4JFAA

Crystal structure of plasmodium falciparum tryptophanyl-trna synthetase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
362
Chain Sequence
b'INYNKLIKEFGCSKITENHIKRIEKLTNSKAHHFIRRGIFFSHRDLDFLLNYYEQHKCFYIYTGRGPSSLSMHLGHLIPFYFCKYLQEAFNVPLVIQLSDDEKYLFNQNYSLEYINTLTNENVKDIISVGLNPELTFIFKNTEYAGYLYPTVLSIHKKTTLNQSMNVFGFNHSDNIGKISYPSFQIAPCFSQCFPNFLGKNIPCLVPQGIDQDPYFRLSRDIAVKMALHKPVVVHSVFMPGLQGVNNSVIFLTDTPEQIKNKINKYAFSGGGTTIQEHREKGGNLDKDISYQYLRYLLEDDNKLNEIGEKYKKGEMLSGEIKKILIDVLTELVLKHQEKKKSLTDEEISYFFDPNKPSLQKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan--tRNA ligase
molecule tags Ligase
source organism Plasmodium falciparum
publication title An appended domain results in an unusual architecture for malaria parasite tryptophanyl-tRNA synthetase
pubmed doi rcsb
total genus 134
structure length 362
sequence length 385
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 4jfaA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4jfaA01
5HUJA 2HMAA 4MW5A 1H1TA 2DXIA 5J58A 2JA2A 3UY4A 4H3SA 2Z09A 4EG5A 2WB2A 4MVWA 1JIIA 3NBKA 1MB9A 2HZ7A 3GLVA 4MW2A 1R6TA 1NUTA 1KAQA 3PNVA 1VBMA 4MUHA 3AKZA 4G6ZA 1U3DA 3P0JA 2YWBA 2VTBB 2QTMA 1JZSA 2J5BA 3HL4A 3CR8A 1NYLA 4G5YA 2A88A 5DEOA 3H9BA 1YUNA 1WOYA 2GKSA 1KKUA 1U7XA 2QUIA 1JEEA 1N75A 1I6KA 2PFSA 4DDHA 4QRDA 2X1MA 4RUKA 3PXUA 1VBKA 2IJGX 2CYCA 3VRHA 1J21A 1XJQA 4MUGA 1KAMA 4DNXA 2AG6A 1NP7A 1TQ8A 3DPIA 2ZP1A 1WXIA 1NUSA 2QJTA 1X8XA 2A1UB 3Q12A 3FDXA 4R2MA 3AG5A 1PFWA 1H3FA 3CVWA 1OWOA 3K32A 4EG3A 1EXDA 1KR2A 3IMEA 1WQ3A 3SP1A 1LW7A 5KHAA 4J75A 4MUJA 3KT3A 2PXHA 3VU8A 1M83A 3INNA 1NUQA 4RPIA 3PRHA 1KQPA 2DERA 3ND6A 2D5BA 1OWNA 4CT0A 5K0SA 1N2IA 2A84A 4UZEA 4XFDA 3CA8A 1CT9A 2YY5A 1EUQA 4HPWA 4K03A 3DV2A 5DK4A 1UFVA 1OWPA 1J09A 2X3FA 3P52A 5J5AA 5KCMA 3ISJA 2YXNA 3D6VA 1R6XA 2RD2A 4A91A 2RE8A 2J09A 4JZYA 2EL7A 5EKDA 5TEVA 3FH0A 1F7VA 1JECA 2TS1A 3COYA 3CLTD 1O96B 2XRYA 4MW4A 3P0IA 1T9GS 4NAHA 4EGAA 1N1DA 1IH8A 4GRIA 1WXEA 1D2RA 2QJFA 3IUEA 3K9WA 4MW6A 1JIJA 1XNHA 3L92A 4UZFA 1QJCA 2A1TS 1N78A 4ND6A 1O95C 3SYTA 4MLPA 3N8HA 1N2JA 3A05A 1XNGA 3M5WA 1N2HA 3N2YA 1OWLA 4HJRA 1RQGA 4U7JA 3S3TA 1YIDA 3FOCA 4U8HA 1F7UA 1WXHA 1N77A 2PZ8A 5KWVA 3CLSC 4MUNA 1WXGA 3PNBA 3FY4A 2H2AA 4JXXA 1G59A 4E1AA 1J1UA 2I1LA 2CV2A 1SURA 4L2IA 1WKBA 4G5FA 4MWEA 5J59A 3CVUA 1G8HA 1OBCA 2XRZA 4JYZA 2E0IA 1PFYA 3TZLA 4WNYA 3ZGZA 1M1ZA 4GU5A 1QRUA 1O95D 2DUMA 3GMIA 1XNJA 1NUUA 1GLNA 1LI5A 1N3LA 2D13A 1MAUA 4ARCA 1GN8A 1N2OA 1OD6A 1K4KA 4ZCQA 3LOQA 1FFYA 1MBZA 3RHSA 1FYDA 3OP1A 3RBAA 4EG7A 3HV0A 5FO1A 5LLTA 4KPUA 1WJGA 4MULA 4OUDB 5TEWA 2IP1A 1MB2A 3G59A 3UC5A 1O6BA 3P0HA 5BNZA 3H99A 1JZQA 5TGTA 3HZRA 4NZPA 3F3MA 4EFKA 4P2BA 2WSIA 3COZA 4MQ6A 3KFLA 1PFUA 4WSOA 1EFPA 3E27A 1YIAA 4R0NA 2QUJA 1O0BA 1JILA 4YMIA 3X1JA 4MWCA 4YP6A 1IRXA 2A7XA 3IUBA 3KT8A 2AZXA 3LE8A 2J08A 1O97C 3ELBA 1R6UA 4Q16A 1OWMA 1KORA 2QTNA 3HMQA 4KR9A 4L2IB 3H97A 2CYAA 1N2BA 1WY5A 1VBNA 3FIUA 4K0RA 4CDMA 1H3EA 1EE1A 1WQ4A 5JBNA 1VL2A 3TQIA 1QRTA 1TYBE 3A04A 3COWA 3ZIUA 4MWDA 4ZT6A 3UOWA 1K97A 1S4MA 3IVCA 2PZAA 4HK4A 1NUPA 1I2DA 1T6YA 3MMXA 5K0TA 2O8VA 4ZCPA 1NI5A 2C5SA 2O5RA 3SEQA 1WXFA 1Y42X 4EG6A 1Q15A 1G8GA 3NBAA 4EF6A 3IOEA 1M8GA 4I6EA 3HFJA 4MAFA 3FWKA 5H7XA 1YULA 2E89A 2HGZA 2OQ2A 1I6LA 4DDMA 4ND7A 2H29A 4ZT2A 5FO0A 3CLUD 4NAUA 1QNFA 3G6KA 4PBTA 3FHJA 3TNJA 3A2KA 2CYBA 1GPMA 2NZ2A 2DLCX 3ZJUA 4MW7A 2X0KA 4DJAA 3D6UA 3Q4GA 1O94D 3KT6A 1KQNA 1U3CA 1U7DA 2X1LA 2A4MA 5HG0A 3DLAA 1QRSA 1GTSA 1Q11A 3ND5A 3NV7A 1ULHA 5HUHA 4TS1A 3G5AA 3TS1A 1JMVA 1IVSA 3IVGA 1Q19A 2CUZA 4DLPA 1JHDA 3JXEA 1OBHA 5TS2A 3CVVA 2IELA 4MUKA 4NX2A 1TYDE 2AKEA 2GM3A 1QU2A 4XSVA 4JXZA 4YP5A 3CLRC 5F23A 1H3NA 4KPUB 1M8JA 1V47A 1QU3A 1KH1A 5DB4A 1TYAE 4ZT4A 3RFFA 4X0EA 4DDKA 1WZ2A 4F4HA 1MOPA 1N2EA 3GUZA 3FI0A 2A1UA 3ZUGA 4OUDA 1KP2A 2YWCA 1X6VA 4MVYA 1GZUA 1T9GR 1PFVA 2CV1A 1JIKA 4FZJA 2JAXA 1ILEA 4KR7A 3Q10A 1PG0A 3IMCA 4MW0A 2PIDA 1MAWA 4NDAA 1M8FA 4QREA 3QE4A 3DO8A 2CSXA 5IJXA 3H9CA 1O97D 1T6XA 3MLBA 1I6MA 4EG8A 3ILVA 5IHXA 3AIIA 1J1ZA 3U1VA 1K4MA 1K92A 1O0CA 3ZJTA 1VLHA 1TYCA 3RK0A 4AQ7A 2E21A 5DASA 1MRZA 1IFXA 3A4IA 4MVXA 5AHWA 5LM3A 3SDBA 4ZT3A 2GOYA 4ZCRA 3MUEA 4F3RA 3CVYA 1NSYA 4MUFA 3MLAA 1IQUA 1O5TA 3TQOA 1QQTA 2QUKA 4Q93A 4I6JA 4QBTA 3QTTA 4R2LA 3MXTA 3RK1A 2DPLA 2VXOA 1O96A 1YUMA 2V0CA 1B6TA 3IH5A 4ARIA 3PNYA 2G36A 3AL0C 1EUYA 5LFAA 1U0BB 1T6ZA 1BS2A 3SEZA 3COVA 4J76A 4U63A 3AFHA 1YI8A 4CDNA 5FNZA 4HJXA 1ZUNA 2NSYA 3SZGA 2R5WA 3FNRA 3QTBA 1QTQA 4KKVA 4PBRA 1J20A 1M8PA 3IDFA 4DE5A 2JANA 1TFUA 1TEZA 1EFVB 4MVCA 1J70A 1JGTA 4ZT7A 2V0GA 1O94C 2D54A 4KR6A 3IVXA 2J4DA 4I6GA 4MUIA 3ZXSA 3N9IA 1ZJWA 2ZUEA 3IMGA 1Q77A 1NURA 2CFOA 4MW1A 3X1MA 4YBRA 2DETA 1ZH0A 3SZ3A 2PZBA 1COZA 3FG9A 3X1KA 3FETA 2DR2A 3CLUC 1NZJA 2QTRA 1F9AA 2CT8A 4JFAA 2QJOA 1LI7A 4XFJA 3CLSD 2ZUFA 1P7PA 3ND7A 4MUEA 3BL5A 3ZJVA 2QUHA 1F4LA 2A1TR 4ZCSA 4NATA 1IHOA 3CLRD 3HGMA 2WQ6A 3L93A 3AG6A 2WQ7A 2A86A 3IOCA 4AS1A 1IQRA 1GAXA 1IQ0A 1MC1A 4CQNA 2CV0A 3IODA 2BYTA 4PBSA 2J07A 4OJMX 3KT0A 2PG3A 4YP7A 4EG4A 3UMVA 3CVXA 3TZEA 2EJCA 1N2GA 4ZCTA 4S1OA 3LCJA 2Z08A 2OV4A 3N05A 3IOBA 2BTEA 1KH3A 2VTBA 1MJHA 1A8HA 2Z3VA 1GTRA 1EFVA 1EFPB 3ZXIA 1HYBA 1EJ2A 3UK2A 3RJZA 2E18A 4PY2A 1KP3A 3H05A 4MWBA 1KQOA 1M8KA 1KH2A 1G8FA 3OTWA 4MW9A 4EG1A 3I05A 1JEDA 5H16A 2DEUA 2B7LA 4BWVA 3CLTC 3VGJA 4ZT5A 1V8FA 1ZH6A 3C8ZA 1PG2A 1DNPA
chains in the Genus database with same CATH superfamily
3AM3A 4TTTS 4M4SA 1T8UA 2VTVA 5FWAA 4C05A 4QLBA 4M9UA 5BSMA 3FYUB 4IEIA 4CJXA 4J0IA 4RELA 2IYYA 1V43A 2ZUDA 4NCHA 5JSFA 2AJTA 2PJZA 5FB3A 1PI3A 4J4TA 3V00A 3UGQA 3AERB 5G3YA 3B12A 3K9HA 2R7KA 4IKPA 1KSGA 5KNDD 5AXCA 1O6FA 4RVOA 2A2ZA 3G5LA 4BO0A 3Q72A 2DWQA 2XGSA 3PKIA 2DFNA 1I32A 4OHPA 1W581 1QZZA 1U80A 4G6ZA 1QC5B 1JI3A 4JKYA 4KODA 2OR3A 1N8NA 1JZSA 2HMYB 3BH6A 3CR8A 1NYLA 1PWEA 3FWPA 2IFTA 1AUOA 4LVUA 4HWGA 3ZD7A 1IVYA 1Y37A 1NIJA 3CF4A 2BFCB 2YFKA 4E1BA 3V8NA 1SWVA 1SCIA 2GKSA 3G5UA 1ND6A 1D1TA 1TECE 4GGOA 1U7XA 4GG1A 4KH0A 4L4SA 1E63A 4Q9LA 2J33A 1HL3A 1I0LA 3CN7A 3IGFA 4L8LA 3Q5DA 2B5WA 1S5PA 3IKLA 3E3MA 1JFVA 2B69A 4RZXA 1SU7A 3IXLA 5AOCA 3VR2D 1AA6A 2YXEA 1YC2A 1J6UA 3K73O 2RHBA 4QEZA 3FNQA 4IOMA 5ECDA 3I6YA 3DVSX 5DNDA 4UMFA 4B48A 1NN3A 3BM5A 3FXAA 5MGNA 2BEWB 3W9YA 4AKHA 2P9JA 4AF6A 5A6VA 4DZZA 3U9LA 1WUTA 1NP7A 3KCQA 4Y6RA 1VYTA 1RPJA 3LUDA 2HU5A 4NYIR 2ESRA 3BMXA 4Q4JB 3ZN2A 2O2IA 5TQ2B 3Q12A 3G5TA 3WI7A 4LJRA 3VSBA 1GP2A 2W11A 2XUPA 4MKGA 4EO9A 4ER3A 3R6LA 3MGAA 1JQLB 3AESA 4JOSA 2R6AA 1ZRNA 2GNAA 7REQB 2RFLA 2XA9A 3FCYA 3H5TA 5KJFA 2OMEA 3QOXA 1QLHA 2GCOA 2JJ2D 2OZLA 2VP3A 2W42A 1DSSG 4ND3A 4RXMA 5KHAA 2HF9A 5IXJA 3TG2A 2CNNA 2A9KA 3Q7EA 4HWPA 3ZWOA 1A95A 4ZVTA 4YXFA 1JWAB 1W88A 2JGFA 3TEMA 3N87A 3JQEA 3TW6A 4DMCA 1ZAYA 2Z5FA 3QM1A 2P9GA 3UV6A 4YPVA 1KI3A 4ARAA 1GV0A 3Q3VA 4BU1A 4XFDA 4PGMA 3NBYC 1WCIB 2A0YA 2AQIA 2HNKA 2ZGVA 3O4IA 5EKTA 2OB1A 1JR3D 1SCQA 1CUSA 2OAEA 1R0BA 5JE8A 1H9AA 4OQNA 1DAEA 4TKZA 4Z9FA 5JZBA 1Q95A 3ES9A 3HSSA 3QLEA 5FF9A 1CQPA 2OZVA 3D3EA 1K5HA 3H7AA 1RQ2A 4AYWA 2EYQA 3C5WP 3G5MA 4J4HA 1Z7YA 3PNMA 4EELA 1U6IA 4WACA 5I51A 2QXTA 1I4EB 4FEEA 1KDRA 2GS9A 3UMYA 4CVNA 4IF6A 4CUZA 3TPFA 3GJ6A 4MW4A 4R2WA 1PTJC 1T3GA 2FCAA 3IR7A 3M8KA 3L0IB 3PBKA 1WKCA 2BFPA 2C1XA 3OG9A 2YIDA 4G56A 4AZTA 1D2RA 1UT5A 4NULA 2QJFA 3RRXA 3THYA 3R3UA 4WCVA 3IPCA 4OFBA 4AMZA 1R3UA 4GGMX 4RPGA 2XBUA 1GJRA 5AJTA 2LNDA 5DGTA 4C3ZA 2Q7XA 4GLFA 4TKUB 5FV4A 3EMVA 3N5KA 3DB1A 4GXTA 3C85A 4ED9A 5JD3A 1RXEA 2IHZA 1UXGA 2VDPB 3KQYA 1TM4E 4OGLA 1R66A 3O3CA 2WNIA 2IEYA 1RQGA 2QVBA 2FUEA 3ZU2A 5TF0A 5AH0A 5IDYA 4H7PA 3LX5A 4ABYA 3SEAA 3B1XA 2X9VA 1SQ6A 3CUYA 1D0VA 4M9XA 3QJGA 3JWPA 3AEUB 3GP3A 1JYEA 4MUNA 3HABA 3SFVA 2JBAB 1KBOA 2LR0A 4MHSA 5IARA 4E1AA 4Q9JA 1J2YA 3FW1A 3FRIA 2GNOA 4MTLA 4E21A 1CRLA 1Y8AA 1LK5A 2H4XA 2ZWIA 3B2EA 4KQWA 2JJ1D 4OSOA 4RK5A 2GRAA 3TOSA 2QLFA 3OCUA 4XGQA 3WMXA 2CXQA 3RU7A 2JFVA 1U2GA 3VC1A 2WZCA 3H9GA 2I3ZA 3EGXA 5A7HA 1Z62A 3TLYA 4BZXA 1PTJA 3RC8A 1MX3A 4H7KA 2O06A 5DGXA 3RKRA 3HWRA 3QY9A 2DPHA 4MIYA 1NQ5A 4UVEA 5EJEA 5JH7A 3I2YX 5LWHA 2FGJA 4JJIA 2JG3A 3LXUX 4IIDA 4K6KA 5KAPA 4DQ0A 4XVCA 1FLAA 3LXRA 2LW7A 2A3NA 2NVUA 4QXAA 2GI4A 2ZU0C 3GGDA 2Z3WA 4Q3LA 5AOBA 4J8PA 4Q5IA 4ZJYA 5BSFA 2HA3A 2I6UA 5DVZA 3VDMA 3A7DA 1RRVA 2RJNA 3Q6IA 9LDBA 1C9NA 2F9FA 2RAFA 1MBZA 2FLWA 2WHRA 3GCGA 1L4UA 1YDHA 2VR1A 2ZYHA 5A5DA 3I53A 1RRPA 1N8SA 2XGOA 2JH3A 5CFRA 1PFKA 4X54A 3VGPA 3AIMA 3WV4A 1IN5A 2I2WA 1CC1S 4CHGA 4YLYA 1MEJA 1I5EA 1ST2A 3ESDA 2GZAA 2YNMA 3CM0A 1N0WA 3GRFA 4NPHA 5FUYA 3B78A 3K71B 2QIPA 3GJSA 4N54A 5J63A 4F0JA 1DDOA 4A10A 2WAXA 2Q5OA 1U81A 4LYAA 2H06A 3O7WA 3NUQA 3N6XA 4MLZA 2G7ZA 3HJNA 3VHRA 4DV3B 4DIEA 1EK1A 3JQAA 3PK0A 4RGYA 4JJ8A 1EP9A 2QUJA 3FTPA 4MV4A 4R0NA 4WUTA 4EKEA 2HWUA 2QP3A 1O0BA 2PZGA 1ZK2A 1DKLA 4N4AA 1GILA 4KPFC 1GT6A 1RC1A 2J08A 2NT3A 3KWJA 2PMCA 1V11B 4N49A 4YV1A 5JQGB 5G40A 1FB5A 5JADA 4TM8A 3N59A 5DYNA 3SR3A 1SBIA 2NO4A 2VJMA 1ZCFA 4KXXA 1YFZA 1H3EA 2OTCA 1XB2A 4KQEA 4RAOA 4Q9DA 3ROQA 1NF8A 1XL1A 3ZIUA 1GR1A 1MAHA 5JG7A 3CX6A 2XXAB 5J4LA 5J1SB 5JSYA 1JYSA 1WMDA 1Z16A 1AF4A 2GYUA 2ORED 2P9YA 3LNTA 4L4ZA 4PQGA 4TS9A 2P6RA 3IHTA 2WU3A 3PR1A 5A71A 1SBZA 5D86A 2XVZA 5AI0A 1Y6GA 1R18A 1NI5A 1WXFA 1JNYA 2XBLA 3OZEA 3UJ7A 4PCLA 4EKDA 3EEFA 1SQGA 1CZHA 2J32A 3Q9SA 3KUXA 3SX4A 4EF6A 1AVTA 4FSDA 3EVAA 4IW3B 2IWHA 3TSCA 5ALIA 4LRWA 2EVWX 4GPAA 4K6CA 3NWOA 4LQCA 3V33A 3O2SB 3JY6A 1MIHA 1LDNA 2C2YA 2D7JA 2G77B 3KQVA 3R3SA 5H7XA 1VQ1A 1QZXA 2JAUA 2HWXA 4ND7A 3HVRA 1NVTA 4ZT2A 3CCBA 5GADl 4QTZA 1QNFA 1N0IA 4W7SA 5FFNA 4B7AA 4EQZA 4OJQA 4AS1A 3Q3HA 3FHJA 1DS6A 1WDKA 3FWYA 4X1YB 2PJDA 3AL3A 1E5QA 1EUCA 2IPNA 3LZCA 3OJWA 1PHPA 1E98A 3EXFA 4YAJA 4D98A 3Q4GA 2DULA 5CVTA 1KQNA 3LK6A 1BGWA 1RIIA 4D45A 5CCEA 4FWTA 3V34A 5AVKA 3QZUA 1QTNA 4RL6A 1FS4A 1KEWA 4U7DA 4OMCA 3LL4A 4UHKA 2FXVA 1UH5A 3RIMA 1Y4DE 2FP3A 4C3OB 5JSZA 3S5UA 2KI5A 3FCOA 1JMVA 3KPJA 4BV9A 1DKNA 4HLCA 4M22A 5I7RA 2NXJA 3G0CA 2H16A 4LZNA 1OLSA 5KYXB 1DKRA 4A0RA 3GJ5A 3KLMX 4PFJA 3HI6A 4YH1A 3RVJA 2QX6A 3V4ZA 1QU2A 3FMGA 1TQDA 5FEMA 1DO8A 4PEVA 4GSKA 4X45A 2UYGA 4QFMA 5MDHA 4UNSA 5IAAA 3QWFA 3GEEA 2RHRA 3RVDA 1PSDA 4OIMA 3MOGA 5EJGA 1EDZA 4LQDA 3N2ZB 4MCIA 2ZTUA 3ZBPA 3PFKA 4ZT4A 3ROKA 2IBTA 3T12A 4ZQBA 2HA2A 4ZODA 4DM7A 2XB4A 2BD0A 2BMEA 3FI0A 4F9FA 5IDQA 3G2IA 3OUUA 4KOEC 1VP9A 1AKWA 1E5XA 1G19A 1RCUA 2I71A 4FBLA 3R77A 4LJ8A 2ZRFA 2BLNA 3PA6A 1Y80A 1SOVA 2G76A 2LIVA 5LA6F 1ZI9A 3SHQA 2JAXA 3S8EA 1QH1A 1Z5UA 2I67A 3DBLA 5AKEA 1QPBA 3MTAA 1PHRA 1X74A 4NJEA 2YC4C 3I2HA 5I7EA 1DRKA 2R48A 5GOTA 1YDMA 1ZC4A 3LHDA 4YJHA 2XWBF 4BFZA 4BVEA 4Z7JA 1PNRA 2QW8A 1W88B 3MS2A 3GFVA 1ONSA 1Z7GA 2QY6A 1J1ZA 2FUKA 4GI3A 3F73A 4JA0A 2UYHA 3M4XA 5AW9A 4LDAA 5DHTA 1FU8A 1I3CA 1R8SA 2AMVA 3D3KA 5JAQA 4KXVA 6CHYA 1NU6A 3TMKA 1FXSA 4PYQA 2P68A 5AKLA 5BNWA 4BEVA 3GAFA 1OYOA 5KREA 2GOYA 1KIMA 1GRVA 1UC9A 4WK2B 2Z3ZA 1E2LA 4OX9Y 4DA7A 2XKKA 4RVGA 4Z0TA 2Q9CA 4ID9A 1HA3A 4JSTA 4QUEA 3ZWCA 3F6SA 1W1WA 5EXPA 3VZDA 4YA6A 3RANA 1XSEA 4JNCA 3AY6A 4JQSA 3PG5A 4AG3A 3N7TA 5GONA 2DLNA 4GZ6A 4HT3B 1CCWA 3WMRA 1W94A 1JPJA 2CL7X 1TUBA 5EIOA 3OVMA 3OU6A 5EUCA 1G5FA 4LY0A 4NICA 4A8JC 1PJ8A 5T64A 2HHHB 2PSJA 4HGZA 1BO6A 1UODA 4YAEA 1OAKA 1P5ZB 2GETA 1Q1AA 1OLOA 3DT9A 4G0MA 4IQGA 1ZK0A 4K9QA 3AL0C 4EABA 1UFOA 2YUIA 4RS3A 2VDWA 4DHEA 2JLSA 1XBTA 2PVPA 2CLLB 2C7VA 4OY3A 2B2XA 3D6HA 3HCRA 4PG7A 3EWIA 4PO3X 2HCJB 4LSWA 5CTJA 4YC7A 5GONF 4COKA 4B6QA 4DGSA 1NWHA 4Y6LA 3V6MA 2R6R1 2B98A 3GNQA 4KKVA 4PPYA 4F7DA 2OQRA 2JGLA 4HNAB 3IDFA 5F9MA 4K8RB 5HPYB 3ZY2A 2CZGA 4ER7A 3DFKA 1A7KA 3Q7RA 4UAJA 2VSFA 4HEHA 1K6MA 1PR3A 3ON5A 2RKWA 3L7KA 3ZY6A 4MIKA 3UJNA 5JSQA 4ZHSA 1TLLA 5L95A 3RODA 1JBKA 3L6CA 4GE3A 2DQ4A 3U3JA 4AQDA 5F1PA 1JDNA 2YJ3A 4O5OA 5FL7D 3FNBA 5EKUA 5AVZA 1U7PA 2WWTA 1B16A 3ILXA 3CLUC 3BIXA 1Z29A 1L4BA 3SDZA 3L0OA 4BN5A 1GVHA 4I5GA 1W8IA 2V6GA 4C2AA 4WCFC 1IG0A 1QFSA 3CLSD 2P35A 1ZWKA 4N7RA 1EZ1A 2C5GA 3LSTA 4MUEA 5AXBA 3T99A 3WLJA 5LOVF 4N48A 1L5HA 3LAWA 2ZWOA 3WDKA 3AUUA 1WW3A 1KDOA 2Q9UA 3IV6A 1KO7A 1L9KA 3IHLA 2AOTB 3FFBA 2QMYA 4AZ3A 2DKOA 4F4DA 1RACA 5AW5A 3RUFA 5KVSA 1KJYA 4BMZA 4DIFA 1KI9A 4S35A 4G0YA 2CV0A 5TR9A 3BERA 3EFBA 5L4NA 5HF5A 4DTCA 4PBSA 4D9MA 2Y1EA 1YVUA 1SCDA 3HBJA 4OOEA 3U39A 1ULSA 4R1LA 1I51A 4P83A 3ZWKA 2GFIA 2WDZA 4XR9A 3RTDA 1AN9A 5JU6A 4A2QA 4RMGA 3OQMA 3SVZA 2BP7B 1RLJA 2F3UA 3GZNB 4XUDA 2AZDA 4DSZA 1CUWA 5CAEA 1A82A 4XRRA 4TLDA 1E1QA 1E5VA 3GJ8A 3KZ1E 4OSPA 4QOJA 1L8AA 3T7JA 3GJTA 1L5SA 2C2OA 4JXJA 1XTBA 2YXLA 1G5PA 4D46A 1G42A 3Q8XB 1TXGA 2NTVA 5EI5A 5JJ5A 5MFPA 2VHJA 3O8NA 4UBLA 3H4IA 1NC1A 4MGEA 1IOVA 3UK2A 4ISCA 3HMKA 3UK6A 1GKIA 3FTQA 4O4LF 4DQVA 1KU6A 2JAWA 2GJAA 1NG9A 3EYWA 1PDVA 3H6GA 4S1TA 3WQSB 2ZROA 3OIDA 4KIFA 5AM5A 4PY2A 2QVGA 4J07A 3BMNB 3EWSA 2RC5A 2PT7A 3ZIAD 3MRXA 3ANNA 3NOVA 4K6GA 3KQLA 1XV5A 1OFIA 1FU4A 2GNPA 1C4OA 3LHKA 4N5IX 2C99A 1EFLA 2F1IA 3IELA 4OHMA 2B7LA 1FNMA 5AVXA 4M7OA 3ZXXA 3JZFA 4A8JA 5HRCA 2YW9A 3L2OB 4F46A 2CVZA 3L41A 3M4ZA 1UP4A 3UT5B 3C8ZA 4ACAA 1JHXA 2EFGA 2GT1A 4HBZA 1KJZA 2Q8PA 4JLKA 1M7BA 4R84A 1ZU4A 5CVDA 4CWAA 1KDZA 3TSWA 1VHWA 3O4VA 2EWWA 2YJZA 4L28A 4RWZA 3LNCA 4PNEA 4H3SA 4EG5A 4A8JB 3THXA 1WDTA 2YZGA 2YWDA 5J2UF 2BR4A 3LQ4A 3LGXA 2HZ7A 4P86A 2R97A 3CF0A 4DY4A 5KNLA 3NAMA 3PCTA 4NEGA 2AMFA 4IIUA 2X0FA 3GGPA 1GPYA 1DEOA 2DBZA 3BJEA 2I6XA 4MA4A 4RVUA 3MBOA 5LQSA 4NFHA 4MO2A 3B7PA 4MS1A 3WL4A 4G5YA 2COEA 1EIZA 2A88A 2OWDA 2ZJOA 4G23A 4YASA 4CF7A 4I2VA 3VA7A 1TTTA 2W9XA 4E1VA 3KKZA 2I34A 2I4NA 3AFIA 4HNUA 1IBCA 2Q2QA 1ENZA 3B70A 5DEIA 2A14A 5T57A 3WWDA 4Q9AA 2UZIR 4E6EA 2NV2B 1HMYA 3IVAA 2PKQO 4CV2A 2AFIE 1E6EA 3ITNA 1ZONA 3KTAA 5KQPA 5KS2A 1X2BA 3OF5A 4WX2B 2J31A 2EKDA 4N5NA 1WZEA 4LWPA 1YR9A 2PX0A 3ITEA 1R9GA 2X5JO 1JYFA 2OXCA 2AW3A 3V3TA 2CNKA 4NONA 1BQ4A 1ZM2A 1H1LA 4O0LA 3PYMA 4FLMA 4TVOA 2X42A 3WE7A 4A6XA 4AZ0A 4JYAB 3NI2A 3K92A 1T2CA 2GZ3A 2GK3A 2Q07A 2QQGA 4NABA 3LC7O 4JJ7A 4O2LA 3SF8B 5F1KA 4ZQHA 4ZIRB 2E5LB 2ZP1A 2B0CA 2AC2A 2XVMA 3NXSA 3PJDA 1X7WB 4JROA 4RJJA 3K53A 1A9XB 4CL2A 1J2RA 4X85A 4DM4A 1BRMA 2W6PA 1R0KA 2QQFA 3UTCA 3B38A 2ATXA 1FXWA 3FNGA 3QLUC 4H15A 4AG5A 3A28A 3W5SA 1R0YA 1ZX1A 1UKEA 2IBSA 4BMCA 1PZXA 5A9RA 3KT3A 3G2JA 1LFAA 3SIRA 3N0TA 1U1GA 5GM2A 4LJSA 1E2JA 4UEWA 3LRXA 4WY5A 3ZLTA 1PGNA 2TRSB 2XZPA 4P3NA 4D2IA 4ALNA 1C3OB 1ENYA 3NFYA 4KJXA 3HXTA 4EX6A 4DDVA 1DEHA 2VP6A 3U80A 1F38A 1TF5A 1NOKA 3RRNA 1E9SA 1VP3A 4M1SA 5DK4A 3RM3A 4C4PA 3VNBA 3NZEA 4EVQA 4D4LA 3VZCA 4M0EA 3PFHA 2PRJA 4JUBA 1CPYA 1S8AA 3DEKA 3RW9A 4DEXA 4CEJB 1EDDA 2HLNA 3C6ZA 5AM1A 2R7MA 2J7KA 1O89A 4H7IA 1L7EA 4J1QA 1T8SA 3CE6A 5CA0A 4F1JA 4G09A 2WD9A 1JDBC 3K0CC 2NPFA 1GDTA 3B1FA 3G02A 3LBAA 4MV8A 3KHUA 4KI7A 4RHUA 2XRYA 5AHRA 3TCNA 2HXYA 3TNYA 5MF6A 5DM0A 1W87A 2VG8A 3F67A 4ZK6A 1U11A 3O8RA 2JI7A 3FVRA 3CINA 5BW6B 2RGGA 3HSKA 1G5IA 3I9V1 4ZAVA 3TFWA 5B12A 2EZ8A 1L8QA 1XNHA 1T9KA 4IKEA 2V3WA 1MCZA 4M0CA 2BFFA 4GMXA 5FUVA 1X92A 1R4NB 3EQZA 2IXTA 1SO8A 1FL9A 5DBHX 2BFEB 5CYPA 1NVAA 2EL9A 2QDKA 2QB5A 4R69A 3SYTA 4QHTA 3ZZNA 3I3OA 4XRGA 1PLJA 2ZWMA 3S6JA 2IXAA 1WMFA 1YD7A 3WADA 4NE7A 2GN2A 5F4BA 3ISVA 3NC0C 2RGNA 1J5PA 1BHQ1 3I52A 4MR8A 4NPAA 5I7AA 3T9BA 4U7JA 2B2CA 3KDPA 3V1MA 4F56A 8MHTA 1ZNXA 3PUWA 5A6SA 4MR7A 2PO7A 1LWNA 3ETHA 3HA5A 4FHZA 2Z2YA 1B8UA 1FX1A 2ZRQA 4LMRA 5CPFA 1T4CB 4MS3A 5KU7A 1HXHA 4I9UA 3FPEA 4XB6B 4DYVA 5LNK1 4GSLA 3BGOS 3BJMA 2FPSA 1I01A 1D7OA 5JY1A 3BB1A 5EYPB 1G8HA 4MR7B 3H6KA 4EKIA 1HK7A 4QM7A 3C48A 4KFUA 4ZO8A 2JLQA 2HO5A 1P2GA 2W2OA 4MV3A 3HB9A 5B58T 2EEZA 2UYOA 2YYAA 4OQEA 4BP1A 5J4KA 4JN6B 2FB9A 4S24A 3ZE6A 4HAIA 4Y3UA 5KMGB 1ISHA 1U2DC 2OO3A 4XE5A 5ERGB 1U4NA 5FTNA 2V1UA 3KJGA 2D06A 4LOKA 4NPCA 3AVUA 1UT6A 1D6MA 4BOYA 2HA5A 1DBVO 1LPOA 1VL1A 2P7IA 5TJHA 4A0GA 3UPUA 1PR5A 4P4SA 5JFGA 4MAAA 5LLTA 5FO1A 3OTIA 3GLTA 4CL0A 1CJVC 3ICVA 1WF3A 3LIPA 4GAEA 1GQSA 2A35A 3B6IA 4X41A 3KZMA 4Y9UA 4TKLA 4TYQA 3K6SB 4RVDA 4PC2A 3WB1A 8ADHA 5IAOA 5E3IA 4QSMA 4HYTA 1ATZA 4N8EA 4U5XA 2XR1A 1UKAA 2YWRA 4C5AA 1ZOIA 4GYJA 1J9ZA 3L1JA 3M4JA 1KWGA 4XQGA 5I9LA 4KNYA 1E1CB 4LRXA 4RK4A 2XWPA 5GVRA 3GFTA 2ASVA 2ZITA 1PFUA 2OY0A 3OMXA 4P7FA 4D8XA 2VYVA 5GTDA 3D2AA 3F71A 1FK8A 5I8WA 2FSFA 4EPYA 3O2QB 4HWTA 4Y8VA 2OPHA 5DHQA 3TMYA 1G8MA 1U1IA 2FWBA 4XJVA 1T2UA 4D02A 4DRZA 3BIOA 2JKZA 1UXOA 1JQ3A 4NJMA 2EGGA 2RHCA 4FGKA 5KTOA 3AGQA 2AN5A 1RXWA 3GLGB 4LE2A 5LMZA 4J0HA 1R6AA 3UMBA 1XKQA 1Z5OA 2W37A 2YZMA 4YWHA 1EAYA 2RKOA 3ZDBA 1QF6A 3I64A 4FHFA 3NHJA 5FOWA 4C4ZA 1L1QA 1VCNA 5GGXA 1NC3A 3RRYA 2H5JA 4GSYA 3LKBA 2NAPA 1OYYA 1YZKA 3LYLA 3QBVA 4HY3A 5ETJA 4K81B 4E5UA 5LZ2A 1SXQA 2BGIA 2OUIA 1S4MA 3CZPA 1DT3A 4OQLA 4QEKA 3DV0A 2UZ1B 4PLGA 4BYMA 4B6EA 4DM3A 1JKJA 2UVPB 3QLVA 3T1NA 4ROSA 2BGGA 3JSXA 3AI1A 2BFBB 4WOPA 1DCTA 1WZIA 3AW8A 3QWBA 3SYMA 3MOIA 2RHMA 3M9XA 3RVMA 1C0EA 1JNXX 3ZE8A 1KDTA 5HSGA 3EDQA 1CUFA 1VHJA 2GAOA 3CT6A 2MSCB 1UWCA 3ZEAA 1ADGA 1RWBA 3DVRX 4RHTA 5CGQB 1NJ1A 3EW9A 1YULA 4JP2A 2P27A 2PSEA 1RAIA 4FDAA 4GC9A 4NU5A 4QECA 5U4XA 3SE7A 3VNRA 5CDTA 1U2RA 2HF7A 2PSSA 3CNEA 1CUAA 1ACMA 3HLKA 3NH9A 4IGEA 1BZYA 5ALJA 5EE0A 1F4PA 3TLAA 5B4UA 3AP1A 4OTZA 1M2EA 3CX4A 3UVEA 4R1NA 1UJNA 4Z5XA 2B7BA 1WUYA 2R7AA 5ENZA 4R8LA 2L17A 1L7XA 4DSOA 3TEFA 4GEKA 2XA1A 3NUGA 2IA5A 2B1JA 2G82A 5DU2A 1D4OA 1F8XA 1SD1A 2PBFA 2PTGA 3ACBA 3TRJA 4BX3A 2B8EA 2NT4A 3GCWA 1Z0SA 3R9WA 4LVOA 4A26A 1XHLA 2CHEA 4DGQA 1GTSA 4EI9A 1W9MA 3RV4A 4NNPA 3KHKA 2IHYA 2VYVD 1XLTC 1C1XA 4Y6PA 3H11A 3T9EA 4BNYA 2Y6UA 5JDIC 3ZZ0A 1JDVA 4BN0A 1QFMA 5JDIA 2W90A 3ZDDA 1CQWA 3JXEA 3HY4A 1HZZA 4PG8A 3GXOA 5IUNC 2VP2A 3BWDD 5IABA 2OVBA 4N65A 3PL1A 4O0MA 3CF2A 3I8SA 2FSIA 1Y98A 2BH9A 1QRDA 4X3CA 2O8DA 1MV5A 3CLRC 4UM7A 3G2LA 4RTJA 5SZIA 3RRJA 1TAUA 2BEJA 3ZWAA 1D2GA 2D2VA 2QYTA 2XCUA 4DQXA 3DOEA 5LUAA 5ERXA 1ZGZA 5SICE 2Q3BA 2GN1A 5JJBA 2BMFA 3HFRA 2IXBA 3LLSA 5BV0A 5FTWA 3BQNB 1X15A 4FFOA 2B8TA 2YFQA 4FXPA 3UB3A 4DR3B 3OKFA 4BKOA 2YWCA 4DG5A 1EZ4A 3IPRA 4IDCA 4KG7A 2ZUBA 2I7XA 3EUEA 3O3MB 2AFRA 5H9VA 2OA0A 4F2WA 3A6PC 5ALOA 4CMCA 1CXZA 2GQ0A 1IC6A 2XUAA 3NYWA 4MB6A 2EATA 3S2UA 2RK4A 2E6UX 4BVHA 3IMCA 4LK2A 4L6IA 2PIDA 2BSXA 1YBVA 2V7TA 3TLZA 1JMKC 5E2BA 4HAWA 4XDZA 4D9BA 2AE2A 3FBTA 2N47A 3HJUA 5IJXA 2CFTA 2DBYA 3FDZB 2P6NA 4TZTA 2MCFA 1TMKA 2I2BA 4NHOA 2JKYA 2X0DA 4EG8A 2PGJA 1GAXA 1P5JA 4FN4A 1J8VA 4LHWA 1Q7CA 3LM8A 4JSYA 5BY2A 2I4OA 3OU2A 3PR2B 1XPRA 3RFUA 1GU0A 2ERYA 2C95A 5I48A 3Q9UA 3WA7A 3RIGA 4JR0A 5EJFA 4J2HA 4A0QA 3WLQA 1GPBA 1MVOA 2W83A 3NM4A 4P6VF 3TUZC 2HMTA 1PVVA 4MQUA 1QWOA 3MAGA 4MWSA 2QD2A 4YRFA 1XTSA 3B53X 3TTXA 1YACA 2ZRCA 3WWYA 1EU1A 3L9WA 1RLUA 2CEKA 2WVAA 2OAQ1 2ZE6A 3RAJA 4Z2YA 4YT4A 4FBGA 1K89A 4XQEA 1A76A 1AQNA 3A3NA 1L4FA 1TM1E 1VFNA 4ID3A 2FFAA 3GN2A 4U8GA 2QA5A 2BI4A 2ZB2A 4IDQA 4I9FA 5G53C 2O07A 3ZIDA 4URVR 3EB9A 4LHEA 1R8XA 2AIRA 1QE0A 1YJ8A 2EFDB 3A70A 2BN4A 2WT9A 3DLIA 4JVOA 4OQMA 2JHAA 5CMLA 5GPBA 2W6JD 1P1IA 1JIXA 2UZ0A 4J3JA 2B1QA 3C3WA 3D2CA 5LZ7A 2GRJA 2NQTA 2Q5FA 3A2LA 4FOOA 5F35A 1XG5A 4KJZA 5FWYA 4QJ3A 3ZHRA 2WIDA 5CK4A 1C7JA 1U8XX 2ZE8A 3ICPA 2GUWA 3N6RA 3ZHOA 5IM4A 3U4QB 5JJIA 4ZAZA 1JIQA 3E5NA 3MTDA 1T9DA 3AINA 1E9AA 3JYOA 4OMUA 4EJ0A 3R3YA 3PQ8A 4DAEA 1UBNA 721PA 1BYUA 1YXMA 3IQZA 4MPTA 4RVFA 2PU7A 3K9QO 4FMDB 2HXGA 4R98A 1Z56C 2F1HA 2WUFA 3GAAA 4QGSA 4BRSA 4F8EA 1ZUNA 2F62A 1V5WA 4KO1S 4EW2A 1MEEA 3TYXA 3ZYCA 4YT8A 2X8AA 1EX9A 4LPKA 4DLYA 2VPQA 3K5IA 1RBMA 4PZZA 4GZMA 5EMNA 5M29A 1H8EA 4EHKA 1BDHA 1B43A 2MIIA 3UANA 5CVUA 1ADBA 1IE3A 4I55B 4OAPA 4X60A 5H4HA 1BJRE 4MYSA 4BEBA 2Z95A 4P54A 4FDMA 4DLWA 2DCMA 5SYMA 4FDLA 4ZYVA 4PLTA 1QX3A 5KINB 2J7PD 2P6MA 3EHEA 1SBNE 5C53B 2AUNA 2GCEA 3IP8A 1E69A 1RVV1 1WMAA 1U6KA 1HLGA 1I4TD 1EJ0A 3I6QA 3PU6A 4FCWA 2WOOA 2JI9A 4HN2A 5EWJA 5CH5A 3RJMA 3WIVA 1AHPA 2B4AA 5DNEA 1BEUB 3CKLA 2ZJ8A 1ECBA 1YJAA 2FFQA 2OFOA 3PUXA 2OXIA 3U4AA 2JGMA 2VUUA 1BIFA 2FR8C 2AFIA 3QE0A 4PFQA 1CJCA 4I2NA 2J9ZB 1CEQA 3M82A 1LI7A 3R7WA 1LNSA 1QJ4A 2H63A 4BLUA 5A1TA 3EXHC 5A5VA 4KXMA 3I92A 3R5TA 4RJIA 2IZ1A 4JCCA 5B57C 1YKFA 3UAYA 4PZPA 4QDJA 3U5ZB 2FX3A 2X6RA 3IQGX 5C8YB 3VDNB 3AG6A 1H65A 1Y3HA 1R0RE 3AIOA 5IX8A 2CHGA 4KGXA 1NHWA 3BHNA 3FYSA 3ZNNA 5H81A 3VOTA 1JA9A 3BQMB 3PDIB 3S55A 2OFFA 3UWSA 3IOMA 4FOLA 4TLBA 4DVGA 3L0YA 4I1VA 1LK7A 3KOWA 3V5NA 4QOEA 3LTNC 2TMYA 3W2TA 3U7GA 4F60A 4LJYA 4ZCTA 4URWR 5AM0A 1KDYA 4EI8A 4DV2B 1C0KA 3EPRA 4Z4IA 1OOEA 3DZ8A 3IIEA 4R1UA 1F8GA 5HA5A 5DMXA 3R7NA 1A8HA 2IIPA 1XQYA 1A9TA 3EC7A 3I2KA 1U0NA 3GCZA 3ITKA 4QOHA 2HDHA 2JHGA 3JASA 4UUPA 5EVJA 1RE0A 1GXSB 3IEKA 5AD1A 4FONA 4KWCA 1U7HA 2YZNA 4D26A 3I23A 3OT5A 1Q83A 1U0EA 1PO7A 3V46A 4D9NA 1DJPA 1SUBA 3QKRA 2O2SA 4RVHA 1MNQA 2WK1A 2Z98A 2YJGA 1QH1B 3DBLB 3Q7SA 3Q6MA 3BZBA 4KO8A 1BFUA 4QQKA 1KQOA 4REMA 1R8QA 3K15A 3F47A 5C7LO 2GYVA 1B23P 1PZHA 1KH2A 3EGDB 4RK6A 3CB2A 3G89A 3WGJA 2LVBA 3OU7A 4M1TA 3CNOA 4ZOBA 1AGPA 2HLHA 3NGLA 1ISRA 3CH7A 5EQTA 1NATA 4PC7A 3W2GA 4BP9A 4FLEA 3WHLA 5HXAA 3ILSA 1J8DA 1NNUA 5B53A 4EENA 1LF0A 4NF2A 2XT9A 3RU9A 1KK2A 1STOA 1FMCA 1NVVR 2FSPA 3LWNA 1Z5GA 5L3QA 2A1IA 4S1WA 3SC2A 2QL9A 4IICA 5KSWB 1O8CA 2C9BA 4G5QA 2BFDB 1PR6A 2BKUA 3KLOA 5AKXA 3W5JA 4MGKR 5IJ0B 2RCNA 5H3LA 3KSZO 4UUMA 1N5MA 4KBYA 1AZLA 4LQLA 3B36A 1ITZA 1MRNA 1KS2A 1KJ8A 4H7JA 4LOHA 1VBMA 2CVQA 3LWDA 4K9SA 4YALA 2V54A 5DGHA 1SVUA 1G5QA 1V8DA 2UYCA 3OKAA 4XGIA 3WGKA 3LCVB 1W7AA 4PFKA 4HDCA 3Q1KA 1K6XA 4KQFA 1XKLA 3NHZA 3BJRA 4GR5A 2FSVA 2ZULA 2H54A 1PT6A 3VZBA 4GI7A 4ER6A 7REQA 4X1KB 2QUIA 5KQRA 4MQEB 2XXBA 2FR0A 3TAHA 5AP9A 1ESZA 1XXHE 5HF9A 3W7VA 4ETIA 4D3SA 1QHNA 2VAWA 1EB8A 4BFSA 4W5QA 4RBNA 2RK3A 1E3JA 1C4KA 2D5LA 1EFAA 4BLQA 1CTQA 4FYVA 4RJ2A 3R5JA 4RGBA 4QGGA 2IJGX 2BCGY 4K9LA 3E7WA 4ZOQI 3GT3A 4LGCA 1BG6A 2GHTA 4QUAA 4MO9A 1Y6ZA 2TMGA 4R1PA 4CLDA 4MDEA 1KQGA 2P75A 3KQOA 2J45A 5EUMA 2WNSA 3HHEA 3FPBA 5CJJA 3FGNA 2Z1NA 2O7RA 4F4FA 4E33A 1YVEI 2VHVA 3FTFA 3D6FA 4IVQA 3U3OA 3KKPA 1H3FA 1Q7RA 2FEAA 2AZTA 1CY1A 1JX6A 3EC2A 2VRBA 5FWYB 3AB3A 2IXDA 5I9TA 2AV6A 1YZFA 3E2MA 4W9NA 1YGYA 1SXPA 3JALB 3AHCA 3RC2A 5D85A 1JR4A 2HUNA 2XOKA 3QKUA 1V6CA 4XIFA 2JB9A 1K86A 1Y9DA 3KTFA 5GONB 5ADVA 5HUQA 1KEEA 3USES 4B0PA 4K6FA 3KSBC 3QPAA 3QEAZ 3DW1X 4EGJA 2DSTA 4P3PA 2IYVA 3LXMA 3KQNA 2I76A 2WI8A 3DYBA 4FFNA 4MK4A 5CM2Z 4P93A 1YASA 2X5OA 2Q3DA 4HAXA 3NVKI 2PS1A 1K8XB 2FGKA 1OI3A 3BKXA 4CNQA 3DB2A 3QFHA 4NYMQ 3WIBA 2CLOB 1LDEA 1KRHA 4QBKA 1UZNA 4Z4GA 1VDMA 3PYLA 1L4YA 4JYPA 2CD7A 2XIQA 2BVNA 3LX6A 2RHLA 4IUYA 1G9TA 3DTVA 1JVBA 1Z8HA 2DY0A 2BZ0A 1R12A 2OHIA 5JWHA 2H08A 3GUYA 4JBNA 3NHBA 1KI6B 5BV1A 3VTAA 3NUZA 3PPYA 3ZBTA 4IGFA 1Y1KE 3IP9A 1WXEA 3R23A 2WJWA 3QQPA 1B00A 1BC5A 3OJLA 1ZIOA 2O6LA 3MTBA 4QO8A 4TRJA 4AUMA 4DMFA 2WWWA 1IAQA 3ZD8A 4CM9A 1C7EA 4CU5A 2NPIA 5DTRA 5K0LA 3HKDA 2CHUA 2BHTA 3K31A 1C80A 3BD6A 4KUGA 4EYQA 1E2GA 2HIGA 1GZ4A 2O19A 3RRFA 1EAMA 4FK8A 4U2DA 3RQIA 3NTLA 1N2JA 1P2SA 1T8PA 3AQIA 1EWYA 3NB0A 5C46F 3A25A 2WAAA 3AEKA 3M9LA 3ZWPA 5LXTB 4HJRA 2NSLA 1DOHA 2XV1A 3P9QA 5IFKA 2I3DA 1QVRA 4BQOA 5ICMA 3CW9A 3EOZA 3EOAI 4KQHA 3TK1A 4TYWA 5COAA 3KBBA 2PSDA 1JQAA 4J0FA 1P5HA 3MJDA 4OKNA 3I5YA 1T10A 5WRFA 3HNOA 2J8ZA 2RONA 2PMEA 1UBHS 3CRNA 5EE5B 4CCYB 2V4MA 4P0PB 3CEMA 4GYKA 4MIOA 5CFMA 3K09A 2DFKB 3RAFC 1BCRB 1GO2A 1A9RA 4CKWB 3N8NA 4QPCA 4DC9A 1THGA 3R7SA 2ZS7A 1V2HE 3ECCA 4V0RA 3R0XA 4D0NA 4B4OA 1E62A 4KREA 1PFYA 4OHWA 2JBHA 2Q7DA 2I87A 3TF5A 4TZ0A 3NKLA 3CF4G 4HWOA 4GU5A 1TU3A 1GLNA 5LMNB 3HCPA 4KYVA 3NBQA 1EKXA 4C88A 1ECPA 4UDNA 2XVXA 2HCRA 2XSZA 4KMOA 3HDQA 2PWZA 1GN8A 1NP3A 4ZCIA 1KY4A 1VIVA 1XE3A 3OM0A 2WU4A 1GYQA 3ZH2A 1QZTA 1PGPA 3A6FA 3I4LA 4I7EA 6PFKA 1MH9A 4L75A 4EG7A 1CZKA 3MERA 4EFLA 1COWD 4MULA 4IVRA 3F49S 5GV8A 3MMSA 3IJRA 1P2BA 3MELA 4RD1A 1T8WA 2WINI 2IP1A 4RDIA 4H2DA 2EKQA 5DO9A 5TX7A 2ZRJA 4MGHA 4KLRA 1I7SB 1GSHA 3LGAA 3Q3GE 4HEA1 2WLSA 4XLLA 2FRVA 4PZDA 3J7TA 5TGTA 2ERCA 1WU8A 4NZPA 1I4LD 1MH1A 2GJKA 3AZQA 4P1ZA 3DAGA 2CFCA 1MB4A 4BO1A 5JW6A 5DOZA 2O8FB 2PMWB 2IU3A 4MQ6A 4Y2UA 5B6IA 2RH5A 4FYJA 4D5GA 2M6KA 1JI0A 2ODNA 1XDGA 4CKEB 5IVPA 2WHPA 1FYEA 5JNWA 4GZ3A 2OENG 3LCCA 5CB6A 3QUSA 2QKYA 2JA1A 1J0AA 1N3IA 2BEUB 2CCGA 2CHFA 4HH1A 2V65A 1YHNA 2PGLA 2P69A 2PQ0A 1UDRA 3RS5A 4MGZR 1W46A 2QL7A 5I7WA 4ROTA 3O9VA 5ICSA 1MP0A 4B3HA 4P08A 4MI3A 2H18A 1QQAA 4LF9B 1IZ0A 2PLAA 3GQVA 2C92A 3K6SA 4F6CA 1URPA 2B92A 3IKMB 5LYJF 1ESDA 4FUQA 4HXGA 4BL5A 2O1WA 1W1UA 1O7JA 1N5KA 1XEXB 1HY3A 2HHCA 2ISCA 5CW1A 1K0FA 1GQ2A 4MUYA 1T26A 3EQ7A 2D1RA 3FPAA 3HEMA 3RIEA 4MQ5A 1N7HA 3UB2A 3VO2A 2UAGA 4RKYA 4AMYA 5T41A 2PJUA 5D3MA 5IJAA 2VPIA 4PSAA 3TWOA 2FQXA 5K0TA 4HX9A 1Y42X 4LCBA 1ZAKA 4UARA 4EG6A 3D5TA 3VTFA 1RXUA 2Q99A 1PZFA 1D2NA 1GQRA 1TJNA 1I1NA 2GD6A 3NBAA 3ZYZA 3COPA 1CJMA 2H1LA 3MWDA 4QYWA 3TDMA 2AHRA 2O3QA 3F96A 4K9RA 3HUDA 1W5TA 4EA8A 1O4VA 5B7PA 4Q4AA 5FUQA 1B1AA 1M10A 3NONA 5JISA 2ZKIA 3DDZX 4NE9A 4MVJM 3U49A 3KDSE 3MCWA 5FO0A 1IY2A 4ASUD 4BKQA 4JJ4A 7ABPA 2JGNA 3D1VA 2P65A 1LK0A 2RGWA 4M9SA 1GG5A 2R7NA 4Z0NA 1IUNA 3ZY4A 1L4MA 1PGJA 3FVQA 4N1AA 4WZBB 1YFLA 2EP5A 2FWMX 1E64A 1Y3IA 4WY2A 1X39A 4FYYA 4AP6A 1H6CA 4B5LA 1V35A 4WJLA 1Y4ZA 1AXEA 1M1XB 1G5RA 5GWXA 4PU0A 5LSAA 1A4UA 3AHIA 3WXMA 1PNVA 3HN2A 1W4RA 2FI1A 3U4MA 4AP5A 2WD8A 3TEJA 3L77A 1ZD5A 5AI5A 2V7WA 2REQB 4GNRA 4EI7A 4I8DA 3BRWA 3UUGA 5JSKA 4CCAA 2GA9A 5KHLB 2HU7A 2R8YA 4G0WA 1I7QB 5KNDH 4MWGA 3CB4A 1MGPA 3M0EA 1USIA 2WVHA 2C8JA 5CD9A 2ZUWA 4FN5A 1U4SA 2GBLA 3MINB 3UH1A 3V7UA 4PE5B 3DLBA 5GIOE 1CQZA 1UZUA 3F5QA 4HRAA 3P9NA 2GMWA 4YAOA 4BGVA 2RH8A 3AF2A 4BNDA 2NX2A 2P3OA 2R1UA 3O74A 1JSZA 4X91A 5FKJA 2P41A 4XCQA 1NE2A 4LCEA 4B3FX 1CVLA 4MYDA 2I03A 3IEIA 5I5GA 5DSZA 3CQ9A 4GT1A 4WXEA 2XOEA 3LDGA 5FAXA 4R0MA 4C29A 4MVYA 5AUNB 1GZUA 3KKKA 4IIJF 3G1UA 1SXHA 1OH8A 3IUSA 3I62A 4WXYB 3DBOB 1OQAA 2CXHA 3CO5A 2HRQA 4U5QA 1TK9A 4G0QA 1JALA 1SPXA 3JPYA 1FSZA 3GVCA 3GNLA 1KSHA 2FPIB 1MQ9A 3QA3E 2WM8A 2JLUA 3WMGA 4OHCA 2PQ2A 1NLZA 2FQYA 2P9TA 2JJ1A 2POCA 2G70A 4TUYB 1XQVA 2CJFA 5FOTA 2X77A 3GT0A 4RTSA 2VDRB 1RLOA 2W6ID 3RK0A 5JSHA 4RA9A 5JOQA 2FPIA 1W59A 3U44A 3TQQA 5LIPA 2H92A 3O1JC 4B6RA 1V6AA 1JFFB 2VHXA 3VV3A 1Y5NA 1T4GA 1QIEA 3TI7A 4JBGA 3P26A 2DFPA 2SCUB 3C1OA 2HSZA 3PNKA 3OLQA 1NVBA 5ENDA 4V1CI 4E2WA 5IF9A 1UQTA 1KYZA 3GRCA 4LHYA 4OATA 4OHRA 1O5TA 2JAHA 1AMNA 1UBGA 2YS7A 1EFUA 2ZT5A 4DQUA 4RZHA 3NP9A 4BQIA 4UBMA 2XF2A 2ZBQA 3FWHA 3G8AA 3BDAA 4UULA 4B9EA 2XYHA 2WIJA 1VE3A 2MSKA 2QNBA 4FIDA 3HS3A 5E4FA 3EPJA 1J0EA 2AR0A 2IYAA 2OHVA 4G37A 4MJ3A 3V2UA 3KB2A 4D96A 3VU0A 3EA0A 3IUPA 3OM1A 4HB2A 1UBLS 3FRJA 2FWNA 5AMXA 1KPGA 3GRZA 3EVDA 1E1YA 1PL7A 3E4DA 1NUAA 1I1QB 3KJXA 3Q15C 2YWEA 4TMTA 4JUAA 4LJAA 3CKKA 3UA3A 4YRGA 1YRQA 2QRPA 3K8OE 3ORSA 5FBHA 2C58A 1AK1A 4LKOA 3OZSA 1VL8A 3EZNA 4FZVA 4CDNA 5H1YA 2Q1TA 2QE6A 3P9KA 2QVZX 4RD6A 5EHNA 3N6VA 3SZGA 4DLZA 2XTMA 1JR3A 3EEOA 2V6IA 3PXGA 1RYEA 1GITA 3OJCA 1RAEA 3TQSA 5C7YA 1XDZA 5A62A 2ZIGA 4FE4A 4OLAA 2Q6LA 4M8LA 2HJ9A 3ANXA 2FNAA 4MVJI 4UTRA 3FOEC 4R6XA 1U2GC 1Y5RA 3I0NA 3IDOA 3WXBA 5DP1A 2CF5A 3UUFA 1O94A 4ZT7A 2D54A 3L0CA 1SBCA 4RO0A 2Z8YM 1IDOA 1PG5A 4XIJA 1T4CA 2IGBA 1ESCA 3CEAA 2GTIA 1HFJA 2SNIE 4FS3A 3HVKA 2WSSD 3QVKA 1HG0A 2ZUEA 2C3YA 1V6SA 2JJ2A 2XUOA 3S81A 2BSAA 5FEUA 1ZH0A 1BMTA 2BWJA 2BF4A 2HV9A 1P8JA 2R5NA 4J16A 4F5YA 1HYGA 1NZJA 2BELA 3L5KA 1P6UA 3V2HA 4GOND 4WFQA 2G7MC 2QOEA 1U65A 1ZI6A 1Z2EA 2QJOA 3U09A 1U6JA 2H0QA 1P7PA 3SHWA 5ICEA 2YYZA 3P2JA 4KKXB 4DNOA 1UMCB 3ZNPA 3PHCA 3V2IA 2Q3LA 1NU8A 4WLVA 3Q0TA 2RSLA 3W9UA 2IPXA 2DJ5A 1QONA 3L1HA 5LQMA 4Q24A 1K5DA 4KQXA 2QMZA 4ZZ2A 1Y6JA 4R2JA 3MRSA 5AVVA 2ODAA 1A96A 5K8CA 5KTYA 2BM9A 4XKJA 5J23A 1CLUA 1M74A 2XQGA 3HKDB 1BE6A 4OP1A 5TARA 3L06A 1RWNA 4P5DA 4ZQCB 4FCTA 1CD5A 3IFSA 4TSRA 1PT9A 3Q8KA 1QQ5A 2I4RA 1G2IA 2P8JA 1NKSA 1T8RA 2GWRA 2NW6A 4H1VA 5FX2A 5BSVA 3FZNA 3LD9A 3RSZA 3N05A 3GBVA 5JI3E 1FNSA 2HI0A 4WOCA 2QRJA 2WW8A 3L82B 1ZUIA 1UINA 2ZWAA 3P19A 5EKXA 3BTOA 4J3NA 3DUFA 1DAIA 1JHRA 3GFQA 3I37X 3RG8A 2AMLA 2YKGA 4FS8A 4E4RA 5M34A 4G07A 4OGWA 3CY6A 5D8DA 1IHYA 1RC0A 5G1OA 4DOMA 2ZTMA 5KNDA 1YKSA 4Y2SA 4EBBA 4AMBA 4MRPA 4MWBA 4JQOA 4MVJD 1C7RA 4FI3F 4W9MC 1JEJA 2IYEA 4TXNA 1P73A 3ZG6A 2BRUC 2O7QA 3PPXA 1ZGAA 4MQMA 4CKBA 1IZYA 1VRWA 1X1DA 2P7HA 2ZTLA 4PNZA 5H16A 1XZJA 3ZQKA 1PL6A 4B32A 3MK31 3HTXA 1RQXA 4JHXA 4K05A 4EBFA 2FOLA 2V9CA 3OAAA 2HRZA 2X40A 3EA4A 1ZH6A 3FZQA 2GN6A 3THYB 3LWZA 3LL7A 1DNPA 1WV0A 3K30A 5JJKA 3CG0A 5H3HA 4NLLA 5G4KA 2QL6A 1OXBB 4KQ2A 4U9IS 5KSYA 2RHOA 2CNWA 3ROXA 4AO6A 5J58A 4L8FA 3LUFA 3SBEA 3VUFA 4MCJA 1D1QA 1L5GB 3RC1A 2HWYA 3DOUA 1X9HA 3FPCA 5AFSA 5JEDA 2Q1YA 1H1LB 4BAGA 4G81A 4ECEA 5LQNA 1J0BA 1VLVA 5D5PA 1NN0A 3GK3A 3C6BA 1JU3A 1TRHA 3LUKA 5TQ0B 5BN4A 5CT6A 1KAOA 4MUHA 1JQJC 5E9WA 4G4JA 1ZSNA 1FU7A 2UYYA 3AKZA 1WSBA 1U3DA 3AR6A 2DFVA 4HAYA 2FHPA 5K6AC 4XARA 2OBFA 1GPUA 4ZDJA 5DFAA 2WKWA 3WLTA 3MGCA 2JCVA 1N9GB 3BFVA 5THXA 1TKCA 3GZNA 4JDUA 1YA4A 3BGSA 4M60A 5CAEB 2YZ7A 3TIGA 1SIBE 3MMPA 4EY5A 4B76A 1ZINA 5AJVB 3EIOA 1G2OA 4KPEC 1G6KA 3WBBA 2AA3A 2PA0A 3WIDA 4Z54A 3P2IA 2ERXA 4Z4EA 1B6SA 2VNJA 3ESBA 4MPJA 4QX6A 4RUKA 3RGGA 2ACKA 1X1TA 4AWXA 4L5AA 4F45A 2KLBA 2VS1A 3QK7A 1Y9ZA 2BPOA 3AEXA 1M54A 1XFDA 3RYIB 5K8VA 4CGYA 1X1EA 4KW7A 1HDZA 1Z4KA 1XJQA 3UBTA 4RULA 5JMPA 4Q37A 1JH9A 4DQLA 3AO0B 4FMCF 4RQAA 3MSCA 5ALLA 1KVTA 4UUNA 2W2NA 1O03A 3TW8B 1M72A 2VHUA 1Y8ZA 3AKEA 4DN6A 2P2DA 3WK4A 2R1TA 1MC4A 4FZRA 4ZOEA 4NBNA 1RQRA 3OOSA 4GGPA 3RYIA 3T61A 1JKJB 2UVPA 3RF7A 3ABQB 4X1KA 5CEEA 1HQDA 1UK7A 2Z2XA 3K32A 1TADA 1N2XA 1K8RA 2JH8A 3QXGA 4KZKA 4WFIA 4JI1B 2AK3A 3KKQA 1JJFA 4PLFA 2F48A 3R6DA 3SC3A 1WHSA 1GTG1 3FTCA 4PAGA 5CIWA 4GP7A 3A6KA 2PD3A 2HC9A 4GFDA 1JG2A 2DCUA 3GLQA 4M8KA 3EVFA 4G5HA 4OH7A 4R7GA 4DCPA 2VI5A 2V7EA 3KZNA 1N2IA 2WMOB 1UPUA 3HU1A 4E3WA 3WYBA 1JFTA 5LP6F 3MCAA 3PIDA 4X24A 5KYVA 2D1SA 4CKEA 2R8RA 4J91A 3V8QA 3OZWA 3EC1A 4PTLA 3KYDA 3T5BA 1R5BA 4CF6A 4XWKA 5IASA 3FOZA 1P4GA 1YB5A 4CMAA 2UUOA 4Y6QA 4QRIA 4XPZA 2HSGA 5KTSA 2P2LA 5GJBA 3FH0A 3B6KA 2P91A 1BSVA 4IH4A 2YTZA 1BU5A 1Z4MA 3H0CA 4L1KA 5DTEA 3DONA 4DCGA 5FDFA 1Y7LA 1ZFNA 3KDAA 4BVLA 4CLXA 2FMKA 3MWLA 4W4TA 2DECA 1ZRHA 1NX9A 3JQ9A 1PNQA 4G4SO 4ESVA 3GFPA 3K9WA 1XYGA 3MJEA 4R71A 2WILA 4N76A 1JR2A 1QYWA 3PFWO 3JRXA 3QVOA 3FB1A 1ZG3A 1ONPA 3SI7A 3PTLA 4ZRMA 5B2EA 1QRRA 4IL5A 1QHFA 2HDOA 3BCHA 2BTOA 1HBJA 2DR0A 2OBYA 4IDEA 1XN1A 1PT8A 3TD6A 3UT0A 4KXNA 2FEPA 1GKYA 2FQ1A 4EVRA 3R0ZA 4FE3A 1BHJA 3GQBA 2AFIB 4R83A 2E9SA 4CTNA 3QX9A 5CFOA 1U2SA 1P45A 3UBMA 3UHAA 3G9XA 4N3CA 3PJRA 5LYYA 1Y89A 1CZOA 2EJUA 1WXHA 2G72A 3DE6X 4NMXB 2YV1A 1HDCA 1DG1G 1KS9A 1GTJ1 4ODIA 5AM2A 5CLJA 1U5BA 1QIKA 1E9RA 3IB6A 4RDXA 3IJPA 3T7AA 4M49A 4M88A 2FKNA 2H2AA 4D3DA 4NAVA 1QPGA 1T5IA 1YZNA 5ISMA 3ZDXB 2HIHA 2GYWA 3IUQA 1I33A 3LBFA 5DN9A 4C6TB 1RWQA 1I13A 5BPFA 2CHQA 3HYNA 3GI1A 2UXCB 1Y6RA 3OZAA 4X5OA 5EE9A 5AJWA 3LQRA 3WL5A 3PUKA 2QRGA 4P2GA 4RHXA 4LYFA 5KJCA 2P6PA 4YYEA 2J46A 1KE1A 1P91A 3G2KA 2QAJA 5TY0A 3B6ZA 4BLTA 4UE3S 3WGVA 1X7WA 2X8JB 3VOBA 3PEVA 4RF2A 1GADO 1EK0A 1KJNA 1ORWA 3ZV6A 3KU4A 2H1HA 4HSGA 2ZR8A 5B37A 5CRIA 5HFAA 2EW8A 2SBTA 4JODA 4UCWA 4B3JA 1T0JB 3SJZA 1KI8A 4MV6A 4NFLA 1A04A 1FVHA 3A4TA 4BNGA 3M6WA 1Y4UA 3KKEA 2J6BA 1Y1PA 4OQQA 1MG0A 2H1SA 2V8OA 4ZOAA 5AVUA 5KYWB 2IEAA 2CVFA 3R8FA 1J24A 3KQWA 3R7LA 1XVAA 2WRZA 3AF5A 3F9RA 1YVRA 3PFBA 1MENA 2P3QA 1MB2A 4E11A 3T3EA 4F04A 1Q91A 1RADA 3K2BA 5DE3A 1VL5A 2HWKA 4HQKA 4LUCA 2WR8A 3GLIB 1EP3B 1EJBA 4DPMA 2TMKA 4MDHA 1Y0BA 4RFSB 2LV8A 2IZ6A 4TN5A 3JZIA 1VCMA 2OCAA 2ZE5A 1E2NA 3NKVA 2JEOA 3OZIA 1RI4A 4QNMA 5B2ZA 1SFRA 1ZA1A 3HDVA 2EG9A 1I3MA 1Z82A 3ID6C 2XUZA 3D54D 3EXIA 2Z8XA 3PGKA 3EIHA 3HB4X 4YMIA 3GD7A 1P5FA 1ZHOA 1CFJA 2XQFA 5DW0A 4N5HX 1EG2A 1U1FA 2VTDA 3NH6A 2ECPA 4AJEA 3KJNA 1TM2A 1Q0RA 2XB8A 4RV9A 4F3YA 4BJ5A 3ZDRA 3J80A 3AHFA 4FFBA 2C3PA 5JYDA 4UHEA 2PWYA 2QTVB 3GEGA 1WEKA 1XLTA 5DX8A 2BW0A 4UM8B 1JLSA 3TXAA 5JBNA 2X9LA 2CL6X 1DJNA 4GD3Q 3IP7A 2RHHA 2CDAA 1A9XA 3TPCA 1FLNA 1DEAA 2EBWA 4D0GA 5K6RA 4Q3NA 3LUJA 3NETA 5CX1A 2IOYA 1BYIA 2R1ZA 2ZDQA 3PP8A 5GIPE 1AKQA 4YJ3B 5AR1A 3IMFA 4ZCPA 4LF4B 2AYZA 2OP0A 1RYMA 2D7DA 4LF6B 4L8GA 3CZAA 4H4EA 4Q9NA 4Z86A 3DULA 5J4HA 3PSAA 1YVDA 1TKAA 1HTWA 1WXDA 1YSCA 3GLIE 1JBEA 5LYJB 3L1VA 1P0IA 2P0YA 2PK3A 3ZVRA 1Z8NA 2AL7A 2CLCX 1CR2A 1S2OA 1VHTA 3T3IA 2V6JA 3HA3A 2OQ2A 1GPJA 1VA4A 4BNNA 1BOFA 4HD8A 2QMEA 3BXFA 13PKA 1RXYA 1THTA 2O0LA 1XK6A 3RVPA 2A9OA 3OQ1A 4M76B 3BDVA 2Z4RA 1T6NA 2OHGA 4WECA 4XLZA 3RVLA 2I0FA 4B2IA 1QR2A 1E92A 3KVOA 2GHIA 2QN6A 4LXIA 2OSBA 4TTSA 1F06A 2ZJ4A 1A98A 1W5BA 4Y2GA 1XEAA 5KX5B 1OKKD 4TWBA 1AGYA 4OYLA 1JJAA 5CXSA 3HN6A 4AZWA 4UXJA 3PCXA 1KMCA 4IDAA 4EY6A 1Z5VA 3N28A 4JUFA 1IPFA 1Q11A 2NVBA 3HXLA 1D09A 1HRKA 1AF7A 2ZR7A 4QOSA 4XQCA 5K2OA 5BSRA 5HUHA 2MINB 2C94A 3KRTA 2NAFA 4RQUA 1Y1QA 9LDTA 3PWZA 4C0KA 2UZ3A 1HYEA 3JARB 3BGIA 4NX2A 1OXVA 3ZY5A 1KOFA 1M7HA 1LPMA 2I78A 3IUYA 1D8TA 4CNBA 2XDWA 4XSVA 5BOSA 5G3ZA 3TECE 3AY7A 4TTJA 2BJWA 4D42A 3NASA 1U3VA 1JT2A 3OEED 3L07A 4GYWA 2GARA 2JIZA 5IKPA 5K99A 1L7MA 2EFHB 1KSFX 2VZ9A 4JLJA 1GGMA 3B1YA 3ZVLA 4O3MA 3JYNA 2JATA 3MGKA 1SEPA 3TX2A 1H0KA 1O0SA 1MOPA 4B4VA 1M2HA 4HWRA 3RYHA 4DDUA 2N42A 4YMUA 5JCJA 4E22A 4URFA 1K5PA 1C3LA 2GPAA 3RRZA 1VHQA 1QG4A 3AU9A 4AZ3B 4DPKA 1FMLA 1LLUA 3JW8A 4P7KA 1Z68A 2K4MA 3HWWA 4DLAA 5A05A 1IATA 3RV3A 3DL4A 2CXUA 3IEUA 1Q14A 2R79A 3E18A 4HGYA 2QPOA 4K1XA 4FCVA 3U60B 1D03A 1OFGA 1C7ZA 1TVKB 5I8ZA 3RLFA 1GFSA 2WJ6A 4AJ1A 2FW9A 2I91A 1XZQA 3WLOA 1CR1A 1A69A 5D01A 3AIIA 2I7TA 3I28A 1T3SA 4UW9A 2F17A 5H59A 1NLFA 1U9CA 3W05A 3TTUA 3PL5A 4KBGA 1IFXA 1SUFA 2GBFA 2R25B 3JVIA 2GPJA 2DUJA 2P4EA 3P2MA 4UHHA 1D7AA 3G2MA 4IX9A 1QKJA 2HBRA 3CVYA 3ERCA 4H0NA 4Q3CA 1TEHA 1Z75A 1NVMB 2G8NA 5DGDA 4D79A 3TQTA 4CIYA 4NNJA 3GGCA 2HK7A 3TQOA 4KQIA 3RASA 1NW3A 1V96A 4FU0A 1I2AA 5BVGB 2V8BA 3ZOKA 4W1PA 1H5UA 2HKIA 2CB0A 1WTCA 1ZICA 4TT8A 3CRQA 3UK1A 4P22A 4QT0A 2UDPA 1RCFA 2XH8A 1ZL0A 2R2GA 3P27A 5A4KA 1UCFA 4XH9B 4XSGA 2VP0A 3B7GA 3Q8LA 5EIXA 3OEWA 1GKKA 4J1TC 4X61A 3C7AA 2Y77A 4GOLD 1ZD3A 1BXKA 1JIVA 2ANBA 3IH5A 3P2YA 1JR3E 2GZSA 3O6VA 1EGMB 3NIBA 4G1UC 4IDDA 3RPEA 4FB5A 2C8VA 5M7EA 3FNEA 4E15A 4RIHA 3CUSA 3LW8A 1XEXA 4L4RA 5IHPA 5LFAA 2NZ8A 4B75A 3FUXA 2P1ZA 2RKBA 4AQYB 1G4UR 1H66A 1KAEA 1G20B 2AN1A 1RYZA 5B5SA 2NU7A 1CLEA 2O20A 3EF1A 2HMSA 1V1MA 3AKCA 3K0EA 4OF4A 3DBHA 3REQA 4BNLA 2NP6A 4RLQA 1WCIA 1DIAA 3AF6A 3WSTA 4PBRA 3PDWA 2AWOA 4WWHA 1M8PA 2XQJA 5HYVA 2AGVA 1ESNA 2OFWA 3GJRA 1SU8A 2Q8QA 1TEZA 3ZDZB 4JC0A 5BQ3A 1NTOA 3U4DA 3WHKA 2FPKA 1BFKA 1G20A 2NO6A 2BGMA 2ODTX 2WIFA 2BBWA 2OXRA 2WFLA 1K1EA 2XA2A 3DDUA 4OREX 3T1HB 4QM6A 4TSKA 5E6UB 1W30A 2XOXA 3ZXSA 2AR7A 2ZIVB 4NV0A 5A0TA 3WR5A 5D7BA 2N75A 5BMOA 3D31A 3AVYA 1YBMA 4CG2A 4I4TF 2OGSA 3UG6A 1RI5A 1HSZA 3NW9A 5JMOA 1WB9A 4TPKA 4KK3A 4E2XA 3DAHA 1CYDA 5DF1A 1RYHA 4GXQA 1KDVA 3Q2KA 5KVQA 4HUJA 2A4KA 4EX7A 1QAMA 3V7YA 2IHUA 4R8VA 5SY9A 1Z4LA 2HDNB 4M0LA 2GZDA 3CLRD 3FF4A 3WLKX 4BE4A 5ES4B 2WQ6A 4MRAA 4UHDA 4V0NA 4CV3A 1Z2NX 3ZX4A 3B3JA 3MC1A 1PBTA 1L5QA 3PX3A 1CIJA 2IY8A 2QTFA 4GX1A 2Z9CA 4KXFB 4OJYA 3KOZA 4EQ6B 1WKVA 2SHKA 2ROQA 4IH9A 4KOAA 4QE3A 5DN6A 4R1TA 2OC9A 1OAOA 2QUAA 4C06A 1RQPA 2G88A 5LBTA 4HPJB 2IYWA 1CUGA 4R0VA 5EQFA 4C20A 2NO7A 3F2IA 4DMMA 1PW7A 2EDCA 4K9NA 1PP4A 4HDNA 5L3SB 4JI0B 1II8B 2PRKA 1G21E 4BNDB 3CUKA 5EGSA 1N6LA 3ZZMA 1I8TA 4UATA 3MS4A 3V4SA 2BTEA 2NXNA 2OUKA 4G1CA 1D3AA 3FF1A 3JQRA 4YJ3F 2WA2A 2BSQA 3HM9A 3FDZA 1NRIA 4WNAB 3DR3A 4AZSA 4Z7OB 3ZWDA 2A5GA 1B2RA 3GDWA 1SUPA 4B31A 2EZTA 1EQ2A 2ZREA 1MV8A 3RIXA 3V1KA 1V4NA 1GRRA 1VSUA 1VCHA 3N0XA 2XNDD 5IVIA 3RIYA 4ZMRA 4KH1A 2JIPA 2CK3A 1CQJA 4O4IB 2X4GA 3HJHA 3QLVC 4LN1A 3I01A 4TTVA 4RKFA 3GYGA 2LDXA 3DVLA 3FWZA 1HUQA 3HFGA 3CUWA 1KR5A 2YHIB 3OTWA 4EGQA 2FEXA 2WKPA 2HMVA 3C6YA 4PN3A 3ANTA 2W00A 2AKAB 3NO4A 1YMUA 1ZEJA 2GEVA 1HNXB 2VNIA 4CU2A 3WOVA 3VGJA 1TMOA 4IY1A 3G9QA 3LA6A 4NWIA 1KYIA 4ZT5A 5CDGA 5JCPA 4IUCS 1FP7A 1L7BA 1SHUX 2RHJA 4E5MA 3OIWA 3VKHA 4LJLA 4MS4A 1DTWA 5HUJA 4GOOD 4MW5A 3DL0A 3BH7A 2IS2A 3BSWA 3FYHA 1GDHA 1LF5A 4RU1A 4RF3A 4Q7KA 5F64A 3ZCVA 2EWMA 3VSAA 2KB0A 4H9GA 5EMHA 1LRJA 4OYHA 4PRKA 1T2DA 3B3AA 1M5TA 1KK0A 2R1VB 4EKNB 4WFJA 4ON9A 4I3GA 5HOQA 2D4HA 1VI2A 2PZLA 1H4QA 4ZYUA 2HA7A 2PUJA 1BX1A 1KAQA 1E7QA 3OY2A 2FG5A 5BXQC 1IXZA 1WZNA 3KJIA 1NPTO 1O54A 4L0MA 1QORA 4COOA 1A71A 4KMMA 2J5BA 1MJNA 2X0IA 2ZRMA 4ZHQB 8GPBA 4IGKA 1THZA 2YDXA 4CMIB 3F5MA 3EVGA 2IT1A 2GAIA 2JLYA 3PQ2A 1X2EA 3COSA 2B8WA 2WFAA 4GXNA 2EBHX 4B8ZA 4GOJA 3W5BA 5DV9A 4W63A 3TINA 1UBTS 4IJUA 1I6KA 4LY9A 1TZKA 2REOA 3DC7A 5DLYA 1GZHB 2NZVG 4CETA 3O4HA 4ZV4A 2PKWA 4RENA 4G4SP 1MW9X 4H35A 1V11A 4Y2XA 4MX8A 5FWXA 5JQGA 1V1JA 1MT3A 3HWX1 1FDVA 3NFRA 4O4IF 4RA6A 5AKIA 3VRHA 1FFXA 3SS9X 2C9YA 5GV7A 2I8CA 1UMCA 4LISA 5JS6A 1M5RA 1G5HA 2CGEA 3EDCA 4PM4A 4NBTA 4X44A 4ZQGA 5U1PA 2VSXA 3SBXA 2PS0A 2XGJA 4YFYA 1L1EA 4M9QA 1LRKA 4E46A 5I7HA 4INZA 1AS2A 1MC8A 1OC4A 3ED1A 3NDIA 4QICA 5JECA 3H2KA 2D5IA 2MDTA 4JBLA 2ZG6A 5AICA 4L50A 2V6BA 4YCLA 4E08A 3FE2A 5A03A 3ZDAA 1BMFA 1OBFO 2JFWA 3MAJA 3W8EA 1E4OA 1XA0A 3M5PA 1KERA 5CT5A 3VNSA 4HNTA 1R5NA 3JD3A 2FMXA 4U2CA 4BBZA 4C5BA 2GWHA 4PN7A 1M83A 2VNSA 1D6NA 4R7ZA 1C14A 2VJLA 1UKVY 3CTMA 1XVVA 3LZ6A 4HDRB 4L73A 4X84A 5T67A 2BKAA 2VPPA 1W5FA 3UJ6A 2A84A 4UZEA 4D9IA 4YIHA 3P5SA 3STYA 4L5CA 1YNOA 3UXYA 1FXWF 3EMBA 5BSTA 5C1PA 3ZCXA 2G8LA 3C15C 2BY4A 4YK7A 1HC7A 2Z57A 2G5CA 1NBIA 1IXRC 4LV5B 2O8CB 4I1YA 3L4BA 5FT9A 4A6PA 2GUGA 3N0WA 2C2HA 3NWPA 2YXNA 3OURA 4W8OA 2I2DA 1ZJYA 1A88A 1N5JA 2ZI5A 3EVTA 4Q48A 3TCKA 3NHAA 2QN8A 4ZMBA 3VYRB 4UBJA 3SYLA 1YU9A 1OCEA 5KWEA 3V8BA 3VFDA 3UJBA 1QX4A 1CUBA 1NBAA 4KXQA 3GEPA 3T3DA 3MCUA 2YV5A 4CM4B 2G4CA 4MVJE 5AVYA 1NR5A 5I7SA 1RZRD 3OPMA 3JWJA 2X7HA 4UEKA 1WZCA 2CWDA 4K9PA 4Q03A 1DQSA 3VMMA 3RYCB 1QJCA 1TUBB 3QI2A 1E3SA 4DLTA 5IN4A 2J0VA 5FWXB 1ZVKA 5M3BA 4MUAA 1HI9A 3W5AA 1UP6A 2LCIA 4LBWA 2WIAA 2OV1A 3GEDA 1GA6A 3QUQA 4IBOA 4Z8XA 5F9HA 2HBQA 3GLKA 3H8SA 1CY2A 2O3TA 3P7MA 3QKSA 4E88A 1BDBA 1KC1A 3OHPA 4NV1A 3CLSC 5COQA 1UBRS 1ZNWA 3QTLA 2BP7A 3LDFA 4XGKA 5DXJA 3IQDB 4TRMA 2RAUA 1RWPA 3E58A 1GGKA 4R9SA 4BNUA 4QU8A 4C7JA 2CUTA 2F43B 2HLPA 3DZGA 3I32A 3LBIA 3C3EA 3T8YA 5KYUB 1IWOA 1U7UA 1PT5A 3OLVA 2PUFA 4D92A 2V7QA 4MV1A 4K46A 4CMEC 3DBRA 4LZOA 4PINA 2HRDA 3OIYA 5FPHA 5IMSA 1MEOA 5B3JC 4G4IA 4LSGA 3GDGA 3A1TA 2G28A 3AUFA 2NADA 2XMZA 4Z7NB 5CBPA 1W36B 1TTPB 3NP7A 1IBMB 4UMDA 5DCUA 2J0UA 2GPTA 1JXMA 1DARA 3F1LA 1E8DA 3QU5A 4QLAA 1SIOA 2A5DA 3I04M 5P21A 1QIMA 1FBNA 3H1AA 3K9BA 2ZE7A 4IIYA 4BKPA 4D82A 3H3FA 1KE2A 4CIDA 4I1PA 4IQ4A 1PS8A 3AQ4A 3JR3A 3LT2A 2OBLA 5HVNA 4NDZA 4BVGA 3R3JA 5I7OA 5EEGA 1SA0A 4RGQA 1ZJ5A 3Q7PA 1DXQA 2RB5A 4E03A 4M1OA 2ACVA 1L5WA 5CFPA 3KXDA 4PZ0A 3J7AC 2POQX 2VCHA 3DDSA 4HNQA 3RBAA 1DKMA 1GUDA 4UUQA 5F52A 3NNDA 1H8HD 2CJWA 5F3DA 2YRFA 3SZLA 5TEWA 5EJ6A 2C7GA 2GEDA 5FBKA 3I42A 3DO6A 3NT2A 3R3HA 5HEKA 4KL8S 5JNRA 1QIJA 2CL5A 4REQB 2DP4E 2HDWA 3IE0A 3QYAA 4E5PA 3PHHA 4JK3A 2H1VA 1E89A 2FF5A 2ACEA 3QH4A 5ESDA 1J22A 3E3NA 4GWGA 3J81k 2IEIA 3TIVA 3WC4A 3PA8A 4WSOA 2JLAA 1GWNA 3CRMA 3MGGA 1ZJJA 1M2NA 1NY5A 1WDWB 4P36A 4PO1A 4V03A 3DOJA 3B52X 3GGOA 1T1SA 3CYFA 3M6IA 4O8CA 4OFXA 4L02A 3TNFA 2C4HA 1NR7A 5CHYA 1EUZA 1HSOA 1F1JA 2B6NA 3LDAA 2NGRA 1YI1A 3REQB 1W4AA 4L2IB 2YINC 2QN9A 3TG8A 2CYAA 4L5IA 2WHYA 4XTRA 1JDSA 1KMIY 5BURA 1FUYB 4ICIA 4F3TA 4UDYX 2I65A 3M3DA 3Q0EA 3N70A 4X8LA 2UZ4A 3SZRA 2IHKA 3F3SA 1FW6A 5LA6B 4PRYA 4A27A 3JVDA 2PZAA 2AG1A 3F46A 1LS1A 1N9GA 4IS2A 3RUCA 4EH1A 1QG0A 4HK4A 1NUPA 2NZXA 4HOYA 5BMVB 1I2DA 3FFWA 3DXFA 3OQIB 4U02A 2O8BB 1GA4A 1E77A 1KMQA 4L0CA 1SUSA 2J9YB 4RH0A 4A3SA 2GAJA 4UJ3A 5FPTA 3PEWA 3MSXA 1QQBA 1JLLB 1JFRA 3RUDA 2RK6A 1CULC 2PIAA 3LUGA 3QPDA 2NUAA 2RAVA 2BAGA 5D3ZA 2H1WA 3E1GA 4MAFA 5LP6A 1REQB 1J90A 4NL4H 5CW2A 2JLZA 1P2VA 2LUOA 2QROA 3L7BA 1XP5A 2HSEA 1T34A 2QLBA 1TA4A 1NBWB 1R00A 1QTIA 2QHXA 3E5RA 1OFTA 5JNUA 5PGMA 1DCKA 2JIOA 3UF0A 4CCYA 1ABBA 2IH2A 4LIPD 3NEYA 2JW5A 4MROA 3ZKAA 4A0HA 3CNHA 2OT3B 4PXYA 1LZKA 4DLBA 2NZ2A 2V58A 3E8SA 1TX4B 3ZJUA 2J5XA 3ROEA 3RS2A 3MXOA 1YRAA 5EN4A 4X71A 1D2CA 4EUEA 4IIJA 3INYA 5IT0A 3ROTA 4OUKX 5DX0A 3QNMA 4I81A 4TX1A 2APJA 3EXEB 4DWJA 3NHWA 4ZEVA 4YV0A 2C2KA 3C97A 3V3KA 2WHPB 2V5UA 3HB0A 3GJ3A 4KIUA 5DBFA 1RI2A 2W2PA 1OYWA 4BCDA 2IUFA 4V0MA 1VIMA 2MYNA 4KPYA 2C07A 3AI3A 4G0PA 5CBPB 3IVGA 4WCFA 3NQ41 1PR1A 3GDFA 3RAGA 3T9CA 3FGZA 4C03A 1VMAA 3OCVA 2C5FA 2Y92A 3IP3A 4AIRA 3BRQA 1WG8A 2ZUTA 4GR4A 4YJ2B 1I2ZA 1XF9A 2JAPA 1XYVA 1WVIA 1YQDA 1M8JA 3U1BA 3UT5A 4FQ8A 1Z3CA 2QM0A 4PFSA 1XD9A 4RHFA 3ND9A 3OOHA 4TMXA 1TYAE 2V59A 3O38A 2A94A 3V4VB 5EJ5A 4KSYA 1OPXA 3BHJA 3TVTA 4V38A 1JXQA 1U8FO 1EWVA 1E7YA 1ZK1A 4ZV7A 4JT9A 1NPYA 3S2YA 3TKLA 2LPMA 1QUFA 4ZTBA 2NPOA 1YWGO 1AUQA 1XJ5A 3OFNA 1FRQA 3OSZA 4UBOA 3T7SA 4BDSA 3WIOA 1T35A 3ENVA 4KR7A 3NHYA 2DQKA 2ZRKA 1A2BA 4K5QA 4B82A 2IXEA 4JC8A 1MX1A 2P2SA 1RAAA 3GEHA 3HDHA 1K6JA 1Z45A 3PNOA 4YQEA 1Z5PA 1O97D 3KPVA 3H4MA 3EZFA 2ZIFA 3FGOA 3OEYA 5AVSA 4X8MA 4DSAA 1V7PC 3HJRA 1OXXK 3DH0A 3R7FA 1JEOA 1RLMA 3UFXA 3ZBQA 1QM5A 3R5FA 3WFJA 4KLNA 3LFTA 5K3EA 1UEXC 2P2ZA 2QYOA 4MVXA 4W5NA 1QSGA 1XWFA 2RI1A 2JASA 2G80A 1M73E 4H4CA 5ESRA <