA 3BGDA 3GVCA 3IUNA 3S8MA 1D8TA 2E9SA 2HFKA 4N3GA 3ZWXA 4CKBA 1OTXA 4J90A 1M7GA 1GARA 5DRYA 3RJ9A 1S3GA 5AIAA 3MAJA 2ALJA 1QO0A 3GEEA 3NEJA 1Q2XA 2HUNA 2IHZA 4KQKA 3EOBI 1D04A 4JU9A 5F5LA 4A8JA 2BFMA 3Q2OA 4URHA 1IOVA 3DR3A 5IKMA 1CNMA 1D0VA 3RVRA 1K75A 2TSYB 2YC4C 2QW0X 3K70B 1I2DA 1GD1O 2XQFA 3ESDA 2O06A 4IXWA 1ZN7A 2G8NA 4MR7B 2ZIAA 4EL5A 2XUPA 1NV8A 5ER6A 1PDOA 2ZUDA 1IBMB 4UQLA 1Y1LA 5IARA 5C51B 3T3NA 1H85A 3HPRA 1L0BA 4ZYTA 5JXHA 3C2QA 4MO9A 3TDMA 3K0HA 4CKCB 5KTOA 3WOVA 4AJLA 2G09A 2H8KA 3KG2A 5ESDA 3MGKA 3ONWA 1E64A 1E18A 4M0PA 2IUTA 2IYYA 1R6UA 5GMOA 4D0GA 2DZDA 3NM5A 4J0KA 1T6YA 1QXSA 4W8OA 1W0JA 1ZONA 1MPTA 3RDPA 3GVPA 3F8TA 3HJBA 3COWA 4RQTA 1A8QA 1XALA 3BSSA 3OJXA 1EJ2A 1FQOA 3T1HB 1KQOA 5A4KA 1G8FA 2J3LA 2QENA 4NFHA 1Z33A 3ZU6A 3KZXA 4EB0A 1JBKA 4U7GA 3VPGA 3M6VA 1U7PA 1E2QA 2H54A 4PC6A 2OYCA 3VO8A 3TN7A 1IXSB 2ZBVA 2A5LA 3ISJA 2DR0A 1SIBE 3OOJA 1NVVQ 5JXGA 1XRNA 5CNJA 5C46F 3BD8A 1V4VA 2FPOA 1U5CA 3OPYA 3W5AA 2Z2JA 3DW1X 1DX9A 2PKQO 4XKJA 5PNTA 1A8IA 5KNCD 2PZEA 5E9JA 5WRFA 2L42A 1N7GA 3GRZA 3G17A 4TS4A 1H3FA 3C7DB 2MR6A 4FFBA 4RESA 1GGHA 4MW4A 3VUFA 4H2DA 3I9NA 5ALRA 1J00A 2PX5A 3C4VA 2ZUSA 3CLHA 3MWLA 5DTRA 2GF9A 2QRQA 2B0JA 2PK3A 3VISA 2C0QA 4UJ5A 2H7CA 4XB1A 2BGKA 2OZEA 1BX1A 2QN3A 3D8TA 5BPHA 3BGSA 3BTOA 2CJYA 5IDVA 3PPXA 4D0SA 1X7YB 3KYDB 4PLHA 1UQUA 4WZBB 3B70A 3BJMA 3P1JA 1GGKA 1T8PA 1TO2E 1YJBA 3MFQA 2VK2A 4KWTA 4QNRA 4CBVA 3WAJA 1RLTA 5KTTA 2P75A 1NHWA 3MRXA 4LOAA 3VPSA 4BFLA 5ERXA 3ICEA 3T7SA 5HUHA 4MW0A 4K6FA 4QQKA 1UPFA 5GGXA 2I6XA 2VLBA 2Y1GA 3TAXA 3HR8A 2R7KA 1P9NA 1F2DA 5KU7A 1PK9A 2SBTA 2G80A 4C4OA 3FJYA 2NXJA 3F90A 5A7GA 3RRJA 4IIBA 4PLWA 2YXLA 3V8MA 5JD4A 3G85A 4HYYA 5KNDA 3OBIA 4X6YA 2PAAA 3NHFA 4RTLA 2P69A 2B4QA 1YUMA 2X6RA 3K0BA 2PH3A 2M6KA 1CUHA 3W1EA 1U7DA 4G2TA 2TMKA 3PITA 4JEMA 5KB3A 3GRYA 1K2WA 2ADFA 1SD5A 4FSDA 4LMAA 3WGYA 1K27A 1TA9A 4AKHA 1KJJA 2IIQA 4J91A 3R0IA 1M54A 3KFLA 1UZNA 1N8KA 3WSWA 3AUXA 3AVUA 1YGPA 1GKIA 1IBCA 3IEIA 1PV4A 2FN8A 1ZNWA 3KD2A 1D2MA 2AFHE 1Z6YA 2F55A 3ZE0B 1NF2A 4OHBA 1DFHA 4OUDB 1ZVQA 2QUZA 3GLIE 3Q9SA 1YBFA 3R20A 3W3AA 5A1TA 5K99A 2KX7A 4R1UA 2Q4DA 4NCAA 2WV7A 4N5DA 4KQGA 2A58A 1L7VC 5JSZA 1CQJA 4DAOA 2IODA 3H8WA 5BSRA 3ROQA 1CY0A 1RJDA 3WNZA 1TI7A 4FINA 5G02A 5IC6A 2PUVA 3CN9A 3ZK7A 5IW8A 5CX1A 2W6PA 4NCBA 3IQHX 2IC5A 1RZUA 2PG3A 4DTIA 5BSEA 2I34A 1TMGE 1IMJA 4KUEA 1QQ7A 2QU8A 4YR7A 2ZFUA 5IJWA 2O8FB 4TROA 1N2HA 3RKRA 3V4FA 2PL3A 3VPAA 1RACA 3D4OA 1TQ6A 3JVUA 4OQQA 1NQOA 3KO8A 5T5QA 2Q7XA 3IIKA 5LP6C 3N07A 3PNQA 1TJPB 3T4XA 2BGMA 5SZIA 1R64A 1W2HA 4GI3A 2ZCJA 3NETA 3B1YA 3PDIA 4QU5A 4OQMA 2PUDA 2PUJA 4DCJA 2BHLA 1GUBA 3PQ5A 4G8DA 1MW9X 4U3JB 5CR9A 1FFGA 5E8JA 3VR4A 2EFGA 3W2HA 2KYRA 1CBUA 2O3TA 2QD2A 5DM1A 4E08A 1Z4NA 3OA0A 5CDHA 1XMJA 2H0QA 3UICA 2RB5A 3AONB 3QHPA 1NSFA 4B3BA 1E8MA 1D8AA 3PFCA 3Q10A 3QEOA 4HH4A 3HU1A 5EA2A 3SQMA 3WYDA 1HOTA 1XVUA 3R3JA 4ZEXA 4MS1A 5MN4A 2VJYA 2X14A 2PHZA 4HAUA 2H1CA 1QSGA 5D85A 4AY5A 4C4SA 4WCFC 3HBJA 3FTQA 1I36A 4IZHA 2Z56A 1KMHA 1LLDA 2DKNA 4IDDA 1Y7IA 1OXTA 4CU2A 5JBNA 4HQLA 5K3OA 1A71A 1ZITA 2DC1A 1PX0A 4H7EA 3QKUA 2J6IA 3RVBA 5AD1A 1ZCFA 3CS3A 1HK7A 3KS9A 3SQNA 5IH3A 1GZUA 5BUQA 1FRNA 4BQEA 1VECA 3DMDA 1EVJA 3CM0A 3S70A 4W5NA 1EFDN 1U9YA 1I7PA 4PBTA 2EOAA 2QJFA 4LYJA 2J5XA 3VTZA 1KYVA 1ZNQO 4WJZA 3TQOA 4HKTA 2KB0A 4HUJA 3RS5A 2QUJA 3I64A 3OU6A 1Z38A 1N6OA 3GCDA 3KSRA 1J97A 3KXIA 4Q1DA 2X4IA 3GR6A 1K1EA 3BFVA 2GKOA 1OXMA 3N0WA 4DV5B 1VPVA 5BVHB 4F3NA 1HDGO 2WKRA 2PRSA 1H3NA 1PJLA 1RBQA 3AJEA 3QKRA 2ZU0C 4NCKA 1OZGA 4UBKA 2WFMA 5EVCA 5AW7A 4GAEA 1GV1A 3N8NA 1YRYE 3WVNA 2DBYA 1VKZA 3LRTA 2FRXA 2VSFA 4AAYA 5A6SB 1KQNA 4JQSA 2C5FA 4E2ZA 1KPHA 1EGMB 1BXGA 5BRJA 2Q5EA 1S6YA 3DHVA 3TI9A 2D4AA 4K6OA 1D4AA 4LF9B 3I2GA 2R96A 2EBUA 1BA3A 5GIPE 3T5TA 2QMEA 2OZLB 4MKZA 1G21A 2C84A 5JQWA 3VOAA 4YYZA 5HS4A 1ZOSA 4PN3A 3GA0A 3MMXA 4U9IS 3IT0A 1E9BA 3O3OB 2XCTB 4W1PA 4EL0A 4YCMA 1UBSB 3C1UA 3ICVA 1IY0A 5ECWA 5BPFA 2EIXA 3M2PA 4RF4A 1L5MA 1IULA 4GZ6A 1ZJZA 2C2OA 4AZ0A 3LUBA 4B8ZA 4H17A 3HS3A 3REQA 1E2FA 3DVRX 3M4XA 5E2BA 4AY3A 5DKFA 4DWWA 1ITZA 2JIDA 3EXAA 1OQAA 2FKAA 4QDZA 3IS3A 4P92A 4M1EA 4QWWA 1T1IA 5FOXA 4E11A 5CEFA 1VYHA 1TPYA 1S2LA 5JDIA 3A05A 4YC7A 3SBDA 3CX7A 3QVJA 4JMPA 2FRDC 4OL0A 1T5SA 3TQHA 4GXTA 4OLHA 3R24A 4AU1A 4RGQA 4EG8A 4L8LA 2P4QA 2QT1A 3KV1A 3UGQA 2ZXEA 2ZVDA 3AKYA 4PLZA 4TV9B 3G2OA 2UVPA 3RS3A 2B8WA 5A3QA 1TM5E 1XJ0A 1E5QA 4J1TC 4KIJA 3MMSA 3BL8A 3AHEA 1RXEA 2EW1A 5CVUA 3AEXA 3RS4A 3M5WA 2WU3A 1XQVA 3TQQA 3ZE8A 2A92A 3WGGA 1LFDB 4X20A 4MI9A 5I4CA 4JK3A 5JAIA 2CHQA 1IM2A 1FMCA 3VZSA 2EJBA 3L46A 1N2GA 3QPBA 1C7EA 1FP1D 3TKAA 4IPTA 1YXMA 2AFHB 1XF9A 1TM1E 2YRWA 1GTJ1 4YT2A 3IQXA 2WOOA 2VUSA 1JNXX 1MOQA 1L7BA 4X84A 3WE7A 2G07A 3ETGA 2Q46A 5EXEA 5HQ3B 1JDTA 3MAGA 3AP1A 4ODIA 4OYHA 4PU0A 4MGYR 1A9XB 2X23A 4JUFA 1O87A 4EDHA 5ESWA 1R6XA 2JJ2D 1R0SA 1EM6A 1MIOA 5TQ0A 3BICA 1O8BA 1A76A 1H2BA 3G8AA 4R8RA 4CMAA 2P79A 4JH0A 2BEWA 3ISTA 1KQFA 2PEZA 2B8TA 1KBQA 3T0IA 1ZJJA 4CXMA 1XROA 3T1NA 3TNDA 1RE0A 1MCZA 5DN6D 4EG4A 1GV0A 1SFRA 1VA5A 5E1DA 2MSKA 2YJ6A 3NYQA 4ROSA 1GN8A 2WHXA 5LDHA 1B6GA 2JBWA 2Z58A 3CUEF 5HHTA 3JX9A 5FRDA 4TRMA 1JEDA 3TTTA 1M1YE 4BFCA 4FIZA 2D06A 4JOQA 1AN0A 1WQ4A 2H9YA 2C5AA 2K5UA 3MFYA 4U1RA 5CURA 5K4HA 5T67A 5AVVA 1MN6A 4G4JA 2WYUA 3FWKA 1QGOA 3RPEA 6REQB 3ZK9A 2V65A 2Z6AA 4M8IA 2M1XA 2V7QD 5FWYA 1Z2AA 2AJLI 1R00A 5J3JA 2WSSA 1G1AA 1T5TA 1AMOA 2K2QB 3QKSA 2J9FA 2PSEA 2R751 1RQ2A 3G5TA 3LD9A 1UMCA 5ADUS 4EPXA 4IINA 4YRDA 2WWHA 4HT3B 3DD1A 3BMNA 1DAFA 2VDJA 1CLEA 1WABA 3BCUA 4R8KA 5CDFA 3S2UA 4Z49A 5AUOB 2CL0X 3U16A 4ZEMA 1JYEA 5EJEA 4O3MA 4QPJC 3MK31 1WXGA 1OAOC 1PD0A 4DABA 2G7ZA 2OG2A 1T1GA 4YRTA 4B2IA 4BNTA 3WR5A 2YDXA 5EJ7A 2JBHA 3IEMA 4CN9A 2GK6A 1V1RA 4UOZA 5TIIA 1KJIA 1VL6A 4D44A 1ZD4A 3GNLA 1QC5A 5FUBA 1EK0A 3P9CA 3X0DA 3VA7A 3V7YA 4I99A 3L0ZA 4Y2HA 3S2GA 5KUTA 1FMFA 4OQXA 3E53A 2HSGA 1ZG3A 3N3AC 4KQMA 3P94A 4BFYA 5H4HA 3QW4B 3UYKA 3U40A 3N76A 2VAXA 3VJLA 1ZUNB 3WXMA 3H4MA 1XL0A 4HDKA 4I8XA 3WNBA 1FC0A 2OBNA 5JAOA 1N5OX 1T2AA 4N0EA 3H2IA 1P5JA 4UVEA 3B6EA 3D2LA 4CMEA 2GJ9A 4ZO4A 1JMKC 3F96A 3PKIA 4AUMA 2Q3BA 2ROQA 1QU2A 2CL7X 4JP8A 5KS2A 1TIBA 3WYNA 4MWTA 3GGPA 3KVVA 2LCQA 1ZY2A 4G5FA 4PSAA 4A0QA 3E4DA 1L7NA 2V1XA 2B82A 4HMQA 4OBBA 3LLSA 3LKZA 2GUGA 2QN9A 3V1LA 3AK4A 1PGOA 3UJ6A 1FFDA 1KEEA 1VSUA 4M46A 2AJTA 1PQUA 2QD3A 4HFJA 2ZI3A 2B2CA 1E0DA 3H5NA 5LQUA 2PMEA 2I4LA 2KM1A 1DTWB 2V3CC 2F8SA 3HDGA 3LY7A 3MINB 4KE9A 4YP6A 3ZXSA 5A4DA 3N7AA 2WAMA 5K1ZA 4CN8A 2VDUE 4B1FA 4WVLA 2O8DB 3V97A 4ZQFA 1SC6A 1U5BB 2GO1A 1W25A 3NORA 2ZJ8A 4YHHB 2GETA 3KOMA 1QHEA 1FOEB 4WK0B 3ZWVA 4Q24A 3RGGA 3LPCA 3V4LA 3V6MA 4AP6A 4DS3A 3IOEA 4FOSA 1RHQA 2RJOA 1LZLA 2DPYA 4CMHA 5AQ1A 2NSLA 2QG4A 1RP7A 3GGGA 3GO4A 2NXEA 3NGXA 4L72A 1KRWA 3CX3A 4U00A 4IIXA 2AG8A 4C3OB 3MJFA 5I9SA 3T8YA 3CE6A 1RVDA 1LPBB 3DJFA 3ZH9B 1K4KA 2D1SA 4NICA 4LQ4A 4CEIB 2ZEJA 4ZGGA 1PX2A 3L2OB 2Q1YA 2P3QA 1E1CA 4PYJA 2V9ZA 3NIFB 2D0IA 3U3JA 2L19A 4C2BA 2FYTA 3FSEA 3PHBE 1IJFA 1NVFA 1G4HA 3ZTYA 5G40A 1QVVA 1QOQB 2B4YA 5IK2A 3PKZA 4FYVA 1DWQA 3OECA 2O3QA 1C14A 3S81A 1ZMRA 4IDBA 4XQEA 5REQB 1WF3A 1KEEB 3KB6A 4NCXA 4ZOAA 1N2OA 1WLYA 1JG3A 2Q4RA 4RK6A 1OCEA 3Q7PA 1I7NA 3I3SR 2H2IA 4FCVA 1V47A 2H4JA 5ALLA 1L8XA 1OZ0A 1Z7GA 2W6ID 1IU9A 4E13A 3MZ0A 3C7CB 3UG6A 5IAAA 3O0DA 2HQRA 4HZGA 5CTAA 1U2TA 3W9YA 5CT6A 1NDHA 4GD3Q 2RMKA 5E3JA 3L4KA 4TTSA 3FTEA 1J1ZA 1RSZA 3IRUA 1FLDA 2JPDA 1E9DA 4M8NE 4P8RA 2H65A 2WF6A 3RBVA 2AW5A 4RVCA 2X0RA 5H1YA 1G20E 4S1TA 4E2YA 2GYVA 4KYVA 2PZKA 2JLYA 1KORA 4B43A 5DGCA 1NY6A 1YOBA 3N8KA 1TUIA 4B6RA 3NNDA 3VYUB 2IIBA 3EY4A 5G4LA 3O8NA 3L4SO 1E58A 1N77A 4L5YA 2O8EB 1MT0A 1DARA 1G42A 3KV3O 4LC1A 2ZI4A 3AUUA 3HKDA 1JG4A 5ALSA 4FD2A 4INJA 4BZQA 5TPZA 3MQ4A 2QSYA 2RKOA 3KDAA 5AHKA 4D9JA 3UMJA 4BXOB 3MILA 4UZFA 1RYHA 4XIGS 2I7TA 4D9NA 4EMTA 4W5RA 3FPKA 2BOVA 4EVIA 1RQLA 2VWPA 2W58A 3OT1B 3ULKA 4K87A 4L5JA 2GEVA 4BVAA 3T9BA 5B1IA 3PFFA 4CKCA 4V38A 3DEYX 1AKEA 3DZIA 3C5VA 3RFVA 3PNPA 4U7DA 3JWPA 4HAVA 1VLZA 5DP1A 3I2JA 3SC2B 1O54A 3UCEA 4MS3A 3V9PA 5FHRA 2P9TA 5AUNB 5L3VA 3QITA 4EW1A 4DV0B 4Q9JA 4TKUB 4JB3A 5IVKA 3JAWA 4MRMB 1M34A 4RHFA 4DNFA 1DDGA 4A91A 5EGSA 1C7FA 3DBRB 4O4IF 1XJQA 4NONA 5DTEA 4RVOA 1IDN1 4X7RA 1NZFA 1R1DA 4R1PA 4HPXB 1ECPA 2JJ8A 3JQFC 4G0OA 1UBUS 4C29A 2R6R1 3VH4A 2G1UA 1F9EA 4X64B 3N9IA 2W6MA 2JA1A 3CWZA 3O4RA 1JAIA 2OUKA 1T0BA 1UBRS 3SXJA 5G0VA 2JGRA 5KHOC 4NECA 4F56A 5FUYA 3NHRA 4RJLA 1NF8A 2BFEB 3CUWA 3LOPA 3K05A 1PWXA 4HXGA 3NKVA 4O08A 5EINA 4CYMA 4EECA 5FEMA 4RJKA 5K0GA 3GLGB 1KNXA 1T8UA 3N8GA 4ZCMA 4B6PA 3RASA 4JBYA 1EUYA 4OI0A 1EWVA 4OJNA 3B1FA 1ZKDA 2XH8A 4HAYA 2AMJA 3FMGA 5BQPA 1JF8A 4HXFB 1ZQ9A 3V8NA 1CTQA 3BKWA 3HSSA 3UKJA 1ZRSA 4KV9A 5T41A 3WK9A 4HDNB 2FEMA 2NVWA 5CPFA 3ZV5A 1B8NA 3IO5A 3ENVA 2WU4A 3TRKA 4TS9A 4ND8B 1CV2A 3S1LA 2QTCA 1G8JA 3ND5A 2E87A 1B2LA 1QGYA 1I0ZA 2E4YA 3DD5A 4GPEA 4R7GA 3N05A 3HABA 1GTMA 3DVQX 1PW7A 2YICA 4KXVA 3RHTA 1U0OC 2XB2A 2GM4A 3VOSA 2QLBA 1T0PA 1U4OA 2B21A 2HCBA 3DZCA 4ZVLA 3TBKA 3RAEC 4KVGA 3FNIA 2NYVA 5GONF 4YR9A 2Z5VA 2PRIA 3AHHA 4Y6QA 4C6RA 4H9GA 1FNCA 3HE3A 1GQSA 1UBHS 2YV5A 3Q41A 3RFTA 4KZKA 4M21A 2Y0EA 3SICE 3ASZA 1CUGA 3AR7A 2QLJA 3D6HA 3WL6A 4QKQA 4OA5A 4KQXA 5HKLA 2NXWA 4PC3A 5KVVA 2WLSA 2W2NA 4N3AA 2O59A 1HOXA 4H7DA 1GTSA 2RK4A 3DXXA 5GOTA 5D8DA 4BFVA 4GKJB 1LBEA 1VG1A 2V97A 1Y6RA 2FLWA 1AF4A 1FEZA 1DWUA 1ONSA 4M0CA 4UM7A 1JZTA 1MF7A 5IDQA 4NAVA 4ER3A 1ZW6A 3P9YA 1L7DA 1L5KA 3BMCB 2RBEA 4G5HA 5COBA 4OUDA 3ODPA 4JASB 3WNQA 2VSQA 2PMKA 2F8LA 5A0TA 1N1GA 3QE9Y 2DUMA 5BW6B 4HSEA 2A67A 3TUJC 4ZZ0A 4RSRA 2FRVA 4GQAA 1Z3IX 1ES9A 5EIOA 5FDFA 1P61B 4ZRDA 1MJFA 2C07A 2C2BA 3DMTA 2C2KA 4BJHB 1M1NA 1UDBA 3JZIA 1Z8NA 3JASB 2WAAA 4KQIA 1Q84A 3FIJA 1W49A 4FJ0A 3IFSA 3OZUA 4DC9A 4ZICA 3GRRA 4HN9A 4ZJUA 4K9NA 2ZWAA 2ZAGA 3ND8A 4PYIA 3R9XB 2PX6A 2FFQA 3WO0A 3ZU2A 5KU1A 3KQQA 2VQ6A 1BCSA 4G1CA 4Z0TA 2RHLA 3IUYA 4NZ9A 2H48A 2C57A 4OGFA 5HZMA 3L8GA 4DAEA 1V7QA 3PI7A 1LB1B 4DM7A 4EI8A 2O2HA 1FSSA 2XCQA 2R6DA 4QDKA 3EJWA 3HV0A 3IP5A 4WQMA 3AJ8A 4JXZA 4C3ZA 2ZB2A 4NYMR 4TN1A 5E6SA 2WF8A 2XMBA 3UAGA 4JROA 3SSOA 4TPKA 5AW1A 2B4KA 2KS6A 1S01A 3JARB 3V33A 2V7GA 4XM0A 4C0LA 1GTZA 2LD4A 3MGCA 1ZXBA 3PUWA 4FLFA 5IJ0A 1MLDA 4TTRA 2BF4A 3BB3A 1KU0A 2FMXA 4R71A 4AKIA 3B3JA 3KTAB 5JYBA 1J20A 5CXSA 1R88A 4Y6RA 1U1FA 1JAHA 2G08A 3JVVA 3MTIA 2QE7D 1PZHA 2GD6A 1GCOA 5F5NA 1E4OA 3IDOA 3AOGA 4E15A 3BA1A 3N2EA 1XU7A 1ONBA 1UXGA 4ZDWA 1QYCA 1ID8A 1ZNYA 5HR5A 2O07A 1OTYA 4MVXA 2C1EA 3V4OA 2I0FA 3MLBA 1W1IA 3NBZC 1CIVA 4B4WA 3QFTA 4ADSG 5C7OO 5HJEA 2GXAA 3FMVA 3KYCB 4AF6A 2BGWA 3JQ7A 1IK6A 4KGDA 4JBXA 1ZJ4A 1I30A 4MVJD 5JVDA 2PQMA 4HGQA 1VJ0A 3SIPA 2C3OA 4N47A 2GK7A 1GLNA 3JPYA 1SUFA 1D3AA 3I72A 4G09A 4IIDA 3CVXA 3CGGA 1RD4A 3V1KA 2YFQA 1ZIXA 3G0DA 1KO8A 3SEZA 3ZDFA 4ZGWA 2EG5A 3GIWA 4A5SA 1UPBA 3E5MA 5KQLA 1MEEA 4Y0VA 5LLSA 1HX7A 1X2BA 3OIGA 1IRIA 2RHJA 4GP7A 4KOAA 5F2OA 3SR3A 4F4DA 3EPJA 1UQTA 4C07A 3V34A 2KE5A 4Z7JA 1ZN8A 3HUEA 5JSQA 1M2JA 2BDUA 4E3ZA 2ECQA 1R0CA 2EKZA 3BIFA 5F4BA 3ZWYA 5JNUA 2BIFA 3UMYA 3K20A 3EULA 4RMIA 4IIGA 2VQDA 3A1FA 5CJPA 4ARAA 3THYB 5EE0A 3E8MA 3R5JA 1T9HA 4B73A 2UUCB 5D86A 5ED0A 4M88A 4DA8A 1TDJA 3AFHA 4IUBS 3HSKA 3NHZA 1K8XB 5FWAA 1IDOA 2OO5A 3IMCA 1VP3A 3KKPA 3G7UA 5C18A 3AJDA 1FYWA 1T8TA 2ADOA 4B40A 1F06A 2PGLA 4NMXB 3WQQA 1PBTA 2HC9A 2R8RA 1UBOS 3EWSA 2XNJA 1NXVA 3O03A 4OU5A 4UAVA 5K0NA 3LPNA 4IUCS 5GOZA 3A9UA 4LJYA 3BKXA 1BU8A 2RGGA 1AUVA 1YT5A 9ATCA 5AJZA 2IX9A 3RS0A 3IAM6 2XUFA 3S4YA 3STUA 5ES4B 1P77A 1Q1AA 1QG2A 2AOXA 1ZOLA 1JQLB 4O1HA 3AIOA 2GPWA 3QJYA 1W36B 2XGMA 4IAOA 1UBKS 4KN6A 4C0BA 1BVYF 1KIMA 2VP3A 5E1MA 3A1DA 3FNEA 3LKDA 1I4LD 1MRSA 2V54A 1YE8A 4M8LA 3UK0A 1DT3A 4XI9A 5EJAA 3WGTA 3ZOKA 821PA 1SQ0A 2YZ2A 1T8RA 4TM7A 3B36A 1JXMA 5E0KB 4BNYA 3RBXA 3RHFA 2N0SA 3P0FA 4YJ3A 3FUUA 3QFFA 4IIFA 4ZD6A 4CTKA 4QGBA 3NTOA 2I9KA 5DNAA 2QRVA 3T54A 2WK1A 5JO0A 4H7KA 1ZWKA 1EDBA 1E7MA 3G0BA 3VKGA 4M38A 5D5HA 3CJTA 4KMMA 1VMAA 1LGYA 1P1FA 4G8CA 5F98A 1A8PA 2ZYUX 3HYSA 1AQNA 2H7VA 2ZWMA 1VGVA 4H6XA 4PYQA 4NIMA 4BIMA 4DLZA 1N32B 3QU9A 4M0UA 3FI9A 2X7JA 2XV1A 1P2TA 5ALJA 4HWOA 2GK3A 4K9RA 5IC5A 1ESCA 2VPQA 4QYXA 3D5TA 5D87A 2COUA 3H16A 1RQRA 3OKFA 1WW8A 5LQCA 1HQDA 1IWPB 2FMFA 4C1NA 3QMPA 4LX8A 3LY8A 5B5SA 4IG9A 2YYSA 3C8DA 1EIZA 4TTQA 3IOBA 2JIRA 3P5SA 3SX0A 3BDAA 1FSPA 2I6QA 4NG5A 1E8DA 3UUWA 4ZO8A 1P73A 3CZ9A 4DADA 4QTYA 4HI0E 2HJGA 3OVMA 3RABA 3GPIA 1FU4A 2BHNA 3LRPA 4UBNA 2QQFA 2NSJA 3N7UA 1VCIA 2RGYA 2SCUB 2WA2A 4RXMA 1JP7A 2C95A 1UBMS 4UVIA 4PAQA 5JXWA 3ACBA 3T1YB 4CIBA 1P29A 3H11B 1IL0A 1PYOA 3GYGA 1F8GA 1DHRA 1NBIA 2GDZA 3CSDA 1M5UA 3SC3A 5JJLA 5JQGB 5KYWB 4GUAA 4EUHA 3OT4A 5BWLA 1C1DB 4HQKA 1P1CA 3NX4A 1DNPA 3SWWA 1RABA 2VVTA 1JQKA 1ADFA 3GJ6A 3ITEA 4JU8A 1C4XA 4Y9TA 2RHDA 2WIFA 4I50A 5FWXB 8GPBA 4GYWA 1L1EA 1WXFA 4OHCA 4UM9B 4BX0A 2ZUEA 4PSKA 1P9OA 3BWMA 4GBED 5EWJB 4JL8A 2ERYA 3GDGA 1KI1A 2A5GA 1RZRA 5FYDA 5K0FA 3SF8A 6GPBA 4WN3A 4WXPA 2BEKA 2PMWB 1X1SA 1G64A 2H1IA 3AEKB 2WI8A 3GJQA 4NK4A 2KBEA 5HK9A 4RD6A 2C7VA 2ZPUA 2D5IA 3HDQA 3IP1A 4P33A 3SZMA 4EHHA 4WBNB 4R9RA 1Z75A 1X7XB 4DV6B 2EJCA 2DWOA 1DIAA 1XD2A 3RHSA 2HHHB 1NMSA 1TLFA 3C8UA 3W5UA 4CLXA 2CCJA 1XPUA 4CL8A 3DGEC 4G9BA 1GN9A 1ZKMA 2AVNA 2PUCA 4NL4H 3KWFA 4CQMD 2NPOA 5SICE 3SQLA 3K96A 1LNSA 3JVEA 2NZ8A 3K9CA 4QATA 2H2HA 2BFBB 3FUVA 5J4KA 1VFPA 1ZM9A 4AG5A 3ACCA 4ZT3A 2XNSA 1HYGA 4KO4S 1B6SA 2EFYA 1Y4AE 4HF7A 4N8DA 3TQFA 4RE5A 5LNK6 1RFLA 2C3MA 1R3DA 1TM4E 1JJFA 3STYA 2AQ8A 5AR1A 3RVSA 2PPLA 5BV1A 2X1HA 4TV8F 5DNCA 3DEKA 2IS4A 3W5SA 2FUG1 3K6KA 1T8YA 4AG3A 1JEOA 4IP0A 1QH8B 4MTLA 2EBWA 1MORA 1YDEA 1O6ZA 1N2SA 3AY0A 3E70C 3OZEA 4M1ZA 4ZVTA 2IYXA 5HQJA 5F2NA 4IH1A 1DLJA 1OSNA 3WGJA 1VHTA 1AZLA 1US8A 1M6NA 4JLPA 2Q0SA 3VU1A 4EGFA 1NOJA 1Q5PA 3GD7A 2C4TA 2HWUA 1FW8A 2C96A 1FJGB 2PZGA 1YJCA 2XE8A 3ER6A 3IP7A 2VXBA 1KAQA 3N86A 3OCZA 5E0OA 5HS6A 1WU8A 4AWAA 5K0ZA 5CA1F 1HRDA 2HK9A 4OB6A 1MO6A 3HYRA 4S0ZA 1QDEA 4UE2A 3HBMA 5KWJA 3LOUA 5JYEA 2OV6A 3M0EA 1O03A 3JRWA 5JMPA 1FVXA 3DZGA 1SIUA 4JZYA 4ZVVA 4CPDA 2DR2A 1CULC 5TQ2B 5EMNA 2JFVA 1ORRA 3OLYA 3NUGA 4DLAA 1XMQB 3ROMA 5CA0B 2B2XA 3V2HA 5H02A 1IVNA 4RMNA 5TMEA 1HR0B 4L73A 5ENVA 3PNVA 3O2SB 2BGLA 2GF2A 3Q7QA 3F5SA 3G8DA 5FP0A 3SC6A 2PCLA 4ZZ3A 5IAEA 5FOTA 4JC4A 3ZJVA 1V11A 4QARA 1Y7PA 5KCZA 5BO5A 4CHGA 4EX7A 4FPXA 5IH7A 1M2GA 1I94B 3EQ2A 4LDNA 3DXFA 3JZDA 3FHLA 1YR8A 4ER5A 3F3KA 4D9EA 3VC3A 3L5KA 3LBIA 1A2QA 1K97A 1LD3A 2XB4A 1QGZA 2BM1A 1T4GA 5J59A 1D2EA 5M34A 3IELA 3T7IA 1KVQA 1W30A 4GOJA 1GRQA 1XTSA 3THOA 4BQNA 4QHYA 3AUTA 3WADA 4EGCB 4ZN6A 2DGDA 1SBIA 2WHQA 1KWGA 4JLSA 4Q48A 2CSXA 3LC0A 1TRHA 3Q85A 3KBOA 3SS9X 4ND5A 5F7XA 4J4HA 3ZS9A 5T8KC 4DMMA 1P2BA 4S12A 5CBPA 2A86A 5A03A 3EEYA 1NG1A 3SIRA 3CT4A 3Q5GA 1TOAA 1BYIA 4ZT6A 3GN1A 2R00C 2HBRA 3WWEA 5BVGB 1J1IA 1DUVG 1WJGA 2H9IA 3L77A 1DX4A 2IY8A 4Z6KA 5JZ9A 2XX3A 4MJ3A 4GI2A 4ZZ1A 2GJAA 2H1LA 1A5AB 4BVKA 3WGVA 3SAJA 4A92A 2OWEA 5EHIA 2A6PA 1LSJA 2WHEA 3CHYA 1HLGA 3QNUA 1CEQA 2MWMA 4GGPA 4O4LA 4YWHA 3FLEA 1DG1G 1G3RA 4QYSA 4EHLA 4WK2B 1YZTA 3GARA 3ZWOA 4BECA 3FZEA 5SYAA 4YAWA 1K9SA 4CF6A 3AZOA 3I58A 1N2CB 3U4QB 3P9XA 3WWOA 1OKKA 3VNVA 3SYRA 5B3LA 4FZ3A 2DPGA 5GIOE 4BHTA 3TOZA 4NHOA 3BL5A 1UUFA 2DY0A 2PGIA 4LBYA 1EPUA 1JHMA 1GAQA 2VF2A 2HR1A 1L5WA 1RVV1 4BNDA 3GJ4A 4E5NA 2WTAA 2ORWA 4HMOA 4RFSB 1G18A 2Y71A 1CEYA 1CF9A 1PGJA 4MKGA 3KQUA 4XX0A 4Y98A 2WWWA 3TLAA 4AL4A 2E4UA 4BGUA 4ZHSA 3UAOA 5EHXA 3AHDA 2JJYA 3RCBA 3VPFA 4JBLA 4EB6B 5IX8A 5JI3E 2WR8A 4M7RA 5FTMA 5JW6A 2QD5A 4CCSA 3SN6A 2E6UX 2PFSA 1QFYA 2VTEA 2CWWA 2WKSA 3GGDA 5ILQA 3W6NA 3GDHA 4C89A 4ZTBA 4H18A 2FZVA 4P31A 3NONA 2KBFA 2JJ1A 4PFQA 2RD2A 1BQEA 1EFAA 1J9ZA 4B75A 1LI7A 3B6IA 3E0QA 1S2NA 1R50A 2XXBA 3ISVA 3K4PA 1ZM7A 5LL6P 1FMTA 3CW2A 2QX9A 3QOFA 4EG5A 3Q87B 3I4CA 5NLLA 1EDDA 2CZCA 3KLPX 4X8MA 5L6LB 3BREA 1V9LA 5EKDA 1YZ3A 2AD1A 3F3MA 3T95A 4DNOA 1MUUA 2BFFB 1OWNA 4HNSA 4F91B 2GHQA 1Y33E 2QNBA 3NC0C 3NBUA 4Z4GA 3QYPA 1SU8A 4YI3A 1GR1A 4MUIA 2IU3A 5JAUA 3HB5X 2NPFA 5LU8A 3ESAA 1NC3A 1GKYA 4RENA 5HILA 2FSHA 1T2DA 4MQ4A 1Y3AA 2MIIA 2ZVPX 2EZUA 4EAQA 1YIAA 3NNSA 2QXYA 1ODCA 3O21A 1QV9A 1ISPA 3KPYA 4HDRA 1WZ2A 2IJGX 1ILWA 4LE1A 5L4LA 4J3NA 3V3KA 4BFWA 4PHTA 1QKJA 2VT7A 1EM8B 2ES4A 4X3OA 1OIVA 1SC1A 2WILA 3F4LA 4H4CA 5J1SB 2EJTA 5IMBA 1H66A 4COOA 2YY5A 2IOFA 4Q4HB 3WMFA 3TGLA 1LTKA 5HYVA 5DCUA 2FUCA 5K5EA 1BXRB 3B3GA 4JC0A 5I48A 1QRDA 4D25A 1OLUB 3K6JA 4A27A 1JLLA 4V0QA 2WB2A 1NKVA 4LMRA 1C3VA 4ACAA 1IG3A 2XVXA 2W70A 1OAAA 4Q3NA 4DR7B 2HA5A 3JQDA 3MJVA 4I1VA 4OGLA 4Z9XA 1V5GA 3UT5A 1W4ZA 4G0NA 4U2GA 3AR8A 3CQ9A 1RQNA 2DH5A 1S7CA 2CNWA 4D5GA 4OV6B 2AFIB 1LH0A 2ZQ5A 4G81A 2SKEA 3FDZB 4U2EA 3SDSA 3GLHB 4B3SB 3HWSA 3NJ4A 1A5SB 4FGWA 3HLKA 3FYUB 4HSGA 1GZVA 3EFHA 2KQUA 2O0LA 2A30A 4H7FA 1FFCA 4LG1A 1QR6A 2JEYA 1PUXA 4S3MA 1P0IA 4F8YA 2FW6A 1YCFA 3KJQA 1U28C 4JQZA 1QVZA 2E4AA 4P54A 3A1WA 3U31A 1H8HA 2B6HA 2FQYA 2KI5A 4DZRA 3T35A 3UG7A 2ZM6B 4G5QA 3FKSA 3SLRA 3SBEA 4EUNA 3T5PA 4MJXA 4F2HA 3RSSA 3CCBA 2RBKA 3EXFB 1T9GS 4ZJPA 1PEDA 3QFRA 4PSVA 2W2KB 5L4NA 1TEVA 4LHYA 2ZUWA 2Y0CA 3B6JA 4Q1EA 4R7TA 2J9RA 3VBEA 3GH3A 1BW9A 2DWCA 1RKVA 4JENA 4L76A 1MIHA 1I80A 2YWFA 3K6SA 3TIVA 5LVAA 4D43A 2IP1A 4P0PB 1ACJA 1J0AA 3KJGA 1SVKA 5ENZA 1TKAA 3K0FA 1AV6A 3L7OA 2JARA 2IZ1A 3MJEA 4K6KA 2WSSD 5CB4B 4CI0B 3G8YA 3PJFA 2DM6A 3T06B 2QTLA 2RGNA 3PGLA 3NEPX 4GOLD 4MYDA 2OCXA 2F3SA 3VNBA 2GYYA 1ECFA 2QIPA 4L9RA 4BTVA 2QMOA 4YQZA 3PC4A 3U3KA 3GBSA 4CMIB 4J4TA 4K46A 4RFVA 2DFNA 1L4YA 2BH2A 1P0CA 1EP1B 2QTRA 3C74A 3FBWA 1Q7TA 1WS6A 1D7AA 2PGDA 4O2AF 4EG1A 4IDQA 1AC5A 3ANSA 5CFNA 5FA6A 4F92B 1DDOA 4OQYA 3IRVA 3MPOA 3TKLA 4EA6A 4CKWA 4G36A 1L5YA 4E88A 1PR2A 1Y3FE 2O1WA 3FWYA 1XMXA 3F9IA 3MBIA 3E8SA 3PL5A 1LQUA 1XR3A 3FCOA 2OCDA 1PFVA 1CQWA 4RK7A 3C4JA 4M22A 4XOIA 4XR4A 4GVPA 1K7CA 4YJDA 3RYHA 1USWA 3UXYA 1ZISA 5BSUA 2H07A 4ENSA 5JISA 4YROA 2VDMB 4WIAA 5U1PA 3UMBA 1TU4A 1RMQA 3MNFA