4DQ0A

The crystal structure of tellurite resistance protein from escherichia coli o157:h7 str. sakai
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
IRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDGEYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWEMVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Tellurite resistance protein
publication title The crystal structure of tellurite resistance protein from Escherichia coli O157:H7 str. Sakai
rcsb
source organism Escherichia coli
total genus 69
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4dq0A00
3MHTA 3LKZA 3HA3A 4U7TB 5EIFA 3LX6A 4P7KA 2OZVA 3FYCA 3C6KA 3BWBA 2UYHA 3E8SA 3A7EA 2IH4A 3HM2A 3QOWA 2GA9A 3PTAA 2ORED 3HCDA 4PYOA 4BP1A 1SKMA 1IM8A 1QAQA 1HNNA 3PX3A 3G8AA 5EKXA 5FA8A 4RTPA 2BR4A 2P7HA 4OQDA 2NYUA 1Y8CA 4IV8A 3NDIA 3CVOA 3BKXA 1X1BA 5GINE 1Q0SA 3PFHA 5HIJA 2VZ9A 2ZBQA 1JG2A 3G2PA 1BKYA 4M38A 3KQPA 3OPNA 3GNLA 3PS9A 4PIMA 3BGIA 4YUVA 2QRVA 5F2NA 1YZ3A 4P58A 1QZZA 4BY9E 2EX4A 4WVLA 2AOTA 2ZTHA 3Q87B 4LWPA 4CWAA 2P40A 5FA5A 4QTUB 1YFLA 2ESRA 4A6DA 1EJ6A 2ZIGA 3BWMA 4P7JA 3O31A 3UZUA 3ME5A 1KIAA 1YFJA 3FTFA 3GRVA 4PINA 4CXMA 3DP7A 2NXEA 3K0BA 3O7WA 3P71T 2N47A 3IYLW 5EQJB 5EZQA 3SGLA 5EPEA 5IKMA 3KR1A 1P91A 5T6BA 2CKDA 4QDJA 3FRHA 5EMJA 3LDFA 2NXJA 3NW9A 4M7RA 2ZZNA 3ELYA 4HSGA 5P8WA 2BZGA 5DTMA 5E1BA 4E33A 5EEHA 1M6EX 3LDGA 2YXEA 3PX2A 1ZG3A 4ER3A 3FUXA 4HTFA 1AQJA 2AOVA 4RTKA 1AV6A 2HMYB 1RI1A 5EOVA 3M6WA 3FPFA 2PX2A 5IH3A 5HFJA 1JG3A 3DMFA 3G88A 3OZRA 3EVBA 3G2MA 3NVMB 4OQEA 5DPMA 5DSTA 3DMHA 1I1NA 2O05A 3CJQA 3F4KA 5K0NA 4RTLA 5EMLA 4RTSA 5K0EA 3UFBA 1ZGJA 1FP1D 1N7JA 3G5LA 3KQQA 4ER7A 5ICEA 4CTKA 2OB2A 2ZSUA 4QDKA 2FRXA 4KIGA 1G8SA 3LCCA 3P8ZA 2ZVJA 3PT9A 3TMAA 5LR6A 5CCXA 1SQFA 4HGYA 3I64A 3SSMA 4FSDA 4A6EA 2XYVA 5EZSA 3T7RA 3UBTA 1I9GA 3EVEA 2C7QA 2BR3A 4GQBA 2XYQA 4PYQA 1JQDA 4RVHA 1O54A 5DXAA 3TM4A 2G8NA 2PJDA 4ISCA 5DX8A 4E32A 3AXTA 2OXTA 3HCFA 4R05A 5K0BA 1P1BA 5DT2A 4YMHA 2I7CA 5DXJA 2QY6A 4HH4A 4KWCA 5MHTA 1X1AA 3ELDA 4GOND 1XCJA 1TPYA 2JHPA 4FGZA 4GOMD 3G2QA 3HEMA 3OFJA 4HRAA 1P1CA 2G70A 2VDWA 2YUIA 3LPMA 2EFJA 3FUVA 4R8RA 4RX1A 3UA4A 5K0CA 2ZIFA 2GB4A 3HNRA 3PFGA 3GRZA 3EMDA 4H0NA 2G1PA 1SUSA 3VC2A 2P1DA 3LSTA 5E1DA 5DRTA 4CKBA 3SR4A 4K6MA 1WZNA 4FT4A 4MHTA 1L3CA 2I62A 1EIZA 4C05A 4KDRA 3B3GA 2O57A 5K03A 3TPZA 3BKWA 3G2OA 3I58A 4DM3A 1DCTA 2FK7A 2P8JA 4E2ZA 3GO4A 1G60A 3SXJA 2IDKA 3R0QA 5JUWA 2A14A 2JHAA 3GRRA 2GLUA 3A26A 3GU3A 5EVJA 3GXOA 3SM3A 4AZVA 3CC8A 3E23A 3GRUA 3GJYA 3BWCA 1VE3A 2CMGA 3AY0A 3OU7A 3DXXA 4EKIA 5EMMA 4RTRA 1VL5A 3TLJA 3KQOA 4MTLA 5F2KA 4AZWA 2AVNA 1BHJA 1VIDA 5K0FA 2ZWVA 4E2YA 3MTIA 4YUWA 2PX8A 4RWZA 3DOUA 3R9XB 2UYOA 2PWPA 4AZTA 3UA3A 1XCLA 4E30A 4EMSA 5CD1A 3EVCA 3MB5A 4PIPA 4MIKA 2AOWA 3TQSA 3DULA 4PONA 3T7TA 1B42A 4DZRA 5FULA 2ZLBA 5BW4A 1KHHA 3HA7A 2B25A 2VDUE 2Z6QA 1V39A 4XUEA 1JR4A 3O4FA 1JQEA 2H00A 3ERCA 2AS0A 1NV9A 4LG1A 2OPBA 5E9WA 3I53A 3P2KA 2IH5A 2NP7A 5BXYA 4X1OA 2JJQA 4X60A 5M5BA 1SUIA 3EEOA 1O9HA 3S68A 3C3PA 3DMGA 3UJCA 5FUBA 1FJXA 3BWYA 3T0IA 2B78A 4OBXA 3V8VA 5K05A 1ZGAA 2K4MA 3KR2A 1NT2A 1KR5A 4GEKA 1EJ0A 2PLWA 2XYRA 3ER9A 1R8YA 4IWNA 4PCAA 3FTCA 3GWZA 2P3OA 4EKGA 2BM8A 3HVHA 5JR3A 5EHGA 2ADMA 1YB2A 1ZQ9A 1BC5A 3EGEA 1QYRA 1NW3A 3OZSA 4PWYA 2Z6AA 1L3BA 5FTWA 3LBYA 2ZBRA 4MQ4A 4C07A 1R8XA 2EJUA 3B7PA 1R6AA 3TFWA 3WSTA 1INLA 3FUWA 3M6UA 1UWVA 3EGVA 2NXNA 3G5TA 3OFKA 4GOLD 3R24A 2PXXA 4FZVA 5HEKA 3TKYA 2UYQA 3NTVA 5U4XA 4ER5A 5CVEA 5GM1A 4BLUA 2PBFA 2ZZKA 1IXKA 5LQCA 2C7PA 2HR1A 3K6RA 4O29A 5CVDA 1QANA 1KP9A 2BR5A 2DULA 1PJZA 2P35A 5CVVA 2JH9A 3TOSA 3HP7A 5B1SA 3DR5A 5EEGA 3AXSA 2Z6UA 3HVKA 4C06A 2AN4A 5CM2Z 1H1DA 1D2HA 1RJGA 4HGZA 5EC8A 1JSZA 1JG1A 3GGDA 3HA5A 3A4TA 1U2ZA 3M6XA 3SX0A 4BLVA 2B2CA 4PYIA 5EKUA 2QRVB 5FCDA 4PYJA 2AOTB 3THRA 5CVUA 2XBMA 4QPPA 2AOUA 3M6VA 3A27A 3KPUA 2B9EA 2ONZA 3PVCA 3LECA 3AWIA 4YV2A 1M6YA 3FTDA 4R8SA 1G6Q1 2ZCJA 3X0DA 3VC1A 3LBFA 1YF3A 3DXYA 3KQSA 2YTZA 5CUQA 2IIPA 5DM2A 5DTRA 5BW5A 4PYKA 3EVAA 3THSA 3DH0A 4LECA 3NWEA 3UWPA 1QAOA 3G8BA 3MGGA 3FPGA 3LDUA 5HILA 4M36A 1G38A 4HTFB 5DTQA 5KYGA 3ELUA 2IDJA 3QOXA 2IGTA 3KR9A 4LWOA 1SQGA 3SSNA 4DQ0A 4RTNA 3BXOA 4C4AA 2PGXA 3SSOA 4ER6A 1FP2A 3GDHA 4RTJA 4DA4A 5E9JA 2EG5A 3MCZA 5C0OE 3QV2A 2AZTA 1NKVA 1F38A 1VBFA 1Z3CA 3MTEA 4DCMA 5DM0A 3KPWA 3LHDA 1DL5A 2CMHA 2ONYA 2XVAA 4RSRA 3LCUA 2AN5A 5FWDA 3LCVB 4RYLA 2ZULA 3OE4A 3B3FA 2WA1A 3IV6A 5K0LA 1PRYA 5BP7A 1RI5A 3HCBA 3EGIA 2FK8A 4PGHA 3FUTA 1RI3A 5HIMA 3MQ2A 3FYDA 1NW8A 5CIYA 4KIFA 3FTEA 3KPYA 2C7RA 7MHTA 2I6GA 3A25A 4UOEA 5C1IA 2PT6A 3LKDA 4E31A 1XXLA 3R3HA 2FHPA 2CL5A 3UJ6A 2VP3A 1TW2A 2HWKA 1I4WA 2NP6A 2VDVE 4CTJA 1NW7A 4HG2A 1AF7A 3EVZA 1NBHA 5D1HA 3P2EA 3UJ7A 3M70A 4CKCA 2GH1A 4FR0A 2H1RA 2IBSA 4YUYA 2PSSA 3EMBA 3REOA 5GIOE 3PLAE 3R6TA 1EAMA 3JWHA 3C0KA 1BOOA 2V74B 1L9KA 1MJFA 3LL7A 2PV0A 2P41A 4GOOD 4RV9A 5LQNA 1VPTA 3P2IA 3PB3A 1WY7A 4GF5A 4B17A 2ZBPA 5DX0A 3TKAA 1KYWA 2GAFA 3TM5A 2IPXA 1WXXA 2B3TA 3VYWA 1RI2A 1T43A 3KQTA 4R6WA 4XUDA 5EG5A 3VSEA 1R00A 3EVGA 3P9NA 2IP2A 2QM3A 3Q7EA 1XDSA 2FYTA 2E5WA 3G89A 4ZTBA 5DM1A 4X61A 1FPQA 5FADA 1KYZA 3E05A 3U81A 2NNWB 3OCJA 3M4XA 5G02A 2LD4A 5DM4A 3NWBA 2ZWAA 3HCAA 3OE5A 5GM2A 3UJBA 1L1EA 1KPIA 3DTNA 3I5UA 3HTXA 1EQAA 1AQIA 1XDUA 2NXCA 3I9FA 2PWYA 3EVFA 4DCGA 2AVDA 3C3YA 1MHTA 4RVFA 2AN3A 4DKJA 1JG4A 5DSXA 4IV0A 3CJRA 4C08A 3MAGA 4YV0A 1VQ1A 4RVGA 5E8RA 4POOA 3GCZA 3P97A 3P9CA 4EQZA 5FQNA 2F8LA 3OU2A 3NDJA 3FZGA 3ELWA 1JTFA 4NECA 5E2AA 4AX8A 2QYOA 2R6ZA 3ANXA 4QVGA 4AZSA 4RTOA 3DUWA 1N2XA 5CCBA 4GUAA 4DF3A 1NV8A 1ORIA 4X63A 4JXJA 5FHQA 5LSAA 5DX1A 1TW3A 3NJRA 3JWGA 2YXDA 1VP3A 2BH2A 4E2WA 1HMYA 2PXAA 1ORHA 3MERA 4KW7A 3D2LA 4OA8A 1DUSA 4CKEA 4L7VA 4PCLA 4QVKA 3CKKA 1KXZA 4PNEA 5E1MA 2HV9A 3A7DA 4IKPA 5ICFA 1JQ3A 3HVJA 3NMUF 1R18A 1NW6A 2PX4A 5E9QA 1SG9A 3BGVA 2ZIEA 2PXCA 3UJ9A 1WXWA 3JWJA 4YV1A 4AUKA 2P3QA 5GP1A 2IFTA 3P9IA 5LQAA 10MHA 5KQSA 2ZZMA 1UIRA 3KPJA 4M37A 2ZFUA 1EG2A 3G7UA 5GOZA 2AR0A 2OO3A 2UYCA 3KR0A 5DWQA 4FSXA 1RI4A 1UFKA 3SMQA 1ZHFA 3B5IA 3FPJA 5E8JA 2I9KA 3UJDA 2OKCA 8MHTA 4EK9A 4FS8A 3TR6A 4R6XA 4XUCA 1R74A 3KQWA 2IH2A 2YX1A 1KPGA 3BZBA 4G56A 3RODA 3ER8A 4GC9A 2OBFA 1FBNA 4PYMA 2WK1A 1X1DA 2EJTA 1XJ5A 4QQNA 4C04A 3NVKI 2ERCA 2O0LA 4FT2A 2YVLA 1WS6A 4F85A 2YQZA 5K0GA 3DXZA 5EMKA 1VLMA 4F84A 1G55A 3P9KA 5D1NA 5DRYA 4E2XA 5ERGB 3ID6C 5DLYA 4MWZA 5K0JA 1NE2A 2FCAA 4V0RA 1OR8A 4E70A 3FUUA 2YXLA 4YMGA 2AOUB 4BP3A 4PGGA 1KPHA 3LGAA 1XDZA 2HNKA 3DLCA 4ER0A 3RIEA 3CJTA 1VP9A 4WXHA 1YZHA 2JG3A 5KVAA 2XVMA 5HOQA 5FQOA 5LQRA 1Q0TA 4KDCA 4RVDA 2PX5A 4Z2YA 1O9GA 2GPYA 4C03A 4OA5A 3HVIA 2QE6A 5FWAA 3T7SA 3FPEA 2P7IA 4P7FA 2DPMA 5GWXA 2JHCA 3UJ8A 5K8VA 5GIPE 4Y2HA 5KQRA 3GIWA 4FP9A 1XTPA 3FPHA 4YUZA 5E1OA 3KQMA 4Y30A 4YUXA 1QAMA 3OU6A 4RTQA 3V97A 3KPVA 3IHTA 3UJAA 4XCXA 5LQKA 1RJEA 2ZW9A 5LQUA 1F3LA 1NBIA 3B89A 4HC4A 2GS9A 3SVZA 1WG8A 2G72A 4QQKA 3TRKA 4P7GA 1NW5A 2OY0A 4OBWA 1XVAA 5CVJA 5F2OA 1SVUA 2PY6A 3M33A 5T67A 4QPNA 3KQYA 4PYNA 4F86A 3KQVA 4X41A 2Y1XA 3GRYA 5KS2A 3L8DA 4ATNA 2WA2A 3CBGA 4DMGA 1RJFA 4GC5A 3E7PA 2AOXA 1P39A 3EVDA 2UZ4A 1X1CA 5K01A 1M0EA 5ICCA 2V7EA 1YUBA 3C6MA 5HIKA 2KW5A 3BT7A 1L3IA 3H2BA 3KHKA 3KU1A 5EGSA 1IY9A 2JH8A 5HZMA 5FHRA 3ORHA 2IBTA 1ZKDA 2HTEA 4KRGA 4QTTB 4U7PB 5HIIA 2PVCA 1N7IA 3JWIA 3B3JA 2BM9A 3HCCA 2Y1WA 4KVZA 1X19A 2OYRA 3FRIA 3EEYA 3EPPA 4RTMA 4V0QA 2O06A 5EHIA 5EIWA 5H02A 2P3LA 1D2GA 1D2CA 5K09A 2PKWA 2G71A 4PYLA 3OZTA 3CCFA 3KKZA 5C9ZA 3HCEA 5LQJA 2C7OA 2Q41A 3IEIA 2H11A 5T64A 3AJDA 2YR0A 5ICGA 1G8AA 1RJDA 3RW9A 3MCTA 4EVIA 2CWWA 3DLIA 2VS1A 3BUSA 1JTEA 5E2BA 2O07A 9MHTA 1JSXA 2PT9A 2OB1A 4GBED 2FPOA 4OX9Y 4BLWA 3CGGA 2R3SA 3BGDA
chains in the Genus database with same CATH superfamily
4AO8A 2L2QA 5CFOA 3PC8C 4U7TB 5EIFA 3N8NA 4IRXA 4LCJA 4DABA 2OZVA 3W2IA 4F96A 1X80A 1FY2A 2CKMA 2D0IA 3LC7O 2VQ3A 3DWEX 4Z0PA 1ZJWA 1E92A 2QTAA 2QE7D 4BP1A 3ACDA 2C0QA 1M1NA 2YUTA 4W6ZA 3VZRA 1M6WA 3DKPA 3TDKA 3J81k 3UPDA 3OX3A 4DV1B 1H2BA 1O5TA 1CY0A 1H2YA 3B7GA 3BKXA 3C3XA 4OY3A 5FI3A 3U1BA 1XLWA 1EDBA 3O90A 5KYUB 3R5SA 3P9XA 2E4XA 3MLAA 1FS4A 2HA2A 2JLAA 1LWOA 1MEJA 3DOOA 2FSUA 3KKEA 4PIMA 5AXDA 5ALYA 3UHOA 2FQWA 3CF6R 1MRZA 4G25A 3J80A 2A84A 4MUXA 2P40A 1NE7A 1GAJA 1NMSA 4IZOA 1ZOOA 4NICA 4QTUB 5DSZA 4EHIA 1A9TA 4ND8B 4R81A 1GSHA 3AF0A 1V5FA 2HLPA 2XNDD 3HBAA 2FEOA 4ZOBA 4AXBA 4CIDA 4MUHA 5FUXA 4IWYA 2BAGA 4AJ9A 1USVA 3DP7A 1JEYB 2HNAA 4RFLA 3SGLA 1HT1E 2HO5A 4TKUA 4BLSA 1EBUA 3KR1A 4DBLE 4QLBA 3IOEA 2YVKA 4RMNA 2WFLA 4JJGA 4IP0A 3NW9A 2CVPA 4OHVA 4BX2A 2YJ6A 1C4OA 3CR8A 2FUG1 3TW8A 5FWYB 2JLZA 4E6EA 3AP1A 3AY7A 3GJTA 4LXXA 4WNIA 3GBSA 2HMYB 1T0BA 3B9RA 3ESDA 2UZ3A 1Y7HA 2VJAA 1DAIA 1Z0DA 3GAAA 5DYWA 2YMPA 5KQPA 2WHPA 1NQTA 3BT7A 2A88A 1E5QA 4RANA 5LUAA 1I0LA 1QB7A 1HQKA 4QYIB 1X1SA 4BFWA 4EVQA 1PK9A 1YWGO 3CJQA 4MW2A 3KCNA 3AVTA 4LJ4A 2PCLA 1HEYA 4KO8A 2ZSUA 3P7MA 4M7WA 4PLHA 2YINC 3CZRA 1OPRA 2XMBA 3BF8A 1MR3F 1E5VA 1K2WA 3KB6A 3PFBA 4OHFA 2V7WA 3TMAA 5BUZA 2VP2A 3AGQA 5LA6A 1KWKA 3RUIA 3DWGA 1NJFA 1Q0LA 1NX6A 3EVEA 2FZ4A 4I2NA 2VTBA 3TSWA 3C3WA 3U62A 1A9SA 4AZ0B 2WRZA 4YJDA 1XALA 2JLSA 2VAXA 2C2HA 2Y1DA 3VDMA 4ISCA 1S8FA 3AXTA 2C4TA 4TMTA 3BZWA 1DNPA 3KDAA 3NBQA 3V8QA 1CP3A 2Q4RA 3T1TA 3WAGA 5ISMA 4L5IA 4L9AA 1KL7A 2A5LA 1V7PC 3GLGE 4UDOA 2FV8A 3IV7A 2UUPA 4G84A 1J5PA 4U2CA 5EFOA 4W99A 2R84A 4A0SA 3AVWA 3ZE8A 4JI1B 3AIKA 2CJXA 4MCIA 1Z22A 4JL8A 4AN0A 2GB4A 2R6FA 5DNYB 3OQOA 4O4IF 4M1KA 2UVPB 3GGPA 2XECA 3I73A 1I0IA 1AXRA 1OYWA 2RONA 3IIIA 4S05A 1E7QA 3INRA 3ZWXA 4LE0A 4KNYA 1ZGHA 4DA8A 2PLAA 3D7NA 5D3MB 4DM3A 2C3OA 3GO4A 3V7WA 4I08A 3NB0A 1XTIA 2BRUC 3A26A 3ZHXA 4NMHA 4ZOCA 3R9XB 4XIGS 1ZR2A 1FK8A 2F1JA 1GO2A 4EYGA 3DBLB 1BWRA 4MB2A 5B1DA 1XZAA 4IDGA 3CLVA 3DKVA 2QLJA 3I62A 4HUQB 4JCCA 3DNFA 4KEAA 3JZMA 3DSRA 5CMLA 3RSLA 4JXKA 2MHCA 3T61A 3RC2A 3H1AA 3OQVA 2YYSA 3BFVA 3JAWA 1BMQA 4D81A 2Z08A 1ZPDA 2OILA 2GN6A 5I4CA 3GLHA 4ZEOA 3GLFE 1XXHA 2D5AA 3EXEA 5IARA 2ZLBA 3QYJA 3GGOA 1LZLA 3NU1A 5KNDH 3PTZA 1R0CA 4ZI7B 2H00A 3ACBA 4NL4H 1U3CA 4NU8X 5GQSA 3SKVA 3OLQA 3DZGA 4CT4B 3FKSA 3E4CA 3CH7A 2I2AA 2CNWA 5J1SB 3HKCB 5AKLA 2WIDA 4Y2VA 3TBFA 4P3OA 3SOPA 3JATB 1V35A 1K8QA 1V4BA 2JDID 4BMCA 3BG5A 3KDSE 3WWYA 5LP6B 3LFTA 3AESA 2GAIA 2XWJI 1M2OB 1IHXA 4X1YA 1T0JB 3NNDA 3AL0C 2FWAA 621PA 1LBHA 1EJ0A 2PLWA 3TO5A 3T1QA 1LS1A 4W9NC 4NCNA 2JLUA 2GM4A 2JBAA 4C2BA 3IPAA 4MI1A 2QNRA 2O0MA 3G0BA 1ORVA 4XJTA 4YN3A 2P5SA 1LVHA 1Z4JA 1NYRA 2D7CA 2PUWA 4MPPA 1REQB 2IEZA 3CGWA 3QNUA 4QBKA 5D6OA 2QG6A 2PVPA 5B4VA 1FNNA 4EB0A 2GK6A 1F8FA 4W5HA 1SIBE 3F4BA 5HUQA 2VEOA 4DCNA 4UNIA 4R68A 1XI2A 1L7DA 3KJFA 3VZCA 1XA3A 4PHCA 5A7GA 2GGSA 2NOAA 3CRRA 2BJVA 3CPEA 4DLWA 4MWGA 2VP0A 1H94A 4ENUA 4QXPA 3GT7A 4YP0A 4B0OA 1O0BA 4BQSA 1FSPA 1JSZA 3KC2A 1PWEA 4PO3X 3WWCA 2IYAA 4PTLA 4G23A 4MR7B 3L06A 5ALIA 3VTKA 2YJNA 1QYWA 2PD4A 3EC1A 2Y77A 3FFBA 3G5UA 4EGCB 3N2EA 4EPVA 1CUCA 4FB5A 3VNRA 2JIDA 1B43A 4JZKA 3U9LA 3FUCA 1O0SA 4TS3A 1CR6A 1E8DA 2QPAA 4DTIA 1BU5A 3ZEIA 1YASA 1JR3D 2CLEB 4DQDA 3FTDA 1Y4UA 2NW6A 4Q1EA 3MILA 3TYXA 5JFOA 1EDOA 1RHUA 3L7BA 4KXFB 1PQUA 5JMPA 4CL8A 1HPLA 2I4RA 3DXYA 1LA2A 1MO3A 3KQSA 4GI5A 4IIJF 2A9QA 4OLHA 2JVJA 5ALZA 3U5TA 1A7UA 1PJTA 2G0TA 4HWRA 3MWJA 3EVAA 4FUTA 4II3A 4EABA 1YCGA 1VLQA 2WWTA 3Q3VA 5HGJA 1OFTA 3LDUA 1ZGGA 2Z3VA 3HYSA 5DHFA 1KJ8A 1KYXA 2ZP1A 4FU0A 5DIFA 3LC2O 3R3ZA 3HI6A 5G3ZA 3W79A 1Z0AA 3E3NA 1GFSA 2EL9A 2VDLB 3EA4A 5ENVA 2BY4A 2Q45A 3GZNA 1C30A 2BIFA 4RACA 4LX8A 1NX9A 1V96A 2HT1A 1FZQA 2CBXA 1ADJA 3GJ8A 3P52A 1YSCA 1JR2A 1F38A 5C4GB 1GNVA 4CR7A 2XE6A 4EOGA 3KPWA 1QZXA 1XPJA 4OI1A 2PZMA 1P7ZA 1E99A 2OYSA 3JASB 3KL4A 1C7ZA 4XJSA 4ZVKA 4A6PA 2VF2A 1I5RA 1NLZA 2WIKA 2WA1A 4MVJI 4DXDA 3JSAA 4PGHA 2FK8A 3P0FA 2I76A 4I1YA 1QBGA 3UNXA 2NACA 4AS2A 1QFJA 4BZZA 5KAMA 2ENWA 2PQ6A 1QE5A 1EUCB 1SBTA 1Z34A 2PIAA 2QXYA 4DAEA 5K3BA 1SG6A 3PFCA 4MA0A 5IPFA 4UKDA 1EJ2A 2CL5A 1J20A 1GZUA 4YRZA 4I81A 1JHVA 1TW2A 4LDRA 4PPGA 2V6IA 5DEIA 5CBKA 3DE1X 1QUEA 1MA3A 1MIOA 1K66A 2O3TA 1XYGA 1DC5A 3JQGA 4RNCA 1GCGA 3M70A 4YT8A 5TPWA 4YRGA 3PJFA 5HNKA 3I2HA 3MUFA 4XWTA 1ZVQA 4B09A 1Y89A 4Q24A 1CVRA 1N34B 3V8BA 1Y5IA 3LXRA 3VR6A 2XYHA 4QECA 3LL7A 3GRKA 3ONEA 3NTLA 4DRZA 3PPVA 1Z4MA 2CVQA 1ZH4A 2AEEA 2J5XA 3IUNA 1BHQ1 1MAAA 1U9CA 1X7HA 2Q2NA 1GOTA 4B35A 1Z6ZA 2QTMA 1VM6A 4LS3A 3VOTA 2XMDA 3GF4A 2O7VA 1NPDA 3ONNA 1JKMA 2Q5IA 3OQ1A 1CJBA 2IP2A 4GT1A 4LYHA 4ETIA 2AT1A 2E5WA 4HNQA 3AUUA 1NKSA 4ZXFA 4ENSA 2G5CA 4P4NA 2NNWB 2XJ4A 1G7RA 5G02A 1FP6A 3NC1C 2E6KA 2P1RA 3RJZA 4MXDA 4B40A 4GNRA 1AGYA 4OOEA 2H9IA 1QH0A 5MN6A 5GONB 1HUQA 1AKNA 1DC3A 3D3KA 3EF0A 5AICA 4EKYA 1JXQA 2IXEA 3AB3A 4OSEA 5DSXA 4I1SA 4ZD6A 4L8LA 5KVSA 3G17A 1YL5A 1V43A 2Q5QA 3V6MA 1I0ZA 1KJIA 1ULBA 5FI1B 5FPYA 3M6IA 3ZWNA 4ZKDA 2JFFA 1RXUA 2H54A 2WD9A 3ZK8A 4R1TA 1J6UA 1CE8A 1VBMA 3PIRA 4G8BA 5ED4A 3ANXA 1X14A 3A70A 1M72A 1GN9A 4FYHA 1GSAA 1YDFA 4CQMB 1U04A 2PZBA 1PZGA 1TW3A 3NJRA 5CA1B 4BQNA 2MSEB 1VP3A 221PA 5K51A 4BB6A 4HT3B 3RFFA 4RFSB 2C4UA 1VIVA 4CKEA 1NPTO 2DFTA 3H2IA 2O1SA 1LBEA 4PCLA 1S8NA 3I09A 3LDAA 2Z4SA 1VE9A 3O2NA 3SU8A 3O83A 3OD1A 5DEOA 5L40A 2ECKA 4ZYTA 2FMIA 4AO6A 3HB1A 2GBPA 3F6PA 2Z4RA 3GCXA 4OHOA 1J8DA 1F60A 1V9SA 5MN5A 1KKUA 1IEVA 5M2QA 2AYXA 3BMCA 1YDGA 3H9CA 10MHA 4XWKA 3KPJA 1XZQA 4XA8A 2EJCA 5D51S 1BA3A 1ECGA 1ORDA 2Q9UA 4HD8A 4NFSA 3U31A 4EEZA 3P4XA 4D98A 3RASA 1NUUA 3NXSA 2ASVA 5IXYA 2XNKA 2FEWB 1ZK2A 1WKCA 1X39A 3T5AA 1F0YA 4C7BA 1YFKA 2WT8A 3TR6A 1QDLB 3CXRA 3RRXA 5GJVC 1X42A 5BYAA 2X77A 3UGJA 4N0MA 4WHMA 5CLFA 4GC9A 1VHJA 1FXSA 1GFWA 2HSZA 3FBWA 4OQPA 3GEGA 3RB8A 1Y9EA 4Q5IA 1TO6A 2PAAA 2XDWA 4X91A 4WJZA 4MUGA 3KQHA 4F85A 3DO8A 4O4JB 3U7JA 3NS7A 4V2IA 2K87A 1ZMTA 4LXIA 1W5EA 3TRDA 1DX6A 4WZAA 5EMKA 3ZWBA 1E61A 3ML1A 3H11A 4J7AA 4II7A 3NTUA 3QPVA 4KQ9A 4NBKA 4Z8YA 1LCIA 1PJ2A 5TX7A 4AWAA 3EXHB 2AXNA 2CSXA 3D0KA 1NE2A 3I9KA 1H2XA 4FCWA 1KWGA 4FOSA 2RIRA 5JARA 5JAUA 2AXEA 1X13A 1TM3E 2R87A 2YXLA 1EHIA 1DIOB 3QV1A 2VA8A 3U16A 3GLHE 3V8MA 3WB0A 2I2WA 1XXHE 2EWMA 4A1FA 1VP9A 2JIZD 1X1EA 2EGGA 5DMXA 5ECYA 3W9YA 4CG0A 4EUNA 5KVAA 3OHMA 4G2NA 2JLRA 4S35A 3VPHA 3HDYA 4C03A 3TPCA 5FWAA 3NEJA 5KVVA 3QEBZ 4P7FA 3TVYA 4PNZA 3VSAA 2Z4TA 3UCXA 1XNHA 4L0MA 3DHEA 5CLJA 1QTIA 4YUWA 1B0PA 1K0UA 1BFUA 1J0EA 4FJ1A 4YUZA 3ETGA 3OU6A 4R41A 4L76A 3S40A 4RTQA 3QLEA 4MW5A 4RHXA 1IL0A 1QX3A 5EP4A 3RKRA 4IMPA 4F72A 3K5HA 1F3LA 4X20A 3B9BA 4HC4A 5K45A 2W8BA 3GPIA 4CR6A 4ND5A 4UAVA 5CM8B 3TMKA 4P7GA 1QQ6A 3ANNA 3VPGA 1D4OA 2OHJA 3Q11A 1SVUA 2ZATA 1LSJA 5T67A 3VDXA 4F9EA 2FPGB 1DXYA 4CUJA 1CNFA 4B47A 8GPBA 4CIYA 1N78A 1FFXA 1UJCA 3JU3A 2WJYA 1LDYA 2BH9A 2VYQA 2XKJE 4EKEA 2UU9B 4GPBA 3CTMA 2PHZA 4BVLA 1NU8A 2J8ZA 1QPBA 2OC9A 4EA6A 1O57A 2MWMA 1KAQA 4P7BA 4R7TA 3O2SB 1DBVO 3T9CA 3WICA 2ZYIA 3KDPA 3CVWA 1NVEA 2FR8A 1VE6A 5DK6A 1MOZA 1H2ZA 1ZCJA 1RFLA 4LDJA 1VBNA 3O73A 5KYXA 1RWNA 2DBZA 1KORA 2QD3A 3FOBA 4B6GA 3R0IA 5HSGA 3GNSA 1Z6AA 3GJSA 1I4DD 1PWXA 2OYRA 4B81A 4EZEA 5LVAA 3L77A 3R40A 3EPPA 4WBSA 5F5NA 1ZJYA 3RLIA 4LHSA 3SYRA 4DNFA 1L8XA 2HMWA 3GFTA 1EWQA 4IWXA 1XOIA 1Q92A 2G71A 5J2UA 1SHTX 3DHVA 3DFUA 2FFBA 3KKZA 1ZLYA 4PLVA 3F3KA 2R5NA 1K4KA 1Y34E 2IYEA 2WOJA 3L7LA 3H9GA 4KI0A 4Z3DA 4JB8A 3OUTA 2IE0A 4RGYA 1IEQA 1B6RA 2E4WA 2GFQA 4KB5A 4LDPA 1L6IA 1RM4A 4LRWA 2G0NA 4MPTA 1LWNA 1XCPA 1U7PA 5KKNB 3HXLA 4CGZA 721PA 4JYAB 2W37A 2I22A 2J67A 4EELA 1WB5A 3QSYA 3BQ9A 4DLLA 2HK9A 4H1TA 3BGDA 4JUCA 4BO2A 4HVTA 4Q4AB 3EC7A 1K3UB 1TF2A 3W04A 4ETNA 4YCLA 1UFRA 4MQFA 3IAXA 3EFHA 1MJ5A 3AR7A 4YJ3B 3VOBA 3RS8A 4FONA 2WNSA 2RE8A 2ZKLA 4D3DA 2IOHA 2P2ZA 2JATA 3AB7A 4JP3A 1RE1A 4JVOA 4R8MA 5FA8A 5IRCD 2ZQZA 5FR2A 2DP4E 5AW7A 5FBQB 4NK5A 5GINE 1T1SA 5HKAA 3PQEA 1QIMA 1JG2A 4I55B 2OO5C 5FORA 3RSCA 5CDHA 2FPPA 3T7KA 1YI0A 4Q6BA 3KL2A 4M6WB 4X92A 2JCBA 1PJ8A 3PS9A 4QX6A 3ROEA 3VISA 5BMVB 1R8JA 2F67A 2J45A 2ATVA 1KQPA 1M2GA 2OZKA 3I2IA 1J09A 3EGDB 3IDSA 3M6AA 4IFEA 4UAJA 2F8TA 3TRJA 2BSAA 5ESWA 2QVBA 3BEDA 1BRTA 2HCFA 4JJ7A 4LBYA 2CXTA 3IRUA 4CF4A 5IHXA 3DS8A 1EXMA 5KNCA 2HM7A 1VE1A 1KIAA 2FF7A 3FAKA 5I7SA 3FTFA 1A0OA 1C9MA 3DF9A 3O7WA 3K0BA 3OH8A 4UZEA 3T3PB 2VNAA 2XXBA 1RAEA 3T9EA 3RI3A 2G83A 3VVCA 2AHRA 4R3UC 3AINA 3H16A 2YFYA 4G9EA 3IQGX 3A0RB 3K9CA 4M7RA 2ZZNA 3MAAC 1CCWA 5P8WA 3L4EA 3T41A 1XTQA 4JGBA 2IQIA 1XBTA 1AQJA 2GK3A 4K9QA 1AV6A 1RFGE 2QZSA 4D9HA 3PGA1 5EOVA 4X8LA 5IT4A 2BJWA 4H15A 2QRLA 1CC1S 2ZE7A 3Q8WA 2RB5A 3H5AA 2H8GA 1QLWA 4J94A 5KWIA 4TQAA 2VN8A 3V33A 3B1FA 2E5LB 4MK4A 1J4AA 1PUIA 4BFYA 1FNDA 3PFIA 1RCUA 4KL8S 4G1MB 4TTRA 1OIXA 3HWSA 3N8DA 3HACA 4LY3A 4PPNA 1AQYA 3WTBA 4H7FA 1YFZA 1KR2A 4P1ZA 2B94A 4DCUA 1KBOA 2ODEA 2N0SA 4HEHA 3TWOA 2B4KA 4Q4HB 2H2AA 1JE0A 2RHOA 5GONF 3RLFA 3ZTWA 4HB3A 6Q21A 4D26A 4RM2A 3TRFA 2P4SA 3C6ZA 3LM8A 3OZBA 5JADA 4G0WA 4Y2RA 3HU2A 5BR8B 3UBTA 5FL7D 3DAOA 4IIVA 5D87A 3SQLA 1IPEA 4OMUA 4R9UC 4OMFG 3ABOB 4F0JA 4N0EA 4MV0A 2IYXA 2DPXA 1HDGO 4MW7A 4R05A 1X8XA 1XVLA 4CLRB 4OQDA 1I7QB 2XVXA 1SOWA 2C82A 3FG9A 1KO1A 2D54A 4HLUC 4MO9A 4BNIA 5ICSA 4W5OA 3WRXA 3EEBA 4FDLA 5CA1F 4TWRA 1GJRA 1ARZA 1TPYA 2IYPA 2OR3A 3HKEB 1YS4A 4KFTA 4WXEA 2VDWA 4UFPA 5AVRA 1NPYA 1FUIA 3I0NA 4J6EA 5E4JA 1SD1A 5IF9A 2DM6A 2LWIA 2EKQA 3RHTA 3W6UA 3O0TA 2BFDA 3M83A 1GGEA 2A67A 3KSZO 4FINA 4Q6WA 3V8EA 4QG3A 2H3HA 2P62A 1RZ3A 3TJMA 4HDNB 2CXOA 4KI7A 3TLCA 4MGIR 5CJJA 5FD8A 1USIA 3CZ4A 3JQCA 2BMAA 3D2AA 1J2UA 3UAXA 1CQIA 4YTEA 5I5GA 3K53A 1JECA 4LQLA 1SB8A 2IDKA 5JUWA 3IR5A 1Z17A 1U2QA 2IYTA 2V1XA 1CXZA 3MEQA 2FNAA 4FJ0A 3E23A 4J07A 5JI3E 4HATA 1A4IA 2Z5GA 1KDPA 4OHPA 1E4VA 3ICPA 1C3JA 3QFRA 2W2XA 2D8AA 3EF3A 1N5LA 4D6XA 3DQZA 3W5UA 4P2BA 5KJ1A 1F2UB 2XMGA 1GADO 3MTIA 1X0VA 4G4SP 4TKLA 3W2HA 1OFVA 1N75A 5LXTF 2Y67A 3PRYA 5EINA 1PLJA 3WR5A 4EMSA 4PRYA 5T8KC 1V71A 2VT3A 2YYAA 4O4JF 3SC3A 1K6JA 1QJCA 4UVDA 3VDRA 1Q19A 1LI7A 2NUTB 2PKRA 1H0KA 2ZTMA 1AHNA 4I9HA 3DJYA 3EDRA 3AK4A 4TWIA 2G5TA 2GXAA 1FFDA 2CHUA 3K9QO 4JVMA 3RK1A 5GZ1A 4LV8B 4HYQA 3RSFA 2ZT7A 3G7SA 4OUDA 1ZIOA 4ARSA 2OCGA 2JD2A 2SBTA 2AFRA 2AJTA 4TLAA 5EP2A 3WKCA 1KHTA 4RGVA 1NQUA 4X1OA 3TOXA 3CMCO 4OL9A 4UARA 1TCBA 3AEUB 3LOQA 4O4IA 3D0QA 1G16A 1ZZGA 4WZAE 4BEBA 3Q8LA 2B5OA 1G9SA 1EIWA 4WLFA 3NBYC 3FMFA 4IOJA 4JI5B 1SUFA 4NE9A 1G7TA 1KR5A 1FTGA 1XPRA 1VFPA 3N2ZB 4QO7A 3VC7A 1Z5UA 1ZAKA 1PX0A 5CB8A 1H5UA 4I6JA 3BCUA 1JDBC 4R69A 1KK3A 4C3ZA 1FEZA 2F8MA 2ORYA 2PKQO 5ALXA 1KTIA 1VIYA 3UHPA 1IJFA 1XKLA 1US8B 1N3YA 2ARKA 1E3LA 1ZONA 1DEOA 1V9LA 3COWA 3DNPA 4IH9A 5A7HA 4BQPA 1DC4A 3JQBA 1A72A 1VYVA 4Y0VA 1SCUA 3UEOA 2YS6A 1KI3A 5FPPA 2BGIA 4LZWA 4D9CA 2HLHA 3DG9A 2IV7A 2NZJA 4FZRA 2WYIA 5BN5B 5JQGF 1XN4A 4PPFA 4BDTA 2WU8A 2HJWA 4NQZA 2JVIA 2P6MA 4FQ5A 5GIOE 5HKBA 4JV5B 1OYYA 2JCVA 1DFHA 3PJDA 3VU3A 4B3TB 2G1JA 3U40A 1GZVA 1OV4A 1TC2A 1QO9A 1D0SA 5CM2Z 1H1DA 2ZI7A 1SULA 1NVKA 3LY5A 2DC1A 1U2ZA 3IMEA 1MRSA 4TOIA 3TD9A 4JJEA 3R6DA 2PMBA 2H4YA 2Q9AA 4MJ3A 3PBKA 3WO0A 4FFMA 4EPYA 3W5CA 4C76A 4X45A 3CF2A 3AY6A 3ZDCA 1RLJA 2AOUA 4Y98A 4BRZA 3EMKA 3OOHA 2B9EA 3QIVA 2VP5A 4MVYA 3IKTA 4DIDA 5DLDA 3M3PA 2QX7A 3AWIA 1L0BA 1NZJA 3OQHA 3CE9A 4JVNA 4D41A 2JVKA 4D56A 3OFVA 4MUMA 2WM2A 1ACLA 2UZIR 4FN5A 2JAPA 3NBZC 4GYWA 5F5LA 3W5IA 4TL8A 2C1EA 5FDFA 3DAHA 5HZKA 421PA 1LTKA 4IHJF 3RT1A 2AW3A 3IBYA 4AG3A 1U63A 3DH0A 3ZVNA 2JD0A 4V02A 3WNQA 5HILA 5IK2A 2DBQA 3QOXA 4P3KA 2FE1A 1USGA 4QHSA 3PGXA 4RXTA 1CVLA 1LV7A 2HJHA 3GWGA 4J2TA 1IOWA 1J7JA 1E79D 3R7WA 4C7OA 3AX6A 1TVKB 3SQDA 3JQFC 4MVJG 4PHGA 4DCVA 5A3SA 1QQTA 4NFYA 4PANA 1UPBA 4GL2A 4L8VA 5JJ5A 3O47A 2JGEA 3IQHX 1E1CB 4Z4FA 4K87A 5HDQA 2PBRA 3OE4A 4L3VA 1LLUA 1RI5A 3HS3A 3DV0B 4I55F 4ZV4A 5DT9A 5JAMA 2QT0A 4KJXA 5AXCA 4D3FA 4EHDA 3RAGA 2HCJB 4NPCA 5CIYA 3QELB 2I6QA 3K71B 1QFZA 4N9WA 5BMVF 4O02B 4WTOA 5IJ9A 1V9CA 3DE4X 1VI5A 4UOEA 5JSFA 3O2JA 4HN9A 5CTAA 1DPGA 4ILEA 3SG0A 4QUGA 2HWKA 1PIWA 2W7TA 1V1RB 2DJ5A 2VAPA 2ZROA 3MMZA 2EX0A 3T5GA 4RY9A 1N2CB 4HCJA 2WB4A 3CEJA 3WB1A 1RWQA 4LIPD 3SDZA 4S1NA 3BL8A 1JWAB 5BW8A 1NBAA 2H1RA 2XUZA 1U90A 2IBSA 4KWIA 3N8KA 3UMSA 5CFQA 4BC0A 1YR9A 1ZS9A 2PSSA 3OJEA 3F49S 4IIJA 4I5DA 3TZBA 5ENDA 3W9BA 3ZHUA 1IE3A 4DJ5X 4TRJA 1TCAA 1OBFO 4XEUA 4ZAZA 5IT9A 4JEUA 4N82A 2PV0A 2J9ZB 3AONB 2W4IA 4BECA 3ET4A 3H7AA 4IGEA 5J2TB 2V65A 2DR0A 2H9YA 1HDEA 1Q21A 5E3IA 1POWA 1ZMRA 3SY8A 1Z63A 2NO5A 2W2PA 4TYQA 3VH2A 1PEYA 2G9RA 3HO1A 3WISA 1N5IA 3NHYA 5EKDA 2CLDX 5K3SA 1PTJA 1JPUA 1EZ4A 2XUKA 4OGLA 1XD2B 5FF9A 3T5TA 5FADA 3M6MD 1FPQA 1JIVA 2KBFA 4KPGA 5JEEA 4PM4A 2DY1A 3WK4A 1ZRHA 3U4QB 3UJBA 3BRWD 4CUZA 3IS3A 1CZRA 1A71A 3ASVA 4MX8A 3W2GA 5BWBA 5DM70 1X92A 2NSLA 3C8DA 5DGHA 5LB2A 5KYUA 2GTPA 1DQZA 4BEJA 5JRDS 2Z9BA 1DKRA 3BWDD 4OXQA 2FPIB 1E5DA 4RVFA 4RZUA 3QUCA 3OOJA 1LEHA 4LZOA 2GNOA 2Q6OA 3IBTA 3IULA 3L2OB 3QGMA 5AKIA 4U7DA 3KX2A 4GVPA 5F73A 1AZWA 3D81A 5EIEA 5MGBA 2J0QA 1CNMA 1PUXA 2J9FB 1VKJA 2RCYA 4ND8A 4XIIA 2DQKA 1W9HA 3U3DA 2CV0A 2KI5A 2JLWA 2YZ2A 3N8GA 4NQRA 2VDKB 1XX6A 5E2AA 4QVGA 1XZCA 3RC3A 5BVGB 2OHVA 3AFIA 4TS1A 1JEYA 4X8OA 2DT8A 2W93A 3ZTYA 2FN9A 3KT0A 4XIJA 5JTTA 1PJSA 4G09A 3ZJYA 3AFGA 1QVZA 1WETA 3K2IA 1V7ZA 1NJ6A 2HREA 2WKQA 4U0JA 2TMKA 5FWYA 4PRKA 1EX9A 2Q62A 3PC8A 3WMRA 3RYIB 3CRZA 5HP4A 1S6YA 4ZJPA 2ZB7A 4YPFA 3HA2A 1Z2AA 3DKRA 4G85A 3AKCA 1OWMA 2O3JA 3L49A 4P32A 3H1TA 1Q17A 5KOIA 2GPBA 2J3EA 4TLEA 4ROSA 1ABFA 1THMA 2A5YB 2FFRA 2X0RA 3QYPA 5FBRB 1L5KA 3SXUB 4Q02A 2C99A 3GT4A 4BYMA 5I51A 5JW6A 1KRWA 4QYIA 1GQQA 5ALJA 5ITZB 3ZVRA 4QFBA 4QNMA 4OB8A 5FPTA 4LHWA 3DEAA 4JL5A 2RAUA 4NYIR 4ARZB 2F4VB 3ZCQA 1QK3A 4RPCA 3ZYCA 4QU5A 3OKCA 3MJVA 1RBQA 3L8MA 4JDUA 4M8NE 1FFBA 2HLDA 2ORWA 1SVNA 2ZJFA 3B5IA 3IR7A 4Y7CA 1JALA 3ROGA 4KKVA 3W1VA 4ALIA 1R74A 1ZIDA 4LJAA 1M74A 1KPGA 2BMEA 2AXPA 2E21A 3HKDB 2GEKA 4MVXA 4EATA 3LZCA 4AZ0A 1IMJA 9ATCA 1Y8QB 3TXXA 1XELA 3OCVA 3WL8A 4NESA 2WSLA 1FDOA 2FGJA 4XQEA 2QENA 4TRRA 3TNDA 4ZOQI 1E0JA 3DDZX 2IKQA 5KQMA 3THXA 3JVEA 4E3WA 1U98A 1SVSA 1R88A 1FLVA 1NG1A 2P91A 2Z9DA 4ZAWA 4CM1A 3VH4A 4NIMA 4S1WA 1KNXA 3NRJA 3ODPA 4M86A 3UPTA 1RYYA 4QREA 3RYFB 3OEYA 1OXMA 4E5SA 3R23A 1Y4DE 4N47A 5A4IS 1FNCA 4KZPA 4DSUA 1Q7TA 3KCQA 2D2EA 2YYZA 1AQ6A 1GT6A 4L75A 2AUMA 2A5DA 4G8CA 5FYDA 4Z2YA 1I7DA 5NLLA 1O4WA 2HQ1A 1PVDA 2GZAA 3GAMA 5DYYA 2H5LA 2B92A 3DC2A 3L7IA 4EY5A 2AYZA 2NTEA 4EAAA 2DY0A 3WJ2A 4AF6A 5D3MA 1JVSA 4XD7A 5ECWA 3WFIA 4DPMA 1NATA 3ZLTA 3QFSA 3SIPA 2B0JA 5EERA 3C87A 4OH1A 5L51A 3HNPA 1SKBA 3R9XA 3IHTA 3QPWA 4O08A 5EMHA 2OQRA 4RJJA 1XRMA 2I2CA 2ZYDA 4KQHA 3T3NA 3ANYB 3DBLA 1M76A 2G28A 4MUAA 4ED9A 4M46A 4ZQGA 2Y99A 5GADl 5ELMA 4OG2A 1NW5A 4OBWA 1WEKA 5F77A 5FTKA 5SZIA 1G2IA 4HUQA 1IOZA 1O5IA 5CXSA 2IWHA 5G0SA 3QA3E 1P6XA 4PZUA 3WYBA 4C0BA 5ELXA 1L4MA 3GVCA 3MVEA 4UQPA 2VTKA 4MV6A 2DZDA 3L8DA 4PGMA 2CEKA 3PJRA 3QYAA 2AOXA 3AKYA 1FS6A 1LNZA 1VZ3A 4L22A 3UUWA 5I6DA 4Q3KA 1OSNA 1YONA 5TS2A 5E6SA 3IBFA 4MSUA 1NRJB 1IXSB 4GLFA 5FLKA 2OV1A 4HEA1 4RCZA 1IY9A 4L15A 2O52A 3VYRB 2ZUCA 2FPRA 4KRGA 4MPRA 4QTTB 4ZI7A 2YIDA 2PVCA 3ON5A 1RXWA 3KZVA 4P4SB 1E9VA 5AM3A 2RK4A 2OSVA 3TAXA 1X19A 5AOVA 5C1PA 3HKCA 2W58A 1ECPA 3RSOA 2O06A 2QU8A 3JATA 3CT4A 5HCUA 1DO8A 2GZ2A 4EA7A 1G2PA 1H05A 5LP6A 1WOMA 4GWLA 1M2OA 4DWVA 4I6GA 4LE2A 4ZICA 1XMIA 5DX0A 1TFRA 1OA0A 1Q44A 1SKYE 3MW8A 3NAMA 3V5NA 3WKDA 4BFCA 4BN4A 3AJDA 1H5QA 3S3TA 4EVIA 3JRNA 5AOBA 2BFWA 4MIEA 1RWPA 2J33A 2EKLA 3EYWA 4NZMA 5K1ZA 3RVBA 1REQA 3K0KA 1W94A 3NCTA 1J07A 3IE1A 1H85A 3NWJA 4MARA 3SEQA 1OU0A 1G3MA 1T2NA 1XAHA 2WV7A 1N6PA 1B7GO 5TMPA 1U4NA 2FMXA 1VRCA 3ADDA 3JD3A 5DHSA 4DJEC 1PJRA 1NY6A 1NHWA 1OTXA 1PYGA 3FPSA 4JVSB 4L0QA 3WVNA 3HCDA 5HXAA 1SHJA 1SKMA 2DHCA 2H08A 1DP4A 3D6AA 1ODTC 5EKXA 4WCFC 1JMYA 3PD1A 1AKQA 1M2WA 2X4DA 4KFUA 4LHEA 3KXLA 3KYBA 1E3TA 1ZA1A 1GGJA 2P5YA 2QX6A 2WPDD 3KD2A 3O3NB 3QKWA 4MRNA 4YAOA 4IVNA 5B64A 2LRHA 3HJRA 4BDSA 4K81B 4DDMA 1JXOA 3VJKA 3SHWA 3HWX1 4W7IA 1CY1A 1QLJA 4MR7A 4N7JA 4Y2UA 1XPOA 1QP0A 4Y9RA 4OM8A 2C3PA 4IGIA 5DNAA 2IEBA 4HJXA 4LWPA 3D64A 1SUDA 3ZIDA 1SC9A 1ZC3A 2V7PA 5IF3A 3ZS8A 1ZHOA 1P72A 4I14A 1E9CA 3JQAB 1W4ZA 3T9FA 1MT3A 1EJ6A 3F5MA 3OUZA 3UAVA 2VH1A 4RLHA 3VR6H 3ZWKA 4NR0A 5KTOA 3WLOA 4HNVA 2MYUA 1ZGBA 5IXSA 2N47A 1K6IA 4ALJA 5A1TA 4MV8A 2WTUA 1K68A 2DG2A 4PSCA 3CKLA 4G0MA 5DBOA 2BZGA 1QHIA 4S1PA 1W5BA 2GRJA 1SU8A 5J2TF 1DEAA 2EQ5A 2PKXA 3OCUA 4MUIA 4RKEA 3B2EA 2R8OA 5DLQC 3T15A 4XOIA 5CBPB 2EZ9A 4YECA 2XA9A 4RNDB 3K9NA 5J40A 1OB5A 4Y6RA 2A86A 3W2FA 4WCFB 4J0GA 3FPLA 2J7PD 3GJQA 1N9KA 3QG1A 1KQFA 1E2HA 4XCQA 3JCZA 1CJKC 3JASA 5BQFA 4PSUA 2XQGA 1UL1X 4DV2B 3LOUA 4JBNA 4N7MA 1ADYA 3GEEA 5EXPA 1ZK4A 3X1YA 4YIHA 4IVQA 1T3HA 4NXNB 2ZUVA 3UUEA 5EQTA 1P9RA 1Z73A 1EUCA 2PYIA 2X0EA 1KJQA 3GLKA 5AUOB 1MEOA 3H1GA 3ZHTA 1U2GC 3WK6A 4YJ2A 3HDQA 3F46A 3N76A 5CDYA 1JQDA 2H1CA 3FR7A 3G1WA 4RVHA 1SKUA 4Z8XA 1YCHA 3KEGA 4XVHA 1W0JA 3SDSA 2Q6TA 1WDWB 4ZVPA 1P19A 4XGKA 3SKYA 2G82A 3WYNA 4C7XA 1CULC 1KDRA 1C8KA 5F9FA 4Y8VA 3G02A 3WGJA 5JAQA 4KAXA 4BPBA 3EDMA 2BMJA 5MHTA 1KFKB 1SWVA 3EG9B 2G9VA 2D1QA 4C6TB 3GD5A 1G3RA 4WOCA 4QPCA 4JH0A 4HRXA 1VL1A 4KE9A 1O5OA 1TO2E 2ZBGA 3TZEA 1RACA 4GM1A 3L79A 4BNUA 1NG9A 4B2PA 3K5WA 4DDTA 5JDCC 3JYOA 3HUDA 2GPAA 1QJ4A 3VX3A 3QK7A 3ZS9A 1C29B 5C1OA 5LOVF 1NWCA 2HA7A 3WYCA 2A9OA 5P21A 5B3LA 3EIUA 2ZRBA 4A0QA 4E13A 3EDQA 5B55A 4HDCA 3LY8A 1DCTA 3BSYA 5JH7B 1XAGA 3R0QA 2FQQA 3RAJA 3SS9X 1BN7A 1GG2A 2GLUA 4JC5A 3UOGA 3BQNB 2OXCA 2ZR0A 1G59A 2HSGA 3E58A 3N9IA 3STVA 3W5SA 4CU5A 1M2NA 3GCGA 1WLSA 2C4NA 5IT0A 1ETUA 1GRVA 3SHOA 3FTPA 2IITA 3IUMA 2A4KA 5GONA 2GBLC 4J7UA 2ZAIA 2A1TR 4Q9JA 2ADOA 4D43A 5A2GA 4J91A 3TQTA 1KS2A 5B6JA 5C18A 2ZWVA 1IN6A 4E2YA 4OXNA 4LTDA 5EWJB 4MI6A 2AQIA 1PR3A 5D7NA 1OB2A 1ODFA 3W7AA 5K8UA 4BY9E 3T1YB 4C2AA 2CLMB 2OCAA 3R3VA 1X7GA 2IYSA 3U4HA 4F6RA 1D6JA 4FOOA 3F90A 3FSJX 1ZOIA 4X1KB 3WL4A 1V8FA 3AFNA 2W6CX 3OIWA 5F3RA 3VKFA 4CQMA 4UASA 1HDRA 4LGYA 1BGWA 3ZDEA 4N3GA 5CA1A 1NQXA 4GLJA 3EPLA 4FE4A 2CLKB 5CPFA 5A3RA 4NH0A 3AR6A 4Q47A 1NQAO 3RVSA 5IASA 2PS9A 1BW9B 1BEZA 2JJQA 3RF6A 2A0XA 1PFUA 4RFSA 3IQIX 4KYTA 2PE5A 1Z83A 1SRRA 3AL2A 2NU8B 4K9DA 3HSSA 5CLHA 4NBVA 4IAOA 2QR2A 3CKYA 5EWMB 4ZI5A 3UG7A 2ACKA 3FOZA 3QYFA 3ROTA 5K05A 1ZGAA 2K4MA 3EIEA 1NT2A 1HFEL 1XMVA 4LKOA 2XYRA 1GWNA 3ER9A 3OIUA 4FHEA 3AO0B 4IWNA 5IHPA 4A82A 4NI5A 1WQ3A 2OD7A 2QW1A 3A4NA 5CRIA 5DASA 3TNFA 2HA5A 3V1MA 4MCHA 1WDTA 3TNJA 4C0SA 4A2PA 3IA2A 4FZ5A 3OZXA 3RRMA 1PJ3A 2ZE5A 1M33A 2WM8A 4EUHA 2E4ZA 5LDDC 3JQRA 3HN6A 4KG7A 1INLA 5JSKA 3F5FA 1T3GA 3OIYA 2X8AA 4NFLA 4XE5A 1DC6A 3VKVA 2V5VA 2BMWA 2GK7A 3AFOA 2BTOA 5U4XA 4DL9A 3ADCA 1XEXB 2ONCA 1EI9A 3PK0A 5LQCA 1AX9A 2D2VA 1DBQA 1LRKA 2BHTA 2DULA 3G0DA 4V3BA 3ZTTA 4B4VA 1I10A 1JGTA 4DEYA 4Z7QB 5LKRA 2JS7A 1IK6A 2W11A 1W34A 4HAWA 4OFWA 3GRPA 4C06A 5CB0A 2Z6UA 4O4JA 4K40A 4WLNA 4W1RA 2PUFA 3R7FA 2NZ2A 3PUVA 3IQEA 1GDDA 2HIHA 4LTNA 4ZVMA 2HRCA 4L74A 3NVAA 3EXHA 2LDXA 1SUPA 2I5PO 2YJGA 2V0CA 5CVUA 4QPPA 1Z4LA 5LN1A 4RCYA 2IYQA 3TGPA 4H31A 1L5QA 2QHXA 1T8YA 2OHFA 3KZMA 4MR8B 2OFXA 4GP9A 3D4LA 4HGQA 4DC1A 2B1IA 4GOKA 3X0DA 1WHSB 1ZYUA 3RRZA 1DEKA 3TIGA 4L8YA 4KWEA 2IIPA 2FZ5A 4OQMA 2IL1A 4KLNA 5LLDA 3AKEA 1L4HA 4R71A 2ZRIA 3SJCA 1DU4A 4I4IA 1NDHA 2Q4BA 4BRUA 1KZ6A 5CCBA 4D80A 4TT8A 3ETCA 3NKLA 3EGCA 2CJWB 3AHGA 5DTQA 1G38A 4Q16A 4HQ0A 4K3VA 1QRDA 2P2CA 3CHYA 3FIUA 4JEIA 1O6ZA 2P4HX 1XRQA 1FP2A 3EXIB 3GDHA 4L6AA 2FH5B 1U8ZA 4W1QA 4D97A 2P27A 2M2IA 2FPGA 4RK7A 1BMTA 4LOIA 5C0OE 2IS4A 3VMMA 1B23P 1XNQB 4YR9A 3F6SA 2AI1A 3FOCA 5DM0A 3E18A 3G2LA 2P90A 2Q28A 4N39A 1BQ3A 4C0LA 1AN9A 2HWYA 2GLTA 1IU9A 2V6JA 2PRIA 2VL7A 2ZVDA 4LGVA 3IB6A 3MCUA 1D2MA 4QUIA 5KKAA 4C1NA 2JZOA 1IAVA 3JTMA 2NT3A 3IAEA 4KNVA 3FH0A 1FQOA 2X9GA 3NBMA 1ESMA 2QTNA 2ZSJA 4I1VA 1X7XB 1E2IA 4UNPA 4EL0A 4TYPA 1VHTA 2QLFA 1UXGA 4JYPA 4DUYB 2QTZA 3KAKA 1SBZA 4F8YA 1GAXA 3AYXB 2XUIA 3MT0A 4L57A 4DCJA 4E31A 5KNCH 3R3HA 2HU8A 4FNOA 2FMTA 3IIKA 1GKKA 1NBMA 1A9OA 2H29A 2IT1A 4HG2A 4LF4B 4BNJA 4FFRA 1C1YA 3TTUA 3GOHA 3OM9A 1GA1A 4BZXA 1ISMA 2BDEA 2HGSA 4GNKA 3HRHA 2TYSB 2A7XA 3BXFA 3K70D 2HFJA 1CRWG 1R0LA 1SO8A 1XYYA 5AT1A 4ZZ2A 1QZUA 3K16A 3R5TA 4PG6A 4X90A 4MQLA 3WAKA 3E7WA 2WWYA 1Q84A 2I91A 3IUYA 4R1UA 2YHBA 4B4KA 1VSUA 2JBWA 3MCAA 5KKCA 2VSXA 2EYUA 1L7PA 1CR2A 1YBFA 2IE8A 2YZ7A 5D5HA 1GV1A 2PSFA 3A31A 1ESCA 4G97A 3ITDA 4Q4AA 2ZS7A 2BFCB 1XTJA 1JQAA 1KO7A 4Z99A 5HM8A 2B3TA 1XPUA 5ALOA 3TQCA 4YJ3A 5JNVA 1SIOA 2NVOA 1T36B 2I4MA 4DHEA 4BFTA 1P5ZB 2C2ZA 2PANA 4HNHA 4OHYA 3PUIA 2VQ6A 4CKZA 3F7TA 2BSXA 1UH5A 3WIUA 2R60A 1KPIA 1DRJA 3EQ9A 5J3JA 1M2EA 4RORA 2C0CA 2NO9A 1ZNQO 1G5TA 4I55A 2W2VA 3KP1A 3MUOA 4H4CA 4M6WA 1EGHA 3AHEA 3BVPA 3HCPA 1SU7A 5BMVA 2QAGC 3ZV4A 2VJQA 3H2JA 3ONWA 4GGPA 5F1YA 3EGDA 4DUGA 2DCMA 3GLVA 5K3EA 4OYHA 4R2MA 3ZU2A 1ZU4A 3E5HA 2O14A 2JK1A 4GH5A 4M54A 5KDLA 5BWOA 3NOXA 4UNRA 2I67A 4J0EA 1V4NA 4RTOA 4IIFA 4KVAA 1NV8A 1SVLA 2OHGA 3FMGA 3Q8XB 2Y8EA 3E03A 2CFRA 3ILHA 4KMOA 4RAQA 4UU8A 5E4YA 3SEFA 2R11A 2OORA 2VHCA 3MZ0A 3TL3A 3RS0A 4K7JA 1QK5A 3OKFA 1ISPA 3L7JA 1U81A 1EFRA 4LXYA 3COZA 4MUFA 2EBFX 3DTTA 4H1VA 3WYAA 5CLLA 3FKJA 2WIBA 2CV1A 1BMDA 3T4PA 2ZQ5A 1JT2A 3MINB 4QOJA 4GR5A 4BX0A 1RXEA 1DBRA 1EFTA 1TCVA 2XNHA 3TN7A 2ZRJA 1QTRA 3ADKA 5CT9A 1Y1QA 2A57A 1U1EA 5ILGA 3MM4A 3PL5A 1SIWA 4PNPA 1U9YA 3MD0A 2GPJA 4RD2A 4ITRC 5JH7F 1ENZA 4KAJA 1NVGA 5B7QA 4G4JA 1R2QA 3IAHA 3QBVA 1MMFB 4E15A 3DE0X 3I1FA 3AUXA 4A8PA 5L9AA 2P6UA 2GETA 1Z8DA 3EZ9A 4HDOB 4U8HA 4YY3B 4JSYA 1BDIA 4NX2A 1J1IA 1RKQA 1UK8A 2E0IA 1IIRA 2GILA 4BWYA 1Z5PA 4Q4HA 5AHXA 1R9JA 5E8JA 2QP4A 2OKCA 5HVNA 2GFHA 1G63A 1R6XA 4FS8A 2FSHA 4KWHA 4Q3AA 1EP1B 2IH2A 2C5AA 1SELA 1DARA 1PG0A 1E6CA 3SYKA 1OWPA 4CIWA 3DQPA 4U1RA 3H5WA 1HQDA 3K72B 1FLNA 1JEEA 1E4OA 3F1LA 3OPYB 1E0DA 2J4FA 1BH2A 1QIDA 3GA5A 4G0ZA 2R62A 4GS5A 3SX4A 3VZQA 1QP7A 2F90A 1MBZA 2ECQA 2QT1A 4FE3A 3GGJA 4WY2A 5FLEX 4ON9A 1I01A 4CLRA 1G55A 1ZVMA 1T5OA 4BMSA 1T2AA 2X1LA 3RUDA 2BGJA 3HKEA 5EN4A 1XROA 4DG5A 1MNQA 4PGFA 1NMXA 2F1HA 4PWZA 5BWLA 1QMPA 1R5JA 4ER0A 3CJTA 2JKVA 2O3QA 3P4UA 3WLKX 2XZDA 1Q16A 3R3JA 4G0UA 4DE5A 3OM8A 2JAOA 4HDNA 1O9GA 5AJHA 4UTOA 4E51A 2Q0XA 4L6IA 4X64B 3BA1A 1TC1A 1NONA 1A7KA 3OETA 1Z0IA 1XF1A 3PP8A 2JHCA 4KOAA 4O1IA 4KV7A 4Y2HA 3RRYA 3H5IA 1SQ6A 5BSGA 4RIGA 1K63A 3CG0A 1Q50A 5THKA 5DBEX 4QRIA 2J5BA 1D1SA 3O03A 3G0OA 2QDXA 4URHA 1P3DA 4C4ZA 5FI0B 1X7ZB 3FMOB 3SVZA 1QP4A 4TYYA 2O5EA 1AF4A 3FYSA 1QC5B 2C2KA 3Q6MA 1WBJB 1KI9A 2XGGA 4HEJA 2C9MA 1IONA 1XN1A 4J1NA 1V2GA 2D1RA 2QRMA 4MPJA 4IZHA 4X3PA 2QL9A 4B2YA 4NMLA 5AUPB 5JZOA 1JR6A 3QBJA 1F2UA 3FYTA 4RLSA 5BSMA 4M0LA 1KDOA 3OIDA 2AI2A 1R0WA 2CUKA 2O6LA 3DZBA 2PMWB 3NG1A 1MDFA 3DJFA 2VNIA 4P84A 1WIWA 3LVQE 3WL6A 2O2XA 3BCHA 5KEIA 5KPJA 1C41A 2V9PA 2DLNA 3D1VA 4CVNA 1M0EA 5BVHB 1E7MA 5IFKA 5JNWA 1IZZA 2EX1A 2NUTA 1YC5A 3EQ7A 2M6KA 3G1UA 2ABWA 2QWXA 2C00A 5FHRA 2UYGA 3CNEA 3FOEC 4BKOA 1UPUA 1A69A 3A2NA 4X3OA 1DV1A 1CSEE 2IIBA 1GIAA 1LLQA 1S89A 1E63A 1RAAA 2X4LA 3CS3A 4K05A 2PV7A 4P4GA 3C4JA 4F4DA 1E1RD 1TYZA 3AEUA 4GMKA 5EIWA 1O3YA 2X1VA 3I9V1 2GSDA 3IHWA 4Y2SA 1BX1A 5EP3A 1U7OA 4BNDB 4EKDA 3FIJA 4I3FA 2RK6A 3BXXA 3GUUA 3UUGA 1JAZA 3HE3A 2RHHA 4MH0R 1G8AA 2EGHA 4HBGA 1GYPA 1OIWA 3UW3A 4B6OA 1IRXA 1JTEA 4F9FA 4NHEA 9MHTA 1TDJA 2GBFA 1J2JA 2PT9A 2OB1A 4OK6A 3W8EA 1US8A 2FPOA 4EZBA 3U7EB 5ITVA 1GLGA 4W7HA 4IX1A 5FPHA 4C3VA 1JN0A 2C8LA 3LX6A 3F47A 2EFDB 3MG9A 4P7KA 4POAA 5FV7A 3ZDQA 2PZGA 3HM2A 3PRJA 4KRXA 3M2PA 5BN5A 3WMXA 3O95A 1DDGA 1FXWF 3ER6A 1QAQA 4TS9A 4RTPA 2JHFA 1P74A 3D8BA 4RK6A 1E2LA 2Q4TA 2OBYA 1NXQA 2Q29A 3X1WA 1UCFA 5B4UA 3ZGLA 5BV0A 5LMCA 4DCSA 1UUFA 2N42A 1QOZA 2DWUA 3SFVA 1A9ZA 2AE2A 3GYGA 1LDMA 1NLUA 3KD3A 3NHLA 5EUMA 5B6IA 4KO3S 3JVIA 2ZTSA 4KQIA 1RRCA 1VLHA 2DRIA 2CB0A 1TMYA 2AI3A 1YIAA 2CMFA 2R7NA 3GLUA 4RE6A 5J4HA 3M3HA 1H6AA 3KT6A 3H9QA 3IUQA 3IT3A 1H42A 3OQJA 4JNKA 3BDVA 5EA2A 5JXWA 3S2YA 3ZY4A 1YFLA 1NXOA 2ESRA 3LNCA 2VK1A 3ZBUA 1VKHA 1HM5A 1O94D 5DYTA 2J4DA 1RXCA 5A06A 2BGUA 3DEHA 3GUVA 4U5QA 5J5AA 1JU9A 2G77B 1RAHA 3LDFA 5EMJA 3W8RA 3AERB 3GROA 3C5CA 4IDOA 4ZVLA 4XLTA 3R0ZA 3G0IA 1E98A 3ROXA 3O8QB 4F93B 2WLSA 5JCJD 4LRYA 2YHSA 1F9EA 3MCVA 3GFVA 1XUOA 4C2TA 4K8OA 2WOOA 4LJ8A 1BAPA 1TVKA 3KJQA 5IH3A 4WESB 4CIVA 1FU7A 2JAXA 2XUAA 5AUQA 3KFVA 4OV6B 2P9EA 4RPIA 4OQEA 4WKCA 4RZHA 3RDPA 3V7FA 2J9RA 2YV3A 3E8MA 3PPIA 4ZHQB 1ECBA 2HEGA 4QEKA 4ND1A 5AVOA 2QN3A 1DKUA 3V6LA 3F4KA 4LOHA 2AN1A 1E1CA 1GQSA 1FP1D 4HLDA 4D3SA 4XQGA 4B7ZA 1YZGA 1QH8B 1YZYA 1WVGA 3HB7A 4OEHA 3L01A 3DV0A 5EQFA 4EPRA 3ESZA 4BBZA 1Z4PX 2XOXA 3F0TA 3RQSA 3C7TA 4DCCA 3Q5DA 2FDXA 3L1UA 1TT7A 3MJCA 2G06A 2XA2A 3QELA 3GGSA 1KH3A 2CSUA 1PG5A 4FXOA 1CNEA 2Z2KA 1K8YB 3ROQA 1RC8A 3MELA 2GM9A 1XQVA 1XZLA 2P77A 1V1RA 2CXNA 4UDYX 3TM4A 2G8NA 4IJ6A 2ACWA 3PC4A 2NG1A 1N2CA 1GQ2A 1TU4A 2AA3A 3S2SA 1BE8A 5K0BA 4ND2A 4YMHA 1WP9A 5A5VA 5IJ0B 5JVDF 1ZLXA 2FR1A 1A95A 2FN3A 2XMQA 4I3GA 1OILA 1ZNYA 2JHPA 3IL2A 1NDQA 4KN5A 3MIZA 4Z6KA 2F1IA 5JBQA 2G70A 4I2VA 4JC8A 2EFJA 4RX1A 1OTYA 4K26A 1J9ZA 4NU6A 2UUCB 4WY5A 5DULA 5IAEA 2ZIFA 3C6BA 3HNRA 3P2JA 4P3PA 5J2TA 1YA6A 4B80A 1N7HA 1VECA 3GUZA 2QPLA 4PXYA 1WCXA 2NZXA 5JSUA 1CWUA 2ZAYA 2REQB 4GYKA 4AQYB 4D99A 2CFTA 1MAWA 3ORSA 4ENWA 2I29A 1UBLS 3Q2IA 3Q7TA 4Z9XA 1IJBA 4E12A 3KV1A 2VNJA 1P9WA 2WU3A 3SFTA 2O57A 3TPZA 1UBSB 3ZV5A 4DV0B 2P8JA 3GEIA 2W6OA 3CLSC 3F9CA 2HQRA 4P36A 3GRRA 3GU3A 3RSHA 1U8UA 1H1LB 3HR7A 3DO5A 4Y2PA 3U4QA 2WFMA 1AHIA 4RQUA 2ZSEA 3AF5A 5H68A 1E59A 2BBTA 3V1TC 4KE6A 3U4MA 3IAM1 1JIUA 4MEBA 3EIXA 3ZQ4A 3A37A 2FPIA 4OL0A 3DOCA 4RDCA 1C1HA 4MKZA 4D0NA 3R6GA 3VPCA 1USUA 1EE2A 2PX8A 2WSSA 3A6LA 3EBLA 1Y3HA 3T3EA 4BIMA 1KAOA 5EWLB 2GI4A 2XCOA 2E18A 1O8BA 2J9FA 3L40A 4ZRNA 2OXRA 4C6HA 1T4GA 5TLSA 2CF6A 4YXWD 2RHMA 2ZE6A 4TVBA 1T91A 5BVGA 4EJ0A 1EQUA 4PC1A 4Z4HA 2ZYRA 3I9LA 4PC3A 1LFDB 5HZGA 3I04A 2BZ0A 1WZEA 1S0UA 1LDEA 2GN8A 1II9A 2ZJAA 4NPAA 1FMJA 2PN1A 5F98A 3KTAB 2X1MA 1DWPA 3HR4A 4OCZA 1JDNA 2X41A 4K46A 3RYIA 1ILWA 2NUAB 3KTDA 1DPFA 2JIBA 4Z1MD 4QGSA 5B1YA 4A5OA 1WCYA 2FWRA 3KOYA 3T0IA 3V8VA 2JGRA 3EWIA 3ZXYA 4ODIA 1VOTA 2VRCA 2D1FA 1XKTA 4XWAA 3SXUA 2IELA 1FYVA 3FAZA 5CDFA 3OWHA 4DGSA 5CT6A 1KVUA 3GNQA 4PSAA 5BV1A 1JKJB 1ZQ9A 1JDUA 3IBSA 4PWYA 5ITZA 4RHEA 1T3SA 4FCCA 2M6LA 4ML3A 2FPKA 3C45A 4FQ7A 3LBYA 4BFZA 4ARZA 2VAWA 1T9BA 1YRBA 1ZIXA 3Q5EA 3OBBA 3ZHSA 3TQOA 3E7DA 1IHUA 4KDFA 3O9ZA 3EWSA 3G5TA 3VZSA 3UQYS 1ZD2P 1ZD5A 5JANA 3NTVA 2HR1A 2PBFA 3HKDA 1TKBA 1EB9A 3WTCA 3OO1A 3I2GA 3K6RA 4RM3A 4WE3A 1Y8QA 1PBNA 3L0BA 4JN6B 5F51A 4ZVNA 3UAWA 3LT5A 3ZBTA 1KFCB 5GOTA 5EEGA 3WYFA 3Q40A 4PVCA 4AN1A 4QYTA 2WY2D 2AN4A 5E0OA 1XLUA 3U48A 1D2HA 3PEYA 4D3ZA 3PQ4A 4V0SA 4B3FX 3A6GA 2VT2A 2ZPTX 2WVAA 3STUA 4KN9S 3M6XA 3V4OA 1CJMA 2A30A 2IS1A 4II2A 2C2BA 1T0UA 4UCFA 3THRA 2VZ0A 1CUVA 3O7MA 5DP1A 1MX3A 1Z7BA 4KLCA 5F76A 4QGHA 3PNOA 2QROA 5CAEB 3RYFA 4EUSA 4YDRA 5IULC 2G1UA 4NBWA 1SOVA 4AKSA 1LU9A 1S4MA 2XX3A 3C5VA 2GTIA 4GZ3A 4XFDA 1SUBA 1T8WA 3WBFA 3OJCA 5IH7A 4V39A 4RE5A 3FSRA 1JJBA 3F8TA 4UCWA 3DT8A 4EJSC 3K9LA 3CVYA 3QG5A 4N3CA 1HDZA 1JIXA 3M4JA 5DGIA 3RS9A 2QUZA 3I32A 1KEKA 2X3YA 4I4NA 4M36A 1TUEA 3GPBA 3NV9A 3F74A 1J2EA 3KR9A 4KXUA 4RENA 2J30A 1C0LA 3D0OA 1JYEA 2FQ1A 3BXOA 4S0XA 2H31A 4YH1A 5IBPA 5TGDA 3VR3D 4ER6A 4RTJA 5F4ZA 2VHZA 3T35A 4UCQA 2GZ1A 5EHNA 1MCZA 3IOYA 3OTGA 2A94A 3JD1A 3E15A 1XDDA 3OMXA 5DN9A 1ZITA 1DAGA 1EINA 1RMYA 4UM7A 4AJPA 2WSBA 3JQ9A 1JJ7A 1RQLA 2O20A 4RYLA 3BMXA 4X66B 1IHDA 3U44B 2XF8A 4JB0A 5JFTA 3PUHA 3UMMA 3IQFA 1QV9A 2J41A 3E3OA 4XM1A 1GTRA 1L7NA 2C9ZA 3ESBA 1SXJC 3ZIAD 4U8GA 1JA9A 4D7AA 2WJ6A 1FTQA 3ETLA 3NKFA 4JL6A 3PLNA 1E6KA 2EDCA 2I6GA 4ME6A 4P4SA 4TTQA 3N75A 3RFTA 2HKIA 2HYDA 2PFGA 4K6CA 5KHAA 4CEIB 3EZYA 3DE5X 1AMNA 3QMPA 2GXUA 3CEPB 2GAJA 2QP3A 2VDVE 3KHUA 3K9FC 5FFNA 4P4TA 4EJSB 1UEJA 4FR0A 3WK8A 2UYYA 5D84A 2QAJA 5CEEA 3T3IA 4RO0A 4DHWA 1Z8NA 3HBNA 1QG4A 1ESDA 1E2DA 2GEDA 2ZRMA 1O97D 2FRVA 3OM0A 4DDVA 5KWSA 2V74B 4XYGA 2CVHA 3SSAA 1EXNA 1UBHS 2EP8A 2Q3CA 1K4YA 4Y2QA 5C53B 1SVMA 3GUCA 3U9SA 1ZXBA 5EIAA 2BI4A 1O2DA 4R2KA 2ID7A 5COQA 1PR4A 2VPPA 3OJOA 4ETMA 4QARA 1A9XB 1AD2A 1R00A 2F62A 4GBGA 4RQTA 1FVXA 3QTBA 3RVDA 1SURA 3QW2A 4D79A 2R4QA 1ZVKA 3BICA 3HI4A 4KLAA 2BJHA 3Q15C 5FTJA 4L27A 2C2MA 4QOGA 1L1EA 1OFIA 4PHTA 3UKDA 3L0SA 3HJHA 4FNAA 2VDJA 3ZU6A 2AWNA 1DSSG 2CLIB 2PJUA 4PC2A 4UQOA 4WOBA 3RO7A 4AROA 1UWLA 4GSKA 2HF2A 3KXDA 2QLNA 2VUHB 1DT5A 5COBA 3R6LA 2XCQA 4I8DA 4EEKA 1L7MA 3KKMA 4YAWA 4YQZA 1AQNA 4GI7A 4Q19A 4C2UA 4WBNF 3P97A 3H7IA 1Q15A 3C1AA 1UOPA 2KS6A 2ZGVA 3CLTD 3JQAA 4DLAA 2QP9X 2GJ9A 3ZV3A 1ZD9A 2GCIA 2R6DA 2Q1XA 4L1KA 3R7LA 3TLAA 1QB8A 4XYEA 1CJUC 4PQGA 1JHYA 2BKXA 2AFHB 2C9OA 1FDVA 3ZGVA 1ZU5A 2PZKA 1QFMA 2NV6A 2YXDA 1BEEA 1A3CA 4OF4A 2WVGA 3DWIA 1N2CE 3K4PA 4ZYYA 2XSZA 4NZYA 5I9BA 3K35A 1ZCAA 1UAGA 2VNSA 1I5EA 1NW9B 4QJ4A 1R9NA 3WGKA 1LFAA 1Y9DA 3CKKA 4F7DA 5CBPA 1KXZA 3SIWA 3WQRA 5BN4B 3F8SA 2V8BA 3CRVA 4WCFA 4D8XA 3BCSA 1C9JA 3ITEA 4JD5A 4C4SA 4RH3A 4E5MA 1DAOA 3P9IA 4EHKA 2YV5A 3OZ7A 1XL1A 4M87A 4AY6A 3F98A 1BH6A 2AR0A 3W3AD 3WGZA 1XEAA 4H6VA 2BKLA 1WDLA 2R65A 3EARA 8MHTA 4R83A 4AF7A 3LX5A 3G9QA 3NCHA 4G4GA 3PFFA 5IC5A 3KQWA 5AW3A 4MGYR 2FPWA 3DW1X 5HFAA 4R9SA 3DZDA 2RFLA 3WRVA 4HQRA 1Z6QA 4J0JA 1CEQA 2IY7A 3ZUGA 4LJ9A 1PFQA 2OUKA 1W1WA 2YIMA 1FUKA 1II0A 3ICWA 3M81A 1RPJA 3OFNA 3TH5A 3VR2A 2CFSA 1N1DA 2PUGA 3FYUB 4EHJA 3ZHBA 3P9KA 1E6EA 1JHOA 4F3NA 1G5RA 3KJNA 4C6TA 1YAJA 4YMGA 4L0DA 1GNPA 2R6JA 2OQVA 5BWCA 2QD2A 4V24A 1ZSVA 2W0MA 1WXQA 3AUAA 4Q7KA 4WXHA 2GVNA 1RYMA 3SFZA 4BFUA 5LQRA 2E55A 4C22A 1ZX1A 4U6NA 4BTLA 3L7KA 3R3SA 4KITB 5J4KA 5LMNB 1L5SA 1XZFA 3IP8A 4ZREA 3C3AA 3NBKA 5LJLA 2LTAA 1RTKA 3K0AB 4TV9B 4RLFA 2HI0A 1O96B 3MC1A 1IB0A 4L6CA 3R9IA 3WG9A 3X1ZA 1Q1NA 1JXAA 1XTPA 3BD8A 4LE1A 4CCAA 5JH7A 2IUFA 1W4CA 2FSSA 2JZCA 2QKYA 2X5OA 3I6MA 3JALA 2RHGB 4RL6A 1EWKA 4WFIA 3HRIA 5CYPA 1E1NA 5KTNA 2WTMA 9GPBA 5KX5B 2DSTA 2ZITA 2WSYB 4Z0NA 2NMVA 1SFRA 3R5XA 1U2GA 2NVUB 2VWPA 2PX6A 3WXBA 2PY6A 4QPNA 2XYPA 3A6JA 3NIDB 4MVJF 4XGNA 1XEFA 5FAXA 4O2AB 1NR7A 3ZV6A 1SPXA 5EWJA 4DMGA 2KWIA 3KIPA 3U37A 1YA4A 3A6DA 5LFAA 3D3WB 2CC2A 4RQAA 3VR4A 2YWCA 4JI7B 4GZLA 1KA9H 3ZGNA 3K20A 5J4LA 1YS1X 1RQXA 2EHJA 2PRZA 5BSVA 4DR2B 3KFXA 1Z62A 4I8IA 4X1KA 2JH8A 5C8ZA 5C3MA 1L4UA 3SIXA 3BH7A 3OX1A 3BRCA 1A8SA 2V45A 3OCYA 4H1UA 1QRAA 4DY6A 3DC7A 1P61B 3EBPA 4LJ7A 4HK4A 2O7SA 4JKIA 2VCEA 1EBBA 1ZD4A 1BW9A 4RY2A 5JDCA 4TYNA 1T1GA 1H6CA 3G9UA 3VZBA 3TEFA 3KKLA 2NU8A 3BYZA 4Z7JA 1DEHA 5KYWB 2ZS8A 3A4LA 1DKNA 4GKVA 4V3CA 4DW8A 4FMBB 5EWMA 4CDRA 1KKMA 1WMDA 4N0PA 3BHNA 2DR3A 2QNIA 4BOYA 1GFZA 1ZI9A 3ND6A 3HO8A 1V8OA 4BQEA 1K9VF 1YU6A 1GPWB 1TKAA 2SNIE 2ZIXB 3IEIA 2ZT8A 2FETA 4BB5A 1V7CA 3DF7A 3MCTA 5LWHA 5KUTA 2O8DA 2F9MA 3W9SA 5E2BA 5D5PA 2QLLA 1AA9A 4ZCQA 2I9PA 4IQ4A 4NCBA 4GBED 5CFZA 1FQKA 3CGGA 4INZA 5EXEA 3T9AA 5KCZA 2FFJA 3HVRA 4LF8B 2FJ0A 3ANSA 3NIBA 2UYHA 4HAXA 2Q3JA 2DUNA 1F5NA 2YJ5A 5F2EA 1D4ZA 1XEXA 1KDZA 4PYOA 1MO5A 3AI7A 3ZZUA 2G7MC 2D0DA 2ZRPA 3ZWAA 4NLLA 1CEYA 1VXOA 1T9AA 2ZUDA 3LY7A 4YO8A 1PSZA 2R8YA 3TW6A 1ZNXA 3BTOA 4XWWA 5DO9A 3GJXC 1NBOA 1USKA 2NTJA 2NU7B 3G2PA 1GTJ1 4BTEA 2Z5VA 1G291 3CRNA 3MMSA 3L46A 2Z2YA 1CP2A 4L50A 2W6IA 2WM9B 5JU6A 1C7QA 4YFVA 3VNVA 1VJCA 2PTHA 5A4KA 1UK9A 1ODCA 4R8KA 2ZTHA 4FD2A 3NOQA 4QOHA 2P9FA 4YT2A 3GELA 1XR3A 2F3RA 3IT1A 2H5EA 4H3SA 2BDTA 5PGMA 1KOLA 4DR3B 1CK4A 4BS9A 4BX3A 4BVKA 1E6WA 4F7WA 3H2ZA 1MOQA 1ZI8A 2GNPA 2I8CA 4HQLA 4MR8A 3PUZA 1NIJA 4ZP1A 4BO8A 2CFIA 1Y7TA 1WHSA 2C2WA 2NXEA 3DLPX 4ES6A 1U7XA 5A4FS 2G8LA 1PYOA 2WMOB 3Q9LA 3FRHA 2DFLA 4X62B 4WN3A 1N6IA 4MWEA 3ESCA 2GXSA 1PFYA 3L05A 1GTMA 4P5DA 4C43A 2YXEA 2VUUA 4QPZA 3T3MB 3U4IA 2CJWA 4CKXA 5BUCA 3SE0A 1QRSA 4PPQA 2JGKA 2VQSA 3KUUA 1QQAA 3I6IA 3M6WA 5IWCA 1CKEA 3EXIA 4HRYA 1N2ZA 5HFJA 3TLBA 1P4SA 1YMUA 1OHHD 1IZ0A 1L4FA 4TS4A 3K6SB 2Z98A 1ORWA 1QIHA 4BNVA 2WD8A 4HNSA 1W73A 3I3OA 4IYRA 2IBMA 3SLGA 5KYTA 4OFXA 1W46A 2CDRA 3L7MA 2VT6A 4JIMA 3UFBA 1ZNZA 4FLMA 4FBLA 1N7JA 4D82A 1BS9A 3G5LA 3KQQA 4ER7A 3PC6A 5CFPA 3TNLA 2D6FA 3CSDA 1X7XA 1BKSB 3NPMA 3N7UA 4MKFA 3H5OA 3SSMA 4B33A 1DWOA 5C3UA 5HBGA 3T7RA 2C7QA 1DQSA 4GGOA 4GPD1 2XQFA 1UBCA 2WJ3A 1ZWKA 3LQRA 2PNJA 4N7BA 2PJDA 4E32A 3EDCA 3R0XA 1R66A 4MYTA 4D1YA 4E4YA 3LU1A 3H4IA 2H9AA 3C7CB 4I1PA 5DT2A 5BOVA 4AF8A 1MU0A 2CDBA 4FOPA 4NAVA 1I5OA 2GERA 2R66A 4URYR 5ABPA 3WYGA 4KWCA 3RFVA 4WVFA 3ELDA 2HHJA 1N5MA 3PJEA 4FGZA 4UM9D 2H1SA 3GG9A 3WLHA 1SXHA 5CA0B 1IVNA 2YUIA 3KUDA 1MAVA 2JFXA 3I6ZA 4ZZ3A 2QTGA 3F3MA 3P9QA 3PFGA 3PXCX 2YXPX 5JT1A 3F5QA 2RBKA 1QKIA 4HLCA 3ZNNA 3RH0A 2FW7A 4HAVA 1W6RA 2FW0A 4YRBA 2BFCA 4WBXC 1U2PA 3EOZA 1XQ6A 1Y4ZA 3AP3A 2GYUA 1BGXT 1MDBA 5ALFA 1WO8A 1Y7LA 3RTGA 1T36A 1Q7GA 2FSPA 3EOBI 4OI4A 1VRVA 4MIYA 4PQFA 3MXTA 1KBZA 2EFGA 2FK7A 3LIPA 4IIXA 1FDSA 4D2IA 4E2ZA 4UPEA 4B6QA 2FEPA 2WUVA 3WGUA 2XEDA 1UM9B 4WOPA 5LPNA 4KR7A 2FRDC 5CW1A 3TQIA 5T7BA 1QNLA 3W05A 5K3CA 5TF0A 1CT9A 4E