2XVMA

Crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sah
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
AMVIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWERVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords TELLURITE RESISTANCE PROTEIN TEHB
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.1.1.265: Tellurite methyltransferase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2xvmA00
3LDUA 2JH8A 2VP3A 3ER9A 3DOUA 3PVCA 4OBWA 5E1MA 1JG3A 2G72A 2HWKA 4WVLA 4OBXA 3B7PA 4PYOA 4Z2YA 4RTNA 2B3TA 2YXEA 3G2PA 3QV2A 1EJ6A 4OX9Y 5K0FA 3WSTA 5FWDA 3M6VA 2OYRA 1VP3A 4P7FA 5DSTA 3DMFA 3DLCA 1YFLA 3O7WA 5HEKA 2QYOA 1L3BA 1YZ3A 4RVDA 1SQGA 4AX8A 3FUXA 1XDZA 4A6DA 4M36A 2IH2A 4E2WA 2BR4A 1L3CA 3SSMA 1PRYA 3IHTA 2CMHA 5FQOA 5IKMA 3EVGA 3G2OA 4Y2HA 3NDIA 1QYRA 2P3LA 2AN3A 2ZZKA 3EEYA 5EMLA 3FRHA 3C0KA 1INLA 3FUUA 5FA8A 3KQQA 4AZVA 4CTJA 1RI1A 2FK8A 5DT2A 1SUIA 1I9GA 4G56A 3OFJA 4GUAA 2ZTHA 5CD1A 5H02A 1X1AA 2ZBQA 3AXTA 1JSZA 4CKEA 1PJZA 2G1PA 3S68A 2AOXA 4F84A 2BZGA 4F85A 4GOMD 4DKJA 1ZQ9A 1IY9A 5GIPE 1IM8A 3SGLA 3SSOA 1G8AA 3LDFA 2NXEA 1NT2A 3HA7A 2ONYA 5DWQA 5DM1A 4LG1A 1BOOA 3HA5A 5CVJA 2H1RA 4PCAA 1NE2A 5DM2A 2P40A 1NV9A 2HTEA 2WA2A 4P7GA 1XDUA 2ADMA 3A25A 5DTQA 5FCDA 4YV1A 1RJEA 1ZKDA 2PJDA 3A7DA 5FHQA 1XDSA 3P9KA 2ORED 3I64A 4FSDA 5DM0A 2FK7A 4HTFA 1BC5A 3LPMA 2HMYB 1G6Q1 1EQAA 3LBYA 5GINE 10MHA 2GH1A 3LECA 2JH9A 2O06A 3MCTA 5DSXA 5E1OA 4MQ4A 4BY9E 5K01A 1XCJA 3G2QA 3ELWA 5FHRA 2KW5A 3HTXA 2ZCJA 1N2XA 1NW8A 2P8JA 2NP6A 3GRYA 5D1HA 5EZSA 2HR1A 1NBIA 5B1SA 4AZSA 3R9XB 1R8XA 4RX1A 2VZ9A 1KPGA 2IP2A 4B17A 3GWZA 3MCZA 2IDKA 3I58A 5EPEA 3KR2A 4RV9A 3KQVA 4PYQA 3A26A 3OZTA 2IFTA 1XJ5A 5EMMA 5LSAA 3UWPA 1F3LA 3BWYA 4RTLA 2ZZMA 4O29A 5LQNA 2O57A 3M33A 4AZWA 3BGIA 4E70A 1EAMA 1ZGJA 4E2ZA 3UJDA 1I4WA 5FTWA 3ELUA 4FR0A 5U4XA 2NXNA 2FRXA 2GLUA 1NW5A 3DP7A 2F8LA 3GGDA 3V8VA 4DMGA 1ZG3A 3P2KA 1BHJA 3DXYA 3LKZA 3REOA 5EVJA 3LGAA 2AOWA 3GRZA 3KR1A 2BR3A 3HVHA 5M5BA 1JTFA 3LCUA 5FA5A 1XVAA 3G5TA 3I53A 4H0NA 1AQIA 2YQZA 4ISCA 5HIJA 1UFKA 2FYTA 3EGVA 1FP1D 1NBHA 3B3FA 1DUSA 1JG2A 4BLVA 3FTCA 4GQBA 5DM4A 1M6EX 2PWPA 2PV0A 1IXKA 1KPIA 2PBFA 2NXJA 3FZGA 3KPWA 3PS9A 4ER6A 5ERGB 5KVAA 2FHPA 4X63A 1R18A 1RI5A 4YUWA 4OA8A 1NKVA 1NW3A 3TR6A 5LQAA 3PX2A 3BKXA 2A14A 4JXJA 5E2AA 5CVDA 8MHTA 3MTIA 3DTNA 2EFJA 3P8ZA 4GBED 5EMKA 3HCEA 2AZTA 2PWYA 4E2XA 4EQZA 3ANXA 4Y30A 3EVCA 4CXMA 3IV6A 3UA3A 4RVHA 4CKCA 3JWIA 3NW9A 2AOVA 4C05A 3KPJA 4IV8A 1V39A 5E1DA 1UWVA 4DF3A 4YUYA 1RI2A 3VC2A 3QOWA 5HIIA 3THSA 2CWWA 3ERCA 4YV2A 2FCAA 2XVAA 3DR5A 3M6XA 1VP9A 2P1DA 4E33A 4QDKA 5EMJA 3P2IA 3GXOA 3EMBA 5F2OA 3I5UA 2G71A 1QZZA 1VL5A 1X1CA 1O54A 2G70A 2PGXA 3CVOA 3M4XA 4E30A 4FT2A 2GPYA 3C6KA 3NJRA 1SG9A 4QPPA 5D1NA 3UJ6A 3EPPA 3R6TA 5BW4A 1M6YA 1G38A 2Q41A 4EKIA 4PYNA 2I6GA 3MGGA 3SXJA 1VIDA 4P7JA 4ZTBA 5K03A 5C9ZA 1FP2A 2XVMA 1HNNA 4XUEA 4A6EA 2EJUA 4PNEA 5EZQA 5JR3A 2JJQA 3EMDA 1KPHA 1YFJA 2PLWA 3NDJA 2NXCA 2YXDA 2IPXA 3FPGA 4RYLA 2GB4A 5ICCA 1WG8A 3DXXA 4MWZA 1JQEA 5FWAA 2UZ4A 2ZBRA 4QQKA 4QVGA 3CGGA 4KIGA 4QTTB 3VYWA 3H2BA 3TOSA 5BP7A 2ZW9A 3BGVA 1YB2A 3E8SA 1JR4A 2CMGA 4PGGA 1KYZA 3DULA 3SVZA 5EIFA 5DRTA 5T64A 3P97A 2Z6UA 3R24A 2GA9A 1Y8CA 3BGDA 4U7PB 3GCZA 4PYIA 3KR9A 5DTRA 5EG5A 2P3QA 2XYQA 2PXCA 3ELDA 1SUSA 3EVEA 3FPHA 3KQMA 3KQYA 3HVKA 2ZSUA 2AN4A 3T7TA 5JUWA 1FBNA 3BWCA 2I62A 1VQ1A 4PIPA 3GRUA 3HA3A 3P2EA 4YV0A 4GOLD 5E2BA 2BH2A 5CVEA 4E2YA 2BR5A 3RODA 1MJFA 3LX6A 1P1CA 1KIAA 1G8SA 3CJQA 5K0GA 5ICGA 5KQSA 4M38A 1O9GA 2XYVA 3T0IA 4ER7A 3SX0A 4IV0A 5GM1A 2IDJA 2V74B 4PCLA 1D2GA 3PB3A 3JWJA 1QANA 2ZIEA 3B3JA 2PY6A 3EGIA 2YXLA 3O4FA 3OZRA 4KIFA 5DX0A 3V97A 2Z6QA 3HVJA 4KDRA 4HTFB 3UFBA 4RTMA 4ATNA 4POOA 3NWEA 3NVMB 2ZIGA 1AQJA 5T6BA 2V7EA 3T7SA 3A27A 4AUKA 2G8NA 3NVKI 1RI3A 1R74A 1L3IA 3GDHA 4C08A 5HOQA 2QRVB 4RWZA 1FPQA 2C7OA 2JHPA 2OBFA 3M70A 4X60A 1RJGA 2AN5A 2ZLBA 3G7UA 5EEGA 1AV6A 3NTVA 3C3YA 3HCDA 4HGYA 2AOUB 3EGEA 2LD4A 3A4TA 5E9WA 3PFGA 2IH4A 3FPEA 2CKDA 5EGSA 2H11A 1YF3A 4FS8A 5K0NA 2PT9A 4M37A 4UOEA 5FQNA 5EIWA 2B25A 4GEKA 4R8RA 5BXYA 3HCFA 4BP1A 2YR0A 1T43A 5CUQA 3SR4A 4DCMA 3VSEA 5EHIA 5HILA 3HP7A 5K05A 3MTEA 2E5WA 1BKYA 1L1EA 2BM8A 3DLIA 5GIOE 1P91A 4HG2A 2ZWAA 4PYMA 1HMYA 4DQ0A 3UBTA 4QDJA 5MHTA 3E7PA 2PXAA 3BWBA 4GOOD 1DL5A 4IKPA 2ERCA 3TLJA 4LECA 1D2CA 2PVCA 1P1BA 3C3PA 2WK1A 2BM9A 1EG2A 1RJFA 4BLWA 1Z3CA 3FUTA 5C0OE 5E9QA 5C1IA 2O0LA 1KYWA 3AWIA 3E05A 4OQDA 4QPNA 3PX3A 3AJDA 5DLYA 1D2HA 3FYCA 4MIKA 4U7TB 5BW5A 5LQJA 3MHTA 2CL5A 5G02A 3ID6C 3G8BA 5FADA 1JTEA 4RVGA 3FYDA 2YTZA 4YMHA 2DPMA 1P39A 5DTMA 1ZHFA 2R6ZA 3BWMA 5K0EA 3A7EA 2AR0A 1L9KA 3GU3A 3UA4A 5CCXA 3ER8A 2C7RA 4HC4A 4KRGA 1QAQA 5HFJA 1X1BA 1X1DA 3KPYA 4HRAA 4RTSA 1XXLA 3BZBA 3EVAA 4MHTA 2O07A 2I7CA 3BKWA 4BP3A 2P35A 3G88A 2H00A 1VBFA 3GRRA 4CTKA 3FPFA 4C06A 5CCBA 1RJDA 3T7RA 2C7QA 3UJ9A 5CM2Z 3FTEA 3DH0A 3M6UA 3TFWA 3THRA 3FPJA 1JSXA 5CVVA 2EG5A 5EKUA 4F86A 4C04A 3DMHA 3L8DA 3G5LA 2PX4A 4GC9A 4QQNA 3GIWA 3GNLA 2P3OA 3NWBA 2NP7A 2OKCA 4EKGA 1SKMA 2ZULA 3GRVA 1SQFA 1R00A 2QE6A 4FGZA 4R05A 4E32A 2IBTA 1YZHA 2ZIFA 3LSTA 4BLUA 3KPVA 4RTOA 4YUZA 3TKYA 4FT4A 3NMUF 4GF5A 3OU6A 2P41A 3MQ2A 2VDUE 4ER3A 3CBGA 1G55A 3OPNA 3TRKA 4DZRA 1MHTA 2OY0A 4R8SA 2JHCA 4RTRA 2IGTA 1QAMA 2HNKA 1WS6A 5FUBA 2ZVJA 4EVIA 3MAGA 4X41A 4QTUB 4NECA 4PWYA 4DM3A 3LL7A 4X61A 2AVNA 2P7HA 3DMGA 4M7RA 3RW9A 1VE3A 3GO4A 3P9NA 4R6WA 5T67A 3TKAA 4CKBA 1Q0SA 4RTQA 1JQ3A 3DUWA 4GC5A 1XCLA 5HIMA 5F2NA 3HEMA 2OXTA 1NV8A 3BUSA 3PT9A 3JWHA 2VS1A 4V0QA 3CJTA 3SM3A 3AY0A 1EIZA 3KKZA 1KHHA 3P71T 2PX5A 2QY6A 3KQTA 4QVKA 3UJCA 2OZVA 4PYKA 4FSXA 4HH4A 4R6XA 3Q7EA 5FULA 4DA4A 1H1DA 3E23A 4GOND 5DXJA 3DXZA 3UJBA 3EVBA 2OPBA 5EOVA 3G2MA 3ORHA 4OA5A 3HCBA 3TPZA 5KS2A 4HSGA 2GAFA 2IIPA 4V0RA 5LQRA 3G8AA 4X1OA 1SVUA 3Q87B 5CVUA 3G89A 2I9KA 7MHTA 5EQJB 5K0JA 2ZBPA 2B78A 5K0CA 3F4KA 2NNWB 3HCCA 3KPUA 2OB1A 5LR6A 2AVDA 2ZZNA 3BT7A 5K8VA 3LBFA 5E8JA 3QOXA 3CCFA 5EKXA 3CKKA 3LHDA 2ZFUA 3LCCA 2O05A 1WXXA 2AOUA 3VC1A 1G60A 4CWAA 1WXWA 4FP9A 5LQUA 1F38A 5HIKA 4RSRA 4DCGA 3B5IA 3KQWA 3UJAA 5HZMA 3U81A 3I9FA 4IWNA 2QRVA 2Y1XA 5EC8A 4P58A 1KR5A 2YX1A 3HM2A 3SMQA 3PTAA 2IBSA 1QAOA 3LDGA 5GP1A 1JG1A 3O31A 4C03A 3GJYA 3UZUA 2YVLA 1RI4A 5DPMA 3ELYA 3MERA 3IEIA 2QM3A 1NW6A 3EVDA 4RTJA 1YUBA 2AOTA 2ZWVA 3FUVA 3KR0A 2XBMA 3LCVB 4FZVA 2PT6A 2N47A 1VLMA 2VDVE 2UYHA 2JHAA 3R3HA 5K0LA 1NW7A 1TW3A 2WA1A 5ICEA 3OFKA 1OR8A 2FPOA 3KQPA 2GS9A 3AXSA 3OU2A 5DX1A 2AS0A 3CC8A 1X19A 1XTPA 4RVFA 4KDCA 3TM4A 5KYGA 1FJXA 1UIRA 1WZNA 3UJ7A 2B9EA 1B42A 3OE4A 4KWCA 4L7VA 1JQDA 3X0DA 3TMAA 4RTKA 1M0EA 4MTLA 2YUIA 4WXHA 3M6WA 3LKDA 3OE5A 4PYLA 3KQOA 3RIEA 3PLAE 1DCTA 5DX8A 3K6RA 1Q0TA 1TW2A 3ME5A 4EK9A 5P8WA 1I1NA 2EJTA 3OCJA 2PX8A 4P7KA 4YMGA 3PFHA 2NYUA 1JG4A 2PSSA 3HNRA 4PONA 4E31A 3FTDA 1ZGAA 5GM2A 3TM5A 3D2LA 2OB2A 3B3GA 5EEHA 2R3SA 4PINA 2VDWA 2UYQA 2P7IA 1WY7A 2EX4A 3P9CA 4PGHA 5E1BA 1U2ZA 2C7PA 3EVFA 4PYJA 2UYOA 4PIMA 1R6AA 4C4AA 4KVZA 1EJ0A 3HCAA 4ER0A 5CIYA 3KHKA 3R0QA 4OQEA 2K4MA 3FRIA 5GOZA 5KQRA 3UJ8A 1ORHA 3K0BA 4C07A 3OZSA 2JG3A 9MHTA 3C6MA 1KP9A 2AOTB 5ICFA 2PXXA 3CJRA 5K0BA 5LQKA 1VPTA 2PKWA 1O9HA 5E8RA 4YUXA 4XUDA 2Y1WA 1ORIA 2UYCA 4K6MA 1KXZA 2DULA 5E9JA 2ESRA 1N7IA 4HGZA 2HV9A 5IH3A 3SSNA 5K09A 4RTPA 2IH5A 3FTFA 3P9IA 2OO3A 3BXOA 3MB5A 2Z6AA 3FUWA 3EEOA 2ONZA 3OU7A 3IYLW 4XCXA 1R8YA 4EMSA 1AF7A 3KQSA 4LWOA 3EVZA 5EHGA 5GWXA 4LWPA 5F2KA 2B2CA 3KU1A 1TPYA 3HVIA 3B89A 5DXAA 5LQCA 1N7JA 3JWGA 2PX2A 4XUCA 3TQSA 4YUVA 5DRYA 4AZTA 2XYRA 4ER5A 4KW7A
chains in the Genus database with same CATH superfamily
5K2OA 1W44A 3FRJA 2FWPA 1K06A 2X1MA 3PVCA 4OBWA 3SEFA 3ZV4A 1KBOA 3I04A 4AJJA 1NLMA 4MYDA 1TF5A 1Y4DE 4Z1MA 2DH5A 4JCOA 4UJ5A 4RA6A 3URKA 2C4TA 4INAA 2NP7A 3OX1A 2WWFA 1ISPA 4Q18A 3L49A 5K0FA 2JJ1A 4IGKA 2R5WA 2J6BA 3K70B 2FWJA 4EPWA 1U8XX 4FI3F 2HF7A 4I99A 2XYPA 4FGUA 1YE3A 2H5LA 4IIXA 1XTZA 2G67A 1MN6A 2C0PA 2YV1A 1U6IA 2NZ8A 3B51X 2CVHA 5KJFA 4LXXA 5ICSA 1Z4OA 3WIVA 1OZFA 2JCGA 4RD6A 4UHDA 1TK9A 4ZIRB 5ABPA 4KYVA 5IH7A 1G8PA 3PPVA 2CBZA 1C29B 3C0KA 5JEEA 3KQQA 1ECBA 1J33A 2PWBA 1EVIA 4OJKA 3C7AA 3LW8A 1M2VB 3FDXA 4B3SB 4L6IA 3B20A 3AUTA 2W11A 5H02A 1JEOA 1E3JA 2WJPA 3VOAA 2GARA 2HHAA 1X77A 3LWZA 3NHYA 1D1QA 3W6ZA 4MVJM 1SOMA 1YULA 4DDTA 2CN1A 1L6RA 3IQEA 3D8UA 2WPDA 4Z99A 4DKJA 1UOOA 3KYBA 1S4MA 2HQ1A 3PPWA 3TLGA 1TC1A 3ST7A 1YVUA 3EUEA 4D5EA 1TMGE 5SZKB 4CM4B 3OM1A 1FRNA 3G0DA 2W7TA 4YYZA 3EODA 4RM2A 4CG3A 3AFGA 1Q12A 4O2BF 2HYIC 3O3CA 4N65A 4HO1X 3EA0A 2K2WA 1AHNA 1K68A 1W5EA 1WF3A 3A3YA 3BILA 3D0RA 4KMSA 1D6SA 4PLCA 5DI3B 1WDLA 4ZWNA 4J4TA 1A9OA 4AG6A 1ZA1A 3WYDA 1Y48E 4JP2A 5F1YA 4XOUA 1OIVA 4WZBA 1OZGA 1W25A 2IYAA 2R1TB 2PPLA 3EIFA 1P6QA 4MQBA 3VSDA 4MR9A 4F2WA 4F96A 5CB4A 3DEYX 1Z13A 2GMWA 2VWQA 4FN4A 4CFSA 3D81A 4C2TA 1TAQA 1N2XA 2I2WA 2VEDA 2I3AA 4YRAA 2EEPA 1Q83A 3GD7A 1KFJB 1CRWG 3E27A 4XIJA 4F5EA 3VKGA 2HDOA 3RFFA 4DY6A 2D5CA 1FRQA 3RH0A 1M2HA 1GPNA 2QPLA 3JQ8B 2WT9A 3PFKA 3WZLA 1STOA 3DNFA 3SBXA 4EYOA 2O2ZA 1UBJS 1F3LA 4LV5B 3DA8A 4X6XA 1K4KA 1NVUQ 1DAFA 1S7CA 4IJWA 4NYIR 5JZSA 1H4SA 2BOVA 3PL5A 4FE4A 4Q1CA 4F5ZA 3WQRA 2AG1A 2PUFA 2QOEA 1KJJA 1EB8A 2WYHA 1RJ9A 3B52X 3MT8A 1Y8RA 4TWZA 3SNKA 4E94A 1PTJC 1T8WA 5B1YA 4AG3A 3WP0A 1Y6FA 2QZZA 2BZ0A 1KDVA 5A3QA 5K3FA 2WRZA 1LEHA 2OK8A 3QNWA 4HN4B 3ZHUA 2X2FA 1KSFX 2XECA 3E22A 4XCVA 5JAMA 1DBPA 2WT4A 1WAMA 2Y68A 1KH3A 5C7OO 2G76A 1E69A 4EHHA 2BPOA 5CG2A 4OV6B 2BGRA 1OILA 1WZUA 4PC6A 1SJ9A 3D59A 5A9SA 2VJOA 4BP9A 2Q5EA 1ENPA 2EJBA 2WJYA 3K3PA 1JHZA 1KQPA 2D8AA 2PBFA 3A9SA 3GAAA 4W5HA 5DLEA 4AZ3A 3UV3A 4PQYA 3PQFA 3X43A 3L8YA 1JA9A 4KR0A 1UBCA 4Y2QA 2WF8A 3ZDYB 3MMZA 4E1BA 2DPGA 1LLDA 4PSKA 3F90A 3VUEA 2DTXA 3ANSA 3MD0A 1O95C 4B3IA 1JFSA 4PPQA 3JVDA 3TX6A 1P4AA 4M1OA 4CIBA 4Y0NA 4X6YA 5E6UB 5CBPA 3EPLA 2P27A 1OX4B 2OGUA 1GZDA 1HA3A 4OHFA 3OG9A 3SS9X 2HWWA 2O0HA 1RI2A 2OSVA 1GZ4A 1K1EA 3INRA 1LW6E 1SG6A 1UPAA 2O50A 5EXPA 3DR5A 3M6XA 5AVQA 2GZ1A 2OMKA 2R00A 3K7EA 4K6OA 2GM4A 1T5LA 1X7ZA 1WUYA 3B6ZA 3C5WP 4QARA 5GZ3A 4Z9XA 5REQB 1NNEA 3PPXA 1FSGA 2FR8C 3MJ4A 1VL5A 1LDMA 4RQTA 2FUKA 1DTWB 4ZVRA 4KLAA 3GNSA 5TT1A 4URXR 1A5AB 1XNQB 1DGQA 2II6A 4KVGA 5BW4A 2DUNA 1JDTA 2Q41A 5GVSA 2OZLA 3MGGA 5C5IA 1KWKA 4IS2A 3V1NA 1FP2A 3AB3A 2E0IA 1YZGA 4XUEA 3FXAA 3INNA 3BD9A 4YBRA 5DNUA 2WZDA 4TLLB 1DIHA 1XEAA 3NHRA 1E1QD 2OHVA 3QLTA 3P26A 4KQIA 4P32A 4V0MA 1JQEA 4UUPA 3HXQA 2BFPA 3KB8A 1IEXA 1UR5A 4WK0B 4B09A 1N32B 1GA6A 1IWOA 1SA0B 3QEJA 4BLRA 3H9QA 1OWLA 2W0SA 3BGVA 5IABA 2EKZA 5ARDA 4E12A 1FTGA 1KHTA 2XMDA 1E77A 3F5SA 4OVKA 3EFOA 2JKVA 3GW8A 3W5VA 3ORRA 3V4FA 5BN4B 4UQLA 2D7DA 1U8TA 3N5CA 3RTDA 4LW8A 3GCZA 4LCBA 2ABWA 2XYQA 3EVEA 3PEFA 4FCWA 2I62A 4DIEA 3D7SA 4MRMB 4TQAA 3WISA 4GOLD 3THOA 3IP9A 3RYCA 4C14A 1W47A 1G8SA 1HPLA 2I7VA 2BKUA 1I4TD 3RYFA 4YAKA 5K0TA 1OGYA 2FEXA 5JLJA 2I71A 4D4HA 5BSHA 1DWOA 4GYYA 3QXCA 4IV0A 2X40A 2JFVA 3JQAA 4JUFA 5DGDA 3SIWA 1X8LA 2PYDA 2X0FA 3F8WA 2VP4A 5REQA 1YZFA 4EARA 3U1TA 1P7PA 3ICVA 2QG6A 4M1ZA 1XNRB 3A37A 1NF3A 2GZHA 2I6SA 2R85A 3RIYA 3NWEA 2QY9A 2VVTA 1ZEMA 3HS3A 3VR0A 3ZV6A 5T6BA 1PR2A 4HS9A 4IIBA 1VLHA 1RXUA 1U28A 1VLLA 3MGAA 4OXKA 1E5DA 1QVVA 3BTVA 3I6IA 1R74A 4KN8A 4OFWA 4UUMA 5U4QA 4C7KA 3HHEA 5KJ6A 2VSYA 3H8JA 3A36A 2PH7A 3SXPA 1TK2A 3JD2A 3P0IA 1P18A 1N1DA 2HAEA 3TL3A 1JFLA 2BZ1A 3L0BA 5T4BA 4BQNA 3OD5A 3LQQA 2NU9B 5IF9A 3FPEA 1UL1X 1I3NA 1XROA 3ECAA 4I5IA 2QTNA 2JIRA 1R6XA 2QTCA 4R1QA 5K0NA 1YDMA 2ZJ7A 2COKA 4QYIA 4F4FA 4L76A 4Q9AA 5G4LA 3ZK8A 5JNRA 3LC1O 1Q84A 5BQPA 2E49A 3EY4A 3IPLA 3HJBA 2E82A 2W2KA 3ACDA 2NV6A 3WYBA 2UUOA 3WXMA 4BNVA 3RWMB 1JJAA 1TQ6A 4PNHA 1VGVA 3L8GA 4MQ5A 3RQIA 1Y6RA 4DQ0A 3D6FA 3UBTA 1YBFA 3OLCX 1ZY2A 2ON6A 4C0LA 4GM0A 1QV6A 2CHFA 4JSYA 5G1OA 4C30A 1EIWA 4G0XA 4M6WB 5B1HA 5CITA 1VXOA 1UJ4A 2ZIUB 4R1NA 4NOLA 1D2CA 2H9YA 3PVZA 4H4DA 4J0HA 4ABYA 2Q0SA 4XGNA 5TRTA 4CR8A 4M7PA 2Y0DA 2ZRBA 3K2IA 5EE5B 4BLWA 2FUCA 5KQMA 5DM70 1J90A 2VH1A 4I1RA 2CJYA 4QPNA 4CCYB 1KJ8A 2EBHX 2P9ZA 4QU5A 5CM9C 3TI7A 2XDQB 4YJ2A 1RZRA 1XBTA 1E6EA 1T29A 2YFQA 3FMFA 4U7TB 4Y9UA 4L2IB 1Z82A 3B6IA 4UVDA 5LQJA 2H0AA 1YDGA 5JYEA 3AFMA 2H52A 3KSAC 1ZK3A 1PQUA 2HA2A 4AJPA 1XYYA 3QVLA 2SICE 2GTHA 2J9YB 4W1QA 4WY8A 1I1HA 2W2LD 3A7EA 4LEIA 4ZC8A 3QKRA 1PZEA 4HAUA 2QVZX 3JQGA 4HC4A 4JBWA 3LZCA 2VSNA 1DJPA 5I7FA 1A72A 4NEQA 4BP3A 1T5TA 1LDNA 1CZHA 2FPPA 3FMVA 1G8FA 3IB3A 1AB5A 1KH2A 3I2YX 2YN2A 5I9TA 4U9HS 4R3NA 1KY4A 1H1TA 1W8IA 2JNWA 4EP1A 4YRMA 4F92B 5CM2Z 3L1KA 1FEZA 5FTJA 3IUEA 5CVVA 3ESBA 3KJZA 4NOJA 4QWWA 1U2DC 2X22A 4RL6A 4TV8A 3DWIA 1KDOA 3PNYA 2D0DA 4EJSC 4FDLA 4J0IA 3KETA 2GNAA 2VF8A 4Y2GA 1NU6A 4BVHA 5T5QA 1COWD 3GJXC 2RGYA 2OCPA 4QGHA 5FEUA 1XTSA 3FWNA 1YIAA 3H1PA 2DJIA 1VRCA 3MQ2A 5HKKA 2XXAA 1TAHA 2RHBA 3IMFA 2PLAA 4WBNA 1W94A 3O03A 4MS1B 4TOIA 3M0EA 1AKMA 2B34A 1P2BA 2H2FA 1PZFA 2IGTA 1ZUNB 1YC5A 2ZVJA 3UK1A 3ZV5A 2I7DA 2VRCA 3OEYA 2V3WA 4HDQB 1JEQA 1HI9A 1CSEE 5A3SA 3S28A 2EJVA 3KXDA 3LLMA 1UT8A 3NHBA 2BAGA 4RSHA 4RJJA 3MT0A 4PTLA 5KJEA 3HP1A 3O21A 4R2HA 4TSKA 4RGYA 4YJKA 5T67A 3K1AB 3CF2A 3V8RA 1J09A 2CEAA 2D0OB 3FCCA 4GC5A 2J32A 1VXRA 4RPHA 1GOTA 1USWA 3EG9B 3BCSA 4BNLA 1KZ1A 3TB6A 1QFXA 5BNWA 3D4PA 1RBYA 2RHCA 2P5SA 2R00C 2X2EA 3GT0A 3HEBA 3MJTA 4MR8A 5T4HA 3V55A 4CG2A 5BYKA 1ZM3A 4KLNA 3O4IA 1CB0A 4U6NA 2PGOA 2CF6A 2DECA 4LVOA 5KMGA 3KQTA 5KIAA 1BXRA 1Z4LA 2DR0A 1OX6A 2EBWA 2GZ2A 4DA4A 2NUPA 2VO1A 2HMAA 2P3SA 1QLHA 1RWKA 1CVLA 1YL5A 2XOEA 3EGWA 3K9CA 4IJ5A 2GQ0A 2RGEA 2VH5R 4KQJA 4PXAA 4Q7EA 4YMIA 3FFXA 1XU4A 2ZVPX 2HRRA 3RARA 2XB8A 2Q1YA 3Q7RA 4HH3C 1Z6AA 2HUNA 3R1IA 2J3LA 4XGIA 4ZHSA 5CK4A 4KI0A 3PNKA 3QTTA 4DLRA 1KI6A 1G1MA 4JKIA 1BAPA 3NKVA 5GV7A 4MUEA 1P44A 1KA9H 3T94A 1KK1A 2A0FA 1B0PA 1CZRA 2HIAA 1L4KA 4JDPA 1NN1A 1YHNA 4TUYA 5DCLA 5A4AA 3DOFA 3QOXA 2JFNA 3LT5A 1ZXLA 1XFDA 2MTBA 3CX7A 2JJ2A 4ZCQA 2OHXA 2P0YA 4TS9A 1UFVA 3GFGA 3WB9A 1FL9A 1PJBA 2HEIA 4DDVA 1QPBA 2VN8A 1ZRMA 5IHPA 4DBLE 1A4RA 1TUIA 1DC6A 1LX7A 2AJLI 3N8HA 3CG4A 4FQ5A 1VG0B 1P1RA 1PTJA 4JAVC 4JODA 4Q5IA 4BB9A 2V98A 4ZYUA 5FF9A 1S2NA 4HVLA 3LAWA 1DKQA 1SBCA 2C4UA 1RI4A 2HRBA 3KXIA 3OO1A 2J6HA 2PMBA 2PKQP 4AIRA 4TYYA 1DOHA 1FYFA 3OBBA 3UMVA 1Z73A 3FUVA 3GLUA 3I39X 3FNEA 3WDMA 3LA6A 1J0DA 1CDOA 2CHVA 4I8DA 4JYBA 4PG5A 3FHCB 3PQDA 5SYMA 3D8RA 2BL4A 1O8BA 5KKCA 3MAAC 2AFHA 4GKAA 5I5EA 1NC1A 2V9PA 3BMQB 3MNFA 3OPYA 3TTVA 3WICA 5J5VA 2JVIA 1LKZA 4UDOA 4EEXA 2YNMC 3EWIA 1LPSA 1P4HA 1FQOA 4ZCPA 2VF7A 3C8MA 1L7AA 1S5PA 4O33A 1SC6A 3QYAA 3MK31 1W2HA 4N5IX 1HDZA 3ABQB 5DBIA 5FOQA 1ZMOA 2EX1A 4TL8A 1WDMA 3Q1KA 4ZI7B 1JPVA 2AQIA 2V5AA 4WACA 4EX7A 1GTVA 3FHLA 3G8YA 4YJ2F 4N9WA 4KV9A 4ZYYA 4GWGA 1I1NA 5ESXA 2QD2A 4F06A 1UDRA 2FMUA 3LZ6A 2YQ5A 4B8ZA 4PONA 4RK6A 1E7SA 1JR3E 3FTDA 1OWOA 1P1KA 4P3PA 5FPPA 1M8PA 3T1TA 5K20A 1NYRA 3DAGA 2J8ZA 5EXXA 1LK0A 2JBWA 4TKVB 4LX0A 4XSHA 4URZR 3H99A 4KJXA 1VJ5A 2OD2A 1IBCA 3QLEA 5LMUB 1S96A 5IT9A 3ZQ6A 5DXFA 3FH0A 5GOZA 1V4VA 3LPLA 1Z5WA 3GUUA 2BFDB 3PD7A 3SU8A 3U48A 4C7VA 3E15A 4YNBA 4CT0A 4RHXA 4QC2A 4QM6A 4Q4AA 3BN3A 4BFWA 5IRCD 4JK3A 2B7BA 4JX9A 2P62A 2GKGA 3ZWVA 1HNWB 1VPTA 3LXMA 5B1IA 5LP6F 2WAMA 2WC1A 4Y2JA 5C8ZA 4AF8A 2CLKB 3CRW1 2PSJA 5ALTA 4DCOA 1OBHA 4TT3D 1RC8A 1XFAA 5FBRB 1Z8FA 1EFRD 1MQSA 3E7WA 3I45A 1V7QA 3MUNA 4L5CA 1ACMA 1YQTA 3NRJA 4JT4A 3RK1A 4R2WA 2IH5A 3EZ7A 1OU0A 4YXWA 4ASUD 2Z6AA 2ONZA 3OU7A 1UMDB 1PJ8A 3N6XA 4D9JA 4XCXA 3L0IB 1RR6A 3DBLA 1R8YA 1DTSA 1TZCA 2AJDA 2WB4A 4N3BA 5T57A 4EHFA 5KB3A 3DKKA 1NUSA 4YROA 3OFSA 4II7A 3F2IA 4J6FA 3KKMA 4OH1A 3DYIA 5H7XA 5KOJA 2HM7A 3E22B 1A5ZA 1QGED 3KD3A 1TF7A 1J1IA 2JH8A 2C00A 3OA2A 1Y37A 3G9UA 3PDIA 2WWRA 3LFHA 2BMDA 4O4HF 2F3SA 5J40A 1CQXA 4W7SA 5CA0F 1KGSA 1GKYA 1JFFA 3KTAA 4CV3A 4D8YA 1YNOA 4WJKB 1E5VA 3HRIA 4JJKA 1OFUA 2OV2A 3AT1A 3SBOA 2NUTB 2W6IA 3FUXA 4IMJB 3KHSA 2KLHA 5I7SA 1V7ZA 4HNSA 4X7RA 4P3NA 1GFWA 1DKUA 2BGLA 2BEUB 1E1QA 3PF8A 1KMHB 4P1ZA 1W36D 3BWDD 5JY1A 4DXAA 5I6DA 1L5QA 4Q82A 1TMKA 2VP6A 5KX5F 3QFTA 2AG6A 3NNDA 3S4YA 3DONA 4CTJA 2GYUA 2MDTA 5CDFA 1Z0SA 4HDKB 4GUAA 2ZTHA 5CD1A 3DL0A 3LL4A 4C7XA 2DHDA 4F6CA 3AHHA 1NXXA 3OUZA 4OXQA 1JSZA 4YHHB 4JSRA 1BW9A 5AVKA 2H4WA 4CM8B 2WYWA 3KE8A 2PA3A 4OEHA 3U4CA 3VNAA 3ZDDA 2IUSA 2FQ1A 2ZAGA 5AH0A 5FL7D 4QBIA 2NADA 1IHOA 1U1CA 4FFRA 3S44A 3L5KA 2VF4X 5B58C 1FYEA 2Z8YM 1HR0B 3H9BA 2QLFA 3I37X 5HM8A 4KR6A 1V6CA 5TVKA 1DBSA 3GRFA 3DE6X 4AJ1A 2E4WA 4RZXA 4NMLA 1DBIA 5LP6B 3AX6A 3P9KA 1XDWA 4HTFA 1GKUB 3BAFA 4J0FA 4RHFA 5ESRA 5C8XA 4NPCA 1HZZA 2DU8A 4F1KA 1TM2A 2JRLA 1QH0A 4L95C 5EKSA 4DREA 5C8VA 5IT5A 4RKYA 1IBLB 1AQLA 4MP6A 1W59A 4BVKA 2R7NA 4RS4A 1S9DA 5JDCA 4G0UA 1VCMA 5KX5B 3C3KA 1AH2A 2VT3A 2HCBA 4TS3A 3BMCA 3E2MA 5HS6A 3R75A 3OZ7A 3WWDA 2NAFA 3GG2A 3PNPA 3T15A 3DMTA 1BX3A 1GG2A 1N5OX 1R0LA 3PV0A 1QHIA 2M6SA 4I46A 1E92A 1K6EA 3IAFA 3IT3A 3PP8A 4UHHA 2GZSA 4CM6A 1QG4A 1NPTO 3OTOB 4TZ0A 2ZUDA 3RYFB 1A4XA 1W2GA 1ZN9A 5KC8A 1X7XA 3U4DA 2XNCA 3CLTC 2C8VA 2OK7A 1VLJA 4J4HA 1KEZA 2DX7A 1QE5A 1OCEA 3UG6A 3MOSA 2DQKA 2O2JA 2V7PA 2G4VA 3VX3A 4ZDKA 3QUTA 4P3YA 3ZCPA 5KAPA 2C2YA 5D3MB 2YY5A 4IP0A 1ZG3A 4DNFA 2CNWA 2OQ2A 4NESA 4WUTA 3REOA 3DHYA 4F8JA 3LGAA 1N2CA 4QHSA 1F2UA 2UYGA 3MVEA 1GZVA 1O4WA 1CZNA 3G5UA 4EG8A 3SF8B 4C3VA 1V7PC 2Q4BA 4XVCA 1FIUA 1ZVQA 1VKNA 3BL5A 1D7OA 4ISCA 4QG3A 5AW6A 2Z57A 4MRPA 4WKCA 4ZAGA 3ZWXA 5BSGA 1SIUA 1MB2A 4IS3A 1PJTA 5FD8A 1AXRA 3O90A 3T6KA 4OTZA 4G2TA 2OFFA 1ZN8A 4WKPA 2H2AA 4M4SA 3SIRA 4ER6A 5A5EA 4DDHA 2F48A 2FMKA 5ALZA 3E9EA 1D1SA 5LQAA 2CDAA 3AEQB 1QK4A 2V8OA 2VHYA 1QIIA 4IDQA 1NUUA 5AVVA 5L3SB 4NU0A 4ZRMA 2X3YA 2WAYA 3AOEA 1IDN1 2QDXA 2W6JD 3QYFA 4X94A 5TMBA 3PC7A 5EIEA 1JQAA 3F78A 1ODTC 3IV6A 5ES4B 1CE8B 4NE9A 4JFAA 4UBLA 4HGQA 1UIMA 1BX0A 3RFXA 1MVOA 2I54A 3G5AA 3H4IA 4WK6A 4BRWA 2B0CA 2H2DA 1Y8QA 2D00A 1I1QB 4LJ5A 1U3FA 4FW9A 1DEKA 1PD1A 1T3LA 2XGMA 2XYGA 3FLAA 4MUIA 3IC5A 1BJRE 3ADKA 3P32A 4TRJA 5H0IA 5JALA 2AQ8A 4XVUA 1C30A 1N2SA 1UK9A 4I50F 5E7MA 4Y2TA 4HUJA 1H8EA 3SE7A 1D6MA 4ZYVA 1GRRA 1VJDA 2ZGVA 2Z4TA 3NJRA 1UJ5A 1CIPA 1LNSA 1YTUA 2O48X 2X0RA 3ETCA 2D62A 1BJKA 1RCFA 1YK1A 4RMHA 4KDFA 3U9SA 1Y7IA 3LSYA 1K9SA 2IHNA 2JAXA 2NTVA 1OF1A 1EZZA 2V7QA 2GKSA 2V7WA 4FCTA 5JRJA 2UZ4A 3OF3A 1VMIA 4JUBA 4QQKA 2FZVA 4FEAA 3SHWA 1PP4A 4UTPA 2BSXA 3TXXA 1ONPA 1Y4UA 2BBSA 5DNDA 1TRHA 3ZBQA 1N1EA 4WV3A 1UPUA 1RQGA 3HVRA 4BRUA 3MJEA 2ORYA 4FOOA 1SUSA 3EF1A 3N2ZB 1PCXA 4QT0A 5EL0A 4LVNA 4AUNA 3PX7A 3MRTA 1U0NA 2CK3A 3BWCA 4FDTA 1B26A 4V39A 4YONB 4DA8A 2P0AA 1ZI9A 3BXXA 3GJ3A 1FBTA 2IZZA 3BXPA 4B35A 3R44A 1MO3A 1P8AA 5EJEA 4OLBA 1X74A 5T8KC 3V8EA 3T5CA 1HDEA 1RAHA 2WBLC 2WLSA 3IPYA 3FPLA 4AKSA 1HYGA 3ZE2B 4RKEA 4MWDA 1RTTA 2JBAA 4JJ7A 2SKCA 2QTMA 5EE3A 3RNOA 3IKJA 3P9PA 3P9RA 4LDJA 1XXHB 4V3BA 5FI1B 3TPFA 4RTMA 3HO8A 1K8RA 3LPCA 5ELLA 1TC2A 1ZMTA 2Z4SA 4PPGA 5FA6A 1P2VA 1L4FA 1IG3A 1Z0UA 1M0WA 1DLIA 1MC8A 2AUNA 1RI3A 1HF3A 1U94A 4BC1A 1IWPB 3UKDA 5HKKD 3TGLA 2I6FA 1C4WA 4BDSA 1R9GA 4CMEA 1G98A 1G59A 3Q40A 4GDMA 1C3OA 3C3YA 4JDUA 3NYWA 3K73O 3P94A 2YXBA 3BGSA 3QPAA 4FEGA 2JIOA 3A58B 2CKDA 4YJ3B 4KFTA 4DDUA 2IS4A 1WDKA 3CH4B 4M9XA 4CRWB 4AS2A 3DP9A 3OIFA 2GBPA 4O08A 4D45A 4BKUA 2CXTA 2BGUA 1RMYA 3NKFA 3SR4A 3C3JA 3U4GA 5AUNB 2RDMA 5DCYA 3ESAA 4EA6A 3DR3A 3QE0A 2BM8A 3DLIA 2B5VA 4ZU1X 1P91A 2Q0HA 4PYMA 4QUHA 4HYEA 3TL2A 4G5XA 2GAAA 1BIFA 5TQ0B 1G3QA 3FDZB 4RPLA 2PXAA 2FXIA 1ZI6A 3DDUA 3R7BA 3ZC3A 1MEOA 1BO6A 3KQUA 5I4CA 5IDYA 1A9PA 3FYSA 3HY4A 4LDZA 2GFQA 2GHQA 3QU4A 1MORA 2O0LA 3Q5EA 2DE0X 2F90A 3EIQA 2OVFA 1ZD9A 2WV9A 2YVQA 5BW5A 3A6PC 4QX6A 4ENWA 1J21A 1R9JA 4XX0B 1QH8B 5BOSB 2VF2A 1V6SA 1L2TA 3SYRA 3LX8A 2W5UA 1XF9A 2CCJA 3A0UA 1U1IA 1ZHFA 4GPIB 4EW3A 2HX1A 5KREA 4RDCA 2HGZA 1W4LA 2WNHA 3KZOA 3ZGNA 4X66B 1QIDA 4NCHA 4YFVA 1U0EA 4F2HA 3T7IA 3TSYA 5I7AA 4RTSA 1SC9A 2DQZA 5B6JA 1PL7A 2IP4A 2O07A 3NVKI 1AN0A 1D09A 4KQHA 2ODQA 3GLGA 4WK2B 5FBKA 4UE3S 4CTKA 3WMEA 1ZUHA 2QRJA 1I2DA 2XAUA 2J6CA 4EO4A 3GMSA 3ICQB 3FPJA 1JSXA 1R8SA 2V6BA 1G4UR 1UOEA 2B8NA 4FWTA 3I5AA 1CNFA 3MTQA 4DQDA 4L15A 3E61A 1PX0A 1T25A 2JDIA 4HDAA 5J1TB 1MH9A 2QAJA 4HATA 5LKAA 2J3EA 1EUYA 1SKMA 1D9XA 5DNVA 1QIHA 3IIMA 3ZTTA 5LMNB 1U3UA 4DPLA 3OD1A 4B73A 1JI0A 1KSHA 2E6KA 1YA8A 2R7MA 2YZNA 5KYUA 4OQYA 5C7YA 1JR6A 3CBGA 4OO3A 3ETDA 2Z6VA 4DIUA 3RAJA 1LTKA 4FCCA 3QVTA 4M9UA 2Z98A 1CQIB 5IYZF 4HSEA 2HQSA 3HJRA 3GQBB 3ZW7A 3FOCA 4Y3UA 5HTKA 3T9BA 4F4CA 2DUWA 2YWEA 3R6LA 2B20A 2CXXA 4PAOA 2VPTA 2Q3HA 1V8BA 4X61A 5EKDA 2GD1O 2C4VA 4JC8A 3TTSA 2WZBA 2D59A 1TKAA 2YCLA 1ZP6A 1HXHA 1P1HA 1XCLA 5F2NA 1Y9EA 3BUSA 3F5FA 2PCJA 2VRNA 5ADVA 1MDFA 1NVVR 4D4JA 2E89A 4AY5A 4WTOA 5KYNA 1H2AS 1T2NA 2AE1A 3KKZA 2PX5A 3O8DA 1WSWA 1EEXB 1CW2B 1EXNA 3WQSB 4NENB 2LIPA 1P5FA 2GCNA 4BAZA 1UAYA 3Q7EA 2C4NA 4QDOA 5JDIA 3BSWA 1QV9A 1AUPA 2H5JA 3HV0A 2G4CA 3KOMA 3KZMA 3WLRA 2A57A 4RBNA 1VLZA 4G8CA 3L3BA 4S05A 1V16A 1XZKA 1FTWA 2QLBA 5CCEA 1IVYA 3FOZA 1EM8A 5JRDS 3EGXB 2V6IA 1H4TA 3SS7X 2CLSA 3G8AA 2V55B 4G5SA 2IS1A 1V5WA 3I05A 4WQMA 4R54A 3QE4A 4CR6A 1ADYA 4RF5A 5TLSA 2FPRA 2AVDA 2Z8ZA 2DPYA 3BWVA 1Q0RA 3DC7A 2VJMA 4KAXA 3RT1A 1DTEA 3VAYA 5C46F 1ZSNA 4CTMA 4UM9B 1DUIA 2YZKA 1MT3A 3GA7A 3L7MA 4MGYR 5EP3A 2O05A 4A4DA 5KSOA 2RHJA 3QW4B 5EWMB 1NBWB 5H5JA 1VKZA 1OXSC 3U61B 3STUA 4BNWA 1XJQA 4OF4A 4EI7A 3GP5A 2BEJA 3LDGA 1P74A 3IAAA 4IVPA 2KHZA 5LZ2A 3GLIE 1QH1B 3GAFA 4EY3A 3TNYA 1DJOA 1YCFA 1V95A 1PJAA 1QV7A 2ANCA 4XCQA 3ZWOA 2E5FA 5ALEA 1P9NA 3HWWA 5HQ3A 2PJRA 4YRPA 4IMIB 2ENWA 4P98A 5ECGC 5CK5A 5I01A 4F38A 1P0CA 4F3NA 3MD9A 3QPVA 1DIAA 3FWHA 2X0JA 3BXGA 3OJWA 1YZNA 2Q62A 3PDUA 4ZARA 3S2EA 4HF7A 1JH9A 3WHKA 2I2BA 4OKSA 3EXAA 3MG9A 3AVVA 2N9UA 3U3ZA 4J0CA 4BNXA 1M75A 2YHUA 1U4NA 1K0FA 3TSZA 4L7VA 4KGVA 4NG5A 3A2KA 3LP6A 3TAHA 3KOOA 4REQA 3K6KA 3BZWA 1A7KA 3W5IA 5AIBA 3SI7A 2ZXUA 4P0TA 1TW2A 3SJCA 1XXHE 4FBGA 1S2DA 4TTSA 3C1TA 3H84A 1NRXA 4F4DA 3AYXB 2QI9F 4DWOA 4QQRA 3ETGA 1XR3A 1FFCA 3OLQA 3EEFA 2NSHA 2FEKA 4HB3A 3ABSB 5H83A 1J5XA 2GFHA 2GPSA 1EE1A 5ESWA 3O92A 1ZXBA 3CKLA 1JYFA 5HKOA 3WJAA 3UXYA 1JILA 2JZCA 4BEVA 5BY2A 4MV6A 4PVDA 4GOKA 2BW0A 3ZGXA 3VNBA 3TLXA 1XP8A 2RHHA 2YIVX 4C07A 2L0XA 3EIOA 3V48A 1CJBA 2GNOA 3KUUA 3M49A 4M0CA 1VKHA 2J9ZB 1OI4A 2XUJA 1TQ8A 4MK4A 4MVCA 3W3AD 2Y71A 4M0MA 4EHBA 1FFXA 2OQIA 3VR6H 2BFBB 5I8WA 1Z45A 2ZDGA 1JEJA 1CP2A 1ORIA 2P68A 3AV0B 1DV2A 3M3HA 4XJXA 2OCBA 1XCMA 3E84A 4EB6B 4NIMA 4JT2A 3OZVA 3OICA 4MV9A 4ZQHA 4BX0A 4RTPA 3U44B 3M1YA 5ELMA 2JI8A 2EQAA 3CWCA 5JFTA 3DKVA 1J22A 4DLAA 2O7QA 3IURA 3V3KA 4V1CB 5K4GA 3WGTA 4JEIA 1V9SA 2RI0A 3KJHA 2CXHA 3NTQA 3JAKB 4HADA 2IGBA 5ALQA 5TNXA 3ZTYA 4LZLA 2WUFA 3DBRB 3LY5A 4A8HA 4F3RA 4BO4A 1AQ6A 1H8HD 1LF5A 4FKBA 4WA8A 5MFZA 2XYHA 3HQ4O 5KNCH 4MV0A 5KTNA 3I04M 4NYJR 4MZXA 4DTIA 1QG2A 3KWFA 2OD9A 3CZAA 3OFNA 1MHPA 1NJ6A 3HLYA 4KR3A 1OAAA 1SXJE 4NZOA 1U8AA 4NFSA 3E81A 3QEKA 1XZPA 2QAGA 3GB9A 3QZUA 4A8JB 2HF2A 5ITVA 1XDZA 3AIOA 3MRSA 5JAZA 4BC0A 1N5JA 1XALA 5KOYA 1OY1A 3WL8A 2H1FA 2HJHA 4X6UA 3K5IA 3SLKA 3KJGA 2Q7DA 3U4HA 2Q6IA 4WXPA 1FMCA 1R5NA 1GLVA 3H2GA 4LJAA 5FQOA 5TB5A 2PYIA 5CBKA 1JLLA 1O08A 4W6ZA 3M5CA 1JLKA 3TJZA 1LRKA 3NETA 3DMDA 4NCAA 1OZAA 4AFNA 1VA4A 6ABPA 2VK2A 2VDRB 2RHMA 1T9GS 3QX9A 2FDXA 4MVJI 3A1CA 4MKZA 4KITB 3CVXA 1SBTA 4LOKA 3OFJA 2NT4A 1XAIA 1IN5A 3B38A 4KXNA 1J4AA 2R7LA 5K8IA 1QMPA 3BRSA 1IPFA 2ZBQA 2D5AA 1OROA 4U7GA 1Z4NA 1L7RA 3KT3A 1FDTA 4EL0A 4UD2A 4DHEA 2AI2A 4OFBA 4AJLA 5IK2A 4V1CA 1IY9A 4LIPD 2QNRA 2IX3A 3C41J 4N41A 3W5HA 3GUVA 1G9SA 4BO5A 3UC9A 2V6FA 1ZYUA 4HGPA 2ORIA 2FU5C 4A2PA 1BTOA 5HF9A 4MNTA 3KTOA 4C5CA 2CXNA 4I5EA 1N9GA 4PNZA 4D9CA 1JI3A 2V3VA 1XZJA 3COZA 1CF9A 1B6SA 4O25A 4ZT3A 2PJDA 5BV7A 4PLVA 1CX9B 2HY7A 4FMCF 1JN0A 5G2OA 3Q98A 2ZSHA 4DR1B 5CTJA 2A2ZA 4DM7A 3H0EA 4BX2A 3I6BA 1YZYA 2IELA 4KRXA 1EUCB 5FFNA 2EZ9A 4KWIA 4RA9B 2GM5A 3VOTA 2LNDA 3MCTA 1Q91A 2W2OA 1JW9B 3WBFA 1NUTA 3V5NA 3A1NA 3KJQA 3NVDA 4X54A 3EZXA 3F1KA 3VSAA 1WRBA 3H2ZA 1SXPA 3O38A 3RU7A 3G7NA 1TU3A 4NCIA 4EMTA 2JFZA 1VE1A 4HY3A 1WKBA 4Q02A 4TVSA 2VHCA 3T8YA 1K5GA 4Q93A 4CQMB 3HP4A 2GBLA 3JRXA 4UM7A 2OESA 1IWBB 2Z0MA 2WIDA 3QKWA 3SR0A 5JJ5A 1XJ5A 2RK3A 2HK7A 3O82A 4P36A 4RTLA 2IHVA 1JU9A 1GA4A 1A69A 4GYJA 4JWTA 4WH0A 1MAHA 4EUHA 3K32A 2NUTA 5AKEA 4LF4B 1SA0A 2SNIE 4E2ZA 4OXNA 3VU8A 5U4XA 1ID8A 3RS0A 3MELA 4R3UC 4N3AA 1DG9A 2CHQA 3Q15C 4IOLA 4B45A 2AXNA 2JGIA 4U0JA 1ZESA 2PDAA 2X5XA 3VNUA 3TOZA 4DLVA 4PZ0A 5EVJA 4N7JA 4BX9A 5CLHA 1JA0A 3TSOA 3N2IA 4NBWA 3BM5A 4WKOA 5B53A 2QNIA 1Q1AA 1ONNA 4ZO4A 2BHRA 3W3AH 4CLXA 4RZIA 1O58A 4JYPA 4LFCB 1AQIA 3VH1A 4DCJA 4DLYA 4ZEMA 3T3GA 2AN1A 2D3TA 4DOMA 4JC0A 4L9RA 1N8NA 3X1XA 2I33A 4DMUB 2L82A 2OL4A 2RB5A 4UTNA 4RHCA 1XI2A 1XHFA 1I0LA 5BN3A 2ZIWB 5TARA 2JKYA 3CX8A 4J49A 4ENSA 1N6KA 4WXRA 4ZAVA 1G2IA 5FJIA 4LYFA 4A8PA 1JDBB 1SG0A 4P92A 5HF6A 2FWAA 4EA9A 4JI2B 1QJCA 4H1TA 1YI0A 2Y0EA 4H6XA 2OQVA 1OA1A 1T2VA 4D74A 4L8VA 2CFOA 4OYRA 1KY2A 3OQHA 2IYFA 1QZTA 4QTYA 4H7KA 1XVVA 4O63O 4IH1A 2V9CA 3L6CA 4L02A 3WGGA 3D8NA 3DZBA 5HGJA 3AF0A 1RFLA 2NQ8A 3BSSA 3LXRA 4PCVA 1LSJA 1OUMA 3P2IA 5E0OA 3HXMA 2A3NA 5BNIA 3SP1A 2NNLD 5F3DA 2OA0A 3M4XA 3IUSA 4MAFA 3SXUB 3C6KA 4MLPA 3UHOA 1JFTA 2RGCA 4MA5A 3ITDA 3KJFA 4RJKA 3IQZA 8LDHA 3EXEA 3Q3CA 2PMWB 4ZTZB 4K9MA 3QHQA 3AUJB 1G3IA 4R5HA 5IULC 2QTBA 4KQEA 5BOVA 3JY6A 1U8UA 5L3QA 3H11A 4UEWA 3STVA 2J09A 1T1RA 1H5UA 4U6QA 4ZVTA 3NOVA 4B6EA 4BMOB 4C3ZA 4ZDIA 2GB4A 2VHVA 3CEHA 4I7EA 1RWOA 5C1DA 5JH7A 1W36B 1JDNA 2QVBA 1TT5A 3LGXA 4D0RA 2IPLA 2CV2A 3O8LA 3NS7A 4D4LA 4J9UE 1DBWA 2QU8A 2W6OA 4OAQA 1AC5A 3NHMA 1JR4A 5K1ZA 1XMQB 4TYNA 2UU9B 4Y9RA 2FQQA 1S89A 2HI0A 3BSFA 3QTLA 1GL6A 2NYAA 2V4MA 2I9PA 4HDSB 5E7JA 5ENVA 1JHVA 2OUIA 2JGAA 1FTNA 5JBNA 3EWNA 2VQ3A 1QCDA 1S2OA 4TSFA 1ZU4A 1IC6A 1D1TA 4KWTA 4QUJA 1GPYA 4IDOA 4DMFA 4F4JA 5FWYA 2IYXA 1D5CA 1Y3BE 5I48A 4CEJA 3GLSA 1DNPA 4PS0A 1U6JA 2Y67A 4OHWA 3TLAA 1WDWB 4JI5B 1VG9B 1CUCA 3OC0A 1E1YA 2QF7A 4PLGA 5AW4A 5KZMB 1CG6A 1V5EA 3BA1A 4IDDA 5GM1A 2R87A 3CVJA 1P8JA 1Q1QA 4N0DA 1D2GA 2C31A 2EP7A 3DG9A 2E2WA 3K5PA 3SJUA 4WLNA 3W5CA 3DVAB 5AFSA 2O8DB 3IHWA 2AR9A 1Q14A 2WWIA 1O97C 1GNTA 2WU3A 2IE8A 4CE6A 3TOVA 3LVQE 2X7HA 2J9FB 1AQJA 1JJBA 4QAQA 1PSDA 4H7IA 4Z9BA 4QOEA 5JANA 4F6LA 3RYCB 3KEMA 2E48A 1GAJA 1U7TA 2JFWA 1NI5A 3LW7A 5JVDB 1VRVA 4ITUA 2FGKA 4M2LA 1W4BA 4MQUA 3FR7A 3R77A 5AHOA 4HNAB 3E0XA 3EEIA 4Q01A 4RW0A 1GSHA 4AS3A 2V54A 3KKQA 1W29A 2XUOA 2OXFA 4MVXA 3W2FA 3WNZA 4EEKA 3H05A 4Z7OB 1IOZA 2YOHA 4EFMA 5AVSA 4BO7A 3QF4B 3A4YA 2V8BA 3FPCA 1DJQA 3LQKA 4WCVA 5JZ9A 2I29A 5BUQA 5LMZA 4BP1A 1BXGA 3OZEA 3SOZA 4UE6A 1BXRB 3K8YA 4BKRA 3X2FA 1W1IA 2B1GA 1OSNA 3AYZB 1W49A 5KDOA 1A8IA 1QRUA 1QS0B 1T2UA 2NACA 3QKUA 1QYDA 2D2EA 4CEIB 4OU4A 4DXDA 5MN4A 4ZQIA 1F1JA 2ZETA 2GCPA 3BWBA 4NMWA 1ZJ5A 3AESB 4WT7A 3ZS8A 2FEWB 1XOIA 4C6RA 2UDPA 5LMCA 1K63A 4J76A 4UAUA 3RC7A 1CRLA 1BU8A 2Q28A 3OQNA 1EG2A 2IXGA 2P1ZA 4ZEWA 4DAEA 3U09A 3CZCA 1XRSB 2VSFA 4N40A 3BMCB 5DN9A 1Y8AA 3K5HA 4P4SA 5IVDA 1E2IA 4FYMA 3W6UA 5AVJA 2GJSA 1NXVA 4ENRA 4BP8A 4N12A 1JTEA 4MW5A 1UXHA 4E1AA 1WOYA 4HEQA 1OWNA 3Q88A 5FBVB 1DP4A 2PL9A 3GGJA 1V45E 1PWHA 5IXJA 4UU1A 2RK6A 3UA4A 3ZVLA 3ER8A 5CCXA 2I1WA 2XUQA 2Q50A 4LKOA 4WVFA 2C7RA 5DCWA 1UOPA 1X1BA 4IO1A 3SKVA 4HRAA 4CIYA 1W30A 1C4OA 3LHIA 4QLBA 4FFVA 4Z1MD 3B1KA 4G0QA 2JI9A 3M2PA 4LJ6A 3TD6A 1MOZA 3W77A 2QVGA 2HV8A 4LHSA 3LA8A 2OAQ1 1G2OA 1W9HA 4TTPA 3FZYA 4Q9IA 2P79A 2BC9A 2Q3CA 4WDRA 4Q0MA 1LPAB 1UK8A 3FPKA 1BE0A 4DQXA 3RNLA 4L4RA 1A8QA 1SIOA 3HN6A 2BV3A 3MPOA 4D82A 4EKGA 2ZULA 4B6RA 4R05A 3EH2A 4KO8A 1M6HA 2FFAA 4NQZA 4JEHA 3MSCA 3T0FA 5FPKA 4ER3A 2VDNB 1MRSA 3OHSX 4QOIA 1SWWA 3KYCB 1F8YA 4BFVA 1ZS9A 1CY7A 1JB1A 2VR1A 1T5OA 2A9JA 4CMBA 5CA1A 1RP1A 4FJ1A 3BCUA 1YRBA 1LV7A 1MIOB 1GSOA 4BQIA 3ZX5A 3KVOA 3ZK7A 5CFZA 1J8QA 3IDFA 1PBNA 1Q16A 2AMVA 2OG2A 3NEJA 1BDBA 4R6WA 4XGRA 3RASA 2V1UA 3QMMA 4ZOLA 3WL4A 1EVJA 3K31A 4H1WA 3PQ4A 4B81A 1LUAA 3MGCA 1KI7A 1NV8A 2FPXA 3EXIB 3PT9A 4YUAA 3E8MA 1MAVA 1OXKB 1U0FA 3RSZA 2OXRA 2RIPA 5K5EA 2AGVA 4GLFA 2ZUEA 3TLEA 1V47A 2C88A 1KHHA 5IJZA 1JNXX 3KDAA 3NJ8A 3LDHA 4QVKA 1G16A 2IYOA 2G6TA 4HH4A 3CWQA 5TQ2A 3RUEA 1H05A 3GEEA 3JV7A 5AM5A 3SYNA 3K20A 3NGLA 4AWXA 4B3XA 2H8KA 2I2AA 4I50B 1YA6A 1TFRA 4XB2A 1J2RA 4XEHA 3BTSA 5LBUA 1VZ2A 5E3HA 1IDOA 4A1FA 1A5TA 4L85A 1QS0A 3NEYA 1W88A 4AO6A 4MYHA 5LQRA 2F6RA 1CJTC 3G89A 3EXHC 2XCSB 4NMXB 5FO0A 3IJRA 1XK6A 4MR7B 2WPDD 1AE1A 3EAFA 3GBPA 3AO0B 3H83A 3GJ4A 3TINA 3RJ9A 5CVTA 2O2GA 1L5HB 2YHBA 2ZJOA 4G0PA 4G1VA 5ALUA 4PZ9A 2XCRB 1R6DA 1UJBA 3GUHA 2OR3A 3UJHA 2LCIA 2JIZA 4XLZA 3EN0A 1JZTA 2JGNA 3P2OA 2HEGA 3SBDA 5GGXA 1GGHA 1MGPA 3I4CA 3FDJA 4RIGA 3HB1A 4JXZA 4N39A 3GGCA 4RH1A 4YXFA 3DCYA 1LSSA 3P2JA 1PT6A 1RRGA 3L1HA 4OMDA 1E3EA 1OH5A 1BMFA 3DL4A 5KVCA 1ZD1A 2QPTA 4P58A 3OPQA 4HEHA 1NMYA 2GBIA 2VJLA 4FOSA 3SQNA 2VHQA 1BG6A 3A31A 4L8GA 2FOIA 4UQOA 3DEIA 2R751 4YJ3F 3UZUA 3E5NA 4G25A 2QLNA 5J58A 3GPCA 5IM4F 2YN4A 3PNMA 1XCBA 1YUBA 3ASYA 2PD4A 3QE9Y 2FWBA 2HMTA 2XBMA 2HZ7A 3GARA 2UYHA 3W1VA 5EXEA 1OKKA 2GHRA 5GONA 4R2LA 2M6LA 2JI7A 3HFSA 1S8OA 3LO8A 2DWCA 3SDSA 4FC6A 1JU3A 4FJ0A 4RVCA 3ZI0A 3AHCA 1XCGB 4UNSA 4DG8A 2XBLA 1E4YA 1U2GC 2RB4A 1EGAA 1RHMA 2G5TA 1W5SA 3KC2A 4QM7A 1KJ9A 1X0XA 3FCOA 1B42A 3WLFA 4TLDA 3OHPA 4TYPA 3U80A 3U3OA 3CISA 5JG7A 4XDZA 4PGMA 2IX9A 4OM8A 4HL6A 1JLRA 1NZJA 1GGJA 3ME5A 4PTZA 3ZWDA 3KQLA 2XXAB 1VPLA 3N8NA 4L4SA 4M0FA 4IUCS 3UWMA 3U7GA 4GNRA 2NLOA 2PTHA 4OAOA 5LXTA 2OMEA 1FW6A 3R2JA 2OB2A 5BV0A 4PINA 3KSUA 3INTA 4E03A 1R0ZA 3AGQA 3IA2A 5JD5A 4JJGA 3BZUA 4CM7A 3IE2A 4KKXB 3BB3A 2JLQA 2E85A 3K1AA 4PHHA 1O4VA 4BNZA 4YUWA 2J3MA 3HM9A 3ONFA 5EWJB 3SC2A 1FTQA 3N7UA 2CHGA 5DT9A 3U7FB 3NM5A 1MR3F 3CJRA 4HQOA 1H2HA 3IUPA 2Y93A 2XUHA 3B8HA 4YJGB 1O9HA 2NO5A 3G13A 1I32A 1YQXA 3PRHA 3STHA 4DJAA 1CZOA 4FBMA 4G0VA 1H3EA 2DULA 1SKUA 2XSZA 5FUMA 4CETA 4MI3A 3SSNA 5TJ9A 4NJEA 1E58A 1CUBA 3AKEA 1NLUA 2VDOB 4GIBA 1K4MA 4QQFA 4NK4A 3Q3GE 1JKXA 2KJQA 2Z09A 4UHJA 1UJNA 2E4YA 3L93A 4WCDA 2PRZA 4JS0A 3C15C 5G53C 5IT4A 2HDWA 1HKUA 3T5MA 4EKYA 2EIXA 1KI6B 1D2EA 1REQA 1PWYE 1H4VB 3BHNA 4KQMA 1SOWA 1EE9A 4M9CA 2AW3A 3L5OA 4LF7B 1RQLA 2ODTX 1CRQA 3JWGA 1Y89A 2XD9A 2G9UA 3B7WA 4QFDA 2IXDA 1KYTA 2QSZA 2PSEA 4BCCA 1ENZA 1X8XA 2PT5A 2DJ5A 2J3KA 3EIXA 2G04A 4NYMR 4PYOA 5KU1A 3FW1A 3I6QA 1U0JA 1E8MA 1MO4A 1UMCA 1XKXA 2GXQA 1SEVA 1SBYA 3KU4A 3I9MA 3M6VA 3T0GA 2O5EA 1GGMA 2ID7A 1DFGA 1RAIA 1M8GA 1A9YA 1K7YA 4C6TA 2JEYA 3PQ3A 4OX9B 1XHLA 3MYYA 4A6DA 3BEDA 1ACLA 1PR6A 3WV5A 1VYUA 3SSMA 4AZ3B 3SDZA 4KO1S 3F74A 3RIMA 2EZUA 4YI5A 3TJRA 3D8BA 3VKWA 4DA7A 5J47A 3LVFO 3LHKA 3PJEA 3PLNA 2O2EA 3DL7A 3HDYA 6CHYA 3UXHA 3ZVKA 3AG5A 3HKCB 1O94C 2EKLA 3KTAB 1D4OA 4WEOA 3BJIC 1M2JA 1Y1SA 3IMKA 2VPIA 1G8YA 2NXWA 3VHQA 5ADWA 1O1YA 3V1KA 5JH7F 1RWVA 2BEKA 2VZ0A 4X84A 2ID9A 3RAGA 3EW9A 5CJPA 3VHLB 5DK6A 4NV1A 4CLRA 1ML4A 1TNDA 3KB6A 3KBBA 1NUHA 2WP8J 5HRAA 2D74A 1DAKA 4A03A 1QBKC 2G5CA 4JVLA 5ALLA 1G8AA 4ROSA 1SOAA 4US0R 5E4JA 1XZEA 2FRDA 2MT9A 5IKPA 1WV1A 5T7BA 1KZGB 1YTLA 3PK0A 1MRNA 3PUIA 4MR9B 3CSSA 4EO9A 5LC1A 2O9JA 4A15A 2D2FA 2MSWA 1HRDA 4QECA 1R66A 1ECCA 2JF0A 2QK4A 1XDSA 2ORED 4UUOA 4FSHA 5U9CA 2IHYA 2JBAB 5F76A 1CDZA 1LRJA 1EQAA 3C8DA 2A9FA 3PI7A 3G85A 4R2XA 5T41A 3ZEAA 2F1KA 2ZIAA 1RRMA 3IR6A 2ZSIA 3LP8A 5U1PA 3UXMA 1E59A 4NZNA 1G2QA 2FFHA 1BDMA 3HTXA 4NS4A 4LSZA 5EZSA 4DSTA 3G8CA 5BR7A 5HDBB 3AVOA 4YJGA 2BI4A 4AF7A 1BROA 3NC4A 3OZWA 4LMAA 1J24A 2VZ9A 3QFHA 1JYSA 4ZIRA 2R66A 3QBJA 4GPBA 4M60A 2IDKA 1SH7A 2DBQA 2Q3FA 5D2CA 5EWLB 4GSKA 4K9KA 4LNAA 4XDGA 3DOIA 2IFTA 2Y6VA 4N5HX 3MTGA 2V6GA 3R6GA 2AHOA 2IW3A 5DTIA 1NRWA 2OXCA 4TVKA 4ETWA 2GXSA 2IF0A 5T6MA 2YJTD 3C6ZA 1E64A 1G5FA 2G40A 1J7JA 4LYHA 2GAOA 2PEZA 3LVRE 2C2HA 2W9XA 2YV3A 2A5LA 1RAEA 1KFCB 2WP0A 1ISIA 3I9V6 4FMDF 4ZOCA 1ZIDA 3SHOA 3GFBA 4KH1A 1U2TA 1UF9A 1E1RD 3GGDA 3F9RA 2Q8PA 1E61A 3LKZA 4JJAA 2W2XA 2FPUA 3LCJA 1X7HA 2P2LA 3IERA 2AN9A 2XLBA 2OCIA 4KPFC 3BRWD 1DCFA 4XJVA 1V7CA 2H1HA 3I9JA 1BXZA 3NBKA 4PQFA 5GONB 5A06A 3K94A 4P08A 3OC6A 3EGVA 4WKGA 2JASA 4HMQA 2EGHA 4BLVA 4AKEA 2YC4C 4X8HA 1KOJA 1X80B 2ZUTA 4BDTA 2WU1A 2KMLA 3L0YA 2C54A 3N2KA 2I4OA 4FYXA 4HQKA 1GUDA 1PG2A 1HFEL 1TLFA 4Q05A 4UUNA 1P7VA 3TVYA 3FFBA 2ODAA 1G21B 3CZ4A 1DJNA 3MWLA 1NBEA 1VLVA 5E2AA 1L5HA 4EH1A 1QGDA 3VV3A 4Z6KA 1NNLA 2X4LA 2O6HA 4RF4A 1E2DA 1RD4A 4RIFA 1GADO 4WOPA 5K6AA 4KIUA 4EQZA 4I1YA 2YY7A 1RCUA 3W06A 4FX5A 2D7JA 2OZPA 3CO5A 1EXMA 4B7CA 4EUFA 3ZWKA 3BULA 3I9KA 1E2EA 2NU6A 3CTMA 4TTVA 3JATA 4R1TA 4Q4DA 4BEBA 1FVHA 3DO5A 1E94E 4RY2A 2CWWA 3H87A 1UC5B 1DAIA 4MGHA 3WXBA 2V7TA 3MWEB 4E22A 5BQ3A 1GZ7A 4TPKA 1RYYA 4MV4A 1JEAA 2BLNA 3TZCA 4HKTA 4EB0A 4V0OA 1XCPA 1IYZA 1Y6ZA 5CT6A 3QQPA 5IM5A 5DV9A 3U4QA 1AMOA 2ZE7A 2HWYA 4IQ8A 4CMGA 3CUVA 4K9LA 2J4DA 3D6NB 5K6TA 3N2EA 1G38A 1EFRA 3OEHA 3ZJ4A 4HLUC 4D42A 1N78A 2XNDA 1AUVA 3K16A 3OE7D 2B5WA 3NJ4A 3BFVA 2JIPA 2P1RA 3Q1LA 3IKMB 1EM6A 2AIRA 2OHFA 2BDUA 3NDJA 3PWTA 3TFQA 4A9AA 5ICCA 5G4KB 4ND3A 4YRLA 1W88B 3ICOA 5DIFA 1Q15A 4FZJA 4Y1GA 1NN3A 1LQUA 2ZYHA 4LXYA 4OHXA 4D56A 1TAUA 1J0BA 1TVKB 2V9ZA 3BRWA 3CGGA 4GMKA 2JAWA 5KWVA 3JD3A 4E5KA 3QRWA 1KYZA 3W9YA 1F8XA 2HQOA 3OJ0A 4BZZA 4GM1A 2OPHA 3RK4A 1R10A 7ADHA 4FHEA 3NATA 4E08A 3VV2A 1Q17A 1B0AA 1D03A 4GP7A 3R9IA 3SXUA 1VBMA 2XA2A 3ZJTA 2PXCA 2GYYA 1TUBB 2AN4A 2J41A 3CEMA 3HLTA 3SQLA 3H5OA 1PVVA 3T7TA 4RIEA 5JUWA 4JI7B 3K1JA 4Q3AA 4XRGA 2DFKB 4TXMA 3FWZA 4OLFA 3IBFA 1IULA 1NBMA 4OREX 1HEYA 2C1EA 4K2AA 3N8GA 4EYEA 3IOBA 3AEKA 3ILVA 3O75A 3DL2A 4NULA 1HSOA 4QDUA 4C7OB 2WE7A 3L8CA 2QMOA 3O0DA 4FILA 1G20E 1O6GA 4A5SA 3JQGB 2PZFA 4POOA 2QRHA 5DCUA 2IXAA 4UATA 3B1YA 2VLBA 1UBKS 1XEXB 1T1GA 3QI2A 4EZBA 5DBGA 4QO8A 4TZKA 5EAIA 1H65A 4BWFB 2MYPA 2R8RA 3PDHA 3ER6A 4JZKA 5EEGA 3CHYA 1EB9A 1BWSA 3ZEIA 3UAYA 3C3AA 1YR1A 3IP3A 4C88A 2EFGA 1XVIA 2BFWA 2LRHA 1QYVA 2NQTA 3CW2A 3K2BA 1I4LD 1JS1X 3PA8A 1Z08A 4J2HA 1FJHA 4NICA 4X3OA 4FM9A 1YF3A 4DXHA 3BIOA 5A7FA 1EDZA 2F3RA 1FQJA 2MU1A 2NM0A 2VUSA 3SM9A 3ZGLA 4M37A 3TFOA 1K5PA 5A6SB 4ESEA 1ULZA 3OEHD 2QKYA 3CE9A 3ET5A 3N6VA 1QC5B 5DZSA 2IHBA 1RNLA 1XQWA 2W6ID 4FGSA 1YB4A 4HD8A 4NENA 4P4SB 2VZ8A 5J2TF 4AC9A 2O4CA 1K75A 1CLUA 1L1EA 1WXIA 4OB8A 3OFVA 1UDCA 3O7MA 5HCNA 4BNHA 4ERXA 3CVVA 3AWDA 4ZYWA 2NT3A 4EPTA 2WD7B 1F5NA 4HWTA 2GUWA 3OJCA 2IYQA 5KPDA 3QJ5A 3ZZMA 4IKPA 2EU8A 4K0KB 4ZQGA 2GVZC 2VCHA 4NTZA 3DC2A 5F73A 4EYKA 3ZK9A 2YBEA 1PL6A 2BM9A 3R20A 3RR2A 2O3JA 1QNFA 2OV8A 5LXTB 2CHEA 3DAFA 2PUVA 2ZP1A 3GBSA 1YK0A 1PZXA 2IY8A 2IU6A 2Y1GA 1D2HA 3GFVA 4HFMA 3IJ5A 3MXOA 1IIBA 1BYIA 4W9RA 4I0WB 1R0WA 2HO4A 2XOKD 2W42A 3ZDBA 5DBHX 1DDOA 3LY9A 3FTNA 3ONNA 3TVTA 3A1FA 2VG8A 3AI3A 4ECAA 3WS7A 1UUFA 3C4QA 4LGMA 3GU3A 3ZWQA 4BO3A 4CUJA 1ADGA 1JHDA 3HDQA 4ECEA 4EUKA 3K9HA 4TWJA 4U9IS 1L7XA 4BVEA 1CT9A 5G0TA 1CWUA 3RGWS 3WA7A 4WASA 1XAJA 3BKWA 2DWPA 4TLEA 4TX1A 4ZT7A 4LOJA 4L51A 2R68A 2W6MA 1T3GA 3U40A 6AT1A 4HAIA 5J63A 3R3JA 1NXOA 3UJ9A 1TCUA 4JOSA 3ZJVA 1IJKA 2Q5IA 2Q1TA 5EFOA 5C7IO 4F86A 3CZ9A 4XIIA 4RHTA 3ADBA 2O0MA 3G02A 3COJA 4Z3OA 5C51B 3TRDA 4YTEA 1J2EA 3NWBA 1XZGA 3KIPA 2OKCA 1WIWA 4OXXA 4XLTA 3AHJA 3ACCA 2Q3BA 3A6FA 4I1IA 4LZOA 4OHPA 3TBKA 4R2MA 1HV8A 4TTRA 1Z8NA 2A9VA 3OT1B 4PZZA 5H8WA 3HFRA 2EHDA 3CEJA 1U7DA 5CAEA 4HVCA 3GR6A 4FX2A 1RPNA 2QJRA 2VYCA 3ESCA 3MWGA 5BNFA 2O2CA 2F3PA 4M1MA 1L8OA 1UBNA 4X9XA 1TO1E 5TGZA 3V42A 4MA0A 3KBOA 2NGRA 4R2IA 3VR5D 3ZKWB 2CZQA 1QAMA 1UC4B 2XUPA 2ZRGA 5C7LO 3MAGA 1NIJA 1S9HA 1XP5A 2DUMA 1FPMA 2FEPA 4PWYA 4HNVA 5B6PA 3DSRA 5A4KA 5LJIA 4KHPB 4WD3A 3JXEA 4HJRA 1GPBA 3B6JA 5CFOA 1VE3A 5LL6P 1W7AA 1CUDA 2KBFA 4OSEA 4GKKB 4M1TA 4B3RB 2XVYA 4KQGA 4BVGA 3U0BA 5LIPA 4BMNA 1X7WB 1G63A 3GCGA 1VM6A 3JWHA 4PHCA 2IXTA 5EESA 3T4UA 1VJ1A 3PLRA 1YB1A 3SM3A 1WXFA 3TB4A 1F6BA 1VKJA 1R8QA 3GGPA 1WB9A 1Y1RA 3R7NA 4UTOA 1RHRA 4KPGA 4B8YA 4YN3A 3QVVA 3CNHA 4LDPA 2ZS8A 4BNNA 4RK7A 3L8MA 3SYMA 4RF2A 3NBMA 1R2QA 1JGTA 5E6SB 1CFJA 3LGSA 1H2RS 2P2SA 4RK0A 4A0QA 4A82A 3LS2A 3UMCA 4WFJA 4ZI3A 4YFYA 3OOYA 4P4UA 4C20A 5BNZA 1J2TA 2ZBPA 3PU6A 4MW0A 1Z0DA 2JLVA 2VKQA 5KYKA 1TYEB 1KI1A 3A11A 1DV1A 1HE4A 3R76A 4C4RA 1PGQA 2VXYA 5GJVC 1RXVA 1SXJB 1RMTA 3LBFA 5JU6A 1ZINA 2FSVA 1NAIA 4WY2A 3RRNA 4N3CA 5JCOC 3C1UA 4B1FA 3T1HB 2TMDA 3LCCA 5DLQC 1BH6A 1JBQA 2VHZA 3NORA 3A4MA 1XL1A 2YN0A 4NEGA 3TLZA 3VC1A 4BBPA 3W4JA 3GVHA 1F38A 4G9GA 5B7QA 2XTZA 4DCGA 3B5IA 4L4UA 3AHGA 2WYIA 5DTJA 4I08A 5K4AA 3UEOA 4Y2XA 2X13A 3SMQA 3H1FA 4M9QA 5A5GA 3IKLA 2Q6OA 1L0BA 4U2CA 2EQ5A 5HW0A 1ZH6A 2L69A 1EZ4A 1G21E 5E6UA 3CURA 1PHPA 2CNWD 4PGAA 2HQRA 3KJEA 4FB4A 2C04A 3SZMA 3NC0C 3KR0A 2P9YA 3K9FC 2C3PA 3EGDB 4G26A 3ZHQA 1UEXC 3AEKB 2G80A 2WWWA 3HZHA 1ZLYA 3H9UA 5JDCC 5IKXA 1SMKA 3BICA 1VPEA 3UPDA 5K6RA 4Z3KA 1E6MA 3L4SO 1W46A 1HQDA 1PEKE 3P9XA 2EJCA 1PLJA 4D25A 3GP3A 5J4VA 1QCZA 1GRQA 2B9EA 3ORFA 2R44A 3T61A 3X0DA 2YS7A 4NJOA 4ZRDA 1EX6A 4ZN6A 3M5WA 4OHUA 4WXHA 3HBNA 2GD6A 2OM2A 2O8EB 1A9QA 2QTRA 2VJDA 3K6RA 4QLOA 4NOMA 4Z0HO 5BT8A 1FMJA 2NU7A 2FAXA 2ZRQA 1OXBB 4P7KA 3VO2A 2ERXA 4DJFC 1KMMA 3K8QA 4RHYA 4Q6BA 3EPHA 1T8PA 3H5WA 2GDJA 1VSBA 4CQMD 5IBPA 1G2PA 1I7NA 3EK2A 4E21A 1AGXA 3E4CA 2WAAA 1MX1A 5CIQA 3QXGA 2FZ4A 2ZPTX 5TPWB 1D04A 3JU3A 4PGHA 3PICA 2PQ6A 1T4CB 5C80A 2C7PA 1TKCA 2QVXX 3SZUA 2PQMA 2Y9MB 3V4OA 1Z5PA 1W85A 3R7AA 5CIYA 4C4OA 4D44A 2FPMA 2ZKIA 3FRIA 5AK0A 3DE2X 2Z95A 4FFMA 3ETHA 2HSZA 2J7PA 5K2MA 3FI0A 2Q45A 3O8BA 2DT5A 2HK9A 2JI6A 3B9PA 4FFBB 1WSBA 1E3WA 4F3KA 4CKZA 5K3EA 4XAQA 3OUUA 3JQPA 1II8A 5AKJA 4BNFA 2ADFA 1U99A 1T5SA 1U0GA 2J4CA 2NU6B 4RHEA 1AV7A 4CMAA 3JQQA 1YR8A 2J9XB 3TW8A 5IAKA 2MR5A 2C5SA 4ZI5A 4LOLA 3FUWA 4DJTA 2A5GA 2DTEA 4JQZA 4L08A 3T9CA 1J2YA 3KOYA 2IOFA 3ONDA 2EKBA 3G5MA 4W8HA 4Y6OA 3RAPR 3SIPA 3BGWA 4FIDA 4JU8A 3VU0A 3ZW9A 5J23A 5F2KA 3G9QA 4KAAA 1QKKA 4R1UA 5DRYA 4WHMA 3HG7A 1E32A 4KW7A 4NE7A 5AKHA 3N1UA 4ZU3A 1S1MA 4IRMA 5ALXA 4CMJA 2HWKA 2QLMA 1ZX1A 3HCWA 3ZWMA 1ZVVA 4ZKDA 2R6CA 3QSGA 3VDQA 3FKSD 3G1WA 3IHKA 3U3JA 5EZ5A 3PC4A 4M99A 3NTUA 1UQTA 3JTMA 1L5VA 1WDTA 3VFDA 5KNDA 4HB0A 1GGNA 3ZR4B 4D0NA 3UKJA 3AQ4A 3COSA 1DSSG 3ZDZB 3TECE 1L7PA 1IATA 1Q6YA 1C4KA 2X23A 1JDVA 3AESA 1RAGA 1Z0AA 2EW2A 1U7UA 4GXQA 1XQYA 2D8MA 1KZ7B 1PJQA 5IUNC 4FDAA 1Y9JA 1FU7A 4RLFA 2EP8A 1I6KA 4YEDA 3X1YA 3RKRA 1Q7GA 1GVHA 2P3LA 2JCYA 1K9VF 2EOAA 4WZAA 3DHNA 1DT5A 3LWBA 2NU8B 3O8QB 5A0FA 2B8EA 1JWBB 4XIGS 4B6SA 4ETNA 2FW8A 2XPCA 3I09A 2I4RA 4WNYA 5F52A 3BHMA 3QITA 4ZVSA 1AZWA 4KE9A 4NE2A 1M5RA 2GGSA 4G6ZA 5GADl 1J42A 3OQ1A 4CKEA 3SWWA 1LC3A 1QOZA 2AOXA 2VDQB 2PS9A 5FNVB 3S68A 3GD5A 1MPXA 2BHTA 4F84A 1PFKA 3HFJA 5K3DA 2AZMA 2WUWE 3V34A 5BRNA 1K7SN 2ZUVA 3SGLA 1Z2EA 1OWMA 4G37A 1KAHA 1QLWA 3KSMA 3D6AA 2PUAA 4RD0A 5ALOA 1TLTA 1A71A 1K0UA 4ZXFA 4NU8X 1GXSB 1E6WA 1N2JA 1NE2A 2IYUA 4JROA 2PMCA 4EIWA 1W34A 4TKVA 4YV1A 1G6OA 5LZ8A 1AHPA 2OBNA 4GD3Q 4EF4A 1NQTA 2PO7A 3D4LA 4QGGA 1SQSA 2IHKA 4FD3A 3WIUA 2WV7A 1G6Q1 3S40A 1MG0A 1B16A 4TYQA 1ZRSA 4RPCA 1ZD3A 5A7HA 2BE9A 3RJ5A 1K3TA 2Y27A 3AETB 4L4YA 4C4YA 5BN1A 2JRCA 4JA0A 3EEQA 3LUJA 4NNOA 4B5LA 1NASA 1G6HA 2QMQA 1L5RA 1AGPA 3HO6A 1JUDA 5B1SA 3E3LA 3WJ7A 3E1SA 5BPFA 2QN8A 4DMCA 1SZJG 1RJ9B 1G5PA 1XZBA 3V1MA 1DU4A 3RABA 3MCZA 3R3UA 2JZOA 2FSPA 4HX2A 4ND4A 3C85A 2GTIA 1B0UA 3FF1A 1O9BA 4CG0A 2F00A 5FNVF 1MEEA 2WMOB 3UXEA 5LSAA 4HAOA 1X2EA 3CF4G 2NZXA 4LGVA 4PLYA 3TZBA 2ZZMA 5J3JA 3B3AA 3KG2A 2G7ZA 4CKYA 3OOJA 4C6TB 1OTYA 2Z5LA 3LUHA 4CF7A 2R6HA 2VHEA 5DGHA 3EQ9A 5EIXA 1B23P 1E6KA 5E38A 4NX2A 2B4TO 1TE2A 1QYIA 3G2HA 4KNVA 5BR8B 1NYTA 2XB4A 4KUGA 3U3RA 5G0VA 4YP9A 1UKZA 2H65A 3JQ6A 2WTBA 4GXNA 4BGIA 1M6WA 3JQFC 4E11A 4B48A 2ES4A 3IP7A 4P2BA 1NVAA 4RV5A 1JLSA 4FNOA 3CLUC 2FWNA 4UZSA 1T36B 1YDWA 3B3FA 3H7AA 1VIAA 1YBAA 4OHRA 1HLDA 1W4ZA 2PV0A 1I5RA 2XV1A 2WM2A 1SVWA 4TTIA 3FZGA 3IQXA 2FKAA 3NYQA 5ERGB 2C1ZA 3V7WA 4ACAA 1ORRA 1MUUA 1L5KA 3GZ4A 1M76A 2AFRA 4M9SA 1JJIA 3I9OA 4L75A 2QXTA 2NPOA 4AI6A 1GD1O 1QGAA 4FNGA 4YRTA 2R11A 4B43A 4LZPA 4M55A 1LA2A 621PA 1ZJ4A 2FJPA 3VC3A 4I8IA 1C30B 4E2XA 1ZUNA 2B69A 4PRYA 4X00A 4L8FA 5KHOC 1M2EA 4M1QA 1U9ZA 1WCIB 3DHWC 3OTQA 5ALSA 3NW9A 1GEGA 2WNIA 1A3CA 4IHJA 1Z34A 3C8UA 2DQ4A 2Z30A 3PEVA 2VRBA 4I55B 3QNMA 1UWVA 4L3WA 1MENA 1ODFA 3FG9A 4S1VA 2ODNA 4IW3B 5HIIA 2P4SA 2C2BA 4CTNA 2AFIA 4PLWA 3ERCA 2FCAA 2NVWA 3CWZA 1U8YA 3CNEA 2X2OA 4LXIA 2FUEA 4RAOA 1CHNA 5HUQA 2ZRMA 3OI7A 2XMCA 1N8TA 3I5UA 3NIBA 3QW2A 1JALA 4IGIA 1GGEA 2JJMA 4Q3BA 4W5RA 2V58A 3DOEA 2QA5A 1QPZA 3NTLA 2CWDA 2VPWA 2PKRA 1M6YA 3B8EA 2NVUB 3RYHB 5ERYA 4TKUB 2CD7A 4IHQA 3M3DA 4ZTBA 1Y6GA 2EL7A 1CY4A 5DOZA 4ENPA 4P34A 1GFZA 3B1XA 1KPHA 4CEIA 4AKHA 1I2MA 1TF2A 2IPXA 5CXSA 5G3YA 4ZDWA 2JBHA 5HXAA 4PQRA 5FWAA 1VC2A 3P4UA 4BV8A 1IJEA 1I2CA 2QM0A 1XDDA 1YJAA 2VATA 3N58A 5FH9A 4N7MA