2XVMA

Crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sah
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
AMVIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWERVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TELLURITE RESISTANCE PROTEIN TEHB
publication title Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.1.1.265: Tellurite methyltransferase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2xvmA00
4GC9A 2PSSA 5DM1A 5K09A 2IFTA 5CVUA 4EMSA 3G8BA 1XDSA 3GRYA 4Y30A 3VC1A 3FPHA 4A6EA 2AS0A 4OA8A 1M6EX 4E32A 2PKWA 2Q41A 2IIPA 2IP2A 3JWHA 2ZULA 4QTUB 2KW5A 4EKIA 5KQSA 2YR0A 3ER8A 1IXKA 3M6WA 3HEMA 1EJ6A 3EGIA 5BP7A 1RI5A 2NXNA 1VLMA 2PXAA 3PFGA 5EKXA 2IDJA 3V97A 5E1OA 3BWCA 3PTAA 2XYQA 2AOTB 2PXXA 4BP3A 3HA3A 5F2NA 3T7SA 1RI2A 3E7PA 3A27A 1X19A 4LG1A 5CVDA 3TMAA 2GLUA 3LKDA 2GPYA 1M0EA 3GO4A 2YXLA 3ID6C 3LCCA 5DLYA 5C0OE 3AXTA 3NWBA 2PV0A 3UJBA 2YVLA 2AR0A 1NE2A 2I6GA 3OZSA 4FT2A 1XTPA 3VSEA 4BLWA 3MHTA 3PB3A 1JTEA 1ZQ9A 1UWVA 3R6TA 4OBXA 3EVFA 5FADA 4KDRA 1SG9A 2WA2A 3KPJA 1P1CA 1TW3A 1WG8A 1F3LA 3DMGA 3LDFA 4QDKA 4DF3A 4DA4A 2YX1A 3FTFA 1JG3A 1FBNA 5DX1A 3CKKA 3DLCA 4RTQA 1G8AA 8MHTA 1NBIA 3BT7A 4BY9E 1RJDA 2QRVA 4RSRA 3FTDA 3PX2A 4ER6A 5JR3A 2NP6A 3FUVA 2P40A 3A26A 4PGGA 5DRYA 2QYOA 2EX4A 3IV6A 3EVDA 3ERCA 4X1OA 3KR0A 3NDIA 2WA1A 2YTZA 4PIMA 2ZCJA 2OO3A 3EGVA 5LQUA 1JSZA 1JG4A 4RTOA 3I5UA 3FZGA 4DKJA 2ORED 2ESRA 3FPJA 5EHGA 5P8WA 4RTRA 2GAFA 2H1RA 2ONZA 3EGEA 4U7TB 3M70A 2EG5A 5D1NA 4CKBA 1DCTA 3LCUA 2IH4A 4YV2A 5U4XA 1NW5A 1RI4A 2HNKA 3DXXA 3MERA 5C9ZA 2NXCA 5EMMA 3T0IA 2VDWA 3O31A 5DSTA 3SSMA 2BM9A 3FPFA 3FUXA 1XJ5A 1KPHA 3KQOA 3THRA 2PX4A 1KPGA 7MHTA 3DOUA 3ME5A 5DM0A 2Z6AA 5GINE 4RVFA 5K0BA 3DTNA 1XVAA 5FA8A 5T6BA 1RI1A 2HTEA 3OZRA 4NECA 2ERCA 1VP3A 1YUBA 2FYTA 3EVAA 5K0GA 3U81A 3UJ7A 2B78A 3HM2A 4GOOD 3OE4A 1O9HA 2PT9A 3P9NA 2E5WA 2G8NA 3CVOA 4E2ZA 1O9GA 1F38A 1XXLA 3JWGA 3LCVB 1I1NA 2PY6A 4IKPA 2ZWAA 3SX0A 4E2WA 4PIPA 4OQDA 1MHTA 1SVUA 1VL5A 4LWPA 3B3FA 4RTPA 1ORHA 2AOUA 3FRIA 3MB5A 4ER0A 5GIOE 4CTJA 4QDJA 4GC5A 2H11A 2AZTA 5E1BA 9MHTA 2P7HA 3HVKA 4X63A 3TLJA 1BKYA 4DCMA 4RTJA 1M6YA 3UBTA 3EVEA 1IM8A 2OKCA 1YFJA 1X1CA 2O05A 4AX8A 4FT4A 3BGVA 4HGZA 2NYUA 4X61A 2PX8A 3EVZA 1SKMA 2NNWB 4HH4A 2AN4A 2N47A 3A7DA 5DXAA 2V7EA 5FA5A 3SGLA 2CWWA 3GRRA 3MTEA 3UFBA 4C03A 3NMUF 1HNNA 5DXJA 3EPPA 5CM2Z 3TOSA 4OA5A 4BLUA 4PYNA 4R8RA 3ELWA 1JG2A 1WZNA 3DXYA 4M37A 5HFJA 2FK7A 3DH0A 2FPOA 3G2MA 3EVBA 5EVJA 3DLIA 2AVNA 3JWJA 5HZMA 3EMBA 2B2CA 3GDHA 5EGSA 5KVAA 3HCBA 4X41A 3TM5A 4PYMA 5GIPE 2ZLBA 4XUCA 4DCGA 5FCDA 1VQ1A 3OPNA 3PFHA 1XCLA 3PX3A 3K0BA 1R74A 3KR9A 2EFJA 3FTEA 5IKMA 1NV9A 4HSGA 4RV9A 4FP9A 3NDJA 2JH8A 4LECA 5DSXA 4C06A 1N7JA 4YUVA 4PYLA 4FGZA 2ZIFA 5E1DA 3G2QA 3M6XA 5D1HA 3A25A 5F2OA 1R18A 3ELUA 3MTIA 3EEOA 2IBSA 3G5TA 2UYQA 2NXEA 4PINA 1TW2A 4V0RA 4ZTBA 2YXDA 5ERGB 3C6MA 3CC8A 1L9KA 1EIZA 1SUIA 2VS1A 5CVVA 3P2KA 4HG2A 3HCEA 3SSNA 2XYVA 4KIGA 2JH9A 2BH2A 3E8SA 3SMQA 3MCTA 3KQSA 2G1PA 1I9GA 5HIIA 2HMYB 1P39A 4GQBA 5K05A 1YF3A 4QVKA 3REOA 3P8ZA 4YUXA 1O54A 2JHPA 1EAMA 4IV0A 1D2HA 3L8DA 3NVMB 5FHRA 2P41A 4AZTA 1ORIA 4C07A 1B42A 3CJQA 2I7CA 2ZVJA 5DTMA 3G88A 5EZSA 5FQOA 3HCFA 2AN5A 2GS9A 1SQFA 1JG1A 3TQSA 1KYZA 1Z3CA 3A7EA 2Z6UA 5DRTA 2QY6A 3E23A 4RVGA 4EKGA 3FUUA 5JUWA 3E05A 2OYRA 5CIYA 3KQTA 2BZGA 3KR1A 5GM2A 1YFLA 3OU6A 4R05A 1NW3A 2P1DA 2IH2A 4E2XA 2H00A 5FULA 1VP9A 3MAGA 2ZBPA 3HVHA 5EC8A 3TFWA 5LQKA 3BGDA 3I64A 1KHHA 4FR0A 4HTFA 2PLWA 3A4TA 2P3QA 4JXJA 3UJ8A 5HOQA 3M4XA 1QANA 3QV2A 4P7GA 3LDUA 2PWYA 1UFKA 2PX2A 5DT2A 2PGXA 1V39A 2BR3A 3QOXA 5IH3A 3HTXA 1VBFA 3FYCA 4P7JA 2F8LA 4AZWA 1D2GA 3SVZA 5H02A 1T43A 3I53A 4R8SA 3DULA 4U7PB 3LKZA 4DMGA 3T7RA 3LHDA 2AVDA 2XVAA 1QAOA 3GXOA 3NWEA 4CWAA 4L7VA 3C0KA 2ZBQA 4HRAA 4QTTB 1JQ3A 3BWBA 3HCAA 4ISCA 2ZSUA 3G2OA 2B9EA 2JHCA 3BWMA 3I9FA 2ZBRA 4G56A 1L3BA 4EVIA 5CVEA 5CUQA 3G2PA 2R6ZA 5LSAA 4GBED 4AZSA 3P2EA 3UJCA 3ANXA 5HIMA 1DL5A 4CKCA 1WXWA 4RX1A 3KR2A 5E9WA 4E33A 2IBTA 3VC2A 5K03A 3AXSA 3EVCA 5HILA 5EQJB 3MQ2A 4BP1A 5CCXA 2ZZNA 3KKZA 5B1SA 5K0EA 3M6VA 4K6MA 3C6KA 3HA7A 1X1BA 3MCZA 3X0DA 3GIWA 3GRZA 5FHQA 3KPUA 5BW4A 3R9XB 4C05A 1JQEA 2VDUE 3TM4A 1KP9A 2EJUA 3KPVA 3GRUA 4GOMD 5EG5A 2IGTA 4P7FA 3T7TA 2P3OA 1FPQA 2P3LA 2AOTA 4A6DA 4RVDA 4CXMA 3PLAE 3OZTA 1RJGA 3TKAA 3SXJA 3UA4A 1X1DA 2P7IA 5EOVA 5K0LA 1WY7A 4RYLA 2CL5A 5GM1A 2R3SA 3SR4A 2NP7A 1QAQA 2I9KA 3RIEA 1KPIA 4OBWA 4C4AA 2OXTA 1G38A 1ZG3A 3RW9A 4C04A 1WXXA 5CCBA 2G71A 3F4KA 4FS8A 3ELDA 2O06A 3G89A 1N7IA 3NTVA 2O57A 4ER7A 2HV9A 4KRGA 5F2KA 1RJFA 3V8VA 5EMJA 5KQRA 3HCDA 1NBHA 4XCXA 4YMGA 3GCZA 4M36A 2PBFA 1OR8A 3LSTA 2ZIGA 3KQYA 2DULA 2FCAA 3VYWA 1G8SA 1AF7A 3UJ6A 4E31A 4YV0A 4GF5A 5CVJA 1D2CA 4B17A 2GH1A 3LGAA 2GB4A 4GUAA 4PYIA 5GP1A 2QRVB 3LDGA 2A14A 3I58A 5LQNA 1WS6A 5ICGA 1R8YA 2JHAA 3DR5A 3HVIA 2PJDA 3IHTA 1KR5A 4WVLA 5DX0A 5FWDA 5BXYA 5HIKA 4R6XA 4E30A 1EQAA 2VP3A 3EMDA 3FYDA 5EZQA 4ER5A 3MGGA 1ZGAA 4KW7A 4MWZA 3OCJA 2GA9A 4RVHA 5FUBA 4HC4A 4OQEA 3CJRA 5EEGA 1R00A 1JQDA 5HIJA 1SUSA 4CTKA 2IPXA 2G72A 1P91A 1P1BA 4PYJA 3BUSA 3DMHA 3P9CA 5K01A 3R0QA 4F86A 1JR4A 2V74B 3B5IA 4POOA 1JSXA 2P35A 3B89A 3FTCA 2HWKA 5DM4A 4PWYA 2Z6QA 3DUWA 4O29A 3ER9A 3C3YA 4GOND 4P58A 2P8JA 4LWOA 5HEKA 3UJDA 3M6UA 3GRVA 1VPTA 2IH5A 3Q87B 1BHJA 4E2YA 5K0CA 3OFJA 4PCAA 5E9QA 3KU1A 2ZTHA 4FSXA 4PONA 1ZHFA 5EMLA 4BLVA 3EEYA 3K6RA 4UOEA 2BM8A 2UYHA 3AWIA 2Y1XA 5FQNA 4YUWA 5K0JA 2PWPA 5EHIA 2WK1A 4KVZA 2Y1WA 3TR6A 5LQAA 4YUYA 5K0NA 2FK8A 3CBGA 4M7RA 4V0QA 3LBYA 3TPZA 3HCCA 3SM3A 1INLA 3BWYA 4C08A 2AOUB 1XDZA 3CGGA 1G55A 1L1EA 2ONYA 3CCFA 3IYLW 1XCJA 2CKDA 1UIRA 4E70A 5KS2A 2FRXA 3LPMA 3RODA 2OZVA 3NW9A 4OX9Y 3OU2A 5T67A 4X60A 5M5BA 4FSDA 3KQMA 5DTRA 3BKXA 4RTMA 3FUWA 2B3TA 2PXCA 3JWIA 1EJ0A 1G6Q1 2ZW9A 3LECA 2O0LA 4PYKA 3OE5A 4QPNA 4XUEA 5DM2A 5BW5A 2OPBA 2ZWVA 3CJTA 3FRHA 4FZVA 5ICEA 1TPYA 5LQRA 2AOWA 4Z2YA 2PVCA 5K8VA 5EPEA 3KQQA 5DX8A 4M38A 3AY0A 2OY0A 1L3IA 3C3PA 1EG2A 1ZKDA 3DXZA 4RTNA 4IV8A 2G70A 1R8XA 1I4WA 2PX5A 3R3HA 2AN3A 4GOLD 3GWZA 4PYQA 5E8JA 4YV1A 3LL7A 5DPMA 3UJ9A 1H1DA 1YZHA 3G5LA 4QQKA 1ZGJA 4KWCA 5DWQA 3B3GA 3TKYA 4XUDA 1NW7A 5FWAA 1VE3A 2C7RA 2OBFA 1BC5A 5GWXA 1RJEA 3P71T 3P9IA 5E2AA 3KPYA 3O4FA 2ZZKA 1IY9A 3B3JA 2EJTA 3NJRA 3Q7EA 3BKWA 1Q0SA 2XYRA 1KYWA 1SQGA 3FUTA 3FPGA 2HR1A 3UJAA 4RTSA 3UA3A 5EMKA 3ORHA 2O07A 1PRYA 3P2IA 1KIAA 4QQNA 5E1MA 1RI3A 5EKUA 3OFKA 3DMFA 2VZ9A 1Q0TA 4WXHA 2YUIA 1NV8A 4DZRA 3UWPA 3B7PA 2YXEA 3LBFA 5T64A 1KXZA 4CKEA 5E9JA 3WSTA 2LD4A 3H2BA 3DP7A 4H0NA 4EK9A 2B25A 2BR4A 3LX6A 5EEHA 5G02A 2UYOA 3KQWA 5E2BA 4YUZA 3HP7A 4YMHA 2XVMA 3P97A 4QVGA 2CMHA 1QAMA 3BGIA 3KQPA 4DQ0A 4RTLA 5K0FA 2QE6A 2UZ4A 1PJZA 2DPMA 4P7KA 3AJDA 3UZUA 2ZIEA 1AQIA 2I62A 4KDCA 4IWNA 3KHKA 5ICFA 1AQJA 1R6AA 1YB2A 3KPWA 2OB2A 3KQVA 3S68A 3D2LA 3GGDA 4GEKA 4F85A 1HMYA 2ADMA 3HVJA 3R24A 2OB1A 5EIFA 4PGHA 3PS9A 4R6WA 4AUKA 2FHPA 2XBMA 3ELYA 1BOOA 2VDVE 3PT9A 4HTFB 2PT6A 3GJYA 3EVGA 5DTQA 1DUSA 4PYOA 4PNEA 3G7UA 4KIFA 3PVCA 2UYCA 3P9KA 5EIWA 1AV6A 3O7WA 4MQ4A 5C1IA 3FPEA 3BXOA 5CD1A 3QOWA 4QPPA 3BZBA 1G60A 1X1AA 4HGYA 4ER3A 2NXJA 3NVKI 4ATNA 2IDKA 1U2ZA 2ZZMA 2CMGA 3G8AA 3OU7A 1NW6A 3THSA 1FP1D 4MHTA 1QZZA 2JJQA 2K4MA 2C7PA 1QYRA 5FTWA 4DM3A 5LR6A 3HA5A 5E8RA 5KYGA 5LQJA 1NKVA 1Y8CA 4EQZA 5MHTA 1NW8A 4Y2HA 1MJFA 1YZ3A 2QM3A 4RTKA 3GNLA 5GOZA 1NT2A 3GU3A 4MTLA 2BR5A 3SSOA 3TRKA 5LQCA 10MHA 3IEIA 2AOXA 1JTFA 1VIDA 1L3CA 4F84A 1FJXA 2C7QA 1FP2A 2AOVA 2C7OA 3M33A 1N2XA 3HNRA 5ICCA 4MIKA 4RWZA 4AZVA 2ZFUA 2YQZA 1XDUA 4PCLA 2JG3A
chains in the Genus database with same CATH superfamily
1Z7GA 1ZAKA 4YGYA 1ZVKA 2X41A 3LYUA 5DM1A 1KJJA 3U7RA 3LPCA 4RJKA 3GG2A 1WCYA 2QUHA 5EPOA 1Z3IX 3FPHA 4EENA 5M7EA 4Q7QA 2PKWA 3EE6A 4EPTA 2G09A 2HF9A 3EC2A 3EOAI 3HKEA 3E22A 4TS4A 1AGRA 5DGCA 3RARA 4RVCA 3TQRA 3W6NA 3ZZTA 3VVMA 4LY0A 1DV2A 1IXKA 2AFIA 3I73A 2GN6A 3M6WA 2FNAA 2WJIA 3OKPA 1FRQA 4OO3A 1T8UA 3H42B 5ALXA 1LPOA 5J59A 4KREA 3ABSB 3CN9A 3RSCA 1X70A 4DHEA 4RF5A 4UNNA 1AY0A 2NYAA 4O0LA 2JI8A 5BSRA 2ZVPX 3T7SA 1ZVQA 5KVVA 4EJSC 3HDYA 5DLPA 3P9ZA 1REQA 2V3CC 2OG1A 4CQLB 1V1JA 4RDXA 3ZTYA 1MAAA 4BO9A 2I9PA 5I4BA 2YVLA 2ZJ8A 4FLFA 4JLPA 3H0KA 3N2ZB 4E88A 1B23P 1UWVA 1H5UA 4OBXA 4Q4LA 2J1LA 2C7GA 4YJGA 3REQA 3TQIA 3HP4A 1H0RA 2VTVA 4JITA 5L6MB 2JD0A 4Y18A 2I3DA 3C5HA 3CSSA 4J4BA 4OQXA 4CZ2A 1Z0FA 4HYEA 4YT2A 4GM4A 5F5XA 4UCWA 2YN4A 3C5CA 2Q8PA 1E2UA 2X7HA 2WMYA 1DAKA 1TUGA 3CE9A 2J6HA 1WX1A 4ZI7B 1ADYA 1LFDB 4DEVA 2HT1A 1T1EA 2HA4A 2WV9A 4EI9A 2FV8A 2IYZA 3N2YA 2DSNA 1J06A 1L6RA 3RDPA 3EGVA 2QTHA 4ZU1X 4A2CA 3WJ7A 2CLLB 4NDAA 4HAIA 2ORED 2FRVA 2O8BA 4G5OA 3IVGA 2DFTA 4X85A 1EP3B 1FQJA 2BFEA 5CYGA 2XNHA 5HRAA 1Z15A 1U7OA 3GUHA 2G4LA 1SC3A 4EUSA 2GBGA 4INPA 3NGLA 1GR1A 4CLHA 2JLQA 4L3VA 3ABRB 4O63O 3KV1A 3NLLA 4HLNA 3WWOA 1FUKA 4BE9A 1K3UB 1KPGA 2D5LA 4HEA1 4E09A 2OHIA 3CX8A 4B5LA 1GGJA 3HR4A 4OUDB 3IV9A 3DPSA 5T6BA 1MN6A 4AK9A 4EQ6A 3V2HA 1CYEA 5AI4A 1WULS 4OI1A 3C48A 3GBSA 5AH0A 2VF7A 2WSIA 1DAPA 2YS7A 1OTYA 4XARA 4AF6A 4MUYA 3PEVA 1SVUA 2FY8A 2YWGA 3FKJA 1HDEA 4KQEA 1H6AA 5CRIA 2AOUA 1XN1A 3VO1A 4BBZA 1MEEA 4PZLA 1LNQA 4X1KB 5GIOE 4COKA 1GVHA 2XDYA 3AGPA 1EFVB 2MINB 1YE5A 2OQIA 3MNFA 3QVXA 4H59A 1JPUA 3N8IA 3I04M 2DUMA 1KDVA 5JVDA 4BLRA 1UIMA 3TEMA 3DWGA 4FT4A 3UFXA 4F5DA 2IHTA 3QGMA 1JYEA 1CE8B 3EVZA 3G9UA 4XW2A 1HNXB 4MV4A 3DW1X 5CK5A 5FA5A 2QLFA 3EJ6A 4TM8A 5JS7A 2CJWA 4OYYA 3PDHA 1EX6A 2PX6A 1FRNA 2HOQA 5CH5A 5KAPA 3WQBA 2XGMA 4TTJA 1A4UA 1LH0A 2WTEA 2OD7A 2C3PA 3OY7A 1WZNA 2BDUA 3D7KA 1BVUA 4K81B 4YQZA 3PV0A 5HFJA 5T4HA 1I6MA 3VNSA 2V0GA 1O5OA 1Z4KA 2WG0A 3MB8A 1PZMA 5IP5A 2JLSA 4DGSA 3IKTA 4DR4B 4LPKA 2BFPA 3F5DA 4XQ0A 1M2HA 5IHPA 5JIBA 3PX3A 1M34E 1RFLA 3SF0A 2BP7A 1N77A 2P1ZA 3WGQA 3PEEA 5JXJA 4TZTA 4RV9A 2XNCA 2PUCA 4YACA 1ZJWA 2X5OA 3FJ1A 3EA4A 5HUQA 3G2QA 4HDKA 1YJQA 5SV2A 1HETA 2OQVA 5JMOA 1S96A 3QEMA 4RUKA 5L95A 4J1TC 1RVV1 3JD1A 3WY9A 2CGEA 5ITZA 4V0RA 2MYTA 2BEWB 1NUUA 2JFFA 4D1YA 5BPFA 3EA0A 4MWOA 2AYZA 4QGAA 1AH2A 4FYPA 2EZ4A 3WGGA 3A1UA 2PH1A 1AHPA 1XROA 2OP0A 4WOBA 2AMLA 3CWCA 5B3JA 2P4EA 5E4YA 3HJBA 4RLFA 1JQJC 4XAQA 4O4LF 1MNQA 1ODSA 4X93A 2EBWA 5LOVF 3CZCA 2WWTA 2JCSA 4H4DA 1V4BA 3REFA 4A1OA 1VCMA 4YJFA 1W36C 2NIPA 2O2YA 1N1GA 1BMTA 4Y6LA 4RJTA 2E4ZA 3HBMA 2HIAA 4C07A 1ODFA 1HGXA 1GYPA 1UOPA 1XPJA 3CR3C 2B4RO 1C9JA 4ZAFA 1JPVA 3UUGA 3PGA1 3EWAA 2BCEA 1LBSA 4YP6A 3NH6A 3TQSA 3TXAA 1GTSA 3N5KA 3WYBA 5KKAA 2XWPA 4EHBA 1E94E 3W0LB 4YXWD 5JNTA 3IX7A 1T6BY 1VXRA 4RVGA 2UUBB 1Y8RA 3MBKA 4IMJB 5CNJA 1NUAA 1NNLA 4B3IA 4I81A 3UGQA 5K51A 1L6IA 5KKCA 2FEWB 1Y80A 4I4TA 2NSLA 1OZFA 2YJTD 1MGOA 1S8OA 4QQRA 4WJZA 5LQKA 2GK7A 4EYOA 1MH1A 1OAKA 5BYBA 1NJFA 4B6GA 5C35A 1UBOS 1YIAA 1I3CA 1MIOB 2QSJA 4FOOA 1OFVA 1WDKA 2BGTA 2MSCB 3ET5A 2HHLA 2PLWA 4TTRA 4B8ZA 4CJXA 2PRKA 1XEXB 3EULA 3FDZA 2QJFA 4QBFA 2VVTA 3ZZMA 3I39X 2BEVB 2JIQA 1JAXA 1Y9EA 2IXBA 3ESCA 2HB6A 3I92A 1DEHA 2Z5GA 1V39A 4XR9A 3ZK7A 4D45A 4YRKA 3ZWXA 4CMJA 1N2IA 1W2HA 2W8BB 3I12A 3KOOA 4BVBA 4LYGA 2D1TA 2BKAA 3B6JA 4MQUA 3LVQE 4A03A 5IU6A 2R79A 2BOVA 4K3UA 1ICEA 1DC3A 4M9UA 3ZE0B 3IDOA 4DILA 1EESA 2XVAA 4GNKA 1E3QA 3DE6X 3U9LA 3V9PA 3AZQA 2QRNA 1Q1BA 3K2QA 5K4GA 1FP6A 2JK1A 3B8EA 3COWA 1DGQA 3I9FA 4EVIA 2JIPA 3ZI4A 4AJ9A 5E3IA 4UVHA 2ZJAA 4LJLA 3OX4A 5EVCA 2BMWA 3I61A 4V02A 2G63A 2QK4A 4BJ6A 4HAVA 2WIJA 1B4DA 4ARSA 5CYOA 4RX1A 1JEAA 3FJOA 4U7DA 5IH7A 2H9IA 1U81A 1T5IA 3LVBA 4BXOB 1CR6A 5AWFC 3T5DA 2HHHB 1JYFA 5AI8A 2JLVA 1CR4A 5H68A 2R6JA 3RVMA 2O8DA 3VNAA 1HLDA 4I1RA 2AJBA 4UU1A 2ZCUA 3MWJA 4MRRA 4L27A 4BLOA 4JYAB 2UV8A 4MCJA 3UCEA 4F8YA 3IURA 3PJRA 2QDKA 2P3OA 2BH9A 2ZJOA 3EY4A 4L9WA 5CJPA 5KCMA 1KK0A 2BE7A 2BFBB 4BQFA 4MPPA 4URVR 5HR5A 1UMDA 1OXKB 1VCNA 2JGFA 1QFXA 1L4EA 1XN4A 4PLCA 2CL5A 2NQ2C 4CODB 1QAQA 2X9QA 1OX4A 2ZYAA 3Q4GA 4EL0A 2FB9A 1DAMA 4C9BA 1ZG3A 2AIRA 2I76A 3WRXC 4QFBA 2P0YA 1TVKB 4M21A 2M2IA 3OX3A 4FDMA 1RM0A 4UVIA 2IHJA 2DMRA 1RJFA 4DIBA 3I3OA 5T5QA 3BHIA 2UVPA 3DBHB 4BEVA 3U4DA 3ZOZA 3BHJA 4ZOLA 1MC4A 4E31A 1JS1X 3EXHC 1DKRA 3TFQA 4GF5A 4L8FA 1C8VB 3F96A 4N7BA 4FMDF 3RVOA 5B6PA 1ZRNA 4H7KA 4ZYVA 2HBYA 3NHSA 1WS6A 4RLQA 2SCUB 1GEEA 5I7RA 4D8YA 3LNTA 1EBBA 5FWDA 4WT7A 5HIKA 2E6KA 3CEHA 4OGKA 1HZJA 1SVKA 4WKBA 5DXFA 1UADA 1V5FA 2IEDA 5EUBA 1JHRA 3QKIA 4ND8A 5T3YA 2QE7D 2LXNA 1FFEA 1RPAA 5LXTA 4F06A 3PEWA 4GGMX 5ILQA 4YAGA 2VDQB 4BKRA 5LYJB 1ESCA 2PZLA 1MABB 1ZH4A 2I2XB 2C5LA 2G82A 4LIPD 3R5FA 2JK0A 1R6VA 5E6UB 1JYSA 1SZPA 2IWHA 4BGEA 1GA1A 1JG6A 4N12A 3Q7TA 3ER9A 2FPWA 4LWOA 1EQ2A 4NCBA 1U8ZA 4L76A 2I2FA 4H3SA 1DCKA 1VPTA 4I66A 2ZTMA 3COYA 4UPEA 1FS5A 4U7HA 3OG9A 1GZ6A 5KC8A 3AV3A 5EMLA 2PZAA 4G5RA 5FEUA 3OEWA 1RHKA 5AVYA 2YJ4A 2PWPA 2V5AA 1H42A 4Y6SA 1NQXA 3VPAA 1T3ZA 2GN2A 2Y1WA 2VH1A 1MO6A 1LK5A 4ZYTA 2OWDA 1M74A 5K0NA 3H4IA 3IBSA 2FZCA 3FCSB 3KRTA 4M0CA 1EM6A 1GZHB 2B92A 3BWYA 4QEKA 1QGYA 4BMNA 4I36A 4ROSA 3HACA 4YR7A 1RMYA 4NF2A 3LFTA 2EYUA 3VKHA 4TWZA 5B58C 5I9MA 3IKMB 1P4RA 2OGTA 4OX9Y 1XVVA 4H7FA 3KQMA 1DBIA 3RYTC 3FUWA 4BP9A 4Q4CA 1EJ0A 1GWNA 4JUDX 5FAKA 5CD9A 5IJWA 5BYJA 1U3FA 4HTAA 4HMQA 4HWTA 1S2MA 4M0LA 1UJNA 3OEED 5BSWA 3M9LA 1LBEA 1I24A 4RKFA 4BVKA 3O8RA 2ZWVA 3FRHA 1KERA 1SOMA 1FFGA 3IUJA 4G1BA 5KDDA 2XCIA 1NN3A 3PQFA 621PA 2OUKA 1VJRA 1E9VA 4EA7A 3AY0A 2AG8A 2EJBA 2G70A 3BF7A 2WNHA 1I4WA 3CW9A 3H1PA 3IL2A 5DMHA 4LRTB 3PDJA 5E4JA 2J9GA 3FF1A 3NHBA 3UJ9A 4DA8A 3AF1A 2FSGA 3NV7A 2X4IA 3QITA 3TKYA 3D1JA 2FLKA 2Y1GA 2QD1A 4MK4A 2J30A 3B53X 3WFJA 3ZX4A 6REQA 1VE3A 3OQNA 4XWOA 1E1KA 1D2RA 3VPDA 3ZEAA 4E4RA 1PFQA 2MU1A 2XQIA 4JY7A 5HDBB 1EFHA 3FHJA 1U5CA 3KZMA 1PZXA 4KLCA 1A5SB 4O1HA 2QQFA 1CB0A 3CSDA 3RHFA 2O5EA 4DIOA 1C3EA 4AQDA 3FPGA 4BWYA 5DN9A 3THXB 1DO2A 4OIFA 1FU8A 1P2BA 3ROPA 1MPXA 2GTIA 2MSNA 3CX6A 3G9QA 3E35A 3KCNA 4WZBA 3WKAA 1E64A 1EJBA 1HT3A 4EHLA 5BSEA 3IRUA 3CNOA 4TLLB 5EHQA 1N0HA 3TL2A 3WMEA 1F6BA 4LJ7A 1KI2A 3IBGA 4NBLA 4QUJA 2B94A 3DYVA 5FOWA 4Q3KA 3H4VA 1SA0A 4DSAA 2XMSA 3LUDA 3ADKA 2QUJA 1PUIA 1ZI6A 3F2IA 1YQWA 3N8NA 4FYMA 1NWCA 2W5UA 2IYLD 2EZTA 2J5RA 2VCHA 3GAMA 3LY7A 3FX2A 3ECCA 5I4KA 3LA6A 1GTVA 2YWHA 2XZTA 3FVRA 1JEYA 4F91B 4YCDA 1JHUA 2VKQA 3VH4A 2J3LA 3ESZA 2YFQA 3OIFA 1E5QA 4PX3A 4MA0A 3TVYA 1N2HA 3ZUPA 5KTKA 1YRWA 1PJZA 3QE9Y 2A5FA 3L93A 4FUQA 4GMKA 1C3JA 3AUXA 3CRVA 4RH3A 4BNKA 2HMSA 3BMCB 4KSYA 4NE9A 4ETMA 4YK7A 1SCNE 1YB2A 5A03A 3H9EO 4QTXA 4R51A 2OV2A 3W78A 1PJLA 2VRWA 1W581 3CEPB 1EEHA 1XCBA 1Y3AA 4CT4B 1DIGA 1PTKA 3CW8X 1P5ZB 1OLSA 3DHEA 3EQ9A 4IVQA 4PAWA 4A91A 1N78A 3GZNB 3X1YA 3JQ7A 4G4IA 3E81A 1T3GA 4ILEA 4D99A 4UASA 2X0IA 4MVCA 3F8SA 3HJRA 2PUWA 2EXXA 3DE5X 1KSGA 2Q5OA 1COZA 3KJQA 3LUPA 5C7LO 1WV1A 1X42A 4LK3A 3LQFA 1FBTA 4POAA 1PX0A 3RV4A 3ZIAD 1R4NA 4HRYA 4BMSA 3NVKI 2IW3A 2H16A 1X7XA 2D5AA 3AR9A 3IPLA 4P6VF 2B99A 4LC9A 3ZWKA 2ZZMA 1Z0KA 1DP4A 1YASA 1QTNA 3TB6A 2VHJA 3JQQA 3OJXA 4Z5XA 2PL9A 1LK0A 2AFRA 4Y2HA 5DHPA 5CEFA 4LCEA 1YK1A 3GNLA 1A8QA 1NT2A 2WJGA 3AI2A 4XGRA 3QWIA 3VDXA 2WWWA 5A1TA 5AVSA 4ZVLA 2RHDA 2IPNA 2JAQA 2VI5A 2VPQA 3CUTA 4R83A 4K40A 4LXIA 1YBVA 2A94A 2QR2A 4AZVA 3U9SA 4BMZA 3OWOA 2D6FA 1XDUA 1ESZA 1BEUB 3LO8A 3T7KA 4P34A 5JASA 1FXWF 5JG7A 1OOEA 4Y30A 1RRGA 4E32A 2GEBA 1JIQA 3MK31 2XZOA 1ZDMA 5JAQA 5GJBA 3ZWMA 1E69A 1HL7A 2FSVA 2BYTA 1SD2A 2FEKA 2UUAB 1CS0A 5BP7A 4QUIA 3RU2A 1TT5A 2WJVA 2IDJA 3L1KA 5CFLA 3NRBA 4M0FA 2IYSA 4ZIRA 2GBFA 1NC1A 3QEBZ 1ZOSA 4HQ0A 1KKLA 1QIIA 3RVPA 1V1RA 3ETHA 3TLMA 2BFOA 3RYHA 2IT1A 4U3JB 4P4SA 4BJ1A 3NWBA 1TJNA 2PV0A 1SHUX 2BI8A 3H11A 5ENVA 3P9XA 1PYOA 4BGDA 1PVDA 5F3WB 1BJRE 1JHZA 4WBSA 3EVFA 3LPAA 4HLQB 4BKPA 4IDEA 2YV2A 4DY4A 2DF8A 1S3SA 4Q9KA 3UVEA 3HKBB 4CU5A 2FEOA 5FV7A 1T2CA 1Y6RA 3H2GA 1Q21A 5DYIA 3IIIA 3AUTA 3O47A 3A2LA 1R0RE 5CB4F 1OZHA 4MW1A 2V7TA 3P4XA 4B80A 1XHEA 4HRVA 1N6OA 2EX4A 4UM9D 2WWIA 3DT9A 3KR0A 3UMMA 5FBLB 5IK2D 4FKBA 1R2QA 1KQOA 3WGHA 1GPNA 2ESRA 3EF3A 3Q6MA 5AM1A 5TPWB 5B58T 3BTUA 3AVUA 4CKBA 5IKEA 3WA6A 2AHOA 5H5JA 4JU8A 3R5TA 4OB6A 1HDCA 3FHOA 3CM0A 4B6PA 2AV6A 3WLIA 4LMBA 4CPDA 1VSTA 5EMMA 2JHGA 4D9JA 3KUKA 3KZXA 5K3CA 1P1JA 3A1EA 4JFAA 1YZYA 1FYVA 1ENZA 1MBZA 3QX8A 4YJHA 2BFWA 1Q14A 3L7CA 1GRVA 4KFTA 1CFZA 1T34A 3UMFA 4DRXB 1NG1A 2Q4BA 4MEBA 4KWHA 5ISMA 3OZRA 3I0MA 1HMPA 1TF2A 1YUBA 1FXUA 1E61A 3E7XA 3AHDA 1XVIA 2NU7A 3CS3A 3U81A 5LKRA 2X23A 4MS3A 1ZH6A 3WGTA 3K53A 4L8YA 3P9RA 3JWGA 5B1IA 3CLUD 1I1NA 1UOQA 3F3SA 4X8LA 3SX0A 1QO0D 3KT3A 4MQMA 4OQDA 2X58A 2Z1DA 2IUTA 4HXYA 1XHFA 4KFRA 1EGAA 3H9JA 4QPZA 1K75A 4XPIA 4TRMA 4DLPA 1IBMB 3G2KA 1DXYA 3OZDA 3AL3A 4QHSA 1XNRB 3NONA 9MHTA 1XK6A 3IOCA 1YR9A 1X3LA 4B09A 5A2QA 4CLOA 4PAOA 2LZ0A 4TSKA 4WNAB 2P2NA 4FMBB 3RSSA 3Q8WA 3WZLA 4CQMD 1E3LA 4BTVA 1YU9A 3WNCA 1U04A 5A62A 4OCZA 5CJJA 5CGQB 2ZRPA 3BQNB 4R1SA 5DASA 1U6JA 3I5XA 4Q66C 4WK0B 3UXHA 3ZW8A 2YNMD 1JV2B 1XZGA 2R8BA 1CUWA 2ZBUA 2F3RA 3GLIB 5LD2C 3OEYA 3B48A 2ZJ3A 4RZIA 5EGSA 3ZDCA 3L7MA 2F1JA 2ZIAA 2QSZA 1MQ8B 2KJQA 1U4SA 1IONA 2CK3D 2EFJA 3DCJA 1QHSA 5EIBC 3FMVA 3MXOA 1KSHA 5C18A 5IKMA 4HCJA 2C0PA 3C87A 5L3RA 3BMOA 1ANKA 1WKCA 1KFJB 1L5MA 3BIFA 3WLTA 2RGGA 3IQEA 1LJLA 1LZLA 3B1ZA 3MCVA 5KYWA 2FCRA 2CNLA 2FA9A 2X0DA 3DE4X 2WHEA 3RROA 1U6IA 2NSDA 2Y99A 2DKOA 2MYUA 3BM5A 3MAAC 3NUQA 2QF7A 1VJ5A 4FKMA 2OO5C 1FVXA 2H65A 4R0NA 3SHTA 3TRDA 3NYWA 5DBGA 5KBYA 2I2WA 4V1CA 2KHZA 3U4GA 4S1NA 3ZN2A 5CVVA 1NGSA 2JJ8A 3BEOA 3DZKA 1CZKA 3M9XA 1XMIA 2ZPTX 3HCEA 3KC2A 4IOKA 2PD6A 2JH9A 4XD2A 5DI9A 4Z99A 5ALOA 1A5BB 3PD7A 3RVSA 4EG7A 2FG5A 3O3OB 4OJYA 1PD1A 3CZ5A 1EKXA 1CJKC 3EXEA 3Q8XB 1HKHA 1VLJA 2FUKA 2O20A 3N2GB 2ZRNA 1G8KA 4IKEA 1DC4A 1YJXA 4UW9A 5F77A 1NMYA 4ZU6X 1U1EA 4OMFG 2EW2A 5FFNA 1BVYF 1U8EA 4MXDA 1ORIA 5TQ2B 1L7EA 2I7CA 1JNXX 3ZXSA 3G88A 4R3NA 2XITA 2OHGA 2QNBA 1L5KA 4L8LA 4X64B 1PLKA 2L42A 3MJ4A 3OWXA 3OZGA 3WYAA 2RE8A 3GH3A 5D00A 5B2ZA 6ABPA 1YULA 4MX8A 4KE7A 1YRQA 3BRWD 1ZUNA 3FH0A 2B1GA 3G02A 2FPGB 2QT1A 5AIAA 3IQHX 4NV1A 4BFZA 2PGLA 3BRQA 5FORA 1KXJA 1YDEA 3PF8A 1ZR4A 1VPDA 2QJRA 5H70A 1JXAA 1T15A 2HUPA 2VRCD 1T1SA 3V1YA 1A27A 4ROTA 1GFZA 4DUYB 3UC5A 2OAGA 1AQYA 1XZFA 2QNIA 1SC4A 3KQHA 5A4AA 3MGKA 4RPHA 2GBCA 3AR6A 4LQ4A 4YRTA 1CJBA 5ITVA 4FUTA 5KZMB 2X42A 2F90A 1PFWA 2VCYA 4UHJA 3VKWA 1UFKA 4BFVA 2VSFA 1PNVA 4NAVA 3RIYA 1WR8A 5D2CA 2CV1A 3OOJA 2OENG 4ZQCB 4XYGA 2HCTA 3GUVA 4BMYA 4OFZA 1M72A 1VRVA 2Q6TA 1NP3A 3PWZA 1X38A 4ZARA 5BSMA 1AO0A 4DR5B 1UL1X 3HDHA 5AK0A 3DOFA 1SVIA 1YR2A 1E2BA 1W5SA 3R6LA 1KI6A 3LIIA 3HVUA 1KAQA 1YB7A 2Y4NA 2A0XA 3K0CA 3G2OA 1E4VA 1NBWB 1LWNA 2ZBRA 3Q0EA 1L3BA 2HF2A 2I6SA 3NBXX 2G80A 4WLNA 2JCVA 3W1EA 4Z7NB 3JYPA 5IAJA 2D2VA 3CLTC 1YQGA 1RQPA 1BEEA 4I46A 5J4YA 4H77A 4DCVA 3UJ3X 2HA0A 2TS1A 1DQZA 4Q3OA 3A10A 3D54D 4Y2VA 5CMLA 5EKSA 1RS0A 2EARA 1JNYA 5IM4F 3T5CA 2OZKA 2IOFA 4X7BA 3KKZA 2AF3C 2XD9A 3AGQA 4RACA 3UHPA 5HK9A 4YRSA 1WTCA 3SKXA 4DA7A 1TUIA 4JC8A 4ZZ2A 5FHQA 2BFFA 1TZBA 1T35A 3VAAA 2CUNA 1JLMA 4EFMA 1KMNA 3N59A 3CURA 5F1YA 1Q1NA 5FLKA 5COAA 3NQ41 1G7RA 2XTAA 4M0PA 3D31A 4DQKA 1OI4A 1KZ9A 2CNWD 3IQFA 5C8YB 3GLSA 2IHYA 1M1XB 1YCHA 4CF3A 5HQ3B 4NFHA 3H04A 4TSFD 1Z07A 1T5TA 1EUDB 2CXXA 2WWFA 1Z4NA 2RC6A 2ZR9A 1I0ZA 2C5FA 1P4HA 3PNBA 1N2BA 1UQUA 4TUYB 4QLAA 5CU7A 4A0RA 1G38A 4TT8A 3RHTA 1V9CA 4AKEA 3W9BA 1DKNA 1SB9A 4F4HA 5DHFA 2FPPA 3LQ1A 4CVNA 4O2RA 2O06A 5A6SA 1XT6A 2HT6A 3CLVA 4EYGA 3FCUB 1JEJA 5KQRA 4L22A 1MC1A 3O1LA 3R0VA 5IFLA 3GCZA 4M49A 2VPXA 2YWDA 4X1IB 1OXBB 2HWYA 5DBFA 3M6FA 2VP2A 2NU9B 3UKDA 1SUEA 2YHAA 5CXUA 2OKGA 4EHJA 4QGHA 3B2EA 3V4VB 4BRZA 3A6EA 5E6RB 4AJ4A 2W9XA 3NRCA 5LQSA 1DHTA 2RHJA 1U3WA 3Q72A 4J0CA 4LQDA 4P22A 5DK4A 2JHAA 3UQYS 4MKXA 5T4FA 4FCCA 3KVYA 1DQNA 2QLLA 1Z37A 2NOAA 3TVTA 3MGGA 4MNTA 1HT2E 4ND7A 3TZBA 4BO8A 3HUEA 4FW9A 2YS6A 1M2VB 4IINA 1Y3FE 4MWZA 4RVHA 3UKJA 3FR7A 4S1TA 2C58A 3JV7A 1TEHA 4Y3UA 1GNQA 3K1AA 3U1VA 4ZAGA 1C3OA 3K73O 3PD0A 1ZM4A 4HH1A 2Q7DA 3VKFA 2GNOA 2NVBA 1YNOA 2PZBA 2ONKA 4GSYA 4WIAA 1NZDA 4F3KA 4M53A 1AQ6A 1E3WB 1NP6A 1BU5A 2D8AA 2XKJE 3FTCA 3CNQS 1QKKA 3IVRA 4Q1EA 4TXNA 5DVZA 2GLTA 4J3NA 3VV3A 1N2CE 3LHFA 1VMDA 3FCCA 4O4JA 1RJ9A 4Q1FA 1QG6A 3GRVA 1XVLA 2VDLB 2NPFA 4DIKA 2OXIA 4QJ4A 5MFZA 3IXMA 3OFJA 4EA6A 3THWA 1TPZA 5E9QA 4X8OA 1QHGA 5MDHA 4BFUA 3SQXA 3UANA 4U63A 1L5YA 3M5CA 4KO3S 5I9TA 3LW8A 5FQNA 2Y1XA 3LUKA 1LBIA 3SK0A 3SQLA 3ZJUA 1NLUA 1EXNA 4YMIA 3LC0A 4E4TA 1DB3A 3SQOA 3QM1A 1SOWA 1Z8HA 1DJOA 1HV8A 3KOWA 3HWSA 4AJHA 3UXEA 2ZRCA 4UBJA 2WJ6A 4TQAA 5A4MS 3GJ3A 4E08A 2PWZA 4RF3A 2OXCA 2D2FA 3ZDBA 2RHBA 1C0KA 2QKYA 5FBQB 1N2CA 2CVFA 4FSDA 4GFDA 5ALSA 4LI0A 3V2IA 4U4AA 4QOFA 1XI2A 1G6Q1 3MMSA 1B16A 1U7WA 1YV9A 2AW5A 2EF0A 1KVUA 4A6PA 3B5EA 5GTDA 1UP6A 3R6DA 3HJAA 4CEIB 4KRFA 2HQRA 2O8FB 3AERB 2AOWA 2GM3A 3QUSA 4FBMA 3ND7A 4I9FA 4DDHA 6AT1A 1QFZA 5B12A 3VMMA 3C8DA 3QVOA 2OY0A 4BIMA 5IVPA 5K0TA 4C6RA 2J08A 3G82C 1CKEA 1J2EA 1E3IA 4L2IB 5EXDA 1VE6A 5BXQC 1EB9A 3KOYA 3JY6A 2IQ5A 1I7QB 4BJHB 2AG6A 3D6NB 4JA2A 4LX8A 4MRSA 4Q4AB 3QF4B 4Q9HA 5CLQA 4E51A 1TT7A 3OI7A 4XE5A 3F6SA 4IZHA 5DHUA 3INNA 2WIKA 3K05A 1AX9A 1L2TA 3O4GA 3PDIB 4Z4QA 1BMQA 1TVMA 1USVA 4DNOA 2FFHA 1PDVA 4HDMA 1TM3E 3B3JA 3W8EA 1X15A 1QIFA 4W5JA 1BYIA 1W5AA 3JARA 4C6TA 4N48A 4I1UA 3NTRA 2WG2A 2BELA 1I6WA 1OFIA 2C61A 4G6ZA 1Z0UA 3U17A 1THZA 2XWBF 5I8ZA 3D7RA 3AFNA 2ZXEA 4HBGA 3WNBA 3UGJA 4B7CA 1F12A 3P2IA 3NOVA 3PUYA 1YKSA 4UE3S 1N9GA 2LE0A 4ITRC 1RVDA 3LT5A 4G67A 1NDQA 2X5JO 3DEHA 4OK3A 2WOJA 4YAWA 1QK4A 1H0HA 2DE0X 1ZJZA 1T5HX 3LWNA 4Q7EA 5DM60 4EZEA 1OT3A 5FBVB 2WIDA 2HLPA 5T64A 2ZIUB 1MVNA 1KXZA 1NZJA 4D6XA 3PQ4A 5TR9A 5FWXA 4YIKA 1W5TA 2Z98A 2H54A 3FMOB 3NIGB 4E1BA 2IC5A 2HREA 2RGNC 1H9AA 4Q9NA 2OHJA 1WW3A 4M7OA 4X8MA 4B7AA 4D82A 5DNVA 2J5XA 2VHEA 3HKCA 4TQUS 3CUSA 1CP2A 3IE2A 1E1YA 3KB6A 4UDOA 1A69A 1T4DA 4BUJA 4DQ0A 3CLHA 4AMUA 4L4ZA 2XADA 3IDFA 2H4HA 4XYMA 1FCJA 1IEQA 3SLRA 4LBWA 2JI4A 4QEZA 1XMOB 3AHIA 3GR6A 4YFVA 1R9JA 3EIUA 3QFFA 3QPCA 3HB0A 4G0WA 1J7JA 1RMQA 3R6WA 2F2TA 1X80A 1M2FA 4RGBA 4UUBA 1TCAA 3SJUA 2NVOA 5B3KA 1L7OA 5EIFA 3ESXA 1QG4A 1ECPA 4PPGA 5DGDA 1WB4A 1AK1A 2GILA 2FPKA 2M6RA 3QHAA 1NVFA 1YI8A 2QVZX 3GLHA 4G4GA 2W43A 3VHXB 5KSZA 4KTVE 1GIAA 1NU8A 5M3BA 3A3PA 1W6UA 1CRPA 1T4CA 1P2DA 2NZJA 3FPEA 2BHSA 3QOWA 1ECGA 1DEOA 4DSOA 2FI1A 2XKBA 4EW2A 4ER3A 5LMCA 4Y67A 4QDZA 4AXXA 4Z3KA 3HBJA 2GXSA 3UMVA 1CZUA 2VQDA 3I04A 4HQKA 3WYFA 5GMOA 3MJSA 4IICA 2G7ZA 4AG3A 5FOQA 3L6OO 1QIEA 3DSRA 2VDMB 3AH8A 3ONWA 3I0NA 1MJFA 4MVYA 3MWYW 4MYTA 1OHHD 4XA8A 3QVLA 5DYWA 1YO6A 3ET4A 5LQCA 4MTLA 3ZXYA 3P52A 2WUVA 1QC5B 2R48A 4W5HA 4GI2A 1ZK1A 1JHDA 1Q0LA 2ERXA 5SYNA 1VRCA 5AI0A 3PFFA 4DLVA 4YYZA 3QTTA 2J5BA 1ZEMA 3L0CA 5HCUA 4DJ5X 2NAPA 2QSUA 3DZHA 2XI4A 5LMZA 1WUYA 3B2QA 3OQMA 4FM9A 4J76A 1QRAA 5CEEA 1SN7A 4PSUA 3SD7A 3II6X 5DNUA 1M10A 1SCKA 2POQX 3EXFA 2DQZA 2VTDA 3GLTA 1H4TA 4K2HA 4XB1A 3JWHA 2IBMA 1E3TA 1JKJB 1M76A 3ACDA 1FE8A 3D1LA 1HSOA 1BMDA 2I4TA 1EVYA 3BK1A 3PGJA 5ADWA 1APBA 3THYA 1OH6A 1QH9A 3DA8A 5AK5A 3TOXA 3O8QB 3ZJYA 3BWCA 5U4QA 2BJWA 2GRUA 1IQPA 3TEJA 3E7PA 3R5HA 3UWKA 3C5EA 4KRYA 3VSDA 1XPUA 4MZDA 5A4FS 1XX6A 1PFGA 2GPYA 1KQGA 1L5RA 5BN1A 2R84A 1NTOA 5A7FA 5IKPA 1OH7A 1I2BA 5JZOA 1P4GA 4GL2A 2BFAA 2LV8A 4NESA 3JASB 3K6JA 4FT2A 5LUBA 1AGNA 1II8B 2F43A 2VYFA 2EL9A 3R6TA 1O94A 2WY2D 1SG9A 4MZXA 3LDFA 4ZVNA 4TLMB 1LTQA 4LRWA 2XB6A 2AUTA 3K0EA 1RRKA 5CHYA 4H7EA 5KNBA 2LCFA 1CVRA 2C9YA 3W9SA 2QDXA 2QRVA 4KXWA 5C1DA 1PL6A 4QAQA 3BERA 5JQGB 4Y7DA 4ER6A 1PE0A 2JGJA 1VYHA 4FPXA 1R0ZA 1WB5A 2ZSFA 4OHZA 2D0IA 4LHSA 4DJEC 1S2IA 3W2HA 4URFA 2N75A 1Y6JA 5BOSA 2PAAA 5CNKA 1NRJB 2I1VB 1GAEO 3TSCA 3D02A 2FJ0A 1WNTA 2KSQA 3DBRB 1ISRA 4KIWA 4G0UA 4D02A 2NUTB 5JSZA 3KHUA 5KEIA 4RTRA 4AL4A 1PJTA 4QUBA 3EXG2 4IF4A 2PX3A 2OVBA 4P53A 4DCTA 4DQVA 2D7JA 4DCSA 1JLLA 2GESA 3HXPA 1Z4IA 4EJFA 4D9BA 4Z1OA 5C9ZA 4LJ8A 2HA5A 2WYOA 5IZCC 1S01A 2H7YA 2FFBA 1VKHA 4KUEA 1G4HA 2JEOA 3EC1A 2GZSA 3UC9A 2JH3A 2WZQA 4RELA 2EYQA 5DM0A 3SC6A 5B3LA 4PC2A 5D5PA 5JXHA 1EG7A 1XVAA 3IEPA 4FHCA 1RI1A 3DZBA 5B4TA 1YMQA 4RD0A 5KOHA 1VP3A 4XWTA 3I9NA 4O2AA 3T7IA 2MMGA 5K0GA 1FA9A 1XVUA 2XMBA 3MUOA 5K20A 2YASA 3KL4A 3TI7A 1T5SA 1BAPA 2OOKA 5JS1A 1Y3CE 2FFJA 2VH5R 2WT9A 1E2NA 2WTBA 1IAQA 5COBA 5L3SB 5LLDA 4NMWA 2G1JA 5CGZA 5DNEA 1MHTA 2BSAA 3EQZA 4C29A 4RGVA 3G0CA 1O3YA 4IJKA 3PZRA 3FRIA 1KMHB 2PG3A 1WXEA 2ZTVA 4TVKA 5K0ZA 2AE1A 2EKDA 4Y9DA 3Q2OA 4QDJA 1UJBA 3ICOA 1Y6FA 3VZSA 4UEKA 5BV1A 3F4LA 1IPHA 4H7IA 1P81A 4OJTA 4I08A 1BMFD 1YBHA 2XBUA 3VU9B 3TZLA 5AW5A 1XL1A 2PQ2A 2WKWA 2C2GA 1MDFA 2QUZA 2VBFA 4P3OA 1J49A 3A1CA 3PNQA 4KQWA 5D3QA 1Y7PA 4G5YA 5BN3B 3NMUF 3JR7A 4JH0A 4L4SA 3NHFA 2HDOA 4ZHQB 1N0VC 2I6FA 3KOZA 2FPSA 4WPGA 1FNDA 1PNQA 1R10A 1YGPA 3B8HA 3FFTA 4OA5A 2OV1A 4ENWA 1UQRA 2DEUA 3PBKA 3RC3A 1VLHA 2FK7A 3R0IA 1HRKA 1WWKA 3VZDA 4C22A 3UNXA 5B6JA 5FX2A 1UEIA 3DLIA 1TQ4A 2KM1A 3SYTA 2W2MA 3DVRX 4M9CA 3ILSA 2QT0A 1QHHB 1GLVA 1E9EA 2CUTA 2VTKA 4QPCA 3X1DA 2PSDA 3N2KA 1E6UA 1TRKA 1UF9A 1RLJA 1ZMXA 1HQDA 4RMJA 3E1KA 1IXYA 1THGA 4RYDA 1V1MB 1OT5A 3KZVA 4YTEA 2SKCA 2XMCA 5BSFA 3B51X 1HC7A 2JH8A 2XWQA 2MSDB 1A9OA 2P9QA 3OAAD 4AURA 1NF9A 4RCYA 3DZJA 1ISSA 4IJQA 1Z9BA 3QXGA 3X2SA 2HNBA 2V6IA 4XSHA 1OWMA 4B45A 2MYNA 2QMUA 3MVEA 3MTIA 3WMWA 1ETUA 2HQSA 4FFWA 2P5TB 5EE1A 2GPAA 4LZNA 5H3LA 5LC1A 2C5HA 3EUAA 1QLHA 4L15A 2PFSA 3KLOA 3RGGA 3SIRA 1YJAA 5C51B 3IEVA 2PL5A 1LFAA 1BO6A 4PLZA 4WESA 1WXIA 2HZ7A 5C8ZA 1XJQA 2H2HA 4X90A 2I6XA 2C1XA 2R8XA 3AP3A 3FWHA 4W7HA 1Z83A 1TIBA 3GD5A 3OIGA 3E61A 1CUXA 4L8VA 4DVGA 5KSWB 3LGSA 2BMJA 4DMKA 1OIVA 4BDTA 3KXDA 4J3FA 2WF8A 4QUEA 4DV0B 1WUKS 4GOXA 2Q9AA 1NULA 5FQOA 2UYGA 1N7HA 5THQA 4YI5A 5JNVA 4BNIA 2FMIA 4JLAA 3KAJA 4NK5A 4B3FX 5CA0A 2OCPA 2TMGA 3RG2A 1G7CA 4PC3A 4ZA2A 2SKDA 3LW7A 5KCZA 1OA0A 1GG5A 1R7RA 1SOAA 1GU1A 2X4LA 1QDEA 5HYVA 2ATCA 3HEBA 4MW4A 3OH8A 4QU8A 4X3PA 5AHXA 3GJ5A 1J9ZA 1T24A 2YICA 3AESA 3OF2A 3PXAA 4R05A 4TT3D 3W90A 3LXXA 5BR4A 4I4LA 1PG0A 2GDJA 5L3QB 3GT7A 3MWDB 3TOCA 2VT2A 1FS6A 5MN4A 2XIQA 1Z75A 2HPZA 3HH8A 5G0TA 4Z9AA 4URXR 4YX9A 2ZRAA 4U8GA 2XUZA 3NC0C 3FSGA 4MITA 4OOEA 3QPAA 3L4BC 4DLKA 3H99A 4L6CA 4LDPA 5J5VA 3HEAA 3AVYA 5HQTA 1MB3A 3UB3A 3I52A 1LJ8A 2W6JA 2H1OA 4BNGA 1JT2A 2Y1LA 3K2BA 3QEOA 2QRQA 1S8FA 3EXIA 1F48A 5FFMA 5MGBA 1KRHA 2MSKA 4GBJA 3AVVA 3GWGA 1D7OA 2F55A 4KNVA 4OI2A 1HI9A 4EDFA 1DAHA 5FAXA 4FR5A 5FOTA 2JKZA 3FDXA 1K6XA 1MO2A 3C6ZA 3DBLA 3KJHA 3G2LA 2IIQA 1FVOA 4PO8A 4WKNA 2D5CA 2WHYA 2ZXUA 3MZ0A 4NK4A 4EW3A 3O03A 3NPAA 4JOSA 4ZT7A 2ZSUA 2W2KB 3VI3B 4D3YA 4DA0A 1QHXA 4EIWA 3V8MA 3HDQA 4NONA 2JCBA 3SJCA 2VFAA 4RH1A 1Z5PA 5JFGA 2F6RA 3KB2A 5LP6A 1SU6A 5L7YA 4AZSA 2VTEA 3STWA 3GJ4A 4ALNA 2Q0HA 5LN1A 4U7GA 3TR0A 1E62A 2A3RA 2E49A 2XCOA 3PI7A 2ZM6B 3HYSA 2C57A 3DDSA 2YINC 3SICE 4QOJA 4DA9A 1ZCZA 3MQ2A 3ZE9A 1ZSYA 3IR7A 1ADGA 2GN4A 3TIXB 4YRGA 2C95A 2EBFX 3BN3A 3R3WA 1MEOA 2J67A 3HA7A 3TLEA 3V8EA 3EBPA 3WNQA 4D3XA 1TA9A 1A96A 4C4TA 3CUKA 3PT5A 3QQ5A 3H1BA 3PQ7A 5CNMA 4KE8A 1MXFA 4MWTA 4Q4DA 5F7OA 4AY6A 3IIKA 3D7LA 1E0AA 4TWIA 1KP9A 5AXCA 1QZ3A 3TM4A 1F9AA 1PLLA 2VLIA 3D8RA 2XB2A 2D5BA 2JBAB 3MUEA 4E14A 2P9FA 4RMIA 1FPQA 3KJZA 2Y1KA 3LF1A 4RVDA 3CSUA 1KDOA 4HR7A 4BMDA 3UA4A 4EARA 1ZL0A 2OR3A 3AX6A 4FE7A 4O2LA 1QGUB 4TWJA 3EAQA 4BVJA 4XI9A 1XE3A 1Y6GA 2OXTA 2B83A 1UXIA 1Z6AA 3K70B 2GXAA 1KJNA 2D2XA 2ZWPA 3RUPA 3N74A 4GI1A 5L3ZA 1DO0A 3A4VA 3EGWA 3NV9A 4PAQA 1W87A 3ELDA 4NU6A 4UUAA 2XB8A 3HBNA 4UHFA 1UOOA 3TDNA 4LRUA 1X7ZB 1BD3A 2MOKA 5DLQC 4BC0A 4C3UA 1V35A 5DO9A 3VVLA 4P82A 4MKHA 1HO3A 4M36A 1DPGA 3C45A 5BMVA 3LA8A 4PV7A 3NR2A 5DEOA 4G89A 4A8JA 1XA3A 2FCAA 4DXAA 1ETHA 3B1FA 3RFFA 3LCMA 1RYHA 5I7UA 3WAJA 1RWWA 3FG9A 3OX1A 5DX0A 1VYVA 3C1OA 3HVIA 4MVJG 4C0XA 4P31A 5FTKA 1K3FA 2IX9A 4GZ5A 1OJ7A 3N39C 1XFAA 4BN4A 5IABA 3IJ5A 4MIOA 4Q39A 1W0KD 1D1PA 2B4YA 2FSFA 1K8ZB 3ENKA 4YJDA 1UDAA 5CT9A 4HNSA 4DYHA 1TMYA 4M46A 4AIRA 5HMLA 1JQDA 1ZD8A 2V7QD 2G72A 1YHZA 2WI8A 1ST2A 1R3UA 1V3VA 4M9ZA 1GXSB 1LSJA 1PGJA 4MLCA 4PRZA 721PA 4JSYA 4PFKA 1UKYA 4RO0A 4CMHA 1VTKA 5AJYA 5JJIA 2ZJZA 4QO8A 2XUHA 2P8JA 3QKWA 2C2WA 5DHRA 1C5KA 2QZ9A 3LBIA 4DUZB 4FSHA 1EGVB 1KEKA 4TYQA 3ZQUA 3HY6A 2RGCA 1LD3A 1TTHA 1Z6YA 2A84A 3Q87B 4HZGA 4E2YA 3KX2A 4RCZA 2GYWA 1Y3DE 1QFJA 1MX1A 2RHWA 4FFNA 3WICA 4WNCA 2SHKA 3HYRA 4UOEA 1VPVA 1E0DA 1TD1A 3TECE 1KOGA 2F3TA 2Q1UA 1UJ6A 4X20A 4RKWA 5ILGA 1UMCB 1N8TA 5FPQA 2A3NA 2QV7A 3MINA 5BNTA 5IC4A 1BXGB 1E5DA 2VT7A 1MHPA 1QF6A 2VJAA 2PK3A 4ICIA 3KEGA 4NATA 2NUAB 4R2IA 3RRFA 3UY4A 3WX0A 5I4IA 2B69A 2IPAB 3AEQA 1Z5ZA 3QJYA 4MUMA 4MRPA 4NABA 4UATA 4EY3A 1E1CA 1JKMA 2G9UA 3RSFA 1LK7A 3OU2A 2D0PB 3SG0A 1J07A 3D5QA 3HYLA 4H9GA 4ZXFA 4AJ2A 4QBHA 4V0ME 2CJYA 3DEAA 1SVLA 4NYMQ 1SGWA 1SHTX 1N5OX 5A4JA 2VUIB 1AKYA 4YYEA 1D9ZA 4RD6A 3TAUA 1WZEA 3MTGA 1XOIA 3UMCA 4XUEA 3AP1A 4IS2A 1V9SA 4PBSA 2WD7B 4MCAA 2C59A 2IYAA 1CDEA 3IQDB 3IO5A 3D7MA 4BO7A 4GDFA 1EE1A 1A2BA 2ZR7A 3FAZA 1N6NA 3IUMA 2XMQA 4XPZA 1M5RA 1Y8ZA 4B43A 1LPPA 1SBZA 3ONDA 4Q1AA 4RY0A 3I6IA 2WYHA 1DTWA 2O8NA 3E7WA 2EX1A 4B7ZA 5JYEA 3IILA 2JIBA 4B79A 3SNHA 3MTBA 1DKMA 1VBMA 1OXUA 3DFMA 2VO1A 4JMPA 5BUCA 5DN6D 2WQ6A 3KQLA 3OD5A 3CV3A 4ZODA 3MLAA 2PR2A 4XWGA 1ULUA 3M3DA 2JGAA 5A2GA 1QQAA 4ZCMA 3EISA 1IPFA 2V9ZA 4MWGA 1EINA 1QG2A 2Q0XA 3G7NA 4OHRA 4YB8A 5A0FA 4A0QA 4NCXA 5HWSA 3ZE6A 2CC2A 3I2GA 3LAWA 5FI1B 1SXPA 3BMXA 1N3YA 1F51E 3NHAA 3D2AA 3A3KA 4IO0A 1MTZA 4UAVA 1PRYA 2I54A 1V4NA 2CXRA 2GYYA 1FP4A 4KFUA 2VAXA 4IIFA 1YDMA 1NYTA 4JVNA 2QTCA 3RB8A 1TTPB 4ZCRA 4ZVOA 5EWLB 2AG5A 4MV5A 3BDVA 3PQ3A 5AW0A 2Z2YA 4N6OA 3LBFA 3B3AA 4N8EA 4EJ0A 2W90A 4DSZA 2AT1A 3A05A 4OK6A 4X7PA 7REQA 4DEYA 5EJ4A 4OM8A 3KM0A 3DP7A 1Q0QA 2CDNA 4YP9A 3ZU4A 1HE3A 3EIEA 2XA9A 4UNRA 1ISHA 5EEHA 2ZYWX 4I55A 2QR3A 1ISIA 4NJEA 5E2BA 3WSVA 1S7CA 3PC8A 4RAQA 3HP7A 3P97A 1U0EA 3WGVA 4OGGA 1KYQA 1D5WA 5EA2A 4R2MA 4DLZA 1MQSA 2DPMA 1ODCA 3MCAA 3ZQ6A 4IXWA 5JHGB 3H5NA 1NFQA 2Z43A 2VJQA 3Q6IA 4N3AA 3RANA 4DANA 2XZPA 2P68A 2H6EA 4UHEA 1HMYA 1NI4B 1H05A 2K5UA 4CKYA 1GTG1 1YR1A 1IUOA 3E3NA 3PS9A 3KXIA 4K88A 3FDFA 3ZE8A 4HEJA 1UPAA 3EZ2A 4PNEA 1EUZA 4MSUA 2HHAA 3TBHA 2ZE7A 4R54A 4QRDA 2RBGA 1N2OA 3UMGA 3HJFA 3TXYA 2PGIA 5BYKA 4WH0A 3HSYA 1F8FA 2JIDA 2WMOB 4EKNB 4EFLA 1U1CA 1UXGA 2ZYDA 4H31A 3S2YA 1VB3A 3ANYB 3A70A 4V0NA 3WS7A 4G0XA 4PRKA 3ZD7A 2K4MA 3OP1A 3RQIA 4Y2UA 1W0JD 2C04A 1XLVA 1U7ZA 1RWMA 2QZZA 3C14C 2PEZA 3ITKA 1Z2DA 5DBHX 2QN1A 2YIDA 2YYAA 1VKZA 4RTKA 1FNNA 3E2IA 4KMSA 3KSMA 3PLNA 1MQ9A 2NO1A 2XQGA 3IAM1 4PR0A 3BK2A 5JHHB 3CB4A 3GEHA 2AOVA 5HPYB 3QV1A 1LV7A 4C0HA 2JW5A 2IYTA 3U2QA 4GXNA 3KYIB 3A32A 2B61A 4RKEA 2IV3A 1EPUA 3NT4A 4JCOA 1YC5A 3TK1A 1VSVA 1OLXB 4GC9A 1Z0ZA 2HSWA 1IHUA 4BO3A 2ZUTA 2ZRDA 2QVBA 1HE8B 1QH1A 2JKVA 4GYWA 2UZAA 1M6EX 3T1NA 3T35A 3M49A 2ADFA 2EFHB 2IP2A 3GCXA 4Z4IA 1U9IC 4MI6A 3ZHBA 3NOQA 4J43A 5G4KA 1JALA 4HI0E 3JXEA 4XIFA 3KLBA 5E1OA 4ZYUA 3OE7D 5LP6C 4WA7A 5ALRA 1JEQA 3DONA 4A5SA 3ZWCA 1ZLYA 1LPNA 1J39A 1X0VA 2QG6A 3CF4A 2QUKA 3LKDA 1E1RD 3HU2A 1E2GA 3NETA 1NYQA 1PT7A 1Z5UA 1Z5VA 2AQKA 2BGRA 3JVEA 3L7OA 3VAYA 4QLOA 2NNLD 4QA9A 4K26A 1A72A 3NOOA 4DNQA 3E18A 3D43A 1US8A 3U3KA 4BLWA 3VSEA 5CH3A 4LZWA 1O0SA 3D4OA 2NPIA 2VUUA 4GPAA 3OM8A 4GP9A 2Y0PA 5A5FA 4YMSA 2PYIA 5HFNA 4US1R 1PTJC 3DYBA 3BT7A 1EP9A 4FX5A 3ZZUA 1IN8A 5LNK6 3WLKX 1M1YA 1B2RA 1SKYB 2G07A 2GAOA 3FUVA 3DMPA 4TTSA 5C31A 3L0PA 2P2GA 3MQ4A 2HRZA 1Q7TA 1R4AA 1RHUA 3O1HB 2BUBA 1QGAA 1YZUA 1DIBA 2K7ZA 3U31A 3WSWA 1TCCA 3Q3HA 4PY2A 4DKJA 1NR5A 1TO1E 2DH5A 2HTFA 5EHGA 5P8WA 1SVNA 4C78A 1TQ2A 1WCV1 2H1RA 5ALQA 1MVLA 4BTLA 2DLDA 2WSBA 5DV9A 1M6VB 1CDZA 3DXXA 2BGLA 4QG3A 3DZCA 1SHKA 4CN8A 2DHDA 4O33A 3I8OA 4KU4A 3FPFA 3GFRA 1NE7A 4FFPA 5GGXA 2J7PD 4RD3A 1NFFA 2YWRA 3K6KA 5DNDA 2WJZB 1MP0A 2TMYA 1D9XA 1LQTA 1NOIA 3KKNA 1BGVA 3QF7A 1BA3A 4XQGA 5C4MA 1UT8A 4G8JA 2FN3A 4LBZA 2FP4A 2QLBA 4P4GA 3JALB 3M4NA 4C2BA 5JNRA 1L5SA 2FRDC 1EFPA 3OE4A 4MUAA 1P2VA 4ND5A 5TMDA 4E2ZA 4OJQA 2ECOA 4D4GA 4K87A 2PY6A 2YZ2A 5GY7A 1VL6A 1SQ0A 1VL5A 2YV3A 3A04A 1LBQA 2UXDB 3WMFA 3PHCA 2IPLA 1BQ3A 1JJVA 3V34A 1JRLA 2X6TA 3WJAA 5KHLB 1OYOA 1OXVA 1KJIA 4YP7A 3OOWA 4MS4B 1JEEA 2P7HA 2DFVA 4JBLA 3B78A 3EFEA 2D54A 3X1WA 3L6DA 4IMRA 8ADHA 2LVBA 4B3CA 1P72A 1EXWA 3MCWA 5G40A 3BGVA 1IRIA 1XNGA 2QM7A 4HGZA 3D3KA 4DREA 1Z8DA 3COJA 4Q19A 3C98A 4C7VA 4DUGD 3WV5A 2C9MA 2V7EA 5TY0A 2DY0A 5IXJA 1XMVA 2NWQA 4IQ0A 3IVAA 2QN7A 4DR7B 3KUDA 1C9MA 3QXCA 3TD9A 2P4QA 4MULA 1MFZA 2AQIA 2ACVA 4IVNA 4EELA 3RAEC 3R8XA 1P1FA 3DL0A 2FPOA 2Q6VA 3VKGA 1H4VB 1P5FA 3JAWB 2DR2A 5K7SA 4C7JA 2QZSA 1ECCA 1MFPA 2ZLBA 3PICA 3BCSA 3NKVA 2NVUA 3W05A 1LZKA 4LF4B 1TCBA 3ORFA 4ZOBA 3T15A 3AETB 1VRWA 1QVWA 3S29A 3C3XA 4YRFA 3OPQA 1DJNA 5K2MA 2WZDA 5KNCD 2IUFA 1T1GA 3J80A 3NDJA 2QBYB 1S4MA 5K3FA 4I2NA 2VJPA 3N0TA 4H1WA 3SE0A 4L0CA 1YMUA 4EHHA 2XRYA 1T2NA 3B1YA 4CV3A 4HX9A 1GPUA 2GHIA 2Z9BA 1PSZA 2C4KA 4G65A 1XWIA 3G9ZA 4U9UA 2IP4A 4YQEA 3SHVA 2IBSA 4LZZA 1GJRA 1RYEA 1OBHA 2Q1WA 4F97A 2R7KA 3L92A 2AQ8A 4HWSA 4IIEA 5F52A 5IW8A 1GCIA 1UPUA 3K6SB 3E3LA 4FMPA 2PUBA 1G7TA 1W4ZA 2Y6UA 4V2IA 3KZ1E 2JFUA 5ADHA 1MW9X 1CQIB 4CL8A 4XTCS 1IYZA 3HL4A 4OHYA 3EIXA 2E37A 1W2GA 2VJNA 3E8SA 4X71A 3OF5A 4S2EA 1FDTA 2AW3A 2VPZA 2X9GA 3JQCA 3MOGA 4GQBA 4CCYB 2RGYA 4QVKA 3DUFB 3EWSA 2IU3A 4PW0A 3BVPA 4AN4A 2QB5A 4B8WA 3NVMB 2IF0A 1DRWA 4FFVA 3AHFA 3KS9A 3LL4A 4EMUA 1AXGA 1CF2O 2ZVJA 4UC0A 1Z2OX 5EZSA 4QVIA 4U9HS 1I2DA 2ANCA 1VJTA 2GS9A 3MBIA 3OFSA 1N4AA 3H2JA 4DV1B 3VR6A 1CP3A 1UUFA 2FHSA 2IP1A 1EHCA 3E4DA 3WI7A 3HGTA 3GA0A 3HFRA 2QX6A 4MAMA 2JLUA 4KKVA 2A78A 1Q19A 2ATXA 4YONB 1RM5A 3RC7A 5T41A 3S5JA 3D0OA 3K7EA 5AOBA 4RJ2A 3MYRA 3OU6A 3DC7A 3ZXXA 2GXQA 2WNIA 3IKVA 4BV2A 1XRLA 1WW2A 2AR7A 3HA2A 1MRNA 4BNJA 5E38A 5CDTA 2XXAA 3ZHRA 1XQ1A 1DOHA 5E6SB 3WYDA 1G98A 4KH1A 4WX2B 1I4DD 5LA6B 4DIUA 4PEVA 1YJCA 1JB9A 4UHCA 1GNPA 4CMBA 1KK1A 2ZYIA 2OK7A 3O8OA 2VC2B 2V6GA 4P7GA 3OC0A 4F7DA 1AT1A 3BJMA 3JATB 4YUAA 3T9CA 2AUMA 3FLAA 4R68A 4W6ZA 4D97A 2DR3A 2K2WA 1R1DA 3GA5A 3K9QO 4ENRA 5J1SB 1VCIA 2QR5A 4YHBA 3U4CA 1T43A 4TMZA 1JSCA 4P08A 3H1TA 3PC8C 1NSTA 4P3YA 5TPZA 1TFUA 4FILA 2Q7OE 1DCFA 1D4ZA 1TI7A 3DNMA 2RGDA 3D0KA 3LQQA 4YRCA 1E9FA 5GZ1A 5KUTA 1QUFA 4BNFA 3FOWA 2H2IA 1ZY2A 3IMCA 1DEAA 1VL1A 1ZUWA 4X54A 1E6EA 4EEZA 4W9NC 2REQA 3GJTA 4FMCF 3NJ8A 3Q1KA 3W06A 4CT5A 3JVVA 4GBED 4NCJA 3LUAA 3WKEA 3AV0B 3PYMA 1COWA 5E9WA 1QU3A 4AY3A 3EIWA 3ZEIA 3VVBA 2IKQA 3IBTA 3NEAA 5D3ZA 4BMVA 2Q3JA 4CM9D 1FUUA 3NBKA 5JMTA 4O3MA 5HK8A 3MSCA 1G2IA 4N6NA 4XD7A 1H4QA 1VPWA 2FP3A 2VRNA 2XUFA 4EO7A 3AK4A 3S6JA 3ST7A 4FN4A 1MNAA 4F5EA 1QQBA 3EFOB 5KVSA 4EHAA 5KU1A 1RXEA 4XRGA 4IS3A 2CZCA 2WJHA 2NT3A 4OQYA 4P7FA 1HYGA 1K7XB 2C2KA 4D6PA 2ZE5A 3GLRA 2ODWA 1WD5A 2IHKA 2HBRA 3IMEA 2QUAA 4HN4B 4KQKA 1X8KA 2EQAA 1CQJB 4XGIA 5TGTA 1ZONA 4BGVA 2VF4X 4EKYA 3ICEA 4G0NA 1WUIS 5ARCA 4BTEA 1K5HA 3Q12A 2H1WA 3O21A 3FVWA 2X1HA 3RIEA 4YRPA 4CM7A 2XCUA 5LYYA 4BKUA 4N41A 1RAAA 3ORSA 3I9V1 4ZDWA 2AI3A 2B34A 1G41A 1E2IA 1GG2A 3EG9B 4FS8A 2O6LA 1F2UA 2JFZA 5A9SA 1VI2A 3FKSA 1O95C 1RKUA 2OAEA 2EKBA 3MWGA 3ORYA 3PUXA 3WGUA 4DJAA 2BVNA 5TQ0A 5TF0A 1PCXA 2MDTA 3S8EA 1OR8A 2J3JA 1GKIA 1NM5A 3C7CB 3MTDA 2HXYA 1TQ8A 4IW3B 1GQQA 3WWCA 2QD2A 3ENVA 1KEZA 2J59A 1UOEA 1QO7A 2NG1A 2QD5A 4GE3A 2H92A 1U65A 1ZPDA 5G3YA 3ZOKA 4X7MA 1OKKA 1MEJA 1II0A 2OHVA 4LY6A 4RXMA 4WVLA 2LKCA 2PJDA 5ICGA 3K71B 3T99A 1SHZA 1EK0A 4FCVA 4J0GA 1A76A 1J0AA 1UAGA 2YW2A 3BD8A 4RIIA 5EZQA 5MGNA 1XJCA 2Q6IA 3EGDB 4JQOA 2RCNA 4MUGA 5HOEA 1WCIA 2P1RA 1JXMA 1B6RA 1R12A 4HVCA 1YA8A 4G5QA 3E3AA 2B8EA 2ZPUA 4DIMA 2NQTA 3DTTA 4K9RA 1JKXA 1VMKA 2A5DA 2CFSA 1PGQA 3QHPA 4NPHA 4DPMA 1SQ6A 4K28A 1XR3A 1U8YA 4PYJA 5JBQA 4ENPA 1W35A 2G1KA 1DFIA 2DHEA 2V74B 2Z4SA 3B5IA 3GDWA 1LS1A 4YDSA 4RD2A 3SBXA 1ZO8A 1CWUA 2NZUG 3R3SA 3AONB 2A7QA 5FWYA 3ONNA 3EPJA 1F7VA 1FLNA 1WHSB 4Q00A 1ZEJA 1T6YA 1AVTA 2VYQA 2WYUA 3OJCA 4KODA 1I01A 4I7EA 2BMEA 2D2EA 4JROA 4O4HB 4E4YA 3K8QA 1TD9A 1C2TA 3T9FA 3RTAA 4RDIA 4QDUA 4WXMA 1TECE 1QDLB 1YZGA 1CRWG 1N5JA 2RI1A 2O6HA 1AO3A 1T8WA 1IL0A 2X1MA 2F3PA 4RV5A 1VIYA 2JD2A 4HEA6 4YS6A 5ALMA 1INLA 4J16A 4U0JA 2GVNA 1GILA 4LHXA 1MENA 5DTQA 4ZDIA 1XIVA 2QAGB 3MLEA 3W4KA 3C5WP 4OQQA 4H1VA 3VHLB 2H4YA 2PTGA 4C0QC 4RORA 5M5BA 3SHWA 1BEZA 1DKOA 1ZM7A 4FFBA 2FWBA 4MGEA 4H18A 4PRYA 4Y2QA 5IVIA 5KSPA 4CL2A 2WQZA 3HNPA 2QRLA 3KXPA 4G0VA 4QBGB 1GG8A 2I2CA 1RYDA 1CY8A 1GPH1 2C84A 5BRJA 3R5JA 3SX2A 1LDBA 1M6HA 5BW5A 4Y1EA 1NAIA 4M54A 4XX0B 3C4VA 1G4UR 3CLSC 1B41A 1TPYA 3GP5A 4YC7A 5JDCC 4BNNA 4CEHB 5TMEA 1OBVA 4HQOA 3HBLA 1K8RA 1SEPA 4XYEA 5J5CA 3UXMA 1EUCB 3L0OA 3OCVA 4J1NA 1ZYUA 3L8MA 2JA1A 2E4VA 4CM3A 1JIIA 3RFCA 1XQYA 2ZWOA 2CLIB 4LMAA 1Z5GA 1MW8X 1TKCA 4H7HA 4IIXA 1SWVA 3DE2X 4XUDA 3ZPXA 4YY3B 3D8NA 3DM9B 2NUPA 4DARA 2C7RA 4BNDB 4DWOA 3PFNA 5KQGA 4FBGA 4QFDA 4RFLA 3KPYA 4WOCA 4ZKDA 4YHHB 1B7GO 1IY9A 4XM1A 3Q7EA 1USWA 1KWKA 4AT1A 4MH0R 4ASUA 1ZC4A 2RGAA 4NOLA 3OJWA 1W7AA 3TAXA 2XYRA 5TC4A 3VO2A 2P4UA 2XODA 1A5ZA 2E4WA 5IZ4A 3DLTA 3UJAA 1ZISA 2ZYHA 3UA3A 5F9FA 1CUIA 2BDEA 4JLWA 4DQLA 2QRMA 3P2YA 4WKPA 1QPZA 2XD4A 4GGPA 5ALUA 2YIJA 4N54A 2JJ1A 1GY8A 2Y1OA 2GNAA 2QRPA 2XYGA 4MB2A 1XO1A 4YALA 2C4HA 1MG5A 4IIHA 2IA5A 1E3MA 1I14A 4NC9A 5JRDS 2I55A 1LJUA 1ZWLA 1E0SA 2C3UA 1NA5A 3U6BA 3E3OA 3K9LA 2QN8A 1SBQA 3T1HB 3HU5A 2OHHA 4NOJA 4NZ9A 4WK4B 1R3DA 3UO8B 2I80A 3QRWA 1V9LA 2X40A 3A6FA 3BSYA 3MD9A 1GLNA 4OQZA 4YT5A 2R8ZA 1W59A 4ONEA 5G0VA 1G3QA 4ALIA 1K5GA 2HQBA 3J7TA 4ZVMA 2X3FA 4OHFA 2A9RA 4AMYA 4KJXA 1YGYA 1JHMA 2HHJA 2ZROA 3W5DA 4F38A 1XA0A 4NV3A 4OL9A 4B0OA 1NIJA 1JFTA 1Q7BA 2DUUA 3IHWA 3URKA 2HJ9A 3KIPA 5FOUA 5BUQA 3LXMA 1SKAA 3R76A 2CJPA 2V59A 2YJNA 3IUPA 4NOMA 4RW0A 1FNBA 2J5QA 1OB5A 2NSHA 3ZGOA 5TT1A 3ELYA 4C7OA 1LA2A 3HB1A 1CG6A 3OX2A 4HTFB 2NYVA 2RHGB 2YVKA 4NDNE 5CM9C 1IOWA 1X86B 1HA3A 2Q1SA 1JQBA 3PQDA 4PLVA 5K8UA 3OQOA 4MVJH 3WNDA 2XUQA 4K9QA 1HTWA 3LSYA 2AXNA 2XDAA 1CUBA 3FPLA 1E2EA 1KEWA 3DM5A 1QBKC 2YZMA 4JWKA 3Q7PA 1G60A 4HGYA 2DCMA 3FRJA 3IHLA 5EJ5A 4BBPA 1LNZA 2XJ4A 1MZVA 3P7MA 1V45E 4IXTA 2CDCA 5KOYA 4R2JA 1DIHA 4HNTA 1D2NA 3THSA 1QZZA 5A4KA 1A4XA 1K86A 1BZYA 2QMEA 4GKVA 4KKXB 4XJTA 3KOUA 2Y66A 4BFWA 4RLSA 4H7DA 5KYYB 1CY0A 2W2LD 1D6SA 1SVMA 1R16A 1BDMA 4AROA 3C6XA 4P0TA 3TRKA 1NPTO 2EC5A 3EZLA 1IVNA 3G9TA 3EZGA 2AOXA 3SP1A 1VIDA 3QUTA 4CUJA 4EGQA 5JAZA 1CUJA 3X1ZA 2O8EA 1IHOA 4IRXA 1VYTA 4TKVB 1Y9AA 4KB5A 3M33A 1IUKA 4WGFA 1AUXA 3CXUA 1OZGA 2Q21A 2WMDA 3R5SA 1XQ9A 2GUWA 5EFOA 1Q7CA 1KZ4A 1E6LA 2QM0A 2QZPA 3KDSE 4IIJB 3WBKA 3KZCA 1SUWA 5EUMA 3EF0A 1XFDA 4HDOB 3Q3GE 1T9HA 1XMJA 1W76A 4HNRA 1T4BA 1SXJA 3KELA 3L7YA 1NXOA 3RYIA 2RHRA 1SZJG 3MG9A 1IHPA 3EGIA 3OT5A 4LVCA 1RI5A 4FGSA 1NN1A 1BYUA 5J63A 4LWQA 1BGWA 3U7HB 4HOYA 3ILHA 4BU0A 3Q9LA 2XYQA 1B14A 2PXXA 3UN1A 3NGMA 3VZQA 4BVGA 2ZS7A 2ZRJA 4JIGA 3WTCA 1OC4A 3OZIA 3DE0X 1Z6PA 2WHPB 4PE5B 5AHKA 2A9KA 3WAGA 2QTVB 4TYYA 2OGZA 3DOHA 4W99A 4OGFA 2JIRA 3D8SA 3QBJA 1HT0A 4QUAA 4MCIA 3D6TB 5EHNA 5DNWA 4OQ4A 3UJBA 1ZCJA 3BH6A 3NHYA 1PO7A 3A6PC 2WA2A 3BQ9A 2ZUCA 3JW8A 5AOCA 1PSWA 3I09A 3V8PA 4LYYA 2WV7A 1UZAA 4NJOA 2ZYTX 1K4MA 4Q3BA 3VXKA 5FH9A 3KQNA 1E2JA 2OGUA 2ZYSA 3C41J 3ENZA 4RQAA 1AUOA 2ZJ5A 3PHJA 1MC5A 1VMAA 4OXYA 4QE3A 2GEDA 3JQGA 4OXNA 4J0FA 3TSYA 4ERNA 4HQLA 3T54A 4KOEC 1DUIA 3JQ8A 4DCOA 3U48A 3A3OA 4Q3NA 1DAEA 2OO3A 3MWEB 3OC6A 1BHO1 1UT5A 3WLMA 1FFDA 5LQJA 1BCRA 1FIUA 2GCOB 2Z04A 2I3AA 4XDGA 3FPJA 4B6QA 3K72B 4OH1A 2IKSA 3K5PA 3F5QA 3DV2A 3WMXA 4BL5A 1PWXA 1LGYA 2QL7A 4LJ6A 3K09A 2GN9A 5D1NA 4H0CA 2JCGA 2XAAA 1QTRA 3WNZA 5IVKA 4DTIA 3KVVA 3RH0A 3NNDA 1S89A 1A9XA 4IDQA 5EQDA 3WO0A 3KAQA 4Q82A 4XZ3A 2C4WA 4ZQIA 1T8PA 1IDN1 2OP1A 3E7DA 5DSTA 3VYRB 1YB1A 1BRMA 2VA9A 4HB3A 2BM9A 3IJEB 1NM5C 3FUXA 3HDJA 7MHTA 4QGGA 2ZKLA 4PG7A 1B6TA 4ZRNA 5I01A 3UPUA 2IY7A 2Z30A 4BNWA 2Z6AA 1V8OA 3OM0A 1NUTA 2HTEA 2Z95A 5AKHA 1E8DA 3JZDA 1EE2A 2HF8A 4OG2A 1QQ6A 4HNGA 2WPDD 4TV9B 4MTCA 4G1FA 3X1JA 4YCNA 3AY7A 2EOAA 3P9NA 5KYUA 2GF0A 1EFAA 2PANA 1RZ3A 2WKPA 1BD4A 4ARVA 2YQ4A 3WLLA 3N75A 5KOJB 4B33A 3RYFB 3K8OE 4YAEA 4EG8A 4ER0A 3H75A 4YECA 4RMNA 1P2TA 2RGWA 3MD0A 5IN4A 4RE6A 2PZJA 4XFDA 1U7DA 1XTVA 4RTJA 1ZCAA 3H1FA 5AVWA 1T1JA 4M9SA 5DHQA 2VQFB 4QQ8A 2ERYA 1WSDA 2NO4A 2G28A 1W88B 5CLFA 1G6OA 5HFAA 3K94A 5EWMA 1JR3A 4HH4A 2AN4A 2HC9A 4CUKA 1TU0A 1QIDA 1BKDR 4Y0NA 3ZCTA 5ULLA 1I13A 1JZSA 4EYSA 1JN0A 5E7QA 3S8MA 2P75A 3ETNA 4KBYA 4ARAA 2PQMA 4XWKA 2JVJA 3RASA 1ULSA 4NYMR 3DNFA 5D86A 3T0FA 3DH0A 1GGHA 2O19A 1VKJA 2J87A 2VP9A 2FOIA 1CB7A 2WWXA 2WZCA 4D9IA 2DFLA 4DDTA 4EHDA 3GDHA 3P0HA 5EZYB 4AMGA 2XCTB 3WGYA 3RRYA 2QZJA 2VHWA 3O92A 3I45A 2ZS8A 4J16C 1A3CA 3PWTA 2DGDA 2JEZA 2OO7A 2IK8A 4HNHA 4M1MA 3Q10A 4YJ2F 1IOVA 4E6PA 4PBTA 4HSGA 1KH1A 5I7VA 3JAKA 3RS4A 3FETA 3RVBA 5JBNA 1Y9DA 4GUDA 4PYLA 5E1DA 5IJ0B 2EW1A