4JFAA

Crystal structure of plasmodium falciparum tryptophanyl-trna synthetase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
362
Chain Sequence
INYNKLIKEFGCSKITENHIKRIEKLTNSKAHHFIRRGIFFSHRDLDFLLNYYEQHKCFYIYTGRGPSSLSMHLGHLIPFYFCKYLQEAFNVPLVIQLSDDEKYLFNQNYSLEYINTLTNENVKDIISVGLNPELTFIFKNTEYAGYLYPTVLSIHKKTTLNQSMNVFGFNHSDNIGKISYPSFQIAPCFSQCFPNFLGKNIPCLVPQGIDQDPYFRLSRDIAVKMALHKPVVVHSVFMPGLQGVNNSVIFLTDTPEQIKNKINKYAFSGGGTTIQEHREKGGNLDKDISYQYLRYLLEDDNKLNEIGEKYKKGEMLSGEIKKILIDVLTELVLKHQEKKKSLTDEEISYFFDPNKPSLQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Tryptophan--tRNA ligase
publication title An appended domain results in an unusual architecture for malaria parasite tryptophanyl-tRNA synthetase
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 134
structure length 362
sequence length 385
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 4jfaA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4jfaA01
1G8GA 1EUQA 4ND6A 3TQIA 4G5YA 3DLAA 2J09A 3ZUGA 3FWKA 3G59A 2AG6A 2E0IA 5FO0A 4XSVA 1WY5A 3H97A 2RE8A 4ZCTA 3CLUD 4CQNA 3IOEA 4KR9A 4BWVA 1ZUNA 1GZUA 2A86A 1EFPA 1N2JA 2IP1A 3UK2A 4PBSA 4ZCSA 3FDXA 2JANA 4MW6A 4EF6A 1MAUA 4EG3A 3HFJA 4HJRA 1KAQA 2NSYA 1OD6A 2CV2A 4MUHA 1O94C 4RPIA 1GTRA 4DLPA 4UZFA 4U63A 3SZ3A 2A1TS 1OBHA 3HMQA 1XNJA 4JZYA 2CT8A 1ZH6A 3PXUA 4MVCA 3SDBA 1PFUA 2H2AA 4P2BA 1V47A 1PG0A 1JMVA 1WXFA 1GPMA 1N2BA 1WXHA 2NZ2A 5EKDA 5HUHA 4ARIA 1F4LA 5JBNA 4XFDA 3CVUA 3CLTC 2G36A 1NUPA 1N2IA 4EG7A 3HGMA 1YI8A 1KH3A 1IHOA 1K4KA 1NYLA 3N05A 4EG8A 4I6JA 1J1UA 2A4MA 2J08A 3QE4A 2CUZA 2ZUFA 1QJCA 1S4MA 1NUTA 1ILEA 2A1UB 1QU2A 3TZEA 1O0CA 3Q10A 4R2MA 2WSIA 4YP7A 1EE1A 2B7LA 3I05A 3CVVA 1MOPA 4L2IA 1IQUA 1KH1A 1IVSA 2DLCX 4ZT2A 2CFOA 3CLSD 4R0NA 3VGJA 3RHSA 3AKZA 1Q15A 1WQ4A 2PIDA 3ILVA 1M8KA 1U7XA 4MAFA 4JYZA 5J5AA 2V0GA 4MWBA 4JXXA 5KCMA 3DO8A 3MXTA 1QRUA 4MVYA 4DE5A 4MUKA 1MAWA 1NI5A 4NATA 2X1LA 1PG2A 1N2EA 2Z09A 1GN8A 4U7JA 1EFPB 4NX2A 5LLTA 3AIIA 4CDMA 1N78A 1O5TA 2ZP1A 1IRXA 3L92A 4MVXA 4MUJA 2X1MA 5KHAA 3M5WA 1F9AA 1KKUA 1VLHA 3IDFA 2GKSA 3CLRD 2A1TR 1M8JA 1I6LA 4H3SA 1OBCA 1TYAE 1PFVA 1TEZA 2A7XA 4GU5A 1O95D 2HZ7A 3CVXA 1TQ8A 1LI7A 1COZA 1T9GS 2WB2A 1JIIA 3PNYA 2QJOA 1WJGA 5DASA 1YIDA 3FIUA 4A91A 5F23A 3S3TA 1KAMA 3IUBA 1YUNA 2DUMA 1KP2A 2PZ8A 1JECA 2H29A 3AG6A 1M8FA 2AKEA 1O97C 3NBAA 4EG1A 5IJXA 2QUHA 3CLUC 2QTRA 3AG5A 4GRIA 4YBRA 2WQ6A 1FFYA 3U1VA 1QQTA 4F3RA 4DDHA 5H7XA 1G59A 4EG5A 2QUIA 3FH0A 3VRHA 4NAHA 3E27A 2A84A 1FYDA 4F4HA 3AFHA 5BNZA 2DETA 4L2IB 3NBKA 1IQRA 2TS1A 3ND6A 1Y42X 1IH8A 1XNHA 2PG3A 1EFVB 4ND7A 3ZIUA 2DERA 1GLNA 3COYA 2QJTA 4ZT3A 2CV0A 3FG9A 3A04A 3ZJVA 1YIAA 5K0TA 4R2LA 1RQGA 4I6EA 1GTSA 4DJAA 1Q19A 1NSYA 3ZGZA 4MWDA 1K97A 1ZH0A 3F3MA 3ZJTA 4RUKA 1T6XA 2QTMA 1UFVA 3P0HA 3ZJUA 1WXGA 3P0IA 3HL4A 2EL7A 4S1OA 3X1JA 1R6UA 2CSXA 1KR2A 3BL5A 4WNYA 4G5FA 4MUEA 3KT8A 4ZT4A 3DPIA 2DPLA 1F7UA 2QUKA 5J59A 1O94D 1PFYA 5H16A 3CR8A 3IMGA 3VU8A 1WQ3A 1WZ2A 2WQ7A 2HGZA 1QU3A 1N1DA 2QUJA 1G8HA 1ZJWA 4MULA 1X8XA 1J09A 4AQ7A 3LE8A 4ZT5A 2JA2A 3SP1A 4EFKA 4JFAA 1A8HA 4WSOA 1Q77A 1EUYA 4K0RA 1IQ0A 1EFVA 1K92A 3IVCA 1KQOA 1G8FA 1WXIA 1QRTA 1OWPA 4MW4A 4HK4A 1KORA 3CLTD 1MB9A 3SYTA 4MLPA 3G5AA 3GUZA 4G6ZA 3SEQA 3RK1A 4MWCA 2QTNA 3FETA 1N77A 4YP6A 1U3DA 3OP1A 1V8FA 4K03A 5DEOA 1VL2A 1EXDA 2I1LA 3KT6A 1JZQA 5J58A 1OWNA 3IH5A 2IELA 2YXNA 3KT3A 3PNVA 1N2OA 5HG0A 1O6BA 4KPUA 2O5RA 1B6TA 3ELBA 3L93A 1O0BA 3UC5A 3COWA 1U7DA 1VBNA 1K4MA 1VBKA 4J76A 3QTBA 1J1ZA 5FO1A 2IJGX 4TS1A 1U3CA 4J75A 3D6VA 2D5BA 1R6XA 3RFFA 1JZSA 2D54A 3UOWA 3RBAA 1XNGA 4YMIA 3SEZA 2GOYA 2R5WA 3MLAA 3H99A 3X1MA 1U0BB 4MW9A 2CYCA 2E18A 3COVA 1CT9A 1MRZA 2V0CA 4MUFA 1JGTA 4KR6A 1JIJA 1T6ZA 4DNXA 3HV0A 2J4DA 5FNZA 4MWEA 4MW1A 1QTQA 1GAXA 2PZAA 1LI5A 4Q16A 1KQNA 2CYBA 2XRZA 4E1AA 4MUGA 4QBTA 1N2GA 3IODA 2Z3VA 2A88A 1VBMA 2YWBA 5TEWA 3C8ZA 2VXOA 4MW2A 1KQPA 3H9BA 4ZCQA 3A05A 1DNPA 1SURA 4I6GA 1PFWA 3RJZA 3TZLA 3UY4A 1WOYA 1TYCA 3ND5A 3ZXSA 4ARCA 1YULA 1HYBA 3IVXA 4UZEA 4CDNA 1I6KA 2X3FA 1O97D 3QTTA 4XFJA 1NZJA 1JEEA 1N75A 4OUDA 1MBZA 3NV7A 1J70A 3X1KA 1JILA 1I6MA 3P0JA 4PY2A 1OWLA 5TEVA 1JEDA 3P52A 4ZT6A 3UMVA 1M83A 1O96A 4ZCPA 3CVYA 3LCJA 1OWMA 2O8VA 2PXHA 2GM3A 3K32A 1JHDA 2YWCA 4KPUB 5DK4A 3FHJA 1MC1A 3PNBA 3FOCA 4HPWA 3GLVA 1N2HA 2ZUEA 4U8HA 4KKVA 1T9GR 4KR7A 2VTBB 3KT0A 1D2RA 1H3NA 3AL0C 3RK0A 2C5SA 4FZJA 3N9IA 4MW7A 3IUEA 1KP3A 4EG6A 4DDMA 2JAXA 3INNA 3A2KA 3CLSC 3JXEA 1J21A 4PBTA 4MUNA 3IMCA 3MMXA 4HJXA 3G6KA 2D13A 2PFSA 3GMIA 3COZA 3LOQA 5K0SA 3PRHA 2BYTA 1NUQA 2DEUA 4EG4A 1H3FA 2J07A 2E21A 4DDKA 4MW5A 2Z08A 1X6VA 1M8PA 5LM3A 1QNFA 1MJHA 2CYAA 5AHWA 3ISJA 1ULHA 1TYDE 2OQ2A 3IMEA 5HUJA 2XRYA 4X0EA 2DXIA 3ZXIA 3CLRC 1IFXA 3HZRA 1T6YA 3TS1A 5TS2A 3OTWA 1F7VA 2AZXA 1EJ2A 1WXEA 4QREA 2HMAA 1O95C 2J5BA 2PZBA 3A4IA 4MQ6A 4CT0A 1M8GA 4ZCRA 1BS2A 2EJCA 2CV1A 3FY4A 2QJFA 4OUDB 3FNRA 1P7PA 3ND7A 3N8HA 4EGAA 3IVGA 1LW7A 3D6UA 1OWOA 3DV2A 2VTBA 1NP7A 5IHXA 3TNJA 1MB2A 2DR2A 2BTEA 1O96B 4PBRA 4YP5A 5TGTA 4Q93A 1QRSA 1NUSA 2RD2A 1XJQA 4QRDA 3Q12A 3TQOA 5KWVA 4MUIA 2X0KA 4MW0A 4MVWA 1I2DA 1R6TA 3IOCA 4NDAA 1JIKA 3SZGA 3CVWA 1KH2A 1M1ZA 5DB4A 3H05A 1TFUA 1Q11A 4ZT7A 3CA8A 3MLBA 1H3EA 3N2YA 2A1UA 4NAUA 4AS1A 3H9CA 3Q4GA 4JXZA 2YY5A 2OV4A 1YUMA 5LFAA 1WKBA 1NUUA 2E89A 1J20A 3MUEA 3KFLA 3K9WA 1H1TA 3IOBA 1NURA 3FI0A 4OJMX 4NZPA 1TYBE 1N3LA
chains in the Genus database with same CATH superfamily
2QTBA 4F96A 1GNPA 5JHHB 2ZJ3A 1EM8B 5AK3A 3GA0A 2GAOA 3KSUA 5CH3A 3JPWA 4U2BA 4LVOA 5FOVA 3RV3A 1RWQA 1HDCA 2HI0A 2MSKA 1BWPA 5EPUA 4S35A 5HFJA 2AFVA 1SBYA 1H1DA 3LBIA 4BVGA 5DN9A 3F6SA 4MR7A 3CLUD 5DI9A 3IOEA 5DN6A 1PUJA 1QE5A 4FXOA 3MERA 1UFRA 1N2JA 4OF4A 5EQTA 1Y3DE 4H18A 1X86B 4LRYA 1SVNA 5ANRB 3L41A 1M6HA 4EF5A 3PNSA 4ZCSA 1YE8A 2KE5A 2Y9PB 4Q3AA 1OAAA 4ZAWA 1BDJA 2BE9A 2XT9A 1RBYA 4ZARA 4G84A 1LDYA 2F1RA 4M9XA 2X8WA 3REOA 2BZ1A 4JBYA 4QTUB 7REQB 4BP8A 4DV6B 1H8ED 5JS1A 1XQ9A 1E4YA 3K73O 3TTUA 3AY3A 4S2EA 2NZYA 4U63A 2J0UA 4LMAA 1WDLA 3VZPA 1XDDA 3OQOA 2FK8A 2G04A 5J43A 3S55A 5HPYB 1U9ZA 1BW9A 1VYTA 1W88A 2FY8A 3THRA 4MDEA 1GHTA 5I9LA 2NO6A 5HMMA 2X2FA 3DHVA 3D3JA 4GECA 4JSTA 4FU0A 3ENZA 1LNQA 2A59A 2YMMA 4MARA 3GK3A 1PE0A 3MOGA 4KQGA 2P27A 4U7FA 2OG2A 3U37A 1L8LA 3DQPA 3C41J 5A04A 2NZ2A 2V8OA 4DJEC 2P9ZA 5HVNA 1E6MA 4EPYA 2OZLA 3QEMA 2X0JA 4YDQA 4B45A 1N2IA 3DBIA 4OJKA 4L0CA 4PO1A 2G25A 4PYKA 2QR2A 4OI2A 3T95A 4TLBA 8LDHA 2Q4BA 2Q9UA 5EIHA 4QNRA 2QE6A 2G1AA 5JQGA 3OWOA 1P4GA 3MJSA 1KIFA 1KTVA 4KLCA 4ILEA 2VJDA 2YJZA 5CNJA 3ZE6A 1E1QA 3FA2A 4V0KA 4EQ6B 1AQYA 2H1HA 4Q1DA 5E6SA 4RCYA 3LH5A 3WJ7A 1WUHS 1X1QA 5JSZA 1E3WB 1Q3TA 4ZEMA 3D6HA 1EVYA 1Y9AA 1C1YA 1CEQA 4HB2A 4MLZA 1A1VA 1QAMA 4XIGS 5I7HA 4EKNB 1ISGA 1Z45A 4C4RA 4PNHA 3SM3A 3Q8MA 4H16A 4HGQA 5K99A 2XUJA 1GKLA 1E5VA 3G8YA 1I4OA 2MYUA 2JJ2A 1RFGE 3LY9A 4GXNA 3N2GA 4F5WA 3AJ8A 3OIDA 1Z07A 2V98A 1T4GA 1YBVA 1KMMA 1K3TA 2Q3DA 4IJKA 4JZKA 1JEAA 4AIIA 5LCXA 1Q0TA 6NULA 2CVZA 2FR1A 3HDTA 1IY1A 1VDMA 4MA5A 3JZIA 4YRCA 5DRTA 5EPEA 3IQZA 4IG4A 5SZJA 4F04A 5J4LA 4U7JA 4RKQA 3UMJA 3GFSA 5B64A 1QTRA 1Y33E 1WW3A 1EFDN 3OM9A 4QJIA 1IRXA 2RGYA 1CUIA 2ZSFA 3OX1A 2HMUA 3PVZA 1MDBA 4HGYA 5K0NA 3RVPA 2I99A 3Q0EA 5H0IA 3ZNPA 4ESHA 1N32B 1NVVQ 3TGWA 3CJQA 5CAEB 1XEFA 1XVLA 4PZ0A 5I7FA 1Z7GA 2WJAA 4FN5A 3TD2A 1F0KA 1MPXA 1ZO8A 3ORRA 4RLFA 3ZI4A 5ED0A 3CVXA 2P6PA 1MVLA 2BC9A 1XQYA 3FVWA 3WIDA 4F7DA 3FPFA 5F2EA 3CX4A 4IV0A 2B34A 3FFBA 3I28A 4RA9B 3FTQA 1Q1BA 1X1RA 2ZR8A 1P6XA 3N07A 4KUEA 5CEFA 2JK0A 5HM6A 3H4MA 4ZO6A 2UZ4A 2X8BA 4Q1FA 2D62A 2MR6A 1QO0A 3EA4A 1AZWA 1R4NA 3FIUA 3FZNA 3HQ4O 2FPGB 4TXJA 3NIFB 4UMEA 5B6JA 4WNCA 3E2IA 4CL8A 4QC2A 1RQ2A 1N0HA 1YFLA 3F97A 1RAEA 4QM7A 3KAPA 3KHTA 4QYIA 1G18A 2P3SA 2ZS7A 3GBSA 2H2DA 2ODPA 4RK1A 2P7HA 2M6SA 1YDMA 3G9UA 4IV5A 3QUTA 1ZOSA 1UR5A 4TN1A 2J0EA 3EZLA 3PX2A 2WQ6A 5EKTA 1QP7A 1FFYA 1C3OB 1I10A 2R25B 1PQYA 4F3RA 4HTFB 3HYSA 4DQKA 4FZVA 1UWVA 8AT1A 3AY7A 4YNBA 4I46A 1Z26A 5LZ7A 1RZRD 3AFHA 4WJZA 3HI6A 4J94A 3QBEA 3VZQA 2WZCA 2GUWA 3LUKA 1S9DA 5AK5A 5LYJF 5JJKA 1Z4MA 1JZTA 3I5YA 3LIPA 5GJWC 2WTUA 1N5MA 5T6MA 3VHQA 4YEDA 5ALVA 5IDQA 4DMMA 2JFHA 1GO2A 4IDPA 4WASA 4C0BA 1Z4QA 1O9GA 1ZP6A 2JS7A 3BGVA 3E70C 1LEHA 3ID6C 4ZT3A 4K7JA 1T1RA 2WK1A 4AUNA 2XGSA 1S01A 2ERYA 4KO4S 4JJKA 5LMUB 2OVFA 4QLAA 4XIYA 4HAIA 4FTWA 4HQOA 1U0RA 1J0XO 4TMVA 5HJ2A 3E9YA 5CK4A 3G89A 3MS2A 2O0HA 3CUKA 1K3FA 3FYUA 3RS0A 4BNYA 5BUCA 1OREA 1ZOLA 2H1LA 1Z4JA 3BHMA 5J2UB 3F3MA 1VHWA 3MC1A 3QV2A 1BCRA 3QLVC 1KK3A 4Q21A 1LX7A 1W8IA 2ISCA 1P29A 1R0XA 2GKGA 3LV8A 4M86A 1RU3A 5E8RA 3UH1A 2W58A 1B8NA 3PA6A 4OP2A 2I29A 4OHCA 1ZD2P 3ZBQA 1WBBA 1ID1A 4MVJH 5G53C 3HNPA 5KPDA 1WVMA 1LFAA 1RYMA 4B3XA 3QRWA 2BOVA 1UODA 1PI3A 1Q22A 3BL5A 3R7LA 2Z30A 4H0NA 2Y1FA 2F67A 1UPTA 1N9ZA 4K28A 5M2QA 5FA8A 1UC4B 4CV2A 3CF0A 5BSGA 2JFZA 1QP8A 2XUFA 2DLDA 5JVDA 4N3BA 2P1ZA 1OJ7A 3ZUPA 3NIBA 4QDKA 2FP4A 3NKVA 1NVDA 4K86A 3TD6A 4F5EA 1G9XA 2RBKA 4X44A 3VVMA 4D3DA 1UMKA 2FKNA 4R84A 2JI9A 1RRCA 1N1DA 5FOSA 4M83A 5KINB 1OAKA 1J09A 4LRSB 2XT6A 3H5IA 2HJSA 3RSSA 4EHAA 5JMWA 3O75A 1RFLA 2H5JA 3DEFA 1ABEA 1R88A 3G0IA 3HCDA 3OETA 4MIOA 4OPMA 5KYXA 2X2OA 1K4YA 1A98A 2XT0A 1K6EA 3BN3A 3VOBA 1RKQA 3QJYA 1ECFA 1OUMA 4RPJA 1ESNA 4E32A 3S8EA 1RXUA 3ILSA 4NSNA 1A2BA 1MB9A 4HQNA 1QIGA 3EDYA 1VMIA 3BFXA 5DP2A 3WQSB 4XYBA 2IEGA 3CF4G 4RXUA 2WVHA 3O8OA 3PIRA 1U3DA 2EFDB 3D6MA 3OP1A 3VAAA 1XLTC 2PGNA 3F7OA 3P0RA 2G82A 2NZUG 4DUGA 4DR7B 1GAWA 4LG1A 5G0VA 1A9XA 1RBZA 3EW9A 2LZ0A 1E1CA 4LDZA 3IH5A 2WR8A 5DIFA 5ILGA 2CHQA 3INTA 5AH0A 5A4DA 5DV9A 3HN2A 3H65A 5JS8A 4PPYA 1E9SA 4TV9A 3L93A 1BC5A 2XSZA 2Z9CA 3CNNA 1IG3A 1G291 4N12A 1VBKA 1PBTA 2QUBA 3IEUA 1CVRA 5FWNA 4ONEA 2C88A 5AKLA 4RJTA 1B1AA 1XRNA 2AOWA 3NBYC 1TAQA 1U3CA 2BIFA 3L84A 5FF9A 5DGDA 2Q6VA 4OI0A 1KYXA 3AFIA 3UXMA 5HA5A 5C5CA 4ABYA 1L4EA 3P5SA 1U0TA 1AHHA 4LWOA 5E4FA 3RBAA 1HE4A 2MWMA 5BOVA 3OI7A 5SY4A 4WBNA 5ICCA 2R7NA 2ZRKA 3T5CA 5A9SB 4WOKA 4X1OA 4D8WA 1AC5A 4JIGA 1UDBA 2PZEA 1KVUA 2V03A 4CPDA 2CLFB 3P2OA 4E5UA 4Z9XA 1MVNA 4C4SA 3EDOA 4EA9A 1EWKA 4TQUS 3HV0A 2J4DA 1ECJA 4IAOA 3OF3A 4KQ9A 4LRQA 3O9ZA 5CMLA 3VKFA 4IS2A 3KSMA 5ILOA 1GAXA 2VSFA 8MHTA 3ZY6A 4G1EB 2ZBGA 3P45A 4PM4A 3I73A 4Z0HO 4ZQBA 3R5XA 1J6UA 3FE2A 4FI3C 3KB6A 3OVMA 1PN3A 2ZE6A 3A6EA 5KTOA 1R00A 4D0NA 2ZQYA 4I4TF 4JASB 1R6DA 2W4MA 3A70A 2HBYA 1J2RA 1KVSA 2JI4A 2VXOA 3E05A 3HCEA 4BAUA 2DJIA 2IEBA 4YMWA 4IWXA 3KZCA 2WU0A 1PFWA 1T0IA 1XRJA 4GMXA 4C3UA 1VECA 3K94A 5LQAA 1RXSA 3NRBA 1E2GA 4C7OB 4QQKA 2WJWA 3IFSA 3QU4A 5KC9A 4X97A 3X0DA 1MP0A 3RE1A 2OR3A 5SYNA 1HV8A 2JATA 4LOKA 3U3RA 1BXRB 5KX5A 2NPIA 1O97D 2JRLA 3T3HA 2BGUA 3WLAA 3GAZA 4FGSA 4EHNA 4M9RA 2R68A 4YAEA 5LZ8A 4A0FA 4GQBA 2D0OB 1WETA 4D6XA 4M9CA 4HNAA 5JASA 1AKMA 1XB2A 2AI1A 4PG8A 5D6NA 1NQOA 2GD6A 1V9SA 4HVAA 2XUAA 4DV4B 4DREA 3CVYA 3TAXA 2D5CA 1ISRA 4RF5A 3M6FA 3ZE7A 3AWDA 3EXG2 3IAS1 4KXNA 2OYRA 4PLFA 5KI6A 2BF7A 4WWHA 3WMWA 1JHDA 5AKXA 1Z2AA 4IUCS 2OV6A 2RJ3A 4YREA 5JALA 1H42A 4TRMA 3DDWA 3PXAA 4BAGA 1Y6ZA 1O77A 1E5XA 3NEPX 4KKVA 2A3RA 4N0EA 3VSAA 4KR7A 4JGBA 1UBNA 1F2VA 3FDIA 4JB3A 5BSWA 5EIFA 3SFZA 5CB6A 1BRTA 4YWJA 3EGXA 2VTBB 5E3HA 4F72A 4FHZA 4FS8A 4B3DA 4BO2A 1DBRA 5FH9A 1C7ZA 1PSDA 1V39A 2C5SA 2JAHA 2QMOA 2EW8A 2B5WA 2D74A 3QFHA 3KQNA 3UZUA 1YRQA 4K88A 4DCUA 1TT5B 5D3KA 2C7PA 4J0HA 1K6XA 4MUNA 2NUPB 2Q7DA 2WKWA 1P3DA 3UJDA 3OX2A 3JVEA 2VT6A 4RZSA 3MG9A 3TMAA 4JITA 4L4SA 3HEMA 5JI3E 3WLKX 1ULBA 4HRVA 3P26A 2YWFA 3GMDA 2PMCA 3KVRA 2OA0A 2F90A 3LZCA 4H3VA 2HYIC 1CD5A 1M8PA 1MG0A 2GBLA 2OUIA 4INOA 4QQ8A 1MJHA 2VWPA 3JQFC 3DT9A 4LISA 3ISJA 4UUMA 3LP5A 4M1QA 3NGXA 2DTXA 3AX6A 5K3OA 3NHWA 3L8DA 3B2EA 1I9CA 4JI0B 3HS3A 4ZAZA 4BVAA 3WAJA 4OXRA 4FQ5A 2RSLA 2X6TA 3A2NA 4OJYA 3U3ZA 3CSSA 5JZ9A 4O1IA 3EAQA 4M8IA 3ZHCA 3R3ZA 1KHTA 1P44A 2OZEA 4QREA 3B12A 4QFMA 4WKGA 5CVEA 3UAZA 4ZCRA 4YRAA 2QUZA 3VXKA 1EQAA 3U3JA 4BMOB 1DO0A 4GGMX 4J03A 3AEUB 4MYCA 4OUDB 4F46A 1ZW6A 2Q0SA 1R64A 2CHFA 3FGOA 3LU1A 3BB3A 2XVMA 4AZ3B 2X4DA 2G7ZA 1NP7A 4JAVC 2O8EB 2BFBA 4PVCA 1XELA 2VKQA 4ND8B 4XH9B 3RRFA 1W9MA 4TRJA 3UUFA 1WZEA 2F8MA 5KO2A 3NDRA 4URHA 4EZEA 4PO9A 4OCZA 4OLFA 4Z4QA 1Z2CA 3V1LA 3B1XA 5DCWA 1K8YB 2BMJA 2G70A 5B55A 4AZVA 2C3UA 4AF6A 5BQOA 3FMPB 3MJEA 1WMBA 3H9UA 2TMKA 3S2IA 2I2AA 4FFMA 4HLNA 3FWHA 3QPAA 3I9OA 4CFSA 4CG3A 4NONA 3CKLA 4QUIA 4X63A 1M6VB 3DDOA 1WXDA 3DHEA 3BK2A 5AW3A 4DV5B 5CPFA 3GJSA 2ECKA 3PUYA 3UJPA 1V6CA 1CUEA 2NWQA 1P5HA 3GWZA 2QQ0A 3KJNA 5J4HA 4AS1A 2ACWA 2XUKA 1G41A 4R2JA 3E3MA 2IK8A 1RCTE 5JOQA 4TTJA 3E23A 2DLNA 4BBJA 4YUAA 4YAFA 2OV4A 1QIMA 1F5NA 1OZHA 1LDGA 4LCBA 3FCEA 2CZQA 1KJIA 3LFHA 4D6PA 1O95A 5DN6D 2OAP1 1FA9A 1UFKA 2YRXA 3I45A 2W6OA 3GP8A 3MXOA 1JFRA 1G8GA 3RVMA 4ND6A 2FETA 2GWHA 4DKXA 4LCJA 2OCIA 3LKDA 3NW9A 4M8LA 3IEXA 4WVLA 4B17A 3ZDAA 1Z2DA 2FHPA 1U3FA 5BORA 2XVZA 5H02A 1U98A 2WINI 3E9DA 4M8SA 5AJZA 3UOGA 4YMLA 1YRAA 2RE8A 1G64A 2ADOA 1O08A 3B78A 2PAFA 4P7GA 1C1DB 2ODTX 1NV8A 1C9YA 3JATB 1OLSB 2GAIA 4OLHA 1I9GA 5IYZA 3LGAA 5H83A 2QZPA 5IBQA 1FSZA 2D0IA 4L72A 3BDIA 4L5AA 5E9AA 4MCJA 3V4VB 2IS6A 1LGYA 2QRQA 2DUJA 3FDXA 3L6BA 5EQFA 1NVEA 2QI9C 1ZKMA 3ELUA 4MW6A 4NIMA 1U65A 2QMUA 1UDXA 3JARA 3I5XA 3DMYA 1VSBA 3HDVA 4WA8A 2EX0A 3MPUA 6REQA 4DA8A 4BMNA 1WG8A 4ERNA 2QMHA 4R2KA 3U0VA 5ALOA 1M74A 1XZEA 1C7IA 2QSJA 2V5UA 2VJQA 5I48A 3LY7A 1T9KA 2NSJA 2OVBA 2FWNA 2VS1A 2CBXA 3IRVA 3OUUA 4IFEA 4X8HA 4E14A 4WOJA 3L4KA 2XXAA 1RXWA 4MDYA 1J5XA 3HYTA 1SULA 1V47A 2PJDA 4D99A 5KOHA 2IYTA 3RAJA 4L27A 1YB4A 2P2ZA 1VGVA 2C5AA 1HL3A 1K1EA 5HUHA 1JLLA 2CB9A 2EFHB 2AUNA 4G0YA 2O6HA 1NUPA 4IILA 1I7LA 1K7YA 5DT2A 1ZCBA 1ZCAA 3B8HA 4WESA 3UV7A 8ADHA 1UMCB 4P7FA 4IP0A 4BLRA 1VI5A 1HZZA 3HACA 4WZAA 5AM5A 1GNVA 3URKA 3ENVA 3L5KA 3Q7TA 4OTZA 3GJYA 1N1EA 2GARA 3H5NA 2IUYA 1TUBA 4AN0A 3EMBA 5JMPA 2JJ2D 2G28A 2IRWA 2H0QA 4ML3A 3ZX5A 2YWDA 3EFOB 5DCYA 4RTOA 1DDOA 2W2KA 3TG2A 1T3SA 4MWGA 1T26A 2QDXA 3JQ8A 2NAPA 3F6BX 3TIVA 1JYEA 3ECAA 1YK0A 2PMBA 3M1AA 4L9WA 1WW2A 3IHKA 3MYRA 3T12A 2WZBA 3WGGA 4XD7A 1DBIA 4KX5A 3DMNA 3GFFA 1YB2A 4BPRA 3KEMA 4EW1A 3RVRA 3P71T 2VAXA 3I5AA 5J5AA 1RWVA 4WCFA 4ROSA 1J0BA 4E33A 3A37A 4PTLA 4NEGA 2G76A 3SIPA 2O20A 4NBUA 4LDQA 3JCZA 3SCZA 1YRLA 4KRYA 4NATA 4Y2HA 4MR7B 3BD7A 1ZJJA 5GONB 1DCTA 4OH7A 1E5LA 5G0TA 2O05A 4LGVA 2PZJA 4NE7A 4AJ9A 1YQTA 2IW1A 2DWQA 3IRUA 5CLJA 2ZS9A 2AKAB 1X3SA 3WLQA 4WFQA 2A6PA 2PSDA 1CUUA 1X1DA 3L92A 4KXMA 4W6QA 2FUKA 2FEMA 2O48X 1KKUA 3ICCA 4Q3KA 4AK9A 3V4OA 4YT8A 1Q3KA 2PZGA 2H9IA 3F5FA 1P1BA 1MABB 1X15A 4DIBA 1YHZA 1DINA 2A1TR 4R6WA 4E13A 3HEAA 3OUTA 4XTRA 3TR6A 3PQ7A 4B71A 5KWIA 3FDZA 1W59A 3PXEA 4XIJA 4U7WA 4OK6A 5FPPA 2DAPA 3HKDB 4TL6A 3TE7A 2J0UB 2K87A 5EXPA 3K0EA 2HADA 3B6EA 2CZGA 3EB9A 5G0WA 5BOSB 4RABA 3VOTA 3ZV5A 3K53A 1NN3A 3STUA 3W06A 3WDLA 4CFZA 5JLJA 4K9MA 1YQGA 1WJGA 2NACA 3BCUA 5DASA 4XLTA 1EB8A 2HMWA 1G7CA 3EZNA 5DU2A 1W0JD 4A91A 5EI5A 4O4JB 2FPOA 3TRHA 3M4JA 2B8TA 4DBVO 2B83A 2EBHX 2XRMA 1ZEMA 2YY6A 4O0MA 1GNLA 1H6DA 1HO3A 1M8FA 3EXIA 4MCHA 4B4WA 2DFPA 2ZTUA 3M9LA 4HX9A 3HFGA 4N8SA 4O59O 1QBGA 4Q00A 2AFHB 2E49A 2EFCB 2W7TA 5JQGB 3II6X 1PSWA 4HSEA 4OA5A 1CR0A 3JWHA 3BE5A 5KYVA 2ZB7A 3AG5A 1YS9A 5ALMA 1P8AA 3MT7A 4BTVA 2HR1A 4KFCA 3BZWA 4IWYA 4HTAA 2X4IA 1XRSB 3Q2KA 3AY6A 3RFUA 5JSZB 3R6DA 2A84A 4F8JA 1FYDA 3O92A 4QGGA 3T5MA 1UT6A 3IDOA 4MDFA 3P32A 1BJRE 1J8QA 2PIAA 2IC5A 1HFKA 3IP7A 2AQ8A 4RM3A 3CUTA 4JC4A 1DG1G 2Y2UA 3MD9A 2OPBA 3JD2A 4IPTA 3RC1A 3UMCA 2GB4A 5A7FA 1Z18A 3R3WA 3MIIA 4AP6A 3UPDA 5J9FA 4F3YA 2ERCA 2D3TA 4L74A 4LGCA 4WY5A 1GQ2A 3FOWA 2NU8B 3OQMA 2A67A 3VPFA 2X5JO 4RWEA 1GPBA 2SNIE 3N2GB 1E18A 4X92A 2JCXA 2WSBA 1WHTB 2I2DA 5DPMA 4PR0A 3OU7A 4UBKA 2WD7A 3A1FA 3QUBA 4YUZA 4R3NA 3GQBB 4C88A 3JQ7B 4ICIA 4L4ZA 2C2WA 3CFYA 1VJ1A 4ITRC 4Q3LA 2QTWB 1ULSA 5ALZA 4HXGA 4W5HA 4X90A 1X13A 1XR3A 4FCTA 1ENPA 2RHTA 4MMYB 4ND2A 4WY8A 2GRJA 3TSZA 1E6LA 1T6XA 5IBRA 3TM4A 4O4LA 5IT4A 5BR1A 5JZSA 3BGSA 1YONA 4IIGA 3GA5A 1E1DA 2P1RA 1HTTA 4U6NA 2W8BB 5LU9A 1PV2A 2WWIA 1WLSA 2G67A 2WA2A 4KYUA 4ZOBA 3E7FA 3UT6A 3X1JA 2CSXA 4MP3A 3HBMA 1XTUA 2EBFX 2FSVA 4PZCA 4S2UA 3FUCA 4BO8A 4HDRA 3RYCB 3TPFA 2G1UA 1M3SA 3D7RA 3FN4A 2QTFA 4LPSA 2PMEA 2JB9A 3NPMA 3G3EA 2AJ8A 3BIXA 2FPLA 3H7AA 4XE5A 1R9GA 1WQ3A 1J8YF 3S2EA 3ZEIA 4FEYA 5ALSA 3CEJA 4HDSA 5AXCA 2XQKA 3HKCA 4KHZA 1RKXA 4TPKA 1F6BA 4G97A 1R4NB 4RNCA 1LH0A 3JQGB 2MYTA 1W4AA 2WABA 1Y1KE 1ZRHA 2H11A 1AT1A 2OOKA 1F48A 2JH8A 2V5AA 1DDGA 2OCPA 4Q34A 1EFVA 3BWBA 4BUCA 1O94A 1IEVA 2A7QA 3IVCA 1RPNA 3AVUA 1M6WA 5IT5A 1MH1A 3A3KA 2X8JB 3VR1A 4EVQA 3GFPA 3HGTA 1KORA 4Z2YA 5FUWA 3DAHA 4ZCLA 4CCWA 4W1RA 2OYCA 4OQ4A 4Q9LA 4IG9A 4JJZA 2B0CA 4M38A 4HDKA 4P5EA 4TUYF 5B12A 3ZVMA 1KZ1A 3PFWO 5BPHA 1NG9A 5IMSA 1T4DA 1T5OA 2D1TA 4D2IA 2HQBA 1SBZA 2GBPA 4YRDA 2VR1A 4OB8A 3H0EA 4KYVA 1DOHA 3KYIB 3M3DA 1NR7A 5J58A 2NP6A 1AS2A 4GSKA 2G5CA 2VP0A 1NPDA 2Y1OA 2GDZA 1QFYA 4ZZ2A 2HW8A 2D2VA 1NOIA 1XALA 3EVNA 3ME5A 4CTKA 1WZUA 2EYQA 2CFCA 2IXEA 3F1LA 3N2NA 3M81A 1DG3A 5I7RA 1DQNA 1Q7RA 2YDYA 1U7DA 2P77A 1K4MA 3I9V6 3O95A 1ADCA 4FP9A 4ID3A 3T38A 4J76A 3BXHA 4HWGA 2JZCA 1DP4A 1N7JA 3HWRA 4HUQA 3NPAA 5DHFA 1KZ6A 1I5EA 5DVZA 5I9SA 1DEHA 3OJFA 3BK7A 3ZDZB 1S3IA 5EOVA 4CJXA 1ESDA 2EQBA 1EXNA 1JZSA 4EW2A 3DLPX 4H6PA 5T64A 3SJAA 4DPMA 3VKVA 5H3CA 5B3JA 3N2EA 2Q9AA 4HF7A 3MTBA 4AD8A 1WO8A 2AOXA 3P27A 1Q7TA 4LOIA 2WM2A 2YXLA 1FYEA 4MW9A 2CLEB 4ENSA 2W2LA 1E0JA 4TT3D 2PXXA 2UXDB 1Q0RA 2DH6A 3OZXA 3PIIA 2VDWA 3SQMA 4Y6GB 5MN6A 1W93A 1A97A 4J0KA 1KQNA 1REQB 1T43A 2HK7A 3S70A 4GZLA 3KBBA 2C58A 3OD1A 5IM5A 2PAAA 3IXMA 1B3RA 5J47A 1Z2NX 4PLHA 2PBLA 3RUIA 1D5WA 3IQHX 3W3AH 2ET6A 4UHDA 5DWQA 3I23A 2GD1O 4G01B 1FMFA 2V96A 2LNDA 4JQSA 3T4EA 1BVRA 2P75A 1FQJA 3EUFA 1X38A 1GA1A 1Q14A 3E9NA 2GZ3A 3NUQA 4MITA 4UBNA 2XGOA 3PIDA 3CUVA 4QWMA 4ZWNA 2BMFA 4R2WA 5C35A 5F5LA 1TEVA 1Q7CA 2J9RA 4E4RA 4G9EA 1E2LA 3N3BC 3EVCA 3T3OA 3REGA 2V7TA 1IXZA 4PG7A 3PF8A 3JRXA 4O1MA 2I6SA 4Z9FA 4B79A 2AG0A 2V59A 4PNEA 1U02A 4J0FA 2P2YA 2VDNB 2X3FA 3PXBA 5FIUA 3T54A 1G8JA 2HHCA 2YNMA 4RD4A 3ZZUA 1QWSA 3E8SA 5CH5A 1XFDA 5JRDS 3O8OB 4GX5A 5JD3A 1FBTA 1FVFA 1H6AA 1R0SA 3D81A 3FRHA 2J31A 3D3WB 3KUKA 3LQRA 4RMHA 3AONB 4C4PA 5I7VA 1A9XB 4ZGGA 4WOBA 4FW8A 5FUYA 1FFDA 3A4NA 3Q3EA 1MJGA 2HC9A 3H2HA 1WUYA 1ZH8A 4AB1A 2R3SA 1ORVA 3ET5A 4CGYA 2X41A 5TJ9A 3DXYA 3MWKA 4DLUA 3R7FA 2GD0A 2NXCA 3GN2A 3KWFA 1X9IA 4LA4A 1CFZA 1WWKA 2WAXA 2X9NA 3RFCA 4R7GA 3NC4A 2HJ9A 4OGLA 2CHGA 2QAGC 3KJFA 2PUFA 2BTEA 1GAJA 4LSWA 2CN1A 4HAXA 3RROA 1D6MA 4RC9A 3AO0B 3IUEA 1KYVA 3D64A 2G88A 4ZO9A 2HM7A 3DWFA 2EG9A 1JEQA 4PBTA 4LHEA 4RL4A 1OYVA 2I6XA 3R5FA 3FKSA 3L7KA 2HDHA 2O1SA 3AKEA 2WIBA 3G6KA 3N39C 3NYQA 4OBBA 4NV3A 3IULA 5MFZA 3ZWBA 2JD0A 1HT1E 3K1YA 3MT0A 3S5JA 1CY8A 1ZG3A 10MHA 2DEUA 3U81A 1KK1A 1L4NA 1DC7A 2FYTA 2JLCA 4H35A 4NVRA 4WY2A 4BNDA 1PZXA 1HQCA 1MV8A 1RYNA 2R1UA 3G02A 2O52A 5LM3A 1SCQA 1ZQ1A 2GZDA 3VTKA 2NUBA 4AO7A 1SVLA 4F9EA 2PBFA 4E15A 2CLDX 2QXTA 4ZOEA 3Q9NA 1RXIA 1Q7GA 1MENA 2BTQA 1KJNA 1WV1A 2FP3A 1WA5A 3QVMA 3NB0A 4CIAA 1XDBA 1B4DA 4JLWA 2MMGA 5F2OA 1TQ6A 1TO6A 1Q0PA 1GRCA 3DMTC 1T6YA 3ESBA 4P3KA 1R0YA 1SUWA 2GPJA 4IGEA 1KAGA 5IBCA 2FEPA 5JT1A 3HCRA 1O95C 2PQMA 1GG5A 1SK9A 3K70D 3O1IC 4RA6B 1VL1A 1DPFA 4TVOA 4BP1A 3UJHA 2CV1A 3E2MA 4GAEA 5I7WA 1L6RA 4GX0A 1ECLA 5F4BA 1ESZA 3GRZA 5EHXA 3C7AA 1E7MA 3DEKA 2VAVA 1OWOA 2A9PA 4HNAB 4XR4A 4XJTA 4JKIA 1F1JA 3S7ZA 4R0MA 3CEAA 3LDFA 2VP3A 4QLOA 1WZNA 1ZVJA 1AIPA 1N5JA 3DUFB 1UIMA 2FZ4A 1KS2A 4UU1A 4DY6A 1QCCA 3OZRA 4X93A 2V6JA 3NASA 3P9RA 4JSRA 4DM3A 3X3HA 2OBLA 4WZAE 2Q46A 4HAZA 1D0VA 1NMSA 1X7WA 2P5UA 2VIIA 2ZSHA 1X39A 2AZMA 2FMFA 3BIWA 5KKCA 4MQBA 5LKAA 3OPYI 3PQCA 4GUDA 4EMSA 2PUHA 4C5AA 5CEJA 1ZN8A 2DHEA 2PGDA 1LVHA 2X0KA 3AH8A 4GO1A 5BYAA 4L85A 4CM6A 1JAZA 2H51A 2WM3A 4WXYB 5I7AA 2QD2A 3SZGA 1KH2A 4WI1A 2Y1WA 1GT91 5K8LA 4ZPXA 3VZRA 3SVTA 5JNLA 2ENWA 3SPXA 4KIWA 1GQRA 2J0SA 1WZCA 3O4IA 3D3KA 3JQDA 3T9EA 3WRYC 3VZSA 1GNQA 4YRTA 1E7RA 1Y9DA 3BULA 1QSGA 4L08A 2FLVA 1GNSA 3QNWA 1C8VB 2W4QA 1WB4A 1ODCA 1RQ7A 2O8NA 3IOBA 1A8IA 4R1PA 1P19A 3P2MA 4OFZA 1Q50A 2H2WA 4DARA 2R6JA 3A7EA 5KQMA 2PBZA 3TPCA 4IIXA 5EE9A 5KSWB 4GC9A 1YVUA 4P0PB 1UQTA 4RKWA 521PA 1NBIA 2PU7A 2FNAA 1G7RA 3DF7A 3HJTA 3TD9A 5B58T 3DULA 3IA2A 2RHBA 4YCSA 1U0NA 1TMOA 2QV0A 1XN4A 4QBFA 5HWSA 3ZD9A 1ZCZA 4R31A 1ZNXA 2QRJA 4ZYXA 3U6KA 2XDWA 2IYRA 4RHCA 4IEIA 3B48A 2FQQA 4B1FA 4DG8A 5G1PA 5CVDA 4W99A 4BRUA 1IIRA 1YJCA 1DEAA 1IJEA 3CW9A 1X42A 3DOHA 1VMDA 1M5TA 2BEVA 3PXDA 4MGIR 2JANA 4EG3A 2XHZA 1GU7A 1I7PA 2QAGB 3BXOA 2IFTA 1QIIA 4Z9BA 4F6LA 3ECCA 3QY0A 1I8TA 3A1DA 2QHXA 1UUFA 1M0WA 2F4VB 4ZAFA 3UO8B 4LQLA 1R9JA 3BMCB 2PT9A 3WOHA 1BE8A 3K72B 4QGFA 4GDFA 3UCEA 3SMVA 1ANKA 1Y5LA 2X0EA 3IR7A 3EIFA 3KQOA 4EY6A 5AJHA 1Q0ZA 4OLBA 2QPTA 4OMUA 5CD9A 1X1EA 2O6LA 1J9GA 2P6MA 3ANLA 1BXKA 1N8NA 2X5XA 1T3HA 5NULA 2RGNA 3SDBA 1CULC 1JKJB 1NF2A 3GJ3A 1U8ZA 2QVBA 3KJEA 3PGVA 2WOOA 4Y9TA 5AK4A 3L8GA 4BQPA 1EIZA 1J33A 4KQIA 4EGSA 3AOEA 5EXSA 3CRW1 3TNDA 3WOVA 5H70A 5ED4A 3PHLA 4F38A 2CC2A 1PKXA 1RCUA 1IZZA 3EIXA 4Y3UA 1ENZA 4YJKA 5IKEA 1D04A 4X1KA 3DMHA 2J7PA 4MEAA 3A4LA 1VJ5A 4KZKA 2YZ7A 3EEBA 3SI7A 1CQIB 1XEXA 4C5BA 3R9XA 1ULUA 1G38A 4M0MA 2B82A 4WZBE 1GADO 1OAOA 2QJWA 1ZK2A 2W2QA 4L8WB 1TQ2A 4QFDA 4QUDA 2XTNA 3U1BA 1KYQA 1R5OA 4HRXA 4IV8A 4P4LA 4RMGA 5EJFA 1H0SA 3SK0A 3PDJA 3EBPA 2QLFA 4PIMA 1EP3B 2SKDA 5DX1A 2PUCA 2CDNA 1JWLA 1UJMA 3F3YA 5EFOA 5K09A 1RKUA 3C6XA 4KOAA 4REQA 2FCRA 2JFVA 4Y2RA 2E4XA 1ISFA 4IJUA 3EGVA 2RGEA 4L4XA 3OF2A 1SHUX 2ZRGA 2FH5B 2W71A 3RRXA 3TNYA 1KYIA 3T5AA 3THOA 4Q7QA 2BT4A 1YNOA 2FEAA 3EZGA 2DWPA 1BEZA 1JPJA 2MSLA 2FG5A 4HAUA 3PWTA 4FBLA 2PD4A 3OLQA 1PWEA 2FRXA 3LKVA 4YJGA 5BNFA 2JZOA 2ZWOA 3JALA 4JJAA 3BHJA 5E3IA 3SVZA 5J3JA 1OGYA 3IKTA 4MX8A 4XB2A 2EJTA 5J2TF 3V55A 1HG0A 2CSUA 1FXSA 1GN8A 2LIVA 4FEAA 1N78A 3C98A 5I5EA 3OO0A 2J3MA 1IBSA 5AI5A 4MVXA 3GCDA 3QU7A 4FOTA 5A5EA 3PHIA 2XE8A 3U62A 3JTEA 4LC0A 4MV5A 4D9NA 4JC5A 4QEDA 4FYJA 4LI0A 1HFWA 2C94A 6REQB 3ZHUA 2RGXA 1UAYA 1NRXA 1TEZA 3ASYA 3LK6A 4LDAA 5F7ZA 5H9WA 3LLSA 1A9TA 2BGLA 5SICE 5L3VA 2GHIA 5IW8A 5DM1A 4DR4B 1CDOA 1XTTA 4BLOA 1P9RA 2Z8XA 3PC4A 4BZXA 2D5LA 4NI5A 1SUBA 4JOBA 5EEGA 3ROXA 2XXAB 3L8ZA 3MF4A 1LF0A 2FV8A 1DJPA 1UBCA 1XWFA 2HF9A 3JQBC 4QOIA 1YRYE 3TJRA 5B1HA 1YIDA 5LJLA 1TCUA 1ZS9A 3C6ZA 5CLLA 2HRZA 3HKEA 4UFPA 1D4OA 1ZJ4A 2J1LA 1EFCA 3OUZA 5D1HA 4X64B 5JAUA 1EX1A 1SVMA 4OSEA 4B4DA 4KEAA 1P0FA 2C8LA 2ZW9A 3LO8A 1DOZA 1DWOA 4QELA 3G9QA 5H3LA 3U4QA 1OT5A 3O31A 3NBAA 4GOKA 2XB4A 4LYAA 4HDCA 2WJHA 3DNMA 4C7VA 2DSNA 4GXTA 4AJLA 4ETMA 3REQA 2W4IA 2NTEA 4R6XA 5CDFA 1TUBB 3NWEA 4KLRA 4Q82A 1THTA 4UD2A 1QQTA 4R98A 3VNAA 4EB0A 4MR9A 3OZIA 1I13A 1S1MA 2WTBA 5EHQA 2JIRA 4LF6B 3S6JA 2BD0A 4ZMRA 1GXSB 2W2KB 3LXRA 2F43B 2ZM5A 5EYPB 2B4TO 1A2OA 3B9QA 2TS1A 4E70A 3GGDA 2ZBVA 4D57A 4DADA 4JWTA 2GETA 5D3QA 5K0JA 4QARA 4EZBA 4ND7A 1T9CA 5CB4A 1PGPA 3JWGA 5AJXA 5DLDA 3EZFA 3I34X 1QK3A 2Z3ZA 3N6VA 4AJPA 3VR3A 4I55F 1LWNA 2VPXA 4RCVA 1NJ2A 2IL1A 3AHDA 3OCZA 4WCFB 4D0SA 1VIDA 1GD1O 2JAWA 4BCDA 5J2UF 3VJMA 1GGEA 4J3JA 3W7VA 1R3DA 3AILA 4W5QA 1CQJA 3TSAA 3UIEA 3N0WA 3B1YA 3HVHA 1QIFA 4IMIB 4U0JA 2VJKA 5D5QA 1GTSA 3EXFB 2IBTA 2YKGA 1VIVA 2IPOA 2VJYA 3VMMA 5KQGA 2L42A 1PL0A 3O0DA 3RREA 4BNUA 4LF4B 1G20A 3NORA 1N9GB 3CE6A 3P0IA 1PS9A 3C8DA 1HG1A 2EL7A 1HBJA 5EAIA 4JLPA 1QLHA 3RUAA 3OQIA 1XHFA 3MRTA 4WECA 3V80A 1JXAA 1MOQA 4YJFA 1NBMA 3FDZB 4G1UC 1BE1A 1XZQA 4QEKA 2ODQA 3DV0B 4UM5A 5L45A 5GVSA 4PYNA 1QVAA 1KFKB 2DPLA 4L7VA 4Z2AA 2H4JA 1O94D 2ID4A 4RGBA 2QOEA 2C7QA 5EZYF 3BJIC 3NRJA 4TYQA 6LDHA 5AVQA 2VA9A 2VJMB 3WWOA 3VU8A 1K6MA 3FUWA 5I7EA 2LVBA 5JRJA 1EGHA 1NDQA 3EMVA 1SXIA 3COPA 3KCNA 3QPUA 4P7BA 3TNFA 3GZNB 2P0YA 5JPIA 4C4YA 1FFXB 1K27A 2EDAA 1YCFA 1XLWA 3EXIB 1FFAA 2ZWAA 3LT1A 2AN5A 1HOTA 3C3EA 2DKFA 3DCIA 1FEZA 2XA9A 4WGFA 3KYCB 2IZ7A 4KLAA 4K9DA 5DGIA 3TINA 1QQBA 2DB3A 2QN7A 3QSYA 1OWPA 1FTQA 1ACLA 3VKUA 4PLYA 4CLHA 3K8YA 3AXSA 4G2NA 5ICEA 2CZCA 1SBCA 1N4DA 1MO3A 1G9TA 3GUZA 3GAMA 3LPNA 2OGWA 3EXG1 3RK1A 3RU9A 3SEQA 3WMRA 5A1TA 5AJVB 2QTNA 1ZUD1 4QL3A 2JGMA 3DO5A 3FETA 3GFQA 3KD3A 3O2SB 5LXTA 3IEMA 4Q4DA 4RTSA 3HVRA 3MGAA 2CDAA 4ZCIA 1P73A 1YUBA 5BWLA 4S05A 1EXDA 3MB5A 5DOZA 2CNDA 2VLIA 4N5MA 1A72A 4RD1A 4TV8A 4AP5A 1P4HA 4PINA 4L4UA 4CF5A 4DLVA 3IELA 1EDZA 3OQPA 2NTNA 2VHWA 4BNKA 2W6JD 4TRRA 4M7OA 3DLHA 1DKQA 4U1RA 3HV2A 2CNOA 4C0SA 1P7CA 1W75A 2YN0A 2I62A 3MMNA 1K06A 2Y4OA 4IRMA 3COWA 2DQKA 1VBNA 1FL9A 4FKBA 2W48A 4UUNA 2WD7B 4XD2A 1U0LA 1L5GB 3QTBA 4RIGA 5CPBA 1GTMA 2FSHA 5KDLA 2YNMC 4IBOA 3JASA 4P8RA 3I6QA 1XTIA 1NQVA 4O4LB 1X7XA 4PHCA 4AZSA 4EAAA 2Z4SA 2GPYA 3CG0A 4P36A 1ZOOA 3DBRB 2XRFA 3MLAA 3PQ2A 2JH3A 3DW1X 5K51A 3GY0A 3RHFA 2IXAA 3V48A 2QYSA 2F9LA 1XD2A 5GJBA 2YWXA 3CPJB 4I0WB 4ND1A 2IPXA 2FR0A 3EAFA 1YQDA 4IIJB 1ZLYA 5FI0B 3BWEA 3HGQA 3L7DA 1P2SA 5D5HA 5EJ2A 1CUGA 5LQRA 1O6CA 3GFGA 5AI6A 4ENWA 1KY2A 3ZY3A 1IXRC 2O23A 4YAWA 2A0WA 2NUTA 2H2HA 2XECA 5JNUA 3P96A 2EJUA 2XV1A 3PL1A 4NY1A 3IODA 4BE7B 1LBSA 1Z5GA 4IGFA 5K8JB 2BJHA 4MA4A 1U8FO 4MQMA 5AXAA 4ETIA 4B3TB 3SICE 2HA2A 2YV2A 5FOXA 4DPLA 4HLDA 4EQZA 3N0RA 3GZTB 2X15A 1RE0A 3A05A 3LZ6A 1DNPA 3EUAA 3H1TA 3OKPA 4YRBA 1JBEA 1LPNA 1DCKA 1ZBDA 3HB5X 1C3VA 3WLLA 1JU4A 4Q7EA 3UANA 1P8JA 4L8YA 2GZHA 4FYKA 1II9A 3ND5A 2AWNA 2IYAA 4FT2A 3SYKA 1KC1A 3LDHA 1EG2A 3B6JA 2AR0A 3DVRX 3PR1A 2Q3BA 2YQZA 2O5EA 2VJNA 4UE2A 3NV7A 1JEEA 2DUNA 1E5TA 4CMHA 2GAAA 3G1TA 4F3CA 3A3NA 1KDVA 1KI1A 4Y1GA 3M89A 2Q4EA 1WXQA 1ZJ6A 4R9VA 1BYIA 1JEDA 2QTHA 1V41E 2I8LA 1YR6A 1KDYA 1BMFD 3IP3A 3PPIA 4JNKA 1C41A 1C4XA 4UFNA 4RTJA 3LXMA 1QAQA 1P1RA 5NLLA 3FRIA 5JXGA 2PSSA 4B3BA 2WSSA 1UPXA 3LDGA 4PRZA 4L78A 1WPGA 1RI5A 1J0AA 3WL3A 3AR3A 3HU3A 3B36A 4DCVA 2VQSA 3SLRA 1YVEI 2HQRA 2ZI6A 1YS1X 2FEWB 4REOA 4K6CA 2OC4A 2EW2A 4JYPA 3V2HA 3FPSA 3KT0A 1XAIA 1QP0A 4OOFA 4D97A 4D4GA 1RWMA 5A62A 3ND8A 3GOHA 3SXUB 3D02A 1RAIA 2AB0A 1T91A 4PYOA 2B2CA 2X40A 2DULA 1ACMA 3IT2A 1MFPA 4URWR 4TROA 4EDHA 2JHPA 4E5KA 4DYHA 1ZXLA 2HXGA 3PUWA 3C74A 4HJXA 3JAKB 1N5KA 3DH0A 3ZVLA 3W77A 3HP7A 2AEEA 3C3CA 5FA6A 1VE1A 5L3RA 2O7QA 2W6CX 3S29A 4KOEC 3RS9A 4C7BA 4RDIA 3SBDA 2DJ5A 4HAVA 4UVGA 1YU9A 4CU5A 1E77A 4BNVA 2PJRA 5ICMA 3FD8A 4TZ0A 1NJ8A 3OCVA 5KJ6A 1ULHA 1TYDE 4MI6A 3RSCA 3AERA 3GT0A 1XP5A 2XYPA 1MW8X 5A4JA 2IP4A 1ZGJA 4Z4IA 1ZM2A 5ABPA 4RTPA 1J56A 1J8MF 1JLSA 4XUDA 4IO0A 1N2SA 1YHNA 2OZVA 2ZE5A 4CEHA 4MI1A 1ZN2A 4CNBA 2E5WA 3GUUA 4A0HA 3IYLW 1QGUA 1PQWA 3DJYA 1EE9A 3ADKA 3RYCA 2GBFA 1MJFA 2PZBA 3KSDO 2QYHA 4H6VA 4WXHA 5HILA 1ISIA 1Y5MA 1NQUA 1C9NA 3AXTA 4JODA 2P8SA 4J4BA 1HXHA 5KYYA 1Y6JA 1OSNA 2EL9A 3DZCA 3DONA 3ND7A 4DWOA 3W4IA 1I4WA 1UBEA 1LNSA 2HUPA 3S5UA 3ZU3A 1FZQA 2VYNA 4LMBA 2JLAA 4LV8B 3HB1A 1Y3BE 1WU7A 4ENRA 2DR2A 1U1EA 3K96A 3JR7A 4HVCA 1SG9A 3QY9A 4EJSC 2NU9A 2PKRA 2IYPA 1DB3A 3NGMA 3QYAA 2WYOA 3IV7A 4J6EA 5DTQA 2A94A 2FK7A 3RG2A 1P91A 5AVZA 3C5CA 4GR4A 4FI3F 4PX9A 2PR7A 4Q9JA 4BNZA 4LJ7A 2EQ5A 4RFVA 5EJ8A 3T9FA 1I1OA 3R3XA 3T6KA 2OV3A 2YFKA 1PQUA 1ZRNA 2PRYA 3DL2A 4W7HA 5ADVA 4QTTB 3HFSA 1I2DA 1GY8A 5LA6A 3ULKA 4NDAA 4G89A 1HLDA 3CWQA 4X60A 3CVWA 4TLDA 1JQDA 4IOLA 4L0QA 1TFUA 3LKBA 4P86A 4WMLA 2REOA 4RY0A 4XJXA 5KYUA 1GL7A 5EVCA 4B8WA 1P7WA 2AVNA 1MT3A 2YVAA 1ZR4A 1IVYA 4DDTA 1DKOA 3OTGA 1EJ6A 3E4CA 1N0UA 2Q3JA 2YXEA 3Q2OA 2GK7A 2OHJA 3M0EA 4HQ6A 4D0GA 4QDZA 3KFLA 4K9LA 2JJ8A 5DHQA 1SKQA 4XQ9A 3NZEA 3TW8A 2BM9A 3VNUA 4BCBA 2YVUA 4JLUA 4DABA 2JC3A 5H4HA 4ZZ3A 1G8SA 2ZAGA 3KVNA 3FPHA 3PJDA 1DQPA 4KNVA 4QXPA 3X1ZA 5AW7A 3CT4A 4J1TC 5AVKA 2J09A 1KFJB 4N8EA 3ZUGA 4DUPA 3F71A 2OO5C 5CYOA 3TRDA 2BMDA 4OGGA 2VUHB 1WSAA 1ORDA 1DTWA 5HM8A 3C1AA 1AZLA 3F8SA 3KQSA 1WDKA 2ZSJA 4Y8VA 3VC2A 2HA6A 1L4FA 1SPBS 3OOEA 4G0ZA 3TOCA 4RHUA 4X6YA 3WGQA 3FLEA 4DM4A 1Y7LA 1Z0IA 3MBIA 2HBQA 1H2EA 4LXTA 3KBOA 2H8GA 2Z6QA 1VKZA 1N57A 2LE0A 4RPKA 4F93B 5ISMA 2Q2NA 4MS1A 3GLKA 1J06A 1YZGA 2XYQA 1JNYA 2FUG1 3E53A 2E5LB 4DMGA 3Q11A 4L9RA 1USIA 2ATIA 1NXPA 1KAQA 4PHHA 2GCOA 4Z4CA 2CV2A 2I66A 3BCRA 2CJWB 4FT4A 4BJ6A 3ZD7A 4L5BA 5D3ZA 4DLPA 4RLQA 2Z8YA 1YZKA 4UZFA 5EP1A 3V8RA 2WWHA 5HR5A 1VLMA 1VKHA 4A7PA 2V45A 5FWDA 3UUGA 2QJRA 5EIWA 1K6JA 1TECE 2J7PD 2FOIA 4G8JA 1FUUA 2PX5A 4C08A 1LY1A 3BMXA 1KVTA 1E99A 4OMDA 4OXNA 4Q3CA 4XGQA 2WMNB 3R9IA 4LHZA 1XPJA 4E5NA 2XB6A 4FMDB 4OYHA 3MCTA 3W78A 1G55A 1T9HA 1N92A 4YA6A 1EQUA 5GM1A 3WY9A 2PJUA 4DLZA 3SHVA 1VHJA 1PR3A 1HA3A 1PUXA 3JS5A 4FB5A 4IKPA 4M87A 1BG6A 3U3MA 1Q0QA 3NHBA 3A1NA 4JLMA 5CXSA 5AR1A 3MGKA 3N05A 4K6GA 4EW6A 1Y8RA 4JLVA 4HWRA 3HG7A 1MGPA 3OFKA 2PWBA 1W94A 4I1SA 4RHFA 2LCQA 2G5PA 3WZMA 3BWYA 4H2DA 1RQRA 4FFBB 5I8WA 4HV4A 2EKQA 5JCJA 4A2QA 3M83A 4D9BA 4KLZA 2C1EA 2NU6B 5A03A 1LS6A 3EUWA 3OIUA 1WCV1 3ZU5A 1FS4A 1UWKA 3D8RA 4ZXPA 4MKGA 3QKSB 1M66A 2VF4X 4ZAXA 2Q1UA 4YLYA 1HNXB 1L1RA 1ZMOA 3TI9A 2MYNA 1K08A 2NVUA 3EIWA 1IM5A 3MK31 4KXYA 4O0LA 1ISPA 1D5CA 1T24A 4TTRA 5GONF 4YRZA 2PUWA 4HVLA 2M6KA 4EB6A 1QRUA 2BRUA 3GJQA 3LK7A 4BO3A 3D6FA 3G2MA 1NTOA 4X85A 2OE2A 4EJSB 5KWJA 5G4KA 2X1LA 3BXZA 1CR6A 1KDTA 1S89A 2OCXA 4U9HS 5AW1A 1XAHA 2O1XA 4D9KA 1XZKA 3RAEC 1U0OC 1FDWA 2UZ3A 1JFSA 3G85A 2IXBA 3BFKA 4ZGWA 3UC9A 3BM5A 1GKIA 3MW8A 2VPYA 4A16A 3HXLA 4MQLA 2Q7OE 4W8HA 5DZSA 3UYKA 1Z0FA 4BKPA 4B3MB 3WBKA 2EWWA 5IG2A 1VLHA 4UTOA 4C03A 3HVKA 4WTOA 4UTXA 3V7WA 4DN6A 5BP7A 3IUQA 1R6AA 1HT3A 1FK8A 2CL5A 2DP4E 3A4MA 1JXOA 1OBCA 2AA3A 1NR5A 3TB4A 4QYWA 4O4IA 4FC6A 2IZ5A 2JFUA 1C2TA 1U63A 4PNZA 3H84A 1XD9A 1XTSA 4GI5A 1IK6A 2Q3LA 4EO4A 2XUPA 4O4JF 2Q9BA 4C43A 5JARA 4Z4EA 1TQHA 3CSDA 2GN4A 4YACA 1G98A 4RLSA 1RRVA 4ZHQA 2FPUA 4IICA 1EVZA 1E3SA 2HIHA 2I2WA 3BZBA 4FBGA 7YASA 1G5FA 2R1TA 3PUJA 5FTNA 5F23A 2VJPA 5JQGF 3JQEA 4MDHA 1NJ6A 4H7FA 1KPHA 3S44A 4EI9A 1D2MA 1YUNA 4JR1A 2R47A 2PZ8A 3SNHA 3AG6A 2VTVA 5AW2A 4X1KB 2VOJA 3OPMA 5KYKA 3WGJA 1J0DA 1R37A 3R9XB 4NOLA 2PXAA 3Q0TA 1TUGA 1V2HE 2D1SA 1AMNA 1Q20A 1OROA 2PUGA 2FGJA 2QI9F 4UM8B 2V6BA 4BJ5A 1FFWA 4LXGA 3V7NA 3WBJA 5D6OA 3JYQA 4KQ6A 3VAZA 3A1EA 4BXOA 1GRNA 2MR5A 1PW5A 1MR3F 4L57A 3NIDB 2O2HA 1UM8A 4REQB 1EWVA 1JB1A 2H63A 3GJ6A 1NC3A 1UOOA 5ERYA 1X1TA 4YRGA 3WA7A 2FX2A 2ZYVX 4AMUA 4CT5A 4E22A 5F77A 3HYLA 2W93A 1ZVMA 1FUYB 2G0NA 2J5KA 2OCDA 2B2XA 5GP1A 4CM7A 5CFOA 1KOJA 4X1YB 5B2EA 2HSGA 1FP4A 2JLSA 3EIHA 3GF4A 4F11A 3A04A 5JJIA 3JU3A 4YJGB 2H4XA 1G3RA 2WBLC 4JIMA 3TOZA 3CKKA 1SCIA 1RQGA 1YZLA 1SMKA 3DE2X 5C81A 4BQQA 1GPUA 2O5VA 5JW6A 1TLTA 1Z15A 1ML4A 2G9UA 2PD3A 5HKAA 3LSTA 3QITA 4CR7A 2GTPA 1ZD3A 1UFVA 3F8WA 3TVDA 1P81A 3ONEA 1R4AA 1RC8A 2PVCA 3NFYA 1DI0A 1Z0UA 3WR5A 5CVTA 3LMKA 2BDEA 1Z0SA 4ZOAA 5GM2A 2WHEA 3OZBA 1ZVVA 4RLHA 1QZXA 2LKCA 1I6WA 1OE0A 5G0UA 3Q8KA 1V8BA 2WJ4A 1WSWA 3FAZA 4GZMA 2I1QA 5BR7A 3A1VA 4AKHA 4IRXA 1N8KA 1YIOA 4N7MA 4IJWA 4D7AA 5JECA 4U3JA 4CL0A 1FC0A 2Y66A 4LYJA 2R5NA 4BS9A 2WNSA 1UOQA 3NR2A 5H16A 2PBRA 2FVYA 1ZA2A 4FD3A 2GBIA 3B1ZA 3T3NA 4XUEA 1NQWA 4JJ8A 1H23A 5B4VA 1FNBA 3DE1X 1M1YB 1T5SA 2CFRA 1HDRA 4MULA 4XM2A 3WV5A 1KYYA 2YV4A 3T94A 4ZN6A 1ZHHA 3M4ZA 3FR7A 1RI2A 1A4IA 1A8HA 3HKEB 1KQFA 1IOZA 1QIKA 5TQ0A 4KQKA 3H8VA 1G8AA 3UB3A 3DSRA 3NU1A 4QOSA 4M1YA 2KI5A 1XPOA 3GDOA 5JI2E 2R6DA 4P81A 4QXAA 4NBNA 2J32A 4QECA 4I1OA 2JF0A 1DRKA 2IWRA 5GWXA 3U9TA 2HXYA 4LIPD 2X9QA 4PFSA 4JBHA 3UK0A 4MR9B 3G49A 3ZKWA 4JP3A 2O0MA 3UXYA 1J8FA 4HMPA 3NC1C 3KYDA 4QDXA 4K03A 5L51A 4PPNA 4RETA 2ZTVA 2HCRA 1S2GA 5B4UA 3GEEA 2B8EA 1VG8A 1NBOA 1II8A 2NT3A 3KZXA 3NWPA 3PFIA 4I7EA 4YRLA 1E6UA 1QYCA 4IWNA 5EWMA 4ASUD 4M7RA 3O4FA 1IZ0A 3QWIA 4BO1A 2P90A 5KTTA 4KYIB 4BWFB 3FKQA 4LK2A 1COWA 5CB4B 4K9KA 3E7WA 1Q0LA 2GZRA 4QXMA 1L1EA 3I1JA 4TXMA 3G1WA 4WLOA 5IVHA 1G42A 1UMDA 3U26A 2VLBA 5JD4A 3A6HA 3Q8LA 2M32A 4RAOA 1JWBB 3TFWA 1EK5A 4KTTE 1ONPA 4C2TA 2GDJA 1YL7A 2HY7A 1CS0A 1QANA 1AO3A 1I7SB 4WAUA 1K7SN 4DS3A 3M4XA 4KX3A 1Z4NA 4H7HA 4LHVA 5FJIA 4S04A 3OFND 5K3AA 4JBWA 1MC4A 1ODKA 4Q1AA 3LYHA 3ZTYA 4B3RB 3D6VA 3AI1A 1C3LA 3MCVA 3QXSA 3QJGA 4XQGA 4F1WA 2J3QA 2OXFA 1O57A 5HF8A 1G20B 5CA1B 4H1TA 4GBMA 4RS4A 3ZW8A 1Y9ZA 2E9SA 3GH1A 4OXQA 3G23A 1NNLA 1ZNQO 2ZBQA 3OQIB 1MDFA 3EC1A 4GKAA 4YAGA 4QGHA 4FYXA 3UG7A 2AW5A 1OFTA 2YHAA 3YASA 5I6DA 4QBIA 5EG5A 1JFVA 1ZRMA 1I0IA 1VHTA 1MAVA 5E4YA 2MSWA 3UGQA 5KCZA 1XEAA 3HCOA 1TQ4A 4MWEA 5BN3B 5LQMA 2VHVA 2VYFA 2QX9A 2ALJA 4ZC8A 3EVBA 4N54A 5H9VA 5CT8A 1A9ZA 1LVGA 1XZDA 3IAM6 3FZGA 3LBFA 3PEVA 2IHJA 4MWOA 3RFTA 3JVUA 3RBZA 1T5DX 4ILKA 4OBWA 3CZMA 4MW2A 1IMOA 4H0CA 3G8BA 1J2JA 3L43A 5DTRA 4OJQA 3FGNA 1NN5A 4GMHA 1CUDA 4I6GA 2JGRA 3UMSA 4BFYA 2P2GA 3OLVA 3QK7A 4U6QA 1TYCA 1SQGA 3Q7EA 1HNWB 2O19A 4DM7A 5TMEA 4C1BA 1CJBA 1F38A 4LQDA 3FTPA 5IDWA 1RPZA 2HHJA 3LY8A 4QT4A 2WKRA 2W37A 5BV7A 2WSSD 4AROA 4UEJA 3NHJA 4TLMB 4HO1X 3VNRA 5T3UA 4M21A 3ILHA 3CH7A 4ZO7A 4A26A 3TCXB 1QXSA 3ROEA 2W11A 4NEHB 4C0QC 1N5IA 3F74A 2BEUA 2YN4A 1V11B 2QAJA 4Q48A 4G1FA 4TV8B 5D84A 4QKQA 3UT5A 3TG8A 3MNFA 5AK6A 4LOAA 2O8FA 4M76B 1VJRA 3QBTA 3IPXA 4GHWA 1PWHA 4JOCA 1IUKA 1K5HA 4TTPA 1EFRD 4W1SA 4JI1B 5IXYA 2YWCA 4DT1A 3TIIA 3ADCA 1IEQA 1TUIA 4F4CA 2JFPA 4B6EA 1G66A 3DFKA 3C1OA 4B2IA 2ZETA 3KUCA 2JLRA 4N6OA 3V3TA 2E85A 2ZE8A 4F91B 3IOYA 1E0DA 1H9CA 2AI3A 1KNQA 3L7BA 1NY6A 3PX3A 1KK2A 2CL7X 3D5EA 2CDRA 2JIZD 5AWFC 6GPBA 3B6ZA 5D01A 2OD9A 1I30A 2H6EA 1C0KA 3CCFA 3IUNA 3JASB 1G8MA 3OWXA 4FZJA 1KEUA 4EMUA 1X7XB 1YZUA 2NXNA 2YRFA 2RIRA 4JL5A 1QIEA 4R2XA 1YR1A 2I54A 5FI5A 4DDMA 2XWBF 4ZA2A 1DC5A 1EEXB 1UPUA 1LRJA 1DARA 3F5MA 4GOXA 1DRUA 4ZI7B 1IN5A 5A5DA 5KAMA 4R1TA 2DTDA 1AQNA 1VL5A 3C15C 1CNFA 3CUUA 2G77B 3HCCA 2MSNA 4CTMA 4U2KA 4Z7JA 3KXIA 4BYGA 1A7UA 3DEHA 1AS0A 1J0EA 2J07A 2WNHA 2Z04A 4L51A 3EVEA 2QRKA 3SVLA 2BEKA 2OYSA 1W6RA 3RYIA 2BR3A 4K2HA 3FAKA 4RESA 4PZDA 2CYAA 1WEKA 3HDQA 5JSYA 1XF9A 3S28A 1CP2A 2ZRJA 1A5ZA 3DD5A 5KAPA 3AUFA 4QU8A 1E63A 4BGVA 1OB2A 4RIEA 1K9VF 1Z73A 5EWLA 4MV8A 4TMTA 3GPIA 2I8AA 3BTUA 1P39A 5JEEA 1QR6A 1ARZA 4D79A 1DJLA 1FDSA 4MQ6A 3TX2A 1IEXA 3UWSA 1C9EA 4KGVA 1D2EA 5IZCC 3L8CA 1RTTA 4YRFA 3NAGA 2E4AA 3BEDA 4HUTA 3DC2A 3IR5A 1H2AS 4OK5A 5JXJA 5DM70 1JKMA 1KMCA 3EDMA 1K8XB 2B35A 4ZTBA 3JX9A 3K4QA 3B38A 3GX1A 1TKAA 4W6ZA 5ECWA 2FMUA 2JJQA 4G5GA 1RE1A 1QG2A 4IHJF 4D8YA 1P1CA 3A6PC 5TT1A 2L17A 3F78A 1MB2A 1H69A 2DBVO 4LWQA 2ACKA 3M5CA 4PV7A 1YJ5A 4UEKA 5ALGA 1T8WA 1U8YA 2A1IA 3GNSA 2IQIA 5F1OA 4CIDA 4RVDA 1JYFA 1J2YA 5KYXB 5E0OA 1E2IA 2FFHA 1NL3A 3MMSA 2Q7XA 1IL0A 2PGJA 3Q1KA 4INJA 3WAKA 1PDVA 4HQKA 4GI2A 3RVBA 2OBFA 3LCVB 3KQKA 1UL1X 4KQJA 4LK3A 2LR0A 5JSHA 1JR3E 1IN6A 2XW6A 4D41A 5L4LA 4MVWA 2JA1A 4ZTZB 3CKMA 4LBVA 1R6TA 4IJQA 3P9KA 2V3VA 1JIKA 4W5OA 1M5RA 4ZAGA 4E0BA 3HK2A 1KJYA 1D8AA 2UVDA 1JQ3A 5IC4A 2IOYA 1ONNA 4HDAA 4X7PA 5EMKA 2EGHA 2WY2D 4DLKA 3AF6A 1T2NA 1E5DA 2NW6A 4HS9A 1QMPA 2ZPUA 4YRRA 3DZGA 3WBBA 4RE6A 2P4HX 3DMGA 1WKBA 2VXBA 1QC5B 2A58A 3GJXC 4P3PA 1USVA 2G5GX 2BJWA 3KQLA 2FW0A 2BZ0A 4MJLA 3PC8A 1J0CA 3NMUF 1WUKS 2ECFA 4BJHB 1O3YA 2P9BA 2N47A 7GPBA 4ZYLA 4XGNA 5KSOA 3DCYA 2X6QA 3F47A 4OL9A 2L82A 3PDIA 1UKCA 4DLSA 4KITB 2QRZA 1RI3A 2XB9A 4G4SP 2RHOA 3FWKA 2P8JA 3M82A 2JJ1A 5F33A 1NT4A 1KDZA 1B43A 3HLKA 3MS7A 4KIUA 3OZDA 2ZJ6A 3QPDA 2MSDB 2ZAOA 3AERB 3RVJA 3E61A 1CUHA 5HIJA 1ZUNA 1O9BA 3BD6A 3C5HA 6PFKA 1FP1D 1KEVA 2A30A 2QTLA 1R9NA 4RTKA 1K5GA 2QX4A 2IP1A 1KJJA 3OP4A 2JBWA 4OBXA 1YR9A 3CO5A 2ZUSA 1DE0A 2QXUA 5G2OA 1C8LA 3A1UA 5TRTA 3BJZA 3FZEA 3BJEA 3VH2A 1PDOA 3HY3A 4TMZA 4CTNA 1EYZA 4YO8A 3GHYA 3MTJA 4UBLA 3SKXA 2FDRA 4YJ3A 1LC0A 1PT6A 3KLBA 3Q88A 4PQFA 4NCAA 1ZGGA 1JQAA 4LFCB 4MS3B 5LYYA 2H48A 3MGCA 3TTSA 3NNSA 3SSOA 1M54A 3R7WB 2Q4RA 4B76A 4C2BA 1OKKA 4E7OA 3IAAA 1JA9A 1AURA 4PG5A 1ZH2A 2IV2X 3D4IA 3RT7A 4ZI5A 4O8ZA 2V4MA 4ROTA 1DWPA 3A4TA 3TRFA 4WPGA 4KWEA 3W2GA 4MVJI 1M7GA 4CKBB 4ECEA 2JLXA 4E2WA 5IWAB 4L3OA 3VJLA 3MWJA 4UJ3A 3R9WA 5EXEA 1JR3D 3I76A 3WYBA 2Q9CA 5JCJD 3G6WA 2ZG6A 5C1DA 3GJ5A 4QASA 2G36A 2PH5A 1SEVA 1X9HA 2PGIA 3CO0S 2Z5FA 3HJGA 1F6DA 2HCTA 4OGKA 3IEPA 1G60A 3NBZC 1E9RA 2J9ZB 4L5CA 4ARSA 1Z8FA 4PF1A 3MWLA 3CR3C 5IKOA 3F90A 2FHSA 3OFSA 2BFWA 1ISMA 5DM60 4EL5A 2QORA 2DYKA 1DWQA 4J6FA 1O0CA 2YUIA 3TXAA 3FI9A 3I8SA 1BKSB 3HB4X 1XVIA 3JSAA 4U0KA 3T0FA 3V4SA 3EOAI 4KVAA 2XAAA 3LS2A 4D82A 3F6PA 4MTLA 1UXHA 4C4ZA 1GCIA 1QH1A 3TW8B 2CE7A 3BPSA 4K9NA 5DYIA 5AK0A 2RGAA 4R0NA 1L7BA 3HXTA 3GPBA 1F2TA 1XFAA 1TAGA 2N46A 2ZI7A 3QPVA 2HSZA 4BE9A 2X0FA 3G5MA 1QHIA 1PYOA 2UYHA 2QP9X 1YZ3A 3UJ3X 4L50A 5DWVA 3HR8A 3PRYA 1ZI9A 3HKBA 3F9IA 3TH5A 4RELA 4HXEB 1LD3A 1P1KA 1VPVA 5DHPA 4CQJA 1PV1A 3CXUA 4KN5A 4MUKA 4EGFA 4F5ZA 1MO5A 2BFFA 2D2FA 4I9HA 1JIVA 1Y4AE 3RSGA 3R7AA 1SELA 1QHHB 3UWDA 3BSFA 3RBXA 3QTLA 4G25A 5TXGA 2WHPB 2AIRA 4ANFA 1CPYA 1OBVA 2GN0A 1JR4A 3PNKA 1C7RA 3DBVO 2DU8A 5KHAA 1QHFA 1FDRA 1J25A 1E4EB 2E4YA 4IHKA 4U7GA 5DBGA 3ABOB 1Y6GA 2UXBB 3CGGA 5EKUA 4MJXA 2GCOB 2Q4TA 3A4VA 3STHA 4BGDA 5A6VA 4AY6A 4H3SA 4Q4HB 3KOYA 1ISHA 1UEXC 4PSAA 5D00A 1HE3A 1V45E 2Q5LA 3IHLA 1DSSG 1U2RA 3C4JA 5HTKA 1V7CA 4UPVA 1FX0B 1N6KA 3D6NB 1GL3A 1OU0A 1CRWG 5CXXA 4G0MA 1IHYA 2ZVQX 3E58A 1I24A 3P9PA 1WUIS 4RPGA 3D8NA 3TB6A 5KTSA 4ZV9A 2UUAB 2OBNA 2VF5X 3L6RA 2XZDA 1COZA 4BKMA 4LXUA 5F78A 4BDTA 1Y48E 2AV6A 1E2DA 2KSQA 4UCXA 1P7VA 3GZ4A 3N5CA 4TM7A 5IJ0A 2BGJA 3CQ9A 2O2YA 3FVVA 2BW0A 2CD7A 3WLHA 4CE6A 4KR2A 2IPLA 4KG7A 1X1BA 1DAKA 2WG2A 1RDFA 3LC2O 3OEWA 2N1MA 2PK3A 1XQWA 3VR5A 3ONDA 4PG4A 1EFKA 3AW9A 5DNAA 3ZE2B 3ZWVA 4DLNA 4UNSA 4V1CA 5JFGA 1FTSA 2CVPA 1Y8RB 1TZJA 3IAUA 1NP3A 2O7NA 4V0RA 3DTNA 4C0AC 2NVBA 1QH9A 2ST1A 2VHYA 5IK2A 2MTBA 1XDWA 3B52X 3PEEA 5F73A 3KXLA 4FCVA 1VL6A 4RTMA 5MGNA 1YZYA 3FJYA 3SIXA 5LP6A 3DXZA 3SIRA 3LA8A 3Q6NA 1B8UA 1OI2A 3IPYA 1RMQA 2QMZA 2XUIA 4OEHA 4PAWA 1QKKA 4OHXA 3RO7A 3R74A 1IQRA 4B6RA 4LKRA 3QEKA 4MCIA 1XNHA 5CDTA 4HATA 1ZGAA 3VTFA 1N8TA 2J3DA 3LM8A 3FPGA 3PFFA 4AT1A 1TCAA 4MWSA 4CV3A 2LBPA 1VJCA 1NBWB 1BVYF 1MB4A 2Q1TA 3HPQA 3LBAA 2C84A 2H54A 1T36A 1CUWA 2W43A 4K9OA 4F8YA 3MJVA 1PG5A 3CWCA 3ZJVA 2GYVA 5TVGA 1FTWA 2XIQA 3M33A 1UBHS 3U4MA 1Z88A 4I6EA 2C9OA 3PI6A 3NDJA 4S24A 1D07A 5P8WA 1NX9A 3A6JA 3Q9SA 2QQEA 4G8CA 4F3TA 4N3GA 3ADBA 2I1VB 1CXZA 1L8AA 2OQRA 3CJRA 3ZJTA 1C3EA 2YFHA 3VHRA 4AAYA 2BF4A 4UW9A 3HMKA 1WXGA 1D1QA 5AXDA 2BUCA 4L6IA 4TZTA 3U5ZB 3IILA 4RZXA 3N1UA 1A27A 5BN4A 1P3Y1 4PYLA 1AN0A 1QF7A 3QOXA 4D9IA 1X7YA 2VDUE 3OQ1A 2J33A 2P91A 3BIFA 4GUAA 3W9SA 1HDYA 1TF5A 4EZIA 3HXMA 1EHIA 1F8GA 2ZRLA 1KZ7B 4P4SA 5LQKA 4ITUA 5GGYA 2ISQA 2GILA 1DIAA 4DJJA 4PNPA 1DC6A 4MV3A 4YRMA 1ABBA 3I8XA 1EVQA 2KJQA 4H7DA 3SQOA 5EXXA 4YXWD 5AW0A 3DKIA 4DR6B 3M8KA 1DLIA 3ZY4A 1BX1A 1THGA 4X84A 1H5UA 1E0AA 1XQVA 2BSXA 3O83A 1S3SA 1JPVA 3AJAA 2R1TB 3QKRB 4HX5A 2JFOA 4EKGA 1QGZA 4HADA 1CK4A 1EP2B 1VJDA 2EJVA 4NC9A 4HYYA 1SHJA 2Y2VA 3PYMA 4K0RA 3ZDBA 4JI6B 2O9JA 4ADSG 3U7FB 2V7QA 3ETGA 2QT0A 3A28A 3IQXA 3EA5A 2HRQA 3NS7A 1VHQA 3DL0A 3OA2A 2B0JA 2AG5A 2ZBPA 1U2GC 4AY5A 4DJDC 2LUOA 4US2R 2PQ0A 3CLTD 3ELWA 4K9RA 1CQXA 1KMHA 3VC1A 4BQOA 1COWD 4CFYA 3FYCA 2VNKA 3SX4A 3VZDA 4BPBA 3Q7SA 4G5SA 4IIFA 3T0GA 4KZPA 4ZU1X 4PHGA 2C2YA 4BXOB 5BRJA 4OHBA 5DGHA 2HU7A 1EPUA 4MWZA 2C31A 4CW7A 1JG4A 5ALQA 2IYEA 4QVKA 3AEZA 4ND4A 1U6JA 3JQAA 1JALA 2EFEB 1E9DA 2CMDA 4GWGA 3AB7A 5LQUA 1DAMA 4DLTA 2QR3A 2Q5CA 4DA9A 4ZRDA 5FL7D 4YCAA 4Y2QA 4C3OB 4YPVA 3DF9A 1PS8A 1ICEA 4ZICA 2WF7A 4ODIA 1L4MA 5FB3A 4BVHA 1JQJC 4LV5B 1IJKA 4O4LF 2W83A 2MIIA 3QFCA 2WF6A 1UP4A 3HVUA 3NUZA 4UNQA 1RYFA 1XRLA 2XD4A 3CURA 3GBPA 5B4TA 9GPBA 1EINA 3B5JA 1JJIA 2RH5A 2C9MA 3HP1A 3WSWA 1BH6A 1OXBB 2PHZA 2WTEA 3R0VA 2QD3A 3WNCA 1GQQA 4H08A 4IIJF 1R10A 5DXFA 5U1PA 5JD5A 3GJZA 5A06A 3PE3A 4G41A 1QOQB 5AKEA 1TT7A 3RSOA 3TTTA 1IBCA 1B23P 4GRDA 1SUCA 3RG8A 3OZGA 4X91A 4KR6A 3OT4A 1LV8A 1B2LA 5HKKA 1U2DA 3V2GA 1QCZA 1PX2A 1JG7A 4FFDA 3RF6A 2Y0DA 4J7AA 5ALLA 1F6WA 1XMSA 1KDOA 5DFAA 4B4KA 3BRCA 2Q6TA 4R8RA 4PN3A 2OXEA 5GMOA 3HBAA 3MTGA 2G06A 3TTWA 4CTOA 3IXLA 5DSXA 1L2TA 1YRBA 5TEWA 4D9GA 1RSZA 1P7YA 2YQ5A 1K6IA 1E8NA 1U3UA 2R6GA 3LUDA 4ZCQA 5KVSA 4RVGA 1FP7A 1UH5A 1LBIA 3EY4A 4M0FA 5TQ0B 3RJZA 3DKRA 1YBAA 4MYRA 3RC9A 3U2QA 4IFBA 3ORQA 1CF4A 1U7UA 2ENUA 1UIRA 5HF9A 1QE3A 3STVA 4RFSA 2CXRA 4FNOA 2PA0A 2WWTA 1YULA 1PZFA 5KSYA 1E2UA 5ADUS 3F4KA 3R6TA 2XQVA 3V97A 2KB0A 3CF2A 4M1KA 2H7CA 4G4IA 1A2KC 4NXMB 1GVHA 1DFIA 4BX8A 4ZQHA 1ATZA 4POOA 3ZKWB 3V2UA 4PZEA 4N5NA 3KYDB 2V9CA 2VSQA 1EAYA 4EBFA 4EF4A 3TECE 2R4UA 3BILA 1IY9A 2PEZA 1H2YA 3CZAA 3SG0A 4YRIA 1T4CB 2YICA 3BMQB 4IIHA 3B7WA 1VOTA 3IP9A 3LQKA 4J0QA 5EWMB 4D96A 1P7ZA 1O96A 3H2ZA 2ZGVA 1BD4A 1MLDA 3OZ7A 4CI0B 3OEED 2OILA 5FPSA 1UDAA 2RK4A 1N0WA 4MIEA 5CT5A 4P3NA 1A5SB 1D9XA 5T4FA 3I1FA 5AOAA 3BXEA 4KV9A 3BCHA 4ALNA 4EEXA 3KJHA 3CX7A 3KX2A 3GLVA 3HJFA 1N2HA 3E5HA 4TOIA 1K0FA 3E4DA 2X7JA 3OA0A 3L0SA 3PI7A 4GBJA 4LNUA 4DLRA 3DTVA 5B2FA 3KQWA 1MIOB 1QPGA 1LK7A 4O4HB 4CCYB 3AL0C 4CM8A 1DKPA 2NV2B 2XOXA 2YVLA 4G5RA 2GR9A 2IYWA 3WGVA 4FKZA 2ECOA 4D3FA 5HF6A 3J81A 4S12A 3IT1A 1KP3A 4XM0A 1IMJA 2XMZA 3VSCA 4LF5B 3INNA 4UMDA 3A6FA 2JIOA 5GY7A 4OLJA 4FFPA 3TSOA 2Q3EA 2CNNA 2A9KA 2B99A 3MMXA 4Q0MA 2QEQA 5IJWA 1GZ5A 4EP1A 1SQ6A 1A82A 3TKYA 2HFJA 3L4SO 2OPHA 4D9EA 2FE4A 2QSYA 5GOTA 3WI7A 1U2PA 2A14A 2YRWA 4QG3A 4JX8A 5KVAA 1H1LA 1FY2A 3QM1A 4G5HA 3NBFA 5K0GA 3QGMA 1V26A 1EDOA