3M2PA

The crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
294
structure length
287
Chain Sequence
SLKIAVTGGTGFLGQYVVESIKNDGNTPIILTRSIGDYEYRVSDYTLEDLINQLNDVDAVVHLAATRGSQGKISEFHDNEILTQNLYDACYENNISNIVYASTISAYSDETSLPWNEKELPLPDLMYGVSKLACEHIGNIYSRKKGLCIKNLRFAHLYGFNENYMINRFFRQAFHGEQLTLHANSVAKREFLYAKDAAKSVIYALKQEKVSGTFNIGSGDALTNYEVANTINNAFGNKDNLLVKNPNANEGIHSSYMDSSKAKELLDFSTDYNFATAVEEIHLLMRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of UDP-N-acetylglucosamine 4-epimerase from Bacillus cereus
rcsb
source organism Bacillus cereus
molecule tags Isomerase
molecule keywords UDP-N-acetylglucosamine 4-epimerase
total genus 106
structure length 287
sequence length 294
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2010-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3m2pA00
4D46A 1U3UA 3AUTA 3FBTA 3Q9UA 1GEEA 1GV0A 1N1GA 1OMOA 3JQDA 4LGVA 5CPFA 4AJEA 5IFLA 5JCXA 1EBFA 1MP0A 1LBEA 1JW9B 3VVCA 3I6QA 1WMAA 3W8EA 2D2IA 1JN0A 5G0SA 5A9RA 5TIIA 2GN4A 2HSDA 1E1NA 2OHXA 2I66A 3FN4A 2X9NA 1HE3A 2D8AA 3RASA 4B79A 4BNWA 2GYYA 2CVOA 4E12A 5GZ3A 3DZKA 5TJHA 2IODA 1HE5A 1YBMA 4CQMA 4P38A 5DBIA 4EEXA 3GHHA 3PWKA 5F1PA 2AQIA 1BMDA 4BNFA 1IB6A 3OQ1A 3VZSA 1NWCA 3QQPA 2EHDA 3AU9A 1U4SA 4TKLA 1V3UA 2X23A 1R16A 4GQAA 4DBVO 2VQ3A 4D44A 5KVSA 4M54A 3ZW8A 3RC2A 4YJGB 1QSGA 3H5NA 1L1FA 1MXHA 4ND2A 2I6TA 4IDGA 1EVJA 3TZKA 1ENYA 2VNSA 3SLGA 1C1DB 4QUKA 4LCJA 5MDHA 1X15A 3LC1O 5JO9A 4M49A 1F14A 2AQHA 1YKFA 3VKVA 5KJFA 2Q3EA 3PK0A 4PG7A 3FR8A 1JVSA 5DULA 4GKVA 4YAIA 1OFGA 4D0SA 5IF3A 1U8XX 4RLHA 1T1RA 3NUGA 3QWFA 4K6CA 1H9BA 2VNAA 4DBZA 4XYLA 4HADA 1NAIA 3MTJA 3DHNA 3MJCA 3IL2A 4RL6A 4BNHA 4JBHA 3VTZA 1JA9A 4UAGA 3A4VA 1TEHA 3G1TA 4GLLA 5EINA 2GGSA 5TLSA 2VN8A 4FPXA 4IDAA 1IE3A 2B69A 1O9BA 2OFPA 1B8VA 4AJNA 1Y1PA 2V65A 4GVLA 2PD3A 2ZTMA 2P9GA 4HBGA 5G0TA 1U3TA 1MB4A 3OQBA 5ADHA 4CMBA 2G76A 4M86A 3DBRA 4MVJM 2WD7A 4B4OA 4IDCA 1FDWA 4CQLA 3KEOA 1NPYA 4Q3BA 1QYDA 2HUNA 2UVDA 1FMCA 5JCJA 4GX0A 5LDGA 1OC2A 3BMOB 4QXMA 4YJFA 3VVBA 3AI2A 4YXFA 4JX8A 2OL4A 3PIIA 4KOAA 4OM8A 1FDUA 1T25A 3HDJA 1TB4A 1BWSA 3ADOA 1DEHA 5TGDA 4C4OA 1ISJA 1X13A 3ZWYA 4ALIA 3I1JA 4HFJA 2NU8A 4WEQA 2B5WA 3M2PA 4TRJA 4WASA 5IDWA 3VOSA 1ZO8A 1E3JA 3MCVA 4GX5A 2E4AA 3WNQA 2PH3A 3ZV5A 3AY6A 2QG4A 4AJPA 5HM8A 3K92A 4LRTB 3S2FA 4NIMA 1ADGA 3UKOA 1WVGA 3OA0A 1X1EA 2E49A 1D3AA 5KJ1A 5JY6A 3O8QA 2X0RA 2OXIA 1TLTA 2Z95A 1E3SA 1HRDA 1XEAA 2B4TO 2BFPA 3P2YA 1B3RA 3E5MA 5JAIA 3LZ6A 4WEOA 5DT9A 4Z3DA 4BS9A 2NVWA 3JQCA 3F9IA 3PQEA 1NP3A 4J7UA 3DZGA 5KKCA 4YA6A 3GLQA 3GMSA 1Q0HA 2VOEA 4J6FA 4YBZA 3V5NA 4CR8A 1MX3A 3GDOA 3HN2A 3AJRA 5LC1A 4BKUA 2UAGA 3DR3A 4DPMA 4YTEA 4E30A 1R4MA 1DXYA 2CUKA 3RWBA 1GDHA 5A06A 1E1LA 3KO8A 4E33A 4E5NA 1EQ2A 2CDAA 5ENDA 4PZDA 4PLHA 4R69A 2GNAA 4RPJA 1AGNA 1NR1A 4FOSA 2E6UX 4G2NA 4L8VA 4Q3CA 4UVDA 1M66A 1XA0A 2HO5A 3OH8A 2POQX 3FNGA 5DNAA 2JFFA 4MJLA 2PH5A 4TRRA 4EUFA 1ADBA 1UXJA 4MO2A 1UAGA 2Y1OA 2HCTA 2J3KA 5L4LA 1KIFA 2EEZA 1H5QA 4IZIA 4KDFA 2GO1A 3GGOA 1GV1A 4E6PA 4LMRA 1E77A 1PZEA 2HMTA 4WE3A 3ZV3A 2YZ7A 2XXJA 4K9DA 3BHIA 4BKQA 3JD4A 1JTVA 3D4OA 4BNVA 1PGPA 3JQ9C 4NFHA 4E3ZA 5EIOA 5COBA 1IPEA 2X9GA 4B7UA 1D8AA 4YQYA 1ISIA 3B6ZA 3DONA 4GBJA 4KP7A 8LDHA 1DDOA 3GG9A 2F00A 3AU8A 4BO5A 2AE1A 4PLVA 3R0IA 4BO6A 2NADA 4ZJUA 3KYCA 4J0FA 1J5PA 4J2HA 1GYQA 1GTMA 4YRDA 3WGZA 1KEPA 3UCXA 4CMEA 5IN4A 4BB6A 3VH4A 4GH5A 4FR5A 4R54A 2GZ3A 1LLUA 1V9LA 3FNEA 4YDRA 1UZMA 3W4IA 5L95A 4CUZA 4CR6A 2G82A 4J1SA 2VUUA 1UR5A 4L0QA 1QRRA 5A4DA 2Q4BA 5CAEA 2X0JA 3QWIA 4A26A 4IDFA 4DUPA 4N5LA 3RROA 4OL9A 4R9SA 4BV9A 2DPHA 3SVTA 3EYWA 3GAFA 3E8XA 5DOVA 1VL8A 1UH5A 4FIZA 2CSUA 1EVIA 4FSHA 4EGFA 4OXKA 2ET6A 2H6EA 4DIOA 1LXCA 1ONNA 2P5UA 4RO0A 1I33A 3VH1A 5IXYA 4I1IA 3WSWA 1LDBA 4MP6A 4ALNA 4NJMB 1C0IA 4KWIA 3VPHA 1NPDA 5COQA 4XA8A 3UW3A 2PV7A 4IPTA 3DO5A 3LF2A 1EZ4A 3S1LA 2OUIA 2A9FA 4RF4A 5B4VA 1AXGA 1Z7EA 1I3NA 1O0SA 2Y0DA 1HLPA 1LTHR 2WEKA 5CEJA 5JFOA 1LI4A 2FR1A 3KBOA 4UUMA 1ZJYA 2X7HA 3ONFA 4QO7A 3U0BA 1YQXA 2PKQO 4DPKA 1EK5A 3UH1A 2BI7A 1GZ4A 5DZSA 2QZZA 1WZEA 4FCCA 3OMLA 3E03A 3OSUA 2O4UX 5G2OA 3I23A 1HT0A 5A9TA 4YT2A 4J7XA 5KOIA 2YV1A 4BNUA 1UZNA 2CVZA 3R1IA 4N5MA 2CF5A 4M8SA 1K89A 2AA3A 2W98A 2JKVA 3NJ4A 1ZIDA 1LA2A 1Y9EA 1I30A 4LK3A 4ONEA 3TZCA 5MGBA 5F21A 4XR9A 4B3HA 3LVFO 1ONOA 3X2EA 3RI3A 5CDUA 4NFYA 2X8LA 3CTMA 4KUEA 4ZRNA 1R12A 1ZK2A 4CLDA 4L73A 2NU7A 2O23A 5AXBA 1L7EA 3JQ6A 2GERA 3OJLA 3WNVA 3IAHA 5JNLA 1U2GA 1E5QA 4W9NC 4BNGA 4L74A 1XCBA 4FGWA 5JBIA 4AJJA 4NK4A 1YE3A 3JYLA 5EMHA 2CZCA 3UXYA 2BFOA 2QRLA 2VHYA 4UEOA 4YJGA 1BW9B 3NX4A 2PZJA 1VI2A 5ES3A 1ZW1A 5B37A 3UFXA 1P9LA 3RU7A 3DEYX 3F4LA 3PWZA 1B3BA 2NVUB 5JYDA 3WMWA 3WTCA 2W2LD 4G5HA 1DAOA 3NTOA 1SB8A 3RU9A 1T2EA 5KNLA 3GEGA 4CV1A 3QV1A 5DCWA 1Q0QA 2YFHA 1ZUD1 3FNHA 3WDSA 3Q9NA 3EZLA 1SB9A 1QV6A 3BMCA 3TN7A 4P8RA 3X2FA 4GI2A 3ZNQA 5THKA 5L45A 1LSOA 4CLOA 1R0LA 4NBUA 3WWZA 3PJDA 3EZYA 4P4NA 3PTZA 3CINA 4CUKA 4I08A 4JLWA 2Y1FA 4IS2A 2Q50A 1NNUA 3K5PA 1LC3A 4CM9D 2P2SA 3RD5A 2VUTA 2P5YA 3QWHA 1LDNA 4UREA 3VPGA 3WQSB 1UDAA 2A92A 2P4HX 2W2LA 3ZU4A 5H83A 5A1TA 3RIHA 5CDSA 3KYDA 3C7CB 1E92A 2DU8A 1WAMA 1UP4A 2EERA 1M6WA 2E82A 3HWRA 3NYWA 1Q1NA 3AOGA 1Q7GA 4E32A 1GD1O 3PHLA 2NQTA 1X7HA 2ZB4A 1U28A 4OO3A 4XYGA 1LU9A 1YDEA 2PGJA 4LMPA 1DOHA 1PJTA 2AG8A 4KQWA 3RVDA 2J3JA 4PG4A 2DFVA 3L6DA 4Q3AA 1ZNQO 1R4NA 1VJ1A 1N7HA 1EBUA 3OF2A 1HZJA 4ND1A 1RM5A 1A9ZA 1CEQA 1ZSNA 4KQXA 1IYZA 4S1VA 4BKOA 3FPLA 4TVBA 3BMNB 3ADPA 4UULA 3FCOA 1ZJZA 3H3FA 4I5GA 1P44A 1EUDA 1Y8QB 5GZ6A 4L76A 2PKRA 3I4FA 2VWQA 3DBLA 1C0KA 1RM3A 3PGXA 4YT5A 5A3JA 2I5PO 1UJMA 3OFSA 4XB1A 3P19A 5DCUA 1NXQA 1E5LA 2WYUA 3NTQA 3JTMA 3GF4A 4Z0TA 5ILOA 5COAA 4YRAA 3GEDA 2J3HA 3O03A 3OETA 3QP9A 1QYVA 4I9UA 5HS6A 2PTGA 4BGVA 3ZHZA 3I9NA 2C7VA 2X6TA 5JMPA 1B14A 1N5DA 4MVJP 3AW9A 1P77A 2FSVA 1P33A 1UXKA 3JQ8A 4EJ0A 3H3JA 4JP2A 1UDCA 4WUVA 1T4DA 2BFAA 1QORA 4JN6B 2PZKA 3U62A 3O26A 2FMUA 1GQ2A 2VHZA 3P7MA 4XR4A 5JPIA 5KVQA 3RKRA 3V2HA 2NV6A 3WGIA 1PL6A 4QFDA 2QX7A 4OMUA 4IINA 4PZEA 3FHLA 3NGXA 1PL8A 4D43A 2DKNA 3VH3A 2HK7A 1JWAB 4YT4A 4DMMA 4FW8A 3VKUA 1CYDA 2GLXA 1T2FA 3L9WA 4CM4B 3TJRA 1DIAA 3ITKA 1MA0A 3ZWVA 3MOGA 1IZ9A 2C07A 3VZPA 1QR6A 5KJ6A 1U9JA 5FYDA 4DQUA 4CM8B 5EERA 1FXSA 1TVEA 1QMGA 4D42A 1U7TA 2GASA 2HDHA 3I3OA 3QY9A 4PLPA 1ISMA 4JGBA 2OGUA 4ZQFA 3DFUA 3RBXA 4K1LA 4YJHB 5AXDA 5A04A 4II2A 5DN9A 4B4UA 5H81A 4BMNA 3KHUA 4ESOA 5B4TA 3PZRA 1RYEA 1O8CA 2CDBA 4J49A 2QQ5A 3PVZA 4IMPA 4QT0A 1RM4A 1E7QA 1GCUA 3WSVA 1WW8A 2FWMX 5F1KA 3ZHXA 1B8UA 3L4BA 1RM0A 1H9AA 2BRUA 3MWDB 2NQ8A 3F3SA 4BGIA 1ISHA 1PGNA 3IKVA 1K3TA 1SC6A 3GPIA 5BNTA 5TJ9A 1N7GA 2EJWA 2VZ0A 3QWBA 3DTTA 3JQAA 1G0NA 3VPXA 4BGEA 3BZUA 3AWDA 3OJ0A 4W9NA 1V3TA 1UXIA 3GR6A 3IJRA 3IP1A 4WOKA 3ST7A 3C7AA 2EIHA 4CQMD 3F5SA 4E2ZA 4E2XA 2D4AA 3EVNA 1FDSA 3LK7A 3GDGA 3JD0A 3ONDA 2RHCA 2DTXA 5FFFA 5G4KB 1YOVB 4J2OA 2PFGA 3G49A 4AJHA 1P1HA 2JAHA 1H2BA 3E9QA 4MPDA 2FY8A 4Q39A 4WLOA 3TSCA 5C7IO 1NFRA 4PRKA 3U5TA 3OECA 1E7RA 3HFSA 1YVEI 1SZJG 2X0IA 1MG5A 1YB1A 4CM4A 4BOYA 3HE3A 1MFPA 3FR7A 2EGGA 4HFNA 1PJ2A 4MIEA 5CDTA 3ZV4A 2UV8A 1CF2O 3DZBA 4UVHA 1ULSA 1EE9A 3D0OA 2Q1SA 1V0JA 1GAEO 4G65A 4Z9YA 1I5RA 1PJ4A 4OQYA 3BHJA 5C7OO 3LC7O 1KVRA 1U1IA 4CM5A 2JJYA 2DTDA 4YAEA 1R4NB 4A03A 1W8DA 3QHAA 1NQTA 1HDOA 3HZZA 4NR0A 4UVGA 3DZIA 1IPFA 4NU6A 5B12A 4Y6SA 3CIFA 2GZ2A 3QVTA 3WGGA 1ZSVA 2ZATA 2XPCA 1K6JA 4UUPA 4J1QA 1RPNA 1PJCA 4JXKA 4U7WA 4I9NA 5T64A 3AUAA 2NUAA 2WDZA 3PGJA 4NI5A 2GDZA 4TVOA 1LQTA 4O5OA 3WB9A 2C59A 3IJPA 4FFMA 1SOWA 5DOZA 1GEGA 4CMIB 1YS4A 1KC1A 2FR8A 4WK6A 2YJZA 4K6FA 1XSEA 1VC2A 5JAQA 2V6BA 2CDCA 4RVHA 2GZ1A 3ZI0A 4IGFA 3CZMA 2QYTA 4DXHA 4DREA 1P74A 5G0WA 1M75A 2PGLA 4CMIA 4A10A 5K9ZA 2HLPA 3EUWA 4R5MA 2YDXA 4CL8A 2EKLA 3ZWWA 3U4HA 5CPBA 1MG0A 3KUXA 1CQJA 4WCFC 4PLZA 1VLLA 1P1JA 3C1OA 3TFQA 4PLTA 1JLLA 4BV8A 3Q3CA 2ZJ1A 5I7FA 5GMOA 2VUSA 2IZ1A 3OIDA 1QKIA 3CSDA 1Z45A 1NVTA 2C7GA 1HDRA 3C1TA 2IRWA 2Y67A 4TKMA 1DO8A 4GMGA 4NDNE 1XU7A 4WNIA 3G0OA 4AVYA 2ZQYA 1BVUA 2CD9A 4HUJA 5C7LO 2D3TA 2VTDA 4RZIA 1PWZA 1D1SA 3JQBC 2NU9A 2QRKA 1HZZA 2O3RA 3KLMX 1I10A 3NTRA 4MKRA 2WYVA 2V6MA 2D0IA 5B4UA 7MDHA 4YPOA 1H6DA 1AHHA 3I9KA 3D4PA 3K8ZA 3T4XA 1FF9A 3WBBA 2CVQA 4YAKA 1I3LA 2EXXA 4QX6A 3Q1LA 1GZ3A 2ZTLA 1NYTA 1VKOA 1J4AA 3B1JA 1PGJA 3HHPA 3RJ9A 4BNNA 1QYWA 3NDIA 3GMDA 5G4KA 3JQFC 5K6AC 3GOHA 2DAPA 1DB3A 2ZB7A 4DYDA 5K0ZA 4LVCA 2W2KB 4GMFA 4BNZA 2DC1A 1VM6A 1YGYA 2Y0CA 5ILGA 4RORA 3MTGA 1LJ8A 1YB5A 1YL5A 2EKPA 2V6FA 1MLDA 1AE1A 3BYZA 1HSZA 4QO8A 2R00C 1T2AA 2XOXA 5JE8A 1R37A 4E5KA 3F1LA 5FI5A 3TPCA 1HTBA 4F46A 3R3JA 2X4GA 3UVEA 4TSKA 1IHXA 3WJ7A 5I8WA 4CQLB 1DHRA 3M1LA 2WE8A 4FQ8A 2WWRA 2G5CA 3TFOA 3VPFA 3TL3A 1XYGA 4YWJA 3S2EA 1U8FO 2YW9A 2AEJA 4DGSA 1XWFA 3COSA 1TI7A 3MJTA 3PDJA 1LSUA 4MDHA 3KSDO 3AY3A 3PP8A 4E5YA 4Q3DA 3UCEA 4EJ6A 4XDZA 2RCYA 5C37A 1WDMA 1LLCA 1RYDA 4RDIA 3RBZA 4OQZA 2Q99A 3I5MA 7ADHA 4R16A 2PLAA 4Y67A 4W82A 4YAGA 3RUDA 4XDYA 3WMXA 4A5OA 4LW8A 4ALJA 5BQFA 5ICMA 5HRUA 4BNTA 4FFOA 1XKQA 1KY5A 1F8GA 3Q2IA 1IOLA 1E7SA 4OJNA 4EEZA 4FC7A 4R3WA 1YJQA 4DQVA 1DFIA 1U3WA 4NU5A 2Q1TA 4GSLA 2AHRA 3WTBA 2I65A 3H9JA 3PFWO 2WMDA 1GQYA 3JSAA 4YJDA 3NDRA 4XJTA 1WP4A 2OP1A 3DL2A 2EGHA 3GG2A 4RQUA 2NTVA 4Q9NA 3KEQA 1R15A 4HV4A 1BG6A 4PFJA 3I52A 1ENOA 2D5CA 2EP5A 2HRBA 3U4IA 3DFZA 3GH3A 2OBYA 3W6UA 3JD3A 2Z5LA 1R6DA 4B7XA 3EHEA 3KTDA 3LLVA 4ZVVA 1DPGA 2DUWA 4BO9A 3UHAA 3JYNA 3UOGA 3GZNA 2Q2QA 2ZQZA 4Y6RA 3L07A 3ROQA 4N18A 4LN1A 4XYMA 1ZVMA 4MKZA 4NBVA 1KY4A 3TOZA 2AG5A 1PZFA 1SNYA 3GN1A 3BTSA 4MVJE 3Q2KA 1BXZA 2WYWA 1N8KA 3GNTA 4RPKA 4FJ1A 2Y99A 4CV0A 4IGEA 1F17A 5GZ1A 4FDAA 3Q11A 1KVTA 4P4GA 1J0XO 2IYPA 5KVCA 1JU9A 1U7HA 1Y8RB 4BKPA 3AFNA 2WD7B 2PR2A 3IOYA 4ZD6A 1LRKA 2B83A 1GCOA 1NVMB 2AMFA 1NX6A 2GN9A 3PYXA 1U5CA 3DBLB 3K2BA 4QSMA 1OZAA 4PLCA 4FFNA 4QEDA 4RCVA 4M89A 1Q2XA 3OIFA 4TZTA 3GY0A 1A7KA 3RQSA 5I7VA 4CLRB 1ORRA 1M76A 3RCBA 3DZFA 2J5QA 3JYQA 3N7UA 3PLRA 4XX0A 2UUPA 1QYCA 1IY8A 3G1UA 2ZIZA 3T7EA 4Y8VA 1D4FA 4BNJA 3MJVA 5HS4A 1MGOA 1LX6A 1G1AA 4HP8A 2ZJ0A 3DBHA 1XQ6A 5FI3A 4YR9A 3HJAA 5BSEA 2PD4A 4BO8A 4WCFA 3GPDG 3DBRB 4PLWA 2VT2A 3KSZO 4ZRMA 5IXSA 2HK8A 1I3MA 4RF3A 3TZQA 2OBNA 3WOHA 2PKQP 2X5OA 2X1HA 2JCXA 3E5RA 3OQ6A 2HJRA 1KEWA 4D0RA 2C2YA 5DDIP 1ENZA 3DMTC 1B0AA 3EC7A 3WLFA 3EGOA 3QIVA 5AYVA 2HMVA 1HDZA 3WBFA 1R0KA 1HKUA 5J23A 3L77A 5DP1A 3EMKA 4XGKA 1NPTO 1NBOA 3A28A 3ZHYA 3ZWBA 1WDLA 5IDXA 1OC4A 3WXBA 3GVIA 1CETA 1NTOA 1GU7A 3SJ7A 4UUNA 1BGVA 1LDYA 3RUEA 2HQ1A 1MUUA 1MFZA 4OXYA 5TX7A 5A05A 3RSHA 1LQUA 2RBEA 2H9IA 4ND4A 5A3VA 2I3GA 3PZBA 1DC4A 1MC5A 1IUKA 3JYPA 5HWSA 2FN7A 2YUTA 5JCJD 4TRNA 4YRBA 1NAHA 4CM6A 4MP8A 2BLLA 4CL3A 1DRVA 1EUCA 2Q4EA 4JIGA 1CDOA 1B16A 3OICA 4FGSA 3HN7A 5EQDA 4Z0PA 3C7DB 3FWNA 3AUSA 2Q1UA 4IJVA 4I5EA 5JO0A 5LCXA 4LISA 2IEDA 3ULKA 2Y0EA 5AOVA 1VJ0A 1Y9AA 5L4SA 1SBYA 2PD6A 3ZWXA 2I76A 2PK3A 3PHHA 3RUAA 4BO1A 3RC7A 4QFCA 2Q49A 4YVFA 3IKTA 2O2YA 1ONPA 4IDDA 1EQUA 2C5EA 3C85A 3L4SO 1PX0A 1XHLA 1E7WA 1LSJA 1JAXA 3JQGA 4D41A 1H6CA 3PQDA 4NH4A 3TOXA 1DRWA 1JKIA 4JK3A 2DT5A 3D5QA 1P45A 4XEHA 2DVMA 1JDJA 2QYSA 3JQFA 3LSYA 5JSFA 5U9CA 1DJQA 3RJ5A 4YACA 3H7AA 1GR0A 4J3FA 2VWHA 2J3IA 4EW6A 2O50A 1ID1A 3QSGA 3GK3A 5HBRA 3W4JA 3K73O 4N54A 4WLFA 4JP3A 2FPPA 2X58A 3PJFA 1ZH8A 3D4NA 3JQAD 1O94A 3KSUA 3STHA 1Y81A 4Q3EA 2ZKLA 4CJXA 4MVJH 2ZYGA 2VYVD 4BQRA 5JAMA 1T26A 3WYCA 5A5EA 3JQEA 5T8KA 2RIRA 3AI1A 1I2CA 3RFTA 2Y1GA 5ITWA 3CXRA 5IJZA 4BVAA 3WICA 4Z9FA 2VHXA 3HDHA 4XIJA 4DLAA 5EESA 3GDFA 3FTPA 5I7SA 3F4BA 1Y5RA 3QA9A 1E3EA 4GWKA 2Z1MA 4CMCA 3QVSA 4AJ1A 1PU2A 1HDCA 1Q0LA 4PZCA 2NACA 3QVXA 3UUWA 1KVQA 5F3RA 2B35A 1QV7A 1VL6A 1Y7TA 4B3JA 5JC8A 3K31A 4EJMA 1ZXBA 4JJFA 1VPDA 2DBRA 4WCFB 1E3WA 1HETA 2JFHA 4GVXA 3O8QB 3ZZNA 3JD1A 1YL6A 2JHFA 3VDRA 5FEUA 4CMEC 1ISGA 3MJEA 4S3MA 1JAYA 4B4WA 3RUIA 2F1KA 3ROKA 4RVSA 4DRYA 2GCGA 4OOEA 1LRLA 1AXEA 4IDEA 3C3XA 4G81A 3C24A 3RC9A 1ZK0A 3TZHA 3VAZA 2VZ9A 3H5AA 1UZLA 5ENVA 2WSBA 2ZK7A 5EPOA 2GR9A 4QQRA 1N2SA 1BW9A 1ZFNA 2NU6A 4XRRA 4A7PA 3NJ8A 3ZCXA 3O4RA 1CIVA 1HDGO 3WX0A 3FI9A 5L7TA 4WECA 4MIYA 5JDCA 3JQ7A 3SEFA 2I9PA 3BMOA 1XQ1A 3ENNA 4CMGA 2GF2A 4CODB 1NQ5A 4F3YA 3GVHA 1XIVA 4BL5A 4IIVA 1LNQA 3TWOA 1PGOA 1DC6A 4HX5A 4YQZA 1P1KA 3L9XA 4INAA 3I9MA 1F0YA 2O3QA 3N74A 2O48X 3L6EA 2JFGA 2DUUA 2XXBA 3KXDA 1YONA 3ITDA 5I9NA 3RUHA 3WYBA 3IS3A 1HE4A 4WGGA 3DAGA 2FPGA 3LDHA 2OMEA 4RJTA 2UUOA 1YO6A 3I4CA 1UUFA 5ICSA 3G79A 3HADA 4J0EA 1PZHA 2B4QA 1EK6A 4XQCA 3QRWA 4UVEA 4WJZA 1NVGA 3WYEA 1PS8A 5T57A 4D3SA 1JQBA 4XQEA 3OJOA 2Y05A 3WQQA 3RC1A 1E3WB 1GZ6A 3H65A 4R41A 3UCFA 3P2OA 1UAYA 4OOFA 5T6BA 3HNPA 4D3FA 3WIEA 3FBGA 2AQKA 3RUFA 2Q1WA 5CHEA 4EUHA 5BR7A 2JD2A 1U4OA 4WNCA 1W6UA 1DAPA 3HG7A 3INGA 1DIGA 3SX2A 2NTNA 1PQUA 1E3IA 2FZWA 4E31A 1V8BA 2JD0A 2ZCVA 4OXNA 4GSKA 1SO8A 4AJIA 3H9GA 3LT0A 1HWYA 5AXAA 5TT1A 2BELA 2B5VA 2Y1CA 1DIHA 5CDGA 3PDUA 1UDBA 2GD1O 2XAAA 3TF5A 4FJ0A 3BMCB 2NLOA 8ADHA 1DHTA 1LDEA 4R1UA 4PCVA 3W4KA 4BNXA 4NBTA 3ZU3A 1YQDA 4MINA 5TS3A 3H9UA 5F5LA 4WPGA 4ND3A 5CFZA 5A9SA 1JKJA 2YHIA 4U0KA 1C14A 3WWYA 2DFDA 2O3TA 2YV2A 4RV9A 4AICA 4IXWA 2EW2A 1DIRA 3HFGA 1VL0A 3BMQA 4GKBA 3ZNNA 2GPTA 3IUSA 4XIYA 4DLBA 1XELA 5IDQA 4KZPA 4EZBA 4ALMA 1XDWA 2HJSA 2JAPA 3WGTA 2BGKA 3BMQB 5U4QA 4JBIA 4Q3NA 5T67A 4HKTA 4J90A 3DZJA 4MVJF 5JY1A 3GN2A 1C1XB 4BNLA 2R2GA 4J16A 1VSVA 2FHSA 2PWZA 1SCUA 4TRMA 4DL9A 5TNXA 3V1UA 2O3UA 4A2CA 3ICCA 4NBWA 1C1XA 5EJ2A 4YJFB 1PGQA 1C3VA 2P91A 4JJIA 4YB8A 1ML3A 3ZU5A 4E5PA 4PLGA 5DF1A 2ZTVA 2O4CA 4M87A 1LLQA 3I83A 1UXHA 3OHSX 4BIIA 3MZ0A 1AHIA 4BO7A 3ZWOA 1DFGA 4U0JA 3IDSA 1LEHA 4KDEA 4KWHA 3GT0A 1B15A 3E18A 3I9OA 1X7GA 5G4LA 3GVCA 3ZWAA 1Y8QA 2WJPA 3IQDB 4CM1A 3LLSA 1GADO 4WCDA 2VYVA 3LU1A 2Y1EA 3U4DA 3TNLA 3OM9A 2G17A 3BMNA 2VTEA 1X0VA 2X86A 4RPHA 3WFJA 5JLAA 4A0SA 5A9SB 1ZZEA 4WLUA 1F8FA 1EVZA 3TRIA 4EDFA 4RF5A 5L51A 4RZHA 3F5QA 6ADHA 4JROA 1B8PA 4BO0A 2D5AA 3ANNA 1F06A 3U4CA 4URFA 1NQOA 2RAFA 5JMWA 1E0DA 2I3AA 3B1FA 4YEDA 4D45A 1WWKA 3BXXA 2FSSA 4GAEA 1QYXA 3M2TA 3DWFA 1Z82A 2A35A 4ID9A 2Y93A 4ILKA 4MKXA 3OEYA 3ZWMA 4XCVA 1A5ZA 3SC6A 3WR5A 3HDQA 1P0FA 4MIOA 4DC1A 4XKJA 1IULA 2ZB8A 1BHSA 1H6AA 4RQTA 1NASA 3BAZA 4R9RA 3G3EA 2JCVA 4E5MA 2NWQA 4O6VA 4C7KA 4GGOA 2EW8A 4X54A 4J4TA 3RFXA 2NVBA 5A03A 3E48A 1WPQA 3C8MA 5AQ1A 2HMUA 3FPCA 4A73A 3ZDFA 3PXXA 5KJEA 1MV8A 4D3DA 2BF7A 3DBVO 4UVIA 5HTOA 2BH9A 3AUUA 2NTJA 3DAPA 3INRA 1FDVA 3TL2A 1TA4A 4XRGA 3D3EA 3FSRA 4CM8A 4HFMA 3JYOA 2X5KO 1EE2A 4LSMA 4PN3A 4RPLA 1A4UA 3ONEA 3KYCB 4Z3KA 2W8ZA 3A06A 3K30A 4B8WA 5BSFA 5F1OA 5TQVA 3VDQA 2J6IA 1H6BA 4PLYA 5T5QA 4OGWA 3PPIA 3CUKA 4W7IA 2C0CA 3KYDB 2IZ0A 2HU2A 4OSPA 4ZQEA 4GX2A 1O89A 4FN4A 5JXWA 4FD3A 1L7DA 1E3LA 5C5IA 3PYMA 4BMSA 2VZ8A 3AM3A 4E13A 4II3A 1JVBA 3JQBA 3A14A 4TZKA 1A72A 5IZ4A 4BNMA 5JDIA 1YDWA 4B4VA 3H8VA 1QLJA 4IXTA 4CLHA 2XF8A 4ALKA 1LDGA 1A7AA 1PWXA 1WDKA 2DBVO 3EDMA 4CMJA 4CUJA 2RHRA 4FFLA 4XQGA 1ZSYA 2Q45A 3ETGA 4E2WA 2VRBA 5CEFA 4LVUA 3CKYA 2G0TA 1KETA 1KYQA 2OO5A 3GQVA 2VCYA 3WGYA 4CM3A 2P4QA 2BGMA 1NHGA 3L4BC 4P22A 4DPLA 2R00A 1K0UA 2Y68A 1X1TA 3H9EO 4AJ2A 3PWSA 3ZW9A 1NWHA 3AOEC 4DVJA 4NK5A 4ROSA 4ZQGA 5TT0A 3DMYA 4IUYA 1UP7A 4IJUA 3S8MA 1VRWA 2EG9A 2GN6A 4I8XA 3ZWNA 1OAAA 2BMAA 2Q2WA 2YYYA 1PIWA 2VYNA 1SMKA 3QVOA 4LCEA 4AJOA 3LYLA 4GL4A 1QP8A 2DPGA 1ZBQA 4BNYA 3H4VA 1ARZA 3PIDA 1I24A 3WQRA 1JKFA 1B7GO 1M6HA 4MP3A 1XR3A 4ZQHA 2X9VA 3DOOA 2AXQA 4B3IA 5A5FA 4FJ2A 4B7CA 1R66A 3LT2A 4R68A 4NFSA 4YT8A 3WFIA 2E37A 1T2CA 2P9CA 3DHEA 1I2BA 4IQ0A 4PG6A 4FB5A 1KBZA 3DZHA 3FF4A 3V1TC 1QG6A 4TQGA 2GRAA 2Q2VA 4FBGA 4J1TA 1KERA 4O59O 1IZ0A 3MJSA 3HUDA 4R1NA 1A9YA 2BKAA 2NNLD 1Z75A 1MXFA 5EQFA 1WNTA 3GNSA 5DCYA 9LDBA 5JAZA 1OOEA 3MOIA 1PJLA 2TMDA 3GFBA 1HL3A 3E82A 1UP6A 2D59A 2JD1A 3CMMA 2AEFA 3ZWPA 1NQAO 1YL7A 4Z0HO 3VZQA 1J49A 3QE3A 4GWGA 4KTVE 4YYZA 4XJSA 1KEVA 3ZH2A 1ENPA 2O2SA 2VRCA 3H5RA 3OA2A 4BO3A 5B1YA 4IIUA 1A4IA 4HWKA 5ER6A 3GGPA 4E0BA 3LQFA 3ETEA 2C2XA 2J8ZA 3ABIA 5TSDA 1T24A 4MVJA 3GRPA 4IJKA 2DQ4A 1YH3A 3D7LA 4RLSA 2YHUA 3WIDA 1D7OA 1KS9A 4XYEA 1WXDA 3F1KA 4KUGA 1LUAA 1XLTA 4P4LA 1M67A 1WLYA 1P1RA 3BTUA 4TROA 2FR0A 1ZK1A 4OH1A 2P68A 5L7YA 2ZYDA 3GC6A 4H16A 4BHTA 4I9HA 1DBVO 3G17A 5CDYA 3AFMA 1N1EA 1GL3A 2OORA 4MOWA 1DLIA 5ER9A 3RAJA 2CMDA 2X22A 5U1PA 1B26A 4QTZA 5ITVA 5TC4A 5IZCA 3B70A 2EWMA 2V6GA 1P1IA 1EVYA 1G6KA 5BSGA 1CERA 3KRTA 3W8FA 1K2WA 5AVOA 1HYGA 1EDOA 5CP8A 1NM5A 1S7CA 1DSSG 4RF2A 3INTA 4WLVA 4EUEA 3E9MA 3LF1A 1QXSA 2Y1DA 1BXKA 4JQCA 1YQGA 2O7SA 3PHJA 3ZGYA 3NAQA 5EN4A 4CLEA 2DBZA 3K6JA 2UDPA 4CMHA 5L3ZA 1N92A 3F46A 4F6LA 1BDBA 2WM3A 4AJ4A 2ZYAA 2QW8A 4DQXA 4ITUA 5G0UA 3BA1A 2R6JA 3U09A 2GUGA 3KOUA 1LC0A 1XG5A 6LDHA 3H9QA 3V2UA 2D1YA 2IYOA 1PSDA 4ZHSA 4J7CA 3WGOA 4WKGA 1AN9A 1FK8A 1PJSA 4XQ9A 4J9VA 1SPXA 4XYBA 3V8BA 3CH6A 3GZNB 4AFNA 4CQMB 2J5RA 4PIVA 3L6OO 3DOJA 4OKIA 3CEAA 4IMRA 2DLDA 2IE0A 5DBGA 2VYND 3H6KA 1Z7BA 3KLPX 4Y98A 1HE2A 2EJVA 4UUOA 3M1AA 2VWPA 4M1QA 1SEPA 1RWBA 1ZKMA 3FNFA 4J9UE 3WGHA 3JD2A 3DXFA 5JYEA 2C5AA 4FFRA 1KVSA 2HK9A 2LDXA 2IDZA 4IQ8A 3WGQA 5CG1A 2A4KA 3GVXA 4Z6KA 1Q7CA 3BIOA 4DMLA 2TMGA 4IM7A 1HYHA 3GUCA 4PG8A 1Y8RA 1BRMA 1EDZA 1V6AA 1WZIA 1H0KA 4L4SA 3VH2A 4CMKA 4EI2A 3PQFA 2B0JA 3D1LA 5BNIA 3AI3A 3KB6A 3PJGA 1PTJA 4NPCA 1OBFO 1PR9A 1Q7BA 4FC6A 1PJBA 4LSWA 2EF1A 4L9RA 3RUCA 3VHRA 2CF6A 5JDCC 1OI7A 4W7HA 4TMFA 3H2SA 2C20A 4O63O 4DYVA 5L9AA 1S6YA 3OJFA 1A71A 3WS7A 1CWUA 1LSSA 1RJWA 4W4TA 4CMAA 5DBFA 2YY7A 1C0LA 3EW7A 3P5SA 3VC7A 2NVUA 3DC2A 2HKIA 2C54A 4U6QA 1V3VA 3V2GA 4NZ9A 4BKRA 1TT5A 2HRZA 2Y66A 4L75A 4FS3A 4M55A 1Z74A 5I9LA 4K26A 1X14A 4AL4A 1E7MA 3I9LA 5IAAA 5F5NA 3MWEB 2A94A 3NDJA 4XGIA 4XWYA 3O9ZA 2WE7A 2EV9A 3QVWA 2B37A 3DBHB 2JHGA 1Z73A 4XZ3A 4CLXA 2AE2A 1T1SA 2HAEA 4NQZA 4Y6PA 3ZWCA 4F45A 4J4HA 1ZMOA 4CV2A 4UEJA 4IS3A 3ICPA 3VZRA 3I9JA 1IL0A 3D3WA 5I9MA 1YRLA 1I8TA 1HDYA 2DBQA 2LDBA 1V35A 1VKNA 4CLRA 2V7PA 3OBBA 4JBGA 4OSOA 4AG3A 3GA0A 3SXPA 3GUYA 4MVJG 5H82A 2G1UA 1HF3A 2WD8A 4W6ZA 4CM9A 2UYYA 3ZN2A 5JDIC 2HMSA 4QECA 3T7CA 1PZGA 4DTIA 5L40A 1U2DA 1DC3A 3NRCA 3GNQA 5KJCA 1ZK4A 4Y9DA 1ZCJA 2OOSA 9LDTA 4F6CA 4NMHA 4RVFA 3UICA 5BSHA 4XGNA 1DIBA 4E2YA 3EY4A 4NJOA 5TRTA 4TWRA 4R4JA 2YFQA 5L4NA 1KVUA 4ZQBA 3E9NA 3LT4A 4WLEA 5KVVA 3EAGA 1O5IA 4DWVA 2PGDA 2YQ4A 3A9WA 3KYBA 1ADFA 4GPD1 4EITA 3K9QO 1WMBA 1PEDA 1LRJA 1TT7A 2YHIB 2BD0A 3TZ6A 1GUFA 1T4BA 1E1KA 3JQ9A 2W2KA 2AQ8A 2O3SA 2PNFA 4WOJA 3CPSA 3LC2O 4IQGA 3U3XA 1BSVA 1P31A 1P3DA 3GZ4A 3T4EA 1UXGA 3ASUA 4R1TA 1XGKA 3JQAB 2C82A 3HB5X 3K96A 3ZNOA 1I32A 3GVPA 3O38A 5KCZA 1DRUA 4MVJD 1F12A 4H7PA 4E4YA 4GGPA 4LRSB 1FJHA 2IXBA 3IUPA 3GGGA 4H15A 3HB4X 4PVCA 1E6UA 1H2HA 1DLJA 4RVGA 5KWEA 1EFLA 4WLNA 4NHEA 4FOOA 3DQPA 1T2DA 3AM4A 1E1MA 4KTTE 4BGUA 3Q0EA 3OP4A 3W8DA 5KKAA 3UAGA 1G0OA 1HSOA 1HDXA 1DJNA 2AEMA 3W1VA 1D1TA 3ETDA 1M2WA 1U3VA 1YXMA 3NT4A 4U6SA 1PS9A 1ZK3A 2VRCD 5AXCA 1GUZA 3B20A 2ZTUA 3D3WB 2EP7A 3WJAA 3MJ4A 4HXYA 3PFFA 3KV3O 4ZGWA 4CM7A 2WTBA 3FRJA 1I01A 1HXHA 3TDKA 3TQHA 5KIAA 2CFCA 3RBVA 1P0CA 2IZZA 2CY0A 4CV3A 1BXGB 2W4QA 3SJUA 4DA9A 3ENKA 3S2GA 1QLHA 3PLNA 3NGLA 5CG2A 3JV7A 3BTVA 1PS0A 3ANLA 1H94A 4BO4A 1E6WA 1LDMA 4A27A 4RGBA 3QWAA 4GX1A 5LDHA 4DIBA 5G0VA 4DIFA 3HSKA 4FFPA 1EEHA 4B8ZA 4C7JA 3IMFA 4NNJA 1KOLA 1RKXA 3JQ8B 1W73A 4K28A 4CR7A 1CRWG 1N9GA 2O3JA 2I99A 1R0SA 1W0CA 2DTEA 4DC0A 3SLKA 5IDYA 3Q6IA 1AUPA 3DDNA 3WLEA 1X0XA 2ZCUA 4O0LA 1GYPA 3ZNPA 3PEFA 1YOVA 2RH4A 3U49A 2OP0A 3RFVA 1R4MB 4Z9XA 4JJGA 2AW5A 3UGKA 3R6DA 4ZA2A 1YWGO 4J1NA 3ZHBA 3DOCA 3L0DA 4XB2A 4PGFA 2FP4A 2VHWA 1K5HA 1NR7A 2EKQA 2JL1A 2X0NA 5I8ZA 3DHYA 2HMWA 1GYRA 3AM5A 1EUZA 1X7DA 5EL0A 1E6EA 4U8GA 3JQ7B 1BXGA 3DAFA 4J43A 4OYRA 4NG5A 3KM0A 3B1KA 3HDYA 4IY1A 2ZB3A 1BTOA 4J4BA 2FZEA 2FPIA 5KTKA 5IZCC 4AJLA 3EVTA 1XU9A 3WG9A 4YJHA 1Z6ZA 3NT5A 1VSUA 1HLDA 1B2LA 4EBFA 2SCUA 2DM6A 2PA3A 2RH8A 3QJ5A 3BTOA 1BDMA 4O1MA 4I5DA 5GY7A 4DLLA 5CEEA 3PHIA 4KUHA 2B4RO 3LT1A 1ISFA 3PJEA 1O6ZA 2VWGA 4PRLA 4RVDA 4BNKA 1GPDG 5TF4A 1GFSA 4JCOA 4RVUA 4R1SA 3U9LA 1PQPA 2QHXA 2IXAA 1YBVA 2ILTA 4KMSA 4OAQA 5A02A 3N58A 2X5JO 4BMVA 1IHYA 4IZHA 3BHMA 5BNFA 3CE6A 2VT3A 3FWZA 4BNIA 2FOIA 3D5TA 1Y5MA 1U5AA 4UEKA 2W90A 2H63A 1GQQA 3DTYA 4PG5A 4BB5A 5K6AA 2NSDA 2Q46A 2O7QA 4ND5A 4R3NA 3VTFA 1FDTA 3M6IA 4HNHA 5L53A 1BVRA 2J5KA 5FWNA 3UN1A 2I67A 4ZU3A 5BT9A 2PZMA 4E21A 5JS6A 4HNGA 1YJ8A 1Y6JA 4NJMA 2C29D 3IP3A 4RDHA 1SOVA 3PRJA 1SAYA 4PLFA 1YB4A 3IC5A 3H2ZA 1N9GB 1J6UA 3NKLA 5I7EA 5T8KC 1K6XA 4ZICA 3NT2A 3CMCO 4BQPA 5IN5A 2VOJA 4HFRA 1C1DA 4J91A 2GN8A 1GUYA 4R01A 2FRDA 3ANMA 4ALLA 3PI7A 1JWBB 4AJKA 1CJCA 5IG2A 1I36A 3AOEA 3ZV6A 4XD2A 3QLJA 2B36A 3KETA 3SBOA 3ZU2A 4BUCA 3S55A 1I3KA 2NM0A 4HY3A 3NEPX 4NBRA 4MVJI 1HEUA 3GRKA 4R5HA 3UF0A 1I2ZA 2JCYA 2E48A 3S2IA 4U5QA 4R51A 3GEMA 5DP2A 4BO2A 4CPDA 2YDYA 3OJEA 1VJTA 3OEWA 4OHUA 4W99A 3GFGA 1I0ZA 2P9EA 3FTNA 1YBAA 2Z1NA 2IEBA 3V1YA 3JCZA 3VPSA 1A27A 1PL7A 3IIEA 3PHGA 4N7RA 5THQA 3RKUA 3DB2A 2VHVA 3KVOA 1W4ZA 3F6YA 3K2EA 3OIGA 1DFHA 1GPJA 3KZVA 2OZPA 3E6AA 2QRJA 3C1AA 4YAJA 1CQIA 2H1SA 2BFMA 4H3VA 3D64A 4OIMA 4PVDA 4IBOA 1P1FA 1E7YA 4EYEA 1VE9A 1PQWA 4ZN6A 1NFFA 3QW2A 2PY6A 3W6ZA 1PJQA 3JQGB 4IJWA 4N5NA 4RPGA 3E1KA 3AK4A 1GY8A 2H5LA 3GHYA 1C0PA 2BI8A 4I5FA 2YV3A 1O95A 1KC3A 1ULUA 5JW6A 1ZEJA 2BHLA 4JNKA 2QIOA 3ROMA 4D7AA 3I6IA 2BGLA 3FD8A 4GLOA 4D79A 4CLOB 2CNBA 1PR3A 1TT5B 4L4XA 3SC4A 1HYEA 1K6IA 1ZXLA 1ZEMA 3F47A 1MC4A 1NFQA 3AY7A 3GAZA 1SEVA 2PZLA 3ORFA 3PYLA 3HQ4O 2YQ5A 5L7WA 3NV9A 3ASVA 3ON5A 1NHWA 3ROPA 1EMDA 3EK2A 3DMTA 1ADCA 5HA5A 1ZMTA 1LLDA 4IDBA 5C3MA 3CZRA 2QZ9A 3A1NA 4YCAA 1DC5A 4OKNA 5JC1A 3R3SA 1H93A 2GSDA 1PJ3A 1KEUA 1TXGA 5FF9A 3MEQA 4L4RA 1EFKA
chains in the Genus database with same CATH superfamily
3USCS 3TSOA 4ECAA 1U3UA 3AR2A 4TMYA 4HF7A 5HG0A 1ZRMA 3CRRA 3SWWA 4C6RA 1D2NA 1AGPA 4TXLA 1QVZA 3STWA 3DMFA 4X90A 4LV8B 3MFYA 4EG7A 2WPNA 1ECGA 1MP0A 3E7DA 4RWZA 5JOQA 2P9BA 3B5JA 4JUAA 1JW9B 4AP9A 4NYJR 1G8MA 2R4UA 3BDAA 3I6QA 5TQ2A 1MEOA 1VJGA 3BJEA 4KMOA 1ECCA 4A3SA 4EABA 3TMKA 1OREA 2XH8A 1I0IA 3D0KA 4LQDA 2QVBA 3DTNA 3PPYA 2I2FA 4G09A 4YO8A 5TIIA 1QP0A 1C7ZA 2GWHA 2NW6A 2OHXA 3NKFA 2I66A 4EO4A 3K9NA 2A5LA 2X9NA 1HE3A 2ZTSA 2Z6UA 4H31A 2D8AA 2PZEA 3KC2A 2W2XA 3N28A 4L5BA 4D57A 1CUGA 1T9GS 2DH6A 2G25A 4IGIA 2QLJA 4WZAB 3UHJA 3V3TA 1HE5A 4Z7OB 4NXNB 3I2YX 2X5NA 1NX9A 1CJVC 5CCDA 4CQMA 4EEXA 3W34A 3GHHA 5A4AA 1SU8A 2YV4A 2IPAB 3UT0A 2IQIA 1FX0B 1T36B 4HK4A 5FEMA 3OQ1A 2FQWA 1EK2A 4PGMA 2Z9BA 4Q4HB 1EFHA 2I3BA 4U3JA 2EHDA 4M7OA 1V96A 2F17A 2J87A 1A0OA 3IIMA 3OEHA 2OGTA 4MR8A 1EP9A 3IA2A 1K63A 4QQNA 4QRHA 2LUOA 3L7LA 1L1RA 1ZNWA 3ZCSA 1E2BA 3H5NA 4URZR 1SXHA 4ND2A 2FRVA 2I6TA 4BVLA 3TZKA 2HC9A 3FSEA 1JZSA 2AI2A 3SLGA 3DE0X 4WACA 1PJAA 4ZU6X 4EY7A 2FDXA 4LCJA 4C07A 1OWLA 1TMGE 4EFLA 1X15A 4DDTA 5EMLA 5MDHA 2GAAA 3TW4A 1WG8A 1AGXA 4RVOA 1RBYA 2VK2A 1MN6A 3HKEB 3PK0A 4UBNA 3ZZ0A 5BSVA 5CB8A 1Z6TA 3O4IA 5CNKA 1ZG3A 3OG9A 2JLUA 4GKVA 4D0SA 1A4RA 1S2LA 1W85A 1YJXA 1TAQA 2AC2A 4DBZA 3QWFA 5IF3A 4RTMA 1H9BA 3KV1A 4HADA 2BONA 1NAIA 2QI9F 3DHNA 3PC3A 3PUXA 3IL2A 3EFBA 4YO7A 3Q7EA 4COOA 3SKVA 3D8UA 2OENG 3AJEA 5E6RA 3VTZA 3G6WA 2RHGB 3M89A 1P1CA 4FLFA 4ND8A 3PXDA 4UAGA 5HW0A 5IWAB 1NUSA 5TLSA 2IOFA 4FPXA 3TTVA 2RHLA 5CMLA 2V8OA 4B1FA 3M4XA 5JJ5A 2GXAA 2OFWA 4TKVA 2GM9A 2BEVA 2DFKB 4PSAA 1J56A 4HBGA 4Q7EA 1AKMA 5G0TA 3W2IA 3OURA 4IGAA 3CCBA 4MVJM 1G9TA 1KH2A 1NUTA 5DXFA 4IDCA 2OQVA 2XDQA 2FFBA 4CQLA 2P6MA 2ALJA 2X0EA 1I2MA 2HRDA 1Q3HA 1NOJA 2KWIA 3KDSE 4AMZA 4BJHB 2ZYWX 3GJ5A 1NPYA 3NTVA 1M0WA 3QBVA 4Q3BA 2HUNA 5JCJA 1FMCA 5LDGA 5BXQC 2QM0A 5JS7A 2QM8A 3S8YA 3OD5A 3HCFA 3BMOB 3L5OA 5ULLA 2AKAB 4BECA 1GZSA 3L1VA 3CW9A 4PBSA 4YJFA 1Q1QA 3AI2A 1Z4LA 4D96A 2W6MA 2WJZB 1A5SB 2FSVC 1GGFA 1FTYA 1NKSA 3G9UA 3HDJA 1F6DA 3KJNA 1TB4A 1BWSA 2YZ2A 1DEHA 5JSYA 4UMVA 4KXQA 4C4OA 5LBUA 4ALIA 2Z8XA 3DNFA 2NU8A 3PLAE 3KKQA 4TRJA 3NH6A 2VPZA 4CN8A 3ECCA 3ONWA 1GAWA 2QL6A 5KOJA 4AKHA 1HC7A 4WY8A 1H2YA 4WKNA 2GVZC 4G4IA 1KMNA 4F4IA 4LECA 3ZV5A 4QDZA 5DT2A 2VRNA 1ZUNA 4OPMA 3K92A 1KE1A 1E1RD 5TV2A 1ADGA 5H9WA 3H2JA 4RDCA 4NCXA 3PEYA 1P4AA 1FU4A 1YC5A 2E49A 1K66A 2ETVA 2XCOA 3CNHA 2Q5EA 2AXNA 4YPFA 2QMZA 4ACAA 1O9HA 1OZ0A 1FLDA 1R10A 3BDIA 4IRUB 4XM1A 1NVXQ 2J46A 1E3SA 1RP7A 2HHCA 1YQEA 3A1CA 4FBLA 4BFLA 2FK7A 1MR3F 2JFNA 4IHJF 4Q4DA 2IYEA 1KAHA 3LZ6A 1QTNA 3A6LA 1R5NA 2NVWA 3S2UA 1T1GA 3JQCA 5JWHA 2QBYB 4J7UA 4JX9A 2PPVA 2PL9A 2DWPA 2C61A 2IK8A 3IBYA 4NONA 1JPNA 3GLQA 1THZA 5KKCA 1VCIA 2EQAA 4LHVA 2C5HA 3K0HA 3TEFA 4BAGA 7ABPA 1AU9A 1DRKA 5D01A 5HP4A 2CNKA 4F5EA 1NLFA 2YRFA 4PAMA 4R84A 3CF4G 3T15A 2ZRHA 3GDOA 2QN9A 3HN2A 4RJLA 1KQFA 2HLHA 4AROA 1MENA 4BAZA 1YF3A 2UAGA 5LQKA 3DR3A 4DPMA 1PR1A 2F1HA 1NM5C 1DXYA 4I3GA 3GFTA 4AUMA 4A0HA 2VAVA 4QJIA 1BC5A 5A06A 1E1LA 3KO8A 5B30A 2LR0A 2OHFA 4E5NA 1M74A 2AVDA 2F6RA 3P27A 4GNKA 4QPZA 5J43A 2GLTA 3EZGA 2X8JA 4BWFB 4BCDA 1FX1A 821PA 3HBFA 3RSGA 3N07A 3CRW1 4FFDA 5DHRA 5ENDA 2OYCA 3TIGA 4K2HA 1SCBA 2W6ID 2CUNA 2NZVG 4PZDA 1FFXB 2GNAA 4R69A 1NR1A 3L82B 4RPJA 4XAQA 3OLXA 1NMQA 4UTPA 5EZ5A 1XJWA 4NYMR 3LP5A 4N5DA 2HFJA 2E6UX 4G2NA 3DT8A 3DKVA 4NZZA 4JJEA 5FPTA 4UVDA 1DKLA 2HO5A 2CEKA 2V97A 2VCHA 3CNBA 5CB0A 5J4VA 2QZJA 2WZBA 1NF3A 1P61B 3BB3A 2I8CA 4TRRA 4WXRA 2GK3A 2JFVA 2WABA 3KR9A 3WK5A 1QG4A 1T6ZA 3IEMA 1Z4JA 1AKWA 2AZTA 4MO2A 4MWSA 3VI4B 4I6JA 4R40A 3WLTA 2QZPA 4R7GA 1G21E 1PV4A 3BE8A 1VG9B 5J5CA 1X86B 3UMJA 5DWDA 5B7GA 3M0EA 3VZBA 2YYZA 1T8YA 4YMUA 5I9IA 5F9HA 4H7HA 4Z4EA 1B42A 2F3UA 2P6NA 5J2TB 2EBFX 3C3MA 3E3NA 3I1YA 5ELLA 2YZ7A 1ZHOA 5IHPA 4MI1A 3Q98A 1W2HA 2ZTHA 1W5EA 4RHUA 5E1OA 5LP6B 4NOLA 1E5VA 2X9GA 1D8AA 4IIEA 3JWEA 3ORQA 4YQYA 3B6ZA 3TIIA 3O3MB 2OAGA 4KRYA 3ZZMA 3IQIX 2OE2A 3ESBA 4BO5A 2LTAA 1U0EA 1J00A 2AE1A 4JU8A 5A4MS 4PLVA 5JSUA 3STUA 4BO6A 1SUBA 3U4QA 5KYWB 4FZVA 4ZJUA 3ZHSA 1ZA1A 1ODSA 2YWHA 1W2WB 2ONYA 4J0FA 3SQOA 2SKEA 2UYQA 5BMOA 2QG6A 4NAHA 1GTMA 3PRHA 4NE7A 4QAQA 4BB6A 2VCEA 4GQIA 3ZU6A 4GH5A 3RAFC 1QH1A 5L95A 1OIWA 3W4IA 3I5AA 3EC1A 4CUZA 2G82A 2X41A 4YMLA 1QRRA 2JB9A 3OZGA 4QTUB 3QBJA 2G06A 4OUDB 3QWIA 5ELMA 3UMCA 5M29A 3KFVA 1US8A 3IIKA 3LGAA 4DSZA 4CDMA 3VR6H 1H69A 2PX0A 3RROA 3UBMA 3QBDA 2BCJQ 2G36A 4R9SA 5EXXA 1J7JA 2DPHA 3COJA 1GFIA 5DOVA 1TKAA 5E6SB 4UXHA 3S99A 1UH5A 3GJQA 3SKYA 1EVIA 2NXWA 3T1VA 3UT5B 4LNHA 4B6FA 1X9GA 1LZKA 1ONNA 1XROA 2OHJA 1A2QA 5F33A 1TKCA 1Z4MA 1I33A 3IEXA 4IZ6A 3KQUA 4HQFA 4I1IA 3WSWA 2FMIA 3A26A 3LVQE 3ROFA 4DXAA 3CF0A 4TV8A 4G0VA 1RRFA 3NAZA 3QPVA 1PFGA 2E18A 2WKQA 2RK4A 2ZPTX 4QHSA 4XA8A 5COQA 3UW3A 5C46F 3C41J 3UJPA 4ENSA 3O1HB 5A2QA 3LF2A 4MGKR 4ZOBA 1SG9A 3EIUA 1EZ4A 5ITZA 1CU1A 1OUMA 1AXGA 3L0SA 3C97A 1I3NA 2JLZA 1HNWB 4G0XA 1XRLA 3KS9A 5CEJA 3KZXA 2VH2A 4AUKA 2WF9A 3KBOA 3L0CA 1K7YA 1GTRA 1G20B 4CG0A 1QC5A 1VFPA 2QMUA 3C6BA 4J0IA 4ASUD 4D9GA 3ELUA 4GPIB 5C8YB 2JJ2A 2IOYA 3MWKA 3ONFA 3T4UA 3U3KA 4E03A 1I7PA 3VNQA 1ISRA 4DPKA 4V0MA 2R87A 3UK1A 3O8OA 4DRXA 2ZULA 4UDXX 5C1PA 2O5EA 4UD2A 1M1UA 1SVSA 2OV2A 2ZUBA 1JDSA 3TOVA 3DWGA 3OMLA 4W1QA 2A30A 1UM9B 1AIPA 3FHCB 4ZGBA 4C30A 3OKPA 4ZOLB 1GGHA 1DKUA 2HQOA 2CFIA 4YT2A 4J7XA 3ED1A 5KOIA 4RMHA 3NHJA 1M34B 4K9RA 3GLUA 4N7BA 4Y2QA 4BEWA 3MUFA 4URHA 2INGX 4US2R 2JA2A 3V00A 2D8MA 3BF7A 3ISTA 2BKXA 3N0WA 4KK4A 3FLMA 4F3CA 5CT9A 3U7FB 4N0MA 1H22A 3OCWA 2GJ4A 4MRPA 4LK3A 5MGBA 1IBCA 2W11A 3EJWA 1ONOA 1ZN9A 4Y1GA 2NSHA 3X2EA 4OBWA 5CFPA 4P0PB 4NFYA 2RB4A 1FP4A 2DYKA 1NXOA 3HFRA 3Q12A 2L82A 2B2NA 4EFDA 4DSAA 1XCOA 4OMDA 2O23A 3AEXA 5DGCA 5ALTA 2GOYA 1OPRA 3JQ6A 4NNPA 4O4IA 4BU1A 2P5SA 2HT1A 1U2GA 1DBQA 3LW8A 4FGWA 4OFXA 5B6PA 3BL5A 5LSAA 1U2PA 1T8RA 1NVVR 5K8TA 2PZJA 3VJLA 1D8TA 3ZE2B 3DEZA 3BEOA 3ZLJA 3RU7A 3KL2A 4R81A 2FPKA 1Q19A 4L4ZA 4LOAA 2JAXA 5EHQA 5C0OE 4AY6A 5JYDA 3QPWA 4C4TA 1CBUA 2W2LD 3ZQJA 1V5WA 3OPVA 1QF7A 3NTOA 3PU6A 5CJ2A 1JG7A 4JY7A 4JUFA 1MT3A 1Q74A 3OP1A 3KOXA 2HJWA 5GONB 3RU9A 3GEGA 1RLUA 1VQ1A 1ZUD1 1C9MA 1ZS9A 4QDOA 1H05A 3GU3A 1NZJA 1Z2NX 2IITA 1JLHA 2FNAA 2H85A 2CVPA 2XV1A 3DP9A 1JYEA 1Z22A 3FZQA 4JDPA 4MW0A 4P8RA 5FTJA 5K3FA 7AT1A 1RQRA 5HKKD 3GRAA 2XUHA 1DXOA 4V2UA 2ICAA 4CLOA 4YGXB 3BWXA 2XOEA 4P4NA 3DUWA 3FI0A 1KO8A 4L3OA 4CUKA 1NNUA 3IT3A 4XGRA 1GTG1 3IX7A 1V6SA 3EZ9A 1EWQA 3FOAA 3LZDA 4NSNA 4UREA 4XH9B 3THWB 2P4HX 4LNUA 1X1SA 2W2LA 5F5XA 5M04A 2AN3A 1EH5A 4MUKA 5A1TA 2VS1A 3QI2A 5SZIA 2B3DA 2NX2A 2B98A 2E2WA 2ZIVB 3VUFA 1E92A 1KSHA 2DU8A 4U7TB 1WAMA 1UP4A 1TCUA 2H00A 4P08A 4MQ5A 5C5EA 4IIJA 3HWRA 3QYAA 4G63A 4PW0A 3DCYA 3OZUA 4CDNA 5DBEX 4DIUA 3BWDD 1GPH1 2V7WA 2ZI9A 1Q7GA 4E32A 5CA0F 3PHLA 1MH1A 1UT5A 4FKMA 4U7HA 5LD2B 2OC9A 4TV9B 4JKYA 3C98A 4S2UA 5ALPA 4NECA 3NAGA 1LU9A 1XB2A 1KFBB 4JASB 1MCZA 1MZVA 1OV4A 1ULTA 2BHSA 2PGJA 1UBTS 2YJ4A 5KTMA 3LQRA 2H2GA 2DFVA 3R7DA 3WLQA 3L6DA 2MINB 1R4NA 1XOIA 2GBLA 2OCKA 1K7EB 1GVNB 3GAMA 3R24A 1FUIA 2N9UA 3AR5A 1EK1A 4BKOA 3FPLA 3O4FA 2O6LA 4B6PA 3DHVA 4KIFA 3PL5A 4EPTA 3ADPA 2CL0X 3CUSA 4IIFA 1A2BA 3F5FA 5IKMA 1BU8A 3P8ZA 5K7SA 4GKKB 1EFTA 2BEUA 6CHYA 4I5GA 2F7SA 1JR3A 3CKKA 1VKZA 3FPGA 3OLVA 3T1OA 1DMSA 1L4GA 3U9TA 3NIGB 3DBLA 1I2AA 3UO8B 3QV2A 3NRJA 1C0KA 1RM3A 5JZMA 2O7NA 4K6KA 3A3OA 1Z5GA 2RGRA 1TTQB 3FA2A 3HYLA 5DHTA 4W5QA 3OFSA 2FQQA 2PJZA 2E1RA 3P19A 5DCUA 1KAQA 1E5LA 3NTQA 1MQAA 5CGQB 2E6KA 3JTMA 3IUJA 3TZLA 3ZHRA 4L08A 3PC8A 4GXQA 2BP7A 1I6LA 1WCIA 2R5WA 3TSYA 4UBJA 2R25B 4KDCA 4EKYA 4OLAA 3PEVA 3OETA 1G2OA 2HWUA 3QP9A 4G0PA 3R5JA 4RK7A 5E0OA 4NX2A 1O0BA 1EUYA 5TEVA 3H17A 2MSNA 1W59A 3L1JA 2RC5A 3ZHZA 4LF8B 2C7VA 2BT4A 2Q6VA 1N5DA 2APJA 3IOMA 2PXXA 3ILSA 5E1BA 4EJ0A 4HWSA 2VRWA 1TCCA 1UDCA 3KR0A 4WUVA 3ER9A 2YASA 3C3KA 2FKAA 5FKJA 5M5BA 1UIRA 1WU8A 2L42A 3EYAA 1TK9A 4EB6A 1QORA 2BF4A 3O8RA 2RFLA 3BQNB 1T3HA 3U62A 5KVQA 3P7MA 4XR4A 4Q9KA 2IY8A 3RKRA 2WAYA 3ZHQA 2NV6A 4QQ8A 1V8FA 4N82A 1XVVA 4LDNA 4N3GA 3OCVA 4Q1BA 2OV1A 3GLSA 1QHIA 5GQSA 4PZEA 3NGXA 4LQLA 1TFRA 1ICIA 3SXJA 4FMPA 2W2MA 3PPVA 5JH7B 4CM3A 5DMXA 4P3PA 4YMWA 2HWXA 4D43A 2DKNA 2QLFA 2HK7A 5HXAA 5JNSA 3QVLA 4P98A 5ECGC 1ZC4A 1TRKA 3A1FA 4FW8A 5IJAA 4OVKA 1L0BA 1P6UA 3ESQA 4DLZA 2V7UA 2P1RA 3KOZA 1OX5A 4CM4B 4F5ZA 1DIAA 1ZC3A 1MA0A 4RMIA 5DGIA 1Z13A 2WIJA 3MOGA 1T4CA 4S1WA 1IZ9A 4M4SA 4LYYA 3REQA 4EW1A 4QUJA 2A6PA 1U9JA 2A14A 2NXNA 2VJOA 2ZYRA 2AOTB 3E5HA 4HEA6 4UDNA 5EERA 5F77A 3ZK9A 4BAUA 1TVEA 3SS7X 1XAJA 3QY9A 2Z08A 1WXGA 4G5RA 5DI9A 5EFZA 2QV0A 2OGUA 4G0QA 3DFUA 1AMOA 5AKKA 4YV0A 4UPDA 5FOVA 2WWGA 1OFHA 3DPIA 3DNMA 5B7PA 3ZD6A 4FWIB 5DN9A 3F6SA 2V9ZA 4B4UA 1XALA 3KHUA 3FDZA 1FLNA 3E22B 3H5OA 4MGIR 4TT3D 4IEEA 4LX0A 2CDBA 5ALRA 3U44A 4IMPA 1RM4A 1GCUA 1FVHA 2FTKE 1WIWA 3G5MA 1WW8A 2CJPA 1EFCA 2FWMX 3IA7A 5T4EA 3ETLA 3MJFA 1RM0A 2X4DA 1SQSA 5AI9A 1J9GA 1XZGA 2YY6A 1AGYA 3UAVA 1G8FA 1K3TA 3W5VA 3ERCA 3GPIA 1ZUHA 2C2ZA 1AD2A 1SQGA 3HEMA 3FYUA 3JARB 5BNTA 5K45A 4KFRA 4WZBA 2GRUA 3RVPA 3SYLA 4DLVA 5P21A 1GQRA 1RXSA 1DEXA 1PLLA 3BZUA 3RS7A 1KI8A 4N0PA 1V3TA 3IHLA 3IP1A 4C6TB 3C7AA 4UAVA 1Q5PA 1ICEA 1H1TA 3O74A 4AQDA 4CQMD 1C29B 1JR6A 2O0KA 3EVNA 4G9BA 2HWYA 2G72A 3PHBE 4L8WB 3JATA 2XR1A 3GEEA 4WW0A 3GDGA 2VBIA 3NC4A 4NABA 3DDWA 4K46A 5FFFA 3UJ9A 4MVWA 5JFTA 2BIFA 1S7GA 3B2EA 1RLIA 1GTL1 1KS2A 1P1HA 2FY8A 4WLOA 4DLXA 3O5AA 5C7IO 5IKXA 1TUBA 4PRKA 5IVKA 4JT4A 3OECA 2ECKA 1AZWA 5HQTA 4YMSA 5KOHA 1AY0A 2BC9A 1D0VA 4C3VA 1KFJB 1Z26A 3KR1A 1YGPA 1XZFA 3A3NA 1MG5A 1YB1A 3WKEA 1L5MA 1D1QA 1E5XA 3FR7A 3HE3A 2EGGA 4IF4A 3T95A 3W8RA 4TL7A 1J8QA 1G8AA 3T1QA 2ZBVA 1Q3TA 4KAJA 3IESA 4IVRA 3DZBA 4UVHA 1ULSA 2QI9C 5FLXA 4W8OA 1YZLA 1V0JA 4DNPA 4RY2A 4GMDA 5CDHA 3K7EA 3EXFB 4PR0A 3BSYA 4M0KA 3L8HA 1P3JA 5LA6F 2UZ0A 3RV3A 3D3JA 4JEMA 1QNLA 1CR0A 2A1TR 2DTDA 1P7ZA 1ULAA 2OILA 3CBQA 2CLDX 4KLCA 3KOYA 3CCFA 1CZHA 2H7YA 5E9AA 3VHXA 1U3DA 2C9DA 2Y4NA 5EQJB 4ES6A 1NQTA 1VMKA 4PSCA 4YK7A 4K1XA 4RHXA 4NR0A 2R3SA 1ELOA 3FBWA 4Y6SA 3RW9A 3P9QA 4C78A 2YHAA 1FB5A 3LHDA 4QFMA 4ZHQF 3WSTA 2XTMA 3QK7A 1VPTA 4HAXA 2PH7A 4ZOLA 3WE7A 3GIDA 2ZSHA 4CKYA 2XTZA 2VJMB 3VDXA 3QHQA 4JXKA 5T64A 2WDZA 1YT5A 1PV2A 4HWPA 1CR4A 1B0ZA 1M5TA 1YZHA 5GVRA 3WLAA 1K1EA 3HO8A 3X1JA 2AUNA 2C59A 5A4JA 1FEZA 2EAUA 5G1NA 3TRDA 2PBLA 3C3AA 3Q7RA 1O4WA 5K0TA 3T3OA 4FHDA 5HCNA 2ZUDA 4WK6A 4BFUA 2R1UA 1XZCA 2YJZA 5C3UA 3DTVA 3I39X 3MQ4A 3RODA 5AR1A 3I30X 1REQB 2QLLA 3FETA 2REOA 2GBCA 4DUGD 4YAOA 3ZI0A 4OP3A 4IGFA 1LKZA 1TUIA 2W8BA 1ZJWA 4H2DA 4DXHA 3TZEA 1P74A 2CHVA 5G0WA 1M75A 4JLBA 2PGLA 3FNRA 3SE7A 1BKYA 2HIAA 2OWEA 4A10A 4AKGA 3P9KA 1XTKA 1I7NA 2P65A 3CPJB 3EUWA 4YJ2B 5EIBC 1EDEA 2XQKA 2YDXA 4ISBA 1CJSA 3RUPA 4CL8A 1LPAB 3RK4A 4C5CA 2FN3A 2REBA 1SULA 3ZWWA 2W6NA 3MVEA 1X7YA 4EF6A 3HNOA 3VC1A 1DEAA 2WZQA 1WO8A 2Z5VA 4OU5A 2H7VA 4IMJB 1CQJA 2XEXA 2ZIEA 3ACCA 4PLZA 4BMPB 4CTOA 1XNRB 2QUZA 3TFQA 1PK7A 3H13A 3JALB 2D13A 4LY3A 4OEHA 4B7ZA 1KDPA 4PLTA 4RTLA 1C7JA 3ROZA 1EHIA 3OJXA 2PX4A 3VDNB 3HXQA 5HM6A 1YKSA 4RH1A 1J9EA 3BBPA 5KQGA 3NC0C 1Y48E 3FWKA 1QKIA 3OIDA 3HMKA 1DJLA 4D0GA 3VV2A 4B85A 3TSWA 3ER8A 4EJ2A 4RKRA 4Y2YA 1ZWLA 4RD6A 3FOFC 1NG1A 4MRMB 2FWBA 1FBNA 1KQ3A 2IRWA 3FAKA 3SU8A 3OZVA 1DO8A 4TWIA 3GBVA 4NDNE 1XU7A 5BSTA 3SSOA 4AVYA 3EVAA 1E9DA 2GESA 1RPAA 4HX9A 4KBFA 2VTDA 4QVKA 5ALSA 4A7PA 2QRKA 5KYWA 1ODKA 4MKRA 4LG1A 1JDTA 1JDZA 3NBFA 3NBUA 4YPOA 1H6DA 3KKOA 2QUAA 4LRXA 2BBOA 3BXZA 3K8ZA 1W75A 1FF9A 2CVQA 4QUBA 3GFSA 1X92A 2QNRA 4QX6A 1P8AA 3A31A 1GZ3A 1P91A 3Q1LA 4IVQA 4N0QA 4H6PA 5B3JA 2CJWA 3N0VA 3LPCA 1CE8B 3RJ9A 3NDIA 2BTEA 4L85A 4LXTA 3IODA 2BZGA 3CZQA 4Z3DA 4ACBA 5IHXA 3VXKA 4C0QC 2WLTA 1ZIPA 5K0ZA 3E3AA 2K2WA 3KQQA 4OHOA 4BVKA 4E15A 4MA4A 1KP2A 1CLEA 3C87A 1DBRA 3C74A 5K03A 2O54A 1ZKDA 4RORA 1LJ8A 4O4IB 2BKLA 4IR7A 4OHXA 5DMHA 4E7PA 3GFFA 2Q6TA 2CKMA 1SKYE 2HB6A 4P3OA 2E5WA 1CRLA 3T7AA 1YL5A 1Z62A 1VMIA 1W30A 3KJFA 1BX0A 3GUUA 4DIEA 4OQFA 1R37A 2O1SA 4G5GA 2Q3BA 3K6SA 3TPCA 1TK3A 1IBMB 3S3TA 2GJ9A 2H59A 4XW2A 2B3TA 1F38A 1ODJA 1WL8A 5DPMA 1IU9A 2CLLB 2HJ9A 2ILVA 2WE8A 2WP8J 2IYVA 3UMGA 1FJGB 4XXHA 3PVCA 5FOWA 3OQJA 5BOSB 2AEJA 2DR3A 4DGSA 3AF6A 2SECE 3I61A 2QQEA 1O95C 3PCTA 4GXTA 3MJTA 4OM7A 3B3QA 3RSOA 1LS1A 1WXEA 4D3ZA 4EGQA 4D6PA 3LP8A 2MSWA 3R77A 1NATA 4BX2A 3IAS1 4MKGA 2GRJA 2G4VA 2F1IA 2O5RA 4P7GA 2CCJA 2RCYA 5C37A 2GILA 1DX6A 4G5FA 4R05A 1YV9A 2R8YA 3OTOB 3EEFA 3T35A 2Q99A 3I5MA 5LP6C 4RK5A 2PLAA 4Y67A 2XUPA 3N3AC 4LW8A 5BV0A 4M1OA 4Q9JA 4DCCA 1T4CB 3K9WA 3BZWA 3WHIA 2HBZA 8OHMA 1JQEA 1VSQA 3N6VA 1CY2A 3NNDA 1EP1B 1IOLA 1E7SA 5F4BA 1SGWA 3NCTA 3QBTA 3UUFA 5IMSA 3QNUA 2WIAA 1ZR2A 1T35A 3L4EA 4AN4A 4JLVA 3WTBA 3TGLA 4YUWA 3G0HA 1JIQA 1OAKA 2I65A 1TVCA 4IV5A 1J7KA 4F2DA 3IBTA 2C4VA 1GQYA 3ABQB 2UZIR 1KI6A 2F64A 1W0JD 4JS0A 1T34A 4MQLA 3ICWA 4ZOCA 5J4YA 5EE9A 3GG2A 3DL2A 2EGHA 2GPBA 3HEAA 4GPZA 3PUWA 1UBOS 5FAXA 3DMGA 1ETHA 2UXBB 2C9CA 1QTIA 1V47A 3ZX4A 5ECWA 3C3WA 1TECE 4M0MA 1ENOA 4YRLA 2QTMA 1N8NA 1SCKA 1V43A 2HRBA 4LXUA 1RXUA 3BAFA 4XE5A 1MF7A 1SKYB 3PC4A 3JD3A 5JVDB 3ET5A 3KTDA 4ZVVA 2FPLA 4KFUA 5EP2A 3HBJA 2W37A 3CO0S 2RKBA 3GZNA 4QD3A 2ZQZA 5DO9A 3FTEA 1NDQA 3T0FA 1BAPA 3ROQA 2FWAA 1W0KD 3E35A 1MRZA 3GAAA 3JW8A 4KE6A 4PYJA 1O5OA 2AG5A 2FSHA 4XVCA 1ZRSA 2NPOA 3ENVA 1XMIA 4MVJE 5K3BA 3Q2KA 1BXZA 1N8KA 3LIIA 3PC8C 3WAGA 2C1XA 1KJYA 1F17A 2Y0BA 4LDJA 1R88A 2IT1A 4P4GA 4MA0A 1DCTA 3T54A 4EJFA 3QVUA 3K1JA 4OK6A 1Y3DE 4CDGA 4U6NA 3AFNA 2QTLA 4TTAA 1T0IA 1R0BA 2WD7B 3IOYA 4XJXA 4ZO6A 4ZD6A 2G7ZA 2DCMA 3OPNA 3T1NA 1WB9A 5IAAA 2IZ7A 2WFLA 2WHPA 4UCQA 5JXGA 1V95A 1PBTA 4QSMA 1Z12A 2B61A 2YMPA 1EAYA 1JE0A 2QY6A 1GG9A 1T2UA 1Q2XA 3OIFA 5B53A 1XNJA 1M2HA 2B7BA 3RQSA 1X6VA 3H5VA 4L9WA 1SBZA 3UJCA 1SPBS 2ZRKA 3ZE9A 4G1MB 3KXLA 3N05A 2V45A 3IPRA 5PGMA 4XQ0A 5K01A 4BEVA 1IJFA 5K8CA 3U16A 3AH8A 4PZLA 1V39A 2VEOA 3QXGA 5HS4A 4IICA 3V6LA 5HTKA 4U7GA 3OOJA 4C0KA 3HZHA 1XQ6A 5FI3A 2D1RA 1U94A 1QHGA 2GHTA 1RDFA 4H3HB 4X3OA 4MR7A 3HJAA 3E9DA 1G4HA 1JR4A 4ZO4A 1QIJA 5DNEA 2UUAB 1Q17A 4YQEA 3DBRB 1JXOA 2VP3A 4PLWA 1Q6YA 1NJSA 1CUWA 3ZBPA 4JC8A 2DLNA 4QULA 5CM9C 4G23A 5IXSA 5IU6A 3EGIA 3TZQA 1RBMA 3KD3A 2X1HA 3ASYA 1I7SB 1RWKA 3QLUA 4F6RB 4ESVA 3OQ6A 1T9AA 2M1XA 1RMQA 4MV0A 4D0RA 1P5ZB 2P69A 4RSGA 1ENZA 1U04A 2JI4A 3CVJA 3MA0A 4UKDA 4WUTA 4FLEA 4KQMA 1N2IA 4ND6A 3EGOA 1BCRA 4IO0A 1IBLB 5L3QA 5GPBA 1R0KA 2WJ6A 1V1JA 3ZKWB 2FUEA 4C29A 2JKZA 3EMKA 3NHBA 1ITZA 3U7RA 3F71A 2VHUA 1WDLA 3LWDA 3R5KA 1CQWA 5IT5A 1CETA 5AFSA 1UQRA 1PVOA 3I8XA 4PV7A 2WRZA 3OIUA 3O2SB 3AF0A 3S5JA 4KX3A 5BR4A 2F4NA 2QU8A 2ACKA 1X7WB 3ANXA 1C4WA 4MYSA 1V48A 1T9BA 4PYIA 4PX2A 4AZSA 4LWZA 3PBKA 1A69A 5HOQA 4N0DA 1CHNA 1KQPA 2PWYA 4LX8A 1Z16A 3O4HA 2FN7A 5AD1A 3HVUA 3HLTA 4LHSA 2KQUA 3QENA 4Q82A 2B9EA 2C4MA 4N41A 4DBLE 4NMMA 4CM6A 1Y1LA 2BLLA 4CL3A 2OAEA 2P3OA 1P4RA 1E2GA 1EUCA 1TE2A 2HGZA 3PQ5A 4Y2VA 2QKYA 3AHFA 3WISA 4E6EA 2IYFA 1F4VA 1ZN8A 5DGDA 5EQDA 1JV2B 4OTZA 4QGBA 3KKEA 5K0EA 1JT9A 2I62A 4G37A 3SYNA 5CX1A 3CVVA 3A11A 1VHJA 2O5VA 3O1LA 3QEKA 1EE1A 1TVKB 2IEDA 5AVYA 5ITSA 3N2NA 2RKWA 2YY5A 1VJ0A 1RHJA 3NZEA 1SBYA 1PQYA 1ZESA 3B85A 4XIGS 4QFCA 3UWOA 1IY0A 1ESDA 3MT7A 3SDBA 2H65A 1GNRA 3D4LA 4KIWA 1ONPA 1TCBA 1ORDA 1PX0A 1XHLA 3B6IA 4Y2SA 3BD9A 3JQGA 1XZKA 5EXSA 4YX9A 5IJ9A 4RFSB 4MIKA 1DRWA 1JKIA 1XVAA 4JK3A 4LSGA 3D5QA 1P45A 5CR9A 3EXEA 1SBCA 5B6JA 2VSFA 3IKLA 2DVMA 1UT6A 3IT0A 4EUNA 2OM2A 3LSYA 5FV7A 5HUQA 2RHOA 2ZYIA 3TAXA 1DJQA 5WRFA 2JH3A 1CC1S 2QOEA 4L5JA 4NV3A 4O33A 4RVCA 2XMRA 4CL0A 1AT1A 3W4JA 1ID1A 1KK2A 5HBRA 4H08A 3KQMA 2R1VB 3X1YA 3AFGA 4DLLA 2FQYA 2P7HA 4JP3A 3HB9A 2FPPA 5BN3B 1OBHA 5BORA 3D4NA 3JQAD 4UBIA 3STHA 3V8RA 5KOHB 2IYYA 4L5IA 2ZT7A 4D9NA 3R5XA 3LLCA 2ZKLA 1FTWA 4LQ4A 1KEZA 2EW1A 4MVJH 4X3PA 1GPLA 1T26A 3EVZA 3BK1A 1Q84A 4EENA 3AI1A 1BS1A 3O1IC 2Y1GA 3L7NA 3CXRA 1C41A 3BSWA 3I05A 4IH4A 2C5LA 2RAVA 4Z9FA 2YNMD 1W4RA 3GDFA 5CURA 1YI0A 1P4JA 1Y5RA 3QA9A 3ICVA 3CF6R 3CX8A 3B7PA 3T9FA 1IWBB 5BUCA 2QLBA 1OT5A 4XVRA 3FLBA 3LH5A 2HO4A 1KVQA 2PMWB 3DFMA 3SQLA 1SR8A 1ZIXA 5DRTA 5F3RA 1VL6A 2LV8A 3UWDA 1Y7TA 2PWAA 3MRTA 5JC8A 3K31A 4DLRA 1ZXBA 4JJFA 3B3JA 5CVCA 3MBKA 4X44A 3KB1A 5B3LA 5LVAA 3WK6A 4GVXA 1K08A 3JD1A 2JHFA 3VDRA 2GKOA 5K8IA 4JA2A 1KFCB 3M5PA 3MJEA 3DL4A 3IAXA 2F1KA 4I81A 4O02B 5BYKA 3AIOA 1EI9A 4WK0B 1MNQA 3RRNA 4C1BA 1UODA 2ZJOA 3C3XA 4EHFA 5HFJA 1QH9A 3IJEB 1W88A 3G82C 4G81A 3TZHA 4G85A 3ENWA 1XTTA 3HR4A 4PFKA 3ZWDA 1YRAA 1VG1A 4TXHA 3BH0A 2WSBA 4PO3X 1I2DA 1XMJA 1Q0SA 3IR6A 4MHOA 2NPIA 1WBDA 5E4TA 1O8BA 1BW9A 1ECFA 1MJHA 2L18A 3IHTA 2ZUVA 2PIAA 1NJGA 1P5RA 1D0IA 1MX5A 3FZGA 2ZE5A 3II6X 5JATA 3KUUA 2WWXA 3A6FA 3LUCA 1EHYA 1W94A 2VSNA 2C84A 2QP3A 2YV5A 3D02A 3DE3X 4R9VA 1EA7A 4YV7A 1NXSA 5JQGB 3D7RA 4MIYA 2FW6A 3ETHA 3SEFA 2BEWA 2I9PA 4TUYA 1UPTA 4AKTA 2PSSA 1A76A 3FKQA 2V74B 4I66A 1MJ5A 3TTSA 3RU3A 2M98A 3L0ZA 3QFFA 4BKMA 2V9CA 2OPHA 1OB2A 1U28C 4HX5A 1P1KA 1MABB 4INAA 1B76A 4C4XA 2O3QA 1EUDB 3MW8A 3RS3A 2O48X 5LL6P 4Y1RB 2BFCA 1F9EA 2C88A 3OLWA 3O95A 4JBWA 3K0SA 4UE2A 2CJWB 2GJ8A 3RUHA 4AWBA 5CD1A 3U60B 4LKOA 4V0QA 2JPDA 5L3RA 1UC9A 1W4AA 3H0EA 2XNJA 4RJTA 3I4CA 1W36C 2PJDA 2VQ6A 3I2IA 3ZLTA 4WK4B 4D8YA 4QTYA 2QB5A 3V4RA 3G79A 1U1DA 1JFFA 3DE4X 1NIJA 3AUFA 2JZOA 1PZHA 2IXTA 1EK6A 3HADA 3LX6A 4QHYA 4NENB 4Y1RA 4BN4A 1FRQA 5JUWA 5ARBA 1YCHA 1NVGA 2GPJA 2OO3A 1PS8A 5T57A 2OSBA 3QKTA 5EE5B 1EU1A 1LCIA 3M1YA 2ZDQA 3AP2A 3K5WA 5CXXA 3RC1A 4UNRA 2IV2X 5LQMA 1N57A 2A86A 2R4QA 3TCNA 1E3WB 3B6JA 1GZ6A 4W8GA 3G2QA 3IV7A 3BM5A 3UCFA 4DQUA 2H9YA 1JTFA 1UAYA 4OOFA 4HS9A 5T6BA 3HNPA 1KE2A 1F2TB 1KJJA 1UPAA 3IIJA 4D0NA 1TUEA 3C8HA 4NARA 2Q1WA 4EUHA 2XDAA 2VDUE 1O03A 4X7BA 2GK4A 3TLAA 3M4YA 4DQ0A 3DKRA 4QJ4A 2XYPA 3ROTA 3INGA 4QJ5A 2NTNA 1E3IA 3W5AA 4Q21A 3K6KA 1V8BA 2XA1A 2JD0A 3G2IA 4KLNA 2XCLA 3KU4A 3IEIA 2GXSA 4Q1EA 4EY4A 4X8OA 3G8BA 3ROEA 1HWYA 3ZGOA 5KHOC 2BFFB 3DMPA 3EQ2A 3WL5A 3BIFA 1DIHA 1L4HA 3PDUA 1QRUA 4AX4A 1VTKA 3OY2A 2P27A 2CLMB 3URKA 4GICA 3V6MA 3JVVA 2Z09A 2G3YA 3AQ4A 2X13A 4KL8S 3MRXA 3LDAA 3FUTA 5LUBA 1LDEA 4LHEA 1M10A 2SKCA 1ZCBA 5F3WB 1L4EA 1SUAA 3BXHA 3OE4A 4UM7A 3ZU3A 1YQDA 5DEOA 1KU6A 4TLMB 4WPGA 1R50A 4ZREA 5KREA 3QHPA 2O3TA 4RV9A 5DTIA 1Z0DA 4GEGA 4ZVOA 2IP1A 2LBPA 2V5VA 4P34A 2Q7OE 4Q1AA 4CKWA 4YJ2F 4HVCA 2FSPA 3EEIA 3QKSB 4XIYA 3IUSA 1CQPA 3AF5A 1XELA 5AK3A 1XKLA 4KZPA 3TLKA 4EZBA 1GL6A 2HJSA 3WGTA 4HNSA 3IOEA 2F1RA 4G2TA 2J0VA 1TU3A 3HVJA 1E61A 1HKHA 3EC2A 5T67A 2PKCA 1MO2A 4HKTA 3R7AA 1RHMA 1ZH4A 1H1LB 3DSRA 3UC9A 5IVHA 4KO4S 1C50A 4KXNA 3HUTA 5THXA 1EZZA 2WZCA 3BH6A 3HACA 5CUQA 1MW8X 1OVGA 3ZDBA 4H4EA 4LE0A 2OY0A 4NCHA 3ID6C 5EJ4A 4MZXA 5AM0A 3TLBA 1V1MB 3HY6A 1VSVA 3MUEA 4FR2A 3HU2A 3TD6A 4B71A 4C03A 2CV1A 3RREA 2O3UA 1U5BA 3K05A 1TD9A 3X1KA 2JBWA 3TJZA 2L2QA 1UKBA 2YN4A 3DC7A 4GRDA 2VG8A 3THXB 1YDFA 2P91A 4KQKA 4LYFA 4AN0A 3AKDA 3GT4A 3JU3A 4LYAA 3HXOA 2B4KA 1XF9A 2H1WA 5FFMA 2HXYA 1UXHA 4L0CA 1T0BA 4BIIA 3MZ0A 5A3SA 1QDEA 1AHIA 3DW3X 2QUIA 4FMCF 4FUTA 5D3ZA 1AUXA 3SR3A 5FA8A 3HGQA 2G40A 1DAGA 1KARA 3C4QA 1KO5A 5TY0A 3L8MA 3GVCA 2VDPB 4P7JA 2WJPA 6PFKA 1ZCFA 5CH8A 2XCSB 4EG4A 1HG0A 2VYVA 1V4NA 1I4DD 1U0HC 3MWEA 5EPEA 4BQFA 4YMIA 4KITB 2G17A 3BMNA 8MHTA 2FMFA 1X8JA 1BS9A 5A9SB 1ZZEA 5HGJA 5L6LB 1OLSB