4DQ0A

The crystal structure of tellurite resistance protein from escherichia coli o157:h7 str. sakai
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
195
structure length
195
Chain Sequence
IRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNLHTRVVDLNNLTFDGEYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYYEGWEMVKYNEDVGELHRTDANGNRIKLRFATMLARKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of tellurite resistance protein from Escherichia coli O157:H7 str. Sakai
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Tellurite resistance protein
total genus 69
structure length 195
sequence length 195
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4dq0A00
3M4XA 1X19A 3CCFA 2UYOA 1G6Q1 1EJ0A 2B2CA 3P9NA 5HILA 4OX9Y 5E1OA 3KKZA 5HIKA 1KP9A 2P3LA 2PWYA 10MHA 3A25A 3C6MA 2G70A 3BWBA 5K0JA 2FK7A 3OE4A 1ORIA 3I58A 3MCZA 3R6TA 5DT2A 5ERGB 3JWGA 1NBIA 3E7PA 2IH2A 5F2NA 3R9XB 4YV2A 3FUWA 3LGAA 1HNNA 2UYHA 2ZIEA 4DQ0A 3EVGA 1INLA 4PIPA 5FWAA 2NP7A 3UJCA 2YXEA 3OZTA 3HTXA 4V0QA 4BLWA 3QOWA 4FP9A 5K01A 3LDGA 4DM3A 4PIMA 4B17A 3G2OA 5G02A 1BHJA 2WK1A 1M6EX 2EJTA 3SGLA 3LBYA 2YXLA 2O0LA 4E2YA 1T43A 2BH2A 2Y1XA 3KQMA 2QYOA 3CJQA 2CMGA 3G8BA 5ICCA 3M33A 4RTLA 5K03A 4XUEA 3B3FA 4M38A 5DTMA 5EZSA 5U4XA 5K0GA 4OQDA 4C06A 2B25A 3EPPA 5EKUA 3T7RA 3OZSA 4F85A 4MHTA 3LKZA 2DULA 3FTEA 5HFJA 3UJ7A 3BT7A 3ID6C 4HGZA 1QAOA 3GXOA 2JH9A 1SKMA 2EX4A 1O54A 3L8DA 3LX6A 4O29A 3UWPA 5K0FA 3B5IA 2G1PA 3GDHA 1FJXA 2AOUB 1TW2A 2PKWA 1U2ZA 3I53A 5EC8A 3KQYA 4CKBA 3LHDA 5DTQA 4PWYA 3GRZA 4DKJA 2P7HA 3FPGA 4QQNA 2P8JA 2VP3A 4C03A 3H2BA 4YUXA 2AOTA 3HCBA 3HCCA 1I4WA 4YUVA 2PWPA 5K0CA 1ZKDA 5C1IA 3KPWA 4P7FA 4HG2A 4RTKA 2GS9A 4EKGA 3RIEA 1YB2A 3AXTA 1JQ3A 3Q87B 1EIZA 5T64A 1IY9A 4FSDA 1XDZA 3TQSA 1X1BA 5LQNA 4AUKA 1UIRA 5EIFA 4PYLA 3QOXA 3RW9A 3UZUA 1R74A 5KQSA 4PYIA 4E2XA 2K4MA 5F2OA 1KPGA 1X1DA 3P97A 3GRYA 1X1CA 5FQNA 5K0NA 3FRIA 3HCFA 4A6EA 3DP7A 5K0BA 4BLVA 2JH8A 3OU7A 2ZSUA 3P9CA 4MIKA 2XVAA 4RTQA 1BKYA 4KDCA 3KHKA 3TRKA 3A4TA 1R8XA 2PSSA 3EVDA 2O05A 1KIAA 3GIWA 2IDKA 1I1NA 3A27A 3BGVA 4GOOD 4DCMA 2VDVE 4YUYA 3PFGA 3TFWA 3M6XA 2CKDA 1XDUA 2NP6A 3AJDA 4QTTB 2O06A 1VL5A 2PXAA 2GLUA 2HMYB 4KVZA 4R05A 4R6XA 5MHTA 1L3CA 3DTNA 4GF5A 2E5WA 3G89A 3REOA 4E70A 3KR2A 4X61A 1ZQ9A 3GRVA 2ZLBA 5EEGA 1L1EA 5D1HA 5B1SA 1DUSA 2YQZA 3EMBA 1JQDA 4YMHA 1NW8A 5ICGA 3DLCA 1UFKA 2PT6A 3GU3A 4HRAA 1NV8A 1AF7A 1D2GA 1JG2A 1XTPA 2AOUA 1WXXA 2HV9A 2OPBA 3EGEA 2GH1A 3NW9A 4HC4A 5ICFA 3V97A 2PJDA 2IGTA 4DF3A 5DTRA 1B42A 2PVCA 1VP3A 2OY0A 3GO4A 3HVHA 5EQJB 5KVAA 1RJDA 3DMFA 4JXJA 3M6UA 2PBFA 1HMYA 4P7GA 5DX1A 2JJQA 3KQWA 1VE3A 2UYQA 1G60A 3K0BA 4E32A 3HA7A 4XUCA 5GOZA 3BWYA 3I9FA 4ER3A 3SSMA 1YFJA 4Z2YA 5EKXA 3C6KA 1O9GA 3FUXA 5E8JA 1JTEA 3EVBA 2FRXA 4ER6A 3JWJA 4YUWA 4U7TB 3MTIA 4RVDA 4GOMD 4CWAA 3ELYA 5BW4A 2Z6UA 1KPHA 2C7OA 2IBSA 5EZQA 5IH3A 2HNKA 3SMQA 1SQFA 3LCVB 3GRUA 2PT9A 4PNEA 3CJTA 3AXSA 2EG5A 3DXYA 1AQIA 4KDRA 3WSTA 3M6WA 4MQ4A 1N2XA 2XVMA 2IPXA 2ZZMA 4FGZA 3KQOA 5EG5A 2P35A 3HEMA 2OZVA 4FR0A 4PYMA 1WG8A 2AN5A 2XYVA 4QTUB 2B3TA 3V8VA 1JG4A 3B3GA 3LL7A 5EMLA 3G5TA 4PINA 4KIFA 1D2HA 1SUSA 4NECA 1XVAA 1NW6A 1SUIA 1G8AA 3OU6A 4PYQA 5DSXA 4C05A 3PTAA 5HIMA 3MCTA 1Y8CA 2AVNA 4KWCA 1JQEA 4P7JA 1XDSA 3ANXA 3NDIA 3Q7EA 3DMHA 5EHIA 4YV0A 5K0EA 4PONA 4FT4A 1QANA 2ONYA 5LR6A 4G56A 4ZTBA 3PLAE 2H1RA 3KQQA 4LECA 5CVVA 2FK8A 3B3JA 1IXKA 4GEKA 2XYRA 5EGSA 3NMUF 1PRYA 3GCZA 1L3BA 3PVCA 3DUWA 5DM1A 3C0KA 5FA8A 3HCEA 3CBGA 3DXZA 3B7PA 1VBFA 5BW5A 4R8SA 5BXYA 3TLJA 5LQUA 3UJ8A 4C07A 4C4AA 4CTKA 2I6GA 5JR3A 3BUSA 4FSXA 4RTOA 3M70A 2Q41A 1Z3CA 2NYUA 2CWWA 4YMGA 2GA9A 3FUUA 4M7RA 1H1DA 4PGHA 4BLUA 5M5BA 2QRVB 3TKYA 5FTWA 5EEHA 4CTJA 1D2CA 4E31A 2VDUE 5DPMA 1P91A 3FPJA 5EMJA 5KS2A 4F84A 1EG2A 1R00A 4OBXA 5FA5A 5GP1A 2KW5A 4RTRA 1Q0TA 1X1AA 2OO3A 3HVKA 3P9IA 3PB3A 3OU2A 4AZWA 4XUDA 5F2KA 2AN4A 1SQGA 2C7RA 4ER7A 4MTLA 5P8WA 1JTFA 2ERCA 1KXZA 2B78A 3DMGA 2WA1A 2JHCA 2IFTA 3FRHA 5GWXA 3KPUA 4HTFB 5T6BA 3RODA 1QYRA 1IM8A 3OFKA 3UFBA 5E1MA 5GIOE 3S68A 3THSA 2XBMA 4RVHA 2CMHA 4EMSA 4PGGA 5GM2A 5KQRA 5CM2Z 3LBFA 2IDJA 1L3IA 2LD4A 3NVKI 2JG3A 1Q0SA 4X41A 5HZMA 3HCDA 3G2MA 4POOA 5E1DA 3ELUA 5GIPE 2V74B 2NNWB 2C7PA 5D1NA 3FUVA 1UWVA 3P9KA 4R6WA 4QVKA 1EQAA 5E9WA 2ZIGA 5BP7A 2JHAA 3OE5A 1RJFA 4QDJA 5CVEA 5JUWA 5LSAA 1BOOA 1ZGJA 2OXTA 5GINE 3TPZA 2Z6QA 2ZZNA 5E2BA 4E30A 4ISCA 1G38A 1WS6A 2IP2A 2P1DA 1EAMA 1YFLA 2Z6AA 1RJGA 3GWZA 4ATNA 2H11A 2ONZA 2YR0A 2ZULA 5DM4A 3TM5A 3BGIA 2GB4A 3HP7A 5GM1A 5LQAA 4PYJA 1KR5A 2PLWA 2YX1A 4MWZA 3KPYA 1YUBA 2FHPA 3DR5A 5H02A 4PYOA 1RI1A 4RWZA 3VSEA 3DXXA 1NKVA 3EEOA 4KW7A 3MQ2A 5FQOA 2FPOA 5FWDA 2H00A 1FP1D 3EEYA 4FS8A 1VP9A 2C7QA 2R3SA 3HVIA 2PX5A 1R6AA 1ORHA 3PS9A 1KPIA 2HWKA 2P3QA 3FTDA 2ZFUA 4LWOA 5DX8A 4LG1A 3UJDA 4BP1A 4H0NA 3IEIA 4GOND 1JR4A 5LQRA 5DM2A 5CD1A 2GPYA 2YUIA 3BXOA 3R3HA 1NV9A 3P8ZA 1NT2A 5K05A 1AV6A 2CL5A 2G8NA 3LPMA 2GAFA 1XJ5A 3GGDA 3LCCA 3JWHA 3HA5A 4FZVA 5EHGA 5EVJA 2AR0A 4M36A 3EGVA 2ESRA 4QDKA 2YTZA 4X60A 4CKCA 3SR4A 2PGXA 5FADA 4C08A 3UJ6A 4UOEA 1P1CA 3T7TA 2AOVA 4EKIA 3TM4A 1YZ3A 4BY9E 4OQEA 4E33A 5HIJA 2ZW9A 2ZBQA 1PJZA 3TKAA 2XYQA 8MHTA 2VDWA 3THRA 3IV6A 3UA4A 1NW5A 2BR3A 4QQKA 3CC8A 2BM8A 2AOXA 3C3PA 3NDJA 4EVIA 4YV1A 1QAMA 3KQSA 1RI3A 4AX8A 2ZWVA 3SSOA 4K6MA 2ORED 2R6ZA 2QRVA 3BGDA 3HCAA 4PCAA 3PX2A 3SX0A 4EK9A 1QAQA 3EVFA 4GOLD 3ER9A 1VLMA 2O07A 3DULA 4Y30A 5C9ZA 1FP2A 3P2KA 1XCLA 4RX1A 2ZCJA 5DRYA 3UA3A 3VYWA 5FUBA 3CGGA 4WXHA 3EVZA 4IV8A 1G8SA 5EMKA 2FCAA 4EQZA 5DX0A 1RI4A 2ZBRA 3M6VA 2G72A 2NXNA 2HTEA 4F86A 2FYTA 2DPMA 4HSGA 1KHHA 5CCBA 3MAGA 4WVLA 1F3LA 4C04A 4A6DA 5K8VA 5LQCA 2UZ4A 3CJRA 3MERA 4RTJA 3BWCA 3F4KA 5EIWA 1XCJA 3FPHA 4RVGA 1RI2A 1DL5A 4PYKA 3DOUA 4LWPA 3G2PA 1QZZA 3FTCA 4RTMA 3E05A 1RJEA 3ORHA 1ZHFA 5E8RA 1NW7A 2PXXA 3KQTA 4RV9A 2N47A 1DCTA 1BC5A 1ZG3A 1ZGAA 5EMMA 1G55A 4PYNA 2ZVJA 3LSTA 3EMDA 1I9GA 1VQ1A 3KR0A 5DRTA 3MTEA 3MGGA 4DZRA 5KYGA 2G71A 2OB2A 3BZBA 4Y2HA 5DM0A 3AY0A 4KRGA 3BKWA 3E8SA 5DLYA 5E1BA 2VS1A 2ZWAA 2BR5A 2ZBPA 2UYCA 3ME5A 1M6YA 3SXJA 3TR6A 2I7CA 4E2WA 2PY6A 3LCUA 1KYWA 1R18A 2IIPA 3ELWA 3UJ9A 3HA3A 3NWEA 2OYRA 4ER5A 3G88A 1YZHA 3KPVA 3I5UA 2NXEA 3KR9A 1P39A 1R8YA 1XXLA 3O7WA 3G5LA 3BWMA 3OCJA 1NBHA 4L7VA 5T67A 4DA4A 3EVEA 5ICEA 2YVLA 3FPEA 4IKPA 2HR1A 4OA8A 4RVFA 2O57A 4GC9A 4AZTA 2ZIFA 5DXAA 3NTVA 5HEKA 5C0OE 1P1BA 1M0EA 2Y1WA 1FBNA 1L9KA 2BR4A 5FCDA 3LDFA 3EVCA 4RTNA 2JHPA 1SVUA 1MHTA 1N7JA 2I62A 1JSXA 2AZTA 1JG3A 2QM3A 3FYDA 1EJ6A 5CCXA 2F8LA 3DLIA 3MHTA 4DCGA 3KR1A 3FYCA 3GNLA 1RI5A 3PFHA 3UJAA 2YXDA 3K6RA 3G8AA 3G2QA 4GBED 5HIIA 1YF3A 3NWBA 2AS0A 3ELDA 5K09A 7MHTA 1AQJA 1WZNA 3O4FA 1NW3A 3LDUA 3TMAA 5LQKA 5DWQA 4RSRA 4KIGA 3ERCA 4FT2A 4HGYA 3D2LA 5EPEA 3ER8A 2PV0A 4P58A 3SM3A 1F38A 2AOTB 3A26A 3FUTA 3T7SA 4IWNA 5LQJA 5E9JA 3R24A 3DH0A 2OB1A 2QE6A 4RTSA 1TPYA 2BM9A 3B89A 3KQVA 2PXCA 3U81A 5HOQA 1VPTA 1OR8A 5CIYA 2PX8A 3PX3A 1KYZA 1JSZA 5CVUA 4GC5A 5DXJA 5DSTA 1SG9A 3FZGA 3OFJA 2AOWA 3HM2A 1TW3A 2P7IA 2ZTHA 3AWIA 4RYLA 3HNRA 2AN3A 2ZZKA 1WXWA 3O31A 3OPNA 1VIDA 1N7IA 2IH4A 2BZGA 1JG1A 2QY6A 4BP3A 2PX2A 5CVJA 3KU1A 2I9KA 4HTFA 3KQPA 3R0QA 4XCXA 3KPJA 4X1OA 5EOVA 3VC1A 3MB5A 3EVAA 2AVDA 4V0RA 3SVZA 3EGIA 3A7DA 3GRRA 4PCLA 3UJBA 4AZSA 2WA2A 4R8RA 3X0DA 1O9HA 3T0IA 2IH5A 1MJFA 2V7EA 3PT9A 5CVDA 5IKMA 3UBTA 3FTFA 2IBTA 4X63A 5FHRA 4U7PB 3CKKA 1WY7A 3JWIA 4ER0A 3LECA 3G7UA 3A7EA 2P41A 2OKCA 4GUAA 2NXJA 4QPNA 3P2IA 5CUQA 5FULA 3LKDA 3I64A 3TOSA 4AZVA 2EFJA 2NXCA 4GQBA 1NE2A 4OBWA 4CKEA 5E9QA 4HH4A 2OBFA 2B9EA 2PX4A 4RTPA 5FHQA 3E23A 1V39A 3CVOA 4DMGA 3P71T 4OA5A 4QVGA 3IYLW 5E2AA 3NJRA 4IV0A 4E2ZA 2VZ9A 4M37A 3NVMB 3SSNA 3OZRA 2ADMA 2EJUA 4CXMA 3QV2A 4YUZA 5K0LA 1FPQA 2A14A 3BKXA 2P40A 3FPFA 3IHTA 9MHTA 2P3OA 3GJYA 4QPPA 3VC2A 3P2EA 3HVJA 3C3YA 4P7KA
chains in the Genus database with same CATH superfamily
1OXBB 4JI1B 1H5UA 1MEOA 1OLOA 3MWLA 4URWR 5BUZA 1IJEA 1PEDA 3W4IA 1M5UA 5K2MA 2J4DA 5J2TF 1GPKA 2O1XA 1U2EA 5E9AA 1FFGA 3AIKA 1J7KA 4NP6A 5DLQC 5DJ5A 3X1KA 1HV8A 1UBCA 2XZDA 2SKDA 3TFOA 3JQ8A 4YV2A 3HXQA 1BW9A 3WIEA 4OI1A 5DGXA 1V3TA 1I24A 4H4EA 1Q19A 3ZXYA 2H1FA 4AKSA 5CDGA 2V3CC 1KKMA 4Z4FA 3ICQB 2UUOA 3LUHA 4TTIA 3ZQUA 2ODEA 5I6DA 4CL8A 1M1YE 1AURA 3HRHA 1XLTA 5ITVA 2OHIA 3I4LA 3D4PA 3QUTA 1QR2A 3B1ZA 3LT1A 3S4YA 3CPEA 1GU1A 1QQTA 2WVHA 3DKKA 3KTAA 4M86A 4OYYA 5JO9A 4EQ6A 2AV6A 4W99A 4WXMA 2FZ5A 3M4NA 1NYTA 3B3FA 3FCYA 3D2BA 4X71A 4JLSA 1QH8B 1QK3A 4HPJB 2NO5A 1W5FA 1W5EA 2RHLA 3ECSA 3MD9A 4DLSA 2I7VA 1SN7A 1E4EA 4IZ6A 5BSFA 1GPWB 2JVKA 3BT7A 3LL4A 1G4HA 1RVV1 4Q34A 4WN9B 2VT2A 1FX0B 2R68A 4O2AA 3ESYA 1SC3A 5EL0A 2JFBA 2ZRLA 2Z9CA 1TK3A 4H4CA 1RKXA 3GN2A 4L9SA 4OB6A 2JJ1D 3EBLA 4A2QA 3DFUA 1PJCA 5DTQA 1PNOA 3GRZA 1X7WA 2I34A 2VP3A 2NTVA 2DH6A 2W2NA 2J6IA 2QYTA 1WZUA 4LXXA 5EHNA 1KDPA 2X5KO 3OCXA 1QCDA 3L8YA 1TQ8A 4TTPA 2O2YA 1V2GA 1I4WA 2GBCA 2VHWA 4GL4A 1SG0A 1GFWA 4NICA 4RD4A 5C51B 2EHJA 3V4LA 3WKCA 1A82A 2MSEB 4WLVA 2X19A 3FOFC 1JQ3A 3E1SA 2IGBA 1IVYA 2IXGA 2H1IA 3MOGA 5EIFA 3EEQA 3GFSA 1EGHA 3U7GA 1ZZGA 2OILA 1R74A 1SCKA 2HLPA 4FXOA 4J0GA 3TSCA 3EZFA 4NJMA 4H7HA 3E2MA 2H2DA 5HHTA 3GFVA 3IT3A 2FQYA 1YKGA 2ETXA 3LX5A 4X3PA 5FKJA 3T34A 1PD0A 1VL6A 4EGQA 1JH9A 1SUEA 4MW9A 1KO8A 3TSYA 4RTQA 4HDRA 1FA9A 4HYEA 5DLDA 4UCQA 4UMFA 4YQEA 4BE9A 4C4PA 1XYVA 2O7NA 3GIWA 1VSQA 4F5DA 4RKWA 1C0PA 1PX0A 1YZGA 2VUUA 4TTQA 4R0MA 3T1HB 2FWNA 4D4KA 2OGSA 3D6AA 1ZW1A 1HE8B 3KT3A 3L1HA 1YZFA 2LVBA 4LC0A 2H31A 4HDAA 2X3YA 1IIBA 4AMYA 4C0SA 2BEUA 2V7BA 4YJDA 1H85A 1T29A 3HO6A 2I5PO 1ZHOA 3A6ZA 1KU6A 2AMFA 1W5BA 3OSZA 4EHJA 4TUYA 4DREA 1MQSA 1MGPA 2WIDA 1B7GO 1R4NB 4MR7B 1XTKA 1UZNA 4ARAA 3A4LA 4L6AA 2X1VA 2IP1A 3LUGA 3A9RA 1R3UA 3QITA 3DBIA 4TS9A 2NTJA 3JARB 3QFTA 3AQIA 4TMYA 2XNCA 2FEKA 4R2LA 1G8JA 2HOQA 3I52A 4DVJA 4IAOA 1AN9A 1UXHA 2Y4OA 3NEPX 3GJXC 3F98A 1ISHA 3LUBA 4XOUA 3N2NA 1V8PA 3MT8A 4LYDA 3WBJA 4B43A 3C6KA 2ID9A 2JFHA 2IHTA 4U2EA 3H9BA 5E8JA 3VH2A 2CCKA 2G63A 2QENA 4JBXA 1OSNA 1R4NA 4MRVA 3KYDA 3O38A 1B0AA 3KVRA 1KJWA 1I01A 1NVDA 3V2GA 2XMZA 1UL1X 1MIHA 1XEWY 4DYDA 1G8YA 4JBGA 1O3YA 2AIRA 2F67A 1YCDA 2O2XA 1WBJB 1BE8A 1E5DA 3KM0A 3LE8A 3DOEA 3ESCA 1CJKC 2Q6TA 4YPFA 1FTYA 2JKZA 4KZPA 4QOIA 1HDXA 3EZXA 3H0KA 4FGZA 4JA2A 3FETA 4R2JA 1LF5A 4CE6A 4EY3A 1AQNA 2F1HA 4JBIA 2TMGA 2B3DA 1E63A 4GL2A 2GOYA 2AN5A 2XYVA 3EXG1 3ZE6A 4AO8A 2QZSA 1TFRA 4R7GA 3SC2B 4Y9RA 3N74A 4YCLA 5IT9A 5I9TA 3FKJA 3LL7A 1EDDA 1YSCA 2Q9UA 2H5JA 4N9WA 2ZYUX 4ZU3A 1L4KA 1E77A 4K81B 3KLOA 4FZ3A 4P7JA 4KWCA 5I7SA 1M1YB 4YV0A 3QE0A 4I4TA 2YDYA 1P4SA 4B85A 5HQTA 1QANA 3RVBA 3TZEA 1N6HA 2C2WA 3L9XA 4F4CA 3F90A 3OA2A 1AIPA 3L7YA 1LKZA 4LX0A 5CVVA 4ZO6A 2Q5FA 5FD8A 4UDNA 2N1MA 3ADCA 3MJ4A 3AT1A 3B7PA 3MRXA 2JJ2A 2VJMA 4UZSA 3TLJA 4GZ3A 2OV2A 2ES4A 4TL9A 2I6GA 1ECJA 4KC0A 4B3MB 1DJQA 4E12A 3E1GA 3GQBB 4EY8A 1MAAA 2M2IA 1JH8A 4CQMA 5M5BA 3GJRA 3GLQA 1K2VN 1NHWA 2VPPA 1NBOA 2A5JA 3DOIA 4ND3A 1IQUA 3AU8A 3DOJA 3R0VA 4I55F 4OHCA 5AJTA 5ALIA 5KBYA 1FNNA 4RVSA 5CDHA 1R00A 4UUOA 4W5NA 1THTA 4IVNA 1ISJA 4P32A 4A8PA 3ZHTA 3MGKA 4BC0A 4G5XA 1YACA 1YRLA 3DXFA 3A1TA 2BCEA 2UAGA 3BFVA 1GFIA 1XEXA 2E18A 4QBGB 1E5QA 3VR5A 5FP0A 3M82A 1OAKA 3G0DA 1DCMA 1L7XA 2C1XA 2M6KA 4CM9D 3ECCA 4E7OA 1W48A 2B7LA 2FSHA 3HWRA 3W7VA 2SBTA 4MITA 1PQYA 1E3WA 4P1ZA 5AICA 5I8PA 4DRZA 4CM9A 1VGVA 1XJQA 4HAZA 5JEDA 3SIRA 3VNQA 3WL8A 5LQMA 4R83A 2B6HA 1FU8A 2H48A 4IIJA 3RS2A 3FOZA 4D79A 4WXPA 4QYWA 3B1XA 1E6LA 3U62A 4HLCA 5H83A 5AW1A 4KQJA 4Q1DA 1BRMA 2BKLA 3P94A 3GLGA 2H06A 3H11B 2JFGA 5F2EA 1ZVQA 4AFNA 4W5WA 3WDMA 2FZ4A 4EA7A 2Q9BA 1GLVA 2CVZA 5EP3A 3RSOA 3FUVA 1G8MA 2XIQA 2FVXA 2Z2IA 1V11A 4Y2JA 5CHYA 1OHHD 2AR9A 2GKGA 3HABA 4K0RA 4WBXC 1NVTA 5HZKA 3PI6A 3QYAA 5B12A 3OJ0A 3OE5A 3MELA 2WSYB 4LSGA 4MPRA 4MXDA 1AB5A 1BQ3A 1T1JA 1R0ZA 1H2ZA 5CYOA 3F4BA 2V3WA 3LV8A 3K2QA 3QY0A 4BMZA 3Q9SA 1PWEA 1XJWA 1T2CA 4A2WA 3EDQA 4IIYA 1C5KA 4BDTA 1FYFA 4DIOA 3CH7A 3I4FA 3KYDB 4Q24A 3HP7A 1Y6JA 4JCOA 2QD3A 2PZJA 1ML3A 1I4OA 2GJAA 2JEYA 3DBOB 5AQ1A 2ZB4A 4P3YA 3BFKA 4TMZA 1C9EA 2BM1A 3IAM6 1B23P 1CUXA 2B1IA 3K5IA 3PQ7A 5EVCA 5CLQA 1ZH6A 1Z2OX 5A4IS 1DG9A 1SCJA 2I4RA 2P5SA 1M72A 3SDZA 2Z83A 2P9FA 3F2VA 4MS3B 4RIEA 3V48A 4EVRA 2P9YA 1YHYA 2J0UA 2QTCA 3C8UA 4BO8A 5BR1A 4O3FA 3TKLA 2WABA 3PT5A 1T13A 1XLUA 2CZCA 2I2WA 3P0FA 1DLJA 1PX2A 1Z26A 2GVZC 2I4OA 4DWVA 2QN7A 4L8LA 5F51A 3L40A 4DR2B 3FGPA 2X7JA 3A32A 3CR3C 3UJPA 2C3OA 5EA2A 2AR0A 3DWIA 4B73A 4CFYA 4CHGA 5HSGA 2Q3DA 1GNQA 2O7VA 3K96A 3LH5A 1XLTC 3K2IA 3R0XA 5KCZA 2YHSA 3LOUA 2OWEA 3T7KA 2JLAA 3ILSA 1I9CA 3NM5A 3JWEA 4NJEA 4P35A 1UBHS 4WZBA 4CV2A 3EW7A 1NXXA 5LMUB 2FMTA 2F8SA 1RHRA 1PP4A 3E8MA 4D9IA 1DAIA 1P3JA 3BJIC 3FVWA 5AJUA 4LJ6A 1L9XA 1M2VA 4TVBA 4DHEA 2EZTA 3Q6MA 5G3ZA 3C3PA 4F7DA 1E8DA 4UVDA 2GM4A 3I2KA 1KY5A 4HBZA 2C95A 2WYUA 4CQMB 3SN6A 3Q4GA 2PPVA 3OKCA 4J0CA 5K6AC 4G0NA 3IIJA 3WK4A 3VZPA 1JIQA 1VMEA 2P5UA 3DT9A 3H2ZA 1V8ZA 4PQGA 3Q3IA 4UBIA 3VH4A 2BRUC 1YL6A 1TGVA 2UZ3A 3E3OA 1BWSA 4MUBA 4PY2A 3OBBA 4I4NA 2XQKA 4AMBA 3IE0A 3UMVA 1N2ZA 2YFQA 3NLLA 2P9QA 3TCXB 1TM2A 2FPSA 2O1EA 4RFSB 4XGIA 4YREA 4B2IA 4ZWNA 4DUPA 2NUTA 4F5YA 5JBNA 3VC7A 2QA5A 2QMYA 4AN4A 1B8PA 2XI4A 2ZITA 3ROMA 4DABA 4F86A 5CAEA 4LX8A 5K8VA 2N46A 1G291 2WJYA 3BK1A 3HH8A 4X65B 1PGNA 2AKAB 1O9BA 3F4KA 1X92A 1PNRA 3ENVA 4KMMA 3HBLA 4PYKA 3H4IA 3E5MA 1CF2O 2Q1YA 3CF0A 1F3OA 4IHJA 3VPFA 1U9IA 1JI0A 1VDMA 3F71A 4GOXA 3E05A 1SHUX 4GI2A 4NOKA 3ZQJA 2D6FA 4NNJA 1TF7A 1DG3A 2IHZA 2Q2QA 2P6NA 4HDMB 1H94A 5LWQA 1AUOA 1DCFA 3HDJA 1XU4A 4OLFA 2E48A 3TAXA 2WTNA 3BMXA 4RA9A 1YQQA 3KR0A 1DWUA 2Y92A 1HG1A 2Q8QA 3OLZA 5JNWA 1LZKA 2ZJ5A 2J3EA 4KXFB 3WQSB 3TR0A 3VJKA 1IOZA 5DLYA 3K9CA 2R1VB 2UYCA 2FUCA 2CNDA 4MMXB 3NBUA 1K7SN 4RMNA 2R6R1 2UKDA 1E0DA 2R97A 2E87A 4KP7A 3HA3A 3RRNA 4RIHA 1MCZA 3PTLA 1YZHA 2NZ8A 3AVOA 3LBAA 4B6GA 1Z4KA 2IHYA 1NBHA 2X4DA 3FWHA 4PSVA 5C8YB 4UNPA 1B14A 1ZRSA 3FPEA 4BCBA 1G8FA 5DBEX 5AUPB 4C2TA 3RIYA 5JAMA 1LPSA 1WABA 4OH1A 4V3BA 2Q5OA 2A5DA 4O2BB 5J4KA 4MV5A 1PJSA 2CYCA 3KEGA 2Y1WA 4PLYA 4ZZ0A 2BR4A 2XITA 3EGXB 1DI0A 2I55A 3QQPA 4IF6A 1Q7RA 1IBCA 1JQ5A 2D2XA 2WFZA 2Y2UA 4JX9A 2ZTVA 3VR6A 4HVCA 1JWLA 2AZTA 4GYJA 1QK4A 1XRMA 4Q1BA 4MUXA 3WGNA 1II9A 1LTQA 3PFHA 2VPTA 3GGOA 2BFWA 1W36D 3GVHA 1V8FA 1YI8A 2X14A 2W2PA 3CE9A 3H13A 1DRUA 1XQ6A 3MJHA 4N0DA 9LDBA 1SR8A 2HSGA 3OJCA 3KT0A 1QCZA 4BLPA 4IZHA 3HN2A 4FFNA 1IN7A 1NQXA 4Y18A 3GT0A 4OYHA 3WDSA 1J5EB 3PEYA 1YBAA 3A05A 1E8NA 5IWCA 1NW3A 4JLPA 3UVEA 4CV1A 4RSRA 2QU8A 1UXOA 3Q2IA 3OH8A 1EFVB 2C92A 1B43A 2B82A 3DGEC 1COZA 4RD3A 3E8XA 3VDQA 1XWIA 3A26A 3LG2A 4KIUA 1XTZA 2EOAA 1I2AA 3P9QA 3SM9A 3WV4A 4ZYTA 4TZKA 3PXXA 1KP3A 1T1GA 1E0AA 1KMMA 1U2DA 3DT6A 3QG1A 3TOCA 5L6LB 3FFTA 1RQXA 2EYUA 3FW1A 3T9BA 1KYZA 2HWYA 4W6QA 3J81k 3CVUA 2X3FA 4WSOA 3PC4A 1I5OA 3WWEA 2ZUSA 4UNQA 5E7JA 4BNKA 3H9QA 1BQEA 1K5DA 5KNDA 1T36A 3LAWA 3STVA 4X0EA 2O4CA 2AYYA 1Z4OA 1VPDA 1PR2A 2RC6A 3KQPA 4DMLA 4ENSA 4Z9XA 4B3XA 1OZHA 2OGWA 4MVJF 4O3MA 5EP2A 2GXQA 2I1QA 4LJRA 5G1OA 4UM9D 1ECBA 5IASA 3WA7A 1MO4A 4CZ2A 1D6JA 2VJPA 4DNOA 5BV7A 3AMVA 2GN6A 1AM4D 4Q9NA 4OHXA 3T6KA 4Q6WA 1VSUA 1MX9A 3WDLA 2E55A 3ELBA 2JVJA 1EXMA 4BO9A 2WDPA 1B8UA 3P2IA 4MHOA 2B21A 1E2LA 1I2DA 2ZQYA 3DZGA 3GYGA 1U3DA 3P4XA 4JOSA 1CR1A 1Z3IX 2ODPA 3R6GA 5JJ5A 1DOHA 1TVKB 2Z8YA 4MX8A 1JYSA 3K1JA 5LP6F 4WKCA 5AHKA 2RG1A 4DNXA 3CKMA 4L0QA 2WNHA 4IDHA 3RGGA 3VPCA 2FWMX 2RHTA 2PD4A 1U3VA 3BXEA 1QPGA 4WZAB 3WB2A 3PBKA 2PQMA 3UOGA 5KHOC 4KPUA 4DMCA 2RE8A 1E32A 4OV6B 3HWSA 4AP9A 1THGA 3ENNA 5TGDA 1VSVA 2JGDB 5C8YF 4PU0A 2CMKA 3GLGE 2BEJA 4JUIA 5HJEA 2PWYA 4AVYA 2VSYA 4JX8A 1R0RE 3KZ1E 3L5OA 1NMEA 1C9NA 3K0CC 1G5IA 1SG6A 4BAUA 5ERGB 2QGFA 1DARA 1M74A 1V1JA 1L8XA 3I1YA 3B38A 3AR4A 1QTRA 5B1DA 4LZZA 2EATA 4EI8A 5JDIC 1N3BA 1G18A 1UFQA 2EFDB 3EWNA 4I5GA 3BRWA 4U9UA 4EBFA 1KSHA 4MW6A 3IQZA 4IQGA 3C8DA 1GDDA 1WU8A 1SVIA 5CNMA 2O6LA 2X2OA 4DNQA 4QUKA 1KTIA 3GAFA 3CTMA 3ZIAA 4EPWA 4YRSA 5JADA 1C4WA 4R40A 4BLSA 2NYAA 2DJIA 3QPDA 3O3MB 2HLDD 1TLFA 4P38A 3AB7A 2C9YA 5I4CA 2BFDA 3N2GB 1GTRA 1DAHA 3VU1A 3WWPA 1O03A 3S8MA 4OBEA 4Q05A 5EYPA 2LKDA 4C06A 3EPPA 5EPOA 4ENVA 2H7XA 2V7VA 4K05A 4DVGA 3PJGA 3ZWPA 1I1QB 4PFKA 1ENPA 2WLTA 1GCIA 3B1VA 3PUZA 1GYRA 2JH9A 1SKMA 1J0EA 3QG5A 2PMEA 4NU8X 4GZ5A 4DV3B 4A3SA 2HH9A 3I53A 3OT4A 3VU9A 2EKZA 3ESQA 3RK1A 1O6FA 4JLOA 3AFNA 1CP3A 1XHEA 2BH9A 3MRTA 2PNJA 4DM4A 1Q57A 4G23A 4QQNA 3AUUA 2O3JA 4AJNA 4WBSA 5LYJB 1CLUA 2AOTA 2I3DA 2XE6A 3IMCA 3X2FA 1KETA 1FDVA 4MO9A 4ZOBA 3DHYA 2BKXA 2PUFA 4JP1A 4HRVA 3GGGA 5BN3A 1E2GA 2XNHA 4EAQA 1XROA 4Z5XA 3PXAA 1V4NA 2HADA 2HLDA 3B8EA 4C7VA 2XJ4A 3E03A 1XCPA 3MT0A 1BMQA 2I7DA 1CJTC 4XSGA 3VHRA 1ZONA 1XUOA 4C0XA 1IIRA 3A9WA 2ILVA 1E2KA 3DMTA 2PZKA 4CEHB 1GDHA 4LY6A 1HEUA 1QB7A 4DXHA 1X1DA 2WHXA 5CM8B 1L4NA 1XNGA 4FBGA 4CGZA 1DV2A 5H7XA 4EDFA 4H1WA 3I01M 4HY3A 1Y5NA 3R2JA 4UUQA 3HN6A 5AHWA 3AEXA 4WLFA 1PV2A 2JBWA 5AKHA 3X1XA 4C0QC 2C5BA 4PXAA 4R51A 3IQWA 1D6MA 2G0AA 4S04A 5J2UF 4Q4JB 5A3SA 2GN0A 2HIMA 2P77A 4X7RA 3UT0A 1K86A 4FPXA 4YUAA 4ZK2A 3N5CA 3VNBA 5A06A 2HGSA 2C4KA 2CXTA 4CKCB 1PD1A 4B5LA 1CHDA 1Z73A 1L3CA 3KJFA 4GMHA 4Q16A 2EV9A 2OZEA 4JLBA 1RW4A 4E70A 4HNUA 2DCUA 4UD2A 4FMCF 2FOLA 3DDOA 4QGFA 3B1WA 4CMAA 3M4JA 2B1RA 1JHDA 3O75A 2FX3A 3FTNA 4A73A 2KPOA 1HTTA 4JJ8A 4L9AA 3A31A 1ZCAA 4NYJR 3EGEA 4NMXB 5A4JA 2IW1A 3OESA 2MSNA 4A91A 1F48A 4BU0A 3KJNA 3DE3X 3A4NA 2F59A 3MB8A 3GVPA 3IUJA 3ZX5A 5JWRA 4XTCS 5GGXA 4YJGB 4PYRA 4Y2VA 2LUOA 2D74A 3X43A 2C04A 2PMBA 1J9GA 3L0PA 4TUYB 3K0BA 1BD4A 2E7ZA 1QGOA 2JFXA 1MD9A 1PSZA 1Z8NA 2GD1O 1J33A 2CFTA 1TJ3A 4MPDA 4N5NA 4EL5A 1NVVQ 2WFLB 1P2SA 1W5TA 2JJMA 3O4VA 1E2UA 1MAUA 1YAJA 5G4LA 4I36A 2OOSA 3WYGA 5KU7A 4RK1A 1M2OB 1DFHA 4N7RA 1N6PA 3AILA 3M6WA 4QNMA 3RAGA 1ZSVA 3V7UA 5CFPA 2Y77A 5LOVB 4BL5A 1XVIA 4B31A 1IN6A 3EZGA 3IJPA 2QL9A 1H4VB 1Z6XA 4PLZA 1WG8A 3AUXA 2AI2A 4BO5A 1RQGA 4MLZA 1KBZA 1UBSB 2D1TA 1GNSA 4NF2A 1GY8A 1LS1A 5H3LA 4DV0B 2VTVA 5DTJA 5LZ2A 1DV1A 3U3OA 4JQOA 1KR2A 4FDVA 2ARKA 4KIFA 1D2HA 4LNUA 3DDZX 5HQJA 1GT91 3RUCA 3SQMA 2OCLA 5L51A 1CF9A 4FN5A 4DDMA 4HJXA 3VO8A 2V03A 2II6A 4MDFA 1EJ2A 3C6YA 4OSOA 1O4WA 5AHRA 2IYNA 5LR6A 3CNQS 1K2WA 4KWTA 2EARA 3UXMA 2DEUA 3FKQA 5CLFA 3JASB 3L6EA 2HQRA 3SQWA 1USGA 1R4ZA 2HRZA 2JEZA 4ESEA 3OOJA 5M2QA 2PAFA 3P0IA 4E6PA 2ZKLA 2FFBA 3I45A 1M0WA 1DHTA 4WTOA 4GKKB 4UZFA 1J0AA 3NIDB 1EP3B 3BUSA 3LXXA 3C14C 3W5JA 4DIMA 5B3LA 4Q5IA 4WV3A 4G37A 5TQ2B 3G8YA 5TPZD 3NWJA 1Z38A 2FEOA 2GA9A 3OO1A 4M7RA 3S29A 2CYAA 2WAXA 3AUKA 3QVUA 2HWWA 3SHQA 3TUZC 4LE2A 3IHKA 3GFBA 3RH0A 3ZWCA 2R96A 1F6WA 2QZJA 1JFLA 1L7MA 1E9VA 1SHLA 1XO1A 1U7XA 2BMEA 2GWHA 2HY7A 4I1RA 3NPMA 1JILA 1PLJA 2BL4A 1NC3A 3LLMA 1UC5B 4D42A 3PEWA 5HF9A 1OAOC 2QAGC 3T3GA 2PSJA 5ALTA 1Z6AA 2WMOB 2AJ8A 1BXRA 3F5SA 3L6DA 5CNKA 2FPWA 1U7PA 3NM4A 4X9XA 2FF7A 1A9YA 2HEGA 3JQGA 5JVDF 3M81A 4OO3A 5P8WA 3BHNA 3FAKA 3CEAA 3HZOA 3MWDA 4PNHA 3RKRA 3TD6A 3BCHA 4K88A 4N40A 5K8CA 2IFTA 5BXQC 3RODA 1ZK1A 2JGMA 1I32A 1WNFA 4QQFA 1GCUA 3WLRA 2HMUA 1HDIA 5KYXA 4BBJA 1JHPA 1GLGA 3E9NA 4PGGA 3UB2A 3MJTA 4EYEA 3OQHA 3D7RA 2DY0A 2NG1A 4OHOA 3DBRB 5LB2A 3FB4A 3STXA 1VB5A 3QVGA 2GCOA 1HFWA 1DUVG 2GAIA 3P9KA 2GMWA 4IIFA 4AF8A 1CUSA 1DELA 4IIEA 4RORA 3BULA 1VJRA 1ODSA 1E18A 4RF3A 2PJZA 1W46A 3U48A 2WF6A 2OBBA 1RCTE 3AUTA 1N8KA 2FZKA 4CMGA 5LSAA 4WY8A 2XMRA 3E2PA 4C4RA 3R6WA 4Z7NB 1OU0A 4MZDA 3N76A 3I28A 1KYXA 4H7IA 2J0QA 5ITZA 2GYYA 2QTHA 4KB5A 4L3VA 3IBSA 4RD2A 4XFDA 4CFZA 5HRCA 2B69A 3GCWA 1CUHA 1XNJA 3GLFA 1ZH0A 5IJ0B 5THQA 2FHPA 5HTOA 1C7ZA 2BOVA 4UOZA 3T9AA 4J3JA 1PEKE 3HBNA 3HUTA 1NP6A 1C1XB 3ODPA 2B20A 2IOFA 4HDNB 1Z5OA 3L0BA 3EHDA 3LQKA 1W0JA 1W47A 3OQBA 4GXQA 1T4CB 1T6NA 1NATA 1RE1A 3PSAA 3DFZA 4QXOA 4CU5A 3ZU4A 1T91A 1KPIA 2WU4A 3MLBA 4K8RB 3AEKA 4UEQA 1TJNA 4NYMR 4Z54A 5I7AA 1K3UB 5LXTA 1VA4A 1GRCA 1RYYA 2YUIA 1JU4A 3BXOA 1HE4A 1KBOA 3JZIA 4GGOA 3U7RA 1IXZA 2FWAA 1OIXA 2G8NA 2V7XA 1XZQA 2PEZA 3FMGA 1FDWA 4MCIA 1PU2A 4GOJA 3FNRA 2ETVA 4ZRNA 3JPYA 4RJTA 2DY1A 4M36A 4EB0A 1BJRE 5I51A 2VF8A 1PT6A 1M2GA 4DQKA 3NZEA 3N6XA 4PX2A 1G59A 4C43A 2AD1A 2IA5A 3GHYA 1P1CA 4IIUA 4Y67A 3X1MA 1LPBB 3O7MA 3B2QA 3ETCA 4RK5A 2DWUA 2PRSA 2WZCA 2OQVA 1TYDE 2PM8A 4M8KA 4ZMRA 1YZ3A 1W0KD 4MWBA 4HSEA 1HRKA 5HVNA 2R6FA 4KWHA 3TGPA 4IDAA 1DJLA 1ISGA 2ICAA 3DO8A 1U0OC 3W0LB 2IVZA 1NFRA 4LJ9A 5BYJA 5EJ6A 3ZXUB 3F6CA 4KN8A 1XXHE 4KDEA 2ZKIA 4DLXA 3CEHA 1R0LA 1E79D 4FGJA 2FZWA 3IKVA 3QKIA 4E5PA 1MAVA 4YAUA 1VE1A 2G0NA 3SDSA 4DV7B 2P11A 2QX8A 3CZ9A 3HRIA 3V1UA 3WNBA 4D56A 3BHMA 4M0LA 3G1WA 4ZMBA 1FP2A 2NVBA 2X0RA 3VNVA 4NYIQ 5DCYA 1YDMA 2W6NA 2ZJ0A 4LCEA 1PTJA 2X77A 2ZI7A 1J09A 3AW8A 4P2GA 5CCDA 3FA2A 1X1EA 3ZUPA 4E5SA 4Z7QB 4YT8A 2J9FA 3IPLA 1CJBA 3FPKA 5FBWB 1UK9A 3IILA 2CHQA 3DDWA 3L43A 2RHMA 5TVKA 2HTEA 4LYHA 3D02A 5D84A 4RY8A 2DPMA 4J49A 2QTLA 4UCWA 5KYVA 1BS9A 1GNRA 1TU0A 3O95A 4JMLA 4YRAA 2H07A 5HS6A 5DWDA 2WV7A 2K7ZA 4BX8A 4YP9A 4F92B 1ISIA 5L6MB 1W1IA 1Z7WA 2MR6A 1E3TA 1U5BA 3CMMA 4B4OA 3C5EA 1KQFA 4L2IB 2O3RA 2CVOA 4GNKA 4F3KA 4RTMA 3EIQA 4IGAA 4BQFA 1UPBA 2CVFA 4RBNA 3IR7A 3OZIA 3CLTD 2RK4A 2R66A 3THOA 4JOCA 5EMMA 2ZYDA 3NDPA 3R7NA 2ZTSA 1GKLA 1O6BA 5DRTA 2QRLA 4IIJB 3SBDA 2GI4A 3P4UA 3PD7A 3DMNA 3GUYA 2C61A 4LOAA 2QTTA 4IY1A 4NESA 5AVQA 3RS7A 1PG2A 2ROQA 2ZJZA 4NK5A 3H2YA 4KQGA 1T25A 1PN3A 4A36A 1F4LA 1BJTA 2EJBA 1P75A 2FPGA 2PY6A 1YDGA 3CUWA 4KJZA 2VPYA 4AXBA 2OYRA 1ESCA 3RUDA 3ZU3A 1CY0A 3OY2A 1H3FA 3G88A 4Z8XA 1JEYB 2JLRA 2QRZA 3BN3A 5BY2A 3S7ZA 3BWMA 1DZIA 4XGNA 3IXLA 3GUCA 3GGJA 3L8GA 1MX1A 3PNYA 2IYEA 1TAGA 4G5RA 4IHQA 4HLUC 5FB3A 1E6KA 3PITA 5CB0A 1BTOA 2BGUA 1R0KA 1T9BA 1IQRA 4TWRA 1F12A 1Y48E 3QU5A 4RGYA 1OZGA 4L4XA 4F45A 3LWBA 4KQEA 5HWSA 1UMDB 4Z4EA 1T4CA 3IA2A 4WFQA 3J81A 5TJ9A 4FYXA 2BP7A 3LPAA 4Q3NA 5J3JA 2B2XA 2Z08A 3AEKB 4TV9A 4HYYA 1UOEA 1RLJA 1B3RA 4PLPA 3FYDA 2WTEA 2A5GA 1Z34A 3F46A 3GNLA 4RHFA 3EJ6A 1GUYA 3CX3A 1XP8A 3LOQA 1O95D 3MHPA 2D2IA 1SA0A 2PO5A 4OGLA 2PZMA 4RSGA 3WBKA 3ZQKA 3T54A 4DZTA 4DR4B 1SO8A 3C41J 1WB4A 4DCPA 1NVAA 5EWLB 2R4QA 1UZLA 2ZVQX 5D2CA 3UANA 3ZR4B 4DR7B 5JO0A 1QQBA 2W9XA 4MIOA 2Z6UA 1DKLA 4N03A 4D9EA 5FOTA 1N33B 2EBFX 2JATA 4ZCSA 2NZUG 1XMPA 1UCFA 3VHXA 2VYVD 3RB8A 2HV8A 3HUFA 4OK6A 2RH5A 5F5NA 3SHVA 1TJ5A 3AF3A 5T5QA 2BFFB 2JZNA 1RU3A 2MSLA 3FROA 1FMJA 1RAAA 2C5LA 3GEDA 4TKLA 5TLSA 2NVUA 1FXUA 3H75A 5I01A 4QT4A 1R6UA 1GGKA 4JBLA 4RCZA 1JB9A 1Q91A 4N0EA 4MVYA 4PX5A 3RR2A 5F21A 3IP7A 4GE3A 3W1WA 1USWA 3KS9A 4N5MA 1Q1ZA 1MTOA 3O2QB 3PX3A 5D6NA 1E7RA 4GR9A 5HQ3B 1QQ5A 1OFUX 3UF0A 4AECA 4B4UA 3HM2A 2XSZA 3HUEA 1APBA 2GDJA 3PWTA 4A23A 5DHRA 5BNWA 1JG1A 3IO3A 1E2EA 4LRWA 1N9ZA 1JSLA 1NXWA 4EUNA 2QKYA 1U0TA 4HEA1 4U9HS 4HL6A 3U7FB 1NRXA 4HDSB 1DIBA 4OP1A 4BP3A 4ZDIA 1RE0A 3R0QA 4ETWA 3NG1A 4FDMA 4URYR 5DASA 1ZMBA 3AF2A 5TARA 2IH5A 4RH1A 2BCGY 1EZZA 1L7DA 4CTMA 4YDRA 1Y1LA 1RRPA 1RXWA 3DEKA 3EEBA 3F74A 4EA8A 1H2WA 1JJVA 3COVA 4XRGA 2JCGA 1UWLA 1GNPA 4Q12A 4DEYA 2P41A 2WWWA 2XUPA 5FULA 4QFCA 2A5FA 1Z0UA 5AMXA 2BUCA 2I6UA 3DMYA 1C7EA 3L7AA 3Q3VA 1W1UA 1V39A 4HGPA 3S40A 5KNDH 3HK2A 4I3HA 3WA6A 2HA3A 1VTKA 2VZ9A 4M37A 2XUHA 2YOFA 1WZCA 3ETDA 3E9RA 5EJMA 1KIFA 3DTVB 1FDSA 5K0LA 1JSRA 4QPPA 5E3HA 4UZEA 2JD1A 2XNKA 3EBPA 3WO0A 5HZHA 2FUNB 3C3YA 2LNDA 2VPIA 1MO3A 1PSDA 2MMCA 4LZAA 5AVJA 7ADHA 1ID8A 4FD3A 3SOZA 1HDGO 2DPXA 4BVJA 2IXAA 2R1VA 3H65A 3R6LA 4BQIA 2G70A 2DR0A 1U8EA 4EF6A 4EHNA 1F20A 3F9IA 1B1AA 2PGNA 1XTQA 1ZIXA 5DLEA 4ZXPA 1U02A 3PEVA 4YQZA 3FUWA 1UBOS 1L5QA 2Z43A 4ESVA 1PUXA 3V1NA 4PO8A 2ZPUA 1J2RA 2VSXA 5JVDA 3GLHA 1J2EA 3OZTA 4PICA 1SXGA 2COEA 3BE5A 3H11A 4V0QA 4YGXB 4DLAA 3GW8A 1QGAA 4PG7A 3AYXB 4RW0A 3AI3A 4OHMA 3VSAA 3FCSB 1PJ3A 4PPYA 3KCNA 5LD2C 3BREA 4K2HA 1FS4A 4OHVA 3ZCVA 5TMPA 4PZZA 2NQ2C 1VKJA 3REGA 2X9VA 2A2ZA 4L07A 1I3LA 2F8MA 4TMXA 4EYSA 1JEEA 3KFVA 3PVSA 4IIHA 4TTRA 5IARA 5DN9A 5EZSA 1UBNA 1ZS9A 1WPRA 2VN8A 4EB6A 3QPBA 3TBFA 5H9VA 5M7EA 1Y82A 4Y1FA 4UBJA 2DULA 5AIAA 5H1YA 5LXTF 2HMTA 3M3PA 4EHKA 2YJ4A 4ZVLA 1S6YA 1K63A 2A0FA 4KVGA 3RABA 1GIAA 2XE7A 2DFTA 3LX6A 4IQ0A 5ELMA 3SQNA 2C03A 4TWZA 2QW8A 3ZW8A 3NHKA 1U2ZA 3IAS1 3BZUA 4QOEA 4ZQGA 5AW5A 3ZE1B 5LU8A 5BQ3A 2HNAA 1ONNA 5D3MA 2QRKA 1SIOA 2JD2A 2R0QC 3HFRA 1X77A 4KE6A 3COSA 3I8XA 3DLBA 2P9GA 3ET5A 5J2UB 4LJAA 1FYXA 5KB3A 2H4HA 3EPRA 3KPWA 4P7FA 4J1QA 4MYHA 1D6NA 4HG2A 5GONF 3TLKA 1P0CA 4JC4A 2ZRAA 4EKGA 4TSFA 4CM5A 5EGNA 1GPJA 1RBQA 1JLLB 5FI5A 5C1BA 5BVGB 1O58A 1AB6A 1C30A 1XN4A 1XV5A 5DNEA 4EX6A 3UZUA 4L5CA 3GRCA 3LRPA 4W5JA 4H27A 4X7MA 3WGGA 5C3UA 2A1UA 1EK6A 3IFSA 3RANA 1PTJC 4L4ZA 4KCGA 3AF1A 4WXEA 3OU7A 1F8GA 1DC5A 1DWQA 4J6EA 4CLOB 2IXBA 1E1CB 2PBRA 4NOMA 5CX4A 3RHFA 1GXSA 4LYGA 4E09A 1DTEA 5JCZA 2CVHA 3UATA 1FSSA 1JXMA 4JGGA 3FXAA 1R12A 5MFPA 1M9NA 4RL4A 3QVVA 1YS2X 2NUBA 1ODTC 1GV0A 3QMWA 1P2FA 3R77A 1XRPA 1NDQA 1FUUA 1G0OA 1JYEA 3QKSA 1JIXA 3VO2A 4DSNA 2WAMA 4RZHA 1HZZA 5KTYA 5IU6A 3PEUA 3DTVA 1RYNA 5SZJA 2PLRA 1ZWLA 1BH2A 1IXRC 3AWDA 3EIOA 4ERNA 1HR0B 3GT7A 1G2PA 1QHFA 5JYEA 4N8SA 1RXIA 3WWCA 2JGIA 2QN9A 4U0KA 1Q17A 4D5GA 4YMHA 3II6X 3PNQA 3AF5A 1MOSA 1SQ0A 4JY7A 4PLCA 2A9JA 3GU3A 5L7YA 4PX9A 1NV8A 2EKDA 3K9HA 1D2GA 1XTPA 1K4YA 1P80A 3PYLA 3N6VA 4Y2QA 3HG7A 4DF3A 3QSYA 1XPRA 4GZ6A 5A04A 4IMPA 4PC1A 4PHCA 1XRJA 4MWCA 5GJVC 3CCBA 3GNQA 5L3SA 1O6GA 1XZMA 1WIWA 1EWTA 1HMYA 4MVJG 5BWMA 2W00A 1HMPA 4EHFA 1U63A 1JEAA 4QUAA 4ROSA 1IWOA 1LB1B 2CLSA 1SBYA 1U28A 1YZLA 3HEAA 2O8CB 4ENWA 4O4IA 2AUNA 2EGGA 5GVRA 2B92A 4FHFA 1DINA 1AGXA 3LDHA 2FEWB 2ZR7A 1LV7A 4PZUA 2NM0A 1JN0A 4ZI3A 1YQWA 2HNKA 1EDEA 3ZEAA 4WOPA 4BO1A 3S1AB 1KWKA 1P7YA 4YJGA 4PNEA 3ZXIA 1WW8A 5IJ9A 3U5ZB 3FOBA 1JU3A 4QYMA 1AZTA 1QUEA 4S12A 5AI8A 3T06B 3PGA1 3QOYA 4HRXA 2E4VA 1E1KA 4X90A 2P0AA 2AB0A 3AGQA 4GP9A 1PYGA 4IH4A 2B3TA 1L5YA 5JATA 2YOHA 4HMPA 3K09A 1JG4A 3HYCA 2ORYA 2ZSJA 3WKAA 4OKIA 3ORQA 5IVHA 4ZICA 1FDTA 1QF9A 1UC9A 2V3VA 1H5NA 2LIPA 1WCWA 3GI1A 4PTYA 5ALFA 3V4PB 1DPFA 4XQ9A 3PNLA 3H5OA 4I50B 4C05A 1NOJA 2I8CA 4CKYA 4XB2A 2MINA 4IIVA 2IZ0A 1IHYA 1NF3A 4FFVA 5GY7A 5BWLA 1K7FB 3FUCA 1T8SA 2GM5A 3FCEA 4GWGA 3PLAE 2HX1A 1IVSA 2IS1A 1MVLA 1N9GB 1V0JA 2Q99A 4RXMA 3M2PA 4QBIA 2H65A 6YASA 1J0DA 4GR5A 1G5FA 3K32A 4ZI7F 4DLRA 5ITSA 5LYJA 3HCEA 5DNWA 2ZYRA 2FUEA 4HS4A 5LQUA 4QFBA 4C4AA 2NQ8A 1FB5A 3OF5A 2WNIA 1ES9A 4K8OA 4OHPA 3N3AC 3ZQ6A 4RS4A 5K8TA 2CUKA 1J2YA 3KB2A 3D2AA 1D8TA 3P5SA 5GONA 4J3NA 4I0WB 3BWXA 4BLQA 3UB4A 3PI7A 5FNVF 4YHHB 1I7NA 2WBLC 5CT4A 1W59A 1ABBA 1EEXB 4G41A 1HE2A 4AJKA 1K6EA 2Z1MA 4ASUA 4ZEXA 3I8OA 4PQFA 2JKYA 2WIBA 5FA5A 4CVNA 4ED9A 2VTEA 4GPEA 2PYZA 3E70C 2X8BA 2QMUA 2AJDA 4BNMA 3PJRA 1LX6A 4DE5A 1NKSA 5GJWC 4YRGA 2ORWA 2M6SA 2CK3D 3GZJA 1M66A 3D3QA 2F90A 1OVMA 2PUEA 2OGUA 1E2HA 4OUKX 5EJ5A 5K9ZA 4QT0A 2Z95A 2H85A 2ORVA 4B3BA 4WKOA 2IELA 2LCIA 1VG8A 5CM2Z 1QIJA 3NHUA 3OF2A 3ZHVA 2GXAA 1HT2E 2WM8A 1UMCB 4WE3A 3NIFB 2UVQA 4J0JA 1TECE 1XTSA 4IDPA 3LO5A 5JQGA 4M0MA 1D2MA 2C3YA 1VLQA 1SZPA 1M2NA 3HFGA 3VKVA 4ZVTA 3SQLA 5A5DA 1PZHA 1IG3A 5C5DA 5TB5A 4QDJA 4U3JA 5KYXB 1NLFA 2AQIA 4LRSB 3ZDRA 4E30A 3L7JA 1NNI1 2I4MA 5FTNA 4PC7A 2IOQA 3UAYA 5J2TA 4V0LA 5E95A 3U3DA 2UU9B 2JGNA 4G9EA 3ILYA 1ORWA 5HR5A 3GD5A 4Q4JA 5GM1A 1RABA 1NE7A 1YC2A 1FP7A 4CM3A 3KPYA 3KUUA 1MR3F 2V96A 5A7FA 4RWZA 3F9RA 4M9SA 2Y71A 2GO1A 3UH1A 4QLBA 4M1YA 4W7SA 5FO0A 2B94A 4I9NA 2GVNA 4K6OA 1GUZA 4NV0A 1GLNA 3V8RA 2J9RA 4FS8A 1EP9A 3FNGA 3TLMA 3VVMA 3HVIA 3B9PA 1A50B 4D82A 5MN4A 2I87A 4LWOA 4P33A 4IS2A 1KI7A 1JIKA 2NWQA 4EUHA 2YY6A 3IEIA 4LBZA 2GN2A 4MVJP 1QNFA 1IYZA 2FSVA 2XOEA 4UJ3A 5JPIA 3CNBA 1CYDA 3HDTA 2C4VA 1XJ5A 1YQ9A 4DR1B 1BMDA 1NSTA 1OJ7A 3ZWOA 2QMQA 2HXSA 2MWMA 4KOEC 1JXOA 1QPZA 4D0LB 1X94A 4U7WA 3IDFA 2RHOA 4TWBA 2EZ8A 3OQIB 2H16A 2B5VA 2X7HA 3FDXA 4NEGA 4AQDA 4BWVA 1N9GA 3D3NA 4UM9B 6CHYA 1QVRA 5IN5A 4LVUA 2EW2A 3LSYA 2JBAB 2VJNA 2CJYA 2ZBQA 2ZT5A 3CF6R 1J2TA 1PGQA 3F47A 2Z6VA 4KFUA 4X97A 4ZV4A 3CLTC 1VBKA 2OBLA 3K9WA 3RU9A 5T41A 2XUDA 4QQKA 3H2SA 1J0BA 3CKLA 4HNHA 3L7CA 3UKOA 1NIJA 2FU5C 4HQRA 4BO4A 1BMTA 1N6KA 4JVLA 2O59A 4GOLD 4OGKA 7REQB 2F48A 3WY9A 1GU0A 2C77A 3KETA 4OQLA 2VRCD 1HYBA 1OASA 4M9ZA 5TMDA 1N1GA 4GG1A 2OG1A 3HJFA 3ZD8A 1NN3A 4F9EA 3NGLA 4P4LA 4C1NA 5BUSA 1S0UA 2ZT7A 4BVAA 3EASA 3OO0A 4X85A 4ZVMA 5IC6A 3BIOA 4ZOCA 2ZUTA 2JZCA 1TVEA 2WWFA 4OSPA 4BNIA 1UJ6A 2WKRA 3GP3A 3JQPA 1F3LA 3RRJA 4C04A 4EPRA 5CCBA 3ACDA 1GL9B 3C24A 4F0JA 2B0CA 3R75A 2R8EA 1PQPA 3BB4A 5C52B 2CDNA 5KSPA 2FPIB 3FPHA 1T34A 3G9TA 4TWAA 1ULTA 1W5SA 4XCQA 2NT3A 2C0CA 2Q6VA 1RHUA 1VJ0A 1WF3A 5COQA 2QJFA 3IL2A 3L1IA 1FCJA 3ZDXB 3BJRA 2P30A 4NLLA 4CR6A 3KV1A 5HJ7A 1U1GA 3LK6A 5K99A 1GN9A 3V8EA 1VQ1A 4C4SA 3DZCA 2HNBA 1ILWA 4XI9A 4TUYF 5L45A 2VKQA 2GKSA 2HRQA 2X1MA 2O8DB 1AXRA 1K6JA 2ZBPA 4DIDA 4EJSC 1X42A 3H5TA 1XZHA 1Y8AA 3UJ9A 1U4OA 1AD2A 1CUAA 1NJ1A 2LDXA 3IAXA 3ONNA 4QQRA 4ZV9A 3V46A 3UW3A 4RK7A 1V71A 2DFKB 1SD1A 1F1BA 3RTEA 1FVFA 4WAUA 2DFPA 4GI3A 1Z2CA 2PNFA 1F8XA 1OWMA 4ALLA 1T3LA 2P68A 3IUYA 4EF5A 2AWOA 3DQPA 3R3XA 4JSTA 3EC2A 3W2GA 1OY1A 1NU8A 4GC9A 1TEHA 3KKMA 5K2OA 5EXTA 2H2AA 1P77A 1EDOA 3FYTA 1UF9A 2QTMA 5I7HA 1H1TA 2CLEB 2QJOA 3M6IA 1EWRA 1LK7A 1F51E 1ECCA 3M34A 3PQ4A 4JR0A 3SLGA 1ZD4A 3ZWVA 1ADBA 3TVDA 1XC7A 4EFKA 3UMFA 3ZJTA 2QBYA 4I3FA 2ZB3A 5P21A 3T5MA 3DOOA 4JYBA 1DEKA 2V58A 5I8WA 3R3UA 4D3XA 5EHZA 2EJVA 4Z4CA 1O95A 3IAS6 2QDKA 2D54A 3CWZA 5EUQB 5CXXA 3AVXA 1OJLA 4AJOA 1UIMA 4RKEA 4MV4A 2R86A 2OKGA 3EYAA 1AGNA 1YMUA 2PD3A 2PS9A 3OAAD 3KE8A 4IILA 4JYCA 1T0UA 5JSKA 2RFLA 3MBOA 4NHOA 1O95C 3SJUA 1GUBA 2PUBA 1Q15A 4UM8B 1O08A 1W52X 3CRZA 4P58A 1JR2A 3D1JA 1V4BA 2VCYA 3JZAA 4PG6A 4YAFA 3QENA 3QI2A 3R7FA 1Z0ZA 1WM1A 4FUTA 1GR0A 5DNUA 2EFCB 3HP1A 4G0QA 2ZOSA 4HXEB 4BN5A 4E7PA 2ZRCA 4P3PA 3G0HA 5K8UA 1JIIA 5EMNA 1ULHA 1YFZA 3W9UA 1DBSA 2CDBA 3WHPA 4KG7A 1EB8A 4UDYX 5CVUA 1GZ3A 5DXJA 2O2SA 3OP1A 4L8GA 4NMLA 4P22A 1KXJA 4W1RA 1DCKA 2G77B 4AO6A 4CUJA 2ZZKA 1F2TB 5IYZF 2C5HA 2GJ4A 3KQUA 1THZA 2IOHA 2BGMA 1FNDA 3GN1A 4KL8S 4W1SA 2KLHA 3RUPA 2I9KA 2WQ7A 4FKMA 4J9VA 4M0FA 4V38A 3DEHA 1KZ4A 3JALA 4EG0A 5FI1B 2XHEA 2WJHA 3GRRA 1QKJA 1J99A 1GAJA 1Y7HA 2ZAYA 4DCNA 3WGJA 3R9WA 4MB6A 2KBFA 4UUBA 3RAEC 3GUUA 3K0AA 3PT9A 4FJ2A 4KGDA 5FPHA 5A4AA 1FP6A 3NYIA 3DJFA 5K5EA 5T3UA 3U9SA 1SELA 1V7CA 3GPDG 5IM5A 2Z5FA 3U60B 1EFHA 3INTA 5CUQA 1ZIOA 3LKDA 4CLHA 2ZUEA 3CF4G 1N7HA 2HK9A 4NDAA 5BMOA 4KYTA 2JPDA 1SURA 3PEEA 5I3CA 3U3XA 1A5TA 1T1RA 3EXEA 4OA5A 5AT1A 1P60A 3E22A 3IYLW 4E2ZA 4WHMA 5REQA 4RAQA 3OZRA 3GEMA 4QRDA 1U9ZA 4CF7A 5E4JA 3HN7A 5JH7B 2DH5A 3BKXA 1B4DA 2HBRA 1U2GA 1U0SY 2QLTA 2P3OA 2A9FA 2XB8A 2I1LA 3PUKA 3DS8A 3TZCA 1PVOA 1NSYA 3ND5A 3ESRA 1ZY2A 1DX6A 4N6NA 1EQUA 1MX5A 1WDLA 1GPYA 4MSUA 3LTNC 4QO7A 4YJFA 3DB1A 1ORDA 3EZ2A 3CVYA 4DV1B 2UUBB 1J8VA 3AEZA 8ATCA 4PHHA 4LRYA 1CY8A 1NLZA 2QX4A 3A10A 2IHBA 1Q77A 3L9WA 4IFBA 4IV5A 4JI3B 4BHTA 2N1BA 1G1MA 1D4OA 1TAHA 3E7PA 6NULA 3MEQA 4WJLA 1MQ9A 2UYGA 3KOMA 3ZI4A 1YK1A 1JDJA 1QOZA 3UMJA 2OCIA 5FWAA 2GZDA 4DT1A 2GKOA 3KT8A 2OM2A 4CM4A 2MJLA 3M83A 1WOMA 1BSVA 1DDOA 1NI4A 1QFZA 2J09A 3KYCB 4X6XA 2GM9A 5CAEB 3UMSA 1QHSA 2AW5A 2X0JA 2G06A 3DUFA 1G5RA 3M3DA 1PGJA 2XOKD 1Y98A 2NX2A 3H1AA 4JENA 1QLJA 3W1VA 4YQFA 2Y1XA 4MRNA 5I7UA 1IM5A 4IS3A 1YDWA 3SYTA 2NZYA 3G8BA 3ICWA 2EU8A 1KZHA 2ZI3A 3TI7A 3ZJ5A 3IKTA 3ZY6A 5JSQA 3R44A 1KIMA 1M6VB 1T2EA 4ZDJA 2K2QB 2AK3A 4EO4A 5HM6A 3FTEA 3I0MA 1MBZA 2YNMC 1KZ7B 5JXWA 1T3SA 3LXUX 3NT4A 5L40A 3ID6C 1CY6A 3GXOA 3R9IA 3G0CA 3FWYA 3L7LA 1GL6A 3SXUB 1IHXA 2WJ3A 3PD1A 2ECKA 4KPFC 2HAEA 3VHXB 2XRMA 2HF8A 4WNYA 4AYXA 4CKZA 1JKJA 1SU8A 2XAAA 1B0PA 5IUKC 3U4HA 2CXOA 1ULBA 2JKVA 2R2GA 2X15A 4RO0A 3WAJA 1CUVA 2AXQA 2C8LA 3H9GA 2VUTA 2VSOA 2BBOA 1DEXA 3W8NA 2RJNA 1I80A 1DLIA 2C31A 4YYEA 4RJKA 4RTKA 3AJEA 5HP4A 4RVOA 2WU0A 4CT5A 2FETA 4F2HA 4DXAA 3PR3A 4URFA 5EIBD 1TTTA 1XQ9A 5I47A 2GARA 5DKFA 4ZJYA 3QF7A 4JL8A 4LYAA 1UIRA 2JFVA 4YQYA 4AMZA 1TUGA 2PGJA 4OFXA 1DBQA 4FFRA 1YBFA 3MMXA 4MQ5A 1AHNA 1YZUA 2HXGA 1GVHA 1L8AA 3AEYA 3E9DA 5ALNA 4RDXA 4ISBA 1UJ2A 3I0NA 2R4TA 4M54A 1P74A 1X1CA 3MUFA 4XLZA 2GZ3A 4Q9KA 3SC3A 4ZPXA 1K0UA 4HZIA 2QD2A 2ZBGA 2DHQA 4K6FA 1R8SA 2JIOA 3D64A 5J59A 3T4UA 1WKVA 1EP2B 2FFAA 4HZGA 4M9QA 1ODJA 1DAOA 1HWYA 2D0OB 2JRLA 4QRHA 1UP7A 1T5DX 4Q9HA 4D81A 5F7XA 3ROKA 5JIBA 3EPJA 1YNSA 4J07A 4KPYA 2VDVE 1C30B 1K75A 2ZJFA 4NZYA 3OEYA 1TCAA 1U9YA 2GZSA 2HLHA 2NVWA 2IE8A 3FNHA 1A96A 3BIWA 3MPUA 4ZCQA 3R74A 4BMDA 2WWIA 4EGJA 5C7YA 3UNXA 3BGSA 3BICA 3O2SB 1G5HA 2H7YA 2HN9A 4R6XA 5MHTA 4GF5A 4RLHA 4ENUA 2YFHA 4YY3B 1H1LB 1I4TD 4HAUA 5JH7A 3PNPA 5A2GA 1RAGA 4ND6A 4OK3A 3S6JA 3O8RA 1HYGA 4ALKA 2E4ZA 3EY9A 2XQFA 3G17A 4WKGA 4EZBA 1PVVA 3HDYA 2WUFA 4WACA 1DQSA 3HU1A 2JAOA 4YRTA 3V33A 2Q7OE 1QE0A 4MCJA 4ZZ3A 3AL2A 4V0MA 2NXWA 1JXAA 1UFKA 2R79A 3G0IA 3GVXA 3LHFA 4KFRA 4TTVA 1AF7A 4U7GA 3UUGA 1Z4MA 1ESNA 2OAEA 2EAUA 3ANLA 3HS3A 3IBGA 3VX4A 3V97A 3B12A 1V7QA 2AW3A 1BKSB 3ED5A 3WK8A 3CY6A 3PQ8A 5LM3A 4AG3A 3RSHA 3UT5A 3WGMA 4H3HB 3ETHA 3HWWA 3WGTA 2KLBA 3QVOA 1N2JA 1NXVA 3I6YA 4BNZA 4MW0A 4X92A 1QMPA 1V2HE 4PCUA 3IVXA 3SIXA 5ALUA 2R6GA 4ER3A 3NHWA 3RFTA 5HUQA 3DKIA 1E2IA 1JTEA 3O8QA 3ZJ4A 2VRWA 2P9CA 2ZJ2A 1PZGA 3LXMA 4QLAA 4B48A 1CY2A 4N5LA 2IIQA 2YYSA 3SAJA 4D3SA 2NUTB 4AKIA 1UKCA 1DEOA 1L5LA 3A4VA 3T9EA 3BB3A 1OYOA 1OBVA 1C3JA 3G2JA 3OJEA 1LJLA 1E94E 4S1TA 2D1RA 5HE8A 4CR7A 4ZHQB 1DT5A 4WJKB 5AKYA 3QZUA 2PUAA 3WSWA 2XVMA 3DBHB 2A8YA 3PGVA 4JVMA 4MQMA 1RLUA 3TLYA 2H2HA 4BGVA 4FE4A 2AHRA 3MYRA 3LX8A 1A9TA 1SCDA 2CFRA 4AUNA 1IE3A 3F96A 3WB0A 3D59A 3T99A 3FWNA 1K1EA 5A5VA 1YDHA 3GIDA 4US0R 1JPNA 5EIBC 3DMPA 2OMEA 5HFNA 1YJQA 5AVRA 5IG2A 4X91A 1GKUB 1KC3A 2G4CA 2GSDA 4D43A 1RKQA 4MZXA 4RJJA 1IEWA 3QYPA 3Q7SA 3TEMA 4CDMA 4HLNA 1RC0A 3WV5A 3B60A 5T4EA 2CHEA 2NTYC 3WWDA 3U6KA 1XDSA 4GMFA 2JS7A 4NARA 4MRSA 5KIAA 1YA4A 3VR6H 1XMIA 1B0UA 2ZIXB 3GJ5A 4N8DA 4CMHA 1AGPA 4GEKA 3OHPA 4LKRA 2F55A 4INZA 1ISRA 2RGWA 5AWFC 3PVCA 1HLFA 3WGQA 1H0KA 1ODIA 3OAAA 4LYFA 3D0OA 4G85A 4WVFA 2F43A 1KZ6A 1F60A 1G5TA 3ZI0A 4R8SA 3OFND 4HBGA 4UHKA 1ZCFA 5EAIA 3TB4A 4CTKA 4KHPB 4RTOA 1JBKA 1U28C 2ACVA 1B8VA 4YALA 3MGCA 3F0TA 3JYQA 1UJNA 5EP4A 1U1EA 2P6RA 1ZKMA 3CRMA 1UC4B 2IYVA 1WD5A 2XA2A 4PO9A 3EXHB 5ESWA 5KSWB 1FFYA 3F67A 821PA 1G3IA 3LFTA 1LLFA 3FMPB 4HB4A 2NSLA 4L5BA 4DMHA 1NW9B 2OV3A 5JRDS 1JDSA 1YR8A 2QVBA 5JZBA 2ATEA 2FZGA 3SJZA 2L19A 1KHTA 1VHTA 4F84A 3IC5A 3WG9A 1UDBA 2BFPA 3ZV5A 2A1UB 1UDXA 2GF9A 2OGTA 2CD9A 1J8MF 2Q5HA 4OMFG 3CT4A 3K9BA 1L8QA 1Z5PA 4AG6A 4PIVA 4B45A 1T36B 4BFXA 3I5MA 1JRLA 4A8JC 2HLNA 2QUHA 3UWMA 3A70A 1NX9A 1RRGA 1JHAA 3CONA 5JJBA 4Q39A 1OTHA 1Z4LA 2P4EA 2RHCA 3QLVA 3UFBA 2QN3A 4X20A 5CJPA 4G65A 5I5GA 2O2IA 2Q4RA 2VFAA 1BGWA 5EE9A 1H6CA 2OHVA 2YYAA 2VSQA 3B85A 2X8JA 1X1RA 4XDZA 3DPIA 5BSHA 2Z09A 4JWTA 3M2TA 1XLVA 4A6PA 3W5BA 3KLMX 4R1QA 2BT4A 3ZD7A 2W11A 1X7GA 3FGNA 3RJMA 4POOA 4JJ4A 5D1NA 1UWVA 2DETA 3IV7A 3PDCA 5F3DA 2EW8A 3PPVA 2CE2X 2ZIGA 4NMMA 4TLBA 4FB4A 5CIQA 5JBIA 3W4KA 4KRFA 1EK1A 4CR8A 1DNPA 2HDHA 5KTSA 4OUDA 2IP2A 4NHEA 2HEIA 1QF6A 1Q20A 2C58A 2A35A 1HBJA 1I5EA 1WKBA 2GNOA 4DQXA 3BGIA 2AGVA 3OUUA 4UREA 5EIAA 4HQ6A 4EMBA 4W5RA 1GZDA 1KR5A 3HI6A 3GDFA 2Q45A 4TLAA 2ZJ6A 3VOAA 3D6NB 4YVFA 4XGQA 4AJLA 1FC0A 1E3IA 4L4RA 2R8OA 1L5MA 4A8JB 5KOHA 4HDMA 5B7PA 4LHSA 5JZSA 4WXYB 3K9FC 4DEXA 2BM0A 4JJFA 4XQ0A 3UXYA 1K9VF 3ND8A 1D7AA 4U2KA 1G4UR 3IKLA 621PA 3THYA 4BBAA 1DXYA 2GPYA 2IDZA 1Q6ZA 4MS4A 3PKIA 1KI9A 3JAKB 4DMFA 4OU5A 3V8BA 5K8LA 4GBGA 4WNAA 1XRSB 2R8XA 4NMWA 3L4SO 1XNQB 4PBRA 4R1UA 4JS0A 4KBFA 1O8BA 3IELA 4Q7JB 1NZDA 5A9RA 3FCUB 3T9FA 4UFNA 2YY5A 4D9KA 1LVUA 1SFRA 1H9CA 5EZ5A 2XDQB 3T7TA 4DN6A 2P5TB 3CZRA 1KQOA 5AI0A 3IQIX 1E2BA 1O94A 1YMVA 1LLDA 2PTGA 3FGZA 3BRWD 5I5EA 3FBWA 4N3AA 3D3EA 2Z56A 3OZUA 5C3MA 2J85A 5DNAA 2WINI 4BMPB 4EVIA 1JFFA 4UNRA 1HDYA 3GNTA 1R5JA 4RF4A 3Q8MA 2PUVA 2ZI4A 3HCAA 2O2HA 3PX2A 4GU5A 4ZRMA 4A0SA 4DGSA 3RC8A 5KNBA 1QP0A 1OI3A 1UEIA 1DRWA 1Y4AE 3BEDA 3D9QX 1WW3A 5GTDA 2HA4A 2NZJA 4H35A 5HUJA 2JBAA 3ZHZA 2OO5A 2ZB2A 2VPXA 2OCDA 4NQRA 4C87A 2LRHA 5DGHA 2AFHB 2XMDA 5KTMA 3TJMA 2F00A 4BNGA 4DJDC 2DWQA 5EMKA 2OFPA 2FCAA 3TG8A 1M2FA 3IP1A 3ONFA 1QFMA 4DA9A 4GPBA 4A2CA 3R3YA 3LVQE 3NYWA 2OSBA 2YHAA 3LWNA 4FOSA 3MK31 1M1NA 2CGEA 2HT6A 4R71A 3CJRA 3LZDA 2MINB 3MERA 1ATZA 4Q82A 1MMFB 2OP1A 4RLFA 2FJ0A 1L5HA 4E21A 1T0JB 4K2AA 1V5IA 4PRKA 1IL0A 3PDHA 4M0UA 4U6SA 3D0QA 3B53X 1FMFA 2BFCA 3K9LA 2BMAA 4G1UC 3RS8A 1BC5A 3C48A 5E6UA 1M0SA 4ZO9A 2AZXA 3IEMA 1I9GA 4FFWA 4K9NA 5KNCD 4KX3A 1H0RA 1WSWA 2V6FA 4JQCA 4L7QA 4LV6A 3VPDA 1AUQA 2R1TA 3ZXSA 2H54A 3O4HA 2G7ZA 4GLOA 4MDEA 5B1IA 3B1KA 2ZWAA 2BR5A 4C4ZA 5DF1A 1X7YB 1YOVB 3AF4A 2X0DA 1BXZA 1ZNYA 1L4HA 1K6XA 2WTAA 1KYWA 2IIPA 3O74A 1N2SA 4HWSA 3ZWWA 2JFUA 2XWJI 3PJFA 3SD7A 3UK6A 4C1BA 4XYBA 2WSSA 1COWD 3FMFA 1KO1A 1YQEA 2YZNA 3E4DA 5DHUA 4CT0A 1Q1AA 2VH2A 3CA8A 3MQFA 4LEIA 5TR9A 1USVA 4BTEA 4EY7A 3FLBA 2PS1A 5IYZB 4Y2TA 1GUFA 3HZZA 4DZZA 3AFHA 3UK0A 1QQ6A 3PR1A 1BWQA 2Q46A 1N0HA 3ZDDA 3NM6B 4K9LA 1FLAA 4KRYA 4P0QB 1FBNA 5C7IO 3ENWA 3NB0A 4UDXX 5FCDA 4I5DA 5FFMA 1Y33E 2CNBA 1ACLA 1MXHA 4F9GA 3KSRA 5AM1A 3QOFA 1EWQA 4PXSA 2ZRDA 1EJ6A 2QTZA 2W48A 2Z1NA 4F2GA 2QVXX 3BAZA 1GGEA 2GA8A 4QD3A 1YB4A 2NADA 4GYKA 4EEZA 2OECA 2YHIA 4MHSA 3OJXA 2FPGB 4ARSA 5ALQA 3K70B 4X6YA 2CVPA 3DFIA 4KIJA 1QR6A 4XCVA 1O7JA 1WUYA 4J7XA 4J16C 3EA4A 2H6EA 4NE9A 1VRWA 1AK9A 1WXGA 3NATA 1QIMA 5LMCA 4PLHA 3M4YA 2REQB 1E1MA 4NDNE 5IUJC 4PFJA 2B61A 1M1XB 1AXGA 2FUKA 2LTAA 4HLQB 4B33A 3ER8A 2HMWA 2V9CA 2GCOB 3HKEA 4AYWA 1BXGA 3FUTA 4F04A 2IYXA 4HI0E 2GGSA 4D6XA 1A9QA 4EFNA 1YRYE 1SNYA 4F8JA 1E3SA 4Q18A 4ALJA 3CMCO 2QS9A 4R1OA 1V7ZA 2NO9A 4JT2A 2PXCA 3D4OA 5ALLA 3X1DA 2EGHA 3EY4A 5AI9A 2OEPA 2D5AA 4XWAA 2G9ZA 2BGWA 3NAMA 3D7NA 2ZATA 1WPXA 3E81A 4QYIA 1BU5A 3JSXA 4V0ME 5A62A 1I1OA 1CRLA 1ZX1A 2QTNA 3PLRA 4HH3C 1HH4A 1ZJJA 1A8PA 1BHSA 1RWXA 1OV6A 3TF5A 2PX2A 4D4JA 3ONEA 4BV2A 4OG2A 3ANSA 3PTZA 5EOVA 2VNAA 3U09A 3R3ZA 2P1RA 1XEFA 3IBTA 3L5KA 1CP2A 3EGIA 1WUTA 1RXSA 2YBEA 4EG3A 3X0DA 1P7PA 2YICA 2C20A 4PN3A 2QIOA 4JA0A 2OMKA 4G1MB 1QKKA 1WB5A 1O5OA 4I9GA 4CMEC 3AF0A 2XTAA 4FKZA 1XK7A 1QFYA 2GVDC 2VHUA 3C7CB 3K9GA 3A0RB 3NU1A 3PA6A 5JC1A 3L4KA 4N9QA 2AQKA 2R00A 2HSJA 2PZLA 4FWBA 2YZ2A 1W34A 4BVEA 1REQB 3CVOA 2VHYA 4MCHA 3PC2A 4MTCA 4RTPA 4EFLA 3GQBA 3L8MA 4PZEA 4ZZ1A 3MA0A 3RRZA 5DNDA 5AKEA 1Y8ZA 2PCJA 2VG8A 1NULA 2OV4A 3KZOA 4DYVA 4ARUA 5MF6A 3IHTA 4JLUA 4YO7A 5DYGA 2JLWA 4RLSA 2Q0HA 4E5DA 3ROZA 2WD8A 4IJWA 1Z07A 1HDEA 3Q0EA 1VE5A 1XZPA 3M4XA 3PNKA 5LMZA 3DTVD 3M49A 3QU4A 2ZIZA 2HO4A 1FFHA 2BZSA 1G21E 1MC8A 2XWPA 1G63A 1K88A 2YHBA 4UHBA 3TTVA 3WRXC 2ZSKA 4FCVA 4RNDB 4RC9A 2WYOA 3CW9A 3QA3E 2JLYA 3PFCA 2DQZA 2UYHA 1C0EA 4DDKA 1TYAE 1DG1G 3EVGA 1OIVA 4UXIA 1J22A 1T1EA 2GLXA 1BDMA 3L0ZA 4E46A 3I1JA 3F6RA 1ADCA 2XOKA 1T6XA 3PL5A 3EFOB 3SGLA 3QRWA 3VPHA 1NM5C 3BEOA 1W4LA 3C3WA 3CPSA 1HPLA 1T43A 4WK2B 1N4AA 9LDTA 3CGWA 3GT4A 1A7AA 1T2FA 3A9VA 2O8FB 4MUJA 2QLMA 1G4AE 3DZBA 4CCSA 2FSIA 1D1TA 1P0MA 4XUEA 4GEGA 3TW8A 2RK3A 4RTLA 1DJOA 3H0CA 3HYNA 5J63A 1QF7A 3QVLA 4DIUA 3KAJA 3L7IA 5HM8A 1R5OA 2W2VA 4HCJA 4DT1B 4I1VA 4YGYA 3RRBA 1EUZA 3HWX1 3W78A 4YAOA 4EENA 3UG6A 1Y3CE 1FNBA 3N6RA 4UJ5A 5C8ZA 5SV2A 4WDRA 5K1ZA 4B4WA 1VIMA 3I1IA 3DW1X 1BX1A 3BL5A 3UAGA 2XVXA 2Q4DA 4WFJA 5CDUA 4YECA 2HU8A 1L4BA 1XA3A 1TZKA 2RGRA 1QRDA 3KX2A 4UHJA 3SLRA 1SVSA 2BFEA 3QV1A 5KSYA 3PDIB 3JARA 1Z2EA 2AMJA 3N3BC 1GU7A 3ZBTA 2BBSA 3OEEA 4RQUA 3QBTA 4YJHB 3B1FA 5HKLA 5DU2A 4YUVA 4MGKR 1U3TA 1IONA 2O0MA 4G3XA 1KSGA 4A27A 4EAAA 3ZCPA 2Z3ZA 4OQMA 3W9YA 4NBWA 5JOQA 5J1SB 1FY2A 3QUQA 2ZR9A 4FLFA 5TY0A 4J8PA 3GXBA 4MVJM 4FSDA 4MWSA 4TL8A 2ZUUA 5T64A 3RRFA 3NR2A 4YRIA 5CBKA 4LTMA 2MYNA 2QZ9A 2HDWA 3CVWA 2GZHA 3IE2A 4R54A 4AZ0B 2PZGA 1JBQA 2XWSA 4PTLA 1FFAA 1F9AA 3HFSA 3WKEA 3EDRA 1NLYA 3WXMA 1MHPA 3HCFA 1LW6E 3DP7A 2AYXA 5K0JA 4CM1A 4G5HA 4XWGA 3KWLA 1Q95A 1UDWA 5MN5A 4UVIA 3ITNA 3AY7A 3E15A 1DKPA 2O2ZA 1Y9DA 2WT9A 2Q3BA 2XMCA 3ZXXA 1VCOA 1EFRD 3ONDA 5I7WA 2DLCX 3TZ6A 3ZWMA 1U80A 1UQRA 4MP8A 4Y7DA 3M6XA 2IOYA 4KAAA 3Q5EA 3AJDA 3VFDA 2QQ5A 4RF5A 3BC1A 1FMTA 1JMVA 3HRKA 4KYIB 2QUJA 1NBMA 3WHKA 3G23A 4KR2A 1U2RA 4PHFA 1DQYA 3SS7X 4YBRA 4HH0A 1OFGA 1ZMRA 1RQPA 1DMSA 1UODA 3H86A 3O84A 3ONVA 3OY7A 3NT2A 3LPNA 4XX0B 2C84A 2VNKA 4GO1A 5I9IA 2GPTA 3OZDA 1V45E 2CXHA 3IKMB 3RK4A 4O4LF 1FRVA 1UBFA 1FYDA 2J6HA 2C5AA 4EELA 1JE0A 5ICGA 4ZT2A 1WLYA 4D3FA 4ZHQF 3U3JA 1X80A 1E3JA 4ID9A 1RCUA 4TXNA 3N39C 2YKGA 3I09A 5J4LA 4INPA 3VH1A 2OPBA 3O83A 1XI2A 3NW9A 3VOSA 4OHRA 1VPEA 3EUAA 2IGTA 3MSCA 4QPZA 4NENA 3WWZA 2WIKA 2DTDA 4KWIA 5CFLA 3O1HB 5EQDA 1U7DA 2WU8A 2IIVA 4ITVA 3TGWA 1S89A 2FX5A 4MQEB 3VPSA 4DL9A 1WKCA 1G60A 1UADA 1E4OA 3G1UA 1R6TA 1NRIA 2FZLA 5AI5A 4X54A 4DA7A 4U7DA 1XTUA 1IXSB 1NG9A 2JLCA 4IDCA 1WJGA 4U7TB 4CWAA 1RYHA 4LJKA 1UBRS 1VL0A 1Z7YA 3VZBA 4MRAA 2FDCA 3UK2A 2W2XA 1HOTA 2SNIE 3EXEB 4D44A 4FWIB 1CR0A 2AE1A 1JR6A 2XAUA 3PFWO 4H7JA 3WSTA 4MS1B 1PR1A 4EEKA 4Q02A 1OILA 5IAEA 3TQFA 4AC9A 4LZLA