4DQ0A

The crystal structure of tellurite resistance protein from escherichia coli o157:h7 str. sakai
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
IRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDGEYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWEMVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tellurite resistance protein
publication title The crystal structure of tellurite resistance protein from Escherichia coli O157:H7 str. Sakai
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 69
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4dq0A00
3HCDA 3CJTA 5JR3A 3LX6A 5E8JA 1G8SA 2GB4A 3BKXA 3BKWA 4WXHA 1DL5A 2EX4A 3FUWA 5DM1A 1EJ6A 3UZUA 4ER5A 4F85A 3EMBA 2ZWAA 2IDJA 5LQJA 3PS9A 1ZGAA 4RVGA 3SM3A 5BW4A 2DULA 4EKIA 5DPMA 1NW3A 3IYLW 1L3IA 2P3QA 1Q0SA 1Z3CA 3K0BA 4R8RA 3OE4A 1NV9A 3GRZA 5EG5A 3B3FA 3UJ6A 5ICCA 3RIEA 2PX8A 1I1NA 4RTJA 3EGEA 3UBTA 4ATNA 2B2CA 4HSGA 3KHKA 2GS9A 1M6YA 3O7WA 4HTFB 2PVCA 5CD1A 2UYHA 2G72A 4V0RA 5EMLA 5LSAA 2IDKA 3OPNA 1N7IA 3PFGA 5F2OA 2ZIFA 2ZWVA 5K0GA 3EVBA 5CVDA 3R0QA 5K01A 1R74A 1BC5A 1H1DA 4FR0A 2NNWB 3HVKA 1JQDA 3LBYA 3PFHA 2YX1A 1ORIA 2P7HA 5FWDA 5FHRA 5LQRA 1UIRA 4YV1A 5EKUA 3FUXA 2PKWA 3ER8A 3MGGA 1RI3A 3FTDA 4MWZA 1WG8A 3BGIA 3FUTA 5FQOA 3KQMA 5K0FA 3B89A 3FTFA 4PGGA 2HNKA 5G02A 2YXLA 2BR3A 4M37A 5HFJA 3AY0A 4IWNA 3CGGA 3BXOA 1TW2A 2B9EA 4E33A 2C7OA 2P41A 1SKMA 1KIAA 3ORHA 3DOUA 3CJQA 2B3TA 4E30A 2IFTA 5EC8A 2PX2A 2ZTHA 2UYQA 3TPZA 5CUQA 1JQ3A 3EVGA 1XVAA 3GRRA 3ME5A 3M6WA 3HTXA 1SG9A 3OZSA 5FQNA 4E2XA 2KW5A 2OBFA 1XDZA 2V74B 2ZIGA 2IBTA 1XDSA 4HRAA 10MHA 5GWXA 2ZSUA 2P1DA 3KR0A 1T43A 5E1MA 1KXZA 3PLAE 3MTEA 2O0LA 5T6BA 4AZWA 1TPYA 4LECA 3C3PA 3P2IA 1MJFA 4C08A 3EVAA 3IHTA 2FCAA 2JHPA 1UFKA 3G7UA 2OO3A 1QAOA 3I64A 3EVEA 4PINA 3G89A 5T64A 3NVKI 3TFWA 4MIKA 2YR0A 3BZBA 4RTMA 3UJAA 3G8BA 3TKYA 2PWYA 3LCUA 3PX3A 3PTAA 2NYUA 4MHTA 1QYRA 3ELDA 3DXXA 3GRYA 3BWBA 2WA1A 4B17A 1KHHA 1X19A 1ZKDA 2XYQA 2ZZKA 4F86A 4RX1A 2OKCA 1FPQA 3P97A 4HG2A 4DQ0A 2GA9A 5EEHA 4GQBA 1QAMA 2QRVA 3CBGA 4FP9A 1NBHA 2YXDA 2OYRA 2ZBPA 4PYJA 4DZRA 5CIYA 5E9QA 5LQCA 4OQDA 2NXEA 3ER9A 3GRVA 2PXCA 5C9ZA 5DX0A 3E23A 2Y1WA 1WS6A 2PT9A 3B3GA 3JWHA 8MHTA 1PJZA 3DUWA 4XUEA 3P71T 3SVZA 3KPWA 4RVDA 3LSTA 1BKYA 2ERCA 4IV0A 4OBXA 3BUSA 5BXYA 4DMGA 3G8AA 4CKEA 1KP9A 3ELUA 3FYCA 2JHAA 1AF7A 2WK1A 3A25A 3HCEA 3OFJA 4AZVA 2I9KA 2ZBQA 4G56A 2OB1A 2AN5A 3B5IA 3AWIA 4OA5A 3CCFA 1R8YA 4K6MA 1ORHA 2AZTA 2JH9A 2A14A 4E2YA 5IKMA 3HCAA 4R05A 5ERGB 4PYLA 1QZZA 4HC4A 5CM2Z 2EJTA 3FPFA 4Z2YA 4DA4A 1M6EX 3LDFA 2Z6UA 1D2GA 4HGYA 5DXAA 5DT2A 1DCTA 5DWQA 5K0EA 1RI1A 1EAMA 3HA7A 4RTSA 3LDGA 2E5WA 3T7RA 1G6Q1 5HZMA 2Q41A 3LCCA 2YTZA 5DTRA 2YVLA 3C6MA 4PYNA 9MHTA 1KPGA 5LQNA 5IH3A 1SVUA 3NDJA 1KPIA 1XXLA 3SSNA 3DMHA 4QPPA 3I58A 1G38A 5K0JA 2PGXA 2I6GA 3L8DA 3K6RA 3NJRA 5HILA 1NT2A 3JWJA 3M70A 3OU6A 4OQEA 3BGVA 4KWCA 4HTFA 2R3SA 2BZGA 5K0NA 2LD4A 3ERCA 3NWBA 3KQQA 2PT6A 1BOOA 1P1CA 2BM9A 1VPTA 3KPUA 3UJ8A 4PIMA 5K09A 4XUCA 2IP2A 4QQNA 4RV9A 4QDKA 3BGDA 3LDUA 3AXSA 3KQPA 4FT4A 1X1AA 4CTKA 4LG1A 1ZGJA 2AVDA 5KQSA 3MHTA 3HNRA 1ZHFA 3EGIA 1INLA 2XBMA 2PWPA 3HCCA 2ZBRA 5LQKA 4BLVA 3Q7EA 4GOND 3NVMB 5EZSA 1NW7A 1RI5A 4RWZA 1D2HA 4CWAA 4E32A 3P9NA 2Y1XA 1RJEA 3NWEA 3THSA 4YUWA 4E70A 1D2CA 2VS1A 3KQSA 3S68A 3KU1A 2ZZMA 4DKJA 3GRUA 5HIKA 3ANXA 4A6EA 3O31A 4LWPA 5DSXA 4FSDA 4P7FA 4YUVA 4RTNA 3REOA 1SUIA 4R6WA 3LKDA 2PJDA 4LWOA 1RJFA 3TM4A 1YFJA 5EEGA 5U4XA 2HV9A 3G5LA 4EKGA 4YV2A 5K0CA 2B25A 4A6DA 2NXNA 2AOUB 2C7PA 1X1DA 1XDUA 3M6VA 4X61A 3T7TA 2HMYB 1U2ZA 2V7EA 3KQYA 3MCTA 4L7VA 3UJCA 2GLUA 4EQZA 1RJDA 3FPEA 2UZ4A 3P9KA 2N47A 4PYOA 2ZIEA 1MHTA 2FRXA 2O06A 3BWYA 4PGHA 4RTLA 3QOWA 1I4WA 2EFJA 1EG2A 3OCJA 2Z6AA 5HOQA 4GC5A 4GOLD 3JWGA 1VQ1A 1G55A 3EVCA 3NDIA 4GEKA 5E8RA 2IH5A 1IM8A 1R00A 3ELWA 3SMQA 3SX0A 1NBIA 1YUBA 2VZ9A 2QY6A 4JXJA 1SUSA 1KYZA 3DMGA 4NECA 1JTFA 4OX9Y 3P9CA 5LQUA 3FTEA 1R8XA 1YB2A 1AQIA 5CVJA 1R6AA 2H00A 3TOSA 4YMHA 4YMGA 3GU3A 4ER6A 3EVDA 1M0EA 3LPMA 2ADMA 2P3LA 3U81A 4YUYA 4PONA 3KKZA 3TR6A 5E9JA 3FPGA 4E31A 2YXEA 5GIOE 4OA8A 3HVHA 2FK7A 2IGTA 4KRGA 1NE2A 4E2WA 2AOWA 1DUSA 3R24A 4Y30A 3VSEA 2AVNA 5FWAA 3G2QA 2ESRA 4U7TB 1VP9A 5BW5A 2BH2A 4GF5A 1EQAA 2CKDA 5EVJA 5GIPE 1JG3A 4AUKA 2P35A 3HCBA 3LL7A 5M5BA 4M36A 3I5UA 5EMKA 5MHTA 3G88A 3I53A 3CKKA 3EVFA 3GO4A 5CVVA 3GNLA 3UA4A 3GCZA 5D1NA 3SSMA 3HP7A 3F4KA 3E05A 1RI2A 2CMGA 4Y2HA 4V0QA 4AZSA 1BHJA 3DXYA 3HA3A 3LHDA 5EOVA 3LGAA 1YF3A 1QAQA 2P8JA 3LKZA 1NW5A 2PLWA 3A26A 5EIWA 1XJ5A 3BWCA 3V8VA 5FCDA 5DX8A 2CMHA 3NTVA 5K0BA 5GINE 1WXWA 2ONZA 2C7QA 1JG4A 4X63A 1JTEA 2IBSA 1VIDA 5EMJA 3R3HA 2IPXA 3DTNA 2OY0A 4P7JA 1F3LA 3D2LA 3HA5A 5DXJA 5EZQA 3X0DA 3KQVA 2CWWA 3M33A 5KYGA 4ISCA 2AOTA 2Z6QA 2NP7A 4PYIA 5ICFA 2OXTA 4X41A 3OFKA 1JG2A 2G71A 5DTMA 2JHCA 2VDWA 2O07A 4POOA 3E7PA 2JJQA 1WXXA 3FRHA 2HTEA 3LECA 4PNEA 5KS2A 2IH2A 2PXAA 7MHTA 2P7IA 4MQ4A 3HVIA 4KDCA 1N2XA 3EMDA 4ER0A 3MTIA 4EVIA 5FULA 3SR4A 1O9GA 1JSXA 1VE3A 5E2AA 3M6XA 3TQSA 3GXOA 4R6XA 3JWIA 4PIPA 1SQFA 4ER3A 2XVAA 1RJGA 1Y8CA 1RI4A 1V39A 3FUVA 5FTWA 3UJDA 5EKXA 3EEYA 3TMAA 2FHPA 2FYTA 5C1IA 3MCZA 2GAFA 1R18A 3CJRA 3DH0A 2ZCJA 2AOTB 2OPBA 4BLUA 2G8NA 2WA2A 3OZRA 2ONYA 5DM4A 5EGSA 1VP3A 4C4AA 3B3JA 1KYWA 4BP1A 2BR4A 4HGZA 4GOMD 4IKPA 2PX4A 2AOUA 4M7RA 5CVEA 1G60A 3C3YA 3GWZA 3KQOA 1IY9A 1JQEA 3TKAA 3GDHA 3P8ZA 2PX5A 2DPMA 2H11A 4QTTB 2BM8A 5EMMA 3VC1A 4CKCA 4QTUB 4R8SA 3IV6A 2CL5A 3FPJA 5HIJA 1HNNA 5LQAA 2JH8A 1G8AA 4P58A 3P2EA 5D1HA 3KQTA 3T7SA 4QQKA 3UJ9A 1NW8A 2BR5A 4DF3A 1YFLA 3MB5A 5E1BA 1I9GA 3G2MA 1NV8A 3T0IA 5FUBA 2ZVJA 5ICGA 1X1BA 2ORED 2PXXA 4KVZA 2OZVA 5EHGA 4M38A 4F84A 3G2OA 2AN4A 5H02A 4FSXA 4GBED 3KQWA 2HR1A 3FPHA 4GC9A 3TM5A 4YV0A 3FUUA 3SXJA 4C06A 5T67A 1AV6A 2NXCA 3ID6C 5K0LA 2G70A 5GM2A 2XYRA 3AJDA 4PYKA 5C0OE 3KR9A 3DULA 1F38A 3QV2A 4PYMA 3RODA 1Q0TA 1SQGA 1P91A 4ZTBA 2YUIA 4C04A 1P1BA 1YZHA 3EVZA 3P2KA 5EIFA 1EJ0A 2GH1A 4X1OA 5FA5A 2AS0A 2UYOA 3DMFA 3OU2A 4GOOD 1FP2A 1NW6A 2PV0A 3EGVA 4QVGA 5BP7A 4WVLA 3A4TA 1VLMA 2F8LA 3UJBA 2OB2A 3H2BA 3KPYA 3OZTA 5DLYA 3ELYA 3FYDA 3BWMA 3A7EA 5E1OA 3UWPA 4RTOA 2JG3A 1L3CA 4RTKA 1VBFA 2FK8A 4X60A 2FPOA 3DLCA 1NKVA 4RSRA 5CVUA 2EG5A 2K4MA 3KPVA 3MQ2A 3NW9A 3O4FA 4RYLA 3LCVB 3GIWA 4RTQA 2YQZA 3HM2A 3RW9A 3C0KA 3C6KA 3SGLA 3CC8A 3KPJA 3OU7A 1JSZA 3PB3A 4KIFA 4KIGA 4DM3A 5FA8A 1L9KA 1N7JA 1JR4A 3GJYA 5E1DA 1ZG3A 5P8WA 3WSTA 1FJXA 4RVFA 3CVOA 2I7CA 2XVMA 5JUWA 3I9FA 2GPYA 3AXTA 4BP3A 1TW3A 3DLIA 3E8SA 2QE6A 3M4XA 1O9HA 3EPPA 3VC2A 4CKBA 2ZULA 2QM3A 3GGDA 5EQJB 2AN3A 3QOXA 3EEOA 5GOZA 4U7PB 2EJUA 4RTPA 3SSOA 2AR0A 1XTPA 1KR5A 4BY9E 3OE5A 3HCFA 2I62A 4FT2A 4XUDA 5DRYA 5EPEA 5FADA 5K03A 1FBNA 2IIPA 4YUXA 1P39A 3NMUF 4UOEA 2AOXA 4PWYA 3DXZA 4IV8A 4XCXA 3UJ7A 4QVKA 3PVCA 4DCGA 1ZQ9A 5K05A 4FZVA 2O05A 4EK9A 1EIZA 3UFBA 4E2ZA 3PX2A 1XCLA 4C05A 4RTRA 4HH4A 2VP3A 1PRYA 1QANA 4PCLA 5HIMA 3VYWA 5KVAA 5CCBA 4DCMA 2B78A 3LBFA 3M6UA 4YUZA 5F2NA 4PYQA 4AZTA 5DM2A 4RVHA 3BT7A 4KW7A 5DX1A 2UYCA 3B7PA 3HVJA 1VL5A 3G2PA 2XYVA 3KR1A 4PCAA 3G5TA 1B42A 3IEIA 4OBWA 1UWVA 3DR5A 2PBFA 4MTLA 1IXKA 5E2BA 2C7RA 3P9IA 1X1CA 1WY7A 3TLJA 1L3BA 3A27A 4QPNA 1OR8A 2ZLBA 2QYOA 3FZGA 4P7KA 5EHIA 3THRA 4O29A 5FHQA 4GUAA 5B1SA 5ICEA 4EMSA 3DP7A 4H0NA 3MAGA 3HEMA 3MERA 5DM0A 5GM1A 5LR6A 2NXJA 2PSSA 3A7DA 1FP1D 2ZZNA 2NP6A 2P40A 1HMYA 5DRTA 3FTCA 3R6TA 2HWKA 1XCJA 2QRVB 1O54A 5F2KA 3UA3A 4C07A 4AX8A 2AOVA 4BLWA 1L1EA 4FS8A 3Q87B 2R6ZA 2VDUE 4P7GA 1KPHA 3V97A 5DSTA 2IH4A 2PY6A 4ER7A 5KQRA 4CXMA 2H1RA 4KDRA 2ZW9A 4FGZA 3R9XB 1YZ3A 5E9WA 1WZNA 5DTQA 4QDJA 5GP1A 5CCXA 3TRKA 1AQJA 3PT9A 2P3OA 4C03A 2G1PA 1JG1A 5HIIA 5HEKA 4CTJA 5K8VA 3KR2A 2VDVE 2ZFUA 3FRIA 2O57A
chains in the Genus database with same CATH superfamily
5BN5B 2GEBA 4ZYUA 2PKCA 3WYGA 2JA2A 1G8SA 3BKWA 3EISA 3VR5A 5HJ7A 2EX4A 2I8LA 3D6MA 5HKAA 1DC5A 2QW8A 4O4LF 2MMCA 4XX0A 3L4JA 1E94E 2CK3D 5HPYB 3LBHA 3ZHBA 2PVPA 2GUGA 3LUFA 4OKIA 3SNHA 1AB6A 5BQ5A 1Q0SA 1Z3CA 3K9QO 2TMKA 1FSSA 3NTXA 3REGA 2WSSA 3WB1A 1OBHA 3JALA 4ESEA 3ZEAA 3E81A 2PX8A 3GUYA 4RTJA 1DOHA 4ATNA 5BWOA 1FU4A 3OY2A 3O3MB 4YA6A 3UV7A 3OIWA 2R7AA 4CTMA 4BB9A 2EL9A 3CR3C 1EVIA 4II2A 4RPHA 1Y1TA 1CJTC 3K9BA 4X8LA 1UZNA 1XLUA 5F2OA 1BW9B 3RGWS 3W5JA 4C7MA 1O3YA 1E3TA 1F2VA 1R74A 4Y2UA 4KMSA 1FNMA 5LPNA 1AV7A 1FJHA 4KQIA 4U7WA 3LG2A 3WISA 1FA9A 5ED0A 3CX3A 2YCBA 3Q2IA 4J8PA 2DH5A 3RVQA 4BQQA 4O0MA 4HWKA 3T9DA 3U4HA 1QZTA 4DCPA 2MT9A 2KBEA 1GGFA 1DEKA 1NXPA 2PQ6A 5FR2A 3ER8A 3FTDA 4KYUA 3NETA 4MWZA 2ZRBA 2CCKA 4MUHA 4XWKA 1LNZA 5EL0A 2ZYAA 3AM5A 4LXGA 4LZZA 4M7PA 2VXCA 3QPCA 3WLLA 5HX7A 2CV0A 1Z2OX 3BXOA 2A5FA 1UOQA 2BT4A 3OJLA 3PIIA 1PR9A 2BFNA 3HKEB 4KYIB 1YA4A 5DN9A 1SVLA 4MTCA 1O8CA 1JQ3A 2AV6A 4IGKA 1FXSA 3IDOA 3RQSA 2XMBA 4PEVA 5A04A 1D2RA 4Q1VA 4YRGA 4NZZA 5ELLA 2WD8A 1GFWA 3U7HB 4XEUA 1U5AA 2BEUA 2QL6A 1CF9A 2WKQA 3HR8A 1MVNA 5IDQA 3B1VA 3AH8A 1OWPA 5E1MA 2PD4A 4IV5A 4O4HA 5HW0A 1GZDA 2GASA 4INZA 3L7JA 3LP6A 1U2QA 2HA2A 3LUBA 4EJSA 3N6XA 1KO8A 2JA1A 1A2BA 2DTEA 2QNIA 1PQ4A 3RSGA 5DULA 3HO8A 1TDJA 4EECA 2FGKA 4F4HA 1NRIA 3VDXA 4NCBA 5CPFA 2NVWA 4EB6B 3ZGZA 1UPXA 1VYVA 4M83A 5EERA 1KE1A 3T4XA 4YJ3F 3TFWA 3W2IA 3O84A 3PQ6A 5C5IA 1FTGA 2HCRA 5C1DA 4PW0A 2QP4A 4K28A 2WZQA 1P6UA 4IZOA 3DXXA 4FGLA 5H9VA 4BX2A 1UZLA 4OX9Y 1X19A 4MEBA 4YI5A 3A6PC 5DYWA 2AG6A 1KETA 2E4ZA 1XZPA 4UW9A 3EF0A 4BFZA 2XMZA 5AKEA 3W5BA 5KDDA 1WKBA 1NBHA 3AUXA 1FXWF 4HEA1 1ZIPA 1FLAA 1XCMA 4KHPB 2FP3A 3ZCVA 1H2EA 1U02A 2GA8A 4DM7A 3IELA 4KO2S 5B7NA 3D02A 5ALPA 1GGKA 1WA5A 1XMOB 2MIIA 4MVJD 3DBRB 4N0QA 1CX9B 2ZUTA 3W9SA 2FN8A 1SXPA 4KQ1A 4I3GA 5DTIA 5I9NA 4H1HA 2B0CA 4FMCF 2H5LA 5AIBA 2B6NA 1PL0A 4CUZA 2A6PA 1NPDA 4DA9A 4FQ7A 3OY7A 2WE7A 4HJXA 4KN6A 4QGBA 2FFBA 4U7FA 3H0CA 4X91A 4BP8A 2ZUDA 4OLHA 1ML3A 2OOSA 4TMKA 4EG0A 3EOBI 1P17A 1TIPA 4X8HA 4D0GA 3UJNA 2JH9A 1U7DA 2HBYA 3SDZA 1T35A 2AF3C 2E48A 5ERGB 1CETA 5EWLA 3IR5A 1W87A 3KEOA 2JKZA 3DMTA 4IYJA 4ND5A 5M34A 3AHIA 1XTIA 4G2TA 1N7GA 3P5SA 1X74A 1T34A 1GEEA 2B1GA 3ASUA 3OKAA 5EJ2A 5LYYA 1P4JA 2HIGA 3CCCA 3HA7A 1XTRA 4CM7A 4EGJA 4B3MB 1X14A 4PYNA 1KEVA 2OYSA 2R4TA 2W90A 3DLAA 1SUAA 4XFKA 4TTTS 2OK7A 4ZYZA 1RYMA 1BX0A 1Z28A 4MAMA 4IDGA 4H6WA 1VL1A 3ZWNA 4NFYA 2R60A 4LJRA 1VHDA 1RCUA 2FSGA 2GO1A 3CUVA 3OU6A 1PSDA 2R3SA 5DYYA 2LD4A 3WLNA 4CUKA 1IIRA 1VLVA 3O4IA 4QTYA 1QP0A 1ZJ5A 3LWBA 1V7CA 1D6SA 2FZCA 1ZL0A 2V6BA 4MS4A 3QVMA 3AXSA 3NEAA 1DBSA 3GGGA 4FNGA 4KHZA 3UJHA 1RXCA 3D4NA 5CBPA 1ZHFA 1SY7A 3QA3E 4R9RA 4D99A 5EMHA 4UMFA 3GRPA 3H0KA 2JGIA 4GKBA 1M8PA 1Z4QA 1YACA 5AQEA 1MW8X 2A2ZA 2RHGB 4DC1A 1EWTA 1XEWY 1U4NA 1N9KA 2P79A 3TGWA 4EY3A 5D87A 1TC2A 2QSYA 1ANKA 3F6PA 2GVNA 4ZALA 1CS0B 1USGA 1UDXA 1M5RA 2OO5C 1U0OC 2ZIXA 1JW9B 1MZVA 3FSEA 3M9WA 1ZH2A 1U3UA 2YHBA 2ZSBA 3ND5A 3OBIA 1XCOA 5DLEA 3KJFA 1QU2A 1TKBA 3C3BA 4IRMA 4P4SB 3A6JA 3AEKA 4KOAA 2ZUEA 1TUEA 4WT7A 2XDWA 4O3FA 5ES3A 2ZIEA 1FNBA 3SHVA 1MEJA 3MMNA 4X1YB 5JOQA 3W79A 3WIUA 3DBHB 5HXAA 1T1SA 4DUZB 2XKBA 2SICE 3MRSA 3KKKA 1LQUA 3ICWA 4CQMB 2B8JA 3T7EA 1MPTA 3PGKA 1WQ3A 2DE0X 3DMDA 3I0ZA 4DLZA 4REOA 3AEUB 3R7AA 3JYOA 3B6KA 1R00A 2W6ID 2WRZA 3KYJB 3PE4A 1A5ZA 2Y9PB 3KFXA 1GNRA 4IWXA 1GU0A 3AY6A 4OOFA 2X9QA 1BQ4A 1CU1A 1UINA 2OLKA 3KJIA 5EJ7A 4GWGA 3KSMA 2WLTA 4MJXA 2WJ3A 1BFKA 5LQUA 1CR6A 3B1ZA 3FG9A 3BE4A 3OQ6A 1G3QA 5KTYA 4UHBA 2XB6A 1AK9A 1H2AS 5C4GB 5KX5B 4FI3C 3SYLA 5FLXA 4HVLA 5HUQA 1M0EA 1QRTA 1ZRSA 4YNBA 3OT4A 1BVRA 2CZGA 3CH7A 3EG9A 3Q12A 4XDHA 3VI3B 1ODCA 2QJTA 4PONA 2BHSA 4O8ZA 5K7SA 4KYTA 4KDFA 3WGOA 2QMHA 4YRQA 1J00A 2FK7A 1PT6A 1VM6A 4IOJA 2AI1A 4NATA 3D6AA 2COKA 4D41A 1IE3A 2MOKA 3LFHA 3I9V1 3GPIA 4QYSA 5KVQA 3RF7A 5B58C 5CITA 2ESRA 4P3KA 3ZTYA 3IB6A 3M4YA 4KK3A 3KYCA 1HA3A 4C87A 1VSTA 4EHHA 2XW6A 1XTTA 2QN6A 1VKHA 3AUFA 4UU8A 4AP5A 3W9YA 3I5UA 3ML1A 4PZCA 2H1CA 3OURA 5MFZA 1RHQA 1B0AA 2X0NA 3GCZA 3N0VA 3OQPA 4ARZA 2Y71A 3AERA 4Q4JA 4P35A 1FSGA 4PU0A 4UTVA 4KPYA 3G6KA 2G0NA 2JGLA 2REOA 2H54A 2N42A 1XZBA 1A9XA 2O8VA 3BRQA 1K5PA 2VPYA 1VB3A 2Y2UA 3DGEC 3E84A 3IP1A 4R1QA 4QXOA 2C5AA 3EAQA 1G6OA 4RIFA 4HPJB 4F1WA 1QLWA 3ITEA 3IPYA 4PHHA 5JFGA 4OGGA 1G9XA 1UH5A 1N9GB 4L95C 5D5PA 4C6TB 3ZBTA 5I6DA 2J3QA 2ARKA 1PG0A 5ELXA 1Y8RA 3ZIAD 1BE1A 2NP7A 3ANYB 3O9VA 1KO1A 5JMOA 4R2MA 1Y6GA 3SZMA 3VX4A 3A06A 3GLQA 2I22A 3DMYA 3ODGA 2O8CB 1PR5A 2DWPA 1RQ2A 2PXAA 1ESDA 2IIBA 2GPBA 2ZEJA 1QHIA 4HXYA 4PY2A 3GLHA 5BWNA 2ON6A 1T3HA 2QU7A 4X1KB 5H83A 1CDOA 4LJ9A 4ZOBA 1HFWA 1VE3A 3KZXA 4G1FA 3V1YA 2HDHA 4GLOA 2EW1A 3AY3A 1P72A 1YAJA 3DWFA 4G1VA 3UJDA 3FGZA 1KQNA 5JLAA 5LJLA 5EKXA 1V1MA 4K7JA 4MLDA 3GUZA 4CM4B 3VOAA 4LHWA 4XDGA 4V0OA 4DG9A 2PO5A 2GAFA 4L0MA 5EE5B 1T0PA 5A3QA 1X7ZB 5IW8A 3OZRA 4OU4A 1XDBA 1X7XA 2QV0A 2X41A 4NU6A 4CFYA 5IJWA 4F93B 1ODLA 3DW3X 4M8KA 1JQEA 3EW9A 4QTTB 3ZKAA 1JHQA 3U1BA 1ODIA 4M0DA 4UHJA 4BFCA 5BUCA 1L5HB 2J31A 3VNQA 1OB2A 3T34A 1L7AA 3JQ7B 4BATA 1RBYA 1PTJC 4HEA6 2IX3A 3UJ9A 2G07A 4HUJA 2K6GA 4Z9BA 4P0QB 1JU4A 2DBRA 4ZGGA 2DXIA 3OOWA 2F17A 2BCEA 4GW3A 4HH0A 5KKCA 2LRHA 1LBEA 4KXYA 3MT7A 3AVXA 3ET5A 2AF4C 3BVPA 1V96A 3KB1A 4ZAVA 3T3GA 1PJLA 2XRYA 1LBTA 5JNUA 3ZLJA 1XVVA 4PPQA 5FT9A 2WAYA 2QR5A 4JXXA 4GE0A 1XWWA 4ZO8A 1W5BA 4B4UA 4ZQFA 1U9JA 3W5AA 1A9ZA 2YXBA 4HDRA 1E77A 1S7CA 1RD4A 4WESA 5SICE 5T67A 2NPFA 3WHLA 1Z5NA 1MO4A 1UDAA 1UPTA 1ZBQA 2Q50A 1CP2A 1GNLA 2P5YA 3DTTA 2OHFA 3F1KA 3M6FA 4MKXA 2SKEA 4DUGA 1SC4A 1SWWA 1U2PA 2IHZA 2X9LA 4HAIA 4PFQA 3WWEA 1J6UA 1SQGA 1TCCA 3DWEX 4DRXB 4QRHA 2TSYB 4N5MA 4II7A 5SV2A 4EUFA 3RG2A 1KAQA 4PFKA 1V5IA 2GPTA 2WINI 3L0YA 2DHRA 2NO1A 3EXAA 1P60A 2Z9CA 3PC3A 4PNPA 5LDGA 3ZU3A 1RR6A 4BO7A 1UK9A 2ID9A 2V54A 4B7CA 3F2VA 1VLMA 1SU4A 3PWKA 1M75A 3H75A 1IZ9A 3QFCA 1D2EA 1XMJA 2JG3A 3HE3A 2X9NA 3HJTA 4EAAA 1QGZA 4K6GA 2XVYA 3GYBA 4GXRA 4KQXA 4B3RB 2PGIA 1DSSG 4MVXA 1KU0A 2ZTLA 1ZXLA 1J42A 2WJPA 1SCUA 1NBAA 3MBOA 2VRWA 5CIWA 4NBSA 1YKSA 2G9NA 3TNLA 3UPUA 5E7QA 3TPCA 2VP6A 3K15A 4RVFA 4CLRA 4J43A 1X8LA 2DHEA 1S3GA 2ADOA 3V8NA 4IMPA 3UKJA 1T8RA 2O8EA 1XEAA 2WF7A 4WDRA 4ZIRA 1E98A 3QKUA 4AFNA 1ZD2P 3UK7A 4RJJA 3SFTA 1VB5A 3FYSA 1QQ6A 1LVUA 2I3BA 1PGJA 5CA1B 4YCSA 4W8HA 2OV3A 2EZ4A 3B1YA 3GVIA 2PUWA 4FHGA 4K88A 3OE5A 4WBXC 5T41A 4FT2A 4J1QA 5H3HA 1Z0DA 4I19A 4A0HA 1FBNA 4BB6A 1YTLA 1XL0A 3PLNA 4BMDA 1P9LA 3M5WA 4RHXA 4DB4A 3UH0A 4TQUS 3PPYA 5AW1A 1T36B 1BDIA 1YVUA 5GONF 4CR7A 1Z5UA 2O05A 1E7RA 4G86A 5ALKA 4Z86A 4J0EA 3ABZA 4E94A 2HL6A 5LVAA 3QWFA 3OLCX 1MHPA 4GBJA 1T8UA 1A8SA 2AG8A 3WHKA 3NC1C 3WS7A 1DWOA 2VAXA 3AHEA 2YQ5A 4AZTA 1LRJA 5DX1A 4MLCA 3B7PA 2JJ2A 5KOJA 4JUDX 3EEQA 2JFYA 2AKEA 1Y9ZA 3A1FA 1MFZA 2D1QA 3WQRA 1DOAA 1TMKA 2HB6A 2Z30A 3B48A 3PR3A 2PV7A 3IPRA 3OHPA 1XWIA 1OR8A 1RAFA 2YWXA 5B64A 1LU9A 3EHDA 1V45E 3MF4A 1UT5A 2XOXA 4WNCA 1D0SA 3THRA 4BRSA 2PUCA 3UK1A 3E27A 3D4IA 2FXVA 5BNIA 3EC7A 3NASA 4M9UA 4E5UA 2CW5A 2DPYA 5CDTA 3TZKA 5LR6A 3A7DA 1FP1D 5EJ6A 2QLJA 1RXUA 1T3LA 1RS0A 1JVSA 3P45A 4UFPA 1I7DA 2J0QA 4FOTA 1II8B 1XCJA 3KD2A 4TUYB 4P08A 4H7PA 1YHZA 2J3LA 5HF9A 1XKTA 3IOBA 2DP4E 3ICPA 4WKPA 1D8TA 1NSFA 5EIAA 3SKXA 4U2GA 3E48A 4C4ZA 3N0XA 4N0DA 4O3MA 4JT9A 4KQEA 3N76A 1I24A 3OJFA 4GE3A 1JR3E 2ZE5A 2Y8EA 4JVSB 4KODA 3HYLA 4QGHA 1RPZA 2UUAB 3HKCB 2D5IA 1BXZA 3TBKA 3WGQA 4EPTA 3I9V6 1YQEA 2AXEA 4L76A 1FX0A 2R7NA 4I7EA 2W11A 2R65A 4HN9A 4TV8F 1TUBB 2Q4RA 4BZZA 3K8OE 3S4YA 1AHPA 4OMCA 1MABB 4CTJA 5L6LB 3N2GA 2O54A 3FRIA 1BE0A 4HDNB 3PX7A 4MW0A 2CL6X 1G5PA 2IU0A 3F1LA 4DLBA 2Y1LA 4ZVSA 2BLNA 2XNSA 4YJKA 3KZMA 4ER5A 2JFHA 1OI3A 5LLSA 3ASYA 1BKSB 3BGOS 1UMBB 2D06A 5GPBA 1FFWA 1BMFA 1MBZA 1YR2A 4HLUC 2O3RA 1EI9A 2D8AA 3DQQA 5C7IO 4GOJA 1P9RA 2WFZA 3A9WA 3AKDA 3OKCA 4HUQB 4MS3A 1AQLA 4XFDA 5LXTA 3ZVMA 2WVAA 3HLKA 5KTMA 4FHFA 3HRHA 4K6HA 3CCBA 3KFLA 2X5XA 4DIKA 1XZFA 3O3NB 4C7OB 1C8BA 3L1UA 2O2SA 3R75A 4AIRA 2WJIA 1N0IA 1NW4A 1IM5A 4XIYA 2P9CA 1QTRA 1YZYA 2XUIA 2VNKA 4M46A 1N3IA 3FDZA 2RJ3A 3LKVA 5HS6A 5HSGA 3TFOA 1T4MA 1UCFA 2IKQA 1FUKA 2HHJA 3SC2A 4ZEOA 4BJ5A 4XWGA 4WRRA 2PFKA 1SKAA 3C70A 3PFHA 4UVIA 1QGUA 3GT0A 3FPBA 4ZZ1A 3WGLA 2XNDA 1W4ZA 3AFMA 4JK3A 2IXAA 4E08A 1N5OX 1YQDA 2ZKIA 1A7KA 1KZYC 2XXAA 2UYYA 3TLEA 4PGGA 2H51A 4KL8S 4IX1A 2HRQA 4PGMA 1T5OA 5K3DA 3H8JA 1KERA 2R4UA 2ZRJA 3WY9A 5TB5A 3F4BA 2RHWA 2YN4A 1SPBS 5KHAA 1Z4JA 3GZTB 2B82A 5B2EA 1PJ2A 4KQCA 2QGFA 2AG5A 1AMUA 2VSOA 5L4NA 5IRCD 3VNAA 3V8QA 1OWMA 2PL3A 3M6WA 1Z12A 2HFJA 3IBYA 4IW3B 4AXBA 4INAA 5FB3A 2IIQA 2KW5A 3OJCA 5G4KA 3AWDA 3MW8A 4IJ5A 1T4BA 4LZLA 1JJFA 1JEQB 1YH3A 1XMPA 4KFRA 3UAXA 1E1YA 3E4DA 1N5LA 4RLQA 5JSKA 3VDQA 1KH2A 4M0FA 2WPDA 8ADHA 4PN3A 4Q4LA 4WTOA 3RT7A 4S1OA 1ETUA 1I5EA 1Z5OA 4TLCA 1IATA 4E46A 1N7HA 2J9FB 3HH8A 4BQSA 1H2HA 1I3NA 4YT8A 2QL7A 4C20A 5AVUA 5HP4A 3UYKA 3N6RA 2B21A 1FS4A 3IDZA 3BZBA 4JBWA 4X54A 2UZ1A 3CVYA 3ITNA 4G8CA 3PX3A 4Z8YA 3PTAA 1U0BB 1KHHA 1ZKDA 2QT9A 2B36A 1NMZA 2ZZKA 3GLTA 1ISGA 1JXOA 2OKCA 4ZOAA 4ZV7A 1KY2A 2GA9A 2GEUA 4DQ0A 3ABRB 2X0DA 5AVRA 5KO2A 4QXMA 2GJ9A 3H6GA 3P9XA 1EB8A 1YXMA 3FVTA 4ZCTA 2RHDA 2B37A 2D74A 3ER9A 3ZWKA 1Z0IA 2FRVA 1YZTA 2C4NA 2Y1WA 3E23A 5EY5B 3SDBA 2PMWB 4P9NA 3T1NA 3M81A 2QU8A 1DZ3A 2GN1A 4ZCPA 4YQFA 5DGIA 3K2QA 3EXHA 4WUTA 1MN6A 2FPGB 4Q02A 4RVDA 1Y98A 1H05A 3A9SA 2Q5JA 3MRTA 2CSUA 4IV0A 3ZYCA 5JRDS 3WB9A 5ALSA 1CY4A 1V7PC 4BKOA 1IIBA 2RIPA 2D59A 2OHJA 5GQSA 1CFJA 2RBGA 1LDMA 1FFCA 4FFBB 2JLAA 4J0HA 4DABA 4YR7A 3IEVA 3E35A 2ONCA 4PVDA 3NFRA 2EFDB 1A7JA 1GZHB 2XE8A 1RFGE 3SXPA 5BN5A 4FYIA 3ACCA 5FI3A 1PFUA 4EFDA 3G9TA 4YRNA 3NIFB 2WIBA 4B09A 4DA4A 4I3HA 1R0KA 1Y6ZA 1FDRA 4IFEA 4EGQA 4YCMA 1M2NA 3OPXA 3L07A 3OESA 2SBTA 4RTSA 4GR9A 4MPRA 4Q7QA 3T7RA 5FWYA 3U7QB 1IBMB 5ALQA 5K8IA 3DEIA 1VPWA 4NOMA 3C6MA 4D5GA 5HR5A 4A2WA 5AK4A 3U7EB 4H6VA 4DJTA 1JLHA 1IXYA 3OUUA 3N0WA 4ACBA 1GGJA 2VIIA 4QGGA 4WE3A 3T1TA 5H8WA 2BP7A 3SJ7A 4JSYA 1FU7A 1K2WA 2HMTA 3DBVO 4N0PA 2IOFK 4YGYA 3SFZA 1KXJA 2ZREA 2HXGA 4J76A 1GGNA 4OVKA 5DGTA 2P91A 3W3AH 3E18A 5TQ0B 4BMZA 1XOIA 4QJ5A 2Y6VA 4J9VA 3GAZA 3IT0A 1MQAA 1P1CA 1BW9A 1W36D 1JAHA 1J2JA 2HK6A 2AD1A 2DF8A 3U3MA 1NI3A 1QC5B 2Q2WA 4JJ8A 5ELMA 5K8UA 4CTKA 2BWJA 2V7WA 5DO9A 4CEJB 1RM3A 5DHTA 1L5SA 3EC1A 1P29A 3GJTA 4C4RA 1IY8A 1QG4A 2H0RA 3HCCA 4H60A 3HB4X 1KWGA 5JVDA 2XWBF 2GHQA 2FW8A 3V8BA 3R7BA 4HNUA 5KB3A 3V2IA 3WMRA 2GD6A 4MW1A 1Y6FA 3IIIA 2HD4A 2XBLA 3I4LA 2NGRA 5AVYA 1MNQA 4IQGA 4M7OA 4ZI2A 1OX4B 1JLMA 4W7IA 2FW7A 4ZQEA 1RM4A 5FI5A 3HKEA 4JOQA 3IPXA 3WADA 1MVLA 1D1PA 3Q9NA 1DC6A 4BN4A 2OCKA 3QSGA 3LUCA 4JCCA 3PE3A 1ZJWA 1SQ6A 3F8SA 2X0EA 1G9TA 3W8EA 1ZUIA 5C7LO 1K86A 1O6ZA 3LZ6A 3WGNA 3K2IA 1X1DA 1IZYA 1XDUA 1G8GA 3IXLA 5EPOA 3TAUA 4LJ5A 1NDQA 3HNPA 2UZ4A 3WTCA 5KAMA 5A06A 3LT0A 4Y1RA 3HSSA 3ONWA 4FILA 4OJMX 5GGXA 4H1WA 1UPCA 5LMZA 1MHTA 2XSZA 4FPXA 3VR6A 4PHCA 5E4YA 2ZYVX 3BMNB 5F9MA 1H0KA 1I4WA 4EB6A 4MR7B 1UADA 4BYMA 1GL9B 3FSGA 3K0FB 4GX2A 4H7DA 1T9DA 4OQLA 3G2IA 2FLVA 4BO0A 4HNVA 1BGWA 1KL7A 1KYIA 3K6KA 3I73A 1E0DA 3BFJA 3NBMA 2MCFA 5JYBA 2VTVA 1ZA1A 3UMYA 2NN3C 1JNYA 5CEFA 3I1YA 2C3YA 2ZAYA 2QZSA 3ZU5A 3I09A 4JLJA 4OH1A 1OWNA 4PQRA 4NBRA 2XIJA 3KEQA 3RIYA 5B1YA 3AUUA 3BHNA 3E0XA 3AZQA 4ER6A 3IFSA 2F00A 3DBRA 3URKA 3ZNOA 4RVCA 1G64A 3DEFA 4BB0A 3O03A 5C8ZA 4EF6A 2FFHA 2H92A 4JC5A 5CXXA 1RTKA 3U4IA 3WWOA 4CKZA 1XEXA 1M2OB 3LLCA 3PXXA 2BSXA 2ZQYA 4JELA 1T2AA 1IUKA 3OFNA 3L0BA 4JA2A 1EDBA 3GROA 1NR1A 3OJWA 2KSQA 2QENA 2XGOA 1GGEA 1KJJA 3BN3A 3QFRA 5K45A 4EQ6B 5B1IA 4HB2A 5EZYF 2XH8A 4FYHA 5D1NA 3OJEA 1F5SA 2D2IA 1GPMA 2VJBA 2Z43A 4Z4IA 2Q1WA 5EMNA 2X8JB 1JPJA 1XD2B 4WNAB 5EOVA 1JQLB 4DJFC 1A5SB 1QAQA 3BF8A 3PUJA 3T1YB 4L15A 5EIWA 3CN9A 1ENPA 4BVGA 4L16A 5GJVC 2WOOA 1L4EA 2PU5A 5IEJA 1T13A 2AK3A 3EDYA 4MVJH 5FTMA 5IKOA 4Q7LA 4QHSA 1SEVA 3D81A 1XU7A 3LQRA 3P52A 4XW2A 1OBOA 3ZNQA 4E14A 4LS3A 3BS4A 1N78A 4NS4A 2VPWA 2Z04A 2CKMA 4MR9B 2VUTA 2OFFA 1NT4A 2C2XA 4YRAA 4G85A 1IXSB 3A9RA 3IUNA 1FRNA 1FSPA 3D54D 1DBQA 4H4EA 3WBFA 1VBNA 2O3SA 2IUEA 3KLMX 4R8VA 3STXA 2HCJB 3A6ZA 2V6MA 1SUCA 1G7CA 2FOLA 2J4DA 1V6AA 4YRBA 1EUQA 1RWMA 4H35A 3ETDA 1GFZA 3OC0A 3I37X 2ZRMA 4ME6A 4IXTA 4ZRDA 3RDPA 1RWKA 1RPNA 5G41A 1E2QA 4IS2A 4G26A 1SQFA 4TVOA 3JQCA 4QDZA 1UDBA 1A1SA 3CB4A 3OPVA 4H6PA 4ZVOA 5HG0A 2MSEB 2OWDA 1FDTA 2WIKA 2QD5A 5AH0A 3UGTA 2G8NA 3P7MA 2DUMA 5DM4A 3PXGA 3WRVA 5DHRA 1ZK1A 3VO8A 5CVEA 3KB6A 3O75A 3QWBA 3DYVA 4ANFA 4YHBA 1Q74A 2L18A 4P4SA 2VWQA 4OJTA 4GPAA 1MRZA 1U3TA 4DVJA 3FPJA 1Z06A 5J2UA 1JU9A 2N3ZA 4RM2A 2V9PA 2VL7A 4X1YA 2AG1A 4DG8A 3DBHA 2HSWA 3O4RA 5ALHA 1I32A 3AJ9A 1NW8A 2WMNB 4IF4A 1ZD3A 3LT2A 4FE7A 4UUBA 4CQMA 5FEMA 3C2QA 2F64A 5F23A 4YI3A 2VJMB 2X1LA 3JWEA 5EHQA 2IHKA 1NQUA 4MRSA 3G7SA 3AEUA 1CP3A 1VECA 2CLHB 2YRXA 3LKBA 1PE0A 1GPUA 2P9ZA 2XMDA 3O0TA 4PXSA 3RJMA 2RH5A 1BH6A 4BX9A 1FQKA 1K68A 4Y6GB 1LTHR 1WZUA 1IK6A 1TOAA 1T8WA 2H3EA 3GJ7A 4FU0A 1SBCA 4MGKR 3VU8A 3WK8A 4YIKA 2J30A 2CUNA 1YS2X 1GXSA 5K0LA 1E3IA 2RCNA 3RVPA 2QI9F 2VRBA 1SIBE 3PFIA 2XUZA 1D7OA 5LYJA 1SVSA 4C5AA 5KX5A 1V35A 4GYJA 1N0VC 3VSAA 1AVTA 3GP3A 4NJEB 4JIGA 4LF4B 2CYAA 2E18A 4KX5A 3S7ZA 1L8AA 4JLAA 1XO1A 4MINA 4RHTA 3P2KA 2ZE8A 1THGA 2JB9A 4MP6A 4WBNB 3SMVA 2IDZA 4Y2SA 4C88A 2ISCA 2WMOB 3BAFA 3EGVA 3GAMA 4M54A 1C4WA 3N6VA 3T3IA 3EBLA 1TU4A 2Z56A 3AI2A 2H9AA 2O3JA 1A04A 3S81A 3IVCA 1K7CA 1JPVA 2P4HX 4F5ZA 1Z6QA 3OTIA 5B58T 3ES9A 2YJ3A 2W7TA 3DLCA 3C7TA 4U02A 3E9DA 4ZPXA 4AQDA 4BGIA 4R3UC 1J20A 5JS8A 1HBJA 2C9BA 2QGZA 3Q5GA 2BMDA 1WW2A 1U5CA 3K0HA 4RQBA 2OMKA 2QD4A 2V7TA 4DM3A 1OHHD 4F11A 5FA8A 2DTDA 3IIJA 4XOIA 2XMSA 4A23A 2XVMA 3D8HA 4PZ9A 1JXQA 5J4YA 5FWXB 4C2TA 5F1PA 5KTOA 4EFNA 2JNWA 3BMQB 3M4XA 1YVDA 4PWZA 1M9NA 2W2MA 4NAUA 5ALGA 2AD5A 2YS7A 3AILA 5BWMA 2GI4A 4TKMA 3KETA 2IYFA 1R66A 1J5PA 5BOVA 4C6TA 5FKJA 4C78A 4NOJA 1FFYA 4C4OA 4AC9A 4P53A 2VCHA 2DQKA 4HPWA 1X8KA 4B3GA 4Q1BA 1E9FA 2Q3FA 1EDDA 3PHIA 4PCVA 1W85B 4PLZA 3W2HA 2O8CA 1LNSA 1U7WA 1U2DA 4LXYA 3W1VA 3ZJVA 5HK9A 4X1KA 1P44A 4D8YA 3BH0A 5CDYA 1B8OA 2DLDA 3M5CA 5CXQA 5IFKA 3LOUA 5KVAA 1AD2A 3CXUA 3DKVA 1KVTA 3VO9A 3UMMA 3GFFA 4UASA 1SC1A 4Y8VA 4CM4A 2N46A 2ZITA 3EASA 4MA4A 4G0ZA 4OGFA 2VEOA 2SCUA 1V4NA 4HBZA 4LNHA 2WHYA 4LXUA 2QRJA 2EDCA 1X7ZA 3G5TA 4ECAA 2G9ZA 4AP9A 4N03A 1LK5A 2B9VA 1MC8A 2OCGA 5K3SA 3WIEA 4EI7A 3PEWA 3PHGA 4DDKA 4KXWA 2KM1A 4X00A 5EKTA 3HJBA 2K2WA 1C8VB 1SXGA 2ZLBA 4R9VA 3RG8A 3DOEA 1Z26A 5F9HA 1Z15A 2JHGA 1D0VA 4D9NA 1C3JA 2XF8A 2WWRA 5J5CA 4EMSA 1NWCA 4LMRA 3TIGA 4MWSA 3RFCA 3JQ7A 1JHRA 1OTYA 1FMLA 2AHOA 3M1YA 3NGLA 3S1SA 1A8UA 1LB1B 3RHTA 2IYSA 3W7VA 3ZUGA 3NT4A 2HA0A 3C7AA 2RKBA 3SAJA 1O54A 1W0KD 4S04A 4C7KA 1ZM9A 3QEAZ 4L8GA 4BLWA 4ZI3A 4KPFC 5L7TA 4BNYA 4CL0A 4L5JA 2VF4X 4RZQA 5DOZA 4TMZA 2PKXA 4UNIA 1RMTA 2VH5R 1ZJJA 4WEQA 4AJOA 5IX8A 1JEJA 1YZ3A 3AG5A 3QYAA 4PSKA 1ABEA 2JDID 2P1ZA 4CKEB 1BXGA 1J9EA 1M8FA 1NQAO 2P3OA 2RI0A 3L6CA 5A4MS 3QKSA 3UAOA 3GRKA 2WU3A 3EE6A 2CUTA 4JZKA 3F5FA 4L02A 3O73A 1O7JA 4QICA 4HXFB 4OO3A 4DGQA 1VC2A 1TNDA 4DRXA 4E5PA 3I4CA 2CY0A 1LW6E 1Y6RA 3C8ZA 4JEUA 4R0VA 4GXNA 3R09A 4KJZA 1XE3A 2D8MA 5CD9A 3T4UA 1PK9A 4BMSA 4RVGA 2VQDA 5ALLA 1H2FA 4BDSA 5HM8A 3QBTA 4ZN6A 3DYBA 5B12A 4DY4A 1Y5MA 3BXHA 1SURA 3O8BA 4C7VA 2ZUVA 3N2EA 2WF9A 1DRVA 5ICCA 4M22A 1WO8A 2R2AA 4FR5A 5T8KC 1A0OA 5EWJB 3N75A 3ZE0B 2XNCA 4EG5A 4JYMA 2J45A 4U9HS 2BMFA 3B2EA 3NM4A 2Z1DA 3BE8A 2W2PA 4TWJA 3WA6A 5JZSA 2QOEA 1N7IA 3P2MA 3AHGA 2ZWVA 4EUEA 1TM2A 4FWIB 1A77A 5FOTA 3EY4A 3BK7A 1C50A 1BRTA 1QRRA 1SVNA 1PVVA 3WLKX 2YHAA 3T7DA 4J6EA 1O0BA 2XNHA 4WCFB 1R8SA 2C2OA 1A95A 5JCOC 1UIRA 5BV1A 2X7XA 1FSZA 1TB4A 3KXKA 4GZ5A 3H3XA 3SJCA 3FUXA 4FBGA 1WG8A 2YVQA 3FTFA 2DY0A 2G1UA 5F7XA 2HNKA 4JASB 2YXLA 2ZCUA 1RJ9B 5DYTA 3KXDA 3VR1A 2VATA 3CGGA 2I2FA 3QPUA 3LJKA 2QJRA 1SKMA 3EOAI 4U4AA 4GNKA 4JLPA 3WV4A 3ILXA 3H13A 4E30A 1TF7A 2R6HA 2ATIA 2BC9A 3TPZA 1T36A 1TC1A 1LSSA 4DLSA 3A70A 1GKKA 2XUJA 3BSFA 1Q7CA 1KYXA 3KG2A 4HN2A 1MQSA 1Z37A 4HGNA 4LJSA 1R0YA 1ML4A 1W9HA 3HVUA 1PJ8A 1FQOA 5EXPA 1SRQA 1XDZA 3VNVA 2ZYIA 5KWJA 1A8IA 3MTAA 4YP0A 3SYTA 3AR4A 2PX6A 1ACMA 3EQ9A 3HB1A 1L5FA 5ER6A 2H17A 3K96A 1XNHA 3PSHA 1DQNA 4AZWA 5EIXA 3C3PA 3L40A 1QJCA 1BO6A 1IRIA 1I6LA 1L7DA 4B35A 1GQSA 2Q0SA 2GM3A 1TLTA 3CLSD 3G89A 3ICOA 3FIUA 4UXJA 3IMKA 1XMSA 2XEDA 3BEOA 2Y0EA 3GFVA 3PL1A 1ZNYA 1PBNA 4RTMA 1T0BA 5DNCA 1C30B 4A2QA 3USCS 1Y37A 2FPLA 1Z6YA 1I3LA 1M5UA 2JIQA 3BWBA 3R0IA 4UFOA 4L4XA 4L8YA 1OH7A 1KDTA 5L95A 3JRNA 1VIYA 1WAMA 4AKHA 4HG2A 3B9RA 4NPHA 2WTAA 5GJCA 2XECA 4B33A 1II8A 4TUYA 3CBGA 2EL7A 3O2NA 4TL8A 1OXMA 4TROA 2O0MA 4MIEA 3PUVA 4DR5B 2QYSA 2EP8A 4IZHA 2A9QA 2BDUA 2O1SA 4QRDA 2VNJA 4RZHA 4UU0A 5C9ZA 3WWYA 2W83A 3UH1A 2OQRA 4Z0TA 1PJZA 1MOZA 3NAZA 5DASA 4XUEA 2RCYA 3OZVA 4MZXA 1H5NA 2JI4A 3LSTA 4J0FA 4Y2GA 5U9CA 3HKCA 3ET4A 3ZV3A 3V6MA 5G0UA 1TA9A 2BF4A 3T35A 4YPVA 1LRKA 4HQLA 4U6SA 4OHYA 1EFPB 3PBKA 2YY7A 2B1RA 1MABA 2QTHA 3GUUA 4UM8B 4W6ZA 1Y6QA 2XI4A 4OA5A 4HDNA 2AZTA 3ZV7A 4F2WA 5IK2D 1Z2DA 3I1JA 1YNOA 1E1KA 3NDPA 4PLYA 3TK1A 3OLWA 4DWVA 1A5TA 2CBGA 4PG4A 2W2VA 4UJ3A 1D2GA 3UTDA 3I9KA 5DT2A 1Z22A 2PRSA 1RI1A 1OLUA 1UMBA 3FGOA 3IQXA 4LE0A 2CDCA 4AD8A 2D4AA 4A8TA 2YVLA 4MJ7A 1U1FA 3CF4A 4HUQA 4RA9B 1Y82A 5HBRA 5DEOA 1EXDA 4RXTA 2P9FA 4LF7B 4MJ3A 2BFFB 1EDEA 2PGXA 1RHRA 3K9CA 2IHUA 1XRJA 1TYAE 2OAQ1 3OIVA 4NMLA 4XM2A 3WDMA 4C7OA 3V8EA 4BKUA 2GM9A 5KWVA 2DJ5A 4KQ9A 2C4TA 1PR2A 2R0QC 1R3UA 2FQQA 3ANMA 3DTVB 3F96A 4FDLA 4JT8A 4N47A 3WG9A 2PT6A 4CJXA 3ZV4A 1X42A 2NAPA 1VPTA 1AUPA 2RHCA 3CVUA 3ZI4A 3ZCSA 2Q6LA 1ZMOA 3UANA 1FP4B 4IGFA 4JY7A 3PEFA 2ZRGA 5F1KA 4KP7A 2JI8A 3QMWA 1U98A 2FN4A 4D25A 1A4RA 1RWOA 2OV2A 3DCIA 1XYYA 4J91A 5EUCA 1AZSC 4BLVA 4D3YA 2GN8A 4PLPA 2FUNB 4AJJA 3LPDA 4K6OA 4Q82A 2X4LA 3R23A 4U1RA 3PKJA 1N6NA 2BFBB 1T1JA 2F3QA 3NH6A 4GPEA 4QECA 4TXHA 4ZU3A 3RVOA 4CG0A 5AJWA 3U4AA 2Q5FA 4GGPA 4NMHA 1MOPA 4UQPA 4D82A 1FW8A 1VKNA 5TGZA 3CF0A 1BHQ1 3W5IA 4U6QA 2VBGA 2O1XA 4CMJA 3AR9A 1UJ5A 4HQOA 2W6CX 1YZFA 3IKTA 1GL3A 1ZH8A 2R751 1J06A 1ONSA 3LQYA 5U4XA 4YV2A 2V96A 3K1AB 3KALA 4KLAA 4PZUA 3AJAA 3MCTA 2LVBA 4AMUA 1NOIA 2H65A 4EO4A 5TGDA 2G04A 2V97A 3GMTA 3EUWA 3RPEA 1STOA 1UQTA 4U7JA 2I2WA 3FMIA 5IG2A 3OQ1A 4KLNA 2J9FA 4MP8A 3P4XA 1AQNA 3VPXA 3UJ3X 4NP6A 2PLAA 3JD2A 4J0JA 2Y9MB 1E8NA 3W8DA 1U5BB 5AVOA 1Y7HA 4DNFA 3PRYA 3M4ZA 1IQUA 2B4QA 2EKDA 1FSFA 1M3SA 1IN6A 1PJSA 4WOCA 1GG5A 4WLNA 4CMGA 2FUG1 5HDBB 4QZVA 1ZSVA 3ROFA 2J33A 3NP7A 2WD7B 5EP1A 1F0YA 3KJQA 3ROKA 2A0FA 1Z47A 2H00A 4RY9A 4YMGA 3L2OB 1TKAA 3N53A 2FDXA 1USUA 1CUWA 3NHSA 4LYGA 4W4TA 2FPGA 2PANA 1TVKB 1CULC 3FKSA 5CNJA 2H1FA 3FZEA 3VU0A 4URVR 3QE2A 5E9JA 3FPGA 5B1EA 4ZTZB 2F1OA 3MILA 4AJ9A 1FJ2A 2HM7A 4G5FA 4EIWA 1QO0A 3ECAA 4AO7A 4KRGA 5BOSB 2FN3A 4DV7B 2RBEA 3KV3O 1BMTA 3GJSA 5BNTA 1U90A 3VSEA 4BGEA 5ALNA 5AW4A 1T5BA 2O8BA 1KU6A 1KY4A 4W8GA 5BW5A 5KJ6A 2CKDA 3BQMB 4UCQA 4FUQA 4IILA 2UVPA 1NLYA 3C87A 4L5IA 4AUKA 4M0KA 3OO0A 1CTQA 1AK2A 2L2QA 2AW3A 4EYOA 3U3JA 1L5OA 2HREA 4XKJA 5KKAA 1U3FA 2PO7A 4Y2PA 1XZIA 3KTDA 3L49A 3OEHA 4BNZA 2DT5A 4TSFA 2QYTA 4EHKA 1JTVA 1E7MA 5C8YB 4EJ2A 4C0XA 3CB2A 4WK2B 5AUOB 1QIKA 2QMOA 2MINB 2PLWA 3A26A 3EPKA 2XCOA 4GNRA 3HUDA 3CN7A 3KNZA 2VYVD 4ROTA 4BBZA 2MSDB 3QNMA 1JX6A 1K06A 5TQ0A 4LDZA 4PO8A 3SC4A 1N1MA 2H1VA 2ZUSA 1VIDA 5JECA 2EYUA 4BXOB 1HL3A 5EZQA 1CQWA 2BFCB 3F7TA 5CLHA 4ZCIA 1KJYA 2AWOA 2QXYA 4U2DA 5FPYA 1MJNA 1TYZA 4NFLA 1RXVA 1QC5A 3ZH2A 4X41A 4WGGA 3VR3D 4CEJA 2ZANA 1QF6A 3E8XA 5GZ6A 3T7CA 2AYZA 3HCOA 1S96A 5HCUA 4DE5A 2AXQA 2HF7A 2HZ7A 1M1XB 2YZGA 3CZCA 3Q7QA 3R0ZA 3MWDA 1WJGA 3EH1A 3IS3A 3PNBA 4DZTA 3BM5A 1OVMA 3MTIA 4JOCA 1FFAA 1IB0A 2GNAA 2V6JA 1BHO1 1XRMA 1U9IC 3IC5A 1OX4A 4I1YA 1JIJA 3TQSA 3U9LA 4PIPA 5CB6A 4G9EA 2NNLD 1B8UA 2P4UA 3IAEA 1RI4A 5SZJA 1N6LA 1R27A 2FSPA 3NHFA 1TJ5A 1TZMA 2C5BA 3EEYA 3P1JA 1KC1A 1E79A 3MGAA 4N7JA 4DLYA 3V2GA 4FFVA 5KMGA 5KTKA 4B32A 4EY8A 4JKIA 5KC9A 2OMEA 3A9CA 3DEYX 2P9EA 3F47A 4A1FA 3NYWA 5EMMA 2GEKA 2PX5A 3UCEA 3VC1A 4DCTA 3NLLA 4E7OA 1HYEA 4QULA 1RLMA 2W98A 4R8SA 3MM4A 4FONA 2ZRKA 3OIDA 5B1DA 1C2TA 1XAHA 2JH8A 3EPHA 1KQOA 1OAAA 2PH5A 4Q3EA 5D1HA 4JI6B 2Z83A 4AXXA 2C9DA 3IKMB 4UHCA 1NU6A 1K7XB 2PUHA 2A9OA 3MJTA 4MR7A 5FTJA 1Z07A 1N8SA 1TU0A 2HADA 3K0FA 2IUTA 4A16A 4LJLA 2PUGA 3WICA 1R9NA 4C0JA 4RDXA 2R86A 4LV6A 4QEZA 1O2DA 1SVKA 2DY1A 5JCJA 3QX8A 4TV9B 3DV0B 1TEXA 5THKA 2YHUA 2UV8A 2B69A 3GJ8A 3OEED 1SCAA 1G9SA 1WVIA 4FSXA 1Q5PA 2RGCA 4GC9A 3WKAA 4EPYA 4O33A 2PAAA 3JQ8B 3DL7A 5C4MA 3DD5A 5DHPA 2A8YA 3N8NA 1KRHA 3RFFA 4D5EA 4K1XA 5LU9A 3AJDA 4MPJA 1OVGA 1VE9A 1N2CB 3CF6R 3PQ3A 3LY7A 4MA5A 3RODA 1RXSA 3V1TC 3WYEA 1JN0A 4GDFA 1O5TA 4K9QA 2QN1A 2B99A 1CUDA 3DP9A 4AY2A 3QE4A 2HQSA 1YZHA 2WWTA 2WNSA 4LJYA 1B6RA 4R81A 2C58A 1Z45A 4HK4A 1K63A 1Z8NA 3PCXA 1M2OA 3Q3JB 1IWPB 1GUDA 1PQYA 2DG2A 3TSZA 4C0BA 1Z36A 1BDMA 3D3QA 4ZOEA 5T6MA 5CX1B 4EQ6A 4HF7A 1CJSA 1W5AA 4MKGA 3UPTA 2GGSA 3HEAA 2BJVA 5LMNB 3ZS8A 4EUHA 5GMOA 1ONPA 3TD2A 2H1IA 2X8JA 1HE5A 3LTNC 2C5EA 1JIKA 2AKYA 2EW2A 4KIFA 1A98A 2CYBA 3GJYA 4KIGA 5CEEA 4XB2A 3PCRB 1Y5RA 3RS2A 4QDOA 3VI4B 5JUWA 3HB5X 2ST1A 4Q4CA 2XODA 2KMLA 3L8YA 1A9OA 4XSGA 2EKLA 4MPPA 4NZPA 4YK7A 3LZCA 1LLCA 4FFDA 1M83A 2Q29A 4BZWA 3ROMA 3N8IA 4MR9A 3M3DA 1NA5A 4QUAA 5ALMA 4F9GA 1CY8A 2Q4DA 1VYHA 1N3YA 5FORA 2HFKA 4IDHA 1J1IA 3NMUF 2D1FA 1PJQA 4X3OA 3VNUA 3Q0IA 4QYXA 1DQYA 5DCUA 3IKVA 4HGQA 1ZN8A 1P1IA 4DCGA 2H59A 2O3UA 3VVLA 1UBNA 4GR4A 3TTYA 2J1LA 3UFBA 1NQOA 3WGKA 1Z4PX 3ZDQA 3P4YA 2I34A 1XR3A 2ECQA 2VP3A 2J8ZA 4UXHA 3VYWA 1NN1A 2H5IA 1G16A 3GMIA 3DE6X 5JBNA 2Z5FA 4KN8A 4JAVC 1CUYA 1JA9A 4IKEA 3ZZMA 3IOEA 2I91A 3A4IA 5KNBA 1AO3A 4PCAA 3W78A 1FFEA 2FE4A 5I9MA 1QHHB 2FZEA 3VH4A 3TOCA 5C3MA 1VHLA 4JGBA 2ERXA 1Y7TA 3OIYA 3MQ4A 2Y6UA 1MIOB 1PWYE 2C77A 2OHVA 1A7AA 1ZZEA 3FYUC 3H2GA 1SCJA 2FUG6 5DBFA 1NNLA 3MS2A 4MIOA 5DM0A 3TO5A 1SO8A 5FNVB 3T4PA 3TSOA 4IMJB 2HO4A 2ZTSA 2PIDA 2G09A 2ZJ8A 2WTBA 3FTCA 3FF1A 3R6TA 2Z5VA 1UDWA 4BC1A 2I87A 4L6AA 1T5LA 4AX8A 3X2FA 1DAMA 1Z2CA 2VJMA 3EDOA 1AU9A 1QHYA 2VT7A 4U8HA 2FQ1A 4O4IF 3S2FA 1WCIB 3TN7A 2XAAA 3LC7O 4YMWA 4DQUA 3RJZA 4QUDA 5DK6A 3JZAA 2HU8A 5IHPA 1RQRA 3CSUA 3P9ZA 4WASA 4JEMA 3G0OA 1ZM7A 1FVHA 1XAIA 2ZKLA 2ZCVA 3FCYA 4LY6A 2J5BA 3C7CB 3IE1A 2FKNA 5FUQA 4P3YA 2PL5A 2GHRA 4F4CA 3PNYA 4IQFA 4MQ5A 3M6MD 4NNPA 2O57A 4NJEA 1VG0B 4NE7A 5IWAB 3VYVA 2R87A 4Y6SA 4QNNA 3DZ8A 1EWYA 4WBNA 4CIAA 3OHSX 5TDHA 2HA6A 2IDJA 4CQLB 5BW4A 5LLTA 1X92A 3QXXA 5DM70 1P4HA 3NXSA 5SYNA 3AW9A 3ECSA 1IFXA 2Q7DA 3OCYA 3CU5A 1S2MA 2UXCB 4MUKA 3OKPA 4QE3A 3KHKA 5DU2A 3WAGA 1Z38A 2IITA 3HGTA 3I6BA 5JDIA 3S5UA 4RJKA 5KAPA 4ZVTA 5CD1A 4EVRA 4EA7A 3A9VA 4Q37A 2IDKA 3BK2A 3OPNA 4BCBA 1HRDA 3G82C 1VLZA 2VUIB 4AO6A 2I7XA 3VKUA 2OZEA 4RL6A 4NHOA 3GPCA 1LLDA 1L5NA 5FWXA 4ERNA 1JQDA 4NU8X 3BMQA 3DG9A 2C2HA 1SM4A 3G02A 5BV8A 1M6VA 3EIUA 2QE7A 3DWGA 1W44A 3H42B 5DNWA 5D7BA 2JHFA 5EP3A 4ETIA 4AN4A 3DZBA 3KX2A 4R4JA 1RI3A 1D4FA 2E3JA 1QMPA 1Q3HA 4JODA 2QUBA 5AXBA 2X77A 4R2HA 3TQTA 1EDZA 4MGZR 3R6GA 4E33A 4QGSA 1W85A 4IH1A 4DNQA 1BQ3A 1H6AA 1XRPA 4MQUA 4ZYLA 4MQEB 2FWMX 3OF2A 4WKGA 3M89A 1UC9A 4L51A 4TYWA 1HYHA 1L5MA 3AYZB 5J4KA 4CKWB 3LU1A 4WEOA 2QS9A 3Q2KA 1Q7GA 2NAFA 1BIFA 4GI3A 3N5KA 1AN9A 4JLOA 4UEOA 2J9YB 3RVBA 3V4SA 2IZ5A 3WSVA 1OWLA 3MRXA 3O4GA 4X6UA 3ZGNA 3DE3X 4HRYA 4F1KA 3A2LA 2YV1A 1KXZA 4CL3A 4S1VA 4G0NA 2IH2A 1T2DA 2IXEA 2M6SA 3GGCA 4BN5A 1DZIA 3F5SA 1SD1A 1QGOA 1MJFA 2NLOA 3EVAA 3RV4A 2QRNA 1UXJA 5IZCC 4Q24A 2O14A 4FD2A 4NU0A 2NV0A 3SQNA 3AOEC 2OO3A 1B0PA 3RAFC 1KGDA 1J97A 1XLVA 2P2NA 4R5HA 4I36A 3SZOA 3WQSB 1ENZA 2JGMA 3N2KB 4ZVKA 3L7IA 1J56A 5MFPA 4B31A 3M34A 3THOA 3I2GA 3V4FA 2YR0A 3VR6D 1ISMA 1O6BA 1P2VA 1YZLA 3BXPA 3DO5A 3ZJYA 4EF5A 4UREA 4BVBA 1W4BA 1KDZA 2A0WA 3EN0A 4D4IA 1AGYA 1JKMA 1ESMA 2NO5A 2PU7A 4URWR 2VP0A 4Y3UA 2Q49A 4PHFA 4U0JA 3U39A 3L4KA 1UJCA 4O2BF 3L9WA 3N2YA 4TT3D 3MCVA 1TZ2A 3ZDBA 4M3NA 5AI8A 2I8CA 4XFJA 5BRJA 4CV1A 1I4DD 5IT0A 2DFPA 4J75A 1MEOA 4RHUA 4X9XA 2B30A 4HQFA 2IYQA 1DCFA 4QNRA 1LPMA 2XBUA 3BX1A 3GOQA 4KRFA 1K2VN 1I51A 2DJIA 3KCNA 4RF2A 3RC9A 3AIKA 1TQ6A 2FN7A 2XKJE 3OAAA 3T3EA 3JQFC 4CMKA 3AF0A 2FRDC 4CKEA 4JXZA 4KKXB 3SVTA 1FRQA 3H5NA 3WYFA 1FUEA 1SHKA 5IKXA 2VHXA 4N5DA 4BMVA 3KXIA 5C7YA 4ICIA 4JEHA 1A69A 1X15A 3AFNA 4MB0A 3WKCA 4GKJB 1T5DX 4TLEA 4KNYA 2HJ9A 5IKMA 2A9PA 2WV9A 5K3BA 4DCOA 1FFDA 1TZJA 2EJTA 2VUSA 3UMRA 5IH7A 3CZ9A 2BFOA 2HPZA 3RQIA 5JY1A 3HGQA 3JQAD 3MUNA 1QHNA 2X0IA 3K2BA 1THZA 4GYWA 4QO7A 2YTZA 5JSQA 3RU7A 4YB8A 4KIUA 1EGMB 4TLLB 1E5QA 4XD2A 1WMAA 3B70A 1T9ZA 3OP4A 5LB2A 2L17A 2YY5A 4D8XA 4DEXA 1VTKA 3CEMA 5JSFA 3M70A 1M7GA 3BTVA 4IOLA 1BSVA 1CR4A 1UODA 3CZRA 3PR1A 4GZ3A 5F98A 2PLNA 3Q7IA 3RSCA 1RYFA 2XT6A 3YASA 1UXGA 3C98A 1SAYA 1TKRA 2XX3A 2PGLA 2WT8A 3HDQA 2JCBA 2E49A 4ZHSA 1YFKA 3LYHA 4FT4A 4WCFA 2IEBA 1EXWA 4IX9A 3V1LA 1OTXA 1EE1A 1HXHA 2PWPA 2R00A 2Y0DA 4YRCA 1K6XA 1NDHA 1MT0A 1DCMA 1RJ9A 4RENA 1YQUA 3HRIA 4I1SA 1I5OA 2QJOA 4WW0A 4QBKA 1DKPA 5ALYA 3WDLA 4R98A 3W5VA 2EYQA 1NUSA 1OIWA 4W7SA 4FWTA 4GL2A 4EY6A 1NTOA 3FPCA 5HGXA 3EWSA 3B9BA 3ADKA 3REOA 4R6WA 3UHPA 3RVNA 2NSYA 4TV9A 1JFLA 1V8BA 4FLFA 4YP1A 3FR8A 3P0HA 3PA8A 4FDMA 4V02A 3VNRA 5LD2B 2ZYSA 4DMKA 4MRRA 2BTOA 3SS7X 1JR2A 4DLVA 3QE0A 1B2LA 3KQYA 4Q93A 4LX0A 1F2DA 4K03A 3A0RB 4Y9SA 1UBKS 4D9HA 2VP9A 3IQGX 2XD4A 3C5HA 4RH3A 1KRXA 4AQ7A 1U0JA 3O1JC 5HKLA 2YBEA 3HWWA 1B73A 4Q16A 4PX3A 3UKDA 3WTBA 1W7AA 4ZDJA 1QPZA 5D2CA 6REQB 3ZDDA 3ZIDA 3RFVA 4C3ZA 1C1DB 1C30A 2OAEA 3C6ZA 1I4TD 1YC2A 3EVCA 2IV2X 2UXBB 5M29A 4B85A 3ULKA 4XSVA 1WZ2A 3ICQB 3F9IA 3ZNNA 1YCHA 1Q1NA 1G3RA 1GPKA 3GLUA 4BZQA 1Z35A 3RYHB 5LMCA 4ARBA 1I9CA 1F6BA 1KY5A 1NBEA 2FWJA 3CBQA 3I2FA 5KZMB 3PRKE 1CR1A 4FJ2A 3TOSA 4EJMA 2PZGA 5IVKA 1DCKA 1LX7A 2QL5A 3KQKA 3PQ8A 4ITVA 1TMGE 1ODJA 1SCDA 1SVIA 2W2LD 3MJEA 3U4CA 1QIDA 1JR3A 2ZAIA 4LI0A 1IK4A 1HDGO 4OIMA 1EFPA 1KI8A 2QA5A 5C7OO 7MDHA 3TYXA 3HN6A 2Y0PA 3R24A 3O21A 2AVNA 2DQZA 4H7KA 2H08A 2IOQA 3T5CA 1HOXA 2HRRA 2VPZA 1DWUA 1P19A 3E22B 3ENNA 4RFLA 2AWNA 3QG5A 2WHXA 4F2HA 3TL3A 1VKZA 1NW9B 2Z2KA 2YZ7A 4TGLA 1ZJYA 5HRUA 1D03A 1T5IA 1IEVA 3HP7A 3TQCA 3E05A 3OQBA 3SQWA 2Z2IA 1IJEA 3KJGA 5AM3A 3PDWA 3DJFA 1GR0A 4BS9A 3UBMA 4BNVA 1DDIA 2C0CA 1GM5A 1B6TA 2BFFA 3AHJA 3H97A 3SEZA 4XDZA 3TSWA 1CUUA 3DEAA 5AW5A 1RKUA 1ECBA 2H0AA 5FCDA 3RIMA 2BI7A 4AU1A 3C5CA 1J5XA 4QT0A 1AOXA 3CNQS 3LO5A 4CKBB 4BFUA 2J0SA 3DTVA 4X63A 3KEGA 4PRLA 1GTZA 3D2LA 3HA5A 3TW6A 4JSTA 1AGRA 4KBGA 3KP1A 1YB7A 3IXQA 4R2JA 2GRUA 1U2EA 4EW1A 1DRKA 5CFQA 1P2UA 1FP4A 3SBDA 3TINA 5KREA 5H4HA 1P80A 3A04A 3CPSA 4JLVA 5KVCA 3TIIA 5C51B 4CLXA 1F0KA 2QN2A 5HJ2A 5SZHB 1OILA 3WL6A 2BFWA 2XUPA 1AHHA 2GJKA 4OBEA 1V5GA 4DR2B 3AG6A 5G1OA 5H82A 4IG4A 4ER0A 4LTDA 4PO1A 2QNBA 1VDMA 1NNSA 2BFBA 3HNOA 1Q91A 2Q5QA 4RXMA 4RJIA 4AZ3B 4D3ZA 1JSXA 5BPFA 1K4KA 5E2AA 3BERA 4HDCA 4R6XA 1G5QA 1KY3A 3Q9SA 2BEVB 5AIAA 2BLLA 3BGWA 3JZFA 3SZRA 4FIZA 6CHYA 1NYRA 3MIIA 1D2NA 3LDAA 4Q3KA 5C1IA 2IHVA 1ACJA 3CJRA 1D5WA 4X93A 5EE3A 4CBVA 2XMRA 3RUPA 5EJ4A 5B3JC 2B7LA 2H5JA 4K26A 5L3SA 2XCRB 3O95A 2VDWB 3K1AA 3CLKA 3DZJA 1ORTA 4PLVA 1CC1S 4A3SA 2MDTA 2RHLA 3MQFA 4M6WB 5LCXA 1KSHA 4QTUB 2WBLC 2D0DA 1I3KA 3KBBA 5DHSA 2NU6B 1T6XA 3PXDA 4DV1B 2IWRA 1P2GA 2LR0A 4A9AA 1EK2A 1NX6A 3CPHA 2F3SA 4Q1AA 3KQTA 4ZRMA 1IN4A 4QQKA 4B45A 4QWWA 1KVUA 5E6UB 1U5BA 4AJLA 2G80A 3VNBA 5BN3A 2XITA 4AJIA 5C18A 5FUMA 1TCVA 2JAQA 3LHSA 5LP6B 2VXYA 1WCXA 1SU7A 1E5TA 1NR5A 1N4DA 4R01A 3DEZA 3SIPA 3WO1A 4ABYA 1NQ5A 3G9QA 3S28A 1MA0A 4X7PA 4GLFA 4H1UA 1YMQA 4NABA 4QTXA 2XCQA 2VPQA 1Y9JA 3BD7A 5GM2A 1XU4A 2C4UA 3WX0A 1UM9B 3KSBC 1KTIA 1RW4A 1UAAA 3KR9A 3F9CA 1V37A 4NH4A 1TVKA 3LH5A 3Q3CA 1AC5A 2MYTA 2IYXA 2QKYA 3ZBUA 1DHRA 4JVMA 4NENA 1V2HE 4TOIA 5AI4A 2CL7X 2HRZA 3FYHA 1G8PA 3NM5A 1ESZA 1L5ZA 4RABA 3W4JA 1MT3A 1KNQA 3MINB 1V16B 2J67A 5BOSA 2X1VA 2HRDA 1KHTA 4W9RA 5FA5A 3N74A 2Q9AA 1NW6A 1JIUA 1IM2A 3WJ7A 4JBXA 4WJKB 2NOAA 4G5SA 4NBWA 4CV3A 4BGDA 4ESVA 4POAA 3COJA 3KSAC 5LIPA 3ELYA 5E1OA 1CZHA 1HDXA 1P9NA 3MJRA 4Z2AA 1PT7A 1NP6A 1VBFA 2A9KA 2JEOA 4YDQA 3SYMA 4E88A 5EXDA 2CC2A 4HNQA 1U1CA 1KS2A 1I7PA 1RYZA 3GIWA 1VL8A 4US1R 2FPRA 1EUYA 2C4VA 5DJ5A 4XCQA 2YIJA 5HUJA 1GQOA 5C8YA 1V3UA 2F43B 5I8PA 1WHTB 3OZ7A 2AXNA 2PGAA 1N7JA 1FJXA 4MLZA 2M6LA 4DWJA 1TM5E 4V0ME 3ZWQA 2MINA 1XNRB 1JLKA 4P1ZA 1QHFA 1SFRA 3UCFA 2FX2A 3B20A 1UBFA 3DLIA 4ZT3A 5L7YA 2ODPA 4EZBA 1AZWA 1EESA 1JIQA 4WZBE 4J4TA 2EZ9A 3M6LA 4QEDA 5KTRA 3FNFA 3K72B 1RQPA 4WKOA 3KT0A 4G8DA 1VCNA 2FJPA 3I92A 3EZXA 3K0CC 4PGAA 4XQEA 4BNIA 4YY3B 4ZEVA 3AP2A 2YZNA 1U7PA 2J6BA 4TKUB 3RYCA 3UB4A 2IIPA 4QLBA 1KJQA 5FLKA 2EXXA 4XCVA 4OM8A 3CRW1 2PS3A 4PWYA 2VN8A 1ISIA 3D3WB 3JV7A 4X24A 3K4QA 3SLRA 1Z5PA 2BGUA 1FOEB 4O4JB 3ZCUA 1MQ9A 5KHOC 2J46A 1QP7A 3D1LA 3O74A 1L7XA 5KHLB 2J0UB 3UT5B 1SOWA 4XYEA 5DNEA 3GT7A 2B61A 3EIEA 3AFOA 1KOFA 1RRKA 4UNNA 4HH4A 4Z4GA 2EF0A 3NNNA 3QK7A 4IXDA 3AX6A 1UKVY 4G65A 3LBFA 2NTVA 3M6UA 4ZQIA 2F8SA 4O4HF 1Y6JA 2HPVA 4M9CA 5BMOA 5LQDA 2CHFA 5I7FA 3HVJA 2RB5A 2RHOA 3AL2A 4JDUA 4RD4A 4Y1GA 2P9GA 3P9YA 2QMQA 3GARA 3IP8A 4NK4A 4ENWA 2P0EA 1E3SA 1CXZA 1EJBA 1WXIA 3K3PA 1KIMA 1W2WB 5E2BA 1EVEA 1Q19A 2ZRAA 3AUTA 5HA5A 1M2HA 4JLMA 2XEXA 2Y27A 4QAQA 1JAIA 3IUMA 4CCSA 4EMUA 5IPFA 4OX9B 4MKIA 2QGNA 4FC7A 5KDLA 1JZTA 4DR4B 2ZIAA 1R3DA 5LA6B 4BUZA 4O02B 2PEZA 3CLHA 2JIPA 1IQPA 4TRRA 3U3RA 1NF9A 1HURA 1NIJA 2BJHA 2WHEA 2PMFA 2ATXA 2CZCA 2XWPA 3WZMA 2F9FA 3IT2A 5TEVA 1ZK2A 2P6OA 3ZY5A 3R3ZA 1BEEA 3D7NA 3VTZA 4BQNA 4XLLA 4G0UA 2PBLA 5KU7A 1ZEJA 4PQFA 3SE7A 5K8TA 1OPRA 1PJAA 3DV0A 2ZJ1A 5LBUA 3WVNA 4AJPA 5KPJA 4ER7A 3VYTB 3RAPR 3I2IA 2VA9A 3FKJA 3V33A 1IBKB 2XRFA 2AUMA 3IVGA 3JQ8A 4FGUA 3S6JA 3GEGA 2DUWA 1OFUX 5P21A 3BCHA 5TMDA 3RSQA 4OXXA 3JXEA 4BNXA 2FEOA 3B85A 2HBZA 3W6PA 2F90A 2ZG6A 1WXEA 4FWBA 4A27A 4KR2A 4AYXA 2CXQA 1M8JA 2VDVE 3IQIX 3ONFA 2UXDB 2CB9A 5CYGA 3VKWA 1W19A 3LX6A 5AJVB 5CT8A 4OHFA 4QG3A 3ABQB 3LUJA 2A3RA 1QP4A 4N39A 4RVNA 2BW0A 4DNPA 5HCIA 1PBTA 1WU8A 1JKJB 5REQB 1SA0B 2O23A 4M8SA 4GPIB 4DLAA 5IBQA 1QGAA 4OI2A 2CE7A 3I1IA 4MVJM 1ZGAA 3L4SO 2RGBA 4AN0A 5L4LA 3I5YA 5JZ9A 2PKQP 3S2ZA 2P3QA 5I7AA 2CJYA 4ZO7A 1Q0RA 2CD9A 5CX1A 2HLDD 3DAPA 1G6HA 4E5DA 3RARA 4D4JA 2OSVA 4QFMA 1VCMA 1L4LA 4UEQA 1G4AE 3EGEA 3HWRA 3QTBA 1M6YA 2C42A 2QDKA 3OLVA 1AMOA 1JEAA 4LOIA 5CH3A 4EG1A 1D1SA 1AXGA 3SQLA 2X1HA 2VZ8A 1CUJA 3CO5A 3VGJA 1KI1A 3VPCA 4EHJA 5IF9A 1OB5A 2REQA 3LBYA 3TLMA 3IERA 1DELA 4R7GA 1ZMBA 1O94D 5EHXA 1GGVA 4JNKA 5JAUA 2OKGA 3LXMA 4RAQA 3FETA 3UAWA 4R3NA 2BFMA 5TARA 4XSHA 1N9ZA 2VLBA 4LRSB 1OWOA 3SX2A 5K0FA 2DR2A 1MG5A 1XNQB 2YFYA 1Z39A 3INRA 1GVHA 2WWVD 1R50A 1BJTA 2QNRA 3MTDA 5LZ7A 2OFOA 3W3AA 2IV7A 3L0IB 2OGZA 3ONVA 3R9IA 3RAGA 1CW2B 1QG6A 2MYUA 4D56A 1Y4SA 4DSNA 1E3LA 1PJRA 3R3SA 3B6ZA 1G8HA 4P2GA 3WMXA 4BC0A 1DBIA 3NNSA 3EEFA 5I9IA 4DR1B 4F3YA 1AQUA 1TMYA 1UXHA 3GRRA 2PZKA 5K0SA 4AL4A 2Z9DA 1GZ6A 2HQOA 3I9NA 1B41A 1XVLA 4TWAA 2ZYRA 1QOPB 1H4SA 4X0EA 4MEAA 4HRAA 2EV9A 3RB8A 1R0XA 1LF0A 5JMWA 3W6NA 1RAIA 4TN1A 1MV5A 2IA5A 1G0OA 1OTHA 4AP6A 4LTMA 1TQHA 3IDAA 5TSDA 4Q01A 4PVCA 1V95A 3SHOA 2RGNC 3SC3A 4LYJA 2WZCA 5D84A 2FCAA 2JIZD 4JUIA 3UK6A 4CM6A 3L8CA 4CGZA 3UENA 1GAWA 3H7AA 1A8PA 3NHZA 4NMMA 4LPSA 5CYFA 2IUUA 4DT1B 5I7WA 4XE5A 3DL2A 4HB4A 4A36A 1O96B 1L6IA 1DAFA 1MIOA 2FSVC 3C5VA 1U99A 2P6MA 3Q4GA 3ZZUA 2NZYA 2D2XA 2PWYA 2FSSA 1YI0A 2CLSA 5BSWA 4ASUD 4BQEA 1Z7WA 1KO4A 3S44A 1G5HA 1NFFA 1QVAA 2WA1A 5FNVA 3TXXA 5K51A 2EZTA 1HQKA 2GCOB 2QQFA 4X6XA 4UDXX 3RWMB 3W5DA 2CSXA 2XTMA 4WWHA 3NBUA 3RRNA 1QKKA 1W36B 4ZI7F 5E9QA 1IWBB 4TXJA 4UAVA 4ZVLA 5JSYA 3P9RA 4QUBA 1EIWA 1WCIA 3B3GA 1IYZA 4QOJA 4LYYA 3W7BA 1IQRA 4GM0A 1YDWA 1XD9A 4GRDA 4W8OA 3KPWA 5EQTA 3NEYA 4YAIA 4LDAA 4TYQA 5EESA 4BE9A 1ICIA 1YQ9A 2GWHA 1Q1ZA 2H07A 3L01A 3SPXA 3GJ0A 2HSEA 1QGED 4J29A 3OZFA 4MWTA 5JPIA 3GLVA 1QNLA 1RIFA 2ZBQA 3GH1A 4AI6A 1TQ2A 1UK6A 4DR7B 1P2TA 2XDQB 3HY6A 1ZD1A 3AWIA 3CCFA 3F4LA 2I8AA 4K6MA 4B6FA 5JT1A 3R5KA 1QZZA 1JQKA 3HU1A 1ISRA 2J7PD 4HWGA 5D6NA 1UKBA 5JXGA 4NVRA 2PZFA 2O7SA 1GIAA 3EGWA 3QBDA 1E8DA 2QUAA 4N3GA 3WWCA 4CF7A 1EAMA 4URFA 1GNTA 4CQLA 4W82A 3IUPA 4D8TA 1JVBA 4XI9A 3WBBA 3V7FA 9MHTA 2NM0A 4UUNA 3DVQX 1U7UA 3MA0A 3MGKA 1SVUA 1XF9A 3ADPA 5E7MA 4QXPA 2JGDB 2QAGB 3HHPA 2N1BA 4V3BA 4D02A 2GNOA 4RUKA 1WUHS 2C03A 3KO8A 1FCJA 3LIPA 3QOFA 4I9GA 4XVCA 4QU0A 1YCFA 2JFQA 3JQRA 3DE4X 1WLYA 2VI5A 4WMLA 1W88B 3CXRA 4G0VA 1LH0A 3FOCA 4IJQA 4PIMA 4B7XA 3JS5A 3PYMA 3R40A 4JLUA 3HVRA 4F3KA 4YJDA 1A2KC 1W94A 4X62B 1RYHA 4LG1A 5J40A 4O4LB 4YJGB 3RE1A 4F4IA 3DLBA 3KOMA 1W0CA 2ZBRA 3OFVA 1NVTA 4HGRA 4MMYB 2BRUC 3IDSA 4K87A 4ROSA 3L7YA 4DFDA 3FMPB 1ACLA 3MGBA 2W6JD 3O8LA 3PHHA 4TQGA 4E32A 1ZYUA 4MVJA 2VZEA 3OWOA 5HQJA 4I8DA 3TS1A 1YR7A 4DCVA 4FFWA 4WCVA 5TQVA 3KU1A 4YUWA 1UEXC 4H1VA 1F6DA 1VA4A 2JAHA 4JMPA 4I50B 5DBOA 1M6NA 3EZLA 1DEOA 2CGEA 3ETGA 3UMBA 1DAKA 3R4VA 1DKUA 1ORWA 3AIMA 4CKWA 4YCNA 2QUJA 2O59A 3LYLA 4G3XA 2IYRA 1GYRA 5G2OA 2GJ8A 2BUBA 3CLTC 1YFJA 3EX7C 2YV5A 4JHLA 4MW7A 3AUYA 4WXYB 1P7PA