4JFAA

Crystal structure of plasmodium falciparum tryptophanyl-trna synthetase
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
362
Chain Sequence
INYNKLIKEFGCSKITENHIKRIEKLTNSKAHHFIRRGIFFSHRDLDFLLNYYEQHKCFYIYTGRGPSSLSMHLGHLIPFYFCKYLQEAFNVPLVIQLSDDEKYLFNQNYSLEYINTLTNENVKDIISVGLNPELTFIFKNTEYAGYLYPTVLSIHKKTTLNQSMNVFGFNHSDNIGKISYPSFQIAPCFSQCFPNFLGKNIPCLVPQGIDQDPYFRLSRDIAVKMALHKPVVVHSVFMPGLQGVNNSVIFLTDTPEQIKNKINKYAFSGGGTTIQEHREKGGNLDKDISYQYLRYLLEDDNKLNEIGEKYKKGEMLSGEIKKILIDVLTELVLKHQEKKKSLTDEEISYFFDPNKPSLQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An appended domain results in an unusual architecture for malaria parasite tryptophanyl-tRNA synthetase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Ligase
molecule keywords Tryptophan--tRNA ligase
total genus 134
structure length 362
sequence length 385
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 4jfaA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4jfaA01
2A1UA 3X1MA 2OV4A 1FYDA 1ZH6A 2A1TS 1QQTA 1TQ8A 4K0RA 1IQRA 1O95C 3NV7A 4F3RA 4ZCSA 2NZ2A 1WXFA 3TS1A 4R0NA 4MW5A 1O6BA 3IVCA 2V0CA 3AG5A 1PG0A 4MWBA 1F4LA 3CA8A 2A1TR 4NDAA 1J20A 2Z08A 1UFVA 3F3MA 3PRHA 3HL4A 2QJOA 2WQ6A 1K4MA 4EG3A 1EUQA 1NUTA 2QTNA 3CLSD 4HJXA 4KPUA 4OUDA 1XNJA 5FO1A 2ZUFA 4NATA 4MVWA 2X0KA 3ZIUA 3CR8A 4RPIA 3G59A 2AKEA 1KQPA 3IVGA 1WZ2A 1N78A 3E27A 4DJAA 3A05A 4MUGA 3RHSA 2GM3A 5LFAA 1O96A 5IJXA 4YP6A 3SP1A 1JIJA 1OWPA 2CYBA 1NUUA 3OTWA 1NURA 1VL2A 1O95D 1VBNA 2WB2A 3N05A 2DETA 3HFJA 1LW7A 1XJQA 1WKBA 4MUHA 3IVXA 2D54A 1GAXA 3CLTD 4KR6A 3DO8A 3ZXSA 4HJRA 4J75A 2VXOA 1QJCA 3G5AA 3UY4A 4MUIA 3M5WA 3S3TA 2DEUA 3Q10A 1IQ0A 5TS2A 3SDBA 5KWVA 3CLSC 2RD2A 1PFUA 2G36A 1OWMA 3FIUA 1KH1A 4MQ6A 1ZJWA 4MAFA 2O8VA 3IOCA 3QTTA 1CT9A 3ZJTA 2J4DA 3IOEA 4S1OA 4OJMX 1MJHA 1KQNA 3K9WA 3TNJA 1IRXA 4E1AA 5F23A 2QUHA 3DV2A 2YWCA 4NZPA 4I6GA 1WQ4A 3KT6A 2AG6A 2C5SA 1F7UA 1IVSA 1BS2A 3FI0A 2QJFA 3Q12A 4MW6A 3PNYA 1WXEA 1WQ3A 1OWOA 3JXEA 4ZT2A 2I1LA 5FO0A 3LCJA 4DLPA 4DDMA 1EFPB 1TYDE 4NX2A 1MAWA 4YBRA 1MRZA 5LLTA 4A91A 2PZBA 2EL7A 3K32A 4ND7A 1GN8A 4YP7A 3VU8A 1VLHA 5H7XA 1R6UA 3CLUD 3ND6A 3L92A 1O5TA 3MXTA 1JEEA 4UZFA 4EG4A 4ZT4A 2Z09A 4ZCQA 1KP2A 4U63A 3SEQA 1T6XA 2CT8A 2IP1A 3A2KA 1NUSA 1EJ2A 4EG7A 1K4KA 1HYBA 3ZXIA 4G6ZA 1PFVA 2X3FA 1X6VA 4ARIA 4MUKA 4DE5A 3N2YA 4MW1A 3RJZA 3I05A 1M8KA 2QTRA 1V47A 4P2BA 3CVWA 3TZLA 3PNVA 1IQUA 1T9GR 1J1UA 2O5RA 1G59A 1YUNA 4KR7A 1GZUA 1KH3A 2DR2A 4H3SA 4KKVA 5K0SA 4AS1A 1JIIA 2XRZA 1XNHA 4QBTA 1WY5A 1G8FA 2E18A 1MB9A 1KKUA 2PG3A 3Q4GA 2BTEA 1EFVA 4TS1A 1LI7A 3UK2A 1O96B 4ZCPA 1IHOA 1GTSA 3D6UA 1P7PA 2E0IA 1VBMA 1N2BA 3CLRC 4G5FA 2V0GA 1T6ZA 5DK4A 3FHJA 1J21A 3PNBA 3G6KA 1D2RA 2H29A 4Q93A 3P52A 4J76A 5TGTA 1ZH0A 3KT8A 2DLCX 4FZJA 3SEZA 1O94D 1QNFA 3P0IA 3INNA 4JYZA 5HUHA 2IJGX 3SYTA 3H05A 4DDKA 1JILA 2H2AA 2X1MA 1H3FA 3A04A 1H1TA 3FY4A 2CSXA 4YMIA 3IH5A 3SZGA 4MUNA 3X1JA 4EG1A 3IDFA 4BWVA 4I6JA 2E21A 1WXGA 1JEDA 4MULA 2R5WA 1QRUA 3FNRA 4ND6A 3X1KA 4JFAA 4F4HA 3FOCA 4KR9A 1V8FA 3AFHA 3GUZA 3HZRA 4CDNA 1TEZA 3ZJVA 1K97A 5KHAA 3QE4A 3U1VA 1J09A 2DUMA 3CVVA 1M8GA 4G5YA 1TFUA 1IFXA 1M8PA 1JIKA 3FG9A 4Q16A 1JECA 1COZA 1U7XA 3TZEA 2D5BA 1EFPA 1NP7A 1U3CA 1XNGA 4WNYA 1I6KA 3ISJA 1NI5A 3HV0A 3IMEA 2TS1A 1A8HA 2PXHA 3RK0A 3H99A 4YP5A 1EFVB 1U7DA 3VGJA 1F9AA 3H9BA 4JXZA 1K92A 1KQOA 1DNPA 2J08A 1N1DA 3DLAA 2QUJA 1N2OA 4MW0A 3VRHA 1O0CA 2HGZA 2PFSA 2E89A 4MW2A 1QU2A 1O0BA 2ZUEA 2JANA 4EG5A 1N2IA 1N2EA 3FH0A 2BYTA 1R6XA 5BNZA 2NSYA 4EFKA 1WXIA 5EKDA 3CVXA 3KT3A 5AHWA 1JGTA 1O94C 1KP3A 2GOYA 2J5BA 1QU3A 4JXXA 1T6YA 1B6TA 1O97D 3AG6A 1Q77A 5DASA 2A88A 2JAXA 3H9CA 4ZCRA 2DERA 2HMAA 1LI5A 1EUYA 4CDMA 3KFLA 3AL0C 1OBHA 3AIIA 1MBZA 1WJGA 1M83A 3ZJUA 2X1LA 3H97A 1I2DA 4JZYA 1ZUNA 4MUEA 1Q19A 3ND5A 1H3EA 1M8JA 1YI8A 4XSVA 4PY2A 2WSIA 4EF6A 3P0JA 4MUJA 4K03A 3BL5A 3QTBA 3COZA 2QTMA 4OUDB 1JMVA 5TEVA 1RQGA 2QUKA 1Q15A 2OQ2A 1J70A 1YIDA 3HMQA 5JBNA 4ZCTA 4MWEA 4HPWA 1WOYA 1I6LA 3MLAA 1MB2A 2HZ7A 2JA2A 4MVYA 4MWCA 3UC5A 1R6TA 2YY5A 4MUFA 3KT0A 2QJTA 4CT0A 1QRSA 1I6MA 3FDXA 3IUBA 1OWNA 2DPLA 1KH2A 2CYCA 3ILVA 1KAQA 3A4IA 1Y42X 2J09A 4NAHA 2EJCA 4MLPA 2Z3VA 4GU5A 4ARCA 3PXUA 2PZAA 1EE1A 3MMXA 2CV2A 1M1ZA 1NYLA 1TYAE 1N77A 2A4MA 4L2IA 5DEOA 1JZQA 1JZSA 2A84A 2YWBA 3N8HA 5H16A 1PFYA 1S4MA 2A7XA 5FNZA 3LE8A 2PIDA 3TQOA 4DNXA 1H3NA 2RE8A 1OBCA 4U7JA 1TYBE 2XRYA 2GKSA 3COVA 4WSOA 1TYCA 1GPMA 2WQ7A 1O97C 1ILEA 1SURA 1M8FA 1X8XA 1QTQA 1U0BB 4EG6A 3RK1A 4NAUA 4MVXA 2DXIA 1MAUA 1OWLA 1VBKA 3RBAA 1YUMA 5J59A 1FFYA 4GRIA 4KPUB 3UOWA 1N2HA 3TQIA 1T9GS 4MVCA 3MLBA 4I6EA 2AZXA 1G8HA 2CV0A 2YXNA 1NUPA 2QUIA 1NSYA 1PFWA 4UZEA 3N9IA 5IHXA 4ZT7A 2A86A 1MOPA 3ELBA 5J58A 1N2JA 1IH8A 2B7LA 4PBSA 1MC1A 4RUKA 3CVUA 3IMCA 1N2GA 2J07A 4MW7A 3ZUGA 2CFOA 3IUEA 3LOQA 4R2LA 1G8GA 1NZJA 1JHDA 2A1UB 1YIAA 4X0EA 3SZ3A 3AKZA 3OP1A 1N3LA 2D13A 1PG2A 4EG8A 1GLNA 1KR2A 5TEWA 3IODA 4XFJA 3ZGZA 1GTRA 4HK4A 3P0HA 5HG0A 3UMVA 3DPIA 1EXDA 1YULA 4ZT6A 3GLVA 4U8HA 1F7VA 3NBAA 2CYAA 1OD6A 3HGMA 3GMIA 4PBTA 1QRTA 3L93A 1NUQA 3MUEA 2VTBA 2PZ8A 4MW9A 4ZT3A 3COWA 5J5AA 5HUJA 3D6VA 2VTBB 4PBRA 2CV1A 4QREA 2ZP1A 3C8ZA 3FWKA 4EGAA 3CLUC 3COYA 3FETA 4MWDA 2IELA 4MW4A 3IMGA 1ULHA 3ND7A 5LM3A 3IOBA 1KORA 4ZT5A 1N75A 1J1ZA 3NBKA 1KAMA 4DDHA 5K0TA 3CLRD 2CUZA 1Q11A 4QRDA 3RFFA 1U3DA 3CVYA 4R2MA 5DB4A 4L2IB 4CQNA 4XFDA 4AQ7A 3CLTC 5KCMA 1WXHA
chains in the Genus database with same CATH superfamily
1RWXA 1ODJA 3QBJA 1QK4A 1IY1A 4PU0A 1G16A 4QM6A 1G60A 3EOBI 3UJ9A 3LECA 3PVSA 2H85A 5K0JA 5KOYA 5JCXA 3NWEA 4OFZA 5HMMA 2QLLA 1SIUA 2ICAA 1ZRMA 1Y3IA 2OHHA 2GNAA 2PFKA 3CW2A 4R0NA 1O6BA 5GP1A 4CKCA 4WFKA 4KRYA 1EUCA 4E5YA 5BXQC 2W2PA 1W4ZA 3PI7A 4MYTA 1ADCA 1TUIA 1F4LA 3FXAA 5DBOA 3DQZA 1GVNB 2GBLA 4ESHA 1ISSA 1ZKMA 4Z8XA 1JAXA 1ZSYA 4CLOA 4J16A 4XPZA 5HKOA 4M4SA 5ALFA 1U0NA 2I2BA 3FUXA 5JXIA 1ZVMA 2JFVA 3B6MA 1DHTA 1MJGM 1CJCA 1J99A 2VL7A 3QEKA 1U2EA 3TLYA 5EKSA 2DECA 4GL2A 1XNJA 5JOQA 1XZJA 1XMXA 1UF9A 1HE8B 3KEGA 4EDHA 1N5OX 3Q1KA 4GDFA 4RPIA 4FT4A 4UUOA 1LC0A 1YZGA 4EHAA 3AFIA 3V2HA 2QYOA 1XYYA 4RDIA 2PAFA 3NATA 2PR2A 1BYUA 3AF3A 4RFLA 5HF5A 3WLRA 4AP6A 2WMYA 4BX2A 1QGAA 2GM3A 2YFKA 3ZQ6A 4E4TA 4DZTA 3NNNA 5JRZA 3S81A 3W79A 1EP2B 4C6RA 1E3SA 3HSYA 1Z9BA 1RC1A 2PRYA 3NDPA 1NURA 1PT6A 2H1WA 4P4TA 2AUMA 5CHYA 4CNQA 3LA8A 4WASA 2Q4RA 1P4RA 4PGFA 1JEJA 1X1CA 1L4EA 1G3UA 5FOWA 5THXA 1V25A 1ZMXA 1KARA 2FWIA 4OHUA 5JD6A 1GAXA 1DRWA 3QVXA 4LV5B 1NHGA 4BX0A 5ITWA 2PYZA 1EU1A 4WNAA 1D3AA 2H08A 3S99A 4ENSA 2O2SA 5JSZB 5IDWA 5DDIP 1JSCA 2HA0A 2FN3A 3NKLA 3QXJA 1IWOA 3F2IA 4MB2A 3QEJA 1XP8A 3C2QA 2P9TA 1IJEA 3W5UA 1P7ZA 2BC9A 3RJMA 1SVNA 4O4HF 2ODPA 3FTFA 3IPCA 3UM9A 2RIRA 2YW9A 4K9SA 4O5AA 1C3VA 2HI0A 5AKLA 3EZNA 1WR8A 4LF8B 3K2QA 4PLHA 4WRRA 5TPZA 1XU4A 2PVCA 3ZHUA 3PK0A 3PCTA 3AR2A 4FYYA 4JGBA 2ZB3A 4K3UA 4R1NA 5IF9A 4Q7LA 4YO8A 3C3CA 1TM3E 1WRBA 5EJ9A 2HQSA 5BWLA 2I66A 1Q20A 3AEXA 2Z5VA 3G02A 4TMVA 2EW1A 2YYSA 4S3MA 4BKRA 3WFZA 1Z15A 1XZLA 1P2UA 3ONEA 1XVUA 3U3XA 1A97A 3W78A 3NBZC 4H27A 5ALZA 4ZEMA 3I8SA 3JQGB 1OWOA 4RVNA 1IYZA 4U3JA 2QAGC 3CNQS 5EGSA 5AW3A 4IMJB 1QKKA 1EFPB 2PT5A 1OXSC 4LWOA 3ZCXA 2IL1A 2IYXA 3RROA 4YLYA 1VG9B 2WYHA 2YY6A 3W5JA 1MX5A 1VTKA 1NR1A 3LMKA 4QASA 1VXRA 4YP7A 5FF9A 2OCYC 1ISPA 3VDQA 2AVNA 2N9UA 3V48A 3VR5H 3CLUD 1KFBB 2B99A 3VPXA 3E9EA 3D5TA 3OWOA 4G0XA 3UO8B 5EPUA 4MP3A 1ZJZA 2XBUA 3E22A 4AM8A 4LDQA 4PRLA 4JHLA 4WV3A 4ZA2A 2BGGA 2XVAA 3ZU5A 1Q7CA 3ETJA 3EDQA 3GLHA 4KX3A 1DIBA 5A4KA 3GRCA 3HQ4O 4KN8A 1N7JA 4EG7A 3ILSA 2BFWA 2VDQB 3ZE8A 1ZNZA 2EKPA 1MXFA 4QDTA 1T8RA 2IYTA 3O1JC 3BWMA 4R41A 3LK7A 4WH0A 3ANLA 4J49A 4G6ZA 4R2JA 5E9JA 1VCNA 5JJKA 5JJLA 1TQHA 3ENWA 3GFFA 3VZDA 2P0AA 3H5IA 4OJKA 3CZ9A 1KOLA 1OHHD 1K7XB 2PGOA 2OGSA 5BXYA 1FJGB 4KQ6A 1QORA 4UPVA 4JVMA 1KVTA 5CDFE 4NU6A 4E1BA 1DUIA 2N47A 4NARA 5CGZA 3MJVA 3SCZA 5IMBA 1IBKB 2VBCA 4WI1A 1YT5A 4BZPA 1C1DA 1U65A 3B6KA 3KZVA 1E4EB 1Y7HA 4YPVA 5SY9A 2RHRA 1XF9A 4AYTA 1LPMA 2H2GA 4R5MA 4HGQA 3JRXA 1EFHA 3D6MA 4JKYA 2PG3A 3KJIA 4B47A 1W9MA 3EFOB 2REBA 7REQB 1CUEA 4KRXA 3RBXA 4MI1A 1BXZA 2AFHA 5TMDA 3BL8A 5KWIA 2YWJA 3D2AA 4QL3A 4ZCPA 4Z51A 4XIIA 2ZXUA 2GXAA 1UOPA 3ELDA 1QIMA 2DPHA 4MCAA 4DUGA 3N07A 1DEKA 3HLYA 5AKZA 4ZDKA 5CA1F 1SBNE 2YYAA 4TYWA 4LDRA 3PNBA 3PCXA 2BOVA 1TQ6A 4J76A 4FPXA 4YALA 3SM3A 1ODFA 1L6IA 3W2HA 3THXB 1E3MA 2WINI 3OM8A 2X7HA 3D7RA 1X2BA 3SEZA 1LRJA 1G41A 3LO5A 1O6FA 1PT9A 2NU9B 4YXWD 3B3JA 2IUEA 1W8DA 3QI7A 3WZLA 1QMPA 4HB0A 4U0JA 1V71A 4H3KB 5KU7A 2IC5A 1RYZA 1TUEA 1H3FA 2QZJA 2V96A 4LXHA 4Z2AA 2UYYA 4YMIA 4D98A 3H19A 3DHNA 1KETA 1Z5ZA 1PGOA 1PX0A 3CRQA 3FPGA 3LCRA 4WE3A 4MDFA 2NU6A 5K8CA 2W6OA 3NNDA 1F2UA 3O9ZA 2E21A 3PR2B 3RJ5A 4QUEA 4BVAA 3PBKA 1MD9A 2R5WA 1Q14A 3WJ2A 3RREA 1KO4A 3K9LA 4F9FA 3GLFB 3O1LA 3K71B 1CPYA 2QGZA 3EEBA 3HCBA 1ZN9A 4FR0A 4QOFA 2FR8A 4RTMA 1COWD 1RQ2A 5DGTA 4KLNA 4YRSA 3CVVA 2GI4A 1YA4A 4WECA 3WGTA 4QPZA 3KSDO 1BMFD 2ZT7A 3PE6A 1T6NA 2FX2A 2NMVA 1RMQA 5LQDA 1YCFA 4OA8A 4YJDA 4B3HA 3TZEA 5KYWA 1XMVA 1EFPA 5TQ2B 4B34A 4QPPA 4DG9A 3ISJA 1G8SA 4ZZ3A 4GMXA 3TBHA 1ISJA 1WY7A 4HXYA 4PIMA 2G08A 5CFQA 3L4JA 4K87A 4W5QA 2D2FA 3SYRA 1EFVB 1JLMA 4CT5A 1G6KA 2ZRDA 3LVFO 1I80A 5DFAA 4Q9NA 4RTJA 5L8VA 1RPNA 2N1MA 1BMDA 2ZBDA 1GNLA 3LFTA 3H2YA 2IPXA 2WBLC 4GOND 4JKIA 4KQXA 4MR7A 4CI9A 7MDHA 1EFDN 2A67A 1KDTA 2AV6A 2PEYA 3BRQA 3FBWA 4UATA 3K35A 5D51S 3ISTA 5DNDA 2CLFB 4EG5A 4MYSA 3ZZUA 2PS9A 4DAEA 2BYTA 2HDNB 1L1RA 5G1NA 3PPXA 4O4JB 4YI3A 5JPDA 3J81A 1MVOA 2EFHB 1J06A 5KX5F 3GH1A 1PS0A 2POCA 3UCXA 2JA1A 4UBJA 4HB2A 4L8YA 3GGDA 3BAFA 1XFDA 2A1IA 2FRDC 4BV3A 1GGVA 2BMVA 3BMOB 1P0MA 3I0ZA 3L0ZA 3PHIA 1E79D 3SMQA 2X8WA 3RTBA 1L7RA 4LBZA 1L8XA 2HMVA 3IKTA 4ZVRA 3DEJA 4LJKA 1VFPA 2UUBB 2W8BA 3ZWPA 1MO6A 5IYZA 3GOHA 8MHTA 2RHWA 4IV0A 3AL0C 4MR8A 4IINA 1K89A 1ULBA 2ONYA 1PG5A 2V7PA 3CNLA 2IV2X 3T5AA 5HDQA 5LKRA 4JBLA 4JZYA 4URUR 5GJVC 3K16A 1T2FA 4LDPA 3G1TA 1Z37A 2G9QA 1RW4A 3VISA 4C4OA 1AXEA 1YI8A 4D3XA 3MJTA 4X8LA 3FTNA 3ULKA 4R2HA 2X9GA 3T4EA 4QRIA 1NDQA 1PEYA 3HBNA 4C08A 1A4RA 2OBFA 3BFKA 2D4HA 4M7WA 2LIPA 4YRZA 1VJRA 3GNTA 4DAOA 1KVSA 3RIMA 1IOLA 5L4LA 1X8KA 4J0EA 3UHJA 3LBNA 3D3JA 1R6BX 4FSDA 2BMWA 3FZEA 5A4MS 5TEVA 1R66A 3PLAE 1DJMA 1BW9B 3SU8A 1BDHA 1NNSA 3D6HA 3UOGA 2HEIA 4WN3A 2P2SA 4AF8A 1Y80A 4FP9A 1OVGA 3ZIAA 1ECFA 3RRJA 4F8JA 4AQDA 2YQZA 1VIVA 1Z3CA 2HJRA 4PYKA 5LA6F 2C1EA 1U0HC 4MV7A 3FSEA 3VTKA 4BWYA 3S1SA 4ZGBA 3PHLA 4PSKA 2QTVB 5AXDA 3O2QB 5IHPA 1QRSA 4RHXA 3CRW1 2OY0A 1Q0LA 4GX0A 4OQZA 1ACMA 2Q8QA 4G07A 3SQLA 3UCFA 4JD5A 2W37A 3ILVA 4NYIR 4R9NA 2CB9A 4RWEA 4Y0NA 4MDHA 4IFIA 2W6PA 2JGFA 5CAEA 1GO2A 4IGEA 2JKZA 2ZTHA 4HDNB 5B58C 2OXFA 2Y0CA 4DBVO 1TYZA 2VJQA 5K0GA 4IKEA 4XTCS 3WL3A 2BFMA 2LBPA 4DF3A 1FPQA 3HA5A 3CH6A 4K9MA 1M66A 5LKAA 4C87A 1AZSC 1Z5PA 1PNVA 5FIUA 1K6IA 3A1UA 3M3HA 4K7JA 1L8QA 1CYDA 3N8HA 1UMDB 5IT9A 1UKVY 4M0FA 2J7KA 1EB8A 2QD5A 4TTPA 1DRJA 1GZDA 2WA2A 3HVIA 5ICFA 2NPFA 4BRWA 4QODA 5DRYA 2Z98A 2FN4A 4KN6A 5DTRA 5AQEA 3BCRA 4E2XA 4BFUA 3UATA 3EBOA 4O4LB 2FFJA 2FVYA 2XW6A 3VR5A 4LE2A 4Y6GB 4RSGA 4NEGA 5AM4A 2WWFA 1YQ9A 3P2KA 4XGKA 3EC2A 5ALQA 5EZ5A 1V95A 5GJWC 3SZUA 1SIOA 4X7PA 1R4MA 4O2LA 4Q37A 1C7JA 5DYGA 3BEDA 1I94B 2JATA 5JDCC 2VKTA 3BFJA 2I6TA 2V4UA 5CEEA 2O2ZA 1ZW6A 1X7YA 3AKYA 4BASA 4F60A 1YMVA 2ZJFA 4B0OA 4P08A 2KSQA 4ND8A 3L7KA 5CX4A 3VX4A 2YDXA 3HL0A 4GRIA 5IT0A 1DTWB 4M9XA 4OLBA 2FZ4A 2QM7A 4KLZA 4JBGA 4JBWA 4DMFA 3CSSA 4FSXA 4MSUA 2V7TA 3CX7A 4CMIA 1RZRA 2B1QA 3KD3A 3RPEA 2R1VB 1PJ8A 2LTAA 4I55F 3BCHA 4EWLA 3M83A 3DBHB 3FTQA 2C2MA 5JW6A 5JXWA 3FYDA 3C3XA 2IITA 1EMDA 3VR1A 4TXHA 2Z5FA 2Q28A 1FP4B 2BFBB 5E9WA 1UBRS 3UMYA 2AJLI 3WLLA 4UHJA 2QD3A 2PMEA 1T15A 4OK6A 2RI1A 2GBGA 2GCEA 1ZCZA 2FWJA 3ZTWA 4D0NA 5ALXA 3PPYA 1CUFA 1D2EA 3A1DA 1BHJA 1IXYA 1E4OA 3HCAA 1X0VA 2FSFA 3TUZC 1FUKA 3OP1A 2HCFA 1ZJJA 2PLWA 4GOLD 4EG8A 1GLNA 2AOTB 5KKAA 2A5GA 1JR3A 2L82A 2Q5OA 4HK4A 3P9PA 1K7FB 1NHWA 1V9CA 4DV4B 1YRYE 2C2WA 3EMKA 3OAAD 1CJUC 3I01A 1JWAB 4KH0A 2PKXA 3FLMA 4BNYA 4EBFA 4ZCIA 4LY3A 1OTXA 1FP6A 2YCLA 2XZPA 4JLDA 1NDHA 2GD1O 3FMGA 1EGAA 2HBYA 3WB9A 4ZJZA 2ZJ1A 4CR8A 4RQAA 1NRIA 3VH3A 1N5IA 3LF1A 3ZDFA 4BECA 2GSWA 1R4AA 3CNEA 4WN9B 2VWPA 3L8FA 2YWDA 1ZD2P 4QQFA 1P33A 2ZBFA 3FKQA 3HB4X 4P3KA 4MGKR 1CVIA 4Q3LA 1WQ1R 5B6JA 2PMCA 4ASUA 2ZI6A 3KEQA 3O0TA 2KMLA 1W85A 2I5PO 1EIZA 5DLQC 4FDTA 4JVNA 1ZD3A 2VT2A 3OQOA 4XX0B 3RBVA 3A0UA 4HAYA 2Z4SA 4AUKA 1ZC3A 3NTUA 5CIQA 4N65A 3AUTA 3EFBA 1TVKB 4GLFA 4J2TA 1G5PA 1WP9A 2G0AA 3JYHA 1AHNA 3S27A 2NQTA 3S68A 1Z0JA 3V8NA 1Q57A 4L8WB 4P34A 1KAMA 1TF2A 4DLLA 4XUGB 1JN0A 3OBBA 4R16A 5BMOA 4IS2A 1W19A 2QSJA 4FGJA 3PHJA 2AZ4A 3TB6A 1MENA 1HFWA 2HLPA 3OF3A 2AEFA 2A9OA 4R9SA 3NBXX 2O2YA 5H3LA 4B40A 3CLTC 2QX8A 3MJEA 3N8GA 3PSAA 3H9GA 2ZJ4A 3Q6MA 3ESQA 3V5NA 4IDEA 2PUGA 5DLDA 2ZWIA 3D8NA 4KW7A 4RMGA 3MCTA 5CJPA 4ZCSA 4B75A 4R51A 2OCLA 3SHVA 2NO7A 3BJEA 1RRPA 3T1YB 1QP4A 2AL7A 1UOOA 3UWSA 1VRVA 5T64A 2DP4E 3JQAA 1KA9H 1QG6A 4UAGA 1U1EA 2V0CA 4MKXA 2HHLA 3C4QA 5B2FA 1H0HA 3WDMA 1UDXA 1J20A 1OC2A 1ZOLA 1QTIA 1THGA 1JJFA 3JATA 4KK4A 3V1UA 1A9OA 3N8IA 1GQFA 2DHEA 2MOKA 4UUMA 2A5JA 2CHFA 2PKRA 1OFGA 3VR4H 1Z6AA 3D31A 2XTNA 4LC0A 1WOMA 2QMEA 4MS3B 1P7VA 1XVAA 2CXQA 4PO8A 5HGJA 4RZ3A 4O3FA 4AJHA 1MO5A 2XOKA 2FSUA 4JI5B 2EKDA 2I80A 2VP9A 2YXLA 5L3RA 1E7MA 2JFNA 4BZWA 4JJIA 4J7AA 2YWGA 4AG3A 4OXXA 4MI6A 2Y0DA 2DH5A 4WLEA 2PZGA 2QVZX 1MH1A 3GVIA 5E6SB 1NUHA 2BMEA 1L5SA 3SP1A 4WJLA 2QZZA 4BO8A 2C7GA 3DE7X 2ZIAA 2ZS8A 2JLZA 2PUBA 1DWUA 3BD8A 1S2GA 2GF2A 1Z83A 3G89A 3IDQA 3IR6A 4ZQCB 2JASA 3JYPA 2JGEA 3EB9A 3PL5A 2AD5A 2B0JA 1GNTA 3IVXA 1JHAA 4U7DA 1NTRA 1E2BA 1CIVA 1W36D 3ENQA 5CLJA 1SOVA 3ACBA 5HMLA 4HH4A 3RI3A 5K0NA 2VXOA 5CT6A 1QJCA 1MIOB 1VSUA 5MHTA 4HI0E 2W11A 3Q3IA 3UY4A 2VRCA 3I42A 3T1TA 5IH7A 3P9SA 1L7MA 2PRKA 3E8SA 4NSNA 3H3JA 1PFUA 3E9YA 5F1OA 3OEHA 4PYJA 3DMNA 1EDZA 4O0MA 5I4IA 1XL1A 4ITRC 3DLPX 1PV2A 1OC4A 3C1TA 3VOBA 3WI7A 5CD1A 2WFAA 1TJ3A 4RIEA 5AVYA 5K4HA 2QAGB 2J4DA 4OBWA 3HVKA 3ANSA 1E3LA 1YZUA 5EJ7A 1SUDA 1Q7TA 3Q3HA 2Q6VA 3LLCA 2BI4A 3CRRA 4GHWA 3RTEA 5FX2A 2Y1FA 2E4VA 1VGQA 3C3YA 5KSZA 2QUHA 3RM3A 1C7ZA 3EPLA 1XQVA 1CVRA 2CLSA 4I5GA 1G7RA 3I3OA 3R77A 2IZZA 4P3NA 1ZMBA 2QF7A 4R68A 3OZ7A 3WIDA 3HSSA 3FI0A 4QFBA 1GGFA 2LPMA 3OMLA 3WIBA 2ZSHA 1V5EA 1X1RA 2SBTA 1W5FA 3FB1A 1A5BB 2GJAA 1FF9A 4JELA 4LQDA 4R1TA 1LVUA 4HAOA 2GPAA 3HYNA 3JQCA 4RULA 5KI6A 2JB9A 2ZYAA 5DHSA 3VNUA 4IQ0A 5DP2A 5SYAA 1PHPA 1SOMA 3SWWA 2EL7A 5DHFA 1FUUA 1I4WA 1YZKA 1ZD1A 3CPHA 3LXMA 1TEXA 2YX1A 3IQHX 3LUCA 3VTAA 4QGSA 1ZOIA 3O4VA 5HM8A 2IZ0A 1E3JA 3ND6A 5CBPB 1D09A 3AB3A 3CNOA 5L3QB 2YKGA 3EMVA 3WGVA 4UZFA 2BEUA 1EUZA 4K9NA 2PGAA 2X8LA 1D0SA 5D1NA 3HP4A 3Q7SA 2OAP1 3OIGA 5JQWA 1Z6GA 4Y1GA 4FMDF 2ZYUX 4PSCA 5EWJA 1FDUA 1IBMB 1E3QA 1EJ2A 2ECQA 2Q5LA 2QE7D 1ZVKA 4MV4A 4CIWA 2FSGA 3WTCA 3K70B 1NE7A 4CM4B 1XGKA 1HYBA 1XK6A 4IQ4A 5G0WA 1DCTA 1M75A 4PW0A 3A7DA 5IXSA 4BMVA 1YD7A 1QR6A 2ZSUA 3AYXB 1FBNA 3FZGA 5IJZA 1XNRB 1R5NA 2ZAOA 2Q6TA 1E62A 1HKUA 4TTVA 4AJKA 3ZZ1A 1GTJ1 3UXYA 3SR4A 5T4BA 1SQ5A 2I1WA 4K6HA 4PAQA 1IJBA 1ATIA 3QOFA 1BOOA 1Q91A 3E7XA 3H3FA 4FI3F 5DM4A 3AF1A 1T24A 3FMOB 4EYGA 2R7MA 2IW1A 1VJDA 4KKVA 4IMIB 3EUWA 4G5SA 2Q9CA 4GNRA 2R8OA 4XWOA 3I04A 3I09A 3ZOZA 4BGDA 5EKUA 2YH2A 3AW9A 4YJ2F 1RPJA 2PKQP 3GJYA 4R69A 2ZIXA 1SBIA 2C2GA 2WAOA 4OVKA 5IVIA 5BT8A 5F7ZA 2WRZA 4TWIA 4MPJA 3O8NA 3QOXA 5AVSA 3ZZ0A 2YXPX 3C3DA 3B38A 1ZVJA 3DBIA 5AKJA 3IQFA 3VNSA 4URVR 2ZCJA 1ZNWA 2Q2QA 2QROA 4NENB 2YN0A 4EJMA 1G9SA 3BM5A 5JWOA 3ACDA 4XCQA 3MMNA 2AWOA 2VEDA 1TPYA 5KYWB 3COJA 3IIJA 5LQCA 3IKJA 2GJ4A 4YEDA 4OYLA 4M88A 3FHJA 3UYKA 4ZVOA 4C4TA 5C8ZA 1D2RA 4Y6QA 1YJ5A 4FFDA 5IVDA 1ZH0A 5PGMA 4DSZA 1KK1A 2QMZA 3M5PA 4GR4A 4GT1A 1KJ8A 3OIFA 2QW8A 3A27A 1CFJA 4XIJA 1QNFA 4N3AA 2QGFA 3FF4A 2ZWOA 3SC6A 4TV9A 4Y2UA 4NK5A 4UNRA 1P1KA 2GUWA 1RTKA 1Z8FA 2JJQA 2QQFA 1IN8A 3H05A 4EKNB 1U7WA 4MHSA 2OHGA 4G5RA 4LXGA 2ZTVA 1DV2A 3G8DA 4JGGA 3GQVA 1AKTA 1M2JA 2VWGA 3BULA 1B93A 4LYDA 1EM6A 3HRKA 4BWVA 5KTYA 2FPRA 3B5EA 4HPJB 2GZ2A 2PDAA 1S4QA 3GJSA 1OYOA 4ND6A 3KPYA 3VR3D 1BVYF 5C4MA 4BCCA 2FE4A 3D0KA 5JMTA 1KI8A 1F2TB 3DYVA 2QTTA 1L5WA 1Z47A 3MTAA 3ZV5A 4N5IX 4C20A 2DUMA 4M0UA 1C3OB 4DWWA 1Z68A 4IDFA 3TOVA 4QVGA 4FYIA 4Z9AA 4IKOA 3I8XA 3F46A 1TVEA 3IBTA 1JECA 3SLKA 3JQBC 3TD9A 3WB0A 2C7VA 1NLYA 1MO3A 4NIMA 2I4LA 3GCWA 3UK7A 4NF2A 4Q4HB 5I9IA 2VNKA 1Q3TA 2HY7A 3FW1A 3I0MA 2PRZA 1GTG1 3TNLA 3VKWA 2G5PA 2LV8A 1TE2A 5EJMA 3IEVA 4DSTA 5E6SA 2ZRKA 3ZI7A 4AY3A 1P2BA 3H9BA 2E37A 3EQ7A 2VI5A 4XIYA 4G0UA 3CWCA 3HZZA 3GDFA 3JQ7B 3DLAA 1SCAA 4MW0A 1I24A 3UHPA 2G9NA 4CWAA 4N82A 4BQSA 5FWYA 3V1NA 1GG9A 2CHUA 2KW5A 3CS3A 4MQBA 4YT5A 3UJ3X 2VCHA 3QENA 5DZSA 5MFPA 2ZUEA 1E4EA 2FUCA 2YOHA 1C1DB 1HFJA 3CFYA 3IQDB 5FTMA 1PUIA 1WXIA 2GS9A 3R3SA 1SCUB 3MT8A 3SSAA 1T4MA 2HRZA 3MS2A 4F85A 4I1OA 2PO5A 3VYUB 3AJEA 4UEWA 4DEVA 5J3JA 4JB3A 3HM9A 3V2GA 1N1MA 1X7WA 3OTIA 5JCOC 3LTNC 4DEYA 3N76A 5B37A 1WX1A 3L0YA 3M6IA 4HZGA 2WWVD 2CL5A 2PNJA 3THYA 3GAFA 4DLKA 1PZFA 1J8DA 1EWYA 1P9WA 1HTWA 1Z4JA 2CXPA 2AR7A 2OMKA 2VSOA 3DEZA 5B4UA 2ZI4A 1N2CB 2OECA 3EPPA 1DG1G 2V74B 5CT8A 4B87A 1B4DA 1PR1A 4ESEA 5B4VA 4W1QA 2ZJ8A 4H59A 3MCZA 3EQ6A 3OF5A 3JVEA 4CMGA 3KQNA 5JMOA 3P9XA 1RZVA 4PS1A 3LUDA 4H08A 1R64A 5JANA 1UL1X 3PKIA 2HIMA 2C3UA 3G1UA 3FB4A 2JBWA 1R0YA 3K31A 2MSDB 4F71A 3V7UA 1Z26A 3KB8A 5EXEA 5CDHA 1OPXA 1U9IA 1V2GA 5B57C 2EWMA 1RLJA 3PIDA 2KBEA 5AK6A 3QZUA 1L0BA 1W1UA 3RT7A 4RKRA 4HVTA 3WISA 2EXXA 5CA0F 2MSKA 4EUSA 4F97A 1DC6A 4MYRA 1E69A 2PMWB 5FT9A 1OIWA 1NW3A 5JR3A 1J9GA 3D0QA 2XOXA 1SA0A 2IT1A 4WCFB 4OUDB 3RV3A 5KJCA 1COWA 3ZW7A 3JQGA 1FQWA 1G8JA 2WKWA 1EGHA 1JHZA 1XCMA 4IWYA 2C4HA 4HPWA 3HS3A 4FOSA 2NVUB 1TXGA 1T3GA 4DZZA 2J3IA 1SC9A 3K70C 1Q0SA 2F1OA 4F3YA 4CEHA 1MB2A 5K8IA 1VSQA 1XV5A 2P7HA 4O4JF 5L3ZA 2YY5A 4JDUA 4PGGA 2Z95A 4BVKA 3R3JA 1OXMA 1JL3A 1U2DA 4LMPA 2P2ZA 2ECKA 2COEA 3K5IA 5HP4A 4I9GA 4LYFA 5E8JA 4PWZA 4M38A 3CUWA 1Y8RB 3V6MA 4TKUA 1ZA1A 5A3QA 3A4IA 5AJVB 3MWEA 5EFOA 3BB3A 4RA9A 1AGRA 2XVZA 1H2RS 2XCTB 1UZUA 4BNWA 2Z3VA 2ZAMA 4NI5A 3W3AH 4L15A 2HDHA 5ENVA 3T7JA 2EP8A 2P1DA 2ZJ7A 3DQPA 2PRJA 3GZJA 3L0IB 3KRTA 4X71A 3WQHA 2V9CA 2A4MA 5C7YA 4J03A 5C8VA 2EX4A 4RCZA 4PHHA 2OXTA 2YWBA 4CKWB 4KR0A 3G5MA 1OOEA 4KPEC 1LV7A 3VYTB 3NAMA 4L22A 3PSHA 3V4RA 4BFTA 3E2PA 1RT9A 4JBYA 4IOMA 4Y6LA 3BKWA 1UPAA 2P79A 4FEEA 5E38A 3I6MA 3FOEC 3MTBA 3L77A 1XFAA 4PHCA 5KYNA 3WKDA 2XT6A 1KS2A 2QI9F 1Y7PA 4JEMA 3LUAA 1B76A 1W59A 1QANA 1YCGA 4B3FX 2M1XA 4XX0A 2WQ7A 3HE3A 3N8DA 2K7FA 2VPQA 1N6NA 1GL7A 4GICA 4G1EB 1SURA 1ATZA 3R5HA 4U9HS 1QX3A 3RS8A 2DYKA 2J9RA 4TKLA 2Q0HA 4GDMA 4YCAA 1PLJA 4RHYA 1V4BA 4MVXA 5LA6B 3RFXA 1Q92A 3RS7A 1OWLA 3A9WA 3DBHA 3ET4A 2AW3A 1VBKA 4NCJA 5H80A 2PUCA 3ESDA 1H1LB 3E1KA 5AJUA 1MX9A 3LUJA 2VQEB 2J0SA 1RAHA 3EVFA 2BI8A 4KXQA 5JYBA 2NM0A 4PZPA 2V3WA 4WACA 1GIAA 1LFAA 1YRAA 2IZ5A 2ORVA 1FTNA 4HDOB 3I76A 3RCBA 3U7IA 2VT7A 4B45A 5EJ4A 5JAMA 5M34A 1T5SA 3DOFA 1P80A 3VC1A 4E5UA 4KNYA 4CKCB 1H94A 1NYRA 1IQPA 4CM8B 1TT7A 2D74A 2B7LA 4DCPA 1G21B 4R1LA 3ERCA 4NS4A 2WAXA 3DDHA 1KI6B 3FLAA 4Q5IA 4RF5A 5CD9A 5JFOA 1JEAA 3AF6A 1DELA 2Y27A 4PLPA 4KSCA 1G9XA 5JSKA 2PVPA 4IDOA 4O4LF 2GHIA 3T3HA 2W2LA 3ZVKA 2I4MA 1WCIB 3R7BA 5CX1B 1RCUA 4G5XA 3LVRE 1N8NA 1EE9A 4CLDA 4IUDS 1MMFB 3PFWO 2FWPA 4PHFA 2OB2A 1X15A 3DPIA 3QE0A 4HRVA 1QZTA 4CMIB 3GLVA 4KGZA 5HVNA 4M22A 3EX7C 2XQVA 1RI4A 1HL7A 3GXBA 3WAJA 2IYOA 4A2WA 5HS6A 4NOLA 1VLVA 4CZ2A 3NHWA 1T36B 4H7EA 1DJPA 3AB7A 3JQRA 1ZBDA 1N8SA 2HFKA 2X5JO 4LE0A 4MTCA 1ZVQA 4R1MA 5L9AA 1HR0B 4O2RA 1GYPA 1PL6A 2BBSA 3GZ4A 4R81A 4D9NA 1DC3A 5I5EA 3NTOA 3QNMA 2FWAA 4E07A 4FS3A 1B8PA 2VVTA 4FBGA 1E1RD 3B7WA 4AJ4A 3B9RA 1WAMA 3LXXA 4TZTA 5T8KC 3RSZA 5H1YA 3KFXA 1QQBA 2KBFA 5JZBA 2FLKA 3GDOA 5D3ZA 1SKYE 5AT1A 2ZTLA 3GLRA 1CZUA 2VYND 2Z4TA 3IUYA 4RZHA 1S01A 4EGQA 2O52A 1VPVA 1E2FA 1P77A 4AJLA 4RZUA 1F17A 2JK0A 1CNFA 2ZWAA 1NYTA 2L19A 3AU8A 3C8DA 3FUCA 4UVDA 5GV8A 3RK4A 3ZGNA 5T57A 4Q7QA 1U81A 3AVPA 3RWMB 3NM4A 5E2BA 2LXNA 4PANA 1NYQA 4PYOA 1SWVA 1YZVA 1R9GA 4AG5A 5KQMA 3HJFA 1C0LA 1TUBB 3H4IA 2B1JA 3P2YA 4AQ7A 1C3OA 3O8QB 4W99A 3A1EA 1C0EA 2OV4A 5JVDA 3NDIA 4E5SA 3GLIA 1WBBA 2PYDA 4ZJUA 4NY1A 2PWYA 5CAEB 4FOLA 4J0DA 4QVKA 4RJKA 3RYHA 3ES9A 1L7VC 3KDSE 3MAGA 3P0FA 1UK9A 3Q9UA 4LRSB 4OK5A 3EGEA 5DX0A 3HXMA 2OO5A 5KWSA 1NLMA 3IC5A 1K8RA 2FQYA 4IWNA 5FQOA 1DG3A 4M8IA 3ST7A 3CEHA 3FSRA 3M1IA 1CUYA 1DL5A 1XCOA 1QWOA 1Y3AA 1P3DA 3EIWA 1ZH4A 2X8JA 1W6UA 3QVKA 4EMSA 3WLSA 1J49A 1FDWA 4QTUB 2JEOA 1ZRSA 4E11A 1ZMRA 3ZY5A 3KSMA 2EZ8A 3CY6A 4F3NA 1GQ2A 4U7HA 3EIEA 4IDDA 5KYGA 5J2TB 2IV7A 1CR2A 1O0SA 3FSGA 1NOIA 1LSUA 1BW9A 3QU7A 2O8CB 2ONJA 5FV4A 5JUWA 2OXCA 1DX4A 3GW8A 3QEMA 3ZH2A 3MMSA 3ZLBA 4L4XA 3SVLA 2H1OA 1H1LA 1V4VA 2IOFK 1QAQA 2PZMA 2R48A 2TMYA 3D64A 4BLVA 4IJMA 4GBMA 3TO5A 4BFLA 2B1IA 1XB2A 1KC1A 3KSUA 5IN5A 4NJMB 4NZ9A 4NOMA 4L08A 5B1SA 3JQFC 1Q0QA 2FK8A 1DVRA 3EN0A 4KQGA 3EDOA 2IW3A 1JKJA 4ZPJA 1QVZA 2PUTA 3E6AA 2Q27A 4LY0A 1D5WA 1XTIA 3IS3A 3P9ZA 4HDRB 3TW8B 4IG9A 3T7RA 4EPRA 3NEJA 2P69A 2JIOA 3MK31 1HL3A 1M9NA 1QGDA 1VLQA 1VJ5A 2CZGA 2RJ3A 4IDCA 3NHJA 4WJZA 4Q9LA 5EYPB 2SCUB 3GXOA 5M2QA 2NUPB 3B12A 2PCLA 4G0MA 4YA6A 3ZE0B 2PJRA 1VPTA 4OXYA 5F12A 1H69A 4MUHA 4XUCA 3DOIA 1Y3HA 4QYMA 3N28A 4DL9A 3WGIA 5IYZF 1PK7A 4HO1X 5EJ2A 3DVAB 1JEYA 3U3DA 1KFKB 4TLAA 4TLDA 3R7WB 1FFBA 1ZR2A 1EXMA 4XDGA 4WZAA 3CJRA 5LNK6 2VZ0A 1E6KA 1E92A 3QPCA 2VYFA 1UBEA 3CIFA 3FAKA 2QL9A 1RHUA 4ER0A 4IRXA 1ZD9A 4A2QA 2DWUA 4V0RA 5ALIA 2AGVA 2W43A 3TLBA 5JAUA 1NJ8A 2HK7A 4YMVA 1DQRA 1UT5A 1UXIA 1VYVA 2EP5A 2IEAA 3K9WA 2HK9A 1B8UA 3KZOA 4HADA 4MR7B 1LLFA 4IX1A 4XYMA 2VQSA 2IUUA 4FGSA 4E03A 3IVAA 1T8UA 4QOGA 2XOKD 2HK6A 3L8YA 5EWJB 4BEWA 5HKKA 5KS2A 5JS7A 4HF7A 2Q6KA 2QTLA 3QJYA 2IH2A 1RAEA 2PA3A 5CUQA 2RI6A 5LDHA 1MHTA 1TIPA 2QRGA 3AVQA 1DWPA 4KO1S 3FN4A 1TO6A 1UBFA 4C30A 4MS1B 4BO4A 5FLKA 2IPMA 2VK1A 2GYYA 2Z6AA 1NJFA 4RJJA 1TYDE 2EHDA 1F0YA 4G2TA 1BWRA 3ABRB 3SOPA 1MAWA 1JQ5A 3W2FA 2QNBA 4LF5B 1XSEA 4NCHA 4WJKB 1AMNA 2VO1A 1LD3A 1YHYA 2E4WA 3HJUA 1VIYA 3VVCA 2HQRA 2NVWA 3JR3A 3U39A 3ON5A 5D3MB 3DQQA 1RQRA 3N5CA 1PEDA 3G2LA 2A0KA 2RHMA 3L8HA 1SUSA 1WXWA 3LT1A 1ADFA 3IBYA 3N7AA 1CR4A 1ZXLA 4E4RA 1Y8ZA 2V6JA 1H0SA 1E0DA 2QTFA 3SZLA 3PUKA 2C9YA 5HTOA 3LS2A 4XKJA 3GLFA 2XMDA 1VA5A 2GTHA 2VA9A 1Z29A 2RIPA 2G09A 5CHEA 3DBRB 5F64A 1H8EA 1OYVA 3FMFA 3LW7A 5H81A 3LT4A 2HX1A 1J2TA 4NE7A 4JS0A 2IQIA 3I5MA 1WA5A 3HSKA 4RK4A 4HS9A 1YQTA 5DI3B 4JVLA 1AH2A 1QH1A 4DSNA 2OB1A 4O1IA 2GAIA 4EYEA 4OSPA 3K15A 1MV8A 1RHQA 2WICA 3TCNA 1JG6A 5EXPA 1YR1A 3TLMA 3WAKA 2CCGA 3JVVA 1PD0A 1UDAA 1KEUA 1V47A 3ZCTA 1E5LA 1RC8A 2AMJA 2Q0SA 3ORSA 4X94A 1I4EB 5KSYA 2YUTA 2P78A 1Y1QA 2IOYA 3IQXA 4L4ZA 3QJ5A 2WVAA 3UTCA 4MX8A 1I33A 1YUNA 3UHOA 1KQ3A 2A6PA 1XU9A 1LEHA 2YJ4A 2BLLA 3AIMA 3L4BA 5HRAA 3E35A 4Q3EA 1ZI9A 2F48A 3BMNB 3NLLA 4NU5A 4KITB 2HA7A 2I65A 3C98A 3KLOA 1NXPA 4KIFA 3WGLA 4ZVVA 1NXSA 5IEJA 1ENYA 1P1IA 3TECE 1WZCA 3FFXA 3LH5A 3GK3A 2JCXA 2QYSA 2X77A 4EMUA 2J3HA 3VPBA 5J4HA 2GLUA 5LZ9A 5I7WA 2NYUA 1WCXA 2XUJA 3E22B 5F9MA 3PC8C 3C45A 1A4IA 3TQSA 4BEJA 4XYGA 6ABPA 1Z25A 1IHXA 3ZVNA 4CM3A 4WUVA 2WWTA 3U5ZB 5C3MA 3ND9A 2JGJA 2I34A 3PFHA 5K5EA 2NUAA 3S1AA 3DBVO 2QD2A 2BKAA 3HVJA 1ZK4A 3D4NA 4Q93A 1BQ4A 4U6QA 1TKCA 1Q22A 4MS3A 1PJAA 1JI3A 2BGTA 2FPKA 2BEJA 3CKLA 5IMSA 4X62B 3P0IA 2PJZA 2ZYTX 3INNA 1JXQA 1FSFA 4HNVA 3F98A 4L7QA 4H3VA 5TPZD 1P4AA 5DXJA 2IU0A 5FLEX 3EXEB 3RU3A 1OFTA 4H16A 4HAZA 1NXXA 4LWPA 2P75A 2XDAA 3VYSB 4BNGA 4BGIA 1HDEA 2X0IA 4UHEA 4LTNA 5A04A 4MCHA 2WTUA 1MTOA 3HEBA 5IANA 2OBNA 1UDRA 1UCFA 2Q46A 2R6DA 5ENDA 3OCUA 1NXOA 3LXRA 3ONFA 4O4HA 3JQAB 4KEAA 1KY3A 3CB4A 1EVQA 3FGOA 5DW0A 1LQTA 5FBQB 3SX4A 4Z7QB 3I5XA 2ZBUA 3IEKA 4BYGA 2DETA 3GLHB 4D8YA 3BN3A 3E8MA 1ZAYA 2ATCA 3AVYA 1U0SY 2C5HA 2O3RA 4DLBA 4MEAA 3Q7IA 4YJ2B 2ZM6B 4F7DA 3RAPR 5EC8A 5JCJA 4JA2A 4C4YA 2GSDA 1U2GA 2EEPA 4TOIA 4WLOA 2HF2A 1SZPA 4NOJA 4S1PA 4X41A 2AJDA 3TL6A 3ZIAD 4D99A 1AK9A 4NR0A 3DVAA 3ZY6A 4D9EA 3MGCA 5KTRA 2VS1A 1LBSA 2GN6A 2R00A 4JX9A 3DG9A 3K92A 2JJ1A 1RXVA 2WFLA 1NMSA 5A03A 1LI4A 1AV7A 4PZAA 5E7QA 1SOAA 5KSOA 3L4KA 4U2FA 1Y4ZA 3FDJA 4BXOB 3W8EA 5JNWA 3B3GA 1ZR4A 5JVDF 2QI9C 2PXHA 4OHBA 2GASA 4G1MB 1T8WA 4IDNA 3NC4A 4WAUA 1FFGA 4KQ2A 4YP5A 1ZN2A 5HJ2A 1HLPA 5JSFA 2NTNA 3B51X 5I7OA 2WZBA 2O8BA 4HDRA 4LHZA 1JIXA 4XGQA 2Z8XA 5BPFA 2J08A 2XMPA 1ZN7A 3IEXA 1F6DA 1WW3A 2OOKA 4KYVA 4DLZA 4WXYB 3ZD7A 1XRPA 1ZGBA 4XLLA 2ODBA 1D0VA 3B1FA 4RMHA 3VH4A 2RHCA 3FH0A 3TPCA 2OP1A 2ZSKA 4EYQA 1EH5A 4LV6A 1W48A 3MGKA 5ALEA 5DX8A 4P4LA 4KK3A 1I14A 3MS7A 3HPRA 3AR7A 3LY8A 4R1UA 1NBMD 4UULA 5AOCA 5WRFA 4MKIA 1F8YA 1J7JA 2XCUA 4F2GA 5LPNA 1E89A 3B1ZA 2J0EA 1GRRA 5DT2A 3AYZB 3G82C 1G7SA 4B84A 1XZAA 5LZ5A 2HBZA 4L74A 3CZQA 2ZJOA 1NBOA 5GPBA 4A9AA 5K8UA 2ZK7A 5KYTA 1GPAA 2BTQA 6ADHA 2DY1A 5IVHA 1Q0UA 2OWEA 2X8JB 3V1YA 1JRLA 2P4EA 3PP8A 4ZN6A 5JCPA 2B5OA 3H6HA 4V2IA 2P3LA 1Q1NA 1WUIS 2BCJQ 3OU2A 2VDOB 1TTQB 2R7LA 3FJOA 2IP2A 1M1NA 1RZ3A 3TTXA 5IX8A 3F1LA 1GZSA 3OLCX 2II6A 4FYKA 2QQ5A 3DKKA 2EGHA 1WJGA 4JZKA 4UXHA 1G5RA 5H9VA 3D43A 5FXMA 1NVTA 1I51A 3BIOA 4EVQA 5L3QA 2XXJA 3UAWA 2ZE8A 2OHIA 3QBVA 3PD0A 5AHXA 4EUEA 2XUIA 1QOZA 1ZGZA 5CBPA 3QFFA 5LQAA 4X24A 4QUHA 2EJVA 3U16A 1TUBA 4C2BA 2FDRA 5FR2A 4P8RA 4EI9A 3HJAA 3SQOA 4RZIA 1VG8A 4AY6A 4MWSA 4DM7A 3VI3B 5JV5A 1M5UA 4BP8A 4RPHA 2R5FA 5IDYA 3WLNA 3ZBPA 3E8XA 3QTBA 3STWA 3T1HB 1GUYA 2QP9X 1B74A 3BRSA 1Y37A 2Z30A 3N2NA 5BMVF 4RFSA 2B0CA 1ZM7A 4UQLA 3TGWA 2R6R1 1B41A 3GAMA 3U4CA 2FMHA 4N0EA 1W4RA 3MLAA 5GAJA 2VWQA 2OC4A 4U7FA 3LNCA 4RD4A 3CZRA 2I6XA 2Y2VA 3O2JA 3VNRA 4BNZA 3DTNA 2FPXA 4CJXA 5HBRA 2FEPA 2JD1A 3L18A 4I50A 4R9RA 2O7VA 4MLCA 4NS1A 4LKOA 5BN4A 5HOQA 3ADBA 1PZGA 3KTOA 2A0UA 2Y0BA 1ZLXA 4RDHA 3F6EX 1CUSA 3C5VA 2C58A 3DL2A 1SXPA 4H4EA 3RSHA 1CZRA 1IHPA 1U63A 2RONA 2CW5A 4P31A 4OMDA 5CB8A 3VVMA 3M4YA 2PUWA 4DJFC 1B8NA 2FMXA 1P73A 5E8RA 1NBME 2FW7A 3HDQA 2XMBA 3VAZA 3AJ8A 3JR7A 3Q1LA 4Q0MA 5CRIA 6PFKA 1PR3A 3QPVA 3OO0A 1EG2A 2VJAA 2A84A 2I3DA 4HN4B 4TWRA 4GYKA 4AJEA 1TIKA 2O8EA 5HHTA 4YJ3F 3WIVA 1ZLYA 2BEVA 1PEKE 3QPBA 1JHPA 1PFYA 1YB7A 1B23P 2C88A 4NG4A 1JFSA 3KYDB 1NMYA 1H8HD 3HYTA 4HRXA 1GNQA 1HOXA 1QCZA 4TTIA 3ROGA 4HWGA 4UNSA 1A2QA 3R8XA 3COVA 1IG0A 3AVTA 4JIMA 3GRYA 1DXQA 1EEXB 2IYFA 1YV9A 2ZVPX 3H65A 3L05A 3RU7A 2Z6VA 3CTPA 3Q8KA 2Q49A 2PGIA 4GRDA 4LEIA 3U7HB 4WW0A 4L75A 5NULA 1U5BA 5HKAA 3E5NA 4EG6A 1Z07A 3I45A 3EEQA 1OJ7A 3EVNA 1QGUA 5DV9A 4QAQA 2ZRNA 2W9XA 2XR1A 5K01A 3OUTA 2I91A 4X92A 3GRUA 1WKCA 2P4QA 3ER6A 2YVUA 1G8PA 3R5KA 3NP9A 4PQRA 4YDHB 4DQXA 3I01M 1OH5A 4F3TA 1IZ9A 4UM5A 4TKVB 1W8IA 4M8LA 2XRMA 3LWBA 2B9VA 5AXCA 3TN7A 2WIKA 3JYLA 2M32A 4MVCA 4UE3S 4IDGA 1IDOA 1LZLA 4C3VA 2AZXA 1G8HA 3IGFA 4DGSA 4EX6A 4ZHQF 4XARA 1UC4B 1FEZA 3QHPA 3SNKA 4LZWA 5JI3E 2WE7A 3EISA 1E9VA 3PUHA 1JNYA 3DW1X 4ZP1A 3SK0A 2NUBA 4Y2GA 5KPJA 1KEWA 4UCXA 1H8ED 3RUHA 4RKFA 3KELA 2WP0A 4HAVA 3RF7A 3U80A 4PBSA 3F6BX 5BT9A 3X2EA 1E2LA 1P5JA 1BKDR 4ZFNA 1VHJA 3HKCA 3T3NA 1CY1A 2CE7A 4NZNA 4ZOCA 4DQ0A 3THSA 3H1FA 4CL3A 4ERXA 3DOEA 5FRDA 4ED9A 2YW2A 4J29A 3V7WA 1N3LA 1HPLA 1VYHA 4RIHA 3HUTA 2D13A 4PPYA 5J9FA 1FMFA 2PSHA 1EEHA 4WY8A 4JJ6A 4N8DA 1AA9A 5FA8A 4I99A 2FE1A 4RVOA 2A3RA 2YRXA 3GROA 2GPNA 2F3PA 1E9SA 3HU2A 4HQOA 4DDTA 1OFUA 2JLYA 4MQ4A 5KNLA 3WA7A 3UMRA 1XJCA 1WUHS 2R4UA 1HY3A 1I4OA 2EOAA 2GM5A 2FZ5A 4DHEA 1I7LA 3QLEA 3LDGA 3ASVA 1S2MA 3T7SA 3V8BA 1Z2CA 2JLRA 1HXHA 1VHQA 3BOSA 2NZ8A 1YCHA 2D0OB 3B9BA 3KX2A 1GCGA 4TKUB 4US1R 3T7EA 5HXAA 1EZZA 2NN3C 2OCDA 4XD2A 3RASA 4EKEA 2UYHA 4B4UA 1NKTA 4NZYA 5J5AA 1BMTA 4WK0B 1E3WB 2H8GA 2HDOA 4B7UA 2QBYA 1PZEA 3O9MA 4HZUA 3TIFA 1NN1A 1PYGA 3ZWMA 3D3WB 2Y1OA 1E0SA 1CRQA 1FS5A 2CFRA 3O73A 4OAPA 2MINA 3FWKA 4WKPA 1ICEA 1U04A 2MR6A 2YICA 4YUXA 4GKJB 3AL3A 4GBED 2FJPA 2JFGA 3GQBB 4C4ZA 3S7TA 2CXUA 4F04A 1ULHA 3LQQA 1X8LA 2H51A 4CKBA 4I9UA 4DR3B 2H17A 4DC9A 5LQRA 1TCVA 1Y6GA 3BSYA 4KE8A 1NW6A 3UWDA 1Y33E 3RGGA 5HQJA 5CNJA 4Z3DA 4DDHA 1E1LA 1C4KA 1XDBA 2HJSA 1DKMA 3BXHA 1E1CA 3BZWA 1A69A 1OI2A 4LJ6A 3WGYA 5C5CA 2E6KA 4GWLA 4OD0A 1JLSA 4GI1A 4DILA 2GM9A 1GFSA 2PE5A 1U1CA 2BF7A 4B7XA 2JD2A 3VZPA 3LOUA 1XTPA 4H1WA 3EXHB 1DPFA 4L5AA 1KKMA 4FLEA 1EWRA 5AW5A 3MC1A 2B5VA 2XPCA 3ZWOA 4V1CA 1WUTA 4FBLA 3RSFA 4F3RA 1NNEA 3PXAA 1QYCA 4A8JB 1ZISA 1R4NB 2DE0X 1CYEA 2GHTA 5G40A 4KODA 2DG2A 3HFSA 3M6MD 1AKEA 1BEZA 1OR8A 1S1MA 2W2OA 2DSTA 1EX7A 3AR9A 3HBAA 4WQMA 1BXGA 2OBBA 5J5VA 2G06A 4S1WA 2IS6A 5L7TA 4GAEA 3LQ2A 3M8KA 1PN3A 1ZEJA 3NWPA 4WA8A 1EUQA 3H4MA 2N0SA 4BIIA 1SOWA 2CNNA 4H7KA 1TU3A 4I2VA 1HNWB 4ND2A 4IXDA 4PAWA 3U26A 2DT8A 1TO2E 3IJRA 3LUPA 4BNMA 4CM6A 2C2ZA 1CS0A 5KKCA 2AG8A 2O14A 4ND8B 3KUXA 5GVRA 1GCOA 4WNCA 1SUEA 2HPHA 5BR7A 3E7DA 4HG2A 4LCJA 3W90A 4DTIA 1GG2A 1N5MA 3GGPA 4LVUA 5B1YA 1Z8DA 3SE0A 1K08A 1KL7A 1VL0A 2QRVB 3H8SA 5EXSA 1OROA 5LXTB 4FMBB 1QS0B 2Y0PA 4P7JA 3VU9B 1F12A 4G4IA 4YLEA 3OTWA 4AURA 2CYBA 4LOIA 4W8GA 1KYWA 3ZCRA 3FNGA 5LNK1 1PQUA 1ZOPA 4KFRA 5EERA 1EBUA 3STVA 2FPLA 4KR6A 2JZCA 3S5UA 2VK2A 4AVYA 3F73A 3GMTA 1W73A 3NDJA 3MQFA 3T5PA 2OUKA 3FA2A 3VPCA 4MUIA 1LF5A 3QMWA 2W42A 1HG1A 1ODTC 2AG0A 3A2LA 1RQ7A 3QX8A 5EIBC 4B80A 3CLSC 1E2JA 4DRXA 4PAGA 2CEKA 2D2XA 4M1TA 3O8OB 4HN9A 4MQ6A 3FIUA 4GOMD 1AHPA 1XTVA 3WL4A 5EP3A 2ZSEA 3AEYA 3EFEA 2LKDA 3IOCA 3M34A 4X7RA 3LBFA 1NBIA 4HXFB 4RDXA 4AO6A 2I55A 3BHIA 2QPOA 1HMYA 1UINA 4H7PA 1NKSA 3K1AA 3GLGB 1E2NA 1WSBA 3CZPA 4QELA 3AXTA 3HWX1 3VMMA 3U09A 1N32B 4IHJB 1G6OA 2QRQA 4YI5A 5P21A 1FPMA 1DI0A 3FKSA 5ARCA 2HRBA 1C3JA 2FOLA 3OTGA 5ITZB 3B1WA 1WQ4A 2C5SA 4FCVA 1MJ5A 5K8JB 1Q1GA 1AQNA 2QJFA 1OLSB 4N03A 4W9NA 5JD5A 4ZVMA 3ASUA 1V6SA 1ZEMA 4L4UA 1S7GA 3S2YA 1XT6A 5JPIA 3HNRA 2F43B 4D6XA 4EEXA 3EUFA 3MJFA 2AYXA 2EERA 1QMGA 4D8VA 3SE7A 5ICEA 5FTKA 1QFXA 2LKCA 3IDSA 4R01A 1QV9A 1W49A 4G3XA 5H02A 2QMQA 4TUYA 1K8QA 3BXPA 4XJXA 1FVHA 1VLHA 3KOWA 2HADA 1QE0A 4KO3S 4M37A 1Y4AE 3L92A 3GZNB 2ZKLA 4K9OA 1O4VA 4KI7A 4NENA 5CURA 5FWYB 4BBAA 2XJ4A 4E46A 3WLOA 2Z09A 2XGJA 2XNSA 2ORYA 3AF4A 3IR7A 4HPXB 3NM6B 4LNUB 3BHJA 3CNNA 4EFMA 2X76A 4DOMA 2ZBVA 1SAYA 3RTAA 2XCIA 3FBGA 4JQCA 3CRMA 1KIFA 3GFSA 1NVMB 3NKVA 2QX6A 3Q72A 1XG5A 2VDUE 4QX6A 1KI2A 1DC4A 1CZOA 1BN6A 2QMHA 3B1JA 4MKRA 2QVYX 5AOBA 1I3MA 3VAYA 2Y1GA 1KI3A 3AVVA 3L7LA 4B3RB 1JR6A 2FW1A 4MUKA 3OJWA 4PFSA 1USWA 4JEHA 4UBKA 1QAMA 1OW3B 4HWKA 5EE5B 1MEOA 2BE7A 3ZJ5A 3MNFA 3D8SA 4P2BA 2IPNA 2XXBA 1QF6A 1TW2A 5J5CA 4CMHA 2PUEA 1RSZA 2QX4A 5KVCA 4HQFA 5D2CA 4GOJA 1NE2A 2BGLA 2EF1A 5JH7A 4QGFA 1PV4A 3K0EA 4BVJA 3O1IC 2PCJA 3H6GA 4QBTA 4CM4A 1G8FA 3IKMB 2OD9A 4QQKA 2VA8A 3N70A 3E82A 3BWCA 3OT1B 2GF9A 4FNOA 4D57A 1QUEA 3IBFA 3JQDA 2JPDA 3SHFA 3CF0A 3W3ZB 2I8AA 4IJWA 4FFRA 2PUJA 2BEUB 1WBJB 2ZTSA 1LJUA 2J0UB 5B3KA 4DLUA 2C4TA 4U2EA 4JJKA 4FZ3A 1QOQB 2I99A 2Q1SA 3QMVA 1P7PA 2CMGA 3F0TA 4DYVA 3GBVA 4G5FA 4NBVA 2VDVE 1ODLA 4GPIB 5DK6A 3VOTA 4DRZA 2BF4A 3LX6A 5HJ7A 3RSQA 1WPXA 3RJ9A 3W5DA 5AK0A 3P5SA 4BCBA 2DULA 2D59A 1LBEA 4AY2A 3GGCA 3ZW8A 3K09C 3JZAA 1Y6FA 1NAHA 1ANKA 1XO1A 3N39C 2O8FB 5EUCA 3WRXC 4L76A 2J6IA 2R8PA 1CTQA 1N6OA 4QXOA 3SYTA 1S0UA 2F00A 2BP7B 4LJYA 4MJXA 5EFZA 3KWFA 2WPDD 3MUNA 1IXZA 1XQYA 3PQ6A 4X9XA 5DM60 1YFLA 3ZDDA 1LDYA 2H1HA 4OOEA 4OHWA 1DKOA 2DQYA 4I36A 3B6IA 3I73A 1WSWA 3OZXA 5CP8A 4F21A 1YQWA 2PSEA 4AO7A 4YDQA 3EE6A 4EKDA 3QYPA 3W2IA 4GECA 4REQB 4IIJF 5LP1A 3QVUA 3OPQA 3DV0A 3FNRA 4M1KA 1NFFA 5IK2A 3TLJA 1A98A 2JAOA 4BCDA 1KWGA 4JKOA 4FVTA 2OBLA 2IDZA 3EH2A 1L3BA 1PSZA 2HF9A 2WWRA 4KMSA 2RGNC 3NOXA 3NTLA 4EM6A 3ZGOA 3DR3A 3MXOA 4B46A 4RTKA 2KYRA 1NNI1 4L85A 4D4GA 1QC5A 1FDSA 4ZMRA 3QJGA 1IK6A 2FP4B 3JYQA 2CLKB 1JALA 3R75A 1PJSA 3MLEA 1UDCA 3A9VA 4OP1A 3I2YX 4K88A 2FSPA 3A9TA 4YY3B 3AP1A 2RK3A 5BYBA 3PNPA 3G0HA 1KMQA 3DFIA 1T9ZA 3R6TA 3DA8A 3UJ8A 1YHNA 2ZITA 3IKVA 5SV2A 2WJHA 4ECEA 2BZSA 1KAHA 3Q9NA 5TT1A 3WMXA 5DN9A 1QTRA 2PL3A 1Z5OA 3K6RA 3LT5A 3NWBA 3UKDA 4ND5A 3HY6A 2BELA 2D1YA 3QI2A 1X1SA 3LFUA 2ZJAA 3UKOA 4AO8A 4OJTA 1Z0FA 2VAVA 4WVFA 5K3FB 1NV8A 2OZEA 4MW2A 4WMLA 4QTZA 4DADA 2VYVA 4IUYA 2C2XA 1ZGGA 4CMKA 3ICPA 4KXLA 1XDZA 3SQDA 1ML4A 2R3SA 1PK9A 3QVOA 3FVVA 3KAPA 2EYQA 2V98A 3N8KA 3CR7A 5AYVA 2FZGA 4S0ZA 4JP1A 5HFNA 1YU9A 4PNZA 2JW5A 3QUAA 3S7ZA 1U9ZA 2H0QA 2LRHA 2X2PA 2YHIA 5EUBA 1OILA 2D4AA 5K8LA 2QN1A 2HIAA 5G2OA 2RGDA 1M6EX 3M5DA 3DE1X 1F8XA 4FINA 1TUGA 3F4KA 3VA7A 4TV9F 1ZCAA 5L6LB 1U1IA 1XAJA 3NAQA 1LX7A 4YRRA 1H4TA 1W93A 1E5XA 3NO4A 4ECAA 3LHKA 5JYDA 2PKCA 1W0KD 4TTTS 2BJWA 4B1FA 3EG9A 3QW4B 1V3QE 2QYTA 2V7BA 1LI5A 3SS7X 4BLPA 4UREA 1QQ5A 4C05A 4G8CA 1PJBA 1VDZA 3GJRA 4WZZA 2TSYB 2VUUA 3DH0A 4V39A 3MN1A 4JBNA 1D4OA 3AFGA 3ZCSA 1KXZA 2C42A 2PZKA 3P0EA 4FU0A 1DDOA 1NVDA 3RIEA 3R2JA 4NLLA 1IY2A 3MBOA 5TMBA 4XSVA 2HU2A 4CUKA 5BNWA 5AIBA 1J2RA 1ZP6A 2A9RA 4Y30A 3VSCA 4LSGA 5KAPA 3VDRA 3P0JA 1UXHA 4L28A 3TXYA 1S02A 3KVYA 1KRXA 5DLYA 5F33A 3LBYA 2E4XA 3QNUA 4L5YA 4FDAA 3WJ7A 4F92B 3NT5A 4PYNA 3Q85A 5TQVA 3KSZO 2QTMA 2VBIA 3LYLA 1QYWA 4CV0A 1UBCA 2G17A 2QLBA 2O20A 4HD8A 2WQZA 2EJTA 1E7SA 4WOBA 4GMDA 5JBNA 3ADCA 2EIXA 3UFXA 3A6GA 3MFQA 4LJ5A 3T4UA 1N0UA 1I6LA 3QVWA 1Y3CE 4HEJA 5GGXA 1KK0A 3FM9A 4PLGA 1US8A 3B6JA 2WIBA 4W7HA 4ZVLA 4N47A 1ORDA 4I4IA 4GMKA 1CUAA 4M6WA 3DMTC 1SH7A 1V0JA 3HCWA 4K6OA 3ZCPA 5IBPA 3SKVA 4H4CA 5FBZA 1B2LA 1Z8NA 2IXEA 1YBAA 4G9EA 5AVJA 2JJMA 1YR9A 4GM0A 3PU6A 5TJHA 2HLDD 3GUVA 1YQDA 2EG9A 3QBDA 2NNWB 4ZRMA 3U1TA 4CQJA 4LNHA 2X5OA 2ARKA 3NOVA 3THXA 2QL5A 4YRBA 2NSJA 3INTA 3V7NA 4BX3A 3KQQA 4P3PA 4QNMA 1TYAE 1NU8A 1P9LA 2VG8A 5K1ZA 2HDWA 1Q84A 2QV0A 3LJKA 3D81A 2D7DA 4GKKB 5J4LA 5FOVA 4LZPA 5KWJA 2ZBEA 1ZESA 3OCZA 4HX5A 4DIEA 3I23A 3K0SA 2VRBA 3DTVB 3URMA 1R3DA 2VJCA 4ILEA 3VKVA 4Y9SA 2A7XA 2NIPA 2ETXA 3JQEA 3ZE7A 3KQMA 1H3NA 3O26A 4R8VA 3SLGA 5KYYB 3OJ0A 1XCPA 5K6TA 1JHXA 3ZWQA 1OZAA 5IG2A 3E61A 1WNFA 1R2QA 3CZAA 5G41A 3UG7A 2DFPA 3DMTA 5ES4B 1V16B 5GY7A 1Y34E 1QBGA 3B1KA 4EO9A 5I8WA 2WHQA 3LHIA 2RHHA 4QICA 2ZQ5A 2CSXA 2MDTA 3NDBB 3KKQA 1G19A 3MIIA 4AMVA 4FCTA 4LYGA 3QXSA 1IM5A 4QU8A 1MO2A 4PGMA 5KNDD 5C8YF 4KHZA 4W5WA 4JFRA 2R1VA 1YUMA 3DO6A 3KV3O 4RHTA 2XDQB 4JHXA 1DGQA 5B2ZA 1TRKA 2JLVA 4TWJA 3I62A 1FU7A 5JC8A 3FPLA 3IQIX 2FSVC 3S1LA 2I7VA 1VJGA 2QVGA 4Q48A 1CJBA 1D6JA 4DWJA 4HNHA 2H2IA 1MVLA 1QH8A 3KJZA 4TMKA 1VLMA 1IHDA 3AKDA 1IE3A 2VBFA 4LYYA 3TPFA 4UZEA 1OH8A 4KCGA 2JFHA 2WJAA 4JSTA 1L5QA 4QGGA 3RSCA 2ZT6A 2DKOA 4ZI7A 4FILA 1R4MB 1JAZA 1SHTX 2J6CA 3K6KA 1E79A 1W34A 2AC2A 3QSGA 4G4JA 3U40A 3V9PA 5J58A 1PQWA 1IZZA 1MFZA 4CKZA 3V1LA 4ZYUA 2PL1A 2RSLA 1C7RA 4KQFA 4NDZA 5CMLA 3SOZA 4B3TB 1CS4C 3E7PA 4O4LA 1LBQA 3JAKB 4QJ5A 3F6YA 2ERXA 4RSRA 1N5KA 2XIJA 1O03A 1XU7A 3AKZA 2A1UB 4INJA 3R8CA 4Q3KA 4BQQA 3VBEA 3RC7A 4TWAA 5A0TA 1P8JA 1CY8A 3PC3A 1XCLA 2AEEA 1E61A 3U7QA 3G0OA 1CQIA 4RADA 1Z2EA 1IOVA 2YZGA 3SBEA 4Z1MD 2GZDA 2HXYA 5FTJA 2HAEA 3DT6A 2E48A 1Z16A 1TJNA 1SKAA 3AP3A 3DEFA 3LRPA 3NTRA 3I3SR 3QPAA 1BEUB 4MARA 1NR5A 1E98A 4R54A 3TW4A 3ZNNA 1M6VB 2ZI5A 1E2KA 2D1SA 3AF2A 4Y2RA 3WP1B 1DADA 3HGMA 3GMIA 1BSVA 2IYUA 1RJFA 4W1RA 1NRWA 4LJ8A 3HJHA 3NWJA 4AG6A 1K2WA 2XB4A 2ZCVA 1E7WA 1Y6RA 5EPOA 5FPPA 5BSFA 4DRYA 3P5BA 3L7JA 2FCAA 1F8FA 2BZ1A 2PRSA 4QJ4A 3OPVA 4YN3A 5JI2E 1OUMA 1YBHA 5I7UA 2AHRA 1BXKA 3COWA 3HJNA 3IXLA 3R0JA 5F4BA 4ZHQB 3N0RA 1RYYA 2GEFA 3PNMA 1FNDA 1L5ZA 5LBTA 3K6JA 3T3GA 1T0JB 3C8ZA 4CKEB 5BNIA 3PCRB 4GZ5A 4ZO4A 5CXSA 2J33A 1OLXA 2YWHA 2AF4C 3IMGA 4GSYA 4XASA 3SNHA 3U9SA 1ZWLA 1KTVA 3VZBA 3KOMA 3ND7A 2C20A 3GLGE 5CJ2A 2O23A 5LZ7A 3D0OA 1HNNA 4Q47A 4AS2A 2JZNA 3IDAA 3RVBA 1KEVA 1WB5A 4HQNA 1L6RA 3D7MA 2UZ4A 4CEIB 2JIQA 4J43A 1U3DA 3CVYA 1HYEA 2B30A 3ROTA 2XZOA 2JJ8A 5DB4A 3ZU2A 1IPFA 2OAQ1 3DBLA 4V0MA 5CIWA 2F3SA 1YSCA 1OXVA 1PFGA 3B78A 4BNDB 1U0JA 2IU4A 1PUJA 3HU3A 1G20A 4N8SA 2FW0A 2VDNB 3LC1O 4K0RA 1EDDA 2ZYHA 1SD1A 2G8LA 3C4VA 1H8HA 1SKYB 3OZRA 4NNJA 3SSNA 1N3BA 5IYZB 3MJ4A 4YMUA 1EBBA 1ZYUA 1DIHA 1DJLA 1TADA 1UMBA 1V43A 2D1RA 2ZWPA 2R7AA 3FOBA 2J5RA 4XD7A 1Q83A 4C89A 4GBJA 4KYIB 1G2IA 2P2DA 4XPIB 3S2ZA 2PFGA 3PX7A 3GAZA 3W05A 2PX4A 2CDNA 1YB1A 5HQ3A 4J7CA 4QUGA 5FI0B 3PRHA 4JJZA 4N4AA 2B8WA 3GAAA 4OQDA 1SXJD 1WU7A 5EEHA 1U0TA 2GHRA 4P84A 1KFEB 3KXKA 2P3SA 2YIVX 4MV5A 1EAYA 5E95A 3UJNA 3CMMA 2IF2A 1SRQA 3NHBA 3TJRA 4LHXA 1DRUA 4NATA 2J3MA 4L0MA 1QP8A 4BVLA 1YB2A 1ZINA 3FYTA 3I1FA 3M1AA 4K40A 5CYFA 5AICA 2QMYA 4RTLA 4RVSA 4C5CA 5LP6C 3CO5A 3IV6A 2OG2A 4CCAA 5CB4A 2HT1A 4X20A 4EJ6A 2ESRA 3KR2A 3Q87B 4IIEA 1M5TA 3KYIB 3NP7A 3USZA 1R27A 4YT2A 1GOTA 2CMHA 4XB2A 3PUXA 4CTJA 1G64A 1VLJA 3UB3A 4MXDA 4MVJH 4NVRA 4HEQA 4EMTA 4QEKA 4WKGA 1KGSA 2CJYA 3V33A 2JAQA 2OM2A 2UZ1B 3ZQ4A 4E88A 1EFAA 1NVXQ 4BQIA 4QUBA 5DM1A 2OGTA 2AFIA 2F7SA 1FMTA 1Y4DE 2MU1A 2OFXA 4JC4A 5BOSA 1JVSA 2MSEB 5JRJA 2RI0A 1IEQA 2ADOA 2ZIFA 3IUQA 3T9FA 3TX2A 2QTCA 3VR5D 1PGNA 3CW9A 3IBGA 4B71A 2HC9A 3Q10A 5JNVA 1RXUA 3GT4A 5REQB 2PTHA 1RRVA 1II8B 4QUKA 3LNTA 4X1IB 4ZQBA 3SXPA 4JLWA 4AUNA 3OQ1A 4W5JA 1AIPA 4RJTA 1DUVG 1GFWA 2VHXA 4ZJYA 1KH1A 3EGXB 1E8DA 2HREA 5IBCA 4MHTA 4XI9A 3RQSA 1E7YA 4F4CA 1G55A 1CT9A 3W3AD 3NHKA 1G17A 4MR9A 3VHRA 2RHLA 4RK0A 2EHJA 2Q5EA 4W5RA 3M4NA 4IH4A 1U8ZA 5EZYA 5KDDA 4G09A 1TECE 3TNJA 1IRXA 1I4TD 2Q99A 2FPWA 4DR5B 3CSDA 2HU7A 4NZPA 4TMYA 1XVLA 5ELLA 1YS2X 2H7XA 3IT0A 5F1KA 4ZEVA 3U3RA 2HJWA 3HY3A 3VTFA 1W76A 2AX3A 2HHCA 4MW6A 1BG6A 3ELUA 1TAUA 3CX3A 3GZTB 1WQ3A 3CX6A 3CM0A 3PJRA 3LQ1A 4RMNA 1BH6A 1FS4A 1PZXA 3PDHA 1ND5A 4ER3A 4YCMA 2HO4A 3RHFA 3FPKA 4A0GA 3L1HA 1J97A 5AVKA 5KOJB 1APBA 4B3GA 2B4AA 3C3AA 3LCCA 4C4AA 1TZCA 4LECA 2PYIA 1TM4E 1GYRA 4GWKA 3WLFA 2QL7A 4G4SO 4S1NA 4EITA 4EZEA 4OGGA 4U0KA 3WGJA 2AN3A 1YGYA 2XF2A 4QOJA 4BL5A 2C3YA 4C6TB 4CUJA 4ZOLB 3I0NA 2ZE7A 1KP2A 1I36A 1KAGA 1L4BA 1T6XA 1ULTA 4JROA 4W5TA 3KOOA 2VCEA 3OHMA 2RARA 1YZ3A 2XAAA 2F55A 3WYAA 3WYBA 2R97A 3F7OA 5G0TA 4Z0PA 2YBEA 4F8EA 3DMFA 3GFOA 2BHTA 2GAFA 1JAHA 1K7EB 3BSSA 4PGHA 4Q02A 5AXBA 2FUNB 3RANA 3RQIA 2D6FA 4B4WA 1X6VA 2F62A 3Q8XB 4ARIA 1X9IA 5K6RA 1OGIA 2OK7A 2RAPA 5HZKA 3QGMA 1Z0KA 2J3JA 4URZR 2VATA 3FMVA 4GVXA 2A7QA 2HSWA 2EQAA 3KS9A 3NVDA 1EX9A 2OFOA 2R1ZA 2RJNA 3OQBA 3R9IA 4EHHA 5LQMA 1P18A 2ZWVA 5AOVA 1H5UA 4KE7A 1F3OA 1PTJA 1P2GA 3H84A 1T9GR 4Q1EA 1M2VA 5A7GA 1STOA 1T9CA 3EULA 1K9SA 2VNHA 4KUGA 5DYNA 3VR4A 4AP5A 5CU7A 5DWDA 3MAJA 5E6RA 4BQOA 3A9RA 3BK7A 4D3ZA 3HCFA 4LFBB 1XELA 2YINC 3LV8A 4BKOA 1AZWA 1ZUWA 1JPUA 3EIXA 3Q4GA 3K5HA 4BO3A 1YI0A 3DYBA 2QW1A 3D3EA 1OLOA 1B16A 3D8RA 3IALA 3L5KA 4IEEA 4MQFA 4RH1A 2ONKA 3O74A 4QM7A 4L50A 8GPBA 2XD9A 5L40A 1GTSA 4QYIA 3IILA 1ACLA 4LHWA 3K2BA 3NUGA 2BFNA 4RM2A 1N1EA 4H77A 5FI1B 5HZMA 5EQJB 5E1DA 3LCVB 2L2QA 4FHEA 3SYMA 3LL7A 1E8MA 1G63A 3H4VA 3LO8A 4TVOA 3N0XA 4CCWA 3GMSA 1TVMA 5FA6A 4ZK6A 1KC3A 2I4TA 2CUKA 2LWIA 1E9FA 5DJ5A 4CETA 5JROA 3P52A 2I6GA 1UBNA 1A9SA 1NNLA 1CLUA 2GT1A 2QU8A 3KZNA 4FGUA 5FPQA 5K51A 3USCS 4BFXA 5LYYA 4AJPA 4DR7B 1T3SA 2N42A 2VPXA 4AN4A 1IVYA 2DPYA 5I8ZA 1UR5A 3U4HA 2ES4A 5IJ0B 1CUCA 1YAHA 1NN3A 1P45A 2J48A 2JHFA 1TM5E 2Q2WA 3C3KA 2VFAA 2OESA 3FYUB 2RHGB 3G8YA 3IB3A 4QXPA 4X44A 4ZVNA 2COKA 1UPUA 3A06A 1PJZA 1QZUA 1PFQA 1X7XB 3BDAA 3R3XA 4LGVA 2PXAA 1V7QA 4ZGGA 2G72A 1MG5A 2RBGA 3G2JA 1F8UA 2FDCA 2FPUA 5K09A 3LUKA 4ZAGA 1WXGA 1E4YA 1W7AA 3NDRA 3VDNB 4C0AC 4L02A 4COKA 1V2HE 2HYIC 2O0MA 3CCBA 4MUXA 3VKGA 1JLHA 3EDCA 3BF8A 5A5DA 3IHLA 1E66A 2ECFA 2MYNA 1OBOA 1NBHA 1O3YA 2JLQA 1KEZA 1EAMA 3BQMB 3DTVD 4JI3B 3B3FA 4KGDA 4RD3A 3PRKE 3U1VA 1DU4A 5AUNB 1UH5A 1L5OA 2WLSA 2J3KA 3DM9B 3CWQA 1N0VC 2CVOA 1G7TA 3U48A 3VDMA 4PO9A 3U4MA 4LBYA 4CF5A 3BBLA 3EHDA 1COZA 1WZIA 2FB9A 3GNQA 4YXWA 4DCVA 5BV8A 2J46A 4MICA 2GUGA 4Q12A 5ED0A 1EE2A 1NMZA 3KUKA 2L17A 2EFCB 3SXUA 3HV0A 2C3MA 4J90A 1JXMA 5EE0A 4HSGA 1E1RA 1VZ2A 4D97A 5MN4A 5TLSA 3UVEA 1IVNA 2B9EA 4N1AA 5C5DA 5IKEA 1QHGA 2EV9A 4I0WB 1CRLA 3QWHA 1NVAA 1GRVA 2H5EA 2QRZA 3OZIA 4OAOA 5GQSA 1K92A 4TRRA 4XJSA 3MEQA 3WGQA 2VDLB 1Y7TA 1ZZGA 4LF6B 3LCUA 2HHJA 3EGIA 4PFQA 2WHYA 3VNVA 5FADA 4B2PA 1OYWA 1JQEA 3P9KA 2IFTA 4IJQA 4RD1A 5TV2A 4B6QA 1RPAA 2UU9B 1TTHA 3ORQA 4OEHA 1O6CA 3H2BA 3G0DA 1QDLB 4U1RA 3NIGB 5MN5A 3NWOA 5EKDA 4DIUA 5DXFA 4K81B 2XUDA 3KPUA 5IC4A 4TN5A 521PA 1JGTA 2FP3A 3L8ZA 3CN7A 1CUGA 2QV7A 2IUYA 4EB6B 2BR3A 5A9RA 3J7TA 4LXIA 3UJCA 2VKQA 1DJOA 3J7AC 3S2EA 1WUYA 3OCXA 2IEDA 2W4IA 1T6YA 3AM5A 3HACA 4MMYB 4NBRA 3NIBA 4MLZA 1CBUA 2R8XA 3GUUA 4DIOA 1CG6A 3H9CA 3RDPA 1N2XA 2DERA 1C30B 1T1GA 3A9UA 5JAPA 5T4HA 1D8AA 1KBZA 4CDMA 3AOGA 3OLYA 1QGYA 4RS4A 1U0FA 1YO6A 2FPPA 1PT8A 1U8TA 1SVUA 1FNCA 3FPBA 4P38A 1S5PA 3PYMA 3GWGA 4PC6A 1C1XB 2ZATA 3TDMA 3ZHZA 3E0XA 3S70A 1U8FO 3P19A 4CLHA 3G8BA 4K9RA 4OTZA 4Y6RA 4YJ3B 2JIMA 2NO6A 2I76A 2Q7XA 4C3UA 1QHXA 3FPEA 4ZK2A 1C7FA 2NXWA 3HWSA 4HFRA 4L0CA 1RRCA 4EBBA 3GEMA 5AJWA 4QQ8A 4HSEA 1J8YF 2VDWB 2JK1A 4HVCA 4YCSA 4DY6A 4CL2A 2W48A 2A0WA 4M76B 4CLRA 3VVBA 3ZD9A 3BHNA 1UZMA 2REQA 3ML1A 2DT5A 4FOPA 3QE2A 4P0QB 1J70A 2BD0A 4WKOA 3R9XB 1JIVA 4MWEA 4N6NA 3QKWA 4D9CA 2CXOA 2VJKA 3L40A 3WHLA 5KCZA 3K30A 1S3SA 3ICCA 4B7CA 3OU6A 4HNAB 3I4FA 2YNMA 3QU4A 4MWCA 2V5AA 1G5FA 3H5TA 3F71A 2EJUA 2IUTA 4MUFA 2VZ9A 4NMHA 5I9NA 1AY0A 1RNLA 4QRHA 3NZEA 1XTJA 1D04A 4TVBA 2QJTA 4TQGA 3L8CA