5A4FS

The mechanism of hydrogen activation by nife-hydrogenases.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
264
structure length
264
Chain Sequence
KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydrogenase-1 large chain
publication title Mechanism of hydrogen activation by [NiFe] hydrogenases.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr. mc4100
total genus 81
structure length 264
sequence length 264
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 5a4fS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 5a4fS02
1E3DA 4U9IS 1WULS 1UBLS 4CI0B 4UCQA 1UBKS 2WPNA 4TTTS 3ZE7A 4UPEA 3ZE6A 1UBUS 5D51S 5JSKA 1YQ9A 3ZEAA 4KO4S 3ZE9A 1YRQA 4UQPA 3AYXB 4UD6A 4U9HS 1WUIS 1UBHS 1CC1S 4URHA 1UBOS 4IUBS 1UBMS 5A4IS 4KO2S 3CUSA 4C3OB 1FRVA 1UBJS 1WUKS 4GD3Q 3AYZB 1WUJS 5JSUA 5A4MS 4UE6A 4UE2A 3RGWS 1H2RS 4IUCS 5A4FS 4OMFG 5JRDS 1WUHS 5JSHA 4UD2A 1FRFS 2FRVA 3H3XA 3CURA 4UE3S 4UEWA 4IUDS 3USCS 4UQLA 1UBTS 3USES 4UEQA 4UCWA 5ADUS 3MYRA 4KO3S 1H2AS 1YQWA 3ZE8A 4KO1S 1UBRS 4UCXA 4UPVA 3UQYS 4KL8S 5JT1A 4KN9S 5JSYA
chains in the Genus database with same CATH superfamily
1E20A 1AKTA 1L5QA 2YZKA 3GBPA 5L4LA 5B7GA 3PC6A 4RLFA 5FBRB 3HGQA 4GECA 3HBLA 2BT4A 1X94A 3B38A 3ILVA 1U81A 2QLLA 3PI6A 2ATEA 1K75A 1TZMA 1JLMA 2G9UA 3AB3A 2QI9C 1T8UA 3D0KA 1UZLA 3Q9LA 3NBFA 1FNBA 1MG0A 4ID9A 1T9KA 4MWOA 3ZIDA 2QJFA 1LY1A 2CLOB 3ISTA 2G71A 4G0MA 3R3HA 4JLSA 4EY6A 1V1JA 1BVUA 3DTTA 3R3VA 3UUWA 1G8GA 1R6UA 1JAIA 1USIA 1HDZA 2PUVA 4ZT4A 1G3QA 1P3JA 3GIWA 5JFOA 1KJZA 2PS3A 3A11A 5ES4B 2Q28A 1GG5A 2C9YA 3AM3A 3F5FA 3WMFA 1QF7A 3V4VB 1OLSA 3HM2A 3FDZB 5DBOA 2SECE 4AJIA 4CKYA 4EYSA 4QDOA 3F90A 2FSPA 2EFCB 2PG3A 3K9HA 4FR2A 5AKLA 2EBHX 3QBEA 3CF4G 4LS3A 1ZUNB 1EFPA 3CZQA 3X1XA 5IWCA 2JJ8A 3DNFA 2KJQA 1SCQA 1Z3IX 2APJA 4OATA 1OD6A 4UDXX 2IFTA 1W73A 1Y1LA 4RS3A 13PKA 3RS9A 1HYQA 3EYAA 3TIVA 1MH1A 1Z8FA 3AKEA 1YFZA 3HWSA 2IEBA 3IIJA 3AB8A 3OSUA 3P97A 3PC8A 1HT2E 2ZJ0A 5JPCA 5ED4A 5EAIA 1ZVQA 2ZUVA 3RVBA 4M7RA 3SQMA 1AA6A 3O1HB 3WLMA 4OMCA 1EFCA 1GGNA 2DFLA 4G2TA 2X0JA 4C01A 5JQGA 4P4GA 4ESEA 1BA2A 4IJ5A 1DAFA 5BMOA 3P0HA 4HGNA 3GVXA 4LOJA 2I5PO 4KXVA 1B0PA 1Q0UA 4OJKA 4C7MA 4CQMD 1T8WA 5L7WA 5H9WA 2BGRA 2QT9A 4GM1A 2OQRA 1JECA 4GRIA 2Q4RA 2KYRA 5CB4A 4M7OA 1E7QA 1BU5A 1O2DA 1H1LB 2C2HA 1ISRA 2QG6A 3PA6A 5D6NA 3ENZA 4UHCA 5IAKA 1USUA 2KW5A 3QNMA 5FUXA 1Y5RA 4S3MA 3CZ5A 4AMBA 5I6DA 5J47A 4OSEA 4AMYA 1XAJA 1SHTX 2HPZA 1OYWA 1H3NA 4G5YA 4GL4A 4LV6A 3CWCA 4OHXA 4ZTBA 3MGGA 3A1WA 4OHRA 3TNJA 3RNOA 2R4QA 3G68A 2W6JA 5I7VA 2VF7A 3IEPA 6LDHA 4AYXA 2HW8A 1E2NA 5AW0A 3WIVA 4ZHQA 1RXSA 1YZLA 3KXPA 2HRRA 1PT6A 2BTQB 1EX9A 4XSGA 3T94A 5TNXA 1NXQA 1UEIA 2BF4A 5FQOA 4QD3A 4KBYA 2XF2A 1A04A 3C16C 4FKZA 2H92A 3KFXA 1IJFA 1Z4JA 4C2UA 2PFGA 4GLLA 2QTHA 5TB5A 5ULLA 1E3LA 4R2MA 3MXTA 3B51X 1S1MA 2EKDA 3QHAA 2WNIA 2G07A 4WD3A 1GSIA 2YN2A 2UUPA 3I76A 4PBRA 3WQBA 3KSBC 2VTBA 5K8TA 2A4KA 3ROTA 4EL0A 3S28A 3DVSX 3C85A 3UOGA 5F78A 4MGKR 1QHSA 3VYRB 1D6NA 1JKJA 4EA7A 5BWLA 3S2YA 4ZCSA 1DRUA 2K6GA 1QRRA 3FSJX 1E8DA 4G4SO 2CDAA 2X4DA 4HQKA 4QNRA 4S0ZA 3G7NA 4W8GA 3C5VA 7AT1A 2Z2XA 2ZT5A 2J0UA 2P35A 3KTOA 4JUAA 3V2HA 4TROA 1A88A 2QXYA 3I01A 3ZD8A 1US8B 4IRMA 2FWNA 5I9MA 3X2EA 1I6KA 1N5DA 3NXSA 2H2DA 3EQ6A 3W5UA 4B0OA 3V7YA 1PBTA 1QGZA 1XHFA 4P84A 5FAKA 1YACA 4WBNF 3LK6A 5AJUA 2P3LA 5ANRB 4FDAA 1T34A 1Z6QA 4MX8A 5KWJA 2O8BA 4V03A 1PJAA 1W76A 2A7XA 2FW9A 3WTBA 4TSFD 3RC8A 2IY8A 1M6HA 4R1NA 1AMNA 1N5IA 4TWAA 4XJXA 3SJUA 3AVVA 4R0VA 1BRMA 3V5NA 3TLCA 1BA3A 5D51S 3KAPA 2LP4Y 2JFZA 2ODWA 1RWOA 1AZLA 3LQ2A 1C0LA 1O03A 2IU6A 3TRFA 3A1CA 1Z17A 4O25A 2AR0A 4CLXA 4OHOA 5C8YB 3M34A 5HXAA 3L8ZA 4G1MB 1Z2OX 1TMKA 2IPXA 2IQ5A 1KEUA 2TECE 5KX5B 1XPRA 1WHSB 3ONNA 2NU6B 4IJKA 3F9RA 3C98A 3JVVA 5DULA 2RONA 3H83A 1JBKA 2XUZA 1U4NA 4M0PA 1O9BA 1PWZA 4NENA 3S1AB 3ZV6A 1SCNE 4LWOA 3D2BA 1EFVB 1C9YA 3HDGA 3IHWA 2C84A 4K1XA 4JH0A 2PTGA 2WZDA 2XXAA 2AEFA 2IEGA 3IEXA 1G66A 1HZZA 4MKXA 3JZIA 2Z1NA 4O4HA 4B83A 2YS6A 4C7OB 5FUMA 1IXSB 2W37A 1W6UA 2Q5HA 4P7FA 4UE2A 5IBRA 4BNYA 3U1BA 3LWDA 2WWGA 5HWSA 1GQYA 1RBYA 5EL0A 1GM5A 4IG4A 5FTNA 1TZBA 3SMVA 3FSGA 4EIWA 1DX4A 1GCGA 4OMFG 2O2CA 5EJIA 1YRBA 2HWWA 1ULSA 5G3YA 1IOVA 5TT1A 2W2KA 1J07A 4IF6A 5K4AA 2D7DA 3ED5A 4IMIB 3A6KA 4KYUA 3TPCA 1JVSA 2AG0A 3G3EA 3SE0A 1S0UA 3BGWA 2EEZA 4HNGA 2Y92A 1KBQA 1E92A 1MN6A 4JJGA 4RIGA 4XWTA 3KUKA 4LX0A 1RJGA 2R47A 5JJBA 4EF6A 1UWKA 4WE3A 2OYCA 1Q57A 3PJGA 1P4RA 2G28A 1C8VB 3C6BA 4TL8A 4BP9A 4QBKA 1GY8A 2GVNA 1FZQA 1HGXA 2XPCA 1CZUA 1HQCA 2ECPA 2FFJA 1FFEA 3OZVA 3VYUB 4XOIA 4AJNA 4OLBA 2QLFA 4URZR 2E4UA 3CA8A 1TEXA 4J6FA 3T3OA 4GOJA 2IDMA 2TRSB 2ZRJA 5ENVA 3RVSA 1SQ6A 3ENWA 1R5OA 1PK7A 1DXYA 5I4IA 2PSFA 4TYNA 1C7FA 1VA4A 2J0SA 3OEHD 3V00A 5EXEA 4O4IB 4MYTA 1A3CA 4KODA 1E1CA 2FW1A 4K9RA 1K3FA 1GFIA 3DVAA 2F9LA 4R8SA 5DLYA 4ZK6A 3M6IA 2NX2A 3GJTA 3AF5A 3MELA 1NMEA 5AD1A 3I83A 3WHKA 4L74A 3CR3C 1T2NA 1DUSA 1U3CA 3ANLA 4V0MA 3JASA 5ADUS 3INRA 4LRSB 5KMGB 1CFJA 2FPGA 5ALRA 3VZQA 3VX3A 2JJYA 2R4UA 2WT4A 1M2OA 1F6BA 2Q3LA 4UHDA 3ZVNA 2G8NA 4V24A 1TTHA 1OPRA 2VPWA 3GJ5A 2EFEB 3ZJVA 3PZBA 4IWXA 3RJZA 2WUDA 4P54A 3OZUA 1AGRA 4NNJA 1SKQA 4HQOA 3PQ7A 3SEZA 2GZAA 4BLRA 1K68A 5JQWA 3BB4A 5F76A 3GY0A 1YR3A 3EXEA 3P45A 3GI1A 4C03A 3ZU5A 2A8YA 3PKJA 1SD5A 1A76A 4QWMA 3T7RA 4L6IA 1XU4A 3VSEA 4CTOA 2PZKA 2OGZA 2WG1A 4K9NA 4XKJA 5EMMA 3WADA 1DCTA 2O54A 1ZIOA 4ISCA 5A05A 3TGPA 2IHUA 2IYOA 4P32A 2IUSA 4FFVA 3H19A 1CDOA 4BUJA 3NH9A 4WDRA 4I1PA 2D74A 2ZBPA 3TSZA 4NULA 4DIMA 4BNMA 4CG1A 1E98A 1BVRA 1UPUA 2AEMA 5EEGA 4D98A 3DTVB 3CVXA 4DLWA 1DT5A 1WEKA 4KR6A 2IW1A 1S9HA 2ZBQA 2LGJA 3G7UA 2GJAA 3CEAA 2P9HA 4KSYA 1AC5A 3TYXA 4DRXA 1F2TB 5FOWA 4JJFA 3T5PA 4FFPA 3C1UA 3UUEA 3RIEA 4J7AA 4MEJA 2WWWA 3SIXA 1N3IA 3REQB 3SR4A 1NQ5A 3GHHA 3IQHX 4TTQA 4D4LA 2BFBA 1ZA2A 1CS4C 3DZ8A 1KC1A 4YR9A 5KIAA 3U6KA 4QVGA 2Y2VA 4JLMA 4HI0E 5IDYA 3ZC3A 4U63A 4E5NA 2IYAA 4UHKA 3S0JA 1WVGA 4BNTA 1T15A 4IMPA 2XBMA 2ALJA 3GVPA 3SE7A 1VIVA 4U7FA 1XBTA 4TTIA 4KYVA 4IZIA 3RBAA 1M33A 1FUIA 2FZWA 2Z5VA 4BTLA 1FTQA 4LDAA 4X24A 1H4QA 3SZRA 1Z06A 4U7JA 3V1MA 1CRQA 3WLNA 5G1PA 4H7FA 1ORWA 3ZD9A 2IH2A 4MQ5A 1VC2A 1PK9A 5AVUA 2ZW9A 6REQB 1TCAA 3LP6A 3N75A 4UQLA 2OGTA 3CF0A 4A36A 4OQEA 5EKSA 4JEHA 2QTCA 4OA5A 4WV3A 3OQBA 3LF1A 2V0GA 3QVSA 2J4FA 3DE4X 2OXCA 4QYTA 2GFQA 4DCSA 4H77A 4INPA 5DF1A 2Q07A 3NATA 4HXYA 3K0KA 1EP9A 3THWB 3FYCA 3MGKA 1GTJ1 1H42A 2BZGA 3HPRA 3G2PA 5DCWA 3HJGA 4IDPA 2V7BA 4FKBA 2BRUA 2QU8A 3OZTA 2ONCA 4PSAA 1E2DA 1E5DA 4K2AA 2DHCA 1R0ZA 1OKKD 1SQ5A 3N7AA 2PKQP 3EXFB 1Z15A 3H6KA 1VKNA 2RAPA 4YQEA 5JEEA 3R3XA 3D54D 2R6JA 3NEYA 1XJ5A 5D5HA 4B7AA 2GPWA 1TLFA 2BMAA 2BD0A 3H11A 3T5MA 4BE7B 3H4VA 1U7TA 3DDWA 2BHSA 2GFHA 1MAAA 1XALA 3SBXA 3U5ZB 5AW2A 4PZEA 2OM6A 3QPUA 1Z33A 1IFXA 3FUCA 3O84A 4FMBB 5EXPA 1PSWA 4QO8A 5TEVA 2BFFA 3T9CA 1L5OA 1A71A 3KXLA 4OL9A 3N59A 3GJ4A 4DR1B 2FZ5A 3E2MA 1VHDA 1QBGA 2EFGA 2JARA 1PJBA 3OO0A 2OLJA 4MRSA 3OZAA 4P7JA 4AIIA 4C0WA 3JVUA 2H4XA 4MRVA 5KO2A 4GGPA 2XNCA 1G21B 2HBQA 2ZQ5A 1QF9A 4HX2A 1JHQA 1VQ1A 3M2TA 3P52A 4M21A 4HVLA 3BL5A 3GUUA 2YIVX 1W47A 1ECGA 1OXBB 1UKVY 4M46A 5BV2P 1M34E 4RW0A 5B58T 3TRDA 4BCBA 1PSDA 2XGSA 2VNSA 1ZICA 1MQ8B 1U2TA 2J5BA 2FFAA 3DPUA 2V7VA 2G0AA 4QGFA 1UOEA 1NDQA 2ANCA 1MB4A 3DUWA 2P1ZA 4PW0A 2FI1A 4DMMA 3PUVA 4I0WB 1PZXA 3W9SA 5CK4A 4C6TB 1C3EA 3MWYW 4RADA 4HEQA 1T5TA 4DNPA 1J06A 1Z0DA 3RF6A 1QE0A 1B73A 3I4LA 2RC5A 1ESMA 2OA0A 3W8FA 3ZY6A 4I9UA 2BAGA 1M0SA 3AHGA 3ZDCA 4HZIA 1UQRA 4HH0A 4OLHA 1XROA 2PX2A 4LNUB 1NI4B 4YACA 1RQLA 1IG3A 4MQ6A 4BEVA 4EI7A 1GHTA 2C4KA 5FV4A 4R4JA 3W5JA 5IVKA 5EKUA 3OZIA 1DG3A 3LFTA 1NUQA 4G85A 4GIBA 1TI7A 3G23A 1JQKA 3STXA 3GAMA 4EHFA 3PNBA 4YV0A 3CVWA 2DB3A 4KXNA 3AQIA 3KBBA 1DV1A 2V65A 4UEOA 4MQBA 1VSVA 3EIOA 1T3ZA 1UK9A 5EEHA 1W5FA 3EARA 2C9DA 3JD3A 5L9AA 4G25A 4R31A 5ITWA 1J8YF 4TL9A 2EP5A 3QFTA 5A6SB 2VDOB 1RRMA 3W5SA 2GZSA 1FXWA 3HB0A 3Q2IA 4RK0A 3WL8A 3FVQA 4MR9A 4BBPA 1QM5A 3NALA 1ZYUA 3PNYA 1W8DA 1VCMA 3OTIA 1R8YA 4G8CA 4ENTA 2BYTA 16PKA 4QT0A 1FPMA 2A9VA 5KYUA 3QEOA 4QDXA 4QUEA 2D2FA 1YVUA 3LX4A 3Q3IA 5CEFA 1JWLA 2XYRA 2BGTA 2IJGX 4F4CA 5MHTA 4IQ4A 1WCXA 1SZPA 3MCZA 1YS7A 3EGXB 2M98A 3MYRA 4V38A 1WXFA 2AFVA 1U8TA 3RS3A 5DI3A 2OK8A 3HA5A 3LBNA 3FHLA 2WD9A 4MMXB 4DR4B 2PH5A 1UXGA 3ANTA 3NV7A 3OP1A 3W9BA 3CTMA 4L6CA 2XSZD 4XIFA 1F5NA 2P2YA 4UVDA 2QTMA 3IAFA 3ZH9B 4C7BA 3NEPX 5AT1A 3KVRA 1RAHA 1GZDA 1OFGA 4OQLA 5DWQA 3ZNNA 3AP3A 4LZNA 3G2IA 3FUXA 1IB6A 1RU3A 3PUWA 3TPFA 1XXHE 2R66A 3ZW8A 4PFKA 4ZJUA 4YJ3A 3RVMA 4NG4A 2AC4A 5HM6A 3QI7A 2AMJA 5K3AA 1NYTA 4ZFNA 1Q6ZA 3WLLA 4X1KB 4X3CA 1CY4A 2CNLA 2C5BA 3I12A 1ONSA 1EH5A 3CXUA 3NBUA 3RVQA 1JHAA 2BE7A 2GASA 2OMKA 1KMNA 3DBLA 1FQKA 2WW8A 3W2FA 5HOEA 1U28A 2X8WA 2YWGA 3FCYA 4U9IS 4YLEA 3ZTTA 2W2TA 3KQOA 4YDSA 2V7QD 2CD9A 4QPZA 4YAEA 1SKUA 1TQ2A 4C0XA 4CU2A 3RRBA 1GYRA 3FNHA 4GPTA 4QGAA 1O6ZA 1PNQA 1QS0B 4Z1MA 1Z0IA 3CUKA 4OP2A 2NG1A 4XPZA 1U4SA 4LVNA 1WV0A 1V4VA 3BH6A 1ZVKA 3AG5A 4LY3A 1SBHA 2RCNA 3NYRA 4KLRA 4P4SA 4RANA 1J1IA 3ESAA 3OJ0A 4EKYA 3KQUA 1OI4A 2NP7A 5KSZA 4JIMA 4L5AA 1IHXA 821PA 5EE1A 1NOKA 3KU4A 1FNDA 2ZYRA 4NZNA 5K8LA 1JR3A 1L7BA 3GCXA 4OFZA 1MX3A 4FLMA 1WLSA 4G0QA 4RF3A 4TS4A 2WIGA 2DUMA 1M7GA 3V4FA 1F7UA 3HG7A 2VH5R 1QH8B 3I6MA 4LDNA 2ZE8A 3H9CA 3VO9A 3WJ1A 4A0QA 4CKBB 2HNBA 1J7KA 2BEJA 1XV5A 2ZIWB 1KYZA 1Q7RA 5EMKA 2PUDA 1FLDA 4IVRA 3K35A 1PR0A 3A3YA 5HBGA 3VJRA 2V5AA 3FETA 1Q14A 1KI6A 1U8CB 4LOLA 4OGWA 1GYQA 1SG6A 1DRVA 1W0KA 2V3VA 2HAEA 3G6KA 3M6LA 3G2KA 4RPCA 4QLOA 3OHSX 2HGZA 2A59A 2DERA 2A1IA 1DOZA 1XGKA 2HEGA 3QM1A 2XQJA 1K2VN 3U3RA 5C7LO 4FQ5A 3HJNA 4PC7A 4WTOA 2OXRA 4HDRB 4JLJA 3HXOA 4EWLA 1ARZA 2XITA 2E49A 4IVPA 1I4TD 5KU7A 3AUXA 4YP0A 2RHLA 3LV8A 1UBFA 5FWDA 5HILA 2Y1FA 4O2AB 4P5PA 2GYUA 2ZQYA 4Q7KA 4B9EA 1RRKA 2BJVA 4NZMA 4Q00A 1TK3A 4D5GA 1Z18A 2C57A 2F1RA 4OXQA 5EJ5A 2HWXA 3SHWA 4TXMA 5BN5A 1QH1B 3S44A 3C4VA 3KJXA 2PGDA 4XQCA 1MJ5A 4JJAA 1ZMBA 1R88A 1I5OA 1KJ9A 2WKWA 3FBGA 3HABA 4L4ZA 3ESCA 3HFGA 1UR5A 3GPIA 3HUFA 4DDVA 3CRZA 4P22A 1DC4A 3N6RA 4MUBA 3NHYA 4N5LA 1CUJA 2EDCA 2IYZA 3EMDA 1CFZA 5IASA 1NF2A 3UAXA 3OE4A 4NIMA 5PNTA 2ZITA 1R8QA 3FVTA 4WNAA 2P9FA 3M4ZA 5AJXA 4TZ0A 2O2YA 2AN9A 2ZI4A 1LX6A 1O96A 1OFUX 2ZJ4A 4LNHA 4E5MA 1AT1A 2PM8A 3HCBA 3EFOA 4CM1A 3HUDA 2VSNA 4RFSB 1F8FA 4JQZA 1G5HA 3TM5A 2LVBA 4XFJA 1HTTA 2WZCA 5E7IA 2EF1A 4A2WA 5JZOA 3CVOA 1HLPA 3NM5A 2HRBA 4PSUA 1NW6A 4YQFA 1OJ7A 4GP9A 3B1JA 5BYJA 1AKMA 2DU8A 2J6HA 1RMTA 1RWVA 5CCDA 2VK4A 3HRHA 2QX4A 2CZGA 1FSFA 2EJUA 2JCGA 3C6MA 1TM4E 4J29A 4WXPA 5H59A 4UQOA 3N28A 3KD2A 3WIOA 1PSZA 1TIPA 4P3KA 5HPYB 1MF7A 1G5QA 4X0EA 1OB5A 3OC0A 2CLFB 2ERCA 3W04A 5CG2A 3WK7A 5EMNA 5ITVA 1IY0A 2F8SA 4GZ6A 4M49A 3DUFB 1WV1A 1OFTA 1BCSA 1GUAA 1NKVA 3AYXB 5GWXA 1P61B 3H7AA 1UOPA 1YBAA 4KIWA 2PJUA 2LIVA 2HSGA 2ZUDA 1CUWA 3EMKA 3ZLJA 2AOUB 5A4JA 5JPIA 5AM4A 3SS7X 3PCRB 3W06A 1H05A 4OBXA 4OX9Y 3MFQA 4D9CA 2P11A 3Q9UA 2I71A 1N4AA 3T52A 5ARCA 1E3TA 3IQGX 3BXXA 3NDRA 4J0EA 1DBVO 4M86A 2PQMA 5AXAA 5HUJA 2BBOA 1E6UA 3EWSA 4FMDF 3WKEA 1R9MA 2WKRA 2P2CA 2YJ6A 4WK0B 3W2EA 3HKCA 3ENKA 3LD9A 1H8ED 1YZ3A 3L06A 4N7RA 5F3DA 4HYYA 4QQKA 1GPDG 4X1IB 4Y7CA 1QTIA 2HQRA 4TWBA 4YP9A 1X7YB 5E6RA 4YO7A 4Z9YA 2CBXA 4YIHA 2ID4A 1SC4A 4ROTA 2O20A 3O8QA 3PFKA 2D54A 2I29A 1P2SA 4IGEA 3NHZA 5F77A 4P4NA 2ZI3A 3T7CA 3UV6A 5LR6A 2OXIA 1Z0FA 3O03A 1Z6TA 3LIIA 4IKPA 4M9QA 3EMBA 3K9NA 4OA8A 3RFCA 2ATVA 2EGUA 4HUQB 2J32A 1KHHA 1UWCA 1FFXA 4XVQA 4E22A 5B57C 2VP5A 5DI9A 2W48A 1AQUA 2YCLA 3IQWA 1MC5A 7ABPA 3GJ7A 1H4TA 4RF5A 2E48A 4AZ3A 1ZKDA 1T3SA 1ZXBA 4NMWA 5A1JA 1QHEA 3DDSA 3PIRA 4FGJA 5THXA 5C5DA 4CXMA 2CZCA 2JVIA 3FI9A 1VMAA 1UJ5A 1TADA 1V6CA 2CVHA 2WIBA 2XADA 3Q7PA 1FLAA 3H8JA 3JXEA 3KWFA 1GPUA 1VHLA 2I2BA 2WVAA 2Y2UA 3G82C 3OLXA 4DM4A 4K88A 4EKIA 3TLEA 3K6SA 1QQAA 2QSJA 4DV2B 5ALKA 5CD9A 4HEA6 3CBQA 621PA 1Z4IA 4ZYXA 2NO1A 8OHMA 2OO3A 5COAA 4D8TA 1ZJ4A 5HW0A 5EGSA 4DRZA 1Q19A 4RETA 1IOLA 4FHFA 3AJEA 1TQDA 4NMLA 2P7IA 5DDIP 2PYDA 4FYIA 5GM2A 1FNSA 1DWQA 1KK2A 2H2AA 4B87A 4JEMA 1RACA 2R6HA 3HZHA 2DECA 3P4XA 2HOQA 2AUNA 4RIHA 1E6KA 1ZD8A 2IYQA 4PHFA 3BF7A 3SDZA 3AFOA 2IY9A 3UMRA 4BO2A 5U1PA 1V7PC 1FJHA 2G83A 3COSA 3M5CA 1VGQA 1JDJA 3LC2O 3BXFA 4FMDB 1H9BA 4JDUA 1BXKA 5TXGA 5EKTA 1GLNA 1JG6A 1SMKA 1GGKA 3VDQA 3ZUGA 5EKXA 5T8KC 1NKTA 2HSEA 4JI5B 4O4JA 1PJ3A 2AKAB 1KXJA 4AKSA 1XEWY 5AI6A 4JYPA 4OQDA 1P0CA 3FPKA 1KAEA 3JZDA 3PCXA 4CTJA 4PX9A 5CA1F 5I3ZA 1QCCA 4WN9B 2MSCB 3A1VA 4WVLA 3GT7A 2YXPX 1DTSA 4JP2A 1RQRA 3QX7A 4JNKA 4NYMQ 5HP4A 3G9TA 3E3OA 3HKBA 5U4QA 2ZYVX 3L6DA 3GLHA 5DYGA 1SUSA 2Z5LA 4ZYLA 5H5JA 1X7ZA 3PXEA 4ZXFA 2R8PA 2VIIA 4GX5A 3AUTA 4KPYA 3W5VA 3AL2A 3KO8A 1P4JA 2FJUA 1T9DA 3D6TB 5BXQC 2UZ4A 1CCWA 3H84A 5JRZA 3EIUA 1GKKA 2M2IA 2QQGA 2RI6A 3IVMA 1KVRA 1JEAA 2FR1A 3DONA 4IDHA 3V2GA 1M2EA 5DOZA 2EVWX 3OIYA 4CDNA 4F71A 1VRWA 2I2CA 2VCEA 5HUHA 3VVBA 2CXOA 2CLDX 3HK2A 1HSZA 2V6MA 3MERA 4GLJA 1IJKA 2YJ5A 4J76A 2VEDA 4L5IA 4ZKEA 3U09A 2V58A 3K1AA 3SKXA 2PO5A 3GMSA 1HDEA 2GBLA 3TTTA 4I8DA 5FA5A 5EWMB 3DAFA 3MWDB 3PI7A 1XU7A 3DDZX 1NUSA 3R09A 3NX4A 4IH1A 1Q3KA 4YJGB 1ZQ1A 3ZHCA 1NW4A 1RJFA 2HJRA 4FP9A 1IDN1 3E5HA 4HG2A 4E51A 4EQ6A 4ER0A 5JS8A 1CXZA 3OQIB 1NQVA 4UTPA 1RPNA 4G5OA 4OXKA 4II3A 2VJYA 1Y4DE 3OUTA 2AX4A 1U5BA 1BMQA 1WKBA 4E15A 4A92A 3NANA 3ODGA 5CA1B 4ME6A 2R4TA 3KT6A 3ZWYA 1RQ7A 3F97A 3F5DA 3GT4A 1R15A 1A4IA 2OKGA 4LYGA 4AECA 3HPQA 4O4LA 4JYCA 1E3JA 1P31A 3B6JA 2WA1A 3RV4A 1F9EA 1T0PA 1NSFA 2WF7A 3G2HA 1MGOA 1QVRA 4UZSA 1X74A 1D0IA 1H9AA 2C2YA 1XZAA 2P7HA 1H5NA 3DMRA 4LHZA 3T5TA 5B6PA 4TKVA 3WRYA 4RQUA 2FQ1A 1ZM7A 3OWOA 3H3XA 4BAZA 5IVHA 9LDBA 1DJPA 2ZWIA 1HE2A 1KFKB 3L9WA 1U7HA 4I3FA 2QGNA 2XE6A 3R8CA 3USCS 4OFWA 4QGBA 2R6GA 5JO0A 1VE3A 1ZBQA 4I3HA 3UMBA 4BB6A 2X5XA 1FQJA 1AHIA 5AW6A 4LNAA 1ULHA 2FG6C 1FDVA 4EK9A 1JA9A 3W2HA 2PWYA 2Y1EA 4MA5A 1BMTA 3O3OB 3OM9A 5JFGA 2WBLC 2C98A 1UM9A 5F4ZA 2CJWA 1NF9A 1LRJA 3T3EA 3BHIA 5GVRA 1DI0A 3ITKA 3MOIA 4ASUA 4DA6A 2FG5A 2F3UA 4F9EA 1NOJA 1I3MA 3C4QA 1C1DB 3ON5A 7REQB 3AERA 3PSAA 1QZTA 1T8SA 3FRHA 4UMVA 4CIDA 4KV7A 4A15A 3C7CB 3OWXA 4Y2YA 1BEUB 1NXXA 1EI9A 1CRLA 2WUWE 1K5DA 1B14A 3F8WA 3BMCB 1P9WA 4U6NA 1AJEA 2AB0A 2GF2A 3PG5A 4L15A 4DJAA 1ENZA 2UAGA 1G9SA 2X23A 3DBOB 2OKCA 3K0EA 3V1UA 3U60B 1CTQA 4CEIB 2WWFA 1OT5A 3RU3A 3GLIB 2PMKA 4PZZA 1K4KA 5AH0A 3HCNA 5DGIA 4RS4A 5IMBA 3URKA 4AB1A 4AZ0A 1JH8A 2J7KA 3JRNA 4S2EA 5LQMA 4A73A 4BNUA 4NP6A 3P9QA 3Q40A 2XCOA 3P2KA 4M3NA 3B6ZA 3PHLA 3TTWA 1UMCB 1YK0A 2C58A 2IHYA 5TPZA 3THYB 4PAGA 4JQOA 1TK2A 3DEZA 5AVQA 3RBVA 4Q93A 4YO8A 1RBQA 3VR5H 3QVOA 2X9LA 1KMQA 5HFAA 2BR4A 1Y8AA 3A70A 1J24A 2VUSA 2R97A 1CWUA 1I7LA 1T1IA 1WX1A 1ZJZA 3FPAA 1WSWA 1CUVA 1T9HA 3B1XA 4YUXA 3A7EA 3CNBA 1KWKA 1NUTA 1O95C 4OJTA 1U63A 3V4RA 1HEUA 4JUIA 3HSYA 3DEHA 2PY6A 4IG9A 5ICCA 2EATA 4R0NA 3GLIE 1M66A 4NMHA 5TMEA 4WNCA 2HUNA 2O8DB 2QN1A 5E7MA 2BGJA 1P5JA 3CX3A 4LE0A 5B6IA 4FDVA 1DQSA 3CEJA 1JHPA 1NVFA 5IAJA 1J8MF 1EBBA 1K86A 4HAWA 5FV7A 3TW8B 4R1OA 3BYZA 1F0NA 4A1OA 4OYHA 5I48A 1T2VA 2AKEA 1OYVA 3EPLA 2FLVA 2C99A 3GCGA 4LDQA 1JJIA 3QY9A 3VHXB 2Q2WA 4Q1BA 5IRCD 2G5GX 3BWMA 3TH5A 2AW3A 1UBGA 1GQ2A 2X1LA 5DKFA 3CJQA 3V8MA 4EY8A 1HORA 1KC3A 4ZI7F 1PGOA 4TKLA 2J6CA 5ICGA 4ZRNA 3T7TA 2FRVA 1ZD2P 2VYND 2X8JA 3JRXA 1QO0D 2VK1A 4KE7A 4KNWA 4Q1FA 2NUPB 3UWDA 4QOSA 1KJYA 2ZUSA 1DAPA 3N7UA 3LGAA 2R6AA 5C81A 5BNTA 2DTXA 4FSXA 2AD1A 4Y6PA 3TAXA 3ZOKA 2J9GA 1BD3A 3FCUB 3IB6A 2XVYA 2ZJ7A 4QREA 4HUTA 3D5EA 4P0PB 2Q3JA 3HO6A 1JI0A 2EJBA 1E79A 5D1NA 3U3KA 1Y5LA 2JGNA 5JANA 3QPBA 4K7JA 1CRWG 4GGMX 1TM3E 1TEVA 4QUKA 5HNKA 3ICEA 1PVVA 2VFAA 3B2QA 4NWIA 1W19A 4A8HA 1F8GA 4WN3A 3PVZA 1ZJJA 3L8DA 4HGYA 2PGAA 2DQSA 4NFSA 4RDHA 4YRBA 2LUOA 3RS4A 3RRJA 5K4HA 3GP8A 1GN9A 1I0LA 3CB2A 3GXOA 4DE5A 3VKGA 2D7CA 1ULUA 3ICQB 1PDOA 2F1HA 3MLEA 1A9QA 4CM5A 3TIGA 3S2UA 2FZCA 4QLAA 1ZCFA 2QR2A 4JT4A 4XIIA 3LWBA 3ST7A 3B3FA 3TOXA 4BC0A 2CN1A 1IUNA 4IO1A 5I7OA 2BFAA 1Q20A 1D4FA 1OIVA 4E2YA 5FDFA 3U0BA 3B78A 3EXIA 3D8TA 2PKQO 3CSUA 2J5KA 1Y1TA 3H3FA 3OAAA 3AJDA 4FGZA 4GYKA 3ND5A 2BI4A 1UINA 4ZI7B 4R3UC 3SMQA 4E5PA 1KBOA 2X8AA 3WFZA 3NNSA 1X3SA 2ETVA 5A4DA 5CYFA 3WO1A 1I13A 1IUKA 1W2WB 2EP8A 2VJMA 4PIMA 3D5QA 2ST1A 5TR9A 3PQ5A 3VAYA 3AG6A 2ZCUA 4KXWA 2RHWA 4RA9B 1HRKA 3OTOB 2PKXA 4YRRA 5FWYB 4G24A 2PV7A 2RCYA 4KO4S 4QPNA 1VJDA 3AX6A 1JPNA 3NDPA 1RAIA 1D03A 1E6WA 3P20A 1KZYC 5BN4B 2FETA 4C2AA 4KB5A 1AKWA 1SIBE 1IUPA 1WUIS 4PSDA 1W1UA 1KGDA 5CHYA 2JGLA 2PR7A 2V6BA 4Y0AA 4EZBA 4YV1A 4KWCA 1O5TA 4CI9A 5I7WA 1B6GA 2CMDA 4DY6A 1N5JA 1D2MA 2HY7A 5D86A 2ODTX 5HIAA 2HRDA 3AVQA 2PN1A 4DDWA 4JGGA 1WU8A 5D87A 4NTZA 3WBJA 4AJPA 1SRRA 1YE3A 2EQBA 1KY4A 4J4HA 4RDXA 3F4KA 2BKEA 2QOEA 1W9MA 5JR3A 1GZ7A 2W2XA 4JT2A 3CBGA 1RC0A 1C0KA 4V39A 3DP7A 2GAFA 4HD8A 4KE6A 4M7WA 1YR1A 3FFWA 4MS1A 1RJEA 1QO7A 1W88A 3RRMA 3ZCXA 2H8GA 1YTUA 2WHPB 4U0KA 4TTVA 1JPVA 1ML3A 2H9AA 3EAQA 4UDYX 3D8BA 4MDEA 3PD0A 4PTYA 1VE6A 1U2GC 1RLIA 2II6A 2PAAA 1MOQA 1BMFD 3FPCA 1FFAA 3H5IA 4FVTA 4W5RA 1AIPA 4QUBA 5LDHA 2LW7A 1UXIA 1FW6A 3NCTA 2KS6A 2NGRA 4U7PB 4AMGA 1AH2A 2B4KA 2JIOA 1JALA 1VGVA 1ULBA 4N9QA 1MABA 3JQ6A 1QNLA 1G8FA 4FCTA 2VHEA 2YJGA 2B83A 2FRDC 4UE3S 2DUWA 1P1KA 1YJXA 2PT5A 4M54A 3SX0A 1TPZA 3WP0A 2QM3A 5DHFA 2W7TA 4C05A 2V3CC 5DCYA 5FL7A 3I3SR 1K7YA 4UOQA 4BPRA 3OIWA 3WWZA 1KFEB 1KGSA 4Q4HB 3AEUA 3KX2A 3QWBA 4NQRA 3GLFB 4Y2XA 4DVGA 1G7RA 4KK3A 3ZDBA 2YNMA 4PXYA 2ODEA 1NR5A 5IT9A 2AMLA 2UDPA 3B48A 4RDIA 5AJYA 1Z63A 4N39A 1HNNA 1G1AA 4UFNA 4R0MA 3IUSA 2BIFA 2IF0A 5EJ7A 4QELA 3PXGA 4B43A 4Z3DA 3GCDA 3QJ5A 1SXHA 3ZWXA 5A0VA 2JFNA 1JEYA 2ZIAA 3DZJA 3D3QA 3KT3A 2ABWA 4YCSA 2G1UA 5KYWA 5LP6F 3ZJUA 2DPYA 5KTOA 1M72A 2AEEA 2C5LA 4XGRA 4EFLA 3VNVA 1J9GA 2GZRA 4NH0A 3K6RA 1L5KA 1AHNA 1U8AA 1GL9B 3CRVA 3HDHA 4P2GA 4TSKA 3TJZA 2HWKA 4OG2A 1H0SA 1HO3A 4KMMA 3AHIA 4OXRA 3EOZA 3F6YA 3LHIA 1NBIA 3NETA 4XM2A 3O8BA 4BJ6A 3INGA 5M34A 1V39A 5HFNA 3GLFE 1EIZA 1N0WA 1WF3A 1QG4A 5KTKA 4DWVA 4YRKA 2CFCA 2CLKB 2OBFA 1VLVA 4F7DA 2A0YA 1QGAA 2YL2A 1SHUX 3OT1B 4GMHA 4B8ZA 2DLDA 4ZVNA 2PL1A 3JW8A 3UTDA 4FX2A 2PVSA 3CU5A 3ZE6A 3CISA 4GUDA 3SN6A 1HH4A 4YRLA 2M1ZA 5G4KA 2OHOA 2O8EB 4NHOA 1FU8A 3MT0A 1F1JA 2HMUA 1KI2A 3O92A 4GEGA 1A7KA 4R8RA 1OH7A 3NFYA 3Q88A 3V1LA 3X44A 4XCVA 4UTZA 2HSZA 4RLQA 3VJLA 1BDHA 3R5XA 2ZFUA 1JILA 2I66A 2AN1A 2BELA 5EXXA 4BNVA 2HA7A 4UBNA 2QN8A 5BOVA 3NHAA 3C3EA 5KNLA 3SR0A 4J75A 3PDWA 1EPUA 2VDNB 4R83A 4GKAA 1FOEB 2DUNA 1E9AA 1EFKA 1RYFA 4KAJA 3IPXA 3NGXA 4L9AA 5FOQA 1AUVA 1NG1A 1Q17A 4U5QA 4KGZA 5LIPA 2YYYA 2BGNA 5T4BA 3W6OA 1ZL2A 3QVUA 4PQEA 3LDUA 2FN7A 5IVDA 1LKZA 4B34A 3RTCA 1WJGA 1Z9BA 2XYGA 2HO4A 2O0HA 3FDXA 5LBTA 2M6LA 4OQPA 3H05A 3C70A 4FE7A 4LOIA 4MA4A 1W1WA 5KOHA 4NOMA 2OLKA 3ELDA 3PEWA 4P36A 2HDNB 4Q1EA 1KIFA 4D9EA 2XVMA 4F92B 3KYDA 5LMNB 4EYEA 2YKGA 3IDFA 4A5OA 2PT7A 3IBYA 2AOTA 3MWJA 3PA8A 3ROGA 4JLPA 1DP4A 2PD6A 3R3SA 3L8MA 4ARVA 2JAOA 4RQTA 3SLKA 1ZOOA 3AU9A 3TDMA 4X91A 2IODA 1L1RA 5IBCA 2P78A 3KLOA 3N2IA 4MRPA 3NM4A 1QHXA 1OLXA 2FGKA 4URVR 4XCXA 3GVCA 4D8VA 1KPIA 3IIMA 5BN3B 5BW8A 3RSFA 1F1BA 5EC8A 2QJTA 1BE0A 1TL7C 3WYAA 1NUAA 3UKJA 4M2LA 4NRDA 3GA7A 2NTNA 3VPGA 5L6MB 1JA1A 3TQSA 3H99A 1H6AA 4GKVA 1NWCA 3LDHA 1KE1A 1A0OA 1C0IA 4NECA 1WOMA 3K1ZA 2GI4A 4BMCA 4JKYA 4JIGA 4LZZA 3WB2A 3BTUA 1XLTA 3EQZA 1A5TA 1V16B 3DTYA 3PHGA 1MT3A 4FFSA 3MJCA 4KLZA 2ZWMA 1RYZA 5SZHB 2PNJA 3SZMA 3CKKA 2H0RA 1TU3A 5I8ZA 3N2GA 5AXCA 3D81A 3JAKB 1BW9A 3R0VA 4YPOA 1PS8A 3KEMA 3I04M 3K1YA 4J3NA 2NW6A 4KPUB 3NYQA 2PT6A 3KOXA 4H0NA 4W5JA 2Z1DA 1MW9X 1WULS 3FCXA 4RPKA 1FFBA 3E22B 5K0LA 5SICE 3WLRA 1T9GR 3FZNA 3L4JA 1SXPA 4C4AA 1F3LA 1Z5GA 1OI3A 1GCAA 4ZK2A 1SVNA 2NV2B 2WQ6A 2FPMA 2J9RA 4CCYB 4FYMA 4H6VA 2DFKB 3F96A 3L0ZA 1D8AA 2R5FA 2VUHB 4FFMA 2QYSA 4X41A 1UPCA 1TQHA 4HBZA 4CL3A 4MPDA 4JR2A 3KU1A 5KYGA 2JLBA 1JJVA 1OI2A 3I9FA 2UVPA 1N6NA 3ZCRA 4Z8YA 4WLFA 2VF5X 3BK7A 4KXMA 5F4BA 2A30A 2J5XA 2OO5C 3OETA 4H1UA 3OJEA 4ROSA 1B1CA 2RK3A 1NW9B 4ZHQF 4B3TB 2WKPA 1ZRHA 1V35A 4LOKA 4DMRA 1H0RA 2WE8A 2AN4A 3X1DA 4G9EA 1SVWA 1U8EA 3QU7A 1K8YB 2HREA 2H4HA 3P9SA 5GJVC 1NXWA 1UBJS 5CW2A 1FYEA 5CDYA 2JVJA 1TZKA 3HH8A 1VG1A 3K5WA 3E1KA 5EXSA 5TLSA 3AT1A 2WNSA 2CV1A 1P0IA 4PS0A 2WYVA 3CR7A 2YVKA 3I23A 4JI6B 2EP7A 1YZTA 3FKSD 1C81A 2C04A 2FX3A 4ND6A 4M1MA 1KFJB 2MCFA 8ADHA 3I30X 3KXDA 1D7AA 1EP1B 3HU2A 3E3MA 4NR0A 1IN6A 3WXBA 1E2PA 1Z5WA 2QW0X 2R8XA 5ALNA 5F35A 1RYMA 3L0YA 5K3EA 3ZDDA 1JZSA 2MYTA 3C97A 4Y6RA 3AF4A 5IZCA 1Z07A 3F49S 3HR7A 2H17A 4JXKA 4MUEA 1I6WA 2OCPA 1BDJA 1N2CA 1LZKA 3FMFA 1KSHA 3MLBA 3AKZA 4ACBA 4R68A 4XWWA 1E6CA 1QGUA 2D5AA 1U5CA 2QRMA 3BJMA 5KNDA 3SVTA 3Q87B 5DRYA 2XMRA 4I5DA 4Q3KA 1XTBA 3U7RA 4ER5A 1R6XA 3FD8A 4GZLA 5IW8A 1C3JA 4QTTB 2FXIA 5AKKA 1XA3A 4RQBA 2I3GA 2X9QA 3IAUA 4EB6A 1ZVJA 3PGLA 4HRVA 1WO8A 3AC0A 3PHBE 3V4ZA 4XVCA 4OOEA 5H83A 3ZBUA 1OJLA 1ADYA 1COWA 2QMHA 2R44A 1X8JA 4A03A 3CLVA 4RJKA 4LFAB 3EDRA 2NNLD 4OXYA 3ZGZA 1MPXA 3PLAE 1N36B 2W6OA 1OWNA 4CDGA 1H2AS 1MVNA 3K0FB 2QWXA 4FLEA 4N6OA 3EPHA 4MRMB 3GRCA 1AXRA 4EB8A 2FVYA 4PWYA 1XYYA 3L0IB 1BHJA 1QV7A 3KL2A 5BV0A 5B7PA 3DWEX 2Q3BA 1I4EB 3UATA 2JJMA 2JASA 3E81A 1QC5B 5ECDA 4YHBA 5ALMA 3GNQA 3GEEA 2BVNA 3QVGA 4C07A 3I73A 2VTBB 3B20A 1MRSA 4BE9A 4XWGA 5BSTA 721PA 2BSAA 2EQAA 3ZLBA 4G0XA 4FSHA 4IJ6A 4BNDB 4FOOA 1RJ9A 2Q3FA 3NBQA 4M6WB 4B6FA 3BBPA 1I3KA 3MJSA 3BMQB 4HGRA 3JQBA 3Q5EA 3R3UA 4I9NA 4F4JA 1QAOA 4QUHA 2NXNA 3OIUA 2ZYDA 4GI7A 4GR9A 2XLBA 4O4HF 1X13A 3W78A 2I03A 2ECKA 3PDIA 2C96A 1OHHA 4YRGA 4KR2A 1EQ2A 3PBKA 4ZTUB 4OUDA 4MUFA 4W6QA 3UPUA 1YT5A 3F6EX 1V3TA 5CTAA 3SZ3A 3GBSA 1B74A 1PZFA 1SQ0A 2DKOA 2WM2A 3A6LA 4KYIB 1XHEA 4LEIA 2P2ZA 3TRKA 1TM7E 5BSEA 4EITA 1FE8A 5DK4A 2O8BB 2DFDA 4Q21A 1E4OA 4CLRA 4RHTA 2O06A 3FWNA 2XRFA 4PZYA 1RYHA 3BZUA 5AHRA 3TQTA 1R66A 1KJ8A 2D3WA 1UC4B 3OKCA 4GWGA 4DSTA 3ZVMA 4EO9A 4OM8A 2J3DA 1MLDA 2INGX 3OHMA 2ZIZA 4KTTE 1FFCA 2ZR8A 2C7OA 2IZ6A 4PC3A 3UENA 1A4XA 3IAAA 3NBAA 2Q1WA 3L82B 3KEGA 3EEQA 4RK1A 1NBEA 5LOVF 4FHEA 1C4XA 1II8A 2ERYA 5C18A 2IHZA 4CM8A 2ZIGA 4LUCA 4XYBA 3RANA 4OKSA 5JNRA 2ZWPA 1I9CA 1QGED 3G7SA 1E1QA 2GGSA 4RA6A 1ZESA 2PBRA 4X90A 2DQZA 2QM0A 1VMEA 2BONA 1FMTA 3NCHA 5KWSA 5JS7A 1IK6A 2R7NA 4OQMA 1MDFA 3HU3A 4PCUA 3W5DA 3VPCA 3DCIA 4O1IA 2Z9DA 1ABEA 4U8HA 1I2CA 2COEA 1JAHA 1QNFA 4EUEA 3NWBA 4Y2VA 4B09A 4JZYA 1GNSA 4PFJA 4EW3A 4GVPA 3SQWA 5D1HA 3WB0A 4Q9AA 3JQ8B 4QHTA 1YCDA 1MOSA 2JD1A 1ZMXA 3ORYA 3OFJA 4PM4A 3NVKI 5C1PA 2AJTA 5SYNA 1MIHA 2P0EA 3TW4A 4C21A 3L7LA 3NOXA 4N6NA 4OMDA 4COOA 4E3ZA 3TL6A 4U7TB 3MMNA 2I4IA 1V1MA 3Q3JB 4OF4A 3WJ2A 5SV2A 1XZGA 2DR3A 2HEIA 3JPYA 3OLQA 4KBFA 3HCOA 3DMPA 4Y6LA 2DJIA 4C1BA 5DX8A 3EEIA 2HU2A 2YXDA 1ONOA 4L2IA 4GS5A 2XAUA 2Q6IA 2ZBUA 3LHFA 1M3SA 4XFDA 4QEKA 5GGXA 2PS9A 2OFWA 4WCVA 3ZWDA 2H2FA 2F59A 2XRYA 3HP1A 4QYIA 2YIDA 1PD0A 4JHXA 2AF4C 1PNRA 4P80A 1S7CA 1AK1A 5LOVB 4JVSB 3BSYA 4KPGA 2LE0A 4RZUA 1XRNA 2NV0A 3FR8A 1XTRA 3DV0B 1MDBA 5LBIA 5C8XA 5E4JA 3TQCA 5HE8A 1N4DA 3QU5A 3RK0A 2QP3A 3P9NA 5IWAB 4W5NA 4DLNA 5GP1A 5EWLB 1ORVA 4EB0A 4IOJA 3SQDA 3DOOA 4OHKA 2IWRA 3DZKA 3RYTC 2CDBA 5D3MA 3VOAA 5JRJA 4HRAA 4NU8X 1F8UA 1BC5A 4R54A 2VLIA 2WJZB 4YMHA 4NV3A 4ETIA 2BGUA 2G9NA 3DVAB 5I4CA 3LUFA 2HMSA 1G2PA 1P2VA 3GGSA 3W2TA 2C59A 4RIEA 3T99A 3LGSA 3AY3A 1PKEA 4PZPA 4ZCLA 4JBIA 3BD8A 4WK2B 3G59A 2B8NA 1E0DA 3QQPA 2EKPA 1T4CB 1T0UA 2CUNA 1G8PA 1G60A 5DHAA 5H7XA 4BL5A 3HEBA 5HF6A 1JZQA 2PMFA 1U0LA 4I46A 2CUZA 3BE8A 1HZJA 4MR7A 3ZOZA 4GZ3A 3K96A 4RENA 1NQXA 5CYPA 3WMRA 2VK8A 4BNHA 1P7PA 1SY7A 2PGNA 10MHA 4DLLA 1Y9JA 5DXFA 2XEDA 4C4RA 4ZU6X 2DR2A 2FZLA 1ZD9A 2OV6A 4IPTA 2WFAA 3AUSA 2VXYA 4CM9A 4GYWA 1HDRA 4MW2A 2O3JA 3BK2A 3JWJA 3X1JA 4Q9LA 1TKCA 3WC4A 4I36A 1O77A 3BGOS 5FPSA 5LWQA 2H1FA 2GBIA 1DJQA 3I5YA 2DG2A 3LT4A 5CLQA 2OUKA 4LY9A 3RADC 4O08A 2Y1XA 4YRCA 2E5LB 1I2MA 2JI8A 4U3JA 5FTJA 4TKZA 1N2SA 4JLUA 5FPTA 4EG7A 1PUJA 2IYPA 2QDKA 3D5TA 5SYMA 1AQLA 3RFVA 3HLTA 3VX4A 2O8FA 1HQDA 3ICWA 2IA5A 3Q3VA 5H82A 1B1AA 1L9KA 4TWRA 3WYCA 3K9GA 5GZ1A 5JW6A 1E2UA 2A92A 4BFYA 2H7VA 4GFDA 4RTSA 4JA0A 3PE3A 1XN4A 2BJHA 4H59A 4RIIA 2F6RA 3D8SA 1WTCA 5FTWA 2GVZC 2RHGB 1VJTA 2XMZA 3THOA 3E9YA 3TZLA 1JXOA 3FG9A 3GHYA 4G56A 4R1PA 5D7NA 2ZVDA 4DCTA 1XZDA 3UAVA 4EEXA 1Z5PA 3RUDA 4DV0B 2BFMA 4TMYA 1AD2A 4E3WA 3WAKA 1CV2A 2BWJA 3DE3X 2H1IA 3AETA 1MO6A 2GCEA 3AK4A 3E7WA 3RIMA 3X1ZA 5BMVA 2OAP1 3WMGA 4DJDC 3GYGA 4RD0A 3WRVA 1B41A 2AVNA 4RDCA 3RVOA 4O33A 2HMAA 4QXOA 5HMMA 3K09A 3TSOA 2XZOA 5GJBA 4X20A 3HCAA 4MIKA 1D5CA 1IHYA 3ZXSA 1V3UA 1UJNA 1TPYA 4CV0A 1KOJA 2Y4NA 3TEFA 1YK1A 1BQ4A 1DKLA 1G16A 4XXHA 5FEMA 3TCNA 4OD0A 3LRTA 3ECCA 4UM5A 3D7RA 1T4MA 3HKDB 5EHZA 2AFHB 1U9JA 1V5GA 2B8JA 3NEAA 2R8BA 1S8OA 1VG0B 4WA7A 5EJ8A 3HA2A 1QRAA 3OCZA 3FGNA 4XPIB 3DBVO 5H16A 3E9DA 4JR1A 1O5IA 1WDLA 4XARA 2QLMA 4BKOA 2C7RA 4X7MA 2YFHA 1QWOA 1K6JA 2QYOA 3OZWA 3LDAA 4OJNA 1L4NA 1CZKA 5H8WA 4UBLA 3G02A 1BTOA 1K6EA 1IMJA 1HQKA 3ROPA 4DGSA 3N2KA 2X3YA 4YYEA 1Y4AE 1VCOA 2MSWA 1EDDA 3U48A 4TWZA 1FS4A 2MINA 3N74A 5BWBA 3NHWA 3VGPA 1NP6A 4TVOA 1CY6A 3WL3A 5F1OA 3R7NA 2CFTA 2QKYA 3T41A 2ZJZA 4LKRA 4WCFB 1Q1QA 3QA3E 3UF0A 3I53A 4NLLA 1L5MA 4E2ZA 1H3EA 1KU6A 4BO8A 5J58A 2IH5A 2QTWB 4X84A 2VN8A 3MUNA 2PTHA 1G0NA 2CSXA 2ZULA 4GQBA 2DMRA 3TLZA 3DWIA 3JATA 5I8PA 2Y0BA 4IILA 1EKXA 4UNIA 3RI3A 2PU7A 2A5GA 1EE9A 1NL3A 5ESDA 4DIKA 4E09A 3EQ8A 1ODJA 4A3SA 4HAZA 4CEHA 4Q9JA 3O8OA 4ZZ1A 3TQQA 3X1MA 1DEOA 4QE3A 2J3HA 3R20A 1TJ4A 4AYTA 3ZE2B 1GARA 4INAA 2RAVA 4MHTA 1KE2A 3I05A 4LI3X 1NJFA 3L46A 1LPMA 1XMPA 2O8NA 1EM8B 2IIBA 3QNWA 4RZ2A 4US2R 2X77A 3PYMA 3PKZA 5CMLA 3WLPA 2O4CA 4UMFA 1TVKB 5T67A 3CRQA 3OU2A 3VPHA 4QT4A 3HN6A 4D1YA 2CEKA 1ZO8A 3V55A 1FXWF 2DAPA 4WA8A 3T3HA 4HNHA 5F2EA 4RWZA 2YHIB 4ARUA 2GM4A 4CQMA 2BI8A 2GJ4A 4KO2S 3WGHA 5JE8A 1ZQ9A 2JGKA 5HX7A 1SHJA 1UKZA 4HB0A 3BEDA 4CLOB 2JG3A 4LYDA 2O3QA 3EF1A 1OXMA 3L02A 3O2QB 4AJ4A 2PLWA 5ILQA 2IYFA 3BM5A 2LCFA 5EJAA 2QP4A 4XYEA 4QRIA 2CVOA 1RZ3A 1YKGA 4D81A 2IXGA 5MN5A 1IWPB 2TYSB 2XYPA 2EU8A 1M83A 4F11A 3PUKA 5L45A 1H2RS 4S2UA 3DLAA 5EMJA 4K9LA 1ONPA 5CIQA 4WVFA 4ZAVA 2G6BA 1E7MA 4JB2A 2P1RA 2E89A 3QY0A 1WUHS 2FMUA 4EENA 2PUJA 4RVFA 4BZXA 4EPRA 4LXGA 5FLKA 2JGFA 2QTZA 1GT91 4FIDA 4YJ3F 1I94B 3RSZA 3ZY4A 1WP9A 3GJYA 3TRJA 1O7JA 1CK4A 1ZNWA 4BQFA 3T34A 3CUUA 4A16A 2NN3C 2XX3A 5JAHA 5IH7A 1VG9B 4S1PA 3ZYCA 1PLKA 1D9XA 1VJ5A 3IUNA 3ZKAA 1J1UA 4AAYA 3T3IA 1K7FB 4EY7A 4YAIA 1ZLXA 1X1QA 2Q1TA 2P2SA 2VBCA 3QG1A 2W4MA 4CG3A 4EDHA 4YV2A 4B6JA 1UBTS 2GEJA 3IC5A 3VKHA 4K9DA 1P1CA 3GYBA 4CIVA 4FINA 5AYVA 2QL7A 1RCUA 2QD1A 3EVNA 4QG7A 3AR9A 2AV6A 3F98A 1NX9A 1YQTA 5BV8A 2RHMA 1HK7A 3FDJA 1E3QA 4C9BA 4QG3A 3P2JA 2A1UA 4YVFA 3B7PA 2WZBA 1IPFA 5KYUB 2RSLA 3QF4B 4CKXA 4KR0A 3VU3A 5ICSA 4Z86A 5B6JA 1U0FA 3L7NA 4MITA 4GSKA 2QG4A 3KLBA 4QRHA 4WI1A 2H9IA 1E2MA 3IQXA 4HXEB 5CVCA 5KHAA 1HX7A 5B4VA 1U3DA 1R3DA 4M1OA 3OJOA 4QTZA 3S7TA 2RMKA 5DI3B 2WU4A 3FWHA 4TSFA 1JEJA 1Z88A 3RU2A 2BEWB 1R74A 2MOKA 2C4MA 2ZBDA 1E9SA 3GA0A 4UAJA 1DTWA 3ESZA 4OK3A 3WAGA 3SSAA 3JQ9C 4NHEA 1T24A 2GNPA 3CX7A 4PFSA 1T43A 3O8RA 3HI6A 1W48A 2GBPA 1C41A 4IR7A 4PRKA 2HA2A 1MX5A 4Y2GA 4LJRA 4BTEA 4HFMA 4PZLA 3PXXA 3LKBA 1EXMA 1E7WA 5YASA 2YFQA 3C3PA 1Q5PA 4JCOA 4BZPA 3LYUA 1MV5A 1CKEA 2R6R1 4MARA 3WL4A 5A5EA 1M6VA 5A9SA 2QRUA 4IQ8A 2R2GA 3COVA 3H2JA 1TAHA 4JL8A 4NCNA 5SY9A 5K0FA 4BP8A 3CS3A 2W2OA 3T06B 2CW5A 1UJ6A 2XAAA 2XA1A 2B7LA 2HRCA 1E5VA 2JIMA 3C6QA 4H7IA 4F4HA 2X13A 1UANA 2AGVA 2JD0A 1ZRNA 4LVUA 5DLPA 3T9EA 3O91A 3WLOA 4UEJA 5K51A 1VIAA 4P4SB 2FMKA 5LKAA 3IV6A 1O9GA 2R1VB 2PIDA 2N1BA 3OQVA 3ADKA 3QA9A 1VLLA 2WYIA 3E53A 4JENA 3WS7A 5A2QA 5KQLA 1FP2A 3CVVA 2ZUFA 4GVLA 1UPTA 3CE6A 5EP2A 3IR7A 3HYLA 2I2DA 3X2SA 4IS2A 5GTDA 4YB8A 2UV8A 5BRAA 2REQB 5JNUA 2QQ0A 3P94A 5FTLA 1RYNA 1Y42X 1W4AA 4HSEA 4IDQA 2RHOA 3F6CA 2JGDB 4RZSA 5A7HA 2VDWA 3GEBA 5C2JB 5JS1A 3D3WA 3V7FA 4LQLA 4JC4A 2F4NA 1V5IA 4MI9A 1ISGA 1Z56C 2VJLA 2WU1A 4IKOA 1GSHA 3EEYA 4YMVA 2J1LA 1C5KA 3L0CA 5AM2A 1MNQA 2ATCA 1DEAA 1E69A 4Y30A 3HJHA 1G8AA 2E4WA 3LVQE 4FHCA 4W8OA 1WPQA 3U80A 4J9UE 2QIPA 4Y7DA 2VUIB 1U3VA 3B70A 4HNTA 1O9HA 1MEEA 4FJ0A 3UWSA 4DG5A 1CHNA 4LYAA 4PPQA 1AU9A 3NOQA 4MAFA 3OKPA 4U5XA 1JNXX 1YKSA 1WQ4A 2NU8A 1SQSA 3EW9A 2IHVA 1R5JA 3TS1A 1KEEA 1SUFA 1UT5A 1N2JA 3C3BA 3D3EA 3K0CA 3QU9A 4XVHA 5JI3E 3AEZA 4AFNA 3OEHA 3M83A 3FMIA 2BGIA 1IHPA 4XE5A 1QG2A 5E9QA 1GR0A 3VZDA 2IS1A 1K7EB 2NAPA 1A72A 2POCA 2ZK7A 1L3CA 3HDYA 5CH5A 3U7QA 1T2FA 5A0FA 4BLPA 1NMYA 3P9XA 2DT5A 1E7RA 2IHJA 4UBMA 4YBRA 1ZW6A 1G6KA 1Z4NA 3F3YA 2LPMA 1KK0A 4H27A 4WZAA 2CEAA 2O3RA 3LK7A 2NADA 3DQQA 3H7IA 3O93A 1K9SA 4MAAA 4ZREA 4CL8A 1Z4KA 3FB1A 3KUCA 4LXUA 5DASA 2VNHA 2I3AA 3L93A 3ZIUA 1I7SB 2ADOA 4OOFA 5BN5B 3T0IA 4DV4B 2XUAA 3INYA 4M22A 1YMUA 3V1YA 4L4SA 1DLJA 2VYQA 3SZUA 1KARA 2CC2A 3W2GA 2PUBA 4K0KB 1OZFA 1AXEA 3VU9B 1VYHA 3U4QB 1UZMA 2A5YB 3HZZA 1D8TA 3QMWA 4R2IA 1VHTA 4XASA 1VLZA 4S1VA 3IVXA 4L7VA 3I0MA 3IX7A 4OBWA 2NPFA 3ES9A 2XE7A 2P4QA 3I58A 1WDTA 3EXAA 1IN1A 4M9RA 5HEKA 1KR2A 3UK7A 2ZBFA 4EA6A 4WNAB 4BECA 1NVVQ 2YC4C 5TMDA 1WQ1R 2R3SA 4HWSA 4R1TA 3ER6A 5EPUA 2FGJA 4ZCPA 4E1AA 2CKDA 2OUIA 3EAGA 4X3PA 3TKAA 1FNCA 1KL7A 1GRCA 3K9LA 2QB5A 2NXJA 4UCQA 1JTFA 4HZGA 4XDYA 4OLAA 3SJZA 4F4FA 3FKQA 1JLLA 1V9SA 1NJ5A 1YHNA 1DBIA 2FUG1 1AQYA 2SHKA 4IIGA 4KAAA 5BNIA 3DDCA 2QLNA 4IDCA 4M0CA 3L1KA 1T6NA 4ZRMA 3GDFA 5G0UA 4RF2A 2XRZA 3OTQA 2CLMB 5JZSA 1V71A 3R9KA 4DQUA 3MB5A 4RVCA 2IXFA 1BKDR 1GG2A 1YB5A 4MS3B 1TM5E 3JVDA 1K7CA 3NBMA 1RTTA 1XFAA 1TW3A 2PMDA 1DWPA 2GK3A 2PSSA 3HACA 1BQ3A 4MYCA 1A9OA 1IBRA 3IUPA 5E6SA 4YQYA 3UK1A 1QRSA 2VPQA 3BVPA 2CHFA 1FP1D 2VOEA 4BNLA 4QYMA 2Q1YA 3GQVA 3QFCA 4ZV9A 2PGLA 2B1QA 3VDMA 5FLXA 4U0JA 1TYZA 2P9QA 1U6JA 4IINA 1U7XA 2AMVA 3TLKA 1DX6A 1I7PA 4D0NA 5CPFA 4TYYA 4ZO8A 5J59A 2XTMA 2F3SA 4BMPB 1W46A 1KPGA 3L0PA 1USWA 2I78A 2KSQA 1ZR2A 3TVDA 3P9RA 1CJTC 1PJSA 1F2UB 1PLLA 1YRHA 2VT3A 4XB6B 3VSDA 3WGNA 2NU9B 2H2GA 3B3AA 1TIBA 1YJ8A 4E30A 3KQLA 2ORYA 1SURA 4K28A 1BXZA 1GRRA 3PPYA 3D8HA 3W9YA 1N7HA 4QUGA 3RTEA 3WJ7A 3QE4A 2F9MA 3QYPA 4I55A 4V0SA 1XNQB 1V47A 3RD5A 5E6RB 5DE3A 1KYQA 4LBYA 2QPLA 1H0KA 4R1UA 1Z6PA 3DOCA 2RGXA 3WTCA 3SFVA 1QKIA 1P4HA 4IH9A 4NY1A 5KREA 4WL0A 3VR5D 1Y7TA 3LUBA 4UU1A 2BF7A 1P74A 1X1TA 3BTSA 1Q0QA 3FTCA 4JLDA 3JD1A 1L7PA 2IP4A 4L4UA 3TMYA 4FS3A 5HIJA 3TUIC 1WDKA 4Q4CA 4KLCA 5IT5A 1LFDB 4OHVA 5DW3A 1N8NA 2WR8A 3CGGA 4X61A 1OKKA 4RV4A 1QONA 3RAPR 3S55A 1OF1A 2O5RA 4Q4JA 1Y63A 2ZIEA 1QP7A 1J56A 1JHDA 2AN5A 5HS6A 2E18A 2LCQA 2QM7A 1ID8A 1HTWA 1Z39A 4M98A 4Z9FA 3IOCA 4F1WA 5B5SA 4K6GA 4BNNA 4G0UA 1QGYA 2VA8A 1NYQA 2B8EA 4R8MA 3T61A 3WWPA 1LPSA 3ADOA 1F4VA 2XNDD 4EGFA 5CITA 9ATCA 3UK6A 3CO0S 5LZ7A 4Y18A 3B9PA 3RT1A 1Z4MA 1T9GS 3FOWA 1CYEA 4FDTA 4RNDB 4B4UA 4OUKX 1C7EA 5HF9A 4MUNA 3A6PC 3SM3A 3EODA 5JT1A 3N8DA 2BMWA 5IXYA 4IM7A 3TRIA 1QH0A 2BZ0A 3F3KA 4PFQA 5FNVA 2HC9A 2YVQA 2NTVA 2Q5CA 5CK5A 2ZWAA 2WPDD 3HBAA 1DKNA 3M6UA 1NUPA 2FQYA 2BSQA 4WXHA 5LN1A 1K3TA 2HU5A 3C1OA 1YL5A 3GDGA 2PCLA 1M6YA 1KI3A 3ME5A 1T26A 3TE6A 2ACVA 5FOXA 2X9GA 4V2IA 4FX5A 1A96A 1YDWA 2C9CA 4DEVA 4ENVA 1E5TA 2OXTA 1T1EA 1UBKS 1FBNA 1N7IA 1V9LA 2BP7B 4MKGA 2V7PA 4F3RA 4YRJA 4Y6QA 4PGGA 1LJ8A 2W8BA 4B74A 1RCFA 3HKBB 4O4LF 3ZHOA 3DDNA 1MB3A 2E7ZA 2EJVA 4NXNB 2YWDA 2ZJ1A 3GLHB 2D0OB 3K9FC 1GFSA 2GJ8A 1T9BA 2B7CA 4XLZA 3B9QA 4I4IA 1YDFA 4YIKA 4E33A 2I7DA 4KQ9A 1ADBA 1DBQA 3EVDA 4I50F 1J90A 1E5LA 2V7GA 2V7XA 5AWFC 1XF9A 1EGAA 1CDDA 1ONBA 4IDEA 3SU8A 2FZVA 3G0BA 1B6RA 1JPUA 3JYNA 4QOHA 1YJQA 3BFJA 4E03A 1LPAB 1L5FA 4DMHA 4G4IA 1FRNA 2RGGA 3I37X 3M8KA 1UP4A 2R60A 4DW8A 5ITSA 2B4RO 1EE2A 1PV2A 2IHKA 2WWXA 1G5FA 1D3AA 1K7XB 1Y8QA 1NBHA 5DU2A 4M88A 1YB1A 4LXQA 5T7BA 2ZE5A 1MORA 1PX2A 1QE3A 5FNZA 2G6TA 1RSZA 4CMIA 2XBUA 3STTA 2WWYA 1CVIA 4TV8A 5ERXA 1I2DA 3VZPA 4QXRA 5BQPA 5DEIA 3QFHA 4EG3A 4EQ6B 2D06A 1JG1A 3CRRA 4D8UA 1ZNXA 1BO6A 1NF8A 3CXRA 5JAIA 1KZ7B 1SRQA 3T95A 2DBRA 4NPCA 2F3QA 4P6VF 4RQAA 3MJTA 5A03A 4NZPA 1YA8A 5ENZA 5CFQA 5CUQA 3VO8A 3R7FA 4WJKB 4C7VA 4W9RA 2IBTA 2QPOA 3VO1A 2OOKA 3SY8A 5L7TA 2DHRA 5HKKD 4UNRA 3KCQA 2Q0SA 1UKYA 3COPA 3TLMA 2TMDA 1RWPA 2KX7A 4DM3A 1PNVA 1V8FA 3BXGA 3FYTA 4RGQA 5EJ6A 4DMGA 1ACMA 1L5ZA 1N2EA 1DCFA 2AUTA 2H08A 3NFRA 5KDLA 3FUUA 4LDPA 3RHFA 4O5AA 4Z51A 3LX5A 4LTMA 3M6WA 4I50B 4BNXA 4KXUA 1KMHB 2CY0A 1ZIPA 3UJBA 4MQ4A 4DS3A 1R0YA 1FF9A 3UHAA 3USES 4B32A 2H0QA 4CTMA 2P6NA 4RSRA 1KSFX 2OY0A 2I6XA 1Z2NX 1PGJA 4DJEC 4G81A 2GN0A 3ELUA 2A1TS 3N1UA 5KVQA 2AD5A 3RUCA 4DREA 1MHPA 1Y1QA 2IITA 4DLUA 1XRMA 4YFYA 1P18A 1WCIB 2AKYA 5AKXA 4PV7A 1XD2B 2J6BA 1PF7E 3MJVA 3FDZA 4K9MA 4J1TA 5DZSA 1URPA 4YROA 4HDKA 3EGIA 3I1JA 2OLEA 2V7QA 2VCYA 2ZRDA 3H1AA 3V1TC 5IP5A 1X9IA 1N34B 1ZUNA 5DOVA 4Z4CA 4DXHA 1NT4A 4EG5A 1ZJYA 1XE3A 3LUJA 1GG9A 1GT6A 2Q6TA 2F3TA 4WCFC 1L1EA 3KJGA 3OKFA 1H5QA 3W0LB 5CLFA 2H1HA 4TV9B 4A4DA 2V97A 3BIXA 3T7EA 5KSWB 4TMTA 5EFZA 3T8YA 1GPH1 2VT6A 2QTAA 4HVAA 4EA9A 2VZ0A 2I2AA 2QMEA 2G40A 3WYEA 4ZAFA 1LLUA 1T9CA 3JQ7B 1FSZA 1O89A 3AZOA 3ABQB 4J1NA 4R01A 1QQ6A 2Q21A 4Q3NA 3EFBA 1U99A 2ZB3A 2OMEA 3BICA 4WK4B 3TKLA 3LQKA 4Z99A 2ZUUA 3DZFA 2YN0A 3QVJA 4U2BA 1LLCA 4IXMA 5CD1A 1CQWA 1XDGA 4F06A 3ND8A 5B7NA 1ZK1A 1CR4A 3I32A 4KAXA 1Z6YA 3HXLA 3KLPX 4MYUA 4ZARA 4S1OA 3OZDA 5L7YA 4W4TA 3A37A 3I6YA 4X93A 4X94A 2CHEA 4C0QC 2Z6QA 3TG2A 2Z2KA 4NARA 3A6JA 4RHEA 2UYCA 5HKBA 4KOAA 1SKAA 3JCZA 5F21A 4RESA 2Q5LA 5K6RA 5B1IA 2BTQA 1ZNZA 4XDHA 4RD1A 5DHPA 2FSSA 1AX9A 3A1EA 4NZ9A 4TTSA 1SHKA 4C3OB 3E61A 3OCYA 1X7GA 2HZ7A 4JBHA 1JIJA 3PX7A 1L3IA 1NVUQ 1P80A 4GD3Q 1YZUA 3ZWQA 1H4SA 2NO0A 3AJRA 4G89A 1I32A 1ZH8A 3WQHA 3GRVA 1WZCA 3EXG1 3NWEA 1P3DA 3EQ7A 4OBEA 2VT2A 1Y0BA 3KJIA 3ZI7A 2RARA 2B94A 3IS3A 4DB4A 2XWSA 3TWOA 4B6PA 5KYVA 2TSYB 2LNDA 1I3OA 2UKDA 2YMLA 3UJCA 1A7AA 3F4BA 3QIVA 5IKXA 4II2A 2ZLBA 1UDWA 1US8A 1JDNA 3ZJ4A 5BR1A 4EAQA 3A04A 2RBGA 1JGTA 3IVGA 1J70A 6NULA 4BZZA 1BKYA 2IP1A 4G0NA 3EDYA 3TKYA 2HWUA 2PBZA 3W5BA 5EQDA 1IZ0A 1QVZA 3VVMA 1KY5A 2EFYA 2PX4A 3OEYA 2PAFA 1OGIA 3C5WP 3ITDA 4OHBA 2R9VA 4P81A 3N2LA 3P71T 3ROMA 3MJFA 4RZIA 2GS9A 3CLTD 3LW7A 3RYHB 1OH5A 3IMFA 4G63A 1JDPA 2AZMA 4Y8VA 4AF8A 3U1TA 2M1XA 3T4EA 3UJPA 5C8YA 1MNAA 1XVIA 2FPSA 4ICIA 3ZW7A 1LFAA 2LTAA 3CZRA 1Z5VA 4DG8A 1F4LA 3MPUA 3ADBA 2CXXA 1UBRS 2XMQA 5EYPA 3A4IA 5KX5A 1WHSA 3DD1A 1Q44A 1VECA 1Z7GA 2NU6A 2OFPA 3NEJA 1QK3A 2JHFA 3EGCA 3LKDA 4JQYA 4ZC8A 3TLAA 4C14A 5CFZA 2I1VB 2V0NA 3KM0A 5REQA 1CZNA 3CLTC 4XH9B 1EFVA 1D09A 4Y9UA 2QR5A 1IHDA 2OP0A 1EE1A 1QTNA 3HB9A 5BW4A 4J3FA 1KYXA 1TF5A 2ZJ2A 1NP7A 3N2NA 3WICA 4C7OA 3DB2A 3ESDA 4M1SA 2ZATA 3JQDA 1L5WA 2ZSUA 5LA6B 1G0OA 2J33A 3E8XA 1M1YB 1E8NA 2MMCA 3LLCA 2CT8A 3HDTA 3OD1A 4MYRA 5KC9A 3G2LA 3A8TA 5AICA 2QLBA 1I1NA 1K5GA 2FK7A 1V1RB 3MAJA 4LJ7A 1AVTA 3HVIA 3JD0A 4TRRA 5CXSA 2CLCX 2ZTMA 3DBHA 3T35A 1WB6A 1R27A 3MMPA 1UIMA 4OM7A 3WNZA 3NJRA 3QXSA 3ZHZA 4WKOA 1IOWA 2A4MA 1KXZA 2QZ4A 3E9QA 1H8EA 3MTJA 4XIYA 1DJOA 4N49A 2ZRPA 3GLRA 4WZ6A 4FI3F 2R7LA 2PT9A 3GELA 4P4TA 4AUMA 5GADl 2V7WA 4LXTA 4E32A 4YXFA 5KTYA 1FVOA 5F9MA 2YWFA 3F6BX 1TT5B 4L72A 2WWVD 1GADO 3CNNA 1J39A 1NNI1 3MM4A 2AJBA 3PDJA 3TIXB 4L16A 3SYLA 1CULC 4CCWA 2HRZA 1IJEA 5JXIA 4U4AA 4DCMA 2VEOA 4M1TA 3VHRA 4KVZA 1KMIY 1MQ9A 1SAYA 3P2EA 4YUWA 1FX0B 2ZCJA 1BJKA 4A27A 3ZWMA 5LPNA 2CNNA 3FCOA 4LISA 1OZHA 3OFVA 1NMZA 4JMLA 4O4IA 4OQFA 2OCDA 4RORA 1FPQA 1JFRA 3NHUA 1DMSA 2VAMA 4XX0B 3R7LA 1OVGA 3LQFA 1Q92A 2FHPA 3WA6A 2GN4A 3VSBA 1MR3F 1LSUA 5IVIA 5IM5A 5HF8A 4P0QB 3N6XA 5AVSA 3ENQA 3L8HA 1FS6A 4YUZA 3Q7EA 1UM8A 3RPEA 1W88B 5T8KA 3VAAA 5KTRA 3ESXA 1SCAA 4F5WA 1QU3A 5C31A 3PSHA 3U3OA 1N1EA 4HF7A 1I4OA 4ABYA 3GJZA 4BN0A 4OHCA 3AVXA 4JWTA 3A6FA 4L3WA 5B3AA 1XMOB 4YNBA 2IF2A 5FEUA 3HEAA 2ECFA 2V6GA 1TKAA 4NBKA 4HLDA 4BX8A 1JDSA 1NFQA 3ELWA 3EQ2A 4MW4A 2JIDA 2WMNB 2HJ9A 2OCXA 5JALA 1YS2X 2VH1A 1WMBA 4D44A 4BO7A 5L3SB 3AXTA 4ZD6A 2YH2A 4BLSA 3DLTA 3GK3A 1U7PA 2CNWD 1PWYE 1S2MA 2IOFA 2KPOA 2OQIA 4H7EA 3IULA 3SYNA 1OH6A 3GEHA 3RC9A 4OY3A 2IYYA 1BWSA 2C83A 3GJ6A 4FUQA 4X6YA 4KPFC 5KKCA 1ECCA 3B12A 1SCBA 3MSCA 1QP4A 5E4TA 3B1ZA 1DXOA 2J85A 1JQBA 2R5WA 1L5YA 4HK4A 4HDOB 1T1RA 1HI9A 1OX4B 4GU5A 3QLUC 1CUCA 1KEWA 4NBTA 4GKBA 3X2FA 3DF9A 3IPYA 1YDGA 2LCIA 3GPBA 3JARB 3E15A 1UKAA 1R6DA 2DBZA 1VFPA 2CGEA 2ZUBA 2PZBA 4UCXA 1JNYA 1SXJB 4M37A 2W9XA 4ZOEA 2OESA 5ARBA 1NYRA 2DULA 4OHMA 1E1RD 4R9SA 1JL3A 1SUPA 1JN0A 2FJPA 2HNKA 3WKAA 1JEYB 2H0AA 5ALJA 4TTJA 5KJFA 1I36A 4BMNA 3J7AC 3TGWA 5KYWB 4DIDA 1WMFA 2I9PA 2KMLA 4D3ZA 1NV8A 2AHRA 3L04A 1F2TA 4V0OA 4NH4A 4UAUA 4B7UA 4C4TA 2MYUA 4QGSA 4RHUA 5ARDA 4E0BA 4WNYA 4ZODA 5I8WA 4I8IA 3L6BA 2G70A 4I1SA 3REQA 4BMYA 3R3WA 2VTKA 4JYZA 1V5EA 4LE1A 1R12A 4MZXA 4G5HA 1TUIA 3V7UA 2Q2QA 2AT1A 3EPRA 4LYHA 1WD7A 1UXHA 2IZ7A 3BCSA 1XTZA 3U3JA 3RSSA 4AKTA 5IK2D 3NXKA 3SS8A 3T1HB 1DHTA 1RHQA 1M8JA 1XI2A 2I54A 4KJZA 5DTJA 5FBQB 3SF8B 3VRHA 4C76A 2DLCX 2J3MA 1SXJE 1F7VA 4OQQA 1BCRB 3O3MB 4G5FA 1PHPA 1WMEA 1PZHA 1AK2A 1JEOA 2BOVA 2FLKA 2VP2A 3D7MA 4QU0A 4AN0A 5FWXB 5LLDA 4N5NA 4AJOA 1D07A 4P8RA 6GPBA 1IY8A 5E7JA 3H17A 1STOA 1UMKA 4MB2A 1KNQA 4HR7A 3HJAA 2JGIA 3CINA 4UKDA 3EA5A 4CV2A 2CNBA 1HYHA 3KJEA 2QVCA 2XCRB 1IPEA 3HL4A 1I80A 2ET6A 3TO5A 4IYRA 3BERA 1PI3A 2IW3A 2XWQA 4MPPA 5ALSA 4ZV7A 5DMHA 4TYMA 4DBLE 2MT9A 4DC0A 3WSTA 3VNUA 5E0KB 4MI3A 3THWA 1Z35A 1RM5A 3HB1A 1CR0A 4KLNA 5DYYA 4DOMA 4D25A 4GM0A 3RSCA 3WNQA 1RLOA 1P17A 5EJMA 2ZRHA 1JVNA 3UOAB 3VSCA 1J4AA 3K3PA 1Z4QA 1TJ5A 1NP3A 2QTVB 2QDXA 3E05A 3K9WA 3DT8A 3UIEA 1N25A 4YRMA 3WZ2A 1FJGB 2JCYA 3TM4A 2QRGA 1NQWA 1XSEA 3EXFA 3R0XA 2ID7A 3G9XA 5ALDA 2PL3A 5FRDA 2QVZX 3V6MA 2GCGA 4UM9B 4BGIA 5JH7B 3SP1A 4JI1B 3DEIA 4IGFA 3ZV5A 1WMAA 3X1KA 4CQLB 4FTWA 4RVSA 2BHTA 2ECOA 2VF8A 3M0EA 1ZCAA 3KYDB 3KAQA 5K1ZA 2F2TA 4K8OA 1CUGA 2PRIA 3ZWKA 2V5VA 3FAKA 2B4YA 2QENA 2AOTB 2HHAA 2Z4SA 2FSVC 4BNJA 2YWXA 3KQMA 4X95A 1M74A 3LBYA 2CNKA 2HA6A 5EJFA 4CEJB 1WOYA 2W4IA 3M4NA 4J4BA 2EFJA 4D9JA 3IQIX 1S6YA 4NBUA 3RABA 1NBWB 2C7PA 4IX9A 1VPEA 4IXDA 1ORTA 3NAZA 4MS4A 1T0BA 3S40A 3SYTA 4NJEA 4Q4DA 4OVKA 2JD2A 1NQOA 2HXGA 3MBOA 5C1DA 3OF3A 1T91A 2D13A 2I62A 3GEDA 4C6RA 1K3UB 3L4BC 1ULZA 1VL8A 1HY3A 3LF2A 3KQTA 4ML3A 2YJNA 1K6MA 1XCBA 1JDUA 1HT0A 1YBVA 3QKRB 1I1QB 4B3CA 2GRUA 4B76A 4Q9HA 2V3WA 3IMEA 2R8EA 4FZJA 2MHCA 3O3CA 1KDOA 2FMIA 5JSQA 4KGXA 3LQRA 3MWGA 3WRYC 1KO8A 3DZHA 4C0SA 1HL7A 1XZKA 2VXCA 3I34X 3I4FA 4YV7A 2ES4A 3BRCA 2Z2JA 3IV9A 1THTA 3JD4A 4XGKA 4V02A 4ZCQA 4BLOA 1ZU4A 3U62A 2VJDA 1A7UA 2Z08A 5CYGA 4LNUA 5CX1B 2P9EA 1BRTA 1XZQA 5EHQA 1SIOA 2BM9A 2J87A 1L7OA 1JFFB 5DP2A 5SY6A 5HOQA 3DL0A 3OY7A 4N41A 3UJ6A 3VNSA 2ODNA 5JIBA 4O1HA 5IJ0B 3STVA 1V5WA 3SDBA 3DHEA 3KQQA 1PL8A 4IIJB 1QX3A 2FNAA 2PXXA 1M8PA 1ZUHA 1Y8RB 3FNQA 4UVHA 2O7RA 1DC6A 2XQKA 4WZBE 3A1SA 1SVLA 3NRCA 3Q72A 2VNAA 4HDNB 1ZNQO 1CT9A 1FUYB 2GPSA 3OOWA 5GOZA 4L75A 1QF6A 4KQJA 3OE5A 1KDZA 3EN0A 1GXSA 1C30B 1ZH4A 4E5YA 1UEXC 2V8OA 1GKUB 4ARSA 5CU7A 3DH0A 1JA0A 3IE0A 1QTRA 5IN5A 3SX2A 2YYZA 4EUNA 1CUEA 3AFIA 3Q7RA 4H7HA 2GAIA 4MWCA 2WEKA 1R00A 1EYZA 2HLHA 1TYDE 1HPLA 1WL8A 1MXHA 1EJ0A 3EGXA 4GYJA 3I6BA 4EFDA 3LT0A 1DJNA 3P96A 3VPXA 1H2FA 1XQ6A 2SKCA 3JAWB 3KZKA 2VYNA 2OGSA 4EFNA 1QO0A 1QUEA 4QU5A 1NLYA 1NJ1A 1ZH6A 2XMSA 1NIJA 2ZB4A 4BMDA 2Q99A 5J4VA 1JEQA 1QLWA 2B3DA 5CT9A 5EGNA 1J6UA 3TBHA 1LVGA 1MVOA 3GRKA 3EY4A 3ND7A 5JOQA 5FUVA 3S2EA 1IVNA 3FMPB 6Q21A 5BT9A 4NCJA 3T6KA 3GZNA 2BEVB 4JR0A 3Q10A 2W8ZA 5FBHA 5ILOA 4UVIA 2FLWA 1DE0A 1IHOA 2XE8A 2PD4A 2XB2A 1BN7A 2YFYA 4X1KA 5DGCA 4DDKA 1ZXLA 3V80A 5JAZA 2H1WA 2FZ4A 1LXCA 3MGAA 4XWKA 1TD9A 4DV7B 1L5VA 3UT5B 1E89A 4L5JA 4OKNA 2HF7A 3LW8A 4FFDA 2RK4A 4L4RA 3H1BA 5M3BA 3TSCA 1AGPA 2LRHA 3L07A 2UZIR 2VJAA 4YMIA 4EA8A 2C77A 2CFIA 1T5BA 4G9BA 1N7JA 2B98A 2DY1A 3BWEA 3EAFA 4RYDA 4B81A 3I9LA 4WINA 2J3IA 2GD2A 1ISPA 1CNFA 1PVDA 3W7AA 1V43A 3P9IA 1ODIA 4JLOA 1OFHA 2Y1LA 4YAUA 4CQNA 3F5MA 2CFOA 2CNDA 4J0IA 4RJ2A 3WDLA 2P5UA 4DT1A 3I9V6 1YQWA 4LDJA 3RB8A 4KVGA 4EB6B 4J9VA 1QQBA 4HWPA 3TIIA 3DMGA 5T4FA 1KTVA 4B5LA 4E46A 4RTNA 3WGJA 1C2TA 4B4KA 1YE5A 1APBA 3QYFA 2OHGA 3EA4A 1MQAA 3FPFA 4OL0A 4Q3LA 4XZ3A 3U9SA 5JV5A 1QH8A 2P3QA 4II7A 2WHYA 5JD5A 4CKBA 1SVMA 1X39A 2NZ2A 2FQXA 5BW5A 1L3BA 1HETA 2FPPB 1B8NA 1C7QA 1Q3HA 2GK7A 3ORRA 1MO4A 2KLBA 1QAQA 4BB5A 4EI9A 1N32B 1K27A 1TQ4A 1P44A 2F3PA 3BFPA 3M6AA 5FPHA 3RRXA 5AI5A 4AJLA 3SHQA 1TYEB 2E4ZA 2IZZA 2C2BA 3R7DA 3L4KA 5JJIA 4UAGA 4C0LA 3OIGA 1SQFA 4TMKA 1LVHA 3R40A 3KB6A 1OXSC 2CDRA 3SJBA 4F91B 3HL0A 5JCJD 5GZ3A 3IJ5A 2JKYA 3U26A 3IBTA 2G3YA 3OO1A 1K8ZB 2OV8A 2VCHA 4NONA 1SVSA 1C4WA 3UFBA 2KWIA 2HLPA 1TQ6A 3DB1A 2CDCA 2A9PA 4FLFA 4ZYVA 3N87A 4KXFB 2C5AA 4Y9RA 2MMGA 3Q85A 4ZYZA 3GUHA 4PTLA 4O63O 1FLVA 4UJ3A 2XT9A 3WVNA 4O2LA 4PN3A 1Q0HA 3PK0A 4UQPA 5DBHX 1WPRA 4MIOA 2IYWA 3UW1A