2XVMA

Crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sah
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
AMVIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWERVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TELLURITE RESISTANCE PROTEIN TEHB
publication title Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.1.1.265: Tellurite methyltransferase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2xvmA00
5K03A 3DXZA 3KQOA 4MWZA 3SM3A 1EQAA 3UJ7A 1DUSA 3A25A 2UYQA 3NVKI 3G89A 2Z6UA 3VSEA 1O9GA 4R8SA 2G1PA 2IBTA 1NW7A 1UWVA 2AN4A 3B5IA 2VZ9A 2OY0A 1RJGA 4U7PB 2ZWAA 3NDJA 5FTWA 3T7RA 5ERGB 4DZRA 3CGGA 3DMGA 3PFHA 3BWCA 4F85A 3M6UA 4IWNA 3E05A 1T43A 3CJRA 2PBFA 4OBXA 4BLWA 3BWBA 5ICGA 2FYTA 3OFKA 4OQEA 1XCJA 2OXTA 1VPTA 4PYJA 4PINA 5MHTA 3LDGA 3LKDA 3TPZA 1IY9A 4GEKA 4PYLA 4R6WA 4PCLA 1M0EA 4R05A 2ZSUA 2CKDA 3CBGA 3PS9A 3ANXA 2AOVA 1WG8A 3GJYA 3EPPA 3P2IA 4FSXA 5CVEA 2BH2A 3TRKA 3H2BA 4FR0A 3UWPA 2PY6A 4AZTA 2AR0A 3NDIA 4A6EA 3G5TA 3FTCA 3GWZA 5E2BA 4PNEA 4GC5A 4P7GA 5C9ZA 4MHTA 3TM4A 2AOUA 2HTEA 2PXAA 3T7SA 3GNLA 3GRZA 4YUXA 1X1BA 5GM2A 4C04A 5ICEA 5E1MA 2JHPA 1I9GA 2JH9A 2PX2A 3JWGA 3M33A 4FT2A 2GPYA 4QDKA 10MHA 3IEIA 3FPJA 3LL7A 3HA3A 4MQ4A 3G5LA 3B7PA 4YV0A 1KPHA 3UJDA 5HFJA 1XCLA 3P2KA 1QAMA 1QAOA 2O57A 2P7IA 3ELWA 3NJRA 2PSSA 4LECA 4PYOA 3SR4A 1KXZA 4IV0A 1SUIA 5K01A 2EFJA 5K0FA 1ORHA 5M5BA 2PWYA 4PONA 2Y1WA 4RTJA 3HEMA 3UZUA 2GH1A 2K4MA 4RTRA 5K0BA 3BKXA 4KDRA 3OE5A 4RWZA 5U4XA 5E1DA 2ONYA 2EX4A 3EGIA 2NP7A 2Q41A 3HVKA 3K0BA 4UOEA 2IH2A 5E9QA 2ZLBA 2FK7A 3P97A 3LPMA 1WZNA 1PJZA 2JH8A 3DULA 2DULA 2P3QA 4GC9A 4HTFA 4A6DA 4RTQA 5T64A 3VYWA 5DLYA 4POOA 1Q0SA 4GF5A 1KR5A 2B25A 5FQNA 3SVZA 1AQJA 5HEKA 1JG2A 3Q7EA 4E70A 3KQPA 2ZZKA 4KDCA 3WSTA 1P91A 3SSMA 3FUWA 3NMUF 4CTJA 2I7CA 3DP7A 5EIWA 3D2LA 4WXHA 1RJEA 4E2XA 4ER3A 5E8JA 2V74B 3FUTA 4PGHA 4E33A 3BZBA 4RSRA 3KQYA 5EPEA 2AZTA 5KQSA 5GWXA 3EVDA 2XVMA 5LQRA 4X61A 2ZBRA 2NNWB 4V0QA 4WVLA 3AXSA 3E23A 3HP7A 1VIDA 1SG9A 3VC2A 3RW9A 5EMMA 3GU3A 4YMGA 3F4KA 1L3CA 4AZSA 2DPMA 1BC5A 1D2CA 3PX3A 5E1OA 2AN5A 1VQ1A 4ISCA 5LQJA 3EEOA 1SVUA 1G8AA 2PJDA 4PYIA 4QVGA 2PKWA 2WK1A 3KR0A 3PT9A 4ER0A 1G6Q1 3DMFA 3DUWA 3EVFA 1YZHA 4Z2YA 3KQSA 2HMYB 2IH4A 2AVDA 2G71A 4QQNA 4L7VA 4C4AA 3UJAA 2O07A 1KYZA 2VS1A 3RODA 1AV6A 3DTNA 3KPVA 5FUBA 5ICFA 1ZHFA 4EK9A 2C7OA 3FRHA 2PT6A 3R6TA 3DMHA 2OZVA 2QRVA 1G38A 2ERCA 1G60A 5GM1A 4BP1A 1YZ3A 3B3JA 2NYUA 3PVCA 1RI2A 2PV0A 2ONZA 3HVJA 2WA2A 5EMLA 1XDSA 3HA5A 1JTFA 2ZBPA 2G70A 2GA9A 1X1AA 5LQCA 1RI1A 5DSXA 2UZ4A 1INLA 2ZZMA 4RTSA 3HTXA 2BZGA 1B42A 2PT9A 3TKYA 1Q0TA 4GOLD 4C07A 2P3LA 4RV9A 3HVIA 1YUBA 2N47A 3LECA 4C03A 1JG3A 2PLWA 4YV1A 1N2XA 4FZVA 3LCCA 3M6VA 2ZBQA 3S68A 5GIPE 2FK8A 3BT7A 4CWAA 5KYGA 1DCTA 1L3IA 3FPFA 5E2AA 5T67A 1NBHA 4GQBA 3FTDA 3I58A 4Y2HA 2G8NA 3TMAA 3G7UA 3LHDA 2AS0A 5EHGA 2IP2A 3MTIA 5E9WA 4AZWA 1FP2A 4BLVA 3KPYA 3OCJA 2C7QA 4KIFA 2EJUA 5IKMA 2IH5A 1N7IA 2FCAA 1F3LA 3BUSA 2ZW9A 5CVDA 3QOXA 4YUZA 1JR4A 2YR0A 3HCCA 3MB5A 3TLJA 4PCAA 5LR6A 1YB2A 1R8YA 3LBFA 3DLCA 3P71T 2XYQA 4XUCA 4AZVA 5HZMA 5CUQA 3LSTA 5CM2Z 4EQZA 2YVLA 1JTEA 5DXJA 1N7JA 2B78A 2FHPA 2H11A 5C1IA 2PGXA 3MAGA 2HNKA 4DKJA 3T0IA 5EMKA 4C06A 2E5WA 2WA1A 3BGDA 4ER5A 2JG3A 3GO4A 5FADA 4YMHA 4GBED 3GGDA 5BXYA 5CD1A 2AOTB 2NXCA 3EVCA 5EG5A 1X1DA 5EEHA 3SMQA 4E32A 1L1EA 4H0NA 1TW3A 1SKMA 5DX0A 1JQ3A 5BW5A 1FPQA 1FP1D 4CKBA 4DCGA 2B2CA 4QTTB 4YUWA 1JG4A 4DCMA 3P9KA 4RTKA 3PB3A 1EJ6A 3NVMB 1VE3A 2H00A 4BLUA 4ATNA 3BXOA 4PGGA 9MHTA 3TFWA 2XYVA 4K6MA 5JR3A 3KQWA 4YUVA 4RTPA 4KWCA 3JWHA 3P9IA 5EEGA 3G8BA 3ELDA 4FP9A 5DM0A 4HG2A 3MHTA 2BM8A 1IM8A 5EMJA 5F2NA 1RI4A 1YF3A 3M6XA 3KQVA 2P1DA 1QAQA 4PIMA 5DTMA 1L3BA 1U2ZA 1IXKA 3C3PA 3KQMA 2Z6QA 4OX9Y 3THSA 3KKZA 3M4XA 2HWKA 3ORHA 4MTLA 5EVJA 5LQUA 3ER9A 2Z6AA 5HIKA 2CWWA 4P7FA 3A7EA 4RTNA 1BHJA 5EHIA 1NW8A 3EGEA 3FYCA 2IDKA 3P8ZA 3FZGA 1JSXA 5DTQA 5G02A 5C0OE 4LWOA 2QY6A 1SQGA 4JXJA 2ZIFA 2NXEA 3M70A 4QTUB 1R18A 2UYCA 2QYOA 3P2EA 2YQZA 3G8AA 4HC4A 2P8JA 3RIEA 1VP9A 2NP6A 1ZGAA 5EKXA 2IGTA 2C7RA 1Y8CA 5FA8A 3NWEA 3ELYA 3PX2A 3OPNA 2O0LA 5CVUA 4E2WA 2GAFA 5EZQA 5HIIA 2A14A 3AXTA 3HCBA 4LWPA 4RVFA 4EMSA 1D2GA 4XCXA 3E8SA 5ICCA 3GRUA 1TW2A 2HV9A 3OU2A 5KS2A 4FGZA 3SSOA 1RJFA 5EQJB 5DTRA 5K0EA 3UA4A 3IYLW 1G55A 4OA8A 3OZSA 4RX1A 5K0NA 2IIPA 4DQ0A 4LG1A 2NXJA 2P41A 4ER7A 1R6AA 3EVBA 3FUXA 1FBNA 5KQRA 1D2HA 4R8RA 3G2PA 2PX5A 4RVDA 2I9KA 1O9HA 5K8VA 3BGVA 3MGGA 4R6XA 1HMYA 2EJTA 3CJQA 4BY9E 3CCFA 3LBYA 1KIAA 1ZGJA 3LCVB 1NW5A 5E1BA 1QYRA 1WXXA 2PXCA 3UJ6A 2ZIGA 3LDFA 2IFTA 4AX8A 5D1NA 2CL5A 1SUSA 2QM3A 5DT2A 5FWDA 2FRXA 5FQOA 2PX4A 1NE2A 1WY7A 1G8SA 1WXWA 3G2MA 3G88A 1XDUA 2PXXA 1JQDA 3B3GA 3FUUA 2P7HA 3BWMA 4OA5A 5DX1A 1Z3CA 4EKIA 4XUEA 2ZTHA 4IV8A 1ORIA 3DLIA 3DXYA 1XJ5A 2OPBA 3DH0A 3OFJA 4X60A 2P35A 1UIRA 5D1HA 5EZSA 5F2OA 3E7PA 3TKAA 3MCZA 5CIYA 1EIZA 4OQDA 2OO3A 4HGYA 3C6KA 1HNNA 1KYWA 2XVAA 4P7KA 8MHTA 5HOQA 2BM9A 4RVGA 2JHCA 5HIJA 2LD4A 5FHRA 5IH3A 3SGLA 2YTZA 3UBTA 2PVCA 3HCFA 4EKGA 2R3SA 3OU6A 3HCAA 3I5UA 5DM2A 4DF3A 5DPMA 4B17A 1YFJA 1NW6A 4PYNA 1F38A 3C0KA 4Y30A 2ZVJA 3OZRA 1RJDA 1XVAA 1KP9A 2JHAA 5HILA 4AUKA 5LSAA 2ORED 1AQIA 3FUVA 3R9XB 2AOTA 3HCEA 3EVAA 3HM2A 3ID6C 5HIMA 1YFLA 1P39A 1NW3A 5LQNA 2B9EA 3FTEA 5DXAA 3LDUA 2ZULA 3A7DA 1QZZA 5K0CA 1EAMA 3G2OA 3P9CA 4M36A 3TQSA 2QE6A 3SX0A 4QQKA 5DRTA 3B3FA 4F84A 2CMHA 3L8DA 2ZFUA 4MIKA 2GB4A 5DRYA 2GS9A 3FTFA 3EMBA 3M6WA 4DA4A 1OR8A 3K6RA 4X63A 1ZQ9A 3FRIA 3TOSA 3P9NA 4RYLA 3UFBA 2BR3A 2AOXA 3OZTA 5GINE 2VP3A 1TPYA 2O05A 2I62A 3EGVA 1SQFA 2AOWA 3GRYA 3R0QA 2CMGA 5K09A 2ADMA 3DXXA 1XXLA 3KQTA 1L9KA 5GOZA 4CXMA 1RI3A 1ZKDA 2Y1XA 3C3YA 2OBFA 2YXDA 2PX8A 1EG2A 4HH4A 4O29A 1R74A 4HSGA 3KHKA 5LQKA 4FS8A 5DM1A 3UJ9A 3PTAA 3OE4A 3OU7A 3FPEA 4PWYA 3TR6A 3CJTA 3R24A 3THRA 3LKZA 3C6MA 4F86A 3MERA 3KU1A 5LQAA 1PRYA 5E8RA 5BP7A 1NV8A 1NKVA 1AF7A 5E9JA 5FULA 3UA3A 4C08A 3NW9A 4RTLA 2UYHA 3FPGA 4P58A 2YXEA 3MQ2A 3VC1A 3B89A 5CCXA 2VDVE 3BGIA 3JWJA 5CCBA 4DM3A 5KVAA 1FJXA 4E31A 3X0DA 4RTOA 4QPNA 3V97A 4DMGA 5H02A 4M7RA 3NTVA 3QV2A 1EJ0A 4U7TB 4E2ZA 2YX1A 4PYMA 5B1SA 4BP3A 1P1CA 3HCDA 3HNRA 4P7JA 4KW7A 3I64A 2KW5A 3ME5A 2FPOA 2NXNA 3IHTA 2OB2A 3R3HA 3GCZA 5DM4A 4G56A 2IPXA 4KVZA 2GLUA 2AOUB 3JWIA 3DOUA 3SXJA 3TM5A 4E2YA 1RI5A 1KHHA 3KR1A 5EC8A 3BWYA 3EEYA 1VBFA 3G2QA 2BR5A 3GIWA 2O06A 1BKYA 1VL5A 1R00A 4YUYA 3LX6A 1M6YA 3BKWA 4XUDA 1V39A 1I1NA 2ESRA 2B3TA 2EG5A 3REOA 3LCUA 1H1DA 1QANA 1VLMA 3AWIA 4FSDA 2IDJA 4PYKA 1NV9A 2AVNA 5K0GA 3PFGA 5CVVA 4HGZA 4CKCA 1P1BA 1XDZA 2BR4A 3MTEA 3T7TA 3V8VA 2OYRA 3ER8A 3HVHA 2F8LA 5K0JA 3UJBA 2IBSA 2P3OA 4KRGA 3SSNA 1NT2A 4GOMD 2ZZNA 4YV2A 2XYRA 4GOND 4X1OA 3I9FA 1JQEA 1NBIA 2R6ZA 4HTFB 4RTMA 1MHTA 3KR2A 1KPGA 4OBWA 1MJFA 4HRAA 5FCDA 4ZTBA 2ZCJA 2ZWVA 3FYDA 3KPUA 1JSZA 5FWAA 2UYOA 3KR9A 3Q87B 1R8XA 4M38A 1JG1A 4NECA 4E30A 3GXOA 3KPWA 5K0LA 3ERCA 5EOVA 3PLAE 3GRVA 4PYQA 4FT4A 1VP3A 3EVGA 5BW4A 5F2KA 5FHQA 3AY0A 4QVKA 2OKCA 2C7PA 2P40A 4M37A 5EGSA 1UFKA 2V7EA 3A27A 3UJ8A 1X1CA 2H1RA 5DX8A 7MHTA 3GDHA 3LGAA 4KIGA 4RVHA 4X41A 5CVJA 5P8WA 3NWBA 1DL5A 3O4FA 5GP1A 2OB1A 3A26A 3AJDA 4CKEA 1X19A 5DSTA 2XBMA 3FPHA 4QPPA 5DWQA 2ZIEA 5GIOE 4GOOD 5K05A 4GUAA 4ER6A 1WS6A 2YXLA 3QOWA 1I4WA 3A4TA 3EVEA 4QDJA 3UJCA 4IKPA 1ZG3A 3EVZA 3GRRA 1M6EX 4PIPA 2AN3A 5EKUA 2JJQA 1XTPA 1KPIA 2PWPA 2YUIA 4V0RA 2HR1A 2VDWA 3I53A 1O54A 5T6BA 1BOOA 3O7WA 3KPJA 3ELUA 4C05A 4EVIA 3CC8A 3HA7A 3DR5A 2VDUE 3CKKA 5FA5A 3U81A 3IV6A 5JUWA 3O31A 2G72A 2I6GA 2QRVB 3MCTA 5EIFA 3KQQA 4CTKA 3EMDA 3CVOA
chains in the Genus database with same CATH superfamily
1RZ3A 5JI3E 1LPBB 3CE6A 1OX6A 2JLSA 1X7XB 2XLBA 2I78A 1TTTA 2BKXA 4GLOA 4ZVUA 3X1ZA 1QIHA 5J2TA 3IV7A 1WCXA 3OFNA 2CLDX 4K28A 1ISJA 4BVGA 3DTYA 3IUQA 3LIIA 3V2UA 2C3OA 2AE1A 3CGGA 3MGBA 1Z4QA 4E4RA 1B4DA 3E05A 4LBWA 1M0TA 4N65A 1B00A 1PFWA 2JI8A 3A9VA 3SXPA 4L51A 1JILA 4KB5A 2ATVA 3JX9A 5FWNA 5G53C 4DVGA 4LMAA 1I1OA 4PYJA 1NJ6A 1OBVA 3D3EA 1GL6A 1YC2A 3T9FA 2QS9A 5EJ4A 3MA0A 3CF4A 2CKDA 4MRRA 3FWPA 4L28A 4P8RA 1TMOA 3EPPA 3WK8A 2BGGA 1CF9A 1Q2XA 2P2SA 3UK0A 5J4YA 1NY5A 3WJAA 3QXXA 2F3QA 3OJ0A 4RHUA 1OASA 3WHLA 1CP2A 4O3MA 5E2BA 1TMGE 1XRJA 1N5JA 3QW2A 2BVNA 3AUSA 4H1UA 5JMWA 1G59A 5KQPA 1T5LA 2PL9A 3ACDA 4MRMA 3VPBA 3Q3JB 1YH3A 3E1GA 3V6MA 3NALA 4QG3A 1JHMA 2VYND 3P45A 2G80A 1VI5A 3RRBA 4J7XA 1N8TA 4EGCB 1YA8A 4UM9B 1EA7A 2PVSA 3ZHTA 2G4CA 4Z54A 1WTCA 3OM1A 3N70A 3C8DA 3QFRA 1XVUA 2R47A 4A3SA 4ZOLA 4AZ0A 4YAGA 1Y5MA 2EFJA 4EHAA 2CDAA 1RRVA 5I7VA 1VFNA 1R8QA 2Y1WA 3NHMA 3V1KA 5FOVA 4H7KA 2KQUA 4KXNA 3U4MA 3AR9A 2GEJA 3HO6A 5K0BA 1A2BA 5IYZF 1SC4A 1LY1A 2P9CA 3P9YA 4GS5A 4CYMA 2W4IA 1QYWA 4NJEA 2WD8A 3SD7A 1N78A 2E4UA 1EWYA 2HIMA 3LPMA 4L15A 4TLAA 2ILVA 3NC0C 5D5HA 1E7QA 3M9LA 2C4HA 3EZLA 5DLYA 2BBOA 1NFFA 3VBCA 1IN5A 3IDOA 4B7XA 5CLGA 1E9EA 2GI4A 4OYLA 1O94C 4KDCA 4UDYX 5EINA 5HJEA 2I7CA 4EFLA 1DOZA 3CB2A 1WHTA 2VZ8A 4PW0A 4PSVA 3A8TA 4DL9A 4ZJZA 4H16A 1W46A 3A2NA 3OOYA 4U7GA 5JXIA 1VPEA 2PUJA 2G1AA 4R9NA 3ZIUA 1YB4A 4MV4A 3KQYA 2BLLA 4RDHA 2GKOA 3D43A 2XVMA 1J9EA 4C7MA 3CBQA 1DJOA 4C7KA 4HS9A 3QLUA 1M2VA 3AXSA 3TLXA 2UUBB 4CL0A 1U1DA 1MW8X 2C2OA 1DXHA 4LGVA 1PK7A 3H87A 4Y9TA 4XLZA 1L7AA 1V3VA 1GPJA 2HJHA 1Z22A 2EW1A 3FE2A 4LYDA 4JY7A 3WWCA 1G3QA 1MAUA 2JVIA 4MJ3A 3DMPA 1J0CA 4GX0A 3VTAA 5AW7A 1LSJA 3R0IA 4A8PA 5J58A 2XF2A 1JT2A 2DERA 1SBHA 3GRCA 3K8OE 5FFFA 3UMMA 4DMHA 1LK0A 1KBZA 3NAMA 4G1MB 2X6QA 5DW0A 1N9GB 1T9BA 4MLPA 4PSKA 4HV4A 3JQAA 1P72A 2VUHB 3ILXA 4HN2A 3BXZA 4RGYA 1UBEA 3QE3A 3DBRA 3QEOA 5CXXA 3ZHCA 4E09A 2BM1A 2ERCA 4O1HA 2ZG6A 3UT5B 2B7CA 4RUKA 3AOEA 4HGRA 4OAPA 4UARA 1J8YF 3FCOA 3F6RA 4K8OA 3I72A 4R9UC 2MDTA 1ACMA 4UATA 4D8YA 1HZJA 4NNJA 4Y9DA 4BASA 5ADVA 5KTOA 2BI4A 5JFOA 4IJ5A 1WF3A 2NUAB 2WVHA 3DR3A 1KMCA 3TKYA 4GKKB 3OLQA 5HFNA 2XZOA 1G8HA 4RS3A 1L4UA 2VT2A 2XBUA 1JEYA 2PRKA 4N0QA 4YREA 5FOQA 5ALOA 4J0QA 2BF4A 4LZLA 4XX0A 3S68A 2FK8A 4F2DA 3A06A 2XB6A 1ZIXA 4C0BA 3DF9A 1CZKA 3ZQUA 1G9TA 5ENDA 3HVRA 3HUFA 3FTDA 3OOEA 1DAIA 3PFFA 5CDHA 1YCGA 4UCFA 4BNMA 5L6LB 2D2IA 2Z30A 2PT7A 3V4FA 3IA2A 4KIFA 1ISRA 2CNKA 4LE1A 5DJ5A 2ZWIA 4BVKA 4QXOA 4DCVA 2ZW9A 1JBKA 2Z2XA 3BBLA 4G5GA 3ZWOA 4I2NA 2H4JA 3HCCA 4UW9A 2Q7DA 3DPSA 3MWFA 4FFLA 1R8YA 1NZJA 2WYVA 3A4VA 3ZW8A 2FMTA 1RZVA 2N3ZA 5IANA 1XZPA 1M8KA 3DEHA 4MR8A 2JGDA 3NCHA 3SC2A 5A3RA 1FVXA 3I8XA 4FUTA 1Z12A 3QRWA 5LMUB 4A0SA 1FUEA 3SF0A 5A4MS 1KY2A 4M9QA 3C3XA 5EYPB 4YJ3B 3RC1A 3W79A 1KEPA 3RRZA 3ZXUB 1YFKA 1II9A 4B3HA 5TY0A 1OX5A 4D26A 1R9MA 2I6QA 1ZJ5A 4YMHA 3DDZX 1II8A 1JA9A 3CX7A 1MRSA 1V16B 4JFAA 4HMQA 1Y5RA 3IR5A 5LQSA 1HL7A 4H0NA 5AKZA 1E94E 3JR7A 2GXAA 3LLSA 1WUIS 4JGBA 3ZHOA 4TTRA 5JG7A 2AQHA 5FAXA 3BA6A 2VRBA 3K9LA 1LA2A 2XBLA 3QMPA 4A8JC 1QYDA 3E3AA 5CU7A 2V6JA 4HPWA 1H6DA 2GBLC 5CB0A 1ZRMA 3UB4A 4L2IB 1UBCA 4C7VA 2F9MA 4ERXA 1WZUA 2GPWA 1XRSB 3VU0A 4ZKDA 3H11A 1Z37A 4FEEA 4OSPA 2O3UA 4BFXA 3PBKA 4E5NA 2QNIA 1GYPA 4RHTA 1JQ5A 1YKFA 1LX6A 4HG2A 1OXVA 1ZJJA 3JPWA 3N7UA 4M0CA 2YMMA 5JAMA 3MF4A 2FEXA 2CNWA 3ANLA 3M6MD 3QWIA 4KAFA 1BX3A 4OD0A 2EZ4A 1L3BA 2CXNA 3PFWO 5JCXA 1EXDA 1CC1S 4OX9Y 2OXIA 1DXQA 4KQJA 3QVOA 3QTTA 5EVJA 4N0EA 2IU3A 4I6GA 1IEXA 3ER9A 4YT2A 3I45A 4ZRMA 3RS2A 1CY8A 2HV8A 1ZSYA 4OAQA 1X7ZB 2ZAYA 1YL6A 4BLQA 1KEUA 3P8ZA 4O0LA 2E6KA 2VTEA 1P6UA 2CHGA 3OQNA 3S6JA 4BAZA 2XCOA 2YHBA 5JNRA 3FLAA 2IHJA 4BLSA 2BL4A 3GJRA 1LI5A 4X93A 2EWVA 3WHPA 1Z2OX 3LBAA 1WKCA 3BHIA 3GVIA 1DRKA 4CCAA 3OBBA 4NXMB 4AZ3A 5EZQA 4HBZA 5TV2A 2Q1TA 3D8TA 5LCXA 3GCXA 1P8JA 4UUBA 3COJA 1D8AA 2D74A 2O52A 3P32A 4OG2A 4UBKA 4FGZA 1QO0D 4ZJPA 4M76B 2XCSB 1DS6A 2RGNA 1H93A 3EQ7A 3IB3A 1IY2A 3K6KA 4PBTA 3UA4A 4QXPA 1L8OA 3D81A 4WNYA 1ZGGA 1WUHS 5I51A 5LYJF 1JR6A 4Z53A 5AW2A 2XQJA 4LWZA 5LC1A 1YAJA 3O74A 4JLUA 5LXTA 2O2GA 4X1KA 4ZO6A 1PJRA 4RZ3A 4BN4A 5LDHA 3AEQB 5LP6A 4Q3CA 1FF9A 2GYWA 1N2CB 2V54A 2EJTA 1LPNA 2RGYA 1HY3A 4FDLA 3GZNB 4HNQA 3WYEA 2GSWA 3FDZA 3NH6A 1P0PA 3M4NA 1MABB 4ND4A 1HETA 4ZXPA 4CR6A 1YI0A 2I1WA 4KLAA 3IUBA 3QFFA 2DHRA 4LY6A 2B30A 3GFTA 5H7XA 5MFZA 2PUWA 1W4RA 5LYJB 2FRXA 2Q99A 1BDIA 2QJRA 4DGSA 1H3NA 1YMQA 1KAQA 4TKUA 4G41A 1YCHA 1KEEB 4W5QA 5A7GA 3AETB 2H1OA 2CD7A 4ES6A 1EXWA 1X7WB 1FXWA 4C6RA 3SEFA 1T2AA 1XJ5A 3UXHA 2VCEA 3LE8A 3RADC 5KOJA 3P5SA 5AK4A 2OHXA 4Q00A 5CIYA 1IJKA 1EX7A 3SLKA 4C0KA 1UBTS 2Q8NA 4QREA 1D6NA 2ERYA 4P2BA 2VQEB 2DTXA 3B48A 4GKJB 2DC1A 4RVGA 4CKZA 1MC1A 2DFPA 3RC2A 3UHOA 3ZHRA 1WZCA 2FPKA 2W2TA 5BMOA 2PVCA 3GA5A 4O3FA 3I5UA 2J5KA 3DHEA 5FWYA 3H18A 3CLUD 2HDWA 3N76A 2NYVA 2HJSA 3TNJA 5C81A 1RJDA 2F1OA 1GEGA 2AN1A 3HI4A 2GZDA 5F21A 3ZU2A 1OVMA 1W44A 4MJLA 3A6KA 3FMPB 3HKBB 4IVNA 4YK7A 5LQNA 3DOOA 3RJMA 1FJHA 2H1CA 2IZ6A 3FM9A 4MVXA 2IU4A 4GOXA 4WCFC 3T6KA 3ZWCA 3ZJVA 1QZZA 1U98A 5HJ2A 1KMIY 3G2OA 3L49A 3DPIA 3IAFA 2FJUA 3PPXA 3A6EA 5JJLA 1SCKA 5JISA 3PNMA 3CA8A 2JKZA 2OGSA 3WBJA 5AUOB 1YVDA 5KNBA 5GZ1A 1XZGA 1XVTA 4XZ3A 3OM0A 2PGDA 3T5AA 3TJRA 2DAPA 1E2FA 2P9HA 5KU1A 4CMAA 3O8OB 3UFBA 3EIXA 4FYWA 2AFHB 1QCCA 3JYNA 1R15A 4GU5A 1TPYA 2NO9A 1I4EB 3NBUA 4NBSA 5E4JA 4OUDB 1CZUA 1JLHA 2ZYAA 5A9TA 4J7AA 3RTEA 3HA2A 2CMGA 5DEIA 3T8YA 3WV4A 1F60A 3QNWA 5D8DA 1H8HD 1CR4A 3RSQA 3ZUGA 4PLVA 4Z4HA 3JSXA 5E4FA 4Q3KA 3OC6A 3STYA 3C3YA 5TQ2A 2R48A 3BPSA 2F2TA 1D0VA 3L8FA 2DE0X 4XVHA 3OU7A 2HM7A 2W98A 3FPEA 4N5IX 5A5GA 1X38A 2Q0HA 3I0NA 1EM6A 1RABA 1WB6A 2FY8A 2FSFA 3R24A 5EE3A 5JYDA 2YJZA 5GONA 5LLSA 4OB6A 5LA6A 5KC9A 5JTTA 2PSFA 3EZYA 1IK6A 2QG6A 4XJXA 1YNOA 2VWQA 5FFNA 3OY2A 2OK7A 1V8DA 5FV7A 5L51A 2O8EB 1D9XA 1UEXC 1YQWA 4EFMA 3H4TA 4EHDA 4XD2A 4FBLA 1TJ4A 2A5GA 1B16A 2ZBDA 4Y3UA 4HK4A 4CQJA 2JD0A 4PAOA 4KQWA 2X7HA 4NCKA 3GCGA 1F2TA 1M6NA 1YS9A 3PUWA 1PUIA 3FGNA 3KSDO 3IO5A 4FX5A 3G0IA 1YR9A 1PTKA 3NTVA 4UPDA 1H4QA 1C9EA 2GAOA 1CQIB 4GPIB 3M5CA 2DPHA 1MT3A 2FQXA 2OP1A 2XXAB 2QVCA 4J1TC 4FS3A 1RFLA 1TK3A 2GKGA 4LXGA 1YBMA 2ZPUA 4BLRA 3DHWC 4G26A 4DLLA 4WI1A 1ZC4A 4DCNA 2NXNA 3IHTA 2OB2A 5IWAB 1H0HA 1NMEA 5DASA 4PO9A 1FTGA 4Q93A 3PPWA 3TDMA 3AT1A 1SJ9A 5DLQC 1R27A 2Y9MB 3CCBA 1D1SA 3PUJA 2IDMA 3UG7A 4P2GA 3HSKA 5JRDS 4BNGA 4JXZA 2VJCA 1ONSA 2QTNA 3KHSA 3P2YA 3PE3A 5KKAA 4IXNA 1DFHA 4Q9DA 5JPDA 1QMGA 1JKIA 2PGAA 5LZ9A 3C7AA 2I9PA 1K66A 1O97D 4ARCA 2JGMA 2I7XA 1Z15A 4X8OA 2WM2A 3HBAA 3ANSA 4HZIA 3UKJA 1FTYA 2F00A 4E07A 1NV9A 2X76A 1T24A 1PT8A 1N7GA 3WOHA 3R8CA 3V8VA 2EBUA 2WF5A 3HVHA 3DWGA 2FX2A 4I6JA 2X0NA 3Q8WA 1P7VA 2J0UB 4CCYA 2WUDA 4XEUA 2R6ZA 4IIJF 4NU0A 5J5CA 2Q07A 3A3PA 3L7LA 3PYXA 1IXRC 1RQPA 4PWZA 3LW8A 4HNGA 4LNUB 1VYTA 4NX2A 3O9VA 4JCCA 2Q5QA 4BAGA 3Q87B 1R8XA 3KXLA 2BWJA 2ZUCA 4MQ5A 2ZJ5A 4CM4B 2V9CA 1AS2A 1S2MA 3K1ZA 1KZ9A 3PUXA 3QUAA 4GYYA 2HIHA 4KXYA 4OXIA 4PX2A 1ZD3A 1W1UA 3U6BA 4FYXA 4YJHA 1WL8A 1F3OA 3C3DA 3R5HA 2R4TA 1VDMA 5AKGA 2WIKA 4IEEA 2V3CC 4AAYA 2UXDB 7MHTA 2FWNA 1Q6ZA 4IIYA 3DT9A 3E5MA 1SCIA 1ES9A 1GAEO 1QKKA 1FSFA 4TYMA 2A86A 2P77A 2PGNA 3LKBA 4BX9A 5A06A 3E22B 1GUYA 1KI1A 1YIOA 2C29D 1ZCAA 4GOOD 2ICAA 4LFBB 5LB2A 4BVLA 3EVEA 2KLHA 3UAOA 1DIBA 2IZ0A 3EVZA 3GRRA 4GLLA 4IOKA 2R5FA 2ZEJA 4TS9A 2FMXA 2PLAA 4WFIA 3R74A 2YJ4A 3RTAA 5EJFA 4B3BA 3B51X 3DE6X 4WX2B 2DHQA 2YDXA 2AJTA 1M1UA 3OH8A 3RYIA 1VGVA 5I9LA 2FRVA 3CKKA 3IB6A 3YASA 3WYDA 3DOIA 2DUMA 2GXSA 2XWJI 4NBUA 5AWFC 3TGLA 3MCTA 3KQQA 4P1ZA 4DC0A 5K03A 2XOXA 1RQ2A 2OHOA 2P4HX 1FW8A 4G0QA 5FI5A 4NPAA 5THXA 5CHEA 1ZUHA 1QHEA 2Z6UA 4ENRA 4D8XA 2ZRLA 4R8SA 4DA0A 2R11A 3JAKA 1G18A 4U7FA 1LDEA 3NDJA 4HO1X 1D03A 1O96A 3AG6A 1PIWA 3EJWA 1DO8A 3RF6A 2BEUB 3IVCA 4ESHA 4F85A 3DUFA 5IABA 3T54A 2UZAA 4E0BA 1T43A 1D3AA 2GD6A 4MWEA 4F1JA 2CW5A 4EFDA 1X3SA 4QASA 2JS7A 3BWBA 3HSYA 3VYUB 5AUPB 1ODSA 4KBYA 4OQEA 4JI6B 3MSXA 1G2IA 2BRUC 2MSDB 1UCFA 1QB7A 3SC3A 3VDQA 5L3SB 4LK2A 2QPOA 4RH0A 4Q9HA 5FL3A 2H9IA 1KDYA 5IULC 1ZA2A 4IKOA 1KQNA 5M2QA 5JWHA 4D1YA 3D7KA 4W9RA 4KODA 3TRKA 4G5YA 3TLYA 3QVVA 3H1AA 1U0EA 3KOWA 5JCJA 2A7XA 5MF6A 4EEKA 3FVVA 1OZFA 1JI0A 4PNEA 2CXTA 5KDDA 5KX5A 4Q5IA 4ND8B 4TT3D 1CS0A 1P75A 4TTVA 2CV2A 4BPRA 3EOBI 2YV3A 3K0AA 2XF8A 2YL2A 3GNLA 2AEMA 3O8QA 4OYHA 4XSHA 2J3HA 2QM8A 4ALLA 3GJSA 4KSBA 4KLCA 5AVQA 1N6RA 4BUCA 4C7BA 3LAWA 3OI7A 5HP4A 3B7PA 3HABA 4U6NA 5IJ0A 1DUVG 3R5TA 2IX9A 4HLDA 4LECA 4BYGA 2D0DA 1Y6JA 3JQQA 4GGMX 3SR4A 2Q2WA 1STOA 2JLBA 4IV0A 4WFJA 1SVMA 5JMOA 3GYGA 4URWR 2OZLA 3O2JA 2UZ1A 3WGHA 1HR0B 2GH1A 4RTRA 4IMPA 2ZT7A 5DWDA 4BMOB 2Z83A 4LHVA 4AC9A 5HUJA 1CJBA 4KU4A 3OQ6A 4MW9A 2IH2A 1G21A 2BGNA 1QLWA 4BO7A 3H2JA 3OUTA 3VGJA 1GCAA 1ZEMA 3SF8B 1WABA 4UAGA 5C1BA 3UHFA 1E69A 1N2JA 1NVXQ 3CR3C 3ZWQA 1O5IA 3HY4A 4RTQA 2HDOA 3IQEA 3SNHA 1DLIA 3WJ7A 4G1BA 3JZMA 2VG8A 1I33A 2V1XA 1E3EA 4E70A 3LY5A 4LSZA 3JQEA 5AKKA 4FCVA 2FE4A 5AQEA 4YWHA 1LNSA 3X1MA 4E08A 3GMIA 3SWWA 3ILVA 2WJHA 1JA1A 2NPOA 2Q45A 2C0CA 4CQMB 1TZMA 2CC2A 3ML1A 4DB2A 2XH8A 4MYHA 5DM60 4MWGA 1GTG1 4HDAA 4GMKA 2HXSA 4E33A 3BZBA 3IKLA 1I0LA 4H7PA 3T15A 5JQWA 1CT9A 3TQCA 5KQSA 1AO0A 5GWXA 5CB6A 2WMNB 5DYNA 3ITKA 3NGLA 4IIHA 3TLCA 1DXOA 1O08A 3E23A 5JH7A 4UFPA 1DQSA 2YJTD 1WRBA 3Q3EA 3O3OB 1NLZA 3VH2A 3Q85A 4QRIA 1NURA 4ISCA 3RSZA 2PH1A 4FMCB 3NANA 2FSSA 3O91A 4DR1B 3T4EA 1E1MA 2EFYA 4FPXA 3PC3A 3QGMA 3EVFA 4IFEA 1ATZA 2FN8A 3KQSA 5D3MB 2PTHA 1J1UA 4B6PA 2CE2X 4QQNA 1AKVA 2I29A 3VR6A 4RADA 3Q2IA 2BP7A 2VS1A 3O4RA 1Z0SA 4IZOA 1XFAA 2A78A 4AUMA 1H0SA 2B5VA 2C1ZA 5AESA 4UVEA 2Y0BA 2QRVA 1WHSB 4NHEA 1P9WA 2H18A 4PBRA 4D3FA 4DBZA 4IDEA 1JEJA 1G60A 1NXSA 2QMHA 3SVTA 2AI1A 2ZI9A 5KQMA 2ECKA 1NONA 2VH5R 4JQZA 3L4BA 4O4IF 2VJAA 4HH0A 1RI2A 4KNVA 1FE8A 3HA5A 1T34A 2OFXA 2QU8A 2FDXA 2ZBPA 3DVSX 1OU0A 3FG9A 3O3NB 2D0IA 4A4DA 4BWYA 4C6TB 5LQCA 3GQVA 2GNPA 3CYFA 4MKFA 3COYA 2HT6A 2PRJA 4NBLA 4IQ0A 1B42A 1SGWA 3LA6A 5K8IA 2P6UA 3DZ8A 1RKQA 3PF9A 3OIDA 4AMUA 2FETA 4Q4HA 4C3VA 4DT1A 1OREA 3ZHUA 2FUG1 4A92A 2YUTA 1QGUB 4HAWA 1C8LA 2LDBA 1SUBA 2FQYA 2MR6A 4NDNE 2CF5A 4P3PA 4DIUA 3TQIA 1PZXA 3OWHA 3TFQA 3NYRA 3KD2A 2QRMA 4ESVA 2IEYA 3HLYA 1CUAA 5EIBD 4E1BA 5HRAA 4WA7A 3PEFA 4ZQBA 2NU8A 4EJSA 5M29A 1M8JA 1IY0A 3A9CA 1UKCA 2GDJA 1A2KC 2AI3A 2OORA 4AECA 5CLFA 2B9VA 3D4NA 4D5EA 4DUGA 2HHAA 3T0IA 4BMNA 4COOA 2JLQA 1TEZA 1LLCA 5CNIA 1YK1A 1Y63A 3SSAA 1EPUA 5FL7D 3V2HA 1N32B 1M72A 2OTCA 1YJ5A 1P0IA 4AS3A 1FS4A 4NFSA 3PC7A 5KZMB 1B8OA 5BXYA 2NXCA 4AULA 3SX4A 1RWXA 2J3DA 1ICIA 1KVTA 2ZTUA 3GLIB 4W1PA 3U3KA 4G5XA 4HYYA 3M1IA 2PQMA 4IW3B 3RU2A 1KP3A 3ZEAA 3NVAA 4TZ0A 1G7TA 3M4ZA 4RTKA 4EG7A 1EJ6A 4CEJA 2VK2A 3NLLA 5CG1A 4EY7A 2WV9A 4C78A 4MEJA 4BO8A 1Y9ZA 4ZAWA 1TCVA 3FPBA 9MHTA 2PL1A 1JIXA 2JA2A 4H7FA 3VV3A 1K7SN 1KC1A 3JWHA 3IX7A 4RHCA 2DKFA 2FQ1A 3IQFA 4WFKA 4EMTA 3NJ4A 5J4HA 1PYOA 1SVIA 2EQBA 2BM8A 2GVNA 3C3CA 1F2UB 4E5SA 4B73A 5C7OO 1XZAA 1NTOA 4HWOA 1YF3A 5DGXA 3TTTA 1JEQA 2H57A 1IQ0A 4RJ2A 1MR3F 2V45A 5EHXA 2HPVA 1BU5A 4ZHQA 3KKZA 3QNUA 1ECFA 4MQFB 1Q15A 5F33A 3E61A 4O63O 4P80A 1PYDA 4BO1A 1ORVA 1B8UA 1PE0A 2IHUA 2Z9DA 4I36A 3CNBA 4DDHA 2IDKA 3VR4A 4AY2A 5C0OE 1KFKB 2YHSA 4PAWA 5HA5A 1U7UA 2ZIFA 2NXEA 3WGTA 4D6PA 4EYEA 2XQGA 2OGZA 2YQZA 3DAOA 3G8AA 1XTTA 1PJ4A 2P8JA 3Q7TA 4HVTA 1W5AA 3F6SA 5ICMA 2YMLA 4L02A 1QG6A 4Q9LA 3BICA 4A2QA 3FPAA 1UEIA 1OYWA 5DI9A 3AXTA 2PWBA 2Z1DA 3G79A 4RVFA 4WSOA 1HZZC 3WISA 1OGJA 2W43A 5JD5A 2HV9A 4Y9SA 5G0TA 4JV5B 2W48A 3LHIA 1SUFA 2PU7A 3DHNA 4O2AF 5DIZA 1SU8A 4U63A 1K5HA 1XAIA 1YRHA 4UHHA 3ZX4A 2C9OA 4Z7JA 4X91A 5K3DA 1EDEA 1RKXA 5DHRA 1V8PA 3OHPA 4NG4A 4B80A 4ZI7A 1DJMA 3WB9A 1FUKA 1WCV1 3RVLA 1D2HA 1MEJA 4PHTA 1USVA 1YBAA 2W6JA 2XRFA 3WQSB 1XVLA 4EQ6B 2BMAA 2BTOA 1J7KA 1M76A 1W96A 4NPHA 1G0OA 4PZDA 2GF2A 4BVAA 2GN4A 3AP2A 1JYFA 1HXHA 4DV2B 4YPFA 5AVXA 2P9BA 1ZN9A 3E18A 1ESCA 1QYRA 3EAFA 5TLSA 1VJ5A 5JNWA 3UJ6A 2JJ1D 1QF9A 4O4JB 3A6PC 1JG7A 3THYB 3U62A 1EFHA 2IU6A 1X80A 2Y0DA 4RANA 1Q7BA 1Y9JA 4H7EA 3HB7A 1TRHA 3IP7A 4QQFA 4NP6A 1KY3A 4GOJA 1NE2A 4CL3A 3TRHA 5IEBA 4U39A 1GZHB 1XDUA 3TJMA 5CTJA 5CJ2A 1Y34E 4DRXB 5D1HA 4O4HB 4IDHA 3I62A 3WYBA 4AUEA 4CG0A 1JYSA 1Q3HA 2PCJA 3DD1A 3UK7A 3QZUA 3EG9A 1H2YA 3GEBA 3AHGA 1MOQA 4JYBA 2B8TA 3QM1A 1YGYA 4ZC1A 4A1OA 5CFNA 5E9AA 3RQSA 3S2ZA 4E4YA 3IUSA 1IZ7A 4IM7A 4DGQA 4J4BA 1IRXA 3FTQA 4PRKA 4XQEA 3X1WA 1L1FA 4EKGA 3KX2A 1C0PA 2FWPA 5DZSA 8AT1A 3U3OA 3AL0C 1J20A 3WMRA 1LH0A 1SPXA 1Z4PX 4L4RA 1XRQA 2AD5A 2G06A 2EAUA 3FUVA 4L4XA 2GPJA 2EU8A 1FP4A 1E1CA 4Q24A 3ZGLA 1DKQA 2J7PD 3BE6A 1HYGA 3JVIA 4R0VA 3FDIA 4US0R 3HSSA 1PVVA 2PD6A 3VMFA 3D0QA 1GUZA 1HF3A 3U5ZB 2IWHA 4JBHA 1UKBA 3FYSA 5A4JA 2HK6A 1R6UA 4RXTA 3SX0A 1UL1X 4JT4A 2KPOA 1FCJA 1XKXA 3IHKA 1E4EA 3H9UA 4F3KA 3I73A 2YVKA 4EF5A 3A28A 3W04A 5DLPA 3KKLA 1ZZEA 2P9QA 4LMRA 4C5CA 2LPMA 1XE3A 2DFKB 3U19A 2AOXA 1ISHA 2V7QA 4ODIA 3WLPA 2VDWB 4HPJB 4A23A 4X1YB 1F8UA 1HDIA 1N4AA 1B7GO 1Z6TA 2IP4A 3D8NA 1U7OA 2EEZA 2R8ZA 4HATA 3DA8A 2BDEA 1T3GA 1T0UA 1U8TA 1E7RA 1WW8A 4O29A 4BU0A 4HSGA 4YRBA 2I2DA 3X3HA 4FDMA 2QBYB 2C4WA 1SHLA 1F8FA 2IW1A 5H81A 3GLRA 3WQBA 3ABQB 5KWVA 3WGNA 4KL8S 3S1AB 1YB1A 1XP5A 4QDXA 3WQQA 4F3YA 5CYFA 1GN9A 1NKVA 1SBQA 2IHYA 1UIMA 2WT4A 2R62A 3HZRA 5E9JA 1M2EA 3FJOA 1NQ5A 2WSBA 3B89A 4N39A 3S99A 3VZBA 3ZLTA 5J47A 1FOEB 1QYXA 2J9FB 2P79A 2VQDA 5CCBA 2FP3A 2JIRA 3DBIA 4C30A 4PZAA 4J9VA 4JITA 2ZPTX 1ULZA 3B60A 4KQ6A 5AK0A 1WOMA 2RJOA 5K51A 1ODFA 1FQWA 2NOAA 1TD1A 2ORWA 4XD7D 4BMSA 4GI7A 5DGHA 4P4UA 4A8TA 2A9RA 3Q0IA 3GIDA 3QYFA 3FMIA 3UCFA 1Z3IX 5C2JB 1R9NA 3E9ZA 4AY3A 3VR6H 4LJSA 1ECCA 5BSUA 5H3LA 4BFSA 4LE0A 3WKEA 3L4EA 1PFUA 1Z6YA 2VPTA 4LY0A 2V1UA 3FYUC 5LFAA 5IHPA 5JXWA 2EKPA 4M60A 1Y48E 2JGJA 2YWGA 3PDHA 5KTSA 1KI9A 4QE3A 2AOUB 3SXJA 2XNJA 1GIAA 2YRWA 3X1KA 4ANFA 5AOCA 1OBFO 5HKKA 3EGWA 1U0FA 2I4IA 5JAQA 4Y6QA 3DFFA 5IC4A 2V7XA 4LDNA 2ETVA 3K9FC 3VZRA 5JO9A 3PXCX 2XA9A 3QE4A 4ID3A 3PEVA 2XX3A 1NMXA 1QANA 3C6YA 4HB4A 4MVJP 3AHHA 1Y3AA 1CIPA 3HRHA 4ASUD 4DTCA 1SO8A 2PS9A 4PYKA 3LWNA 4NFLA 3F90A 5EUCA 5CVVA 2IC5A 4J94A 1SPBS 1P1BA 3CLHA 3I76A 4A0GA 2O2ZA 3EH1A 2OXEA 4I50A 3PHHA 3FBGA 4MWDA 2OYRA 5B64A 2HQOA 2IUSA 1D1QA 3N7AA 1OW3B 1YA4A 3B9QA 1RQGA 4QKQA 1W88B 3S2UA 1I51A 4UAUA 4E12A 1W8DA 4LOJA 1JAHA 4U2EA 4BOYA 3LTEA 1MHTA 2REQB 2B20A 4K9PA 4NVRA 1XOIA 2MJLA 3WVNA 4G9EA 1LC0A 1HKHA 1Z73A 3GNSA 1T2CA 1KY5A 3K35A 4HUQB 4LHZA 4NHOA 1CVIA 1PK8A 3ZZ0A 3CEAA 4Q34A 4ZZ2A 1EJBA 1NBAA 5I9NA 5K0LA 2J33A 3VDXA 1FNDA 3WKCA 4CLEA 4WRRA 5CEFA 4ZT5A 5B3KA 1ZCFA 5K8CA 3KU4A 1QP0A 2R1VA 1X1CA 3EIEA 1NDUA 5FTJA 1TQ4A 2VDKB 2GZ3A 3B13B 3GPDG 1NNI1 3VR3A 1BE6A 4CGZA 5ALKA 3QXSA 1QX4A 3ADPA 4IOJA 3PR3A 2HGZA 1QK3A 2Q2OA 3D54D 1P5ZB 4GZLA 3VMMA 4AN4A 4C29A 4CKEA 4G1FA 1C0IA 1RAIA 5LU9A 1KO8A 1NBMA 2O8CA 1GPNA 3EA5A 4L9AA 4JGGA 1N2OA 5CXUA 2A0FA 2AN3A 4XFJA 4EG4A 4YXWD 3W8NA 2IA5A 1OX4B 1DRUA 4LFCB 1C9YA 1DZIA 4BMVA 2X8JB 3P0EA 4Z3DA 2A0KA 3BL6A 5AW3A 4UCXA 2V55B 2VLIA 1QV9A 1IQRA 1V95A 3H2GA 1N5KA 4R9VA 1NFRA 2GN2A 1AMUA 1GFSA 4JSRA 4KMSA 3O1LA 3O31A 2G72A 1C2YA 1E9FA 4G5HA 3B2NA 1SB9A 1YBVA 2DQKA 2V98A 3CVOA 4FZRA 4IQFA 4RKYA 4DEYA 4P93A 4UFNA 1XB2A 3VZSA 2B83A 4S3MA 3GA0A 3TBFA 4QTYA 2CGEA 1Y9DA 2NYRA 4OHBA 4MR9A 4L27A 1OHHD 4P32A 3PFHA 1SUAA 4BNIA 2H0QA 3NYWA 5JSUA 1OC4A 2IGBA 2VSFA 2VZ0A 1YVPA 2VHTA 2PBFA 4OBXA 2KBEA 5K3FA 4BLWA 5KYKA 2JGRA 4FDTA 1NG9A 2LW7A 2GAIA 3ESBA 3RG8A 3W2FA 4J0IA 3RI3A 3O3MB 4F04A 5JS1A 2EIXA 4XGIA 3LV8A 3GG2A 2ZWPA 2QW8A 4IDBA 3JQFC 4OHUA 4W1QA 1W4LA 4PS0A 1L7XA 3TZBA 4CF4A 3H1BA 2R0QC 1NVVR 5BN3A 1Z6QA 4N9QA 4HAIA 4AS2A 4ZU6X 3RV4A 3O8RA 1FU4A 3FTCA 4H18A 4Y9UA 2IIBA 1E2IA 5J2UF 1W19A 4AMVA 3UK6A 1EP1B 3TIXB 1V0JA 4JU8A 5F7ZA 3T12A 1EAYA 5TQVA 5I7RA 3VKWA 2G0TA 5DYIA 4LYFA 1BXKA 3F2IA 4LOIA 3ZE2B 2HTEA 3ZE9A 5G1OA 4DQKA 4EI8A 4YCCA 1Z7YA 1FVOA 1GFZA 5F3DA 3GJ3A 4PC3A 1HFJA 1Z33A 5E1MA 2A92A 2LIPA 2YY5A 2D2XA 3JWGA 4ZK2A 2XGJA 3VYTB 3HZZA 1HG0A 4I2VA 5G2OA 1N9ZA 4WQMA 1JHZA 4YV0A 1XCBA 4YAJA 5HFJA 3P2KA 4IGFA 3RBXA 2IH5A 4NYJQ 4B4OA 3I5YA 2VK8A 3A6JA 3JU3A 1VIVA 3AM4A 5A7HA 3W6PA 2PWYA 1YHNA 3NM5A 4C3OB 1ADGA 1WXQA 2QI9C 5KTTA 3ZHBA 3IKTA 2HT1A 3OE5A 1E1NA 4WPGA 1L2TA 3C39A 1HOTA 2G88A 4D2IA 2QMEA 2EX4A 4OHFA 2Q41A 4U7DA 5DU2A 1GTSA 3KKMA 2DGDA 5KREA 2K5UA 1K8ZB 5ALYA 4KQIA 3T9BA 1YE8A 1XF9A 1KL7A 3LG2A 1MFPA 2FW9A 3GNTA 2IOYA 4FFWA 3O4GA 4XSGA 3VYWA 4NQRA 4ZZIA 1DBPA 1ABFA 3LGXA 4OJTA 2VWPA 3HQ4O 1ZKMA 4H0FA 1JG2A 2YKGA 1ORDA 2AMJA 4G0UA 1YZQA 2PPVA 3N5KA 1B93A 3O1HB 4WXEA 4ER3A 1WV0A 4YRTA 2QUAA 1VBKA 4C7JA 2ZYVX 5AJUA 1Z4NA 2OCLA 2O2JA 1W0KD 3UN1A 4LJ9A 1W5EA 3ETGA 5L9AA 1X7YA 2N9UA 3W1VA 5JTUA 4IYRA 5DBHX 4F8JA 4Q4AB 1N2GA 1DKRA 2XMPA 5LLTA 2WKPA 1I4OA 1YASA 2ENUA 4IICA 5EMMA 4YC7A 5KSOA 2Z2ZA 1L3CA 4DV4B 1OH8A 2CUZA 3D0KA 1OYVA 2WJAA 2WLSA 3QFHA 2R4QA 5U1PA 4O2BB 2B37A 3G7NA 2P62A 3OJOA 3ZDXB 4L5IA 1G8KA 1R6TA 3DMFA 3IIEA 1IOLA 2EWWA 3VOAA 1U8UA 4DQVA 4A91A 4J7CA 4MNTA 2G71A 3WAKA 2GCNA 1KMMA 2B5WA 4AFNA 2IS2A 2CLEB 3UHPA 2YW9A 2ZI5A 3D1LA 1JYEA 3DD5A 3R7WB 4B81A 3ASVA 4BBAA 4GPZA 1D04A 4HF7A 5HRUA 1YACA 2IBMA 2ZIXA 1PK9A 4L8LA 4RO0A 2VP9A 2IDZA 4DLXA 4CF7A 5JO0A 2J3KA 4ZYYA 4JVLA 1X7XA 3TUJC 3AVPA 3PQ2A 3JR3A 2PV0A 2PUTA 3B1FA 3HYTA 1T2VA 1GV0A 3C5WP 3ND5A 5KO2A 4MO9A 4JVOA 1YE3A 5ALSA 1RRCA 3TW0A 2BMJA 1WTAA 2DTDA 4JA2A 2ZZMA 4NEGA 4F46A 4QOEA 3TI9A 1CR0A 2JAQA 4GOLD 4EENA 2G25A 1KOFA 2C1XA 1S3GA 2HA2A 4L57A 4PC2A 4C03A 4EYGA 5HQ3A 4OK6A 2Q21A 4LJ5A 2G9NA 4IR7A 2OE2A 3HRIA 1W2WB 3B6JA 1GSIA 3BMXA 3CCCA 1QONA 1Q14A 5DTJA 4GZMA 4OJYA 4RPGA 4R1TA 3UKOA 1C50A 2G0AA 1HV8A 2R7AA 4Q3EA 1J8FA 1HK7A 2BV3A 2FUCA 2OLJA 1L4MA 2VDJA 3CB4A 4K9LA 4NE2A 4DR5B 1T0PA 5IBRA 2QR5A 4KPEC 1R7RA 2C0PA 1H9AA 4F7WA 5LNK1 3RIXA 5LR6A 1E6KA 1PR0A 1PQ4A 1HLDA 1YB2A 3D5EA 4JLJA 3QEMA 3ZNQA 4F5DA 5CEEA 2XYQA 4TYQA 2YHUA 3LD9A 2VBGA 3CV3A 4FILA 1RBMA 1M5UA 4PM4A 1JR3A 4FFBB 4S12A 1V6CA 3OPXA 1VKJA 3GBSA 4RFLA 3ZI4A 2AC4A 4DKJA 1J99A 2SKCA 1ZLYA 3WQHA 1Q1GA 4DHWA 4YCNA 1PV1A 2CLCX 2IYPA 3DOCA 1XNGA 2IPAB 4TKMA 1VLQA 5TVGA 3AEUB 2OEPA 4C4SA 4EHLA 4YQFA 2FV8A 3ZKWB 4WGGA 3IEMA 2A9VA 3FJYA 2AOTB 2PXHA 4BGUA 5CBPA 1IJEA 2IOQA 3O75A 5DF1A 5BQ5A 3LT2A 3MGKA 3GEGA 3IMCA 3KAQA 2WICA 1S7GA 3LO5A 1Q1ZA 4NYIR 3R75A 1SIOA 5HIAA 3IS3A 1JE0A 3KOXA 3H99A 1GFIA 4WGFA 3KS9A 3VRHA 3MQFA 4DCGA 4YAFA 4HFRA 1E96A 1VPWA 3RVOA 4UZSA 4E11A 3NVMB 4L75A 3S40A 2H00A 1RHQA 3BULA 2C9ZA 2KSQA 3BXOA 5AFSA 4YAUA 5JEDA 2XT0A 2Z9CA 3KQWA 4DJ5X 2QLFA 1D4AA 2FPGB 3BD8A 5FPQA 4GI3A 4C4PA 4ICIA 5F2NA 1BD4A 1HDOA 1OBCA 3EIUA 3JWEA 4D3DA 2A8YA 3A6GA 3ENVA 3ZDQA 1OXBB 2EL9A 3C3PA 1NMQA 3PC8A 5ECWA 1DINA 2AIRA 8ATCA 2QLNA 1SCQA 3W7BA 1FFGA 3JWPA 1R0SA 4YYEA 5JQGB 3ANTA 3CFYA 4AY6A 1TJ5A 2WKSA 4F4JA 5T7BA 2PG3A 2Y4OA 1K98A 2YXNA 4RTNA 2YV2A 2EZ9A 1QRRA 1THZA 4N9WA 1PFKA 3VJRA 2P5TB 5I7OA 2ODAA 4A0FA 5CFQA 4PFJA 3PSHA 4P5PA 2YV1A 2UYCA 3RIEA 1RTTA 2BGIA 5EY5B 5IF9A 1T25A 1E1KA 3AEZA 1Z26A 4YRDA 2NO5A 3CO5A 3IIIA 3DE1X 4RAOA 5AJVB 5EUMA 2Z8YA 1H69A 2WJWA 3GRUA 2QPLA 1N9GA 3OU2A 1L5RA 4MMZB 4UD2A 1I5RA 1KFEB 4YLEA 1FK8A 5DTRA 3P0JA 1CE8B 3ISJA 3UT5A 5JSZB 2QENA 2ZJ6A 2ISSD 2ZRPA 3CN7A 2XUPA 3T4UA 5KQRA 2O8DB 3ZR4B 1J2RA 3U80A 4Q1FA 4AWAA 2PS0A 1QHYA 2UVDA 1SOWA 1TTPB 4MVJF 1BTOA 2DR3A 2Q6LA 4J0CA 5J5VA 4NMXB 3FOFC 4N6OA 4HDQB 1I5EA 4TWIA 3E9QA 5I7AA 1FZQA 5E7IA 3CJQA 1H9CA 5CFPA 3QX7A 4F9GA 3LBYA 5FO1A 3HJUA 4MGKR 5EJMA 1SQ5A 3CSSA 3V7NA 5AM1A 1FP7A 5G0SA 2WJIA 1VYHA 3LDFA 2EKLA 4J1TA 1ZICA 3LRPA 2L2QA 2RKOA 3FZEA 2GPBA 2PX4A 3ASUA 4KGVA 3W06A 3VHXB 1WY7A 1G8SA 2VDRB 4LRYA 3TDNA 2ID9A 5CM8B 4XIIA 5JBNA 3W8EA 1L5FA 1HE5A 4NFYA 4AQDA 3PHGA 3AWDA 4XKJA 2NTNA 3H6GA 1UMCA 3HHEA 1A7KA 3HWSA 1L5KA 1E2GA 1A77A 2HBQA 2X19A 4YRZA 5JSHA 2KYRA 1M6VB 2M98A 1O6BA 3DAFA 2FFQA 4LQCA 2IXFA 3HJHA 3PC6A 1EKXA 3UYKA 2XTMA 3DAGA 1NQTA 4G65A 4TKZA 5TQ0A 2CL7X 2XVAA 3LBHA 1TGYA 1CF4A 3SYNA 3GJ8A 4A26A 4DCJA 3JARB 3AF4A 5DHFA 1Y7HA 3GLVA 2VDLB 4YP9A 2G28A 3A1CA 1E5VA 5TT0A 1FFCA 5EYPA 4EDFA 3BRCA 2GRJA 3CX3A 1I7LA 3L41A 4LPSA 4F4IA 721PA 3C0KA 3UV3A 2GEFA 1EBUA 3PGVA 4IO1A 1V16A 2A9JA 2QTTA 4OQLA 3C97A 3KHTA 5FOWA 2W37A 3K5HA 2YWRA 4ZGWA 4QGFA 4FEAA 4LISA 3I9LA 4QYWA 5AVZA 4I4LA 1KORA 3PPVA 1KFBB 2XMGA 3T5DA 3TQSA 3F5FA 3M6IA 4Z2AA 2WUVA 1DAPA 2IZ5A 3B3FA 4H1VA 1MIHA 5DI3B 4ZIRB 1BFDA 4L2IA 6CHYA 3QNMA 1U5CA 2GB4A 5J4KA 1N5LA 1NSFA 5DRYA 3ZWMA 1JI3A 1RYBA 3RSOA 4BVJA 1OR8A 2C5AA 2HK7A 1FMJA 2HF2A 3E35A 3LQKA 4NICA 3T3HA 1A95A 1OMOA 1ZDMA 2LKDA 4X6UA 4F5WA 3LHFA 2FZGA 3L82B 1NVWQ 3IQGX 3L6CA 5BNIA 1L7PA 1V1JA 2DSTA 3SYKA 1PGQA 2VOEA 3PL5A 3RSHA 2O7RA 1EFPB 2FTKE 1NXPA 1E5XA 3Q9NA 5IP5A 3CRRA 5A71A 1RI3A 2I2AA 3T52A 4LEIA 4EJ0A 1EG2A 1U7XA 5ALFA 3QTLA 3PTAA 1YONA 5FOXA 1L6RA 2WQ6A 3ZE1B 1H2AS 3TE6A 1U2GA 3TR6A 4XIFA 5ADUS 1ML4A 1RCTE 2O2IA 2UVQA 3PR1A 3PXAA 2WDPA 3OCCA 3P20A 3U7QB 2R68A 4BX8A 4EGQA 2FUEA 2NPIA 3AF0A 2ZJ7A 3HPQA 3NW9A 3PQ5A 2A9OA 4DLWA 4P58A 4ZYZA 1FMLA 5DB4A 1SY7A 3BGIA 1PLLA 3Q41A 1MEOA 2Q4TA 4QOHA 4XYGA 3AF1A 2NZYA 1BNCA 2IE0A 4KFRA 4EKEA 2AA3A 2E9SA 2C9BA 4Z86A 3IALA 1J5XA 4I1UA 4IDAA 1YVEI 1NC1A 1KAGA 1PZNA 3LQRA 4L9WA 2OQVA 4D9KA 4JI7B 2WSMA 3QV2A 4QSHA 3WA6A 2FRDA 2CF6A 2E21A 3OCWA 3K9HA 3HB4X 1P1CA 3U13A 5I48A 2GHTA 5JY1A 4NCXA 3KNZA 2OECA 2JF0A 2KW5A 3A9RA 1TKAA 5LQMA 4PLZA 3F9IA 3MAJA 4AT1A 3HXMA 3W4IA 1T2FA 3ER6A 1YS2X 5BUQA 4KVZA 5LJIA 3O0TA 3GZNA 1GRRA 3SYLA 1LD3A 1L7NA 1WX1A 1E9VA 2KI5A 3NHPA 3WRXC 1SVWA 1WMDA 1VBFA 4EAAA 1JZQA 2JLCA 4EG6A 2AWNA 2E89A 1NMYA 2Z2YA 1NGSA 2ZS7A 4EG8A 1R6XA 4M1WA 4GFDA 3WWYA 5FPPA 1PX2A 1Z8NA 2C42A 2W2KB 4G5RA 4KQ2A 4S1VA 2AMVA 1NRIA 3PWSA 3Q8XB 4BQSA 4IINA 4LRSB 3WRYA 2C4KA 4R7ZA 4X95A 4DNOA 2ZSJA 2PKCA 1GILA 1TAHA 1D8TA 3GF4A 2E6UX 4D5GA 1WSWA 2X0JA 4EKNB 3OLVA 3T7TA 2WWRA 1U0LA 3N2GB 2RI1A 4ZODA 1ZMRA 1XVVA 4W9NC 3SSNA 5ABPA 2ZUEA 5JZSA 2PL5A 2DHCA 5HE9A 1PS0A 2C77A 4V02A 3H04A 3KR2A 1KC3A 3CW2A 5FTMA 2ZR0A 1GNTA 3ZC3A 4A27A 5C8YB 3W77A 1LS1A 1VCOA 2RHMA 4UTPA 4YRKA 3LYAA 2AJLI 2RH8A 4Y6PA 3KCNA 3V7FA 3KR9A 4FXPA 4BFUA 4ARSA 1I3LA 3H9GA 5CB4B 2Y1DA 1IRIA 4CMJA 1M1YA 3HKBA 4TLCA 4XQ9A 1V9LA 5FYDA 2P40A 3V80A 1Z39A 1HT3A 1O95D 1UFKA 2CL0X 4FGLA 3ZDBA 1UBKS 1XLVA 3RF7A 2XYPA 3SY8A 2GT1A 3TMYA 1QO0A 2QX6A 5DX8A 1KH3A 2CBGA 3LQQA 1GKUB 1T15A 4DG8A 4DMLA 1PQWA 3C43A 5KTKA 2QSYA 5I9BA 1EFKA 2IYFA 3VDMA 3HYLA 1XK6A 1E2DA 3OECA 3EZXA 1GL7A 1TL7C 2ET6A 5DULA 4ZCLA 3SFTA 1ZG3A 1Q19A 1UDCA 1Z5OA 2IYLD 1HE8B 3TLGB 1YQUA 3L1HA 1ISPA 3O8OA 1MC5A 1PS9A 5FBKA 6NULA 2AFHA 4BFVA 2HU2A 1YZYA 4DNFA 2XUOA 2I8LA 3DZCA 4OUDA 4XGNA 4B8YA 3H5LA 1BOOA 4K9MA 3L92A 2J9YB 1C4OA 2AXQA 1ZJ4A 2MMGA 3DKKA 4JQOA 1GPDG 4B8ZA 3LXRA 3AF3A 4LVOA 1I2BA 2IEGA 3RYHB 2W2QA 3L1VA 1WUKS 3ZHYA 3SJUA 2ZIWB 5C31A 2FOLA 3ZE6A 2Z2KA 1Z08A 2AEJA 2WFZA 1H05A 1E7MA 4CLHA 1OSNA 1ZRSA 2BSXA 3GFVA 1I0ZA 1JSCA 2D8MA 1FFHA 1UKVY 2ODQA 2OY0A 1LK7A 1F8YA 4H1HA 4DIOA 2VXYA 2BMVA 3AKDA 2PR2A 1OROA 4TV8F 1R5JA 2H51A 3BM5A 1B76A 4ZEWA 4IWNA 3F6EX 1RXVA 4CF3A 1NWCA 3P2OA 1CERA 1IOVA 2CN1A 2IF0A 3OLYA 3GUUA 5ERXA 3HFSA 1V41E 3U4HA 4HWPA 4D9NA 4P86A 2Q5HA 4E7PA 3GVCA 4MVJG 3LKDA 2ZXUA 4ZV4A 3A1TA 4PYLA 4R6WA 4MI6A 3PICA 3L7CA 4N6GA 3CQ9A 1JXOA 1O5OA 2G9VA 3CBGA 1PEDA 4ZP1A 4BXOB 4H31A 1C2TA 1CY6A 1JJIA 3UWPA 3WMWA 3K7EA 5A2QA 4JI8B 4LF9B 3WWDA 1VJ1A 2XXAA 4OH7A 3KOYA 3TQOA 4R2MA 2IUYA 4R51A 3WFJA 1NRJB 2BTQB 1LDMA 3R3VA 5L7YA 2CVFA 4Y2VA 2A9PA 1QCYA 3QBVA 3TZ6A 3TM4A 3WWEA 3I34X 4YASA 4YUXA 4GEGA 2PK3A 3ZHVA 2POCA 4EB8A 1YL7A 4B35A 3WMFA 3LPLA 2YY7A 4GI2A 8ABPA 3GD5A 1YMUA 3C24A 3FPJA 4I14A 4INAA 5DHPA 1KPHA 1F2DA 1QAMA 6ABPA 2ODEA 2QTVB 3H8SA 3NJRA 5A3JA 2ZDHA 1GG5A 1RSZA 1U2RA 3BSSA 4H4EA 4XM2A 3STUA 2ZBVA 3M7IA 2WWVD 4B46A 4YT4A 3IELA 1TU0A 4N3BA 1RPNA 1K4MA 4KAXA 4PQGA 3AJRA 4GVLA 2ONYA 1EVIA 3SDSA 1H8HA 3BIWA 4HX9A 1DBWA 1EM8B 1WB5A 2AW5A 3BL5A 2QVZX 4G0OA 2ZLBA 4BHTA 4J90A 2R6AA 1BWQA 1KETA 1ABEA 2UZ0A 2QTAA 5ECDA 1JPJA 2W11A 4B82A 3R7FA 1OLUB 5HKLA 2QF7A 2P9YA 2Y0EA 3Q7EA 2XUHA 1IXYA 3DL4A 2TMGA 2FDCA 3HC7A 3WSTA 4ZZ3A 2L42A 2ZUSA 3HNOA 2JL1A 4I4TF 4M1EA 1FNCA 4NMMA 4R54A 1PQUA 5KTPA 4GRDA 5A9SA 2C4VA 1H5QA 4FGWA 3M3DA 5CT5A 7ADHA 2I2FA 3SOZA 3HJFA 1RHJA 4GP6A 4LX8A 3AU9A 3K1TA 1IWOA 4ETWA 1QGYA 4ZI3A 1JV2B 1O4VA 3R7AA 4G23A 5ETJA 3HP7A 1M7BA 1EDZA 4FYJA 2D5LA 4QBHA 4F38A 2ATCA 1SCUA 3PSAA 5CHYA 4UVDA 1AM4D 2AYXA 1QHHB 3GDWA 1QRTA 4BNNA 3ZXIA 1MU0A 1WMEA 2ZRIA 3CT6A 1KS9A 3ZDCA 2COEA 4QYMA 2WWHA 4FFRA 1FFBA 4GIBA 2HSZA 3IJ5A 1GLVA 4G89A 3AR3A 3LS2A 1DT3A 1Z7EA 3M5PA 5FR1A 3RTCA 3VJMA 3ZJYA 4N01A 3OA0A 2JCGA 1RRKA 1R6DA 3MWYW 2D62A 4YCDA 1PKEA 1C3VA 2Z95A 3FCXA 2BT4A 1H6AA 2P67A 5I9TA 1G38A 2E4YA 1UPXA 1AGNA 1WMAA 1XV5A 2HQSA 1NZDA 1KH1A 3BERA 1EX1A 5BY2A 2WMYA 3RO7A 1E3WB 1JAZA 1FDTA 1FDRA 5DN6A 4Z9FA 5TGTA 2YWXA 1GG9A 1E63A 1AKEA 3GJ4A 4JQSA 1BDJA 4PZUA 1A5BB 2A0WA 2G09A 3GLKA 3WSVA 2OXCA 3IT2A 3B9RA 4NBNA 4QHYA 4UU1A 5IT0A 5JSFA 1IBKB 3EVNA 3VU9A 3U4QB 1YR2A 3H5IA 3LCCA 4BGVA 3QIVA 4CLXA 4RBNA 3SS9X 4Z7QB 3H9BA 1C4KA 2APJA 4CMEA 3I58A 3P7MA 4WCVA 1FRQA 4HWGA 2YS6A 1MAAA 3KUXA 3LHDA 4MMXB 4CODB 1Q83A 4AYTA 3EGOA 1JDVA 3AJEA 3C6QA 1UT6A 3GL9A 5I8PA 4KR3A 2Y3IA 4DR6B 2D59A 4X7RA 4EA6A 2D6FA 3CWCA 4S24A 3A04A 1LFDB 4HAVA 1GKYA 1E89A 4RPCA 5A03A 5CVDA 2ZUBA 4DANA 1V7PC 2BCGY 4MDYA 1WULS 2IRWA 3LA8A 4ND8A 4Z9BA 5IN4A 5COAA 1TYCA 1H4SA 4GH5A 1S02A 1L4BA 4MGIR 4RKQA 4XUCA 2DSNA 2JVKA 3TAUA 2XOKD 4PX5A 3NIWA 3KSZO 4KGZA 4ZVTA 2HNKA 1E0AA 3S0JA 3PQ4A 4Q03A 2H48A 3OQOA 4DIKA 1JLMA 4XIGS 2H29A 4HZUB 2PUBA 3LWZA 1RKVA 2FOIA 4HX5A 4JOBA 3DFKA 3ORSA 1YIAA 3V42A 5ALNA 2D1SA 1M2GA 2GZ1A 2J4CA 4FKZA 3PJEA 4L6CA 2AFIE 1W35A 3ODGA 4DILA 1FPQA 4RFSB 4OYRA 2CLSA 4TQGA 4CKBA 2LXNA 4PQEA 1TA9A 1UP6A 3KRTA 3I2GA 1PNTA 1LJLA 3SF8A 4R01A 1T8PA 5AI5A 4BGDA 3HBJA 4UDXX 4EHBA 3ORRA 2OT3B 4GRAA 5JR3A 2EDAA 2VZLA 4YI5A 4QUIA 4M22A 3VPHA 4B6RA 4LTMA 4J91A 2ZYTX 3QPUA 5FBZA 3MWGA 3EEBA 5DM0A 1C9KA 1MGPA 4Q7JB 4ZOQI 3WBFA 4C5AA 1CUZA 5ITWA 1CSEE 1KVSA 5FRDA 4WZAB 4YR9A 4GP9A 1CP3A 5HS6A 3DMDA 1U2ZA 1GPBA 3EH2A 1G5QA 1EUZA 2VKTA 3O1IC 2YN2A 5JNUA 3CRW1 2Y99A 4CT4B 2Z6AA 4URZR 2VRCA 1O6CA 3VUEA 4YQZA 1TEHA 3C3EA 3KXPA 1YBHA 3EQ9A 3L40A 4G09A 1NW8A 1XWIA 3LUGA 2XRMA 4IRMA 3Q2OA 2Q0XA 1GDDA 1RWPA 3UM9A 3AUYA 3KB2A 3M5DA 4OHKA 1U2TA 4RIIA 4TMTA 5AOBA 3MGAA 4A0RA 3NDRA 4ARIA 3LVBA 3UENA 3JYQA 2OHGA 4M0UA 4TVKA 2UUCB 1VP9A 1FDUA 1PJ2A 1E98A 1WLSA 3LGSA 1Y8CA 5K3SA 1D0IA 3L04A 4FOTA 2QUJA 4YS6A 3O38A 2X1VA 2FFBA 3RS9A 5BSHA 1ZD2P 3GLGB 4A1FA 5KS2A 1VI6A 3C98A 2DH5A 1IUOA 1VL0A 1J0BA 3DEZA 4M7WA 1W0JD 4NXNB 3WTBA 1I7QB 2PUEA 5AK6A 1JLSA 1KJNA 1M3SA 5BR8B 1S9HA 2H7CA 2QL5A 2Q3JA 4QHTA 4BNWA 4UTXA 2Q6IA 2L18A 4CFZA 2YFKA 1M83A 3P0HA 4IZHA 4BE7B 3IEVA 4GLJA 4HQOA 4KMRA 1NUSA 1RPZA 3LFTA 1CTQA 4M55A 4TM8A 5FA6A 4TVSA 1UDRA 1T4MA 1FDSA 1NQXA 2Q49A 2ODBA 3KBBA 4R68A 2ZGVA 4ZXFA 2QIPA 3DCYA 3IKVA 1K08A 3S1SA 3ZVRA 1GDHA 2B99A 3NORA 1M0WA 2YXBA 1ZM3A 2XNDD 4X71A 3GCDA 4BN0A 4EJMA 1DKPA 2I6FA 4KO8A 1L4LA 4DG5A 4PLWA 1QGUA 2GAJA 1B0UA 1NL3A 2NSJA 3INNA 3K0KA 3ICVA 2JFPA 5DT2A 4DXAA 1QQAA 1A7UA 4WFQA 3AFMA 4EATA 2DY0A 3GB9A 4I3GA 3DJYA 2C95A 4GR5A 1VG9B 5BQPA 1Q7TA 4XUEA 3R41A 1IFXA 4UULA 3AFOA 3OFJA 1E6CA 1DJQA 4LOLA 1YI8A 1X1QA 2C3UA 2XTZA 3A6HA 1E4OA 4IGAA 3IAXA 4YMTA 2WP8J 3BQ9A 3IVMA 3WNZA 5AVYA 6GPBA 1LZLA 2HRZA 3FNIA 2N75A 3ND7A 2FA9A 5AVRA 2JHCA 3GLHE 3QUBA 2N1MA 1BXGB 3B70A 4BBZA 2G7MC 4NTZA 2VXOA 7MDHA 1B43A 1ZD4A 3ICEA 4YMSA 3OU6A 2GTPA 2X7XA 1CV2A 3F6BX 1GN8A 4AYXA 4EF4A 1QH8A 3OZRA 5F5XA 5LSAA 1BU8A 3QKSB 3H8JA 3N2YA 1ZA1A 4GXRA 3INYA 4HZGA 5LWQA 2ZVPX 3HM2A 3KWFA 3SQDA 3TD6A 3GLIA 5CD9A 1T26A 1YGPA 3IIKA 4ZO7A 1CQXA 4DEVA 5A02A 5JECA 1B0PA 4I99A 4FJ2A 4F2GA 4W5HA 3GPIA 4J6EA 2R96A 2VJMA 1KEZA 3G8DA 4F84A 1JAXA 1ZN8A 2COKA 3CXRA 3O8BA 4H17A 2OD2A 4HRYA 3GYBA 4MXDA 1QZTA 2PMBA 4M1YA 1E6LA 3N39C 3CUTA 4UVHA 1EFVA 1T1JA 5AHOA 5FNVF 3PXUA 4TMKA 2BFBB 4CM8B 3MCAA 3GRAA 4QLBA 3ZCUA 1G64A 4LJLA 4EHNA 3CZ5A 4P36A 1RDFA 3I30X 3IUEA 5J1SB 1A82A 4JJAA 4KLRA 2XZDA 4IMJB 4BU1A 1F2UA 5FPHA 4N7BA 1U8XX 4K3UA 4BWVA 1GU7A 3TFOA 3H8WA 2J0VA 3FNEA 3R0QA 1YQDA 3P4UA 4EW6A 5EE1A 3R9IA 2DFDA 2HMAA 3P9QA 2B8JA 5H4HA 3P2MA 4MQFA 1N5MA 5JWOA 4HS4A 1I6LA 4YFVA 1EBBA 2H1VA 3O90A 5BW6B 4N47A 1WO8A 3U4DA 3HXPA 4MS4B 2VHYA 1LTKA 2OAGA 3AR4A 1U8FO 2H0RA 4ZDIA 3G1WA 2O2CA 4KC0A 2XE4A 4AG6A 1J0AA 1TYEB 3JQDA 1QO9A 2PWZA 2H1SA 5H3CA 1ZD1A 4RTLA 1QP8A 3OT1B 4GL4A 3TRJA 4YV7A 2DLNA 3QKTA 2FWMX 1IWPB 2EFDB 3X43A 1QVWA 2ON6A 2ZYIA 3OF2A 5AM0A 7GPBA 5KUTA 1HEYA 1YCFA 5A5VA 1PZMA 1L6IA 1RLJA 4OP3A 3NYIA 4H7JA 4MP3A 5EMHA 2R1TB 3GRPA 3TF5A 1MRNA 2Y1CA 4JI5B 5IBQA 1XALA 4E2ZA 3KB8A 1RRMA 1KH2A 1WA5A 4C4TA 1Y0BA 5DO9A 1AXGA 4OLJA 2HF9A 3NTQA 3S7ZA 4ZQHA 3HK2A 4EQ6A 2H8KA 1E62A 4IYJA 2CFSA 3E27A 4INOA 1H94A 1QNLA 5KNLA 4YCLA 4E2YA 4UMEA 3TQTA 3ET5A 2PH5A 3H4VA 4BKQA 4KXQA 3NP7A 3K0SA 2BMFA 4C4ZA 3IC5A 1V7QA 3GIWA 4O4JA 2VT3A 4ZC8A 3FWNA 5BT9A 1BKYA 3H5OA 3K2IA 5JLJA 3LX6A 4OFBA 1WJGA 3U3RA 3THYA 4TZ6A 4URUR 4X85A 2J5XA 3RIMA 5A62A 2GGSA 4O4LB 4ZJYA 3H8VA 1L5WA 2D7CA 5EPOA 4L5BA 5AW9A 3QU9A 1YULA 2GVZC 1TEVA 2O0MA 3C8ZA 2XGGA 4QUKA 3VR1A 1UOPA 1NBEA 3FZNA 4LZNA 4O4HA 4EF6A 4ENQA 5B5SA 3AW9A 5FORA 2Q5CA 2B34A 5IKOA 1NQAO 3TD9A 1XRPA 2VNIA 1NXVA 3LZDA 3SBOA 5LBIA 2IBSA 5FLXA 5TMBA 1Q1BA 1JHOA 1XD2B 3STXA 4YV2A 1KJQA 1F06A 2CNBA 3DVLA 4DPKA 1XNRB 3EX7C 5HZGA 5KNCD 4RVSA 2Y76A 821PA 2ZYUX 1Y8AA 4OBWA 4IDPA 3N7TA 4NCIA 5JS2A 3EZNA 4ZGBA 7AT1A 2PKRA 2O0KA 2XWPA 1SRRA 2ZYGA 1VECA 3ZPXA 5IMSA 3H9QA 3K96A 3NT2A 5EZYF 2JA1A 3O8LA 4KEAA 4NNPA 4XCVA 3DDCA 2Z3ZA 3ERCA 3VNSA 1VMAA 3UJHA 1G8JA 2HYDA 3N8GA 5G3ZA 4C4OA 3EVGA 4LCJA 4M0LA 4MUXA 4LBZA 4YECA 5AI4A 5G4LA 1A9XB 4DAEA 3PI6A 3G85A 2AX3A 3R0VA 1NPYA 4C4XA 1TIPA 1W85B 3I8SA 4WBNB 3GDHA 2I80A 2IITA 4RVHA 1TF2A 1DL5A 1KYTA 4KE9A 1SZDA 3I0MA 4O6VA 1WVGA 1ZX1A 2YW2A 4FHGA 4AL4A 4ARAA 3OZ7A 5K8TA 2WWXA 3IT0A 2HJGA 3WYAA 1XF1A 2REXB 4MI9A 1Y6RA 1LRKA 1N1GA 5GQSA 2CZGA 2GK7A 4FYPA 1HYHA 2QQ0A 3R0XA 3NPAA 1T1EA 1VJGA 2HPZA 2WV7A 1UH5A 1XGKA 1JQKA 2VDWA 4TPKA 2MTBA 2YN4A 4TXJA 4YRCA 5E6UA 4X1YA 5EKSA 1A9SA 1TCCA 3D59A 3F97A 4XB1A 5JVDB 5BMVA 1COWA 3UOAB 4F9EA 4Z5XA 2GO7A 3BE5A 3MTQA 3IV6A 4CBVA 4MK4A 3GFOA 2JJ1A 4JODA 3RYCB 2R85A 3GLUA 3BH0A 1EE1A 2GFQA 4JXXA 3PHIA 2IIQA 3VR0A 3ZZNA 4NSNA 3UOGA 2IHNA 2QBYA 1AGRA 1EUQA 3BIOA 1YR1A 3EY9A 3EXG1 1C9JA 4V0KA 2EKQA 4J4TA 1O9GA 2XB9A 4RHEA 2WQ7A 3IR6A 3B5IA 5ESDA 2VZ9A 3SYTA 1FJGB 1B2RA 3UUGA 1HT2E 5FTWA 1HKUA 4DLSA 3OF3A 2K87A 3QFSA 3DCNA 2VNJA 3ZS9A 1WB9A 4HJXA 4QJ5A 3L5KA 3QVMA 4N5NA 4RA9A 1GQRA 2C2MA 2J9FA 3IMFA 1IBLB 3OM9A 1C9NA 5CH5A 3V7WA 1NF3A 4KUGA 3MJRA 1AQLA 4FZJA 5C52B 4YXFA 2X22A 1M67A 2ZJ0A 4Z8YA 3UAYA 2WE7A 3B78A 4NK4A 4XRRA 5C7LO 2R6CA 1M0EA 2AW3A 1U7HA 4CVNA 1RXUA 1XMVA 1YNSA 3ANXA 5CLQA 5IWCA 3C7TA 4LDPA 4KR0A 4FR0A 5DISB 4ESEA 1FYXA 1X1TA 4PO8A 1L4GA 1V1RB 4XIYA 4P81A 4D4GA 2BBWA 4AP9A 1MX1A 1XEXB 2IHBA 1CQJB 4XR9A 3GT3A 1Z5VA 2AOUA 2FR8A 2P4QA 3PKIA 1XA0A 2RBEA 5BOVA 3SP1A 4L8GA 1VHTA 4MYDA 2VT6A 2EYQA 2YZNA 1JMKC 2HPHA 3OTHA 3WGGA 4HDMB 4NWIA 4CLDA 4ZOBA 4QDKA 4F3CA 2GPYA 1PS8A 3VH1A 1QHGA 2ZKIA 5CPFA 4YH1A 3F0TA 3RBZA 4JELA 4JP8A 3HXLA 4OKNA 4D0SA 4GWKA 1ORHA 2VDMB 1XZMA 4NONA 4PQYA 2F1HA 1XTQA 5HF6A 2OFFA 3I4FA 4IBOA 1TMKA 4M0PA 1A71A 2X9GA 1YD7A 5DKFA 5A6SB 1P5HA 2VUIB 3HN7A 4RF2A 1FA9A 1KZHA 3ZI0A 4IILA 5DBGA 3FKSD 1KHTA 4PZLA 3RRFA 1Z0KA 3WXMA 5ULLA 1C7FA 2II6A 3KM0A 2Q6TA 4U7JA 4QZVA 1XU7A 2OV6A 1RQNA 2F8MA 4R8MA 2YWHA 4GWLA 2JH8A 4HB2A 3TZQA 3STTA 2CB0A 4ZCPA 1LNZA 2FWIA 4HHEA 6ADHA 1OH7A 3EJ6A 4OHOA 1TDJA 3PK0A 1TXGA 4HUQA 3LRXA 3PNYA 4EG0A 3O8CA 3NAGA 2Q5JA 2PUCA 1MKYA 3AO0B 2I4TA 2O2HA 3P94A 4Y2RA 4HNHA 3BN3A 5EIWA 3FLEA 1ZM7A 4WXHA 1SC1A 1XJWA 4JI4B 4CV0A 3GOQA 5KHLB 1EWKA 2G1JA 3N2EA 2NSYA 2OHIA 1K92A 3DBHB 4MPDA 4NABA 4QBIA 4QOIA 4DV3B 5BNTA 2EGGA 5FH9A 4XAQA 3LMKA 3ETHA 1L7RA 3USES 3EHEA 1BN6A 1P7YA 3G2IA 2VN8A 4X84A 4XD7A 4AF7A 5K5EA 4OJQA 1XEWX 3JRXA 3TMKA 5JNLA 5KYXA 4AKSA 2NMVA 2XVZA 3KL2A 5I3ZA 4YN3A 1CDDA 1UZNA 1JBQA 1WXFA 2C07A 1LWOA 2ORIA 3MD9A 4XLLA 1IMOA 4R41A 4BV3A 5HVNA 2OLEA 3GUYA 4G8CA 2AMLA 2G77B 2L0XA 2AMFA 3ASYA 1VJCA 3C5HA 4HNSA 4R98A 4XEHA 4ER0A 1H2FA 4UUAA 3A11A 1XQYA 2H4XA 4AM8A 4RZUA 1E2EA 2D5IA 4Z2YA 1B6TA 1NUPA 1T9CA 1TECE 2HMYB 3BMNA 1K8RA 2VHCA 2J32A 3JALA 3MLEA 3VO2A 4DABA 2DHEA 4B4UA 4RABA 5H9VA 1CQZA 4EO7A 2XNHA 5E6RB 3R6TA 3F3YA 3AVXA 4RY0A 1K8XB 2G9ZA 3J7TA 4KQHA 1E5LA 4GSLA 2NYUA 3FHJA 3QSYA 4MPTA 4WXMA 1ABBA 2WA2A 4ZT3A 5AOAA 3VYVA 4ASUA 3VYRB 2YZGA 1JIQA 1XZDA 3LVRE 2RHLA 1GWNA 2H63A 1T10A 5DCWA 3TB6A 3V4RA 4ARBA 1IEQA 3M34A 1UMBA 4GXNA 2V6FA 1Q0TA 1RYHA 2LZ0A 2UVPA 2ERXA 2J3EA 3D3NA 1FNSA 2CMKA 4ENUA 5F9FA 2P3LA 2Q5IA 3BFPA 3IKMB 1UZMA 5K3CA 4FIZA 3RJ9A 4Q7QA 2CKMA 3NIFB 4JWTA 5ER9A 3Q0EA 3F74A 4MUYA 2ORVA 1U11A 2HB6A 2XZPA 1A4XA 1E9AA 3LK7A 1MX9A 3MNFA 3OQVA 2UZ3A 5LOVB 1P4RA 1H5NA 1RYDA 1Y8QB