4JFAA

Crystal structure of plasmodium falciparum tryptophanyl-trna synthetase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
362
Chain Sequence
INYNKLIKEFGCSKITENHIKRIEKLTNSKAHHFIRRGIFFSHRDLDFLLNYYEQHKCFYIYTGRGPSSLSMHLGHLIPFYFCKYLQEAFNVPLVIQLSDDEKYLFNQNYSLEYINTLTNENVKDIISVGLNPELTFIFKNTEYAGYLYPTVLSIHKKTTLNQSMNVFGFNHSDNIGKISYPSFQIAPCFSQCFPNFLGKNIPCLVPQGIDQDPYFRLSRDIAVKMALHKPVVVHSVFMPGLQGVNNSVIFLTDTPEQIKNKINKYAFSGGGTTIQEHREKGGNLDKDISYQYLRYLLEDDNKLNEIGEKYKKGEMLSGEIKKILIDVLTELVLKHQEKKKSLTDEEISYFFDPNKPSLQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan--tRNA ligase
publication title An appended domain results in an unusual architecture for malaria parasite tryptophanyl-tRNA synthetase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Ligase
total genus 134
structure length 362
sequence length 385
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 4jfaA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4jfaA01
4CDNA 2ZP1A 3CLUD 4NAHA 2ZUFA 1IH8A 1VBMA 1H3FA 4GU5A 1WXIA 1FFYA 4L2IA 3IVGA 4MWBA 3TS1A 1EUYA 2IP1A 1SURA 1KORA 4MUJA 4MAFA 4MW5A 3CVYA 3SEQA 3FETA 4HJRA 1KH2A 4MUGA 1T9GS 2EJCA 1XNJA 3ZIUA 3IOBA 4MVXA 3ILVA 4CQNA 1N1DA 3S3TA 3X1JA 4AS1A 2QUIA 2V0CA 4U7JA 2RE8A 3ELBA 2QJOA 4MW4A 3SZ3A 1UFVA 1YUNA 4ND6A 4YP7A 2NZ2A 1GAXA 1YUMA 4WNYA 3RK1A 2E89A 4NDAA 2X1LA 3CLUC 2PZBA 1EE1A 4YP5A 3KT0A 1O96A 3X1KA 1K92A 1N77A 3Q10A 2DXIA 3NV7A 4ARCA 3A2KA 4MWDA 1TEZA 4XFDA 3JXEA 1TQ8A 1CT9A 4G5FA 1O5TA 4I6GA 4MW7A 1S4MA 4DDHA 1OWPA 4J75A 3OTWA 4KR9A 3COVA 5IHXA 3GMIA 1EUQA 1WXEA 1JZQA 4DLPA 4DDMA 4EG7A 1P7PA 3CVVA 1HYBA 4CT0A 2JA2A 2VTBB 3TQIA 4OUDB 2YWCA 2E18A 1D2RA 1K4KA 4F4HA 1GLNA 4YMIA 1OBCA 3UOWA 3L92A 1XNGA 2XRZA 4X0EA 3IMGA 2BTEA 2QUJA 1QU2A 1KH3A 2OV4A 3QTBA 2A1UB 3H97A 2E21A 3ZJUA 4ZCQA 3AL0C 2TS1A 4MUIA 3FNRA 3N9IA 1QTQA 2AZXA 1NP7A 5KHAA 3HL4A 4KPUB 1K97A 3CLTD 3SZGA 1BS2A 4YBRA 3ZJTA 1VBNA 1NUSA 3DO8A 2GKSA 1R6UA 1U0BB 1KAMA 2NSYA 1JIKA 3P0IA 1J70A 1OWMA 3IDFA 2I1LA 1O97D 3LOQA 3NBKA 4E1AA 2GOYA 4EG1A 1F7UA 1NI5A 2DLCX 4QREA 4U8HA 5TGTA 3COWA 3G59A 3AIIA 4JYZA 1NUUA 3FY4A 3KT3A 4L2IB 3ZUGA 4A91A 4DDKA 2H29A 1GN8A 4ZT7A 1QNFA 1F4LA 4AQ7A 1TYCA 4MVCA 5DK4A 3FHJA 1QQTA 4YP6A 1N2BA 3A04A 3E27A 1EFVA 1VLHA 3CLTC 1J1UA 4NX2A 4TS1A 1M1ZA 5HG0A 3MMXA 3D6UA 3KT6A 2QJTA 4U63A 2A1TS 1O95C 4ZT5A 1ZH0A 3UC5A 1N75A 3VRHA 1VL2A 3RFFA 1N3LA 2J09A 3DPIA 4MVYA 4MW0A 1U7DA 4ZT2A 4G6ZA 1N2EA 2CSXA 3U1VA 1I6LA 3I05A 5HUJA 2Z09A 1M8FA 1NUTA 5F23A 3RBAA 3CLSD 1GZUA 3CR8A 2GM3A 3HV0A 2PIDA 1O96B 2J5BA 4OJMX 1WOYA 3HGMA 3FI0A 3BL5A 2A1TR 2WSIA 1U3CA 2BYTA 3SP1A 4CDMA 3RK0A 1EJ2A 1G59A 3IH5A 2X3FA 3Q4GA 5LLTA 2V0GA 1GPMA 1PFYA 1J21A 2OQ2A 3ZJVA 3IUBA 3D6VA 4JXXA 1OD6A 2J4DA 3GLVA 1N2OA 2DR2A 4EF6A 2A7XA 3FIUA 4HK4A 2PFSA 2D54A 3F3MA 4EG4A 2CYBA 1Q15A 2YWBA 2DETA 3IOCA 4MW2A 3IOEA 1N2HA 2IJGX 4NAUA 3IUEA 3CLSC 4DE5A 1GTSA 2J07A 2QTRA 2CV1A 1PFUA 2DPLA 1GTRA 3IVCA 5IJXA 1KP2A 4ZT6A 1T6ZA 1Q11A 1WQ3A 1KKUA 4MW1A 5FO0A 4ARIA 2JANA 1NYLA 2J08A 1LI7A 1G8GA 1JEEA 1R6XA 2D5BA 2O5RA 2AG6A 4K0RA 3PXUA 4WSOA 5H16A 2A4MA 2X0KA 1O6BA 1MAUA 3ZXSA 4EG8A 3N8HA 4FZJA 1WXFA 4JZYA 2EL7A 3VGJA 1TYAE 1ZUNA 3FWKA 2Z08A 3CVWA 1YIAA 2PZAA 1G8HA 2QUHA 3G6KA 1ULHA 1OWNA 3COZA 4MUNA 5TEVA 1MJHA 3AKZA 3A4IA 2CV2A 1QU3A 2CYAA 2E0IA 2O8VA 1WKBA 3K32A 3G5AA 5LM3A 2PXHA 2YXNA 1COZA 1KQOA 2CV0A 1JECA 1KAQA 1Y42X 1WJGA 1J20A 1H1TA 2IELA 1EFPB 4NZPA 2VTBA 2CYCA 1O0BA 4OUDA 1YIDA 1IVSA 4MWEA 3TNJA 2CT8A 1T6YA 1JZSA 4Q16A 1WQ4A 1IQ0A 3FDXA 3QE4A 3MLAA 3H99A 4EGAA 1N2JA 1MOPA 3MXTA 3ISJA 4HPWA 1TYDE 4DNXA 1B6TA 1M8JA 1NUQA 1JMVA 1IRXA 3ND5A 2A1UA 1ILEA 2Z3VA 3DLAA 4GRIA 4I6EA 1U7XA 1NSYA 3RJZA 2H2AA 3AG6A 3IMEA 2YY5A 3C8ZA 2XRYA 2PG3A 4KPUA 1JHDA 1KH1A 1U3DA 3INNA 3MUEA 3M5WA 4JFAA 3CLRD 4ZCPA 3KT8A 1KR2A 1QJCA 2CUZA 1MBZA 3TQOA 3P0JA 4P2BA 5KWVA 1QRTA 3TZEA 1KP3A 3H9CA 2C5SA 2QTNA 3P52A 2PZ8A 1O97C 1WY5A 4EG3A 1JIIA 3ND6A 3Q12A 4MUFA 1QRUA 1YI8A 3L93A 3UK2A 5J58A 3QTTA 4MQ6A 5EKDA 3AG5A 1DNPA 3SDBA 2WQ6A 5DB4A 3ZXIA 2HGZA 4MLPA 2G36A 1WXGA 4MULA 1M83A 3CVXA 4MWCA 3H05A 5H7XA 1LW7A 2JAXA 4MUEA 3H9BA 5FO1A 3DV2A 2DEUA 1TYBE 1PG2A 5TS2A 1K4MA 2A88A 1JEDA 1NURA 4EG5A 1JIJA 4PBRA 1IQRA 4R2MA 1PFVA 4QBTA 4NATA 4PBSA 3CVUA 5K0SA 1M8PA 3CLRC 3IMCA 4H3SA 3COYA 1OBHA 1MRZA 3LCJA 1LI5A 1V47A 3GUZA 1YULA 4R2LA 1XJQA 1V8FA 1MB2A 5TEWA 1JGTA 1M8KA 4ZT4A 3IODA 1WZ2A 2QTMA 4PBTA 4EFKA 4J76A 4JXZA 3PNYA 1NUPA 1ZH6A 3TZLA 1T9GR 1TFUA 4RUKA 5BNZA 4I6JA 2QJFA 3FOCA 4ZT3A 5DEOA 1X6VA 3PRHA 2WQ7A 4KR6A 3RHSA 3UMVA 1KQNA 2QUKA 3HMQA 3HZRA 1A8HA 1N2IA 5KCMA 1M8GA 2R5WA 1XNHA 1NZJA 4MW9A 3X1MA 4ZCTA 1IQUA 3CA8A 2HMAA 2B7LA 2DUMA 4PY2A 3NBAA 4ZCSA 4KR7A 4QRDA 3SEZA 4XFJA 1QRSA 4HJXA 1H3EA 4Q93A 4ND7A 2AKEA 4UZFA 3ZGZA 1Q19A 5AHWA 3ND7A 3HFJA 1J1ZA 1O0CA 4R0NA 3IVXA 3AFHA 1R6TA 1O94D 1X8XA 5J59A 2WB2A 1N78A 5LFAA 5DASA 4ZCRA 1I2DA 4DJAA 3PNBA 2DERA 3P0HA 4G5YA 4BWVA 1RQGA 1KQPA 5JBNA 3MLBA 4MUKA 5HUHA 4XSVA 4RPIA 1MC1A 5FNZA 1JILA 1EFVB 1Q77A 3KFLA 4UZEA 2CFOA 1G8FA 2D13A 2A84A 1I6MA 2X1MA 1T6XA 3LE8A 4MVWA 1O95D 3OP1A 1I6KA 1IHOA 3FG9A 1EXDA 3K9WA 1MAWA 1F9AA 1PG0A 1FYDA 1ZJWA 1H3NA 1IFXA 3PNVA 3UY4A 2HZ7A 4S1OA 5J5AA 3SYTA 3N05A 3FH0A 4MW6A 4K03A 4EG6A 1PFWA 2VXOA 1OWOA 4F3RA 1O94C 1VBKA 1OWLA 5K0TA 1J09A 3VU8A 2ZUEA 1WXHA 1N2GA 4KKVA 1MB9A 1EFPA 1F7VA 3A05A 2A86A 2RD2A 3N2YA 4MUHA
chains in the Genus database with same CATH superfamily
1VRCA 2YW9A 4TXHA 3GPBA 1XD9A 3CLUD 2ZVDA 1ESEA 1YVEI 4FJ1A 2P6MA 1U0LA 3QKSA 2OAEA 1UJBA 3M89A 1JG2A 1D2CA 2CNWD 3G79A 3LK6A 3QKUA 4MWBA 3LC7O 4QATA 4ECEA 4O5OA 2WJHA 4YUAA 5JVDA 4TYYA 2FKNA 1JIQA 3UGJA 3H65A 3HA3A 1SURA 1QONA 1RYBA 4F06A 4ABYA 3KBOA 1R88A 2QGZA 3FF4A 3JQDA 3QEMB 2ZYAA 1EXMA 4HWPA 1KH2A 3TR0A 1XG5A 3PE6A 1T9GS 1N36B 1RWOA 4KQEA 4O0LA 4PQRA 1NVVQ 1VI5A 1XGKA 1NNUA 1SR8A 1XP8A 1JBKA 1AK1A 4GH5A 1U7WA 1EK5A 2P2ZA 2X23A 3BE5A 1NUAA 1HGXA 3GHYA 3LQKA 4I2NA 2N0SA 3RC2A 2G71A 2RE8A 3KIPA 3HBJA 1L1EA 2X0NA 4GOMD 3EEYA 4II2A 2H4JA 1U8XX 4ZEVA 2Z6UA 1DQRA 1OIXA 5CA0A 4QU8A 4WTOA 4DAEA 1PR4A 3BJMA 4K86A 1M6EX 2IE0A 3G0CA 4Y2GA 5C3UA 1WVGA 3PZBA 2PE5A 3PXDA 2PRYA 2H9YA 2OECA 2O2DA 3MBKA 3ZHYA 1WQ1R 2C2MA 4FR5A 4AJNA 4HTFA 3WLEA 4E94A 3LXRA 4QPZA 4R1OA 4Y9RA 3OA0A 1K92A 3BHJA 3H3FA 2V7QD 4PLVA 4D8WA 1YQWA 3LQQA 7MDHA 2FPIB 1L7PA 3FKSD 3HVIA 3OEHA 4A8TA 4R1NA 4WBNB 4LNUA 5ICMA 3GLGA 1IATA 5CX1B 4X1OA 4CTJA 2ZBEA 3OY7A 4OQ4A 4E5NA 1EM8B 1OWPA 5B7PA 4O2AF 5KOJA 2I4LA 3T5TA 1ZA1A 4BASA 1XU9A 4QSMA 3ENNA 2ZM5A 5FX2A 1VLLA 3F9RA 1XVLA 3EXHB 2GSWA 2QLTA 2XV1A 3WJ7A 4B6OA 4AL4A 3N3BC 4YO8A 5LSAA 2JLCA 3A1NA 4YRZA 1H2YA 4HEJA 1DRKA 1ESZA 5IARA 1KSHA 3PEWA 1OBCA 2CXSA 1KY2A 3NHUA 2LIPA 3D6AA 3GVCA 3JAKA 4FDMA 5DZSA 3TYXA 1MX1A 1M75A 1GAEO 3HYLA 4F3YA 4OJTA 3DE5X 2F6RA 4DJEC 4JLOA 2QXUA 1H5UA 1TTHA 1Z15A 3I09A 4GD3Q 5KQMA 2XD9A 2W6NA 5LXTB 4DEXA 2GPAA 2MR6A 1GNSA 1KZ9A 3IP3A 4CLOA 4HDSA 1WDKA 2WIAA 4ZCQA 5GQSA 4IWXA 3B6MA 1JKJB 1C8BA 5KHAA 3W1WA 1MW8X 4R4JA 3BE8A 3MBIA 4LXTA 4KLAA 3KD2A 5FTJA 4MP6A 4DS3A 5P8WA 1TJPB 2ZG6A 4AXXA 2QRZA 1XQ6A 4ZAFA 1GNVA 4HCJA 3LLCA 1A72A 1GQRA 2ZITA 2NPIA 3I2JA 4R2KA 5G3YA 3ZY3A 1ISPA 1NQAO 4A8JA 2GZSA 2EP7A 4YDRA 3AQ4A 2CXTA 1FTQA 5H3HA 2OZLA 3KKQA 3VI4B 2OUKA 4OYLA 3T5DA 1J70A 4C7JA 1TM5E 5B5SA 5FNVB 5C5EA 3EPJA 1Y3IA 3OMXA 4OHOA 1EK1A 4TXNA 1BOOA 3M4XA 1W76A 2WHPA 1NI5A 4OHRA 4G4SP 4Y9UA 4L7VA 4LYDA 3BGSA 3KS9A 3L8FA 4PX3A 4CTOA 2WTUA 3R9WA 2I4TA 1Q0SA 4B83A 3L43A 1G66A 1VYHA 4G37A 2FFJA 3GEHA 3OOWA 2XB6A 1VRVA 1UP4A 2C2XA 2NN3C 2P4QA 5CLFA 4FZ3A 2I3GA 5LLDA 5FKJA 4HEQA 5DE3A 5DIFA 5J23A 1F12A 3MCWA 1HE5A 5CXXA 3WHLA 4BBJA 1F4LA 3HUUA 4M49A 5TVKA 2O8EB 1OHHA 4AX4A 2Z2IA 3FHJA 5C37A 3K9HA 1TUEA 2BMWA 3TRIA 5DN6A 4ZI7A 2IYQA 2FMTA 1E1KA 2D5LA 4D82A 1QO0D 5H02A 1GZHB 2GR9A 1MF7A 2IWRA 4JDUA 5B57C 2NTEA 2ZZKA 1D4FA 1X8KA 1G4AE 2QVCA 3F5SA 3KL4A 4I2VA 3IQXA 5K20A 3LS2A 2QWXA 2WR8A 3W3AA 1DP4A 1U8TA 2L0XA 4YPFA 5G4KB 4G8CA 3QLEA 5HFNA 2WTNA 5J2UA 3HY6A 2ZIFA 4QOJA 1RQXA 4DCNA 2LVBA 5CP8A 1MIHA 5C4IA 1RI1A 3RVSA 2QMEA 1EUZA 3EWSA 2EEPA 3OZUA 4MV1A 2WUWE 2C8KA 3MA0A 3ZHOA 1IU9A 5F23A 5DLEA 3QMVA 2VYFA 3KUUA 4D3SA 6GPBA 4X20A 1O96B 2J5BA 3GGSA 4MGHA 2YHUA 3OQHA 2ZJ1A 2H1IA 3LHDA 1DB3A 4NYIQ 1EJ2A 3L7KA 2A5JA 3GEIA 1ZINA 3CX3A 4X95A 4X41A 1PYDA 4OQXA 2XAAA 2HFKA 2Q1TA 3U4MA 1NT4A 4ZEWA 4GMDA 3RQIA 1BHSA 1TJYA 3SYRA 3EW9A 1N6KA 3SE7A 2XUAA 4BB5A 2VL7A 2AN1A 5DSXA 3E9YA 4Y2RA 1JG4A 3O8BA 5SY6A 4HQRA 1IOVA 5IC4A 1N2OA 4ZYUA 3I01A 4EF6A 4I1RA 3BWDD 3THWB 5TGDA 1X80B 4HK4A 3C3PA 3PC3A 3OWXA 4FHFA 4XW2A 1XD2A 3F3MA 1ZI8A 2ZI9A 3TB6A 1KFEB 4EG4A 1D7AA 1KO7A 3KXLA 2RGXA 3OZWA 5LOVB 3PYMA 3TE7A 3BAZA 3JX9A 3GT3A 3CUEF 1RM4A 5JSZB 1PKXA 1QDEA 2QHXA 1QO9A 2NUTA 3QBEA 2BMAA 2O6HA 3PD1A 2NZ8A 1NXSA 4BECA 3UB4A 4OBWA 2ZT5A 3GEEA 4BGUA 5MN4A 4YUVA 4IUBS 3RIEA 3O21A 4Q1CA 4IY1A 4G0MA 4EYSA 2H2DA 3RIYA 1BROA 1P61B 4V3CA 4F3TA 2IYWA 4J0QA 3SSMA 4ARIA 1QH1A 4WJZA 1Q0PA 1Y3BE 1DDOA 3ICVA 3IKLA 4JJ4A 4MINA 1UEJA 2VPWA 3VNQA 3VZDA 4BN5A 4LMPA 1WHTA 3QWAA 4M9XA 4TKZA 4DZRA 2V6FA 5LPNA 5AK0A 3M9LA 2J9FB 1V5WA 1I2CA 1M72A 4LRWA 4G1FA 3GA5A 4OI4A 4D0RA 4ENVA 1ZIDA 3IQWA 3QNMA 4K6CA 2Q21A 1JPNA 1PZHA 2PSDA 2XYRA 3AR3A 1C1XB 1D1QA 2V6IA 3GJSA 2JLAA 3M81A 1M2HA 4PAWA 5CH5A 4DSAA 1N5DA 2GCGA 4D6YA 4AF6A 5A9SB 4U3JB 1D03A 1YIAA 3A9SA 3OM8A 1ZJ5A 2WAYA 3O0TA 4ZO9A 1LW6E 4UE2A 2P65A 1Z06A 2F43A 4P4UA 4ANFA 2QRVA 4D8VA 4ZREA 3W2EA 2UV8A 4G4GA 3GLGE 2QTCA 1EWKA 5FYDA 2WILA 1BVYF 3ND9A 4RX1A 2IELA 4IQ4A 4CMBA 3ZWAA 1E0SA 1XXHA 5THQA 1MH1A 2FMIA 5AW9A 1O1YA 4UHHA 3WJ1A 5FOUA 1HZZC 1Y3HA 4WACA 2A57A 1T8UA 1JB9A 2F17A 3PJFA 3WC4A 1DIAA 1GU1A 2I8LA 1YCFA 2IEGA 3DEIA 3WB9A 1IY1A 4HMOA 1NXXA 3NUQA 2BFFA 1TZBA 2PTHA 2AD5A 4WY8A 3T3IA 2GBLA 1MOPA 4FBLA 3S2YA 1CRLA 4YDQA 1QHSA 4UUOA 1L6RA 3WIOA 3EQ6A 4XJSA 2HCJB 3RF6A 3TAUA 1WMBA 2X6TA 1KFKB 1JQEA 1SVKA 5LU9A 2GHTA 4KE8A 2P69A 4XUCA 5AW5A 3O8LA 5AJUA 1NU6A 3IR7A 5A5DA 1NSYA 1XZKA 4BKUA 3AHFA 3AEYA 3K09C 1JHXA 2XR1A 1M34B 4LHWA 2OGSA 3C8ZA 4CV3A 3X1DA 3GBPA 4KIFA 4QJ4A 3U37A 2ZSEA 5ITZB 2JPDA 1FDWA 1YB2A 1XTVA 3ZK7A 2R1VB 5AW1A 1GFSA 3KU1A 4LMRA 3C5VA 3PGLA 2I7CA 1VYTA 5LYJA 1KPGA 1V35A 1JYSA 1R64A 1I2ZA 3MTAA 2W5UA 2BZSA 3PFBA 1WUYA 1R37A 3DYIA 1TLTA 5SY4A 3UZUA 3WDSA 4B4KA 3P2OA 1QB8A 4MRAA 1VYVA 2GAJA 3TK1A 4BZZA 5EJ4A 4HVTA 2Z43A 3K15A 1IBKB 1ZGJA 4CR8A 3ESXA 3FKQA 5TPZD 2JBWA 4JHXA 3T7AA 3R7WB 1YR3A 4MUFA 4MO2A 3SZRA 4JLWA 4DVJA 3BWMA 4PIMA 4HDNB 1XTRA 5DCWA 2O8DA 2DFKB 3JQCA 3ECCA 3UUGA 4RAOA 4RSMA 4CWAA 3THXA 2AOUB 1BW9B 2RHMA 1PJQA 1FFDA 3L8DA 3MB5A 4K6GA 5KNDH 4NXMB 4MDYA 3X2SA 3NCTA 4C89A 3JATA 5JXGA 1W52X 3PUIA 2J6IA 1J0BA 3EBPA 1DCMA 2NYUA 4GC5A 4CLRB 2Y99A 5TDHA 2HSEA 1Z7EA 4XZ3A 2IOHA 2LD4A 4BWGA 4OF4A 5JWRA 4KMOA 5GONF 1LDYA 4ASUA 1CLUA 1K4MA 2H2HA 1NURA 1ZK4A 1E6MA 3Q40A 3RUEA 1JIJA 5GZ3A 4ARVA 4H6VA 2JW5A 5JS8A 1U1CA 4GR9A 2PZJA 1NKVA 2HUPA 4N3CA 1EEXB 3VJKA 4O2BA 3H4TA 1VA4A 3IAFA 2GVDC 3Q3VA 4K40A 3RHTA 4BCCA 1K98A 3CUKA 4J2TA 1T5BA 3TSWA 4RULA 1SXIA 2CMHA 2ZSJA 1FC0A 1NM5A 4KK3A 5KAMA 4ZTZB 1CHNA 3TDKA 4Q1DA 2E4AA 2YXDA 2P0EA 1YBFA 3FTDA 3H8SA 2AZDA 3S0JA 1W5TA 3W5HA 1T1IA 1XJQA 3UIEA 4GOOD 4FC6A 2EOAA 4ZI3A 3ORFA 4YS6A 3LA6A 2Q5HA 1B0ZA 1ZMBA 4G25A 5J63A 3LYLA 2WIBA 2POCA 3PNYA 3GT0A 4NJOA 3RSHA 4EKDA 3S8EA 3AC0A 1H2WA 4TLBA 1TFUA 1JHRA 1BWRA 4FDUA 2IPAB 3OM9A 5FP0A 3OIVA 5B7NA 3JZMA 4ARAA 4RFVA 4QUJA 1W48A 2YINC 1XPRA 4MIYA 3AUYA 3MB8A 3W2GA 1J23A 1NW3A 4PS0A 5C4MA 4EEZA 3A70A 3DQQA 4XLZA 3VPCA 4Y2PA 3QWIA 4ISBA 4OK6A 3KHUA 4W1RA 1UZNA 4GAEA 4N3NA 1R16A 3WGLA 5F9HA 1Z6TA 3ZKWA 2FZEA 5FQOA 3CH6A 3TGLA 2VYQA 3IEMA 5CEJA 3R5TA 1GCUA 1KI9A 2O0LA 3K31A 2FPGA 5BSGA 1XBTA 3DBRB 2SCUA 4LQLA 4C2BA 1E66A 1S3GA 2IHKA 2C4UA 2WTXA 1K2WA 2AKEA 2H2FA 4NZNA 2E49A 2Q41A 2QRJA 1DT5A 3KPWA 3MUNA 1OFHA 2Y77A 3QU4A 4XQCA 3KJHA 4K6OA 5G2OA 3T34A 3V7UA 2XDYA 2NQ2C 3T3MB 1E1RA 2G9QA 3R5SA 2QJRA 3KD3A 1M2KA 4UNSA 2DEUA 3M5PA 5EPEA 1D04A 1NLUA 1N2SA 1P19A 2QZZA 1BE6A 3C7AA 3GXBA 4RDCA 4KQIA 3SS7X 2DRIA 1CEYA 3E3NA 1S02A 2CK3D 3T12A 1XD8A 1GLGA 2PWPA 3KOMA 4XSVA 4HUTA 4NYJR 3AHJA 1P29A 5J1TB 3I12A 4PGMA 3J7TA 3ZCSA 3MRSA 2NSJA 3O8OA 3P9QA 4R8RA 5ALPA 1EE9A 2D2EA 2X1MA 3LE8A 4P34A 5HTOA 1RWVA 1KAEA 3QFRA 1IHOA 2ZRJA 4IS2A 2P6PA 1EFKA 2HCRA 3QKWA 3U4DA 1U0GA 4A9AA 1L4YA 1UC9A 2XNJA 4OQQA 4IMRA 3VU1A 4FS3A 1UBTS 1WLYA 1Z68A 2BBOA 2XTNA 3JPWA 2HQ1A 2FV8A 3O1HB 1LX6A 3EC7A 3ORRA 3PNVA 4PZCA 5E6RB 1Q1QA 2WINI 4TMVA 1L5YA 5GOTA 3STYA 4BNDB 3ZDDA 3JWIA 2IX3A 3DT6A 1LSSA 1ZPDA 3LPAA 2JEZA 2N3ZA 1OWOA 1LNSA 2CVQA 3GCZA 3QA3E 3KQYA 3MK31 3TUJC 3ADPA 5L3RA 1TXGA 2AEFA 1OWLA 1QR6A 2IODA 3N6VA 5AKIA 5EFOA 3A6DA 3AEZA 2DF8A 3DM5A 3KOXA 3JQ7B 1SUCA 3WMEA 2PK3A 3FSGA 3T7EA 4RK4A 3P97A 3D8SA 1KS9A 2EZ4A 4N82A 1AS2A 1MQ8B 4Q4JB 2Z4RA 1OXXK 1MC5A 3IHWA 4V0MA 1XXHE 1HYEA 4LJ6A 4N7RA 2ZP1A 5G0SA 1Z2AA 3V7FA 2W4IA 3ZWQA 1IH8A 5L53A 3DBVO 1DWUA 1PJ4A 3PC2A 3WGVA 2B83A 4GMGA 1FXWF 1SXGA 4ZV9A 3RRXA 5KZMB 3TS1A 1HA3A 3GFGA 3NH6A 1FFYA 2EX0A 3OCCA 3P2YA 4JLKA 3NHMA 4HEA1 1JLMA 4IIJB 5SV2A 3DBHB 3OEWA 3ETGA 1ZVKA 2VXYA 3ANTA 1WVIA 3FLEA 3ADCA 1JF8A 1I9CA 2XLCA 3U7QB 4YCCA 5JQGA 1U7OA 2YJ6A 4OQZA 1EBFA 4PEVA 5DT2A 4RNCA 2YMMA 5HFAA 5ICSA 5FYQA 3R7AA 1PT9A 3O9VA 4I4CA 2RHWA 1YZGA 3IOBA 2E85A 4RGQA 3AHCA 1UODA 5EXPA 3ZZ0A 2IZ7A 4UEKA 4BZPA 4MDFA 1OFUA 2NXWA 3CW9A 5BSEA 1COWD 3GUUA 2I2WA 4DCCA 3U16A 1T4DA 4LCJA 1PGOA 1FNSA 4M76B 4CG1A 5E3IA 1B6SA 1F0KA 2NZ2A 3PGVA 5F1KA 3IB6A 1OKKA 1M2NA 1NXTA 2XT9A 3R7NA 3TLAA 4CG0A 1OLUB 2YC4C 3HYRA 3GN2A 1QZUA 1GNTA 5EC8A 4YREA 4K5QA 1ORWA 2E89A 4IIBA 4KL8S 4DY4A 1Z3CA 3PK0A 1DBIA 4AIRA 4FIZA 1Y6GA 1BEUB 1CVLA 5AH0A 3LBNA 2DM6A 2NU7B 1X1RA 3H9QA 2O1WA 2QVBA 2GFIA 5AVYA 1TEZA 1JSCA 1NVGA 1MZVA 1ODCA 1ZS9A 3NGXA 1KOLA 5MN5A 3WGQA 4E08A 4CEIB 2HU7A 2JGAA 1O5TA 4JMPA 2EAUA 2Q2OA 4MR8B 1T3HA 1L4KA 3RC1A 4BKPA 2UU9B 1SKMA 1THGA 1A69A 3RNOA 2YY6A 4J7UA 4YRNA 1DADA 1QMGA 2HV8A 2RHTA 3CV3A 1XRQA 5I4BA 1RI4A 1XVIA 2GN4A 1H0RA 1CV2A 4PZAA 4RGYA 5BMVB 3QIAA 4WOBA 2IX9A 2Y1CA 1P7PA 2V9PA 3PTZA 4FMCB 4RHTA 1CQJB 1VYUA 2X22A 3UVEA 4AG6A 3VHLB 3SKXA 1J8MF 1NXOA 4IFEA 2EG5A 3JD0A 1UBCA 2JFHA 3EZ7A 4B3CA 1EP9A 2QT9A 2ZRLA 3AKYA 3EGXB 2AVDA 3G23A 2XRZA 3RSCA 1EDZA 1PVOA 5JZOA 4LRUA 1YTUA 1XTKA 2I9PA 3PEUA 3HXKA 3JARB 2B4YA 2FWPA 3BFXA 1ZGZA 2XA1A 2Q6KA 3PUZA 1SCAA 1GV1A 2AFVA 2HMSA 2V55B 3DC2A 4I4IA 2FWBA 5DEIA 3N2EA 2W2LA 1ZFNA 3E0QA 3QOYA 3R7DA 1FNDA 4MQUA 1ZZEA 1HE4A 4HDAA 1UMCB 5GPBA 2A9KA 4KAJA 1HQCA 1RAFA 1ZC4A 2FNAA 3PQDA 1VSUA 3IAHA 1N9GB 4ZYVA 4Z4QA 3INGA 5HMMA 4AJ1A 4BFUA 2H11A 2IYYA 2X2FA 4RHCA 1Y6QA 7GPBA 2PUEA 3T3OA 4K28A 1BS2A 4TMYA 3A4LA 2GBPA 1Y89A 1Q3KA 3CBGA 3GMTA 2BGRA 5ADWA 5HDBB 3RTGA 5I8PA 1GZVA 4C0XA 4FM9A 1Y8QA 1ENOA 4PYQA 2BGGA 1X15A 1QUEA 2Y92A 1NTOA 4PWYA 4UPEA 3MWKA 4KMMA 1ZH8A 3N3AC 4NFHA 1KPIA 5KDDA 3P7MA 3G0OA 4US0R 3SMQA 4YQZA 3T3PB 4BLPA 3TKYA 1C0EA 5KVQA 3C1UA 3R6LA 1KK0A 3ML1A 4EATA 1G8JA 2A3RA 4DIOA 4TZ0A 3COWA 4KRYA 1L8QA 2I80A 1NRXA 3WX0A 4S2EA 1FRQA 1BRMA 4LJRA 4D9FA 4Z1MD 2B94A 1ODSA 3KT3A 2PJDA 1PD1A 4TLMB 4RETA 5DXAA 2AW3A 4P80A 1UBLS 5K3FB 4HQKA 3SYNA 4QARA 3JYQA 4ER5A 5I7SA 4REOA 2R7MA 3ZU3A 3HBFA 3G9XA 2VLIA 4AZSA 1TYCA 3TRDA 3D5TA 4G09A 4F84A 1REQA 5F2NA 1J0AA 1JMYA 1E6WA 2C9YA 3CF2A 3ZYZA 4RENA 1E1LA 1FYWA 1T0HB 2HHCA 2Q3BA 1F20A 4NYMR 3HU1A 2DWQA 3N2NA 3D6UA 1JW9B 1FU4A 5AOVA 2GSDA 4ITVA 5DK6A 1ZH0A 4OHMA 3FTEA 4I5FA 2YJTD 4GYYA 4MH0R 1P7CA 2A78A 1GGNA 4H0CA 2G07A 4BMNA 5KYWA 4AU1A 2JDID 4LFAB 5LD2B 3UNXA 4UEQA 5B3JA 2W6ID 3V8VA 5CITA 4I08A 2FZKA 3QG1A 4GQBA 1L8XA 5IS2A 1F8XA 2F3RA 2FDCA 4H1WA 1L3IA 1EHYA 1FQJA 4DCMA 1ACJA 2BR4A 5IAJA 3TD6A 5DNWA 2GH1A 3ZLTA 3VKGA 2I4RA 2G3YA 4EHIA 4QJ3A 4GDMA 4K2HA 4WLVA 4NENB 4HWTA 4ZIRA 1OH6A 2NO0A 3BTSA 4WZAA 4Y2SA 1S8OA 3BH6A 5A6SB 3WGYA 2BFOA 5JMWA 3W4JA 1CS4C 1VDZA 2EJBA 3K53A 4H18A 3K4PA 1EVLA 1IXYA 4W1SA 3FI9A 1P3Y1 1A82A 3ZWCA 4XYGA 7ABPA 1WSBA 2WUFA 1ZN9A 1KERA 1P0IA 4EFMA 2L17A 5DPMA 1M0EA 2GEDA 3CT4A 4TQUS 5ULLA 2FCRA 4PPYA 4Z4IA 1F5SA 3IAM6 1NBMA 1R50A 3A3NA 2UVPB 3PDUA 3T8YA 4NBTA 1UKCA 4MUYA 2Q5FA 4UM9D 4V0ME 1AO0A 1DEAA 1X7GA 2P9FA 1HFKA 3GZJA 1Y7LA 5F2EA 3DTVB 2PFSA 4M0EA 3L06A 3FPHA 1CJTC 1NVVR 3GPLA 3WFJA 3SR0A 3WK7A 4ZCTA 4MHTA 2VF7A 1XTQA 3P9CA 1MXFA 1SBCA 4AJ9A 1X7ZB 5BVGB 2AN5A 2VHEA 4UCWA 4H0NA 4H1TA 4KDEA 1VKRA 1N2HA 2G28A 4MS3B 2IUSA 1KDZA 3WGNA 1Z38A 3GVHA 2QTRA 4OP1A 2QW0X 3QYPA 4L16A 1EVEA 2QD4A 1G5RA 3OD5A 3E9NA 3UUFA 4KGZA 3JWEA 1E8NA 2IHVA 4RVUA 2HPVA 4A5SA 2HA6A 3PX7A 3ZW7A 1ZEJA 2QN2A 5FO0A 1GQQA 1GGHA 4ZGBA 4MUBA 3GWZA 1VPVA 2C4MA 2XEXA 5LB4A 5FULA 2IH2A 4FR2A 3ABZA 4G97A 3T7CA 1QRDA 4Q9HA 2O5RA 1OZAA 1G20A 3T1VA 4P3OA 4YYZA 2D7DA 2JD1A 4RMNA 1I5RA 2NSDA 2VSXA 3K0AB 1NPDA 3WL8A 2O5EA 1CUBA 1G3IA 2OLEA 4Y2JA 2FX2A 4D8YA 2VDOB 1EGMB 3VAAA 2YJNA 4IP0A 1Q74A 2CF5A 4YYEA 4BXOB 1I3OA 2GCOA 3R6TA 3WLOA 2PX6A 2A5GA 1ISSA 4MPRA 1N5LA 4AN4A 3B1FA 3PFCA 3R7BA 2V6BA 4B31A 1LPSA 4TL9A 4I1UA 3WKDA 3T3NA 2IH5A 4DR1B 1E7MA 5K2OA 1YDEA 2WMYA 2O3QA 4ISCA 3WQBA 2E0IA 3O4VA 4UTOA 4AKEA 3RAFC 3C4VA 2R1TB 5AQ1A 1HSOA 4DCUA 2GKOA 1J20A 1AIPA 1KY3A 2ZI7A 1U3VA 3CUWA 1ONPA 3IDQA 1T36B 3PUJA 1MJNA 4I1VA 4RZQA 3WY9A 1XQXA 2FW6A 3FAZA 2Q07A 1C3EA 3O8QB 4JLAA 1P60A 1SELA 2I6SA 3Q7TA 4NZZA 1QS0B 4GW3A 4B4VA 1QE3A 2QD1A 3OP4A 4LRYA 4R69A 4FN4A 1IZ7A 2PXCA 5G41A 2QM3A 2RG7A 3NQ41 1SBTA 2R2GA 2ZR0A 1UOOA 4FQ7A 4Y6OA 4KC0A 2Z8YA 1Y33E 2FOIA 1Z35A 4Q7MB 1G8AA 4TQGA 5LNK6 5CYPA 1TYDE 5JVDB 1D2MA 3EGEA 4GL4A 1G2IA 3NNDA 4RS4A 4G5QA 1ORDA 2GBLC 4WFJA 4DCGA 4PXSA 2CHEA 3RS7A 1G0NA 2Z3VA 3TTVA 4R8VA 3CRW1 2G1AA 4C0JA 3ER6A 2I71A 4GG1A 3NHBA 1T34A 1Y7TA 5IC5A 2YOGA 3RK4A 2H2AA 5JFOA 3Q6MA 2J3IA 4ZI2A 1TMOA 1YHYA 2LPMA 2I3BA 2CDRA 3NYWA 2OV3A 4OJYA 3JD2A 3O83A 1PLKA 1AC5A 4KPUA 1Z13A 1I2AA 4GOXA 4K9KA 3RUHA 1JHDA 4XAQA 5LQDA 3I4CA 3LJKA 2V96A 3T1HB 4MR7B 4QQ8A 1QFZA 2O3TA 3RTEA 1TO6A 1XZQA 3WG9A 4DRXA 3K0SA 3JQFA 5JRZA 4NFSA 1RHKA 2Z4TA 5DGTA 4QBGB 1G5QA 3IEUA 4S0XA 4W82A 2HU2A 3P9ZA 3TUZC 1MQSA 3ZJYA 2AR0A 3W6NA 2ZPAA 4E46A 3ND6A 1VJTA 4US1R 3OU2A 4QFCA 1Z34A 2Q2NA 3A27A 4PZZA 3TTWA 3OWOA 4F5ZA 1KJJA 1PVDA 3GQBA 5E0OA 4G0WA 1R0YA 1QORA 2XMRA 4HH3C 4MVJI 2QTVA 3UWKA 3PNPA 1A5BB 2IOQA 3ANMA 2JGDA 3SF8A 3SZMA 4COOA 5CAEA 1LFDB 1Y4SA 2ZRIA 1OROA 2OV2A 1USGA 3F7MA 3K0EA 3D2LA 1XAHA 4FYPA 3P20A 4GECA 4J43A 4QYTA 3UJ8A 3FZYA 1DQNA 1R3UA 1F6DA 1PSDA 3A2NA 4Y0VA 5BWNA 5EWJB 3IULA 3W3AH 3PXBA 5LKRA 2IYUA 3T7IA 3L0ZA 5E4JA 4FCTA 3EDRA 3RUDA 2WKSA 4ZAZA 3E2IA 4G0NA 5H8WA 4ZVPA 1E5TA 3CF4G 1H23A 2YY7A 5JMOA 1E1QA 1P0MA 2G4LA 2QX9A 1P33A 3U60B 1FUKA 3OF2A 3KELA 2HLDD 1UXOA 2WIGA 4FHEA 2XNCA 4Y6PA 1QLWA 1OBHA 3OTQA 3A9UA 4NU5A 3WIUA 4AF7A 4BEVA 1PL6A 4CCYB 4EB6A 1YB4A 4KTVE 3VSAA 4QYIA 1T6BY 1DEXA 4X1IA 3V9PA 3R24A 2DBQA 1D1TA 1Q7BA 3H1GA 1MB2A 3B1ZA 2ZOSA 3F3KA 5JEDA 4NCNA 2WYHA 1WULS 3I30X 4PYRA 4EFKA 4DM7A 4DR4B 2JIMA 3GDGA 3ZVKA 1CP2A 2BTOA 1HR0B 1B43A 1WXWA 1NUPA 3C48A 1I7LA 3QY0A 1H9BA 4AMYA 2DFDA 3SNKA 1HXHA 4NYIR 4CLOB 1SBQA 4HDSB 2PL3A 5JPDA 4BS9A 1XAIA 1IMJA 3IRUA 1THMA 3PRHA 4NBLA 3CZCA 1RE1A 2F3TA 3EULA 4JIGA 1PCXA 2ZB4A 5BNIA 3RKUA 3TLGA 2HRCA 4QRIA 4DC0A 1V9CA 2ZSHA 3AK4A 4WZAE 1PK9A 3ORHA 5AXAA 1U0NA 1JL3A 1UWCA 2KB0A 4OXXA 4EJFA 2XE8A 3EARA 4A8JB 1TYEB 4EW6A 5CFRA 4D9BA 1DQYA 2B8TA 1XNHA 4DA6A 5FEMA 3X1MA 4UBNA 3RKSA 2FGJA 3GLFB 3VVLA 4M99A 4FXPA 4PSVA 3KV3O 2SBTA 4HDMA 2QAGC 1JQLB 1SUSA 1YB5A 4DN6A 4HN2A 3D8NA 4R3WA 5IW8A 1NBME 2WHPB 2WDPA 2Z6QA 2NIPA 5CTAA 1ADCA 3E22A 3MTBA 4RDIA 3AI7A 2NTVA 1N6NA 5JQWA 3YASA 1HEIA 1F06A 2AT1A 3N7UA 1HT3A 4BTEA 1L8OA 1R5OA 3AINA 4YLEA 5CM8B 3PYXA 5DASA 3TM4A 3EVAA 2OBXA 4B75A 4BNKA 1XB2A 3W0LB 3F3SA 3D4BA 4C30A 3T3HA 5KJ6A 2AXNA 2IQIA 1XMVA 3SF0A 3ZCUA 1QUFA 1UBKS 3W8DA 4V0RA 3I5YA 1RQGA 1BMQA 4P32A 3OLCX 4RD0A 1E62A 5JBNA 5LZ2A 4G0QA 2VEOA 5FOXA 1M2WA 4MPDA 3IBFA 4RFLA 4UZEA 2GZDA 3M3DA 4EARA 1WW3A 4CR7A 4WNIA 3BJEA 1K6MA 3ZV3A 4BMCA 1O95D 1W0CA 3FG9A 4MQFA 1G5HA 1QYXA 5L7YA 1JEYA 4CUJA 1SCKA 2PFKA 4B43A 3DUFB 3K9GA 4JGBA 4WKOA 1MQ9A 1RRMA 2DWCA 1G20E 3S2EA 5J2UB 2R84A 3QY9A 1L7DA 1FSSA 1W29A 2PV7A 4WA8A 1QWOA 2GZ3A 3ZY6A 1Z36A 1G7RA 1GPWB 1O4VA 3N7AA 3Q0IA 1C2YA 3QWFA 2F8LA 3FJOA 1D2GA 3H1FA 2M6KA 3JYNA 4R3NA 1E9RA 4X20B 5HR5A 3RAPR 4TLCA 4DKXA 5JJIA 4K9PA 2A0UA 3ZY5A 3HUFA 4IDAA 3EPKA 1VIYA 2OZEA 1AY0A 2NX2A 2WYIA 2ZANA 3B48A 4H15A 3D1JA 3VKWA 3JQAA 4TZ6A 3L4KA 1C0PA 1QAMA 2V0NA 2R8RA 1UM8A 3EH2A 4GWKA 3S2SA 1QVAA 1WB4A 6REQA 4N8SA 5ICCA 5IPFA 5K0FA 3G1TA 4JBWA 3HN7A 4CN8A 4PCLA 3D4PA 1BNCA 5C51B 1N8TA 4TLDA 2R6R1 2XMBA 2BCEA 1NYTA 3AFMA 3BD6A 4EUSA 4INAA 2CVFA 4FNMA 1P1CA 1HDOA 2WU4A 1KWKA 3UT0A 1U1EA 4QKQA 1XD2B 3D6TB 5C1BA 1C3LA 4KIWA 3PKZA 1RVV1 3R5FA 2OORC 1L7MA 2VNJA 3CZ9A 4I1PA 3G0DA 1UC4B 1OJ7A 1EK2A 4II3A 1ZD2P 1DAIA 3ESDA 3FNGA 3HKEA 1OZHA 4WN9A 3ZJ4A 3T3EA 2HTEA 1KZ7B 4W1PA 2WOJA 2ATCA 3LM8A 1PR5A 3W7BA 2Z1MA 3WK6A 3ICEA 2QUIA 1Y7IA 2QJOA 3GP3A 1IZ9A 3BMQA 1L5ZA 4ZYYA 4MW4A 2ORVA 7ADHA 1QH1B 5HK8A 2VF2A 3QKIA 4ACAA 3SZ3A 1O9BA 5J5CA 4FHDA 4OSEA 1FP6A 4ZVSA 3WYAA 1KU0A 3KAJA 4EI7A 1P4AA 2E5LB 1V5IA 4YP7A 3NHWA 2QG6A 5C1PA 3EB9A 1PWZA 4JWTA 4WK0B 4LVCA 5ILQA 5JBIA 2WHQA 1RHRA 1ZD3A 3EVZA 1N7JA 2BRUA 3T61A 3PTAA 3CX6A 3NVMB 4X1KA 5AHRA 5IYZF 2P4UA 4F2PA 1TQ6A 1PJ3A 4GVXA 1HDXA 4KBGA 3I0NA 4L3WA 3UK1A 3ZX4A 4WBXC 2OFWA 1WUKS 1NN0A 2CKMA 4PFSA 4X90A 1QZZA 1NG1A 1QH8B 2UVDA 3WTBA 4HRAA 1ORIA 2P9CA 3BHIA 5SZJA 4EG0A 2X8AA 4PYJA 1ZY2A 1H5NA 1RU3A 1Y8CA 2WW8A 1A9QA 3BQNB 4XYEA 1P9RA 2ZDHA 1HV8A 1I4DD 1ADBA 5I4KA 4J75A 2B3TA 3LT1A 5IHXA 4Q3DA 1GGEA 4DFDA 5LBTA 4U7TB 3ZWWA 2Q2QA 2YVQA 3L4JA 4LJKA 2QD3A 2JBAA 3GGDA 4MEBA 4UUMA 3WAJA 1XXHB 1OB2A 4QHYA 3DZHA 3WSWA 1T1JA 3H75A 2JVIA 4QGGA 2J0UA 4O2AA 3TQIA 1BCRA 4C7BA 1X74A 2RH9B 1JHPA 2Y4NA 4QGBA 2XRMA 1K4KA 1E3LA 2P78A 2REOA 1TT7A 5JYDA 3IE1A 3KZOA 4FLFA 4RJKA 4NJMB 1I7QB 2DC1A 3BC1A 3Q0TA 2ZYDA 3NOXA 1BMFA 2IIPA 1GYPA 4M8NE 1TJ4A 4NBSA 4N3AA 5I9SA 5T41A 3KVYA 3SU8A 2FLKA 3MWFA 1ZIYA 2GAIA 3BAFA 3EUEA 1BFKA 3ICWA 1SK9A 3O90A 3ECSA 1KJNA 2VHJA 3CNEA 1Q6YA 2IZ6A 2F9MA 3Q0EA 2HW8A 4RMIA 4NE9A 3WGGA 2PS9A 3CFYA 2C04A 3PGJA 1QHGA 4GGPA 4KGDA 4LGCA 3VNAA 4PO1A 2HSJA 3SS8A 3RWMB 4KVGA 3LL4A 1B0UA 5KI6A 1OXTA 4JOSA 1BOFA 3A1VA 2QNRA 4R84A 3GGJA 2W7TA 1JQAA 3AHIA 4ZFNA 5LYJB 3EAQA 3G2KA 2IC5A 3RYIA 2PX8A 5EERA 1KY5A 2ECPA 3RYCA 1YR9A 2VUSA 3ZDZB 4MLCA 1JIKA 3O8CA 4M7WA 5HWSA 1GDDA 5KYXA 1F2DA 1NQTA 2BDUA 1VZ2A 2IE8A 3BRCA 4L74A 3D2BA 1ODLA 2HO5A 2VP6A 2Q2VA 3GCGA 1ANKA 1DG3A 1YQDA 1S4QA 2AUTA 3QE2A 1A2BA 3WNVA 4KQXA 1T2UA 4U8HA 1SUBA 2GJSA 3KX2A 2I1QA 3L7MA 3BJZA 3THXB 5DYYA 5CLQA 3PEVA 1J0XO 4FX2A 4CM8B 3UAZA 2JI4A 2GXSA 3JATB 3SVTA 5JZSA 4YFYA 2PKXA 3AU9A 2IT1A 4D9GA 2GZ1A 3EPPA 3FNHA 3FRHA 2HK8A 3CEAA 3RJ9A 4DPKA 2QMZA 4DSUA 3N8KA 5KTYA 3ZNPA 4Y8VA 1RQ7A 5L7WA 3U1TA 5H4GA 2DZDA 4EHFA 2GVZC 2ZYHA 4CQMD 4D81A 1TCBA 4MZDA 4MRVA 3D4LA 2P5SA 2CMGA 5C34B 1GRVA 3GJ7A 1H4SA 2RHJA 1ZM7A 1XZIA 1A8IA 4JQYA 4R7TA 4C4XA 3ZEIA 3WQHA 5FPYA 3BS4A 2JAUA 1ORVA 3LCVB 3NYQA 4ZT5A 3DVAA 2PO7A 4RKEA 3UC5A 3Q88A 3PE4A 4RVSA 4TWIA 3WYBA 1FQOA 3AGQA 1JAIA 3RFFA 2Y93A 5A4AA 1MV8A 3ADKA 1BE1A 1WCXA 1XELA 4JK3A 4WDQA 4WKBA 4OOEA 3A9VA 5CD9A 2Z4SA 3U1VA 3JY6A 3EQ7A 4MWOA 3ZGOA 4P4GA 3MRXA 2GB4A 5B3JC 1QZXA 2UYYA 2ZFUA 2Z57A 1LBTA 3H5LA 3OZDA 5EIHA 3B3AA 5JMPA 1BX3A 2PZKA 1NJSA 1YE8A 5AOBA 2ZU6A 3R3VA 4LYGA 2PIDA 4DMRA 1Z6ZA 3LQRA 2ZJ5A 1HL3A 5CDYA 5E2BA 4QUAA 3K1AB 4EJSB 2VNAA 3D7KA 1SVIA 4JLMA 1Q0RA 3NM6B 4MKXA 3FYCA 3GCXA 1W36D 3RK0A 3P9YA 2QT1A 4JL5A 5GJWC 1QTIA 3FM9A 1YSCA 3VJMA 1HDCA 2NT4A 4GPTA 1KHHA 1CR6A 2OVFA 1G5TA 2C1ZA 5AVSA 5BN5B 2XKKA 1RXUA 1CPYA 2UZ1A 2CNLA 4BWYA 1AZTA 1I4LD 5CJPA 4HB3A 1TUGA 4FFSA 2FPGB 1I9GA 1SVOA 4ZU6X 2PS3A 3T06B 2IYEA 1Z2PX 3BWEA 3IP1A 4KUEA 3GLFA 3DVRX 3SOZA 2VTBA 2IPMA 4WK2B 1N6LA 2B8JA 3KUDA 5I3ZA 4GNRA 3WYGA 5B1YA 2DETA 5JAZA 4PFJA 1HL7A 3ROQA 1SUEA 3EXG2 5J2TB 4KODA 4NAUA 1ZR4A 5FPHA 4GZ5A 1EAMA 2JGEA 5KX5A 1FNMA 2WBLC 2ZS8A 2CV1A 1N0WA 2C0CA 4H7JA 1PBTA 1GUFA 1T9KA 1VCMA 1K3FA 3DBLA 4QLOA 5TRTA 2WZCA 4AJ4A 2GMWA 2XZLA 4WLOA 4JXKA 3GXOA 2IOFK 3TBKA 5H80A 4PG6A 5K0EA 5JTTA 3SX2A 5A5VA 3N70A 2BHNA 2XY4A 3O8OB 4J49A 4NQRA 5CA0B 1CUAA 5ALXA 3F3YA 3HCOA 5DTQA 4K0RA 4TRRA 4OJQA 2G1KA 2WF5A 5H16A 5CBPA 1NXPA 3DTYA 2IHJA 3EQ9A 5AW2A 4JC8A 4JIMA 1YMQA 4GBJA 1P0PA 2NZXA 1T0PA 2VF4X 2Z1DA 4Q9KA 4WA7A 3VR6A 1SKAA 1EAYA 3MGGA 5EP2A 2K87A 5IKOA 5FA6A 2B25A 3AR9A 2ADFA 3WGUA 3EVNA 4IR7A 1UMDA 3PDHA 9ABPA 2XWSA 4YCNA 3IUSA 3OF5A 5B1DA 3HCCA 1OGYA 3AKZA 3WV4A 2ATXA 4F12A 2G77B 4PQGA 2NXEA 1XMSA 2VH5R 2O8VA 4NV0A 4AKIA 2ZRGA 2GDJA 4FTWA 3NAGA 5FBVB 1ZN7A 3S2IA 2JCGA 2C77A 1C0IA 2H3EA 2OM2A 4S1PA 4UCXA 4YJHA 4D4MA 3CUUA 3E5NA 4FI3F 1JAZA 1PD0A 2UUPA 1QIMA 1E0KA 1TAGA 2VBCA 3CH4B 4H4EA 4MQMA 3N5CA 1E9BA 4N8DA 3VZBA 1XDWA 3DNFA 5DXFA 4BLSA 5IWAB 2F3QA 1JJFA 2XECA 2RC6A 2WK1A 2O54A 1WQ4A 2IRWA 3HL0A 1F38A 2PLWA 3UAYA 4PRYA 3P9SA 4GSKA 4LJ4A 3FSJX 2DECA 1IUPA 1M10A 2FYTA 3BRWD 4MCIA 3OBBA 4P98A 3SKYA 3EGDA 1AV7A 3WRYA 1DCTA 3VU3A 1JR2A 3DLAA 3F7OA 1HT1E 4DWVA 4ZYZA 1SUIA 3RHZA 1WKCA 4E4YA 3NANA 4OGKA 2YV1A 4AKSA 3HCNA 1M5TA 4AYXA 2XH8A 2Y1EA 3CS3A 1U3DA 2VJOA 4Q37A 1GXSA 3LLMA 3MUEA 2F1IA 3M4JA 4XWYA 3KQPA 3OETA 1G9XA 3DDCA 3EZ2A 3H5NA 3VR4D 1T15A 3TQOA 2CUKA 1H6CA 5I9LA 1F0YA 4RHXA 4Y3UA 4BQRA 4ZCMA 4WZBA 4XR9A 4B82A 2WG1A 4M3NA 5JI2E 2PZ8A 4FYKA 5T5QA 2OPHA 1G16A 1CUGA 3EDCA 4TMXA 4FYVA 1YI8A 2ACKA 5J58A 3K8OE 2F9LA 3MYRA 3C3EA 3QTTA 2VTKA 2V8BA 5EKDA 4KLRA 1RW4A 5CFMA 2GLXA 2LDXA 4MLPA 3QOXA 2PUHA 3OFJA 1RQNA 3FMGA 3AB3A 3G0IA 4RABA 2CD9A 3L7JA 4TT3A 4FVTA 3VR5H 5EQJB 3IILA 1LQUA 4OAPA 4EW2A 3G9QA 4IILA 3MS2A 3ED1A 3SBOA 3VSCA 2RAFA 3ZV6A 4F92B 2UUAB 3OZEA 3EEOA 3N2IA 3BXPA 1F5NA 5K6AC 2ACEA 5CG1A 1UJNA 2RHOA 3E5MA 3PFFA 3DMTA 2NACA 3GPCA 4YNBA 1ODJA 2NXCA 4BGVA 3U6KA 3K9CA 3W5CA 1M0TA 1A98A 6PFKA 5JC8A 4ALIA 1NVFA 5JWHA 1FUUA 2Q28A 1D6JA 3R3UA 5GONA 5K7SA 4Q4LA 2O7RA 5K0SA 2YW2A 5IXSA 3HA5A 4NZ9A 1LKZA 4TRMA 3H9GA 3KDPA 3UJAA 2GEVA 3I2YX 1K8QA 4YRQA 1YULA 2Y4OA 3VO1A 1HYGA 3AR7A 1SPBS 4IOJA 1Q3HA 2CL5A 4IG9A 1K4YA 4ZT4A 4YAWA 2E4WA 4PBTA 1CB7A 4JJ8A 2VPYA 4LCEA 1DCKA 1KJ9A 2XUFA 1U0OC 1QAQA 2MDTA 3ZBUA 3C6YA 4Z8YA 2FZWA 2JLSA 1Y1PA 2SECE 2X15A 1SCDA 1C7RA 4XEHA 4K3VA 3QXHA 4FDAA 3RRZA 1R00A 3ECAA 4JJGA 4L07A 4I5GA 4PRLA 1Z2CA 5SICE 1EA7A 4JL8A 4WKNA 1GSOA 2WQ7A 2PH7A 3D9QX 3IAAA 1KQNA 3U3JA 4S0ZA 3HXOA 1ETUA 3NWJA 4HATA 5T3UA 3U19A 2HBQA 1CJVC 4GMXA 1A8HA 1RZVA 4HLUC 1H9AA 4NEQA 1X1AA 2OQRA 1U5BA 3G5TA 1UBMS 2GA8A 2BKVA 2W0MA 2L82A 1GSHA 1RTTA 3N8IA 1N7IA 4C08A 2EW2A 1Y8QB 1W88A 3MZ0A 4J3FA 1SXJA 4JLPA 1KFBB 1U0SY 1CF2O 4K81B 2ZWPA 4PSCA 4YAFA 4MSUA 3VHRA 4C7VA 4MLZA 3F6BX 1WDLA 4PS1A 1NV8A 1ZXXA 1BWSA 1DUSA 2FN4A 3CSSA 3OESA 4RL6A 4IOLA 2E7ZA 4TWJA 4W8HA 3RW9A 1ONBA 1RZUA 2CCJA 1YUBA 1R4MA 3KR2A 4O5AA 3UT5A 1SFRA 3ZGZA 4DF3A 4GUAA 3RVJA 3GLFE 1X2EA 5CD1A 2YIVX 3I8SA 4NFLA 1E4VA 2IOFA 2R6CA 1N7GA 4BMOB 1NJ2A 1O94D 2DHRA 4C20A 4OHZA 4HDRA 4ZQFA 4TSFD 3WZMA 2R6JA 4IDEA 2POQX 5KDLA 2M6RA 4IDQA 4Z3DA 3ZOZA 4B48A 2R0QC 1TIKA 1N3YA 4URWR 4S1VA 3KJIA 4PC6A 3FCOA 5BSHA 1ZRNA 5PNTA 4XGRA 2K2WA 2VT2A 4MTLA 1OLXB 4IDBA 4F2DA 2IYFA 1REQB 3RABA 2H18A 2PGIA 3DKIA 1JKIA 3KM0A 2OMEA 4ZHQF 1HTBA 5JT1A 1Y9DA 4X6LA 4B2PA 1ISIA 2FK7A 4ILEA 4KIJA 1M7BA 4UBJA 1JHQA 3Q3EA 4N9QA 4YJ3F 2FB9A 4CQJA 3QEOA 3FF1A 2QMQA 1ZD1A 3ONVA 4OQLA 3WGZA 5A5FA 3F4BA 3MJRA 4RA6A 5EE0A 1K3UB 5KYWB 3N8NA 3DUWA 1R10A 1JNYA 4QUIA 5FPSA 5KQSA 1QDUA 1W1IA 2GHQA 3D02A 4PLWA 1TTQB 1LDNA 5AM1A 3ZU5A 4CN9A 3DHNA 3B52X 1EVIA 2ZEJA 4N7MA 2VATA 3ZW8A 4HRXA 4LHSA 1D4OA 3EZ6A 1JX6A 3L7LA 5CT5A 5K3CA 3GP5A 1GCIA 1CSEE 4R2XA 4DANA 3FPJA 3QVKA 1GG5A 2PKYX 5FBWB 4A16A 4ZIRB 5HSGA 3HJHA 5AKYA 1CDZA 1FJHA 2FN7A 2CY0A 2JFGA 1N8SA 2FFHA 2IPLA 1O58A 4IS3A 5BR8B 1VPWA 4QFDA 1L5MA 5SZIA 5C2JB 5JUWA 3W06A 4NBNA 1CIJA 1EFHA 2QLFA 3CNQS 2VZ0A 3HXQA 2A86A 1UL1X 3KHTA 4UU1A 1W4BA 5DGHA 4MUHA 2HPZA 2I7XA 3L7BA 2XNDD 1C9NA 4R0VA 5HZMA 5TF0A 2QQFA 3R3WA 5DH9A 4QC2A 3BGOS 2I8AA 1YZUA 3T9EA 4BEWA 3FFTA 2HWXA 2ZUBA 4F3NA 2XQIA 1F2UB 5FWYB 2OV6A 4MIEA 4UVDA 5KTMA 2EIHA 1MC4A 1AUPA 1YDMA 3HCDA 3JQ9C 4I19A 4UREA 1R4AA 3OIFA 4GL2A 1N1EA 1KZ4A 1E63A 1ND6A 1V43A 3K1ZA 2JCVA 4RACA 4G0UA 4JCCA 2KBFA 4LSMA 3ZHSA 1FXWA 3OX2A 2CJFA 1N57A 3RC3A 4MUGA 2HNKA 4LGVA 2WUVA 1MJGM 1WUHS 1JDVA 8ABPA 5FOQA 2VDKB 1JDPA 2UZ4A 5PGMA 1T9DA 3TCNA 2RGAA 1S1MA 4CLEA 4GX5A 1OCEA 2PLNA 3S3TA 3BK1A 3V1YA 1TK3A 4C5CA 5TMPA 4HC4A 3WHPA 2O20A 3PBKA 5B58C 1V96A 2JD2A 3HQ4O 1XCPA 4FDTA 3NM5A 3K70D 1FX1A 4RGVA 4AS3A 3AKCA 4EY5A 4F6RA 4BPRA 4CL0A 3H2YA 2ZVPX 2WIKA 2Y8EA 4MS4A 4J8PA 4WZBE 1AQNA 1I1HA 1S2LA 2XQVA 4CDRA 1X1QA 1DAOA 2M98A 4PR3A 4O1MA 3FFBA 2GRAA 4IUDS 1L5RA 5AXDA 4HNTA 1HZJA 1ZONA 3OQOA 2HSDA 2K7FA 1XYYA 2GD0A 1QX4A 4D0NA 3A2KA 3ANLA 4CM5A 2R4UA 2AYXA 3VU9A 2R25B 4G5FA 4N5LA 2CXPA 4ZVRA 2CB9A 4MW7A 5TMDA 1E3SA 3KCNA 2F1HA 4AUMA 3H7IA 2K6GA 4EAQA 1N6HA 1Q3TA 3R77A 4TT8A 5D5PA 2N9UA 4E70A 4UXJA 3UTCA 3DPUA 3MBOA 1UDBA 2NO4A 1W5FA 1G9TA 1MV5A 2NZJA 1QHXA 4JQCA 5DTMA 2BJWA 1E2PA 4M1EA 3UW3A 2G83A 4ITUA 1Y1SA 3A6LA 5EXEA 4CFZA 1V25A 1QYDA 4KQ9A 3TW0A 4F4HA 1T9HA 4J16A 4FOOA 1EPUA 4ZOCA 1XNGA 3UOWA 3UC9A 2E2WA 4JBGA 5F5XA 2IHUA 4L85A 4V1CI 2IH4A 3H11A 3M70A 3NC1C 2FZVA 2BTEA 4ZEOA 1K6EA 5AKZA 1IEVA 2OSBA 2ZJOA 5AM0A 3NDBB 1KMQA 2RCNA 1DMSA 2X2PA 3IFSA 1RPZA 2V4UA 1KEEB 4UHEA 1RBYA 1FZTA 1R8YA 1RKVA 1U9IA 3OM0A 4UUPA 2A4KA 2GPJA 1SIUA 3C24A 3NASA 3AHDA 3EPRA 1B16A 1XDUA 421PA 1VECA 4EHHA 2JZCA 2OG2A 3FBWA 3AB7A 3LYUA 4PC1A 3V7WA 1HUQA 1OH5A 3L9XA 2D0OB 3GJRA 1A5ZA 2PFGA 3KHSA 4BE7B 1QTQA 2E5FA 4KPUB 4JLSA 4YV0A 1QQBA 3AUKA 4D4JA 1T5DX 2OO5C 3EODA 1HT2E 2R65A 3GNQA 4OLHA 4U6NA 4UQOA 5H68A 3SC6A 5DT9A 3INTA 4CVNA 4GPAA 4MV3A 1QK5A 4LK2A 3EPLA 4NZMA 1TD9A 3T7JA 1S7CA 1PR3A 3H8WA 3GAMA 4BU0A 3FYDA 3L7DA 4Z49A 2G76A 1P3JA 5BPFA 3ET5A 2VNHA 1O97D 4RTPA 3OG9A 4TMKA 1SXJE 3AR6A 2ZBDA 3MCZA 2HIMA 1G1AA 1PX0A 2K5UA 3OZAA 4GEGA 2WT4A 1TDJA 4EG1A 1JH9A 2O7SA 3FSRA 1RLMA 3GQBB 4QJBA 3V48A 1KTVA 1NVWQ 2FEAA 4O4LB 3V8RA 1NVBA 3SQWA 1CCWA 5CBKA 2B30A 3LOPA 4IIEA 3SF8B 4IDNA 1VJ1A 1PJ8A 3L04A 4XSHA 5CR9A 4ER6A 3ZUGA 1YH3A 2NO5A 3CWQA 2I4OA 4HWKA 4TTSA 1CR2A 2AQIA 2V7BA 2WWXA 2H7XA 4I1IA 2FWAA 4KXUA 5ESWA 3ZCPA 4DDKA 4F45A 1SUFA 2V98A 4K9NA 4NDZA 1Q22A 4R8SA 5FAKA 2ZRDA 4QECA 4GR5A 1U28A 3DBIA 4D3DA 2J4CA 3TPZA 2PSSA 3AVQA 3IKJA 1VGQA 3LCRA 1YAJA 4TTPA 2GEJA 5AWFC 1H8HD 5L7TA 3IIMA 2Q0QA 3L8CA 1CQPA 4RMGA 4D25A 4WXPA 2WAOA 4GSLA 4P0TA 4QWWA 4RZ3A 3UJ7A 4EB6B 4DWJA 5HIJA 4X1IB 4ZRMA 1LPNA 3AIMA 3LMKA 5FQNA 1YRLA 1EFRA 2GYYA 3H2HA 4FSHA 3FCUB 3WK4A 2OCAA 2PPVA 1X39A 5LCXA 1U7DA 4D6XA 5FUBA 2HYIC 5KYTA 1N5IA 1FDTA 1GO2A 1RS0A 3QEJA 1G8MA 1YOVA 1Y9JA 3UT6A 1K7FB 3I53A 3BM5A 4YMSA 4HS4A 1NUTA 2XVZA 3FOWA 3CLSD 1TQDA 1DX4A 1KJWA 1KP9A 4J9VA 4ZHSA 1YA4A 3AF2A 2IV2X 2GM3A 3W5JA 1WS6A 3E61A 3G0GA 4YQEA 4ESHA 3V3KA 3U2QA 1X8LA 3T7RA 2YVLA 4XYLA 5LA6F 3RVNA 1BXGA 4KQHA 3HJGA 3TLGB 4CDMA 4E30A 3U3ZA 3H2BA 2O4UX 2OFOA 1OTXA 4N5HX 1WPXA 4AY5A 2XCRB 1TJNA 4PCVA 1NYRA 1V71A 1R3DA 4XRGA 1G6HA 4B7CA 1A8UA 1G8SA 4BLTA 1JWAB 1RR6A 3IB3A 3U0BA 3OVMA 5FADA 1TCAA 3FPLA 4QNNA 2D3TA 3BWXA 4KE7A 3UCEA 1X14A 4R1UA 1VHTA 2WHXA 2IPNA 3Q7SA 2HKIA 4M36A 2PAFA 3BXFA 3L1JA 3U81A 2QL9A 4L4UA 5FBKA 1ZN8A 5J43A 2CYBA 3QF4A 1R6VA 1YRWA 1XDZA 1RRFA 2P9TA 4X8LA 3L7YA 5JSKA 2OYSA 3NX4A 5DKFA 3LKZA 2EJUA 3PC6A 5HGXA 3HP1A 1KNXA 1Y6RA 2I87A 4NU0A 5CM2Z 1N3BA 3F9CA 4M37A 5FI3A 3ZZNA 2VKQA 1YR2A 2VPPA 3X44A 2I33A 3C3DA 3DWIA 1DIGA 4ZYTA 1NKTA 4N0QA 3CEMA 1UIMA 2B98A 1N2XA 1V16A 4RSHA 1PGNA 4OHYA 5F5LA 4LV6A 1HE8B 3ESZA 3PGXA 4GKJB 5JNSA 3LX5A 1KKUA 4DIEA 5U4XA 3LXXA 2KWIA 2E6KA 2GZ2A 2FEKA 1W5AA 3VHXA 4AY4A 3ICQB 4UAGA 2GZRA 1X7YB 4D7AA 2D5BA 1L4NA 4MQFB 3VOAA 1JEYB 1CEEA 1QIJA 2XUKA 2ZUTA 3SHVA 5CK4A 2DJ5A 2HLDA 3BMCB 2NAFA 1G5FA 5FLKA 3WE7A 1XPUA 1IY0A 4W9RA 4BY9E 3EEFA 2W6JD 3KZNA 4W5OA 4EMSA 2I76A 4RVDA 3P19A 5AP9A 1SKYE 2WJ3A 1YQ9A 2ZSIA 2G5GX 4BB6A 2XX3A 5DLPA 3W05A 1NWHA 1ZH2A 3JWGA 4L8YA 1ZWLA 2Y9MB 2FWNA 1PN3A 1D9XA 1A95A 1TGYA 1YD7A 4M8LA 4P6VF 5DTEA 4PPFA 1GGMA 1GVHA 5C5CA 2Z2KA 3NHRA 4BFVA 5BW4A 3O2SB 1JECA 3F6CA 5FBZA 5B3KA 4ZKEA 2O4CA 2OHVA 3JQAB 4F86A 4HQLA 5JR3A 2JKZA 2IGBA 2VQFB 4Z0NA 4DV7B 1RKBA 4NZPA 6REQB 3CCCA 3PSAA 3DEKA 4M1MA 4PC3A 3CO0S 1ZD4A 1HI9A 3BGWA 5JADA 4MX8A 1F60A 1JZSA 3BVPA 3MSXA 1EG2A 4G1MB 5DHFA 2X4DA 3WIVA 2JFQA 4AO6A 1MO2A 3BH0A 4N39A 3UJ3X 5CDHA 1XK7A 5TY0A 4V0NA 4ZJZA 3JVEA 4TTVA 1UXGA 3MXTA 3GL9A 4TKUA 5KYKA 3CC8A 2QJWA 1XVTA 2WWIA 3OBIA 1IL0A 2ZJ4A 1JMVA 1T8RA 3MFYA 4MV7A 5DWVA 2C4NA 4DG5A 1UFRA 4FOLA 4LTMA 1JB1A 3VHQA 4FJ2A 4DCVA 3BORA 2Z95A 5EHIA 5HEKA 3G68A 3VR6H 5BSWA 1Q7CA 2AX3A 2EGHA 2X0RA 4E3ZA 4BX9A 3TW4A 3HKEB 4JKYA 2VJCA 1GN9A 2PG3A 4LQDA 4WN9B 1BCSB 1Q7GA 2X8JA 2G9NA 1H4QA 1TQHA 4LDPA 1AGXA 1THZA 1FTGA 1SCJA 3PICA 3V1KA 3O9MA 3LGXA 2C4VA 4MB0A 3N0VA 4TLEA 3HNOA 3UJDA 2R48A 5K5EA 3TLJA 1TQ2A 4N9WA 1PT8A 3BMQB 2FKAA 1MBZA 4MVJM 4PZUA 4AG5A 4JJFA 1VIAA 3FJYA 3PKIA 1YONA 5C8VA 4WFIA 2VJYA 3E7WA 5DM1A 2EBWA 4JZKA 1KY4A 1UZUA 4KCGA 2PGJA 1DJLA 3LWNA 1M2JA 1FRNA 2ILVA 4XQ9A 2WMOB 3A6FA 3QUQA 4Q9LA 4F4CA 5I7WA 1ULSA 5K4GA 2HN9A 3K9LA 3CRZA 1RIIA 3DDUA 3ICOA 1EFDN 4LHEA 4LKRA 4X1KB 1Y1TA 4U7FA 3MYYA 5C7LO 1NOKA 1PFGA 1WKVA 2BBSA 1XTTA 4H77A 1XR3A 1KR5A 5IBRA 3A32A 1EWTA 1NBHA 3OCZA 3GEDA 2JATA 4IUYA 1WW2A 1OX4A 4K6FA 4OU4A 3WLAA 3ZV7A 2AFIA 3JQQA 1TYBE 4KN8A 2VUTA 4GOND 3F7TA 4L8WB 1I4WA 3GCWA 3LNTA 1GPH1 2FWRA 2IXGA 3G8BA 5AHKA 5EGSA 1ZNQO 3DZKA 4GPBA 2IHYA 1X9GA 4REMA 5ES3A 3U80A 5IVKA 4Q66C 1FU8A 4QBTA 2BOVA 3HZHA 3GRAA 4OB6A 2HHJA 4DNOA 3L01A 4EMTA 3B3FA 1ULZA 1F0NA 4FYHA 1YL5A 1BCRB 1FPMA 4IICA 1LY1A 4B1FA 4ENUA 1CP3A 821PA 3H2SA 4ZOQI 5EP4A 4HFMA 4HDQB 3ENVA 5C8YF 2I91A 3QVOA 4WEQA 1BKDR 2MYPA 1NXWA 2QRGA 3HABA 3LKDA 1E2GA 3ZVNA 3MCTA 1Y9EA 2GQ0A 3DVSX 5BVHB 5A0FA 1HT0A 1V37A 4HXEB 1H2BA 3HLTA 1NGSA 2BGNA 4N41A 5ALVA 1H2ZA 3FKJA 2QTBA 2R8YA 1TM1E 3BFJA 4UEJA 1VB5A 1JZTA 3I9KA 3KSDO 1VHLA 4HNQA 2C9BA 1YS7A 1ZOIA 1RRGA 2C8VA 3L6OO 3BXXA 2YV5A 2BI8A 3VPFA 1XTZA 5EWLB 4Q1AA 1VL1A 2GK4A 3PC4A 4BRSA 3U39A 4IHKA 5F5NA 1YR6A 2OQVA 3G85A 3OTGA 2XKBA 1NVDA 3CLKA 3E18A 1LGYA 3DV0A 3R3HA 4DIFA 1T1GA 1IWBB 1DBRA 5TQVA 4EENA 5ECDA 1R8SA 4GLFA 5JNRA 5LNK1 5EGNA 5EJFA 4EHAA 1EZZA 4TYPA 1D8AA 3VOSA 1N5JA 1KZ6A 2FSPA 5KYXB 4AUNA 4EPTA 3NPMA 3UO8B 2QNBA 2ATVA 2PH5A 3IEVA 2PD4A 3PLNA 4JXJA 1H6BA 3M1LA 1YZHA 4KACA 1KDOA 3AR2A 3SEZA 3TLEA 1SGWA 2PWZA 3NXSA 1BYUA 2BGMA 1OXVA 5AI6A 1TNDA 4ZVUA 3MQFA 3KG2A 3WYCA 5I7EA 3IJPA 5ABPA 4NOKA 3SEFA 1II8A 4KXFB 1Q19A 2R5NA 1SY7A 3MF4A 2VP0A 4GEKA 1OH8A 4WHMA 3RHFA 3A1CA 1CC1S 3P2KA 2IPXA 2NYRA 4IPTA 1P2FA 3WYFA 3LFTA 4YB8A 3TXYA 2I9KA 2IL1A 3LBIA 2QVGA 1RHMA 3HFGA 4YI3A 4V1CA 1NP3A 4YMHA 2VPQA 3PC8C 2PQ0A 2NO7A 4MRMA 1TAUA 2CDAA 4LPSA 1GEEA 4ZGWA 1JJIA 5IJAA 3NEAA 3WNCA 1R8JA 4TV9F 2MOKA 1USIA 1MC1A 1CY2A 1N3IA 1U7TA 2DWPA 2PVPA 4L0MA 4LCBA 1MEOA 3PHBE 2CFOA 3PVZA 2P3SA 4CKCB 3PPWA 5A9RA 2YZKA 4R2WA 4LC0A 1Y80A 3AR5A 5D7NA 3ZU6A 1CY4A 3QEBZ 1A9TA 2CLLB 2YYSA 3DVAB 2WHEA 3WIEA 2VP2A 1UJ5A 2DTEA 2X5KO 4WZZA 2F55A 4DM4A 5I9NA 1GZ3A 1Q91A 1KI4A 4ZO8A 1PJCA 1OVMA 5CVUA 2PU7A 3H0EA 2EC5A 3NP7A 2REXB 4FC7A 1BQ3A 3CINA 4B3JA 4AN0A 4JC5A 1OZGA 4NULA 3NHSA 3D4IA 1ZL2A 5G1PA 1WXQA 4EG6A 2HCFA 4WI1A 4BVEA 3QVVA 5HOEA 1MKYA 5JJKA 5FL3A 3FFAA 4F3RA 2PGLA 3HMKA 4RVHA 3EXIB 4XD7D 3HGQA 4HX2A 3GJXC 3JR7A 5CVTA 2JL1A 2Q5EA 3QIVA 1ZXLA 3ETJA 4C4OA 5JARA 3UHAA 4S2UA 3HI4A 3PLRA 4JBYA 4ND2A 4XIYA 3FRJA 2J9YB 3NVDA 3DLTA 2OESA 4JUCA 4MS1B 5JG7A 2IF0A 4RAQA 3AZOA 2C84A 4IH4A 3IV6A 2PH3A 1W46A 3PCRB 5GP1A 3ZEAA 2B7BA 1QGAA 2D2VA 3GF4A 2GZHA 3K0CC 4P22A 3HB7A 5FPPA 3TOXA 2EX1A 4AZ0A 1A9XA 1YZKA 3FIJA 3P9PA 1NDUA 3EGOA 4GU5A 5G02A 2ZRQA 4CF4A 5D1HA 5AK3A 1ZVVA 2KM1A 1GITA 2G9UA 4AUEA 4XVCA 1NSFA 1FS6A 2ZQZA 3NATA 1RCUA 5LUAA 2PANA 3HNRA 3HU3A 1IN5A 3DAPA 4WPGA 1EHCA 2XGMA 5F2OA 4BJ1A 3UA3A 1JLSA 3VO8A 2VQSA 3EGVA 4WOPA 4PG7A 4DJFC 5KO2A 3I1JA 4F5DA 4E2ZA 4RTQA 4KN6A 5BUQA 1IXSB 1NAIA 1HLFA 5KX5B 1Q1GA 4BO1A 3HPRA 1JEQA 4Z4FA 5KQLA 2QD2A 4AB1A 3HCBA 4GICA 3AJRA 3DEFA 4I4TF 4DQDA 4EKYA 2P9GA 4DLSA 2FDRA 5EE9A 1JXAA 1N1GA 2CCGA 2GFQA 3OLWA 4LY0A 4OP3A 4UBOA 3V1LA 5ADUS 3NTXA 4X64B 2CLDX 1XAJA 1PZMA 2JLQA 5U4QA 3R7SA 4BNYA 1NFRA 3I8OA 5K8UA 3C74A 4P3YA 2LNDA 4ZWNA 4B3GA 4TYWA 1SHTX 3A2MA 1KK2A 2FW9A 3C41J 2G5PA 1PJTA 1E6UA 2ZXEA 1K66A 3LT5A 4C3UA 1M9NA 4BJ5A 3EUWA 1D6MA 3FBGA 4EF4A 3I61A 3KO8A 4DC1A 2FWJA 5CBPB 1YKFA 5I3CA 1QK4A 3RFTA 1U8YA 2WMNB 1T1RA 3OZRA 3KYCB 2HX1A 4A8PA 4I50A 3X1KA 3OPYA 1E1DA 3SQNA 3ZC3A 3G0HA 1YF3A 1OE0A 1YCHA 3L0BA 4YMVA 5L4NA 2JEOA 2XGOA 4LWQA 4AKTA 4BO2A 1NFQA 5IYZA 3GA0A 1SZPA 2DKFA 3R9XA 9MHTA 1DIRA 3B2EA 2V03A 4JKIA 4EO4A 2IKQA 4RQAA 3ZHZA 1APBA 1LV8A 4HGPA 1HY3A 5T4FA 4DDHA 4CV1A 2QGNA 4EVSA 3WLJA 1NG9A 4LYYA 5ECYA 4TSKA 4FGSA 2AFIE 1Y63A 3FR8A 4W99A 2H8KA 3OE1A 4LJLA 4P5DA 3I62A 2OBFA 3TEMA 1IDN1 5AI0A 2A9RA 2ZYWX 3OPNA 5B6JA 2X9GA 3N2KB 4DMUB 4WW0A 1TMGE 4C3OB 4CETA 2VTBB 2I1WA 3TOZA 3FVTA 3VYRB 3DCIA 4CM6A 1WMDA 4UNNA 1PYOA 2V7PA 3EOZA 3LRXA 1D2RA 3O73A 4AO7A 1JDBC 2CZCA 1WXDA 4EAAA 2GTHA 2NPFA 5EMNA 4EK9A 3R75A 3PHCA 1A77A 4IIHA 4G1BA 3CRMA 4J16C 1QPZA 4OU5A 3FDZA 3DJFA 3I5XA 1B2LA 4DBVO 4HWOA 3GFTA 1VE1A 4P4NA 1FMFA 4ZICA 2A5DA 2O2EA 1CY6A 2R86A 4ENPA 4G2TA 2WHRA 2C7VA 4M6WA 3H1EA 5GTDA 3PJEA 1P6QA 4ID3A 1HETA 2FQXA 5F76A 1ICEA 4U9HS 1CDEA 4YRDA 1VSTA 2D2XA 1O4WA 1OFIA 1P91A 1JU3A 1G3QA 1R4ZA 3H8JA 3HL4A 2X9QA 3D5EA 5HF8A 2OZVA 3S68A 4RDHA 1GXSB 3M2PA 5JBQA 2QLNA 3DEHA 3UN1A 5CH3A 4QPPA 5CB6A 4S04A 5KNDD 2VQEB 4MZXA 3DO8A 3PCXA 5J3JA 2V45A 2QV7A 2QTZA 3GEBA 1D1PA 4IOKA 1RKXA 4M1YA 3H6GA 1K9VF 3GNTA 3SXJA 1NRJB 2IGTA 3OEED 4DHWA 5ADHA 2C9OA 3VZQA 4FUTA 4D3ZA 4G84A 3ZK8A 1VZ3A 1SC3A 3GWGA 1NF8A 3A10A 3OFND 1W9HA 2Q1YA 5EIFA 2PX5A 4YRKA 1EQAA 4B32A 1QFXA 4L2IB 3VAZA 1WBJB 2HL6A 1EGHA 1ZX1A 1Z3IX 1XHLA 2BEWA 3HXPA 4L9AA 2ZYIA 2Q3JA 3GUYA 4NONA 4RESA 5M04A 5MN6A 4G1VA 4JEMA 1EX7A 1Y8RA 2MSLA 4YT5A 4GM0A 3T1YB 3JTEA 4LY9A 5DO9A 5KTOA 3DOEA 2C1EA 4YAIA 1ZESA 3ED5A 3H84A 1EX9A 2LV8A 4NOLA 2X0FA 2C07A 1IOWA 4GBGA 1VLHA 2EJWA 5KPDA 3P71T 5K99A 2D3WA 3IDZA 3AF0A 3B6ZA 1U28C 4KQKA 5GONB 4HVLA 2ZZMA 4L3OA 4URYR 1Y98A 2R751 1P1KA 2QLBA 2HDWA 4MK4A 3WL4A 4NMMA 1LNQA 2VNKA 4RWZA 3ZVRA 2ZCVA 5H4HA 2J5RA 1QGED 4UTXA 4IQ8A 5BUCA 2VJPA 4QM6A 3KQKA 4BVAA 2A1IA 2IYNA 1K0FA 4RZIA 2DR3A 1IZZA 3KNZA 3IAS6 5JLAA 4ZZ1A 4IWYA 5L6LB 4PO8A 4OXQA 3I05A 3FNFA 1H6AA 1M8FA 3LNCA 3BL8A 4U1RA 5F7JA 2A0KA 2IUTA 2NZWA 2WJIA 5TV2A 5B64A 3R0ZA 1EZ4A 3PD0A 1D2HA 4QUEA 2G6TA 2DHEA 1DC7A 3AMVA 3JYOA 1L4EA 4EO9A 5BWOA 1NY6A 2EL9A 1C9JA 1PHRA 4D9NA 3KSZO 4OSOA 1V3VA 3W6ZA 3G13A 4FE7A 2GHRA 1AVTA 5AXCA 3VBCA 4M0CA 4R98A 2YUTA 2X3FA 3Q4GA 4JDPA 3SVLA 4NH0A 4R31A 2FZLA 3WFZA 1W88B 1IHPA 1SXJB 2G8LA 1RWWA 1A3CA 3VR4A 4CCAA 4FK8A 4JU8A 1I3KA 5H70A 1AA9A 1GTZA 2GDZA 2JH8A 4KFUA 5DYTA 3CG0A 2J4DA 5ALYA 1DE0A 2CFTA 2RGYA 4Y6LA 3I73A 1T43A 4Z7NB 5BNTA 4EA7A 2HMUA 3EBOA 1YI0A 5KTPA 1INLA 3UT5B 3L8ZA 5CDTA 2FUKA 3TDNA 3HY4A 3IQHX 1NBAA 4S12A 4EJSC 2WQZA 4G0PA 3KQUA 3CPHA 3KPJA 2VUIB 2ZRAA 3IXQA 4KH1A 5IBPA 4HDRB 4DTCA 5CNKA 1W0JA 4CT5A 3C3CA 2LGJA 2Z8YM 1Q5PA 3ZWOA 3NEPX 3RIMA 5K05A 1GTSA 1R0XA 2OAQ1 2YS6A 5T4HA 4EHJA 1S2NA 1Z25A 2JFZA 5CPFA 3F67A 4ZPXA 4URZR 1HH4A 3I2FA 1UKVY 5K1ZA 3B38A 5B1SA 3B9PA 2BGJA 4TN5A 1Z8DA 4HSGA 5SYAA 1P0QA 4LPKA 1NYLA 3WLLA 2VRBA 2NUAA 3EVDA 4I66A 3RT9A 1H0HA 4QNMA 3RG2A 4C03A 4TXLA 3RV3A 1ZCAA 1FVOA 3KB2A 1DAFA 3VNSA 3GEGA 4W5JA 1B23P 2C61A 3IO3A 4F71A 2WNIA 5BYAA 1PSWA 4RA6B 1LPPA 5TLSA 4K6MA 1STOA 1XMJA 3R8XA 1C3XA 3A1EA 3TLCA 3TZQA 4Y9TA 2O2CA 2AE1A 4EWLA 1HOTA 2Q6IA 2ZS7A 2FHSA 3CUYA 4JZYA 5BPHA 3VGJA 1LJUA 4HNGA 5DTRA 1W73A 3EC2A 1E7WA 4WFKA 1SD2A 4GX1A 3AWIA 2OCKA 3THSA 5BSKA 2O2HA 2IYLD 3C0KA 5CJ2A 1W6RA 3SQOA 1S2MA 4KWEA 3KR0A 1S6YA 1M1NB 2KSQA 3GLTA 1AB5A 2C57A 2DUUA 3L6RA 1ONSA 4FE3A 3RC8A 1JEJA 4CMKA 2RK3A 3I9FA 4OVKA 1Y5LA 4Z86A 4CI0B 3TBFA 3OAAA 4QUHA 5KVSA 2E37A 2CYCA 1NI3A 2A3NA 4BYMA 4M8IA 3D3WA 1G3MA 2H9IA 4QVGA 4R6WA 3SLRA 2DR0A 5EMMA 4YRMA 4JI4B 1RXYA 4YUYA 2GCEA 4RLHA 3SK0A 4E2WA 1WG8A 4CUZA 5L4SA 2XVYA 2PUGA 1R0RE 1JUDA 1X7XA 3NO4A 1GG8A 1PJ2A 3K94A 1VIDA 7AT1A 5KSOA 1QDLB 1A88A 3W2TA 4HMQA 4E5PA 1M8JA 1XZNA 2JI6A 4LF4B 4P1ZA 1AU9A 4EY6A 5CLJA 2XTJA 4H60A 2BEVA 2XUJA 4FQ8A 1UMBB 2YFQA 1EFAA 2HQOA 3HSKA 1NVEA 3EDMA 3LDAA 3QKRB 2FOXA 2HF7A 2XMGA 3RT7A 1ZK0A 1HSZA 4CEJA 4XWGA 4EB3A 1XI2A 3UJNA 4B6EA 1CUHA 4TSFA 1TQ4A 3A1UA 1M73E 1UQTA 3WB1A 3GLQA 2CE7A 4DM3A 2NP6A 4Z9FA 3AY0A 2PSEA 3ZCRA 3QVTA 4B0OA 3O7MA 4I55B 1U65A 1KR2A 2GJ9A 5CEEA 2VLBA 4FONA 3ILSA 1SBIA 1YJBA 1QC5A 3BEOA 3TXAA 4OATA 4OQNA 4H7KA 3CYFA 4Q3EA 4HH0A 1XTIA 2C95A 3EOAI 3MJHA 1EE2A 4HWGA 3MHTA 2FFQA 1KEZA 2FPRA 5C1IA 5JYCA 1AMUA 3DE3X 1DRVA 1S01A 1NU8A 4MS4B 5F35A 5GJBA 3TCXB 1DIHA 1U3TA 1QRAA 1DNPA 5DB4A 3D3QA 3ZXIA 1H2RS 1VPDA 4AQYB 3C7DB 1T9CA 4Q48A 3IA7A 4B45A 2SKCA 3FVQA 1QGOA 4TSRA 3PG5A 5H7XA 1QIIA 3WGOA 3ORSA 4KQ2A 3F6YA 4IVRA 2A9QA 1YKGA 2C00A 2D0PB 1L5Q