4DQ0A

The crystal structure of tellurite resistance protein from escherichia coli o157:h7 str. sakai
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
IRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDGEYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWEMVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of tellurite resistance protein from Escherichia coli O157:H7 str. Sakai
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Tellurite resistance protein
total genus 69
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4dq0A00
1KXZA 5E1BA 5LQKA 3PFGA 5KS2A 5U4XA 4BLVA 4PYIA 5CVUA 3UJ8A 5E8RA 2YXDA 3FYDA 5EQJB 5ICGA 1NV9A 4YUWA 2PX5A 4OBXA 4MWZA 1T43A 5LQAA 5CVEA 2V74B 3KR2A 4RYLA 4X63A 1XCJA 4PYJA 3BWMA 2ZBPA 3MTIA 3R6TA 1O54A 3EEYA 5GM2A 5B1SA 2HNKA 5T64A 3NVMB 1DCTA 2B25A 1QYRA 4MTLA 3KR1A 4RV9A 2P7HA 2ZZNA 3FPJA 2P3QA 3KPUA 2ZWVA 2XVAA 2XVMA 5CM2Z 3GNLA 3EVAA 4FT4A 4C08A 2ONYA 4YV1A 2ZLBA 1UFKA 3OPNA 3THSA 3TMAA 5EG5A 3TM5A 1RI5A 1OR8A 2QRVA 4YUVA 2UYHA 3OE4A 3TM4A 4YV2A 5EMMA 1EJ0A 1RJEA 1XVAA 3ELYA 4P7FA 4WXHA 4GOOD 1G38A 1NW6A 2AOVA 3Q87B 3FPEA 4M37A 2IH4A 1M6YA 2ZBRA 3HA5A 3T0IA 2CL5A 2PLWA 3LHDA 2NXJA 4R8SA 4CKCA 3LBYA 3EMBA 1NBIA 3E7PA 5CVJA 3TFWA 1IY9A 1JG1A 2JH8A 3DR5A 4V0QA 5EIFA 1KIAA 3R0QA 3I58A 3NTVA 5HIMA 3TLJA 5CCXA 4ER0A 3GRRA 1XTPA 3JWIA 3VC1A 3GRUA 2G8NA 2IDKA 5K0JA 3BWYA 2H00A 2NXNA 2PSSA 5DXJA 5K0GA 5LR6A 1SQGA 3UZUA 3GXOA 1V39A 2IH2A 1JQDA 1YB2A 2PWPA 4A6EA 4QTUB 5GIOE 3PLAE 1L3CA 3ELDA 3EVZA 1MHTA 4RTMA 4IV8A 3DH0A 3MHTA 3REOA 4KRGA 1BKYA 4GEKA 2QRVB 5DTMA 5EMLA 1YZHA 5GIPE 4PYOA 3DXXA 2ZTHA 5EKXA 3UJAA 5CD1A 5EIWA 2PX2A 1R8YA 1IM8A 4X41A 4YMGA 1FJXA 4HTFB 1M0EA 3SR4A 3BWCA 3FZGA 3E23A 4C07A 4LECA 2QM3A 2B3TA 2FYTA 3PT9A 5D1HA 5DTQA 4PYLA 3VC2A 3LKZA 3SVZA 2GLUA 3DULA 3RW9A 4KWCA 4XUEA 3GGDA 3SSNA 2BM8A 2BR3A 3M6XA 5E9JA 2I7CA 2BH2A 5LQUA 4OBWA 4RTLA 4PNEA 4G56A 5H02A 1VE3A 3B89A 5E1DA 4ER3A 4BP3A 3NW9A 3CBGA 5G02A 4KDRA 3DLCA 3D2LA 5E2BA 2O06A 4U7PB 4F85A 3BKWA 3GIWA 1SKMA 3P2EA 5EC8A 5P8WA 3NVKI 3OE5A 2V7EA 4ISCA 4MHTA 4E2WA 1L3IA 4XUDA 3A7DA 5DM2A 3EVGA 1AF7A 1NT2A 4JXJA 1ZHFA 3SX0A 5DTRA 4KVZA 2AOTA 1VLMA 2ZIEA 4LWPA 4AX8A 5KVAA 1JTEA 2PXCA 3G5LA 3ID6C 1B42A 3IEIA 1SQFA 2NYUA 5CVDA 3VSEA 2ZFUA 4DM3A 2YUIA 1I1NA 1XCLA 3LDGA 4BY9E 4PINA 5EEGA 1KPIA 3HNRA 4BLUA 3QOXA 1D2CA 3KKZA 3FUXA 2VDUE 3I9FA 4CWAA 5ICEA 1R00A 1INLA 4FGZA 3HP7A 4IV0A 2HMYB 5HOQA 2G70A 4BLWA 1M6EX 2PX4A 4FZVA 3DTNA 4E31A 4YMHA 4RTOA 2HR1A 4FT2A 3Q7EA 4ER6A 2GA9A 3DXZA 5DSTA 3FUVA 4RSRA 5FUBA 2IH5A 3IV6A 1EQAA 2P8JA 3IYLW 4PIPA 4L7VA 1UWVA 3OZTA 5FCDA 8MHTA 1MJFA 3LBFA 5E1MA 5ICCA 4LWOA 5BW4A 5K03A 3NWBA 2R3SA 3KPWA 4ER5A 2PKWA 2PT9A 1VPTA 2PV0A 3HA7A 4RTJA 3LCUA 3EVEA 4ATNA 4FP9A 1WG8A 2GPYA 2ERCA 4P58A 1N7IA 5EZQA 1VP9A 4R6XA 3EEOA 2O0LA 1QAQA 2Z6AA 4OX9Y 3B3JA 4HRAA 1HNNA 3GDHA 3K6RA 5GWXA 1SG9A 2EFJA 3I5UA 3KQWA 3SSOA 3T7SA 4HGZA 5DX8A 4H0NA 2P3OA 3RODA 3S68A 2BM9A 4WVLA 2GS9A 5C0OE 4DA4A 3A25A 5GM1A 3UJCA 2ADMA 4GBED 1L1EA 2H1RA 3V8VA 3UFBA 4M36A 1L3BA 2PXAA 2NXCA 1ZGJA 1RI1A 2YR0A 4XUCA 5DWQA 3KR9A 2PT6A 3B3GA 4R6WA 2QE6A 1NV8A 3BZBA 3A27A 1R18A 5FWAA 5GOZA 5K05A 1EIZA 4QQKA 4QTTB 4E30A 1BHJA 1VBFA 3DXYA 3OFKA 4Z2YA 3THRA 5LQCA 2ZCJA 2C7QA 3GWZA 2IPXA 3O4FA 3FTEA 5EGSA 4EKGA 2OPBA 4PGGA 3DLIA 3EMDA 2P40A 4GOLD 5EPEA 2AOWA 4RTNA 2B2CA 2OBFA 4PYMA 5CVVA 3UJ7A 4ZTBA 3B7PA 2LD4A 3CGGA 1ZKDA 2ESRA 4PYNA 2G71A 4FSXA 5FHQA 3KQOA 1AQJA 4RTKA 2VS1A 3MB5A 1X1BA 4CKEA 4NECA 5EOVA 5EHIA 5T67A 5FQNA 3QOWA 5E9WA 2PJDA 1FBNA 3GRVA 3ANXA 1YFLA 1TPYA 4HTFA 5K0FA 2VP3A 1AV6A 2ZZMA 3PVCA 5T6BA 3X0DA 4YUXA 2XBMA 1F3LA 1JR4A 3AJDA 3FUTA 1NW7A 3ORHA 4FSDA 3AWIA 1R8XA 2XYVA 2VZ9A 4C05A 3ERCA 4QPPA 2P3LA 3TOSA 1WXXA 4UOEA 1JSXA 4M7RA 2FHPA 2OKCA 4A6DA 4E33A 3WSTA 2GB4A 3R9XB 4CKBA 3SSMA 2YXEA 3GU3A 5FA8A 1RJGA 2AVDA 3TR6A 4FR0A 4PWYA 4GOND 4RVGA 5DT2A 3PFHA 1JG4A 3PS9A 5DX1A 3MERA 1JTFA 2O57A 4GF5A 5ERGB 5DRTA 2WA1A 2XYRA 3NDIA 3OFJA 1R6AA 1FPQA 1EAMA 1JG2A 1I9GA 5C9ZA 1TW3A 3H2BA 3KQPA 2HTEA 4HH4A 5GINE 3KPVA 3EGVA 2YXLA 5DLYA 3KQMA 3UBTA 3L8DA 5HILA 4IKPA 3NWEA 1ZGAA 2DPMA 3LECA 5E2AA 4PIMA 5EVJA 3ER8A 5FADA 4RVDA 3UA4A 2IBTA 1RJFA 3FTCA 2BR5A 3U81A 5K01A 1FP2A 4DF3A 2C7OA 1XDSA 3M70A 3HTXA 5LQNA 4OA8A 2I6GA 2JHPA 3F4KA 5CCBA 2P35A 3FRIA 1PJZA 3M4XA 3SM3A 5BXYA 2ORED 4Y30A 1X1CA 4DMGA 4E2ZA 1YUBA 1ZG3A 3HA3A 3T7RA 3R24A 4YUZA 3LCVB 4DQ0A 2PVCA 5JR3A 4E70A 3UJDA 2P41A 3HVJA 3OCJA 4YUYA 4PONA 3CCFA 1TW2A 1UIRA 3OZSA 3KPJA 3OU6A 3HVHA 3VYWA 2JH9A 2NP7A 2B78A 4GC9A 5FTWA 4V0RA 4HC4A 1QANA 2QY6A 3TPZA 2O05A 3IHTA 4PCAA 3A4TA 3G2PA 3G2MA 2UYQA 4GOMD 5EHGA 5K0EA 2UYCA 2I62A 3ER9A 1EG2A 2PXXA 3E8SA 2IFTA 1P39A 2JHCA 4P7GA 5HEKA 1RI3A 2YTZA 3FTFA 3JWJA 1NKVA 3HEMA 1WS6A 5KQSA 10MHA 1D2GA 2ZVJA 2NP6A 3KQVA 4M38A 5FA5A 1U2ZA 3UJ9A 3CJQA 4EK9A 1AQIA 2IBSA 5DSXA 3I64A 2ZIFA 3SXJA 1G55A 3P97A 2GAFA 4QPNA 1L9KA 2AS0A 2BZGA 2ZIGA 3C3YA 4KDCA 5DX0A 4DCGA 4PGHA 5E8JA 1G8SA 3TKAA 1O9HA 3UJBA 1Q0TA 4KW7A 5HFJA 3CVOA 5LQJA 1FP1D 2DULA 4FS8A 3G2OA 2EX4A 2G72A 4C4AA 2EG5A 3MGGA 1PRYA 3KQQA 4IWNA 4QVGA 1G8AA 3E05A 3HCBA 4EKIA 2P1DA 1HMYA 5EZSA 3O7WA 3LPMA 4Y2HA 3FTDA 3KHKA 4BP1A 2Z6QA 4K6MA 4AZVA 4R8RA 1XDZA 2PGXA 1X1DA 3R3HA 2ZW9A 5DM4A 3EGEA 3PX2A 4YV0A 5HIKA 4XCXA 2I9KA 3MCTA 4QVKA 2OY0A 2EJTA 3DMHA 3FRHA 2AOUA 3B3FA 4PYKA 1BOOA 1N2XA 1RI4A 3GRZA 3SMQA 3G5TA 4CXMA 2NNWB 3DUWA 3P71T 3P2IA 4GUAA 5E9QA 5F2NA 4EMSA 1Z3CA 5KQRA 1D2HA 4POOA 5BW5A 4QQNA 3CJTA 1DL5A 1RI2A 2AVNA 2CKDA 2OB2A 1N7JA 3HM2A 3K0BA 4MQ4A 3NJRA 5FHRA 1YF3A 2AN5A 3LDFA 9MHTA 2PY6A 1VIDA 1SUIA 2FK7A 1WXWA 2ONZA 1KHHA 2Y1XA 2ZZKA 3MTEA 2R6ZA 3G7UA 2C7RA 1H1DA 3FPHA 2FPOA 3NDJA 4ER7A 3ELWA 4PYQA 4LG1A 2VDVE 2OZVA 5DRYA 2ZWAA 1YFJA 4PCLA 5E1OA 3UJ6A 5F2OA 5JUWA 3CC8A 2O07A 1JG3A 2AR0A 3CJRA 3KPYA 2JHAA 1KPHA 2IIPA 1R74A 3GCZA 4KIFA 4AZTA 4AZSA 1WY7A 3KQYA 1I4WA 4B17A 1ORIA 3A26A 3FPFA 4MIKA 1YZ3A 3TKYA 2UZ4A 5EEHA 5GP1A 5LQRA 3C0KA 5DXAA 4RVHA 2OYRA 2G1PA 3BKXA 3EVBA 4HG2A 1KYWA 2B9EA 1EJ6A 1P1CA 5FULA 3BT7A 1F38A 3QV2A 5FWDA 4HSGA 2CMGA 3AY0A 1XJ5A 3KU1A 1NBHA 3C3PA 4RTRA 1XDUA 3P8ZA 4E2XA 3MAGA 2JJQA 1RJDA 3M6WA 3JWHA 3RIEA 4DZRA 1NW5A 2YX1A 3G8BA 1KR5A 3GRYA 3LDUA 2OO3A 3EVFA 3M6UA 3KR0A 1SVUA 2NXEA 2WK1A 2F8LA 2KW5A 1DUSA 2IP2A 5C1IA 4RTPA 3G89A 5K0BA 3FYCA 1VL5A 2C7PA 1P1BA 3BWBA 4RTQA 5F2KA 5MHTA 4QDJA 3CKKA 4RTSA 1O9GA 1KP9A 5K0LA 1WZNA 1XXLA 2CWWA 2GH1A 2P7IA 3LGAA 3TQSA 2EJUA 1X19A 1IXKA 2IGTA 2YQZA 3HVKA 3DOUA 1QAOA 4DCMA 5HIJA 3C6KA 5M5BA 2AN3A 1Y8CA 4F84A 3GJYA 1JQEA 2PX8A 2ZBQA 2HV9A 3B5IA 5HZMA 5DPMA 3EVCA 2K4MA 4CTJA 1ZQ9A 3G8AA 3MQ2A 5FQOA 5IKMA 3KQSA 4KIGA 3M6VA 3V97A 1NW8A 2ZSUA 3P9NA 4GC5A 4X60A 3SGLA 1NW3A 4X61A 2PWYA 4E2YA 4OQDA 4EVIA 3HCAA 4GQBA 2FCAA 2YVLA 5K0CA 3HVIA 4AUKA 3ELUA 3OU7A 1P91A 4DKJA 2AOUB 3C6MA 2AN4A 2PBFA 4RWZA 5EKUA 5ICFA 4C04A 5LSAA 2AOTB 5D1NA 2HWKA 5K09A 2H11A 3OU2A 5DM1A 2AOXA 3DMGA 2VDWA 3HCDA 3HCEA 2OXTA 2A14A 2E5WA 3DP7A 3PB3A 4E32A 3EGIA 5EMJA 1G6Q1 3MCZA 4HGYA 4CTKA 2IDJA 3BXOA 2CMHA 3FPGA 4QDKA 1Q0SA 1NE2A 5DM0A 3HCFA 3EPPA 3AXSA 3DMFA 3FUUA 4P7KA 5BP7A 2BR4A 2Q41A 1G60A 4RX1A 5K8VA 2Z6UA 3G2QA 4C06A 3FUWA 3P9CA 3PX3A 3P9KA 5EMKA 2FRXA 5KYGA 1QAMA 3NMUF 3LSTA 4R05A 1X1AA 2JG3A 4EQZA 2FK8A 3O31A 4RVFA 1VP3A 3G88A 3LKDA 3UWPA 3LCCA 3ME5A 5CUQA 3UA3A 3GO4A 4F86A 3P9IA 2QYOA 1QZZA 4OA5A 3JWGA 1KPGA 3BUSA 3LL7A 3T7TA 2XYQA 4X1OA 5CIYA 1KYZA 3I53A 3BGDA 1BC5A 2ZULA 1SUSA 3M33A 2OB1A 2N47A 3P2KA 5HIIA 2AZTA 3BGIA 3TRKA 1ORHA 2UYOA 3HCCA 3A7EA 4U7TB 3PTAA 5K0NA 1VQ1A 2WA2A 3BGVA 3OZRA 3KQTA 4C03A 2Y1WA 4OQEA 4AZWA 1JSZA 4P7JA 5IH3A 4O29A 1JQ3A 7MHTA 3AXTA 3EVDA 3LX6A
chains in the Genus database with same CATH superfamily
2DC1A 4I55A 5C5IA 3AY3A 5CA0A 3WKEA 3A3YA 3FY4A 1A2OA 3JS5A 4FS3A 4ACBA 1VYUA 2OO5C 3HFJA 2JZOA 2XRFA 1FRQA 5AHKA 2R2GA 2J6HA 4I8DA 1CVLA 1MJNA 2CVHA 3QLVC 3F3KA 1BHO1 2WWWA 5AKEA 2FQQA 5G0VA 3U44B 5JPDA 3ECSA 4IHJF 2UXDB 3P9PA 3QUAA 3EFOA 4IHJA 4F4IA 5C7LO 1QP0A 1FUIA 3L6EA 4NNJA 4RANA 4RGBA 2PL5A 4PG4A 2JZCA 4MDYA 2XVAA 1SVLA 4U3JB 4GGOA 3NEPX 5CM2Z 1I3KA 5B7PA 2MYTA 5JBIA 3MNFA 1GGHA 1J0EA 2CWDA 4YUVA 3DPUA 3DEZA 4TMWA 4HGPA 3DHYA 4O1HA 4D1YA 4YAKA 4AY2A 1E8DA 3W78A 4MP6A 3UXHA 5B6IA 1NN1A 4LOAA 4YBRA 1GTZA 1QZXA 3A2NA 3U7HB 1G59A 2K2WA 1SBQA 1UXHA 2J3DA 2PZAA 5E6UB 3AHDA 1TYDE 3C85A 2CLKB 2PH1A 3ICOA 2O4UX 5LZ8A 4QASA 4ANFA 1CPYA 3PDIB 2IITA 3MT9A 5EJEA 5B3AA 1XALA 2QX9A 3STVA 5LU8A 1SZJG 4EMTA 4ER0A 5KJFA 3ZDBA 4FU0A 1TD9A 1DDIA 1JFRA 3BERA 1S1CA 4MA4A 3GXOA 3I6BA 3EPJA 4LWZA 1BVYF 1JQDA 3QIAA 5BN3A 2EX0A 1P1IA 4QQFA 4QOFA 3MLEA 4WKBA 4Y6SA 2IWRA 3VO8A 4ZHQA 5FORA 1SCIA 1BKYA 2AXEA 2VNKA 2XE4A 5I7OA 3WBJA 2A5LA 2BI4A 2GJ4A 4PYOA 3FR8A 3JWPA 4LX8A 4CG0A 3FFXA 1ILWA 3M3PA 5JALA 1GFSA 3JYHA 4KIWA 1EFCA 3KOYA 4FHZA 4HD8A 1WA5A 2RGYA 4LBYA 3O4RA 4LOLA 3FZGA 4KJZA 1P44A 2OAP1 2B3TA 2BEUA 4O2BF 1SC4A 1WDKA 5EIEA 4AJ2A 4EUNA 3DULA 5HKOA 3VUFA 4G1BA 4R83A 2R48A 2GEBA 4EY3A 4B34A 1JIJA 3VNBA 2G7ZA 5LMCA 3HZZA 2JLZA 3L4EA 2VPTA 1S2NA 5F7ZA 1VE3A 1CTQA 2JGJA 2OV8A 3QG1A 4M0UA 5E9AA 2Q1SA 3NW9A 4IQFA 2XT6A 4M1KA 1AKVA 3AHJA 4LYDA 3N05A 3HH8A 5JVDF 3N39C 4B7UA 4R1UA 3BKWA 1R8SA 2H2DA 2ID7A 1V11B 3AUTA 3CVVA 3PQ5A 1VBMA 1RWBA 1QRAA 3U1VA 3V32A 2W2LD 2HM7A 3ZU2A 5F7OA 1I13A 4MR7A 4XUDA 1Y42X 4X84A 2VPXA 2GCPA 1NT2A 1Q1AA 3GFRA 4PAQA 3WMXA 4AX8A 3OIYA 2XCTB 2XNDD 2HEGA 4P86A 2VH5R 2HK9A 4PSCA 3NATA 4F72A 2YJ5A 4DM3A 1EM6A 2CE2X 3ANNA 4LZZA 4MUMA 2WSLA 4ZDIA 2P0EA 1O6GA 4ROTA 1FFEA 4E14A 4LDAA 3M2TA 4ZAVA 3I9FA 4KOEC 2ATEA 4BU0A 3EC7A 3G0HA 1KSFX 4FFOA 2N75A 1MJHA 1DTEA 1J06A 3FPBA 3HZOA 2DXIA 4PQYA 1C7ZA 2HRDA 3VH1A 4NAVA 1X6VA 4QJ5A 1DC3A 1E9FA 4PTZA 1P8AA 3D6VA 3WS7A 5JJKA 4U4AA 2J4CA 5FUBA 2WINI 3G5UA 1EQAA 2H2IA 3LT0A 3DLPX 1UWVA 3W1EA 4O6VA 4MO9A 2HHCA 1ISPA 3REFA 5K8CA 3EIQA 3NWBA 1G2PA 2IEAA 1HYQA 3NOXA 4M1WA 1HL3A 1GFIA 3K0KA 1ZIOA 3AKCA 3KB6A 4N0PA 1ONNA 4F6RA 5DNYB 3B9PA 1GNSA 1W2WB 2Q5HA 5E3HA 1LZLA 4ZTZB 4QGHA 5IT9A 3A9WA 4H27A 4PVDA 5FV7A 3SS7X 3UGQA 3GLGE 5MGBA 1KH2A 5DFAA 3NEYA 1MQ9A 1S9HA 2QG6A 3ZVRA 3H1FA 2CLFB 1H1LA 2ZRQA 4G0VA 4G26A 4B33A 2CVQA 3UMMA 1JIQA 1PFVA 3AYXB 3ZKAA 1CIVA 3QUSA 5GM1A 5DYWA 4Z4HA 4JLWA 4RE5A 5TF4A 2Q3BA 5BQ5A 1L1EA 2BIFA 2IIVA 1WDMA 1Y34E 1IZZA 3KZMA 4MJ3A 5I9NA 3QVOA 4Q5IA 3JQQA 1VE7A 3W6ZA 1DJMA 1Y5IA 4P0PB 3LRXA 3IESA 1CDDA 1KMCA 2GCOB 3R09A 1AXGA 1X3SA 1VBFA 2ZM6B 3Q85A 2NV2B 3DE1X 2MSKA 1QMGA 1U80A 3PXXA 4R0MA 1OH5A 1YZTA 2QRGA 4YJ2A 5DM70 3BWVA 3ZWCA 3D6NB 1R5OA 4MUBA 1U0HC 4C4XA 5J2UA 2DHCA 4I46A 5DP1A 2JARA 3B6MA 3QOWA 5FUWA 3W7VA 2OBYA 4F4DA 2JBHA 1LFDB 1FBNA 5CGZA 4OMUA 2UVPA 5FBLB 5ALTA 2PD3A 5EJ4A 2ZETA 3R8CA 2B5VA 1SNYA 5J4LA 1PL6A 2AZXA 1LCIA 1O94D 1R12A 3DD1A 3KKEA 4V3BA 3EUFA 2Q5FA 3MYRA 1X7YA 2XYVA 3RFVA 4AMVA 3PT5A 4QPPA 1EX9A 1QZ3A 4HPXB 1YE8A 1U94A 2X1LA 1TM5E 2ZWPA 1SVNA 3H8VA 4YWJA 2D2EA 3NR2A 5JS2A 4B4WA 1CE8B 1H85A 2HD4A 3N8NA 4R8LA 3W2EA 3GU3A 1TF5A 1VCHA 1RJGA 3V4ZA 4UBJA 3ADDA 2HK6A 2X6QA 4ODIA 4FR0A 2QDXA 3EDOA 4X92A 3HXQA 1OFTA 3C6ZA 2KM1A 2GNOA 2W8ZA 3MERA 1VKHA 4PV7A 1V4NA 4YDHB 4AJHA 1Y7HA 4D46A 4O4HF 3UATA 4F4FA 1YQUA 3OPMA 1R0ZA 5U9CA 4BPBA 5GJBA 3I9MA 5HQTA 1G0OA 2ASVA 2W6PA 1PKXA 5E3IA 2WVAA 3DNMA 5ENZA 5AJXA 5HILA 4K05A 2CXQA 4QZVA 5EVJA 4DZZA 3V6MA 2C82A 2NPIA 5HRCA 4R9VA 3EQZA 3FTCA 3KUXA 3NP9A 5DYTA 2R96A 3HTXA 3ZW8A 4I19A 3RSLA 1C2TA 2WFAA 3GNTA 2QV0A 5KYKA 2BBWA 2BAGA 1RHJA 4EDHA 2AYZA 4KTTE 1GZSA 3IVGA 4XW2A 4BJ5A 1CYDA 4PLVA 1SVKA 4CMEC 1SKQA 3TYXA 2CDAA 2IDZA 5ALSA 1FW8A 4W5NA 3GK3A 2P41A 1Y63A 3P5BA 3W77A 1VYTA 5D3QA 3JATB 4I1OA 2XDYA 4Z7NB 5JBQA 1DWUA 1RAFA 3AETB 1DRVA 2B35A 3OU6A 1N4AA 3WDSA 3WC4A 5JASA 2CCGA 3NEAA 4V0RA 2YJZA 3LCJA 1FMFA 4JI4B 5JQGB 2O05A 2QAGB 4PZEA 4KR7A 3CMCO 1AQ6A 4DLZA 1J42A 3KU4A 1F2TA 2FB9A 4MVWA 5EWLB 2JHCA 3BTOA 1XFAA 3TXAA 3VR4D 1RKXA 1UT6A 4LY6A 4QWWA 1U0JA 1PDOA 1H8HA 1KJYA 3E1KA 2ZSKA 4NJEA 4AWXA 1LWOA 4JR2A 2FX2A 3HCPA 2J4DA 1QYIA 4BB6A 4L51A 4Y7CA 2QP3A 4NK5A 3TGLA 2RKBA 3H9QA 5FPPA 5HDBB 2O8DB 1KO1A 4MMZB 4JEHA 3KSZO 3EBPA 3P26A 4B45A 3SC3A 4BGIA 4RYDA 1SURA 1XKQA 1XA3A 2GI4A 1HK7A 2QZJA 2CVZA 2JLQA 4B76A 4D0RA 5I9TA 1EK0A 5A4FS 3OUTA 3H0CA 4UZEA 5LJLA 3D4IA 2O3RA 3GZNB 1R0XA 1RBQA 1I4EB 2PZBA 2V6MA 3BRWA 4OXIA 1A2BA 3KT6A 4J0IA 4D8TA 4B6JA 2BDTA 1ZWKA 1W2GA 2BHTA 3KHKA 4M7PA 2IQIA 4TTSA 5CGQB 3N87A 4HNAA 1QRTA 3EA5A 3I28A 2RHJA 1I0LA 4FE3A 4JLJA 2QPAA 2Z1MA 1SQSA 4I3FA 2ZW9A 3C8MA 2W6CX 3BMXA 3SN6A 3H86A 1DX9A 2BTOA 4LIPD 3OTQA 1FXSA 2VAVA 5CYGA 4CODB 1EFRD 1DQRA 4JDPA 4ACAA 5BORA 1U6JA 3HU1A 2IXTA 3L7JA 2VTVA 2Y68A 1E99A 3GJ4A 4NCIA 3RIMA 3I5XA 3ER8A 3F9CA 2OECA 5FPKA 2G1UA 1OUMA 3IO3A 1EK2A 1T9BA 4K81B 4QG7A 1JKMA 3G9UA 2HRQA 1Q3KA 2C9MA 4LQDA 1U0GA 4A8JB 2Q5CA 3SJZA 4DV4B 1Q44A 1R88A 1VHTA 3NHPA 2PY6A 1SUIA 3Q7IA 2GAIA 4CMIA 2NZ8A 2ZZKA 2QTWB 1G18A 2R6HA 5BSRA 5C8YB 1Z63A 1NMYA 4FUQA 4RK7A 1L5GB 4DJEC 3FE2A 3FPHA 3WGOA 1T29A 5EE9A 1IE3A 3RIHA 1R5BA 2W8BB 4ER7A 5K6RA 3SYTA 3DFZA 1CDZA 2VDVE 5C34B 3K09C 4NC9A 4JGGA 1XZHA 3I9V1 4TT3A 2OV3A 1QIFA 1HX7A 1AS0A 1DG1G 2FMKA 4N3BA 4GPAA 4UQOA 5KHLB 4L8VA 5KNLA 4RXMA 3H11A 1HBJA 3DXFA 1QE5A 3QP9A 2YZNA 4FIZA 2OM2A 3E9QA 4NDNE 3ZV6A 1E62A 4PQRA 4YRNA 2B9EA 1U04A 3NTOA 1DLJA 2JGMA 2VBCA 1E0JA 2JGFA 1PZHA 1UXJA 2O2JA 1HXHA 3C3XA 2CMGA 2X1MA 4O3MA 3KVNA 4DL9A 2C5BA 3RAEC 2ACWA 3CRZA 3FOBA 3U61B 4CT4B 4OHKA 3P8ZA 1G8YA 4BRZA 2Z2YA 4E2XA 1OT3A 4WKPA 3MJEA 2GLXA 5CB6A 4XXHA 1KU6A 1HA3A 1NN0A 2YX1A 2AR9A 4X7BA 4QPJC 2DWOA 4MB6A 1SXJE 1Z0FA 3PQ8A 2VSXA 1YS1X 5A6SB 1QOPB 1UMCA 5CT4A 4EVRA 4QGSA 4ALKA 2WQ7A 2GN9A 3K2EA 1NL3A 3Q7PA 1IBKB 5CBPA 5IWAB 4MV9A 1G9TA 1NW4A 1OXMA 1N7GA 2J0EA 4LYGA 5KHAA 4OYHA 2I1VB 3K53A 3LGAA 4JLSA 3E4DA 3SCZA 2PKQP 1KU0A 2P2NA 1OLUA 3AIIA 2XNCA 4A0HA 3TG2A 1IN7A 4ZYUA 1NN5A 2JAOA 2QJFA 4C7VA 1DO0A 2YWGA 1PV4A 4K40A 4MW4A 3ISTA 4J75A 4DC9A 1KWKA 1KVTA 2N1MA 1GEGA 5FTMA 1MN6A 3E8XA 3F6PA 4UUPA 1S5PA 2W2OA 4BDSA 1NYTA 4WZAA 2IZ5A 4F9TA 4XPZA 1GRCA 1LPMA 2LUOA 4ARUA 3JWEA 1RPAA 1E2LA 3R77A 1A2KC 1TI7A 4G2NA 2VAPA 1D9XA 4MGZR 1D1PA 5AW3A 1EK6A 1XHLA 5ALEA 3GAMA 3DEIA 1W0JA 1ZINA 1I0ZA 1TTHA 4OB7A 4HADA 1RZUA 3F6SA 1LU9A 2VBGA 1UPAA 4IJVA 1PJ4A 4NG5A 5ALLA 3ZWBA 3ZVNA 1HDIA 3QVLA 3ZQJA 4JFRA 2CMHA 4G23A 1KDVA 3G49A 5M3BA 3LBIA 5DM0A 2Z3WA 5CDTA 2QRLA 1YB4A 2VRBA 2YOHA 3JAKB 3NBYC 3OZUA 2D1SA 2ZT7A 3KP1A 4RX1A 1AGNA 1P72A 5KAPA 4GZLA 1LRKA 4C06A 3BMQB 1GP2A 3I9NA 5EMKA 2C4MA 3QXJA 2F4NA 1KJ8A 3MG9A 3LP8A 3ED1A 3K3PA 1L5OA 1RXEA 2E4AA 3OCWA 3EUEA 4BPRA 2AXPA 3CO0S 1Z35A 1R6UA 2PUGA 1AC5A 3LXUX 4X65B 3A04A 5ALNA 1QZZA 1VIMA 4I81A 4LJAA 4OA5A 4EJ2A 5B36A 4IJMA 1RQ2A 1SUEA 4DEYA 3PR1A 1KYZA 3SJBA 5L3SB 3DTVD 3LPLA 3H6KA 1P7ZA 1SUSA 2B8JA 4ZMSA 1YZKA 3RYFB 1BWRA 2V7WA 1E4YA 4LNAA 1GUZA 2QVGA 1ADBA 2VYCA 2YHIB 3DEKA 1Y7TA 3OOYA 1L5HA 3TDNA 1JSRA 1OIXA 5E0KB 3PWSA 2Q1TA 2XA1A 4KUEA 4P3XA 4TSFD 3V33A 2JD0A 4L85A 2RAUA 1K98A 1B43A 3VKWA 1BE8A 4O29A 1JQ3A 1M8KA 3LX6A 4MWZA 1QHEA 2G08A 3ZX5A 1GM5A 3LC7O 1N2IA 5C8VA 1RZVA 3LL4A 4GXNA 1ZCBA 1OWPA 4A1FA 5KS2A 3L3BA 1DXQA 1AU9A 5CVUA 2JJMA 1U0FA 4ZO9A 4EPTA 4CIWA 1YUMA 1SBZA 1ADFA 3V4PB 3T1HB 1KI4A 2IUFA 4HVAA 5EE0A 4JITA 3TWOA 3ORRA 3ZJVA 3DTTA 3AUFA 2DUUA 1NYQA 3TR5A 5C8YA 4DNQA 1RT9A 3EEYA 3I1JA 3A6GA 5B1SA 3F7OA 3ZHXA 3NVMB 2V98A 1C3OB 3PA6A 5CM8B 3TOXA 4FXOA 4J3NA 4BFSA 4F45A 3MGAA 3C3MA 1PX2A 1LJ8A 1OY1A 1LBQA 3OJOA 4AJEA 3V4RA 1OGJA 2X4IA 2JJ8A 4JQSA 4E5SA 3DDNA 3C8DA 4R68A 5DB4A 1FDRA 1D2NA 1EFPA 4Z4IA 5CYPA 1DUIA 4C3ZA 5B6JA 4UHJA 4O0MA 3RUCA 1Q95A 2ANBA 5AW1A 1TO6A 4UE2A 4UJ5A 5B64A 1OVMA 2DYKA 2D0IA 4OPMA 4U3JA 4EBFA 4EGCB 1I6KA 1ZZGA 3O82A 4WCVA 4ND3A 1MGOA 3ZYZA 2C5LA 3HA5A 3O8DA 1ETUA 3N75A 2HIMA 5KOJA 1W1IA 3LY9A 1TCAA 4BX2A 4CEJA 1FP7A 4U00A 4ZAZA 1N6NA 3EMBA 2OENG 3UV7A 3W5JA 1IN5A 1FEZA 2H29A 1JG1A 3H2SA 4OQXA 4WE3A 3TQRA 4WLNA 3UW1A 3R0QA 4MLDA 4TKUA 4BAUA 5C1DA 2P2ZA 2YY6A 3BRWD 3VKFA 4RSHA 2O50A 2E6UX 3JWIA 5AUQA 5J3JA 1W19A 3P9YA 1D6MA 4E7OA 2RD2A 3KOMA 3CGWA 4OKSA 5J2TB 2PSSA 3CMMA 4MPTA 3IUJA 4LYEA 1W6RA 2CZGA 4BUJA 2OSVA 3IVAA 2HK8A 4D9JA 4EITA 1MZPA 1HDRA 1F1JA 3WLEA 5IDXA 5GIPE 1VL1A 2DPYA 1C0KA 2P0YA 3PQCA 2ZTHA 3IDSA 3UJAA 1IM8A 1CLEA 1YFKA 2ZR7A 3RSSA 1V6SA 2QTCA 3SE7A 1P45A 2IP1A 2CLHB 3LLMA 2FUEA 2Y0CA 3CX4A 4MZDA 5BRJA 3N5KA 2XMRA 2G1JA 1FQOA 3B70A 3GT3A 3H5LA 5EWLA 4DCCA 3VC2A 1PS9A 5IK2A 3M3HA 1K8YB 3H3XA 4GXTA 4HJXA 5COBA 4IMJB 1JPUA 1RJWA 1EVJA 1E1LA 2JIZA 3BCSA 5HG0A 5FEUA 5IAEA 5T7BA 2P3SA 4IXWA 3KAPA 5D5QA 3GW8A 1E1MA 4DR3B 4ZTUB 3ED5A 4BBZA 2IS4A 1FFYA 1L4YA 3G02A 1FQKA 1JQKA 5CXSA 3ZD9A 2WP0A 3N2EA 3CZQA 4AJPA 3QM1A 1EFAA 4XJTA 2OUIA 4HB4A 1YS4A 2YXBA 1IRIA 1XAHA 5G0UA 4LXXA 4U7PB 4WASA 3DT9A 5IARA 5B4TA 3K70D 2R25B 1ENOA 4CGZA 3KVOA 3PNSA 1GPH1 3SU8A 3FYUB 4BHTA 3VR2A 2ZPUA 3WIUA 5I48A 1K8RA 4FNOA 4TYYA 4AJOA 2WYUA 3AW9A 4JT2A 5F9FA 5DM2A 3RWMB 3T4PA 1NE7A 4TWZA 3EVGA 3EBOA 2WI8A 1GKKA 4MVJP 3ZW7A 1OX5A 1LDMA 2UDPA 3CN9A 4I5IA 5CM9C 3T95A 3WBFA 5B4VA 4KR6A 4PSDA 4X8OA 1QQTA 1UKBA 4I1IA 3TIVA 4B81A 3IEIA 5EZYF 1O0BA 4CR6A 2VKQA 3RASA 1IG0A 1E4EA 4PX3A 4W8GA 4C05A 5BMVF 2ZFUA 4JEUA 2GZAA 1Q1BA 3VZDA 4MQEB 4L8GA 3PQ3A 2HB6A 4R3NA 4OBEA 4QHYA 4UEJA 1T0PA 1KQ3A 3CZAA 3H5AA 2VDUE 3SXUB 2E87A 5HM8A 2IOQA 3OZEA 2Y71A 4ROSA 1C1XA 1SUPA 2D2IA 4CM5A 5ITVA 4JWKA 5HNKA 3TUJC 2O5CA 1CUUA 1VI2A 5EUQB 1J9EA 2MIIA 4V2UA 4IDQA 4E31A 1NQXA 4DLVA 2ID9A 3GGGA 3I2GA 3NC1C 4LXTA 2A1TR 2ZSIA 3MD9A 4OI4A 3P94A 3IPYA 1GSAA 3IYLW 2QVZX 1OBFO 3BAFA 5IAAA 1G6KA 4BAGA 1DOAA 1M5RA 2BWJA 1CE8A 2JC3A 5CMLA 5IN4A 3SKXA 4U5XA 3I2HA 3KEOA 1V47A 2D8AA 1YAHA 2WE8A 5GMOA 1CUGA 3VKVA 1Z56C 4OTZA 5CDUA 1X1RA 2G04A 4KO2S 3OIVA 4JVSB 3D1LA 3TQTA 2PR7A 2BDEA 2PUBA 4PW0A 5IJ9A 2I8CA 3OTHA 5IFLA 2PUCA 1M8GA 3O8CA 4OQ4A 2RH4A 3SZMA 3CLSC 5AOAA 5KPDA 3L9XA 4M7WA 4U7JA 4BNIA 2PRSA 4H0FA 2GXQA 2PYDA 5CFPA 3K2QA 3CNHA 3JALA 4RPGA 3CONA 1X38A 2YHUA 5H8WA 3ACCA 1ZM4A 4IZOA 4JLAA 4M36A 4NNPA 5AVYA 4YJ2B 2FSUA 2FDCA 1QLJA 1RI1A 2QNIA 2YR0A 1G3UA 4TLBA 4GL2A 1PGNA 4RCZA 4Q3EA 5A3QA 3HHEA 5DP2A 2PSEA 4HMOA 4NZ9A 1J4AA 5KVQA 3R3YA 1LNSA 3GVIA 2P6UA 3CVJA 4CFYA 3UJPA 4O8CA 2ZCJA 1U6KA 3GMSA 2XTAA 3FMGA 1GN8A 2YYYA 4Q3DA 4D9FA 5JJCA 3U4QA 4S12A 3VC7A 3RTBA 2Q45A 1J8QA 1F8XA 2G71A 3CPHA 1PL7A 2O3SA 4LRQA 3KETA 2J4FA 5JXJA 4K9SA 1J1UA 2H92A 2YBDA 4GXQA 3PI6A 1H1LB 3NCTA 1WB5A 3KJEA 3WA6A 2QROA 3N0WA 5T6BA 3GL9A 5KNBH 4EKYA 3HR7A 3QUTA 2CLDX 1CVIA 1W6UA 2BT4A 2I99A 1H2FA 3NTLA 4QYTA 1XTBA 2KPOA 4GZ3A 3T5MA 4KO3S 3UKDA 4AUMA 5CBKA 4UOEA 4UCFA 2EFEB 2AD1A 4ZXPA 1Y1PA 1NBOA 3OKPA 4WKCA 2DTDA 4R9UC 1WAMA 1HPLA 1R6TA 1PVDA 3D4BA 4RD2A 5AM0A 5HS6A 4EVSA 1UBUS 4AI6A 3Q5GA 2QK4A 2ODAA 5FA8A 1GKLA 1BKSB 4MHOA 3HKEA 1V1RB 2EQBA 2CLLB 1Z8HA 3HJNA 3HLKA 2J33A 3KJFA 2VT7A 4RVGA 4J16A 1KBZA 1YVDA 5F64A 1DXOA 1J90A 1PZGA 2JLBA 2PGOA 1OXXK 2G17A 2R86A 1EUDA 5EYPA 2YWJA 5A4MS 2H2AA 2ZYAA 1V2GA 4S1VA 3BF8A 1G4UR 1ESZA 2ZROA 4EW3A 1EHCA 4Q7QA 3NWEA 3CB2A 1DCFA 3GAFA 3AF0A 3PE3A 2QD2A 4O4IF 2AMFA 1PW7A 1Q91A 2O2CA 2QR2A 3F3YA 2R00A 4B1FA 4DJAA 1JBKA 3KKQA 5LZ2A 1A7AA 5ITZB 1L8XA 2WHRA 3P2MA 3U7QB 1KMQA 3PXGA 3U4GA 4ND5A 1NVVQ 2QPLA 3M7IA 3QWAA 5JI3E 4JI7B 3WKBA 3VR0A 5KTSA 1CT9A 2CEKA 3DVLA 4IG4A 5IJ0A 1J97A 2EBWA 3N58A 2YXNA 3H5NA 3PC4A 5LKRA 1U63A 2H07A 3WWEA 4TVSA 4KE7A 1YRAA 1FSGA 1Q7EA 2PN1A 1H2HA 1YB6A 3PQ7A 3C45A 5AP9A 5K1ZA 1PFUA 4C2BA 1BDIA 1Z2EA 4D02A 2OAQ1 1D5WA 4LDJA 5J4VA 1O96A 1UBJS 1UIRA 3BMOA 3GQBA 4WLOA 2ES4A 1V8DA 5G2OA 2Z2IA 4J4TA 2NP7A 1O7JA 5TPZA 4HC4A 4ZQEA 3L7LA 1AK9A 1ITZA 3TPZA 4HYQA 4X20A 1XRJA 3QVTA 3CNOA 1AHHA 4DDTA 4GU5A 1W0KA 1CZRA 1EFVA 1OFIA 5BOSA 3ZVKA 5JNRA 4H4CA 3LHIA 4M4SA 3C1OA 1R4ZA 3FTFA 3LSYA 3HEMA 3W3AA 3ZXIA 2CNKA 2NVOA 1E7SA 1RDFA 1WIWA 4R1PA 4ENSA 3CEHA 3OOHA 4Q1DA 4WEQA 3OPQA 4A2PA 3R5TA 4P98A 3V7UA 2ZUFA 1Z0DA 3RVOA 2WJ4A 3RREA 1T5OA 1LW7A 3OE7A 3Q8KA 4K87A 1TQ2A 2OZLA 5H82A 4R51A 1TXGA 4TLAA 1XZJA 4R8KA 4ZVUA 5ALDA 2P6PA 1XZBA 2FPSA 3P97A 4F3YA 1II8B 4QPNA 5BN4B 1L9KA 5B37A 4EG4A 5AQEA 2L82A 4JKOA 4LMPA 1L5FA 3NDPA 2VSFA 3KOZA 4PLPA 4HGNA 5DYGA 3V55A 4CLXA 3D2CA 3CV3A 3O73A 4WXMA 3DEYX 4JFAA 1GDDA 2FX5A 5T4FA 2HH9A 3WB1A 3I2JA 3PICA 4QVGA 1PE0A 5EIHA 2WAMA 3RRYA 3U17A 1UZAA 3AL2A 2Y1DA 4WQMA 4Y1RB 3TX2A 2QPTA 2VOJA 3D0KA 4CKCB 1ADGA 3MCWA 3FDFA 4TXLA 1RAAA 4FI3C 1OD6A 3USCS 1KTIA 1YJXA 1FSFA 3E15A 4HDQB 4IW3B 5LA6F 4WNAA 3TNJA 3B1YA 4KREA 3L7YA 2XMSA 4I14A 3GJTA 3DOOA 3A6KA 1A71A 4XASA 4FR2A 4JLOA 2VLIA 1UJNA 2A1TS 2WMDA 3SD7A 4CXMA 4HB0A 3BD7A 1EGAA 5H5JA 4A0GA 2REXB 4PQEA 3A06A 1D2HA 4L6AA 3IRVA 3MRTA 2BUAA 3K1TA 1N7JA 1J9ZA 3F1LA 5FHRA 4QRIA 2W2VA 2I7VA 2E4VA 3AU8A 3EDYA 5C18A 3GMDA 4BUCA 3FVRA 3G7UA 3QKIA 4WRRA 1L4EA 5L7YA 1F0PA 1NVEA 1QGUB 4XD7A 1QS0B 3NTXA 3S2IA 5DRYA 3C14C 1UF9A 1FMCA 4FNGA 3RF6A 4PRYA 3B7GA 3S5UA 3UFXB 2ZTLA 3UJ6A 4OJYA 3QY0A 5IP5A 4ZOQI 1QYVA 4ID9A 4KIFA 2I4MA 5LYJB 2IYSA 2UZ1B 1JHUA 2KJQA 3C4JA 3HBJA 2IPNA 4LOIA 1F0YA 2UV8A 4BQEA 4F4CA 1WO8A 4M8IA 1TF2A 2UZ4A 3BXPA 4B32A 4ME6A 1EX7A 4OVKA 3IJPA 3PHIA 1C29B 5M29A 1NVMB 1O8BA 1GQOA 1VJTA 1YC2A 2WNIA 3CZ9A 1XLTC 3ZBQA 4EGJA 4F11A 1CRPA 4UNSA 1T8TA 1X42A 1LBHA 3DE2X 3HB4X 4HSGA 4ZVLA 3M82A 2GZSA 3AY0A 4IDNA 3R5SA 3D02A 2EHDA 1A98A 3QE2A 3RT1A 2FU5C 1LPOA 3QKUA 2Q29A 4DY6A 3AR9A 2X2OA 1S3SA 2GD6A 3DLTA 4GWGA 3RV3A 3K70B 1PR5A 1BQEA 1R3DA 4BVAA 1XCOA 3I6ZA 5HUQA 2XXAB 1U7WA 4QFBA 3T4XA 4C2AA 4BZPA 3GRYA 4PZ9A 3M6IA 2D62A 2Q0XA 5DYYA 5AWFC 5GAJA 3P5SA 2IJGX 4LV5B 1C50A 4LF7B 3HNPA 4M8KA 4RXTA 2QVBA 4FX5A 3QLUA 3JVEA 1HNWB 1ZJ4A 2HA0A 4JMPA 4DR4B 3B52X 1B76A 1MABB 2G9UA 2JLAA 1UR5A 4JIMA 2P7IA 4X8MA 3D0OA 4RPCA 4M0MA 3GUZA 4NJOA 2SKEA 1V26A 2Z8YA 4NQZA 3CG4A 3C98A 2A9QA 4BLSA 5JXWA 1L7QA 4MW9A 3NM4A 1L7NA 2YZMA 4NPCA 5M5BA 3R74A 4DA6A 1Z4NA 4HNHA 1YA8A 2KLHA 4JXXA 4GMDA 1PBNA 1MR3F 1ZXLA 2QAGC 4ZT6A 2AFIA 1I2MA 1BGVA 3C6YA 4BJ6A 2OV2A 5BURA 4HQKA 3E1SA 4OO3A 2P9YA 4FHCA 1BJKA 3R3XA 2R85A 1PDWA 5DK4A 3O26A 4QT4A 2Z30A 3ZHSA 1ST2A 1XCMA 5JMWA 2O0HA 3M6LA 3OLXA 3Q6MA 1VG9B 4OLHA 2J3KA 3CCCA 4A9AA 2AOTB 3MCVA 3QVGA 1PFYA 1PLKA 4ENUA 3NYWA 5BYAA 1P2UA 4WOBA 1Q3TA 2WYVA 4BXOA 1PEKE 2O19A 2GBGA 3QF7A 1F8FA 4J2OA 4OH7A 4RJ2A 1TEHA 2NSLA 5FB3A 4CDGA 3DHNA 1RRGA 3ETEA 4G8CA 4GKBA 1H8ED 3AXSA 4Y98A 3VR1A 2P9QA 1GGVA 4TKZA 3O95A 4OXQA 4AIRA 1QK4A 2QTRA 3HJGA 5BMVA 3O1JC 2BW0A 3LX4A 3P0FA 1IQRA 5TB5A 1VP3A 2CZCA 2YDXA 3U5ZB 5JFTA 4MQFA 4S2EA 2FN7A 3DWEX 2VH2A 2Y9PB 5CUQA 1OZAA 2VJOA 1EFKA 3OT1B 3AUJB 1EP3B 4QUBA 5JZBA 1AD2A 1DPGA 3U0VA 1PS0A 2R7MA 2HT6A 2R6JA 4HDCA 1ORTA 1W88A 3HU2A 2IHKA 4DMRA 2GWHA 1DHTA 3PE4A 4JLMA 7YASA 4HTAA 1QIJA 3RS0A 3KKKA 1XMSA 3RC8A 1X9GA 3TLGB 1S6YA 2P11A 3ZHRA 3JY6A 4P7JA 3T3IA 1PNQA 2VYQA 5K9ZA 4CT5A 3H5IA 2V6BA 3KWLA 4LTDA 1T4MA 3IMCA 2P2YA 3ESQA 3M34A 4CMHA 5A5FA 1Y8QA 1MO4A 3QY9A 1FFBA 4NS4A 1ZD8A 3IA2A 2CXRA 4FBMA 4XSVA 4R1SA 4FLMA 1X7WB 1K97A 3AUSA 4OP3A 4YMLA 3RYTC 3R3WA 4NZZA 3RFFA 1NJ2A 3D3NA 4GE3A 4RQAA 1UAAA 2YHSA 3A31A 1T43A 4CFZA 3ZWXA 1U3TA 2HMWA 1H2ZA 3BORA 3IBYA 4KN5A 1CR4A 1QIMA 1ZM3A 4QODA 3ODPA 4BO8A 3T1OA 3D8BA 3H5WA 1R5JA 2HU2A 3G8YA 5DGDA 2RAVA 3SC2A 3TBFA 4C7OA 4MTLA 1QO9A 1F4VA 3HZRA 1TIKA 1EA5A 2VF5X 2ZYSA 4TKVB 5FYQA 4ZV4A 3GD7A 4B8YA 1RP7A 3OEED 5FUMA 2XTMA 1YMUA 5JY6A 1WMBA 2ONYA 3OFSA 4DMUB 4KXLA 1WXEA 2ADOA 3IRUA 5CIWA 3OOEA 5EG5A 3VR2D 1W96A 3WB9A 5DGHA 3I8XA 5HRUA 4M1OA 3COZA 5C1OA 5I9LA 1NP7A 2CNDA 5C4GB 1QLHA 4GOOD 4DJFC 1G38A 1CJMA 4AKIA 2FJ0A 5ENVA 3SEAA 1WP9A 5EJ2A 1XU4A 2ZBRA 1CC1S 1UC5B 1COWA 3SIWA 4BFWA 1JDJA 2Y27A 4LOJA 1T2FA 1A7UA 2PR2A 1BQ3A 2OP0A 4HZUA 4NDAA 2ZUBA 3U3XA 3E7PA 2OR3A 1CQZA 3CN7A 4RA6B 4XYMA 5FI0B 3HWRA 3HB9A 2Y0EA 1XK7A 3GGOA 3I58A 3ND5A 3NTVA 1CP3A 4TKMA 4YASA 5SICE 3RV4A 2A5JA 3WLPA 3FLEA 1VJRA 3BL6A 3H4MA 5HIMA 1K6XA 5YASA 1YR6A 2VAMA 2ZUWA 1WW3A 3UYLA 1NSFA 4JR1A 3MBKA 1VJCA 4IEIA 2XQKA 4BEBA 1JDTA 1V39A 1XP5A 3H4VA 5IJZA 2B2XA 3QPUA 2R7LA 3WL4A 5AW0A 1WQ3A 4ZOLA 5ADUS 5I7FA 1O0CA 3G2JA 1XPRA 2RG7A 4JIGA 4DDVA 3LQYA 4PG6A 5FBWB 3S44A 5CB8A 3HDQA 3VSDA 4BRWA 1Z7WA 3M1LA 4EG3A 1UKZA 2Z95A 1Y9JA 1IZ9A 4BLWA 3IE2A 1PR9A 3AFHA 3NHRA 4RS4A 2V59A 2QVCA 2BGRA 4YV7A 4LECA 2JVKA 3ICVA 3MMXA 2FYTA 2UUAB 2ATCA 1QK5A 4TSRA 4DY4A 1GGFA 4FBLA 1US8B 2E4YA 3IULA 4G1VA 1NU8A 3EZNA 2P78A 3F5SA 3FKSD 3PHBE 1LPAB 2CLIB 4FHFA 5BUSA 3ZLTA 1JEYB 3HEBA 1EGHA 2I7CA 3WK8A 4C30A 3OT4A 5KJ6A 4GP9A 3T3DA 4KAAA 5IHXA 2G6TA 4ZO8A 1VMAA 4ER3A 1KJZA 4MVJG 2YZ7A 1YMQA 2AI2A 3CBGA 2IVFA 4FDVA 1M34B 4R2XA 4LXQA 5FI1B 4BQPA 3AIMA 3AKZA 4N01A 5DBHX 4MB2A 2JGDB 1C0LA 3GFOA 4PX2A 2I4TA 1N9GB 3U3DA 1IZ7A 3IUPA 5EC8A 2QD4A 3UVEA 1JKFA 4LSGA 3UKOA 3MBIA 5FUXA 4QGFA 5KTKA 3BA6A 1IN4A 3I32A 4KIUA 2VDWB 2IS2A 3OJEA 3FCEA 2W93A 4GLLA 5AHXA 4KVZA 4BIMA 3EG9B 4KSBA 2UZ3A 2X2PA 2IPMA 2Z8ZA 2CC2A 4PLCA 3I5AA 1LD3A 1T5BA 1CY2A 1FTQA 3I2FA 3A2LA 1KETA 3LBHA 2WUVA 4N9QA 1N0HA 3OJWA 4N9WA 4QNMA 5DNCA 5HHTA 2BFCA 1U5CA 2V54A 3ETLA 2ZKIA 4GECA 2ZS9A 3OT1A 4QEKA 5E7IA 3RRXA 1GUAA 3SNHA 3AL0C 2XNDA 2FGJA 1OZFA 1VLZA 1YZFA 2C98A 3LWZA 2YNMA 3DL0A 3TZKA 1UIMA 2GVZC 2TRSB 2ZE8A 3F5MA 4JUIA 4B8ZA 4BKPA 1DWPA 1A5AB 4KNVA 5A5VA 2WSYB 2QENA 2H57A 1JNXX 2PBRA 1HFWA 2HR1A 3COYA 4BMPB 1L4GA 3BIOA 3G0OA 1Z06A 1SHKA 4HPWA 1KKMA 4IWXA 1S2DA 1SIWA 1O5OA 2FPXA 1ISGA 2MHCA 3I0ZA 4LZLA 5AHRA 2V7TA 5A3JA 5K3EA 3SBDA 4HQOA 4C3VA 1NU6A 1XG5A 3EAGA 4QXMA 3VBEA 5K03A 4RQBA 4C20A 4C2TA 1RKBA 2ZIUB 4HYYA 4D5EA 4ZHSA 2NUBA 4LHEA 5KJEA 4B4KA 2YV5A 4RF3A 4AMZA 2ZAMA 1E2FA 3EEOA 2X3FA 4X1YA 3RHFA 1FRVA 3I3OA 4JEIA 1V6CA 4E22A 3K05A 1Z6YA 4IDCA 4YT8A 5L7TA 1BD3A 1P31A 5C1PA 4DIUA 3RODA 2M32A 4KX3A 3IT2A 3CVUA 3HDJA 2A4MA 3KJHA 2HF8A 3NC0C 3A3OA 2PUVA 3R0ZA 4DMLA 1V8PA 3WBBA 2W58A 3GRKA 4PIVA 3IQFA 4F06A 1U4OA 4O2BA 4Q4DA 5IDWA 4Y3UA 3L1JA 3N7TA 3QTBA 1LBIA 1I3OA 2XOXA 4OHXA 3TK1A 5GVRA 4HNTA 1TK9A 2NUPA 2WNSA 3KXIA 4PZPA 1JDPA 1NVDA 1JIVA 1TF7A 1Z0KA 3GV0A 4S2UA 3THRA 1D0SA 2E5FA 1KFBB 2IPXA 1QHNA 2ZOSA 3T52A 3UB4A 1J21A 4UXJA 5I3CA 3EF3A 2XEXA 4KSYA 4GOLD 5EPEA 1GD1O 2J9FB 2AOWA 3CR3C 3GB9A 3I42A 3JCZA 2FV8A 1C0EA 1E3DA 1T5IA 4UVHA 3UJ7A 4ZO6A 4ND4A 4EGFA 3G8CA 1WSWA 1JE1A 3BXEA 3PHGA 4AULA 3L82B 1II0A 4HI0E 2FZGA 3O4VA 5IX8A 5DNVA 4BGUA 1SC9A 1HDCA 5REQA 1RKVA 1S89A 1WF3A 1UJMA 1ZM7A 2XGOA 3AHFA 4L4SA 3AERA 2AMJA 1JIIA 2XRZA 2ZTVA 1BX1A 1XNQB 2WNHA 2N42A 3CPSA 2QSUA 2VP3A 3GOQA 1P77A 4JI8B 1ZBQA 1IK4A 3THYB 5IH7A 5G41A 4WADA 3KC2A 2WLTA 4NYIQ 1ZK4A 3CLRD 2F1HA 1JU9A 1R0RE 2QLFA 3DKRA 2D5LA 5GJVC 3T5TA 2QA5A 3EZ6A 2IY8A 2EKBA 2WE7A 1A3CA 5LBUA 2EDCA 1UBLS 2WG2A 3A1FA 3OWHA 4N65A 4URHA 4R1QA 3WJ1A 2ZTMA 1UXKA 2B98A 2BCGY 3O1IC 3VPCA 4UAUA 5KWJA 2QZSA 3U1BA 3GBPA 4D8VA 1G8HA 1RCTE 1OTYA 2Q27A 3CBQA 3PYLA 3PRHA 4RLQA 4HNSA 1AKEA 3Q10A 2I6TA 2XGMA 1FFGA 2QLMA 2W6IA 3GFGA 1P6QA 3LUJA 5ESXA 1YS7A 2BM0A 2R68A 4K0RA 1VSVA 3GHYA 1XFDA 4CTNA 3G85A 3UUWA 4HY3A 1VKNA 4Y6LA 4HJRA 3I04A 5KOJB 2QYTA 1I9GA 4DR6B 5IC4A 5L45A 1EWRA 4R1NA 2XUDA 5JNVA 3STTA 2MSNA 5KNBA 2K6GA 2POCA 3E8MA 3QEOA 4UATA 3OF3A 4MJ7A 3HCRA 1ML4A 2BBSA 3RS8A 1SD5A 3KJIA 4YJ3B 3S2SA 4CLRB 3DTVB 3N2GB 3O3MB 4DM4A 3NHSA 4U0JA 5CFMA 1KEEA 2VRCD 3EG9A 3LYLA 2CNWD 1KJIA 3OM0A 3U81A 3OMXA 1JLLB 3IP9A 4URUR 1MXHA 1CR1A 1VC2A 1U8AA 1FSSA 4ND6A 5CCBA 1OJ7A 1B8NA 1CY7A 1KBQA 2BP7B 2IYNA 1KO8A 2IEGA 4I55F 4I3GA 4K7JA 4QARA 5K2MA 3DWFA 3W6NA 5J5CA 4E2ZA 2FJUA 5FTNA 5AVWA 3E3NA 2WW8A 1E2EA 2W6NA 2FE4A 3I6YA 4WA7A 5KYWB 3ZYCA 4ND7A 3CSSA 4DQ0A 4JI1B 2HA3A 4CETA 1GDTA 4E70A 5BSMA 2HPZA 1HOXA 3LF1A 3C43A 1P2FA 3DZJA 3NXKA 4QOIA 5DYNA 1JR2A 4BYGA 3B6IA 1F2UA 2WSBA 4QWMA 2OYCA 2GXAA 5LMNB 2QUAA 1PS8A 4G0UA 2V3CC 3Q1KA 1TTTA 1Z28A 2EJCA 3E5NA 3GVXA 4OI2A 2WSSD 2QYHA 1RTTA 2HZBA 4UASA 4ZCQA 3W2GA 4EHJA 2GKSA 5B12A 2R66A 3S2YA 4TSFA 3HJUA 4XIGS 5A05A 2YTZA 4BNUA 4CKYA 4N0EA 1YQQA 1EB8A 2JB9A 2WJIA 4XX0B 4KQIA 2Q5JA 2V7PA 3LF2A 5AM4A 1K5HA 2GFQA 4RQTA 2F9MA 2DWQA 4A8TA 1RYMA 4MHSA 1Q1ZA 4KWEA 4LF5B 2A94A 3CJQA 1C8LA 3I62A 2J3QA 5GZ6A 2Q3HA 1X7ZA 4UTOA 2C2BA 3CEAA 3VPFA 2I1WA 3LHFA 1CJKC 4LGMA 2VUUA 3LWDA 1E20A 1NBME 2D3TA 5A9SA 4ZAXA 2VZ0A 3CRNA 3EY4A 4W82A 2C57A 5KC8A 3GEMA 1MFPA 4QTXA 3K1JA 3B9QA 4RZ2A 3PEYA 2XUHA 4ENWA 3HB1A 3FTQA 2VXBA 4OMDA 5AIBA 1ECGA 4L9WA 5FOSA 4BNYA 1JYSA 4EKIA 3WGMA 5I9MA 2C3MA 1LVHA 1JVNA 4KR3A 1XU7A 3BQMB 4GUDA 4I4CA 3IKJA 1YIOA 4QFDA 2J5XA 1T9CA 1X1DA 3I9V6 2QUIA 3AF1A 3AEYA 3KDPA 1MJGA 1YQ9A 3NGLA 5KTPA 3W5IA 1LDEA 4YP9A 1W75A 2ISCA 4LV8B 3RAPR 4UTVA 1M5UA 4N18A 3RRJA 2IXBA 3P71T 3FW1A 5JDCC 1H6BA 1AF4A 2Z3VA 3LOQA 4GZ6A 3WXMA 4POOA 2OK8A 3GLHE 3HM2A 2BGWA 4M9UA 2X4DA 3SC2B 4C7OB 4MQ4A 3VYTB 4UDXX 5TRTA 3MTEA 1DQYA 2BFBA 2BJVA 1SXPA 3QQPA 1Z4JA 5EXEA 3RJZA 1C1DA 3UAYA 1F5NA 4ZZIA 5B5SA 5L4LA 1OLUB 4K9NA 4YJKA 1VXOA 4RHTA 3BGSA 3W9BA 5JD6A 5D00A 5FBRB 1I10A 3CXRA 3NOVA 1G5IA 2N1BA 3CZ4A 1C7FA 3H2JA 4Z49A 5DLPA 4ZGBA 1X2EA 3F6CA 3L2OB 4YREA 2PZ8A 1L5VA 4DIFA 1XMOB 5EJ9A 1Y1QA 3KQYA 2JH3A 3RBAA 3RTAA 3WLSA 4ZVTA 1R0LA 4EP1A 1U9CA 5IDVA 2DERA 3GJ7A 3F90A 4PZZA 4XD2A 3QQ5A 4KDEA 2EYQA 1QZTA 5LQRA 3RRZA 4IEFB 1IB0A 3W4KA 4HUTA 4BVJA 3QBTA 4JY7A 3V8MA 3KWMA 1EJ6A 1TKCA 1IWPB 3U9SA 1IIBA 3EMKA 1V96A 1EIWA 1HT1E 5CURA 2VEDA 5DNWA 5H83A 4URVR 1JT2A 4DDHA 2G40A 3C16C 4RTRA 4BBJA 4Z4GA 2NOAA 1CQJA 1Z6GA 5L4SA 1TECE 3DL2A 4V1CA 2HFJA 4IIXA 4TOIA 2G07A 5FL3A 1KR5A 1RP1A 1NWHA 3R23A 4HDKA 4UARA 5JLJA 3RQSA 3KOOA 1ZN8A 3ON5A 3WJAA 4F7WA 2NTJA 1ZICA 1U1GA 4WKGA 2OV6A 2X0DA 4HB2A 3H6GA 3RCBA 1JECA 3DBHB 2DX7A 4B74A 3C5CA 3TVYA 3I9KA 2QN9A 4CM3A 3G13A 4P4SB 1E5VA 3B9RA 1RXVA 3TL6A 1EKXA 5ALXA 3NAZA 1PYGA 2JFFA 3HVKA 1L7BA 4XOUA 3F71A 2LKDA 3LOUA 4C78A 4DBLC 1BAPA 2PX8A 3B5IA 5AVTA 5G40A 1ECFA 1O6CA 1H5NA 2VDPB 3MN1A 4IOKA 4KIGA 1GPLA 3EUWA 3P9NA 4IVQA 3TSYA 4DEVA 2AJTA 3H18A 2FWBA 3NO4A 3HCAA 3EYAA 2YJTD 4L0CA 5AKJA 3V8BA 3T5PA 2E0IA 3K4PA 1FS6A 3ELUA 3FZYA 4ARCA 3KAJA 1GA6A 3P4UA 1EGQA 4OJMX 5EJFA 1H1TA 4DXDA 4IFBA 4ONEA 4WESB 4ENTA 3RGWS 2PTHA 1TIPA 2E4UA 1NXSA 1O58A 2QDKA 3PUZA 5FA6A 1Y80A 2X2EA 1Y1LA 3F74A 5C2JB 4YDSA 1K4YA 3MFQA 5JYDA 2B1QA 2F8TA 4Z86A 1IHDA 4ZT4A 3MAJA 3BXOA 3JTMA 4KWTA 3RC9A 5TMEA 3GFVA 3NRBA 3H87A 4E6PA 4EF5A 2B34A 3VJLA 3OFVA 3U3KA 4GS5A 2H1SA 4IMIB 4E13A 3WMWA 2MU1A 3FUWA 8OHMA 3NBAA 1WZCA 2OORA 3MPOA 3GAZA 2FGKA 3DF9A 4CYMA 3VNQA 5ALPA 3W1WA 1SVOA 1V3VA 2COUA 4B4UA 1GNLA 3NTRA 4P82A 2WY2D 2I29A 4BNTA 3VSCA 1KZYC 4IZIA 1LLDA 3SXUA 2WJHA 1OKKD 1TFUA 2B4AA 5IKOA 3L7OA 4FFLA 1JEAA 3D8NA 3G3EA 2BMEA 5BV7A 3LQKA 1T4CA 1IWBB 2LRHA 5JZMA 1W36D 3O2NA 3G59A 2IZOA 3VKHA 1S8OA 1RE0A 5AVKA 3V8RA 3GLIA 1VQ1A 3ESRA 5ED4A 3KQTA 1PJQA 1Z34A 5LWQA 3LQ2A 1N2GA 2VJYA 1N5OX 4QAJA 4XLTA 4CQNA 1NVAA 1RLOA 1F2TB 1XX6A 2VNSA 3AJRA 3EOAI 3ESYA 3K1AA 1CB0A 1KO5A 2PS9A 2ZUEA 4WCFA 4QL3A 2ZJZA 4XJSA 3QBJA 3OZAA 2QM7A 3NGXA 3NHLA 3PFGA 1JLRA 2YYAA 1H2WA 1RWPA 1KQOA 1U9JA 5TC4A 3W9YA 4UOZA 4HCJA 4TV9F 2W11A 4KXXA 3DEJA 4G97A 4IX9A 1Y37A 4F3KA 4JC4A 3ZE2B 1GPAA 5K3FB 1SR8A 3FCAA 4TWBA 3R5FA 1QYRA 2DT8A 4U2KA 3L6UA 4FDLA 2HSEA 2F90A 1E9VA 3WLJA 1PGOA 1LY1A 2P3QA 4WGGA 5DCLA 3G2HA 2VPPA 4MI6A 3THXA 4FT4A 3K0AA 3EE6A 1QGED 3TMAA 2JIBA 2IGBA 2WF8A 1GTVA 2R4QA 4OXXA 3WGKA 4BLTA 3EASA 4CMCA 1COWD 1BX0A 2JGEA 5JRZA 1HRDA 2NTNA 4F8JA 3FOZA 4Q4AB 5KU1A 3B6EA 3URMA 2MINB 4L3VA 1UM9B 5HR5A 4IUCS 3H3FA 2X0IA 5I8PA 4W1PA 1X39A 5JV5A 3GLQA 4MRMA 5A7GA 3SR3A 3BSSA 1TZ2A 3ORSA 5IBQA 1VBNA 3DR5A 2WUFA 3PK0A 4KNYA 2EOAA 3VPGA 2BFWA 4BTEA 4CEJB 3E53A 4LVNA 4LF8B 2XMBA 1T8UA 4QE3A 3WK9A 2PUTA 2CFCA 4FFNA 4PG7A 1GCAA 4OQZA 2WEKA 2V8OA 5AW5A 3O8NA 3KD2A 3WGVA 3EHEA 2CMFA 3TX6A 4TTAA 1IHOA 4WT7A 1XNRB 4X85A 2CL7X 4B85A 2H18A 4BQIA 3DXXA 1EFPB 4RDCA 1G20B 1OI7A 4NCJA 1W30A 1X3LA 1JP7A 2QOEA 4J1TA 4PO3X 4Y6RA 4BE4A 3GLRA 4FOSA 3SQLA 4CM9A 1XUOA 3F47A 4DA8A 4C07A 1T4CB 4R2MA 2P9TA 2QM3A 1U99A 3H8WA 4PC1A 5D85A 4F1JA 3AHGA 5BOSB 4UHDA 4YRSA 2PGDA 2I4IA 3GPCA 3LPNA 1Z4KA 4QUAA 3EQ6A 4P35A 3NNSA 4YCJA 5GONF 3RW9A 1OZGA 3AM5A 5BY2A 2PJZA 3CLTD 3V8NA 3L0BA 3OQNA 3F4LA 4EPRA 3GLTA 4KKXB 4K9RA 2GPSA 1P0CA 1HSOA 1WHSB 3L8FA 4ZT7A 1Y5MA 1Q50A 3VHQA 1Z17A 3OMWA 3Q88A 5AI5A 4JC8A 1QHGA 4KDRA 4CT0A 5E2BA 4N8DA 1XTVA 2PHZA 3FG9A 4NESA 4COOA 3QU9A 3PKJA 4U9UA 1SKAA 1XD9A 3ZDDA 2W98A 2W7TA 2DG2A 3HGMA 4FZ3A 1HT0A 2FMXA 4BATA 1AQUA 2ICAA 5ISMA 4LVCA 1BROA 1YRWA 1LI4A 3EGXA 4RD3A 4TYNA 4LF4B 1X9IA 1YONA 3JSXA 2NNLD 4DLTA 3RYFA 1PNTA 4C0HA 1JL3A 1KEUA 1T2CA 4IH9A 1TQDA 2WTMA 4FHGA 4C89A 2WTNA 3MRVA 4Y8VA 4YRJA 1SD2A 1KR2A 2DFLA 1ZO8A 4BUZA 1OTXA 2HPVA 2CVOA 3HNRA 3KS9A 2CXSA 3L6DA 5KAMA 5BQXA 4JJ6A 4Z99A 4CF5A 4RULA 1RRCA 3HFRA 4LYAA 3EIWA 3GBVA 1EUDB 2B21A 4YACA 4A16A 3WE7A 4FGZA 3ZHVA 3O8RA 3MWEA 4AROA 1QYWA 4FZVA 1GNQA 1UBFA 3DFKA 4MI1A 4BZXA 1PWZA 4YCSA 3B20A 5J4YA 3IB3A 2IZ6A 2YJ6A 3N0RA 4Q7LA 2W70A 2IH5A 1NXVA 1WOMA 1NNLA 5HF8A 3NLLA 2PYZA 3ZS9A 4C7JA 1MIOA 5B3JC 1Q6ZA 1ZN7A 2EV9A 2J7PD 4Y9UA 3S7ZA 4FDUA 3WMGA 4M1YA 2EJWA 5CLFA 3PC2A 2RIRA 2QRJA 5JT1A 3G1UA 2MSCB 2PKWA 1PG5A 3A1TA 2GK3A 3BH0A 3HA7A 3OQJA 2CCKA 1E1DA 2P5TB 3IBSA 2Q2OA 4HXEB 3V9AA 1NVGA 1UJ2A 2PZEA 3NWJA 4Q3OA 1IRXA 4FMPA 1QPBA 5CNMA 1Z0UA 3PFBA 3ZKWA 1I33A 4DDWA 1HNNA 1K08A 3K92A 1JJFA 3AUKA 4FTWA 5DBIA 5EKDA 2R8OA 4JC0A 3U26A 1ZRNA 3II6X 5KOIA 1U9ZA 1ZOSA 2DY0A 4K28A 4KFSA 3A25A 3HFSA 2OFXA 3FOCA 4K9OA 3WWCA 3PD1A 1ODCA 4GBED 3V8VA 5BSEA 1ZUD1 2PXAA 3EQ2A 2PUAA 1N2ZA 3CZ5A 2ZSHA 4MR7B 5AKLA 5G4KB 1OJLA 3OPYA 1NV8A 2CB9A 4IKOA 3O4HA 2NZUG 3NV9A 1HC7A 3G82C 4ZFNA 4AFNA 5CBPB 3U60B 3FSGA 1XZAA 4XYGA 1EPUA 1PLLA 5JAIA 4ZQFA 2X58A 3DHEA 3GC6A 3H0KA 4O4JB 4S04A 4RK6A 1UMCB 3NNNA 4LZJA 2YIDA 4IX1A 2V7XA 1YHZA 3EGWA 1G3IA 1N77A 4UNIA 1MAHA 3MCUA 1YBFA 5F5NA 4B71A 4KITB 4HGOA 1IATA 4QAQA 5CHEA 4EY4A 4RD0A 1D6JA 1W4BA 2V58A 2ZIXB 2XHZA 2Q46A 4IV5A 4DTCA 1DBQA 4E5VA 1XVVA 1ZM9A 3D54D 1EWQA 4DJ5X 2R6R1 2ZE6A 2FRVA 1MNAA 3CT4A 2OD9A 4JP1A 5TQ0B 2O5EA 5ALJA 4HV4A 1N6LA 1HETA 1RFGE 1SVSA 1ZW6A 4HFJA 4TQUS 1SXIA 1ZBDA 2VG8A 1R8XA 2BONA 3RS4A 5HM6A 1KEZA 4XFKA 2NZWA 1BWSA 2MYUA 4DV0B 2RBEA 2RHRA 1Q0UA 1TRKA 3FVQA 4TMFA 4HNUA 2HL6A 5T4HA 3WSTA 1M73E 2IS1A 4M1SA 2GZHA 1IQ0A 2VATA 2FF5A 3OQBA 3VV3A 5CLHA 1HUQA 1TD1A 4YRFA 1G8MA 2PL1A 3RVJA 3UWOA 1SCJA 1E1CB 1CQXA 3W8FA 1THGA 4BNWA 4X44A 5B53A 5KI6A 1NULA 1TQHA 2W48A 3PFHA 4N54A 2WHEA 1JTFA 1K27A 3ROPA 3DGEC 4DPKA 3D6MA 5DRTA 3VZPA 1XXHB 2UUCB 1X77A 5J43A 1CW2B 5AM5A 3FMOB 1TU3A 1WSAA 4UVDA 4F93B 1A96A 1N1EA 2IZ0A 2ST1A 3EEQA 3LVFO 3CE6A 4J7AA 1UDRA 4P0TA 3GJ8A 3AR8A 4A0RA 1ESDA 1UPUA 3K2IA 1EAYA 2WHXA 3L0PA 3PL1A 3U4IA 4P5EA 4EKNB 2J5RA 2BR5A 2IV7A 4Q48A 3E18A 3KAQA 4DF3A 3G17A 4I1YA 1Z6ZA 1V8ZA 1N3YA 1THMA 2C96A 4OA8A 3WMEA 4I4TB 2XCRB 2J07A 1T3GA 5EGNA 2J0SA 2SKCA 7GPBA 2BGTA 1JDUA 2EARA 4IICA 1ID1A 1UINA 3FYUC 1VI6A 4HEQA 4JYMA 3LCVB 4RZXA 4UU0A 3OD1A 1C41A 1T5TA 2BKLA 4RZSA 1Z6TA 3D31A 4ZZ0A 1DKQA 2W42A 2R5NA 3FWYA 1RWVA 1VE5A 3HDTA 2EF1A 4ZC1A 1AHPA 2FEKA 1PNOA 1GGNA 3OZSA 1GRNA 4JQZA 5LZ4A 4ZHQF 2JH9A 4ZVVA 5K0EA 4GC9A 4G4SO 3TMKA 4R9NA 3JQGB 2WZQA 4DIDA 4EHLA 3TW0A 1PEYA 1A7KA 1WDLA 2IEZA 1MTZA 4A1OA 2H8KA 4J8PA 5AYVA 2WF5A 2NACA 1EQ2A 2C4WA 2BUCA 2DKFA 3CLKA 4HQ0A 1Q0ZA 1C7JA 2R4UA 1ODTC 3C74A 5LU9A 3ZEIA 1EP2B 3JQPA 2WIBA 3QKSB 3EF0A 3RT7A 5LXTA 4GP6A 3FHTA 2NXWA 2BKXA 2DM6A 2AXNA 3G2NA 3WSVA 2GNPA 3DAOA 3K73O 3HL0A 1N6RA 4RIIA 3FGPA 4WK0B 2WICA 1HQCA 5HP4A 1EWTA 1G55A 4FD3A 2QM8A 1H5QA 4DRXB 3JQRA 1NIPA 2I3ZA 5B7GA 2LIPA 3R3JA 4IIJB 4ZRNA 1VDZA 5ULLA 2FZKA 3B85A 4F3RA 4DYDA 4KBFA 4N5IX 2A9VA 2YW2A 4C4AA 2WIKA 1GRRA 4Q66C 4YJHB 2I3BA 2J30A 1G8AA 1NQTA 4G5XA 1HMYA 1XK6A 5BV8A 1QVZA 4QUHA 3IGFA 2I7TA 2QPOA 2VHJA 2ZIWB 3FCCA 1XZMA 3IQDB 5ECWA 5H59A 4BBAA 1HFKA 4DLUA 3I2YX 3GEIA 4WXEA 3ANYB 4HOYA 3Q72A 3HWWA 1ONPA 2EW8A 1ZH8A 2R1TA 2I9KA 2XODA 3PRYA 5FPHA 4ESVA 4OUKX 2O2YA 2WKQA 4P3OA 4YP1A 3RU7A 4I8XA 2GERA 1YSCA 2NNWB 2OO5A 1FFAA 2DMRA 2RHCA 3P2IA 5C5CA 5F2NA 3SQWA 2P9GA 4ND8A 1PWEA 2AZDA 2C2KA 4OHPA 3K0BA 6CHYA 1XT6A 2PAFA 1CF4A 1N0VC 1TU4A 4I4IA 2MSWA 1WXWA 4ZAYA 1I2AA 4RPJA 5LA6B 1IQUA 4UCQA 1J2YA 1WXDA 4IMRA 2FZCA 1S4MA 3PFKA 2C0CA 2FEAA 4MQLA 4UUMA 2OZVA 4M60A 5K0ZA 4WK2B 1XR3A 2A5DA 4PCLA 1BDMA 2ODQA 2O07A 3CX7A 4NYIR 3GCZA 4IXMA 4A0SA 4JQCA 4AZSA 5LWHA 3ESCA 1VGVA 1QQAA 1CQIB 2EEZA 2AEMA 4K8RB 2AE1A 1AO0A 4ZICA 1Y82A 3LYUA 1NPYA 1PT5A 1ONBA 1U8CB 5TXGA 2GK6A 5IBCA 1ESEA 2D59A 2HSZA 5DN6A 1CU1A 1F38A 2VCYA 4EG1A 4G5RA 5E7MA 1KYQA 1NUQA 4PHCA 3TRJA 2YWXA 3QLUC 5L3SA 4E5PA 1G16A 3EG5A 1UL1X 5LIRA 3R76A 3G68A 1NX9A 1OWMA 2OEPA 1NVKA 2ORIA 4JLUA 5K8UA 5HMLA 5H3LA 1DAFA 3HRKA 3NOQA 4DZRA 1Y4AE 3VPDA 1JEQA 3QLTA 4K0KB 3NYIA 4BQQA 3QG5A 1HWYA 2HOQA 2JI4A 3G8BA 4LS3A 3T9DA 5IAOA 3VA7A 1I6MA 3AV3A 2FEWB 2F4VB 2I4LA 1WD7A 5DKFA 3ZV7A 3HY3A 4DARA 4QHSA 5THQA 3MS2A 2SHKA 5C1IA 5K0BA 3QK7A 3BWBA 1WZEA 2VR1A 2BFDA 1I36A 4IXNA 2ZRLA 3IUQA 3B3AA 2JK0A 3EZXA 4JGIA 5CYOA 4CEHB 1TAUA 4M9ZA 3SZRA 1L5YA 3RD5A 3DCIA 4AT1A 2AG8A 2VRCA 4B87A 4HLDA 4MYCA 1NSTA 4GHWA 4NARA 3LPAA 3QUBA 2YRXA 1VL2A 1B0UA 2C4HA 5CG1A 2K4MA 2VWPA 3TLMA 3OP4A 3DS8A 3ZHUA 4B3TB 4Z3DA 2L0XA 3NBUA 3UMSA 1FU8A 3INNA 4NJMA 2EKPA 1EM8A 2C42A 5JBNA 4CF7A 5K8IA 1ZGGA 2F43B 4MWOA 4KQCA 1U9YA 2B94A 1G6OA 2QD3A 2QRQA 3DOCA 4RZHA 2L69A 3H17A 3F67A 3GN1A 3V5NA 3PQDA 2PQ6A 2RH9B 2MR6A 2WG0A 5DBOA 4FOTA 5GJWC 5JG7A 1P1HA 5AVVA 2NW6A 3OU2A 2WWIA 2DF8A 4KAJA 2VDWA 1E2NA 4MAMA 2ASEA 4TUYA 5JNSA 1WE2A 1W34A 2P69A 1G6Q1 3DKPA 1NM5A 3E7WA 4QUIA 4Y6QA 3ZCRA 4UTRA 1AG9A 1T26A 2PM8A 3TAHA 4ZJUA 5JSYA 1ZCAA 4BLRA 1P4HA 3B6KA 3HKCB 4WL0A 3OFND 1M34A 4GVXA 1UH5A 4H7PA 4H16A 2V4MA 4PTLA 1IM2A 5K3BA 2FK8A 3H1PA 3MWEB 5AI0A 3T4UA 3GH1A 4D6XA 3G9QA 4NL4H 1TZJA 3P9IA 2WMYA 5F1KA 4DT1A 4MARA 2IU4A 4OMFG 4TMYA 2A9KA 4B5LA 4KE8A 3KTDA 2PFKA 3NHAA 4MW0A 5A2QA 2I78A 4GYJA 2ZULA 3KXLA 1WHTB 4Y9DA 5HIIA 3ITKA 2HDHA 1C9KA 4U7TB 4OK5A 4XWTA 2YMPA 4PZCA 1J20A 1XVUA 2VHWA 4URWR 3IUYA 3TIXB 4C03A 1SFRA 3A3PA 2PA0A 4AZWA 1XZIA 3H11B 1M2KA 2JDIA 3DWGA 1Z4LA 1SAYA 3HBLA 2BSQA 2D0DA 1RXSA 4IJUA 5LQKA 3KCNA 821PA 2VJKA 2ZRCA 1I7PA 1K0FA 3ACBA 1D2MA 1QC5B 3ESDA 3BDVA 4P83A 4PFJA 4RJKA 5IJXA 3PLRA 5EZYA 3O3OB 3I92A 5E8RA 3HADA 4U8HA 1GAEO 1NG1A 2YXDA 5ICGA 1J0XO 2QXYA 1A8IA 2JAWA 4ZEWA 2ATVA 4BKRA 4CIBA 1HEUA 2JAPA 2Q5IA 3JQ9C 3GHHA 4B3GA 3KWJA 1JPNA 4B40A 1HNZB 2X8JB 2I2CA 2B7CA 3MJVA 1V8OA 4IVRA 2Y3IA 2GCGA 4IDOA 3AB8A 3I09A 2B6NA 4EYEA 5JCXA 4HMPA 5F5XA 2ZYHA 3KPUA 4UNPA 4INAA 3RS9A 4C08A 1FDOA 1KRWA 1E58A 2IQ5A 4CGYA 1UFKA 2WU0A 3WYNA 3SYLA 4ARZB 4LQCA 5F78A 2PLAA 2FSIA 4L5BA 1OTHA 1IUOA 1XEFA 1HEIA 1BXKA 3OA0A 4ZAFA 5JDCA 2DFPA 5LN1A 4DBZA 4R5MA 1T5HX 4WXHA 4RELA 5DBEX 1GXSA 5AI6A 3T5DA 3HKDB 2ZSEA 3IE0A 1E18A 1C5KA 1BXRB 4P7BA 2YJGA 4E6EA 2RGUA 1A0OA 5AK3A 3BE5A 2WP8J 3BREA 2FQWA 1YTLA 3O9ZA 2OUKA 3TFWA 3SI7A 1J0AA 1LI5A 1H9CA 2XQFA 1BEEA 3GRAA 4EI9A 2NTEA 3K8QA 4OL9A 1SULA 3EXFB 2QLJA 4G5YA 4IIYA 4M0FA 5B1DA 5T6MA 3VU9B 2O59A 3BWYA 2OZKA 2FKAA 3B82A 1ADJA 3PVSA 1M33A 1RJ9A 2QZZA 3HXMA 2VI5A 4JEMA 2ECKA 2NZJA 3N3BC 3OZFA 2ZBGA 4MRSA 1O8CA 4QYMA 4Q7KA 5CTJA 5EN4A 4JH0A 4Q02A 3VPAA 3WJ2A 5FOWA 1E3MA 3KXKA 4H6VA 4GGMX 1D9ZA 3Q8WA 4W7HA 5DTMA 2RC5A 5KCZA 2YCBA 1BMTA 2H2WA 2VCEA 4OP2A 1TCVA 1F7UA 1JMYA 2NU7A 5JECA 2X7JA 4K9DA 5COAA 4IZHA 3UTDA 4IBOA 4MICA 3FBTA 3G6KA 5HW0A 4BWVA 1OPRA 3WOVA 1TAGA 1O57A 3AF3A 3LFUA 3AZQA 3PT9A 4H1UA 4KQEA 2QD1A 1DFGA 5AKYA 5F51A 4YCMA 3D3KA 3W5UA 3M6XA 1K6EA 2BH2A 4J76A 2P6NA 4PXAA 1GUDA 1DAKA 1F06A 1NQUA 4EO9A 1D8AA 2V7BA 3FFTA 3K9GA 3ZCTA 3IMGA 5LQSA 2Y1FA 1MEJA 4AP5A 3LUGA 4A5SA 3WLOA 4B2PA 3M8KA 5G02A 1YULA 5I9IA 6AT1A 2J0VA 5CDYA 4Z0TA 4F85A 1L4UA 2R11A 1G5TA 1M6VA 1UMBB 4I5GA 2NZXA 4UUNA 2Q5QA 1HV8A 1IVYA 3MF4A 1SUWA 2QQ0A 1RAEA 2ZJ7A 4C2UA 3RG2A 4BNZA 1K3FA 1X7DA 2E85A 2M98A 3FB1A 4B6PA 2MT9A 4CUZA 3GLIB 2GDJA 1W4CA 2JFXA 2ZJ3A 4KTVE 1M2HA 5IVDA 1VCOA 2D06A 2W2KA 4JCCA 1U8ZA 1Z26A 4MVJD 4V0KA 1ZJJA 3VSEA 4E5NA 1VECA 3RUEA 1JKJA 3FRJA 1D2CA 5DEIA 2ZB8A 1NUUA 3OTIA 4IS3A 3SDBA 4HVLA 4BVHA 1CJSA 2ZYTX 4CV0A 4F9GA 1SEVA 1R66A 1SPBS 3C8ZA 3FUVA 3BHNA 4BMOB 4M55A 5EWJA 1BU5A 1IY8A 1M76A 2WJGA 2KBEA 2QU8A 4UMDA 3TJRA 4BC0A 2BRUA 2XUJA 4NZOA 3PG5A 4II3A 2B9VA 4CM9D 1TYCA 5HGXA 1S1MA 5E4FA 3TRIA 2NYAA 2HBYA 3MOIA 2O2EA 5LVAA 5AUOB 1R0CA 4P58A 2YY5A 2VUSA 3R7LA 2OFWA 4FC6A 4BFZA 4ZYVA 5CFNA 2CHEA 1O6BA 2HWXA 3MTBA 1WPGA 3D43A 4FYMA 4JJ4A 2XYHA 3TMYA 1ULSA 3SSOA 3KLBA 3I5UA 3PNBA 4R7TA 3GLIE 3C7AA 1N2CB 4GRIA 5D7BA 2Y76A 2GS9A 1RQGA 1LEHA 1DTWA 3UJCA 1CJBA 2H4XA 4MJXA 1RRFA 1HYBA 2XMPA 3H04A 4IFEA 3I76A 1DTSA 1GG8A 5C46F 4CKXA 2FPWA 4BFCA 1KK0A 1QVVA 3E35A 1GVNB 5TQ2B 5HF6A 3SM9A 1C8BA 4P4SA 3KR9A 5B1EA 1NI5A 2PT6A 3EQ8A 1RYZA 1ZK0A 2WU4A 3BZBA 3QA9A 4K2HA 3RU2A 1VLLA 2Q3FA 4CQJA 1G17A 4Q9DA 1X13A 4PVCA 4NE9A 1ZESA 1KC3A 1FZTA 2XVZA 1K7YA 2XT9A 3WYDA 2IS6A 1D1SA 1GZ3A 1MU0A 2QS9A 4HLUC 5I5GA 1PR2A 1L7EA 3PNMA