4MRMB

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist phaclofen
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
415
structure length
400
Chain Sequence
SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/antagonist
total genus 137
structure length 400
sequence length 415
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mrmB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mrmB01
4LZLA 1NXTA 1MIHA 5ABPA 2F8SA 1PNRA 3Q7SA 3QK7A 5TQ2B 1VKRA 2LUOA 2FMHA 4JASB 2L19A 2MSLA 1JH9A 1KMIY 1JF8A 4XFKA 1RPJA 1ABFA 1K68A 4Z9AA 3HVRA 4EYGA 3N0XA 5JNRA 2LPMA 5CNIA 5TQ2A 2ID7A 3N75A 4RK5A 4EGSA 3FDFA 3K4HA 3GV0A 3GRCA 4YP9A 3H5LA 4Q7EA 4G0PA 3HXMA 3VNAA 3SNKA 1USGA 1D1QA 2PL9A 3Q9SA 3RVPA 5JS1A 3LKBA 5D2CA 3O2SB 4MGEA 3HUUA 3KG2A 4RSMA 2JVJA 1LJLA 1NXXA 4YR7A 2H3HA 4KMRA 3OQMA 1EFAA 1YK1A 3OLYA 4EVSA 1LJUA 1TMYA 4GNRA 2WY2D 1TLFA 1SXIA 2IOYA 3HUTA 1HEYA 4KNYA 4YS6A 1E6LA 1M2FA 3A3KA 5EWJB 4WUTA 2HPHA 4MQEB 1YTUA 5DLEA 1L5YA 4HNSA 4LRQA 3QEKA 3SAJA 4KQCA 5C5CA 3H5WA 2DRIA 2PUFA 5EWJA 3CS3A 4H60A 4MQEA 2FQYA 2A9RA 4P98A 3QX8A 5HSGA 3O21A 2AYZA 4IRXA 2IKSA 4Q6WA 4WWHA 3LFTA 2MYTA 4EVQA 1JFSA 1ZDMA 3F6CA 4RY9A 3UK0A 6CHYA 3RVLA 5JNVA 4F12A 1JFVA 4DQDA 2E4WA 2CHEA 4PE5B 3GL9A 1APBA 1BA2A 4JB2A 4JOQA 1TM2A 3ROFA 4NCBA 3QLVA 4D74A 4ML3A 3OQNA 4RXUA 5KC9A 4KK4A 3DLHA 4W5RA 3HM9A 3IPCA 3I42A 2CD7A 4F06A 3FFTA 5TQJA 1ZVVA 3HJFA 2FVYA 4WT7A 1ZN2A 2HQOA 4LE0A 3C3KA 2B4AA 4RDCA 2R48A 2HQBA 3H1GA 3HDVA 4F11A 2NT4A 1NXOA 1PHRA 4N47A 2QV0A 5I4CA 4RK7A 1ZAYA 1QO0A 2E4XA 2ZAYA 2YHBA 3TB6A 1CHNA 3EULA 1ZH2A 5JNSA 2JK1A 2Q5CA 4G0XA 4H3KB 4LDZA 4KQ9A 1YK0A 1FSPA 1JDNA 1GUDA 1DBWA 4ETMA 2VUHB 4MQFB 1DRKA 4KFCA 3QLUC 5PNTA 1Z13A 1ZHHA 2FSPA 5JNTA 3LUHA 3IPAA 2I6FA 5FWYB 5EWLB 2ID9A 4IGAA 1YMVA 2H0AA 1Z2DA 2PAFA 2FW0A 3DGEC 2IYNA 1Z2EA 4MQFA 2MYUA 2NUBA 3IP6A 1EAYA 1XHFA 4HYEA 5IUJC 1SXGA 2VK2A 5FWYA 5EWLA 4MS1B 5JNUA 4PZ0A 1CEYA 3I5AA 1BDIA 4TLLB 1Z18A 3RVRA 2WB4A 5E3JA 1P6UA 3OMWA 4RS3A 2FMFA 1LK0A 4O1IA 3TD9A 4Z4IA 3HSYA 5C5EA 4N0PA 1KGSA 1NXVA 5TPZA 4KZKA 4MS1A 1RXEA 3N0RA 5GQSA 2FQWA 1OXBB 2PLNA 3GYBA 4M88A 4WXEA 3GWGA 3D8UA 3KHTA 5HQJA 3LKVA 3T95A 4GPAA 3ROTA 2WRZA 1Z17A 3LUCA 4Z4FA 4OG2A 2OENG 5BQ3A 3OQOA 4RXTA 2VUIB 3H75A 1C0EA 2CHFA 3Q15C 3KYJB 1Z16A 3T38A 3C97A 1QKKA 3QX9A 1M5TA 4XAQA 2RJOA 1DBPA 2LBPA 3OLZA 9ABPA 3FFWA 3P9YA 4LDAA 3I45A 4KV7A 4EY3A 4FE7A 3CLKA 4P1ZA 4NCAA 3MF4A 1ISRA 2XDYA 2A9PA 4G86A 3OLXA 2GKGA 2P9HA 4E7OA 4Z4GA 3HS3A 3HK2A 1JL3A 3ILHA 2E4YA 1YVUA 3H5VA 4ZJPA 3QELB 1GUBA 3OO0A 3JS5A 1XHEA 4XARA 4LE1A 3KLOA 3SM9A 1BAPA 1ZITA 1I3CA 4ETIA 4MRMB 1DC7A 2FN9A 3L49A 3N8IA 1ZGZA 3NBMA 2RDMA 3EGCA 3EQZA 3QELA 3SG0A 3GBVA 1QQAA 4MRMA 1RZRA 1QNLA 4D6XA 5IULC 3CFYA 1JLKA 3HZHA 5IUKC 1QP7A 2P4UA 1QO0D 3E3MA 3Q41A 1J56A 1JHZA 4RK1A 4LX8A 2AYXA 4G0MA 1FFWA 4XXHA 4Q6BA 4NV3A 3O1HB 3TX6A 3EQ2A 4MLDA 2R4QA 1TJYA 3GT7A 1QP0A 5IUNC 2JCGA 4G0QA 4KRFA 1P6QA 4QICA 1D1PA 1Z12A 3KYIB 3FGZA 4YLEA 4L85A 4MR9B 2ZWMA 3M9WA 1KRWA 4W5TA 2QSJA 3KTOA 4ZYLA 3O1IC 3EODA 1WETA 3C6QA 3O1JC 3H1EA 3E61A 3IP9A 4MR9A 1PNTA 4YCSA 1DG9A 1PEYA 2RGYA 2L18A 4RK0A 5FWXB 2X7XA 2J48A 3KS9A 3QLUA 3F7NA 7ABPA 4MAAA 1JDPA 3LUGA 1SRRA 1TVMA 3JVIA 2HSGA 4N0QA 1DC8A 3O75A 3I09A 5FWXA 1S8NA 2IPNA 4YWHA 3RVOA 3B2NA 3QLTA 3R0JA 4Z0NA 1AB6A 4ETNA 1DCMA 4YV7A 4ZMRA 5ED4A 2FLKA 4KREA 2JVIA 1LBHA 2LP4Y 4Z4HA 4TN5A 1RNLA 1U2QA 1JWLA 1DZ3A 3A10A 2YHAA 3H1FA 1F4VA 4N03A 4RK6A 5IBQA 4MS3B 4OLAA 3BRQA 5HM6A 1FFSA 3O74A 3BRSA 5KC8A 3HDGA 4N76A 2LIVA 3NNDA 3CZCA 3OLWA 4N41A 2QU7A 4RXMA 2JVKA 2R47A 4RK4A 4MS3A 4MS4B 4S04A 5IC5A 2PUEA 2WJWA 1DBQA 1DCFA 1C4WA 3N6VA 2PL1A 2FMKA 2WMYA 3BILA 3IDOA 3T6KA 1KRXA 2VYCA 1F51E 2HQRA 3HV2A 3RVNA 2PUGA 3H5IA 4MS4A 3NNSA 3UKJA 3EAFA 2R25B 4O5AA 1ZGGA 1A2OA 2PUCA 1GCAA 4WZZA 2O20A 4RY8A 1FFGA 3DGFC 1QP4A 2A9QA 4PICA 3IP5A 1D2AA 1A0OA 3HO1A 5DCLA 3ILYA 2FLWA 1BDJA 4UHKA 5HKOA 4JP1A 2JBAB 4RV5A 4JA2A 1Z25A 5IX8A 3CG4A 3RH0A 1NXSA 3A0UA 3C3WA 3LOPA 1QPZA 4OLBA 3RVQA 2E4VA 4DADA 5FBHA 1VRVA 2QZJA 3LUDA 3F73A 1NATA 5CNKA 4ZPJA 1DP4A 1ZESA 2JBAA 4JB0A 3TMYA 2QR3A 5CHYA 3T8YA 1FQWA 3OO1A 2FEWB 4L4UA 4B09A 5TE9A 1D5WA 1XWWA 4EYQA 1E6KA 3L6UA 3JPWA 2HJ9A 2NZVG 3MM4A 4HNRA 1VLZA 3LUJA 3A0RB 4IF4A 5B3JC 4OTZA 1DJMA 1RXIA 3CKMA 1M5UA 1DRJA 2FXIA 4D6YA 4W5QA 1E2BA 6ABPA 1USIA 3GBPA 4W5OA 2E4UA 2RJNA 1K66A 3KSMA 3Q7TA 2FMIA 1MVOA 4TLMB 1W25A 4UHJA 3MMNA 3OM1A 4OATA 1CYEA 1A04A 4Z9BA 1MB3A 4MR7B 1L5ZA 1USKA 2OQRA 3F6PA 4DN6A 4HNQA 1AB5A 4NQRA 2FEPA 8ABPA 3D02A 5DGCA 4PEVA 3N53A 3BREA 2GBPA 2FKAA 2GWRA 4IILA 4PYRA 5T3YA 5IEJA 2CWDA 1SXHA 4G97A 5IEBA 3TO5A 4MR7A 4RZSA 1YIOA 4KK3A 1E6MA 4OBBA 4S05A 5JNWA 1EWVA 2PMCA 3URMA 5DTEA 3KCNA 3EJWA 3RVSA 4JAVC 4YGXB 4LE2A 3HEBA 2B1JA 2NZUG 4IMJB 2F8TA 2FEKA 5CNJA 1GLGA 4EUKA 2QVCA 2M1ZA 4QPJC 3LTEA 1MAVA 1U04A 2MSWA 3QEMB 1M2EA 5KI6A 3CHYA 1P2FA 5GOTA 5KQPA 1QMPA 1YMUA 4Z4CA 2N9UA 5FBKA 2FQXA 3JY6A 1U2PA 1EWTA 2QW1A 2WJAA 3OMXA 4O1HA 3CU5A 1ZY2A 4ZMSA 4F3TA 3QEMA 3C3MA 2JRLA 3CG0A 5CNMA 2PUAA 2BGGA 5BRJA 1BDHA 3EDCA 3RVJA 3SQNA 4IMIB 5KQLA 3H5TA 1QQBA 2IPMA 1ZH4A 2PJUA 4CBVA 2W42A 5TPWB 5TPZD 5DKFA 1D4ZA 2E4ZA 3CRNA 3O2JA 3K9CA 4MR8B 3G85A 2MYPA 3DZDA 2GI4A 3LUKA 5TPWA 3S99A 3DBIA 3UUGA 4MR8A 1LBIA 3OLVA 3NHMA 1VPWA 3M9XA 4Z99A 2FN8A 2V0NA 1NY5A 4RKRA 3IP7A 1W9HA 3LUAA 1SD5A 1UDRA 1JYEA 3CZ5A 3MA0A 1PUXA 1GCGA 2IPLA 3NHZA 5KQMA 3G1WA 1URPA 1EWKA 2IPAB 4FE4A 4NICA 2QVGA 3JPYA 5JS2A 3JVDA 1JFTA 1MB0A 2JB9A 3Q7RA 1YS7A 4G0YA 4QYWA 1U0SY 1B00A 3CNBA 1JX6A 3HCWA 3DLBA 4MPTA 3OM0A 4H3HB 4RU1A 1H9CA 1R8JA 4EYOA 4G0OA 4TMYA 3FFXA 4RWEA 3QLVC 2PUBA 2L17A 5BRAA 3LUFA 2GX6A 3M6MD 3RVKA 4YO7A 3H5OA 2PKXA 2WWVD 4FB4A 1Z26A 4F8JA 1P8AA 4W5NA 1ABEA 2NT3A 4XLTA 2KYRA 2PUDA 3GA5A 4MLCA 5KQGA 1Z15A 2L2QA 2PE5A 2MSKA 1U8TA 3MYYA 3NNNA 5T7BA 1OXKB 3CTPA 3KLNA 5B3JA 1RZRD 1YS6A 2MYNA 4G0ZA 1IIBA 1EHCA 1NTRA 4YRZA 5BR1A 5TQ0B 2QXYA 1DCKA 4XASA 4QYMA 3KJXA 4EVRA 1BVHA 3JTEA 3VNBA 2IDMA 5F64A 3W9SA 1ISSA 3LMKA 4E7PA 1NXPA 4KVFA 4MYRA 4Y9TA 4KPYA 1NXWA 1T34A 5EWMB 5TQ0A 4Z4EA 1JYFA 4RY0A 1JBEA 3SY8A 3H6GA 3KKEA 4EYKA 3BBLA 3O2QB 5KWSA 1PEAA 2TMYA 3FMVA 5EWMA 2A9OA 2FTKE 2M98A 4WXMA 4RKQA 3RQIA 3RVMA 3H6HA 3MIZA 3N0WA 1Y1LA 3MQ4A
chains in the Genus database with same CATH superfamily
5EJGA 1X77A 2A4MA 2GEVA 4JJEA 1XTPA 2F8SA 4AFNA 2ZBDA 1V2GA 2FMHA 1R4AA 3ETCA 2MSLA 3G2MA 5LQKA 3PFCA 5JCZA 4N65A 4NOJA 3P2JA 2AFVA 4JWKA 2J0SA 3HDQA 3PD7A 4NULA 4ZWNA 4Z7JA 1Z0KA 2ZTLA 4FYXA 4A9AA 4GE0A 2ZYTX 4OQNA 2QYHA 4WZ6A 1SQFA 2JDID 1D2EA 5KQRA 4YP9A 2PY6A 3AKDA 1SU7A 5LA6A 1OLOA 3T5BA 3UMJA 4EJ6A 3ABSB 5KPJA 1NBEA 1RRMA 1UDBA 4EQ6B 1ZRHA 1W49A 3SP1A 1G21B 2BN4A 2VDWA 3TR6A 1E1RA 1OILA 2JZNA 2YWXA 4DMCA 1J5PA 2FMXA 3A1WA 4UE6A 4QOFA 4F0JA 5AW6A 4YRMA 5IMSA 5KS2A 2BBTA 1YK1A 3WZMA 1EUZA 3WFJA 1IOZA 4TV9A 4CE6A 1XT6A 3OLYA 2A1TS 3NDJA 2O8FB 3THRA 1JZTA 2Q2WA 3RD5A 4MRVA 3HXLA 4YJ2B 4YAJA 4DWVA 2IOYA 1C9JA 1OASA 3QI7A 3MTIA 4O4HF 3QKIA 1BROA 1Z8NA 1FP7A 3O0TA 2NZJA 2FG6C 4IINA 4QUIA 4OGWA 2HPHA 4WZAB 5ETJA 4BLUA 5HZHA 3KU4A 4FSXA 3Q7IA 3T9DA 3L7AA 3NTVA 2AFIE 3QZUA 1W46A 2ODWA 2OV6A 2EG9A 2E6KA 3P9SA 2P6RA 1EVKA 1DXOA 2NU8B 3ZCXA 3W5VA 2XMBA 2ZAGA 4A0SA 5IANA 3H1PA 1NPTO 5JXIA 2I3AA 5COAA 5C5IA 5KTMA 5GV7A 2IPXA 1I1HA 4Q6WA 5HUHA 5CD1A 1H85A 3O38A 3QMPA 1GHTA 3RAGA 3O7MA 4F38A 3HRHA 1Z5ZA 2BUBA 2JEOA 3KE9A 3F3KA 3NWJA 4HADA 3UUEA 4TTRA 5ARCA 1DKQA 4F12A 1H4VB 2PS3A 3PDHA 4IOKA 2PJZA 2AXEA 2BLLA 2G7ZA 4LISA 4XSVA 4RF4A 5DHAA 3KTAA 2YIVX 1E63A 1J2YA 1LI4A 2M6RA 4MLPA 4MW4A 4BNGA 5JEEA 3ZIUA 1U0BB 1JG1A 2YDXA 2BZ1A 3REOA 1VECA 2ZYGA 3KVOA 3I42A 5AKZA 1KDPA 2VRCD 1ZUD1 1YNOA 5M3BA 3RS4A 1JHMA 5TQJA 4G26A 4IXTA 1ZVVA 2EJTA 4UNRA 2VH5R 1LK5A 2VJQA 2VP0A 5F3RA 3S1LA 5AW0A 4PLZA 2PT5A 3WYAA 2DLCX 4HC4A 5GTDA 1NHWA 4I5EA 1SVOA 2HPVA 3KKOA 5ALEA 4EO7A 4ZK6A 1G291 3FVRA 1JFLA 3GLKA 3HVIA 2RIPA 3IDFA 1C1DB 1OLXA 2O05A 2R8OA 2WZBA 1XCJA 2OQ2A 3PZRA 3TSZA 4DTCA 5KVCA 1WZCA 1ZM4A 2EKZA 4BE4A 2VPQA 2NXJA 1F8FA 3GQBB 4RHFA 4D57A 4L0QA 2C84A 3VR5H 3L6BA 2I91A 2YJNA 3DLCA 3V48A 2AR0A 1SVUA 3IEIA 1T3SA 5JNSA 1COWA 4D4KA 5HIAA 3H5AA 4G0XA 4W82A 5LB4A 1P2UA 4FHCA 2PNJA 3G7UA 4U7HA 3ZGNA 5BT8A 2FEMA 2PUWA 5TF4A 4AG3A 4GXTA 2HV9A 1I3OA 2WEKA 3QMWA 2DBVO 3PC7A 1LPPA 3V8PA 2G25A 4J0HA 1GAXA 3TG8A 3TJMA 4IOLA 5JFOA 1D1SA 2ZIVB 1HZZC 2DKFA 2CFOA 1Y8RB 1D8TA 3IQHX 1EM8A 4CFSA 1JDVA 1W44A 4KQMA 4RC9A 2E2WA 4RCZA 2PH1A 2WPNA 3BCRA 1CEYA 2A5GA 4GQBA 4PZ0A 5HWSA 5H8WA 3FYDA 3RS3A 1POXA 2QLTA 5LJLA 4R1QA 1Y6ZA 4JR2A 4B0OA 4P5EA 1ZMBA 1PZFA 3A1EA 4PTLA 4QEKA 1GQOA 4QWWA 3SHOA 4JOBA 4OF4A 1YA4A 3T15A 2HTFA 3N0RA 1G8KA 3JQEA 4GLBA 4B7AA 1KKUA 3LQYA 5LUAA 3QWIA 1GTG1 3DDSA 3A7EA 3HO8A 5FYQA 4DCNA 5AK4A 4D44A 3H6KA 3LS2A 4H3VA 4G1MB 2JATA 5B1DA 3OZIA 4WOPA 4LWOA 3SJCA 4WXRA 5ICSA 3AW9A 1LTHR 1D6NA 4JR1A 1XTTA 5B37A 1G63A 2CHFA 4F5ZA 1QZ3A 3QU4A 3R7NA 2PV7A 4L5BA 5LMNB 4NZMA 4RPGA 4URZR 2IKQA 4DA8A 1GPDG 2LKCA 4PIVA 3UMSA 1TVEA 3C1TA 2QRVB 3RSGA 1DC3A 1TK3A 1TE2A 1RAAA 1U3CA 2IRWA 2BBWA 3W3AA 4KV7A 5DYYA 5LBTA 4YRBA 7REQB 2K5UA 1ECPA 4EB6B 1C3XA 4R9SA 4PC7A 2NUPB 4OK3A 1JU4A 2HX1A 2H08A 3DDWA 1J5XA 2G8NA 2GPNA 4G86A 4M38A 5HQTA 3WGTA 1ZQ9A 1FDSA 3C45A 3KZMA 5HZMA 2ZJBA 1H1LA 1WUYA 1AKUA 3T7KA 1DB3A 4PF1A 4DQKA 2OSBA 2YN4A 1JL3A 4KIFA 2PKCA 2CVPA 2G1JA 1WLSA 1YVUA 2FUG6 4Q48A 1RZUA 3EVFA 1A2KC 4U1RA 4XARA 4QGBA 2BFWA 1H8ED 2GEBA 3UMMA 2I4MA 1K9VF 4BGUA 4K40A 3SEFA 1E2DA 1MXFA 2NXWA 5G4KB 4NDZA 3UAWA 3EGCA 3H2BA 4ADSG 3AEKA 1D4OA 3EFHA 3R5XA 3QBEA 4KBFA 5K0FA 3S27A 3OPYB 3ZXIA 2QIPA 3B6IA 4WKNA 3BFXA 4E08A 4NYIQ 1CD5A 2ZE6A 4QEZA 2XTJA 2IFTA 1Y8AA 2R86A 3IAAA 3AZQA 1SUSA 2BI7A 4FP9A 4HGPA 3WMGA 4CV1A 4KXWA 3HRKA 1HORA 1OZHA 4WCFB 5BUSA 1E6CA 4LX8A 3WRVA 4N5IX 2N1MA 4TTIA 1G4HA 1S4QA 5EXXA 3V7UA 2CB0A 1T9GR 2IYRA 2CJFA 4PBTA 3PFIA 5I9MA 3ESZA 1WPGA 3FCEA 3PHLA 4ZT6A 4YBZA 5ICEA 3IBSA 2ONCA 4KRFA 3NJRA 4Q3OA 1P6QA 1C41A 2WAOA 3DVRX 3C7TA 1K97A 3LJKA 3ECCA 2JW5A 1UAYA 2PL5A 4LIPD 1PWZA 5ALTA 2JGDA 3AVQA 3CC8A 1Q1ZA 5AKHA 4L3OA 3ND5A 3EYAA 3H65A 4J90A 4ZJZA 3ZGOA 5GAJA 2ACVA 2OO5C 5EIHA 5C52B 4G0WA 3LHKA 4TRJA 2VPZA 1K7YA 1TKRA 1I24A 3B9PA 3DLAA 1PAUA 1RQ2A 1SM4A 2NZ2A 1QFYA 1QG4A 2JAHA 4F85A 2AN4A 3HB7A 4G4SO 5EERA 5BQXA 3W8NA 5K45A 1EFPB 2IIQA 2W48A 5C8XA 4L27A 5C1DA 5JWOA 1B15A 2VEOA 4J3FA 3D4OA 4AF8A 1EUYA 1YO6A 2PS0A 1I7LA 2H11A 1UXIA 4BTVA 2DJIA 2XPCA 1A7KA 5TY0A 2XUGA 5C18A 4DZRA 3TOZA 4TYWA 1U9ZA 1SWVA 2HPZA 2HA2A 3K9HA 3NHWA 2XD9A 1T0BA 2VEDA 3A26A 4IV5A 2XDQB 3P0FA 4OUDB 4OD0A 4DCTA 4W5WA 1F4VA 1YZYA 2VSQA 1QYXA 1V11A 3B53X 5DYGA 4LBZA 2R6AA 4GHWA 3TUIC 5HDQA 1CUSA 4R7GA 3OE5A 1RADA 1QHSA 3CIFA 3OLWA 4FJ1A 2G9ZA 3DV9A 3FVVA 5SZIA 3SEAA 3DLIA 3V2UA 2QTTA 1GT91 5K0JA 5FORA 4M54A 1KYXA 1WV0A 4CDRA 2HTEA 2JVKA 1P9NA 4KXVA 4NG4A 4NS4A 4ZVPA 3S8MA 3TIIA 4DV4B 4JBWA 4FHDA 1C1XA 3ZS9A 4LKRA 3W6ZA 2EL7A 1DBQA 1U9CA 2H2AA 3LL4A 4A26A 2WMYA 3MTJA 1N6NA 2HCFA 2QMQA 3HZOA 3K0KA 4GD3Q 4RIGA 2FLVA 4FX5A 3VPCA 1W94A 4ZYYA 3RVNA 5CDGA 1C0LA 5I8WA 2R62A 2IWHA 2ZS9A 4B8ZA 2XUHA 3DZ8A 1N2BA 3AVOA 3IAS1 4E0BA 2C2BA 4LRYA 5CRIA 1FFGA 3ONWA 3OIFA 3L9WA 4AMUA 4UCWA 4IUDS 4EELA 1XRLA 2BI4A 1VKNA 1Q1NA 3UAGA 1L8XA 1U2EA 4IXMA 4CEIA 3C8DA 2X4DA 2G28A 3EC7A 5THXA 5C53B 2JD2A 2VJKA 2JC3A 3UMVA 5I5EA 1AOXA 1WXGA 2RH8A 2Q5FA 3P32A 1YZVA 1CRWG 5B5SA 1WDKA 2UKDA 3QUBA 1Y4AE 4BLQA 4GM1A 4UNQA 3U7EB 3B1KA 4CLDA 2O8DB 2EZ4A 4OHUA 1T0JB 4M7RA 2FWAA 2RGRA 4P32A 1Z3IX 3WSTA 3TMYA 4HDRA 2IELA 2VQ6A 2JBWA 2CVQA 3FLAA 5JSHA 1DI0A 4H4DA 3CJRA 4Y0VA 4I50B 2OYCA 3ICEA 3LUJA 4QRHA 4K9QA 3BPSA 5LQAA 3M81A 3EXIA 4IMRA 1WQ1R 4G9EA 1Z5WA 4REQA 1LBEA 1L6IA 4GYYA 4D0GA 4CWAA 2OHJA 3D1VA 5CG2A 4PPYA 4EHAA 3KYDB 1LDMA 5JISA 4S35A 4YI3A 4ZTUB 3RG2A 1W5AA 4EI8A 3EQ9A 4KEAA 4BWGA 3CY6A 1M34A 3LPAA 3AEQB 4R81A 1UMBA 4HG2A 3UXMA 1A04A 5L3SB 2Z83A 3RC3A 4LZPA 1M8JA 1VKHA 4I6GA 3ZDBA 1RYDA 4GZ3A 3ZKAA 4RADA 4HGZA 3S55A 3IJRA 1F6DA 4EEXA 1P61B 5KNDD 5AI0A 4NYMR 5AM0A 3WYCA 3EFOA 2Z2YA 4EYEA 3BCUA 3PS9A 4BQNA 4RTOA 1ECGA 3U1BA 3AM5A 1IWPB 3O3MB 4P2GA 1T4GA 4RD3A 4UBMA 3NH6A 4IKEA 1V1MA 3ILSA 4FE3A 3GT4A 3SQXA 4U3JB 3ON5A 4C30A 2X6RA 4TXJA 1JLHA 2F8TA 1Q5PA 3D6UA 3KBBA 3LV8A 1RTKA 2OFPA 3CSSA 3U37A 3UQYS 1XPJA 3OJFA 4G25A 5KZMB 1IZ8A 1U5AA 3QEMB 1M2EA 2PBLA 4IV8A 3OJ0A 1MR3F 2BOVA 3EXAA 1JHXA 4OLJA 3VGJA 5M34A 3OQPA 2TMKA 2R8BA 3S7ZA 1OZFA 3B6EA 1ACMA 2Z98A 1EFCA 3CU5A 3E4CA 4RF2A 1Q0RA 3GJYA 1P0CA 2OCAA 2XCUA 1DEHA 1S7CA 2QRPA 4UEJA 1IVNA 3DVAB 521PA 5GJWC 4MI3A 1L5KA 2LVBA 2WSYB 4B6PA 5IH7A 4BXOA 3H5TA 4KWTA 5DIFA 5K3AA 4LHZA 4CBVA 4I9FA 1EZ1A 3SWWA 1WQ3A 1AGRA 2QMYA 3K4PA 2CNDA 3IMCA 4MUJA 1FFCA 4FYWA 2G1KA 3K2EA 2E5WA 3DV0A 3FJYA 2G1PA 1VPLA 4US1R 3O9ZA 3Q0IA 4Q4HA 2CMFA 4DLUA 4QOEA 4OHBA 4MV8A 2F8LA 4XX0B 1QE0A 1TIBA 5A0FA 4I1SA 2WT4A 3AK4A 1NMSA 3UMCA 1M5RA 1A2QA 2AE2A 1RVV1 1M7GA 4HZGA 4YCMA 3O9MA 3K6RA 5I48A 2YVQA 2GRJA 4H08A 3EEYA 4YJGB 1T2FA 2Z57A 5A4MS 2JHGA 5JAZA 3DD5A 5U9CA 4BP3A 1FJHA 1I0IA 1M2OB 3FTCA 4G8CA 3AFMA 3AWDA 1I4OA 2MMGA 2H63A 3QKSA 4CL0A 2V45A 1ULHA 4IGIA 1E3QA 1ULSA 2CLKB 1R8JA 3NCHA 3PC2A 1MV8A 3STWA 2H4XA 1E1QD 1X7XA 1KVTA 4ZZ2A 3KQLA 3WADA 4I5IA 3CBGA 1XLUA 5DI3A 2AI1A 3FUXA 1VXRA 4XVRA 3EZNA 1U7HA 4X7MA 3EVCA 3IOMA 4YV1A 4P4NA 4PXAA 2VH2A 2CF6A 1BC5A 4HDNB 3K20A 4PYLA 2WAYA 4XDHA 4MW0A 1KP2A 4TS1A 1YR7A 1SD2A 1IIBA 1X3SA 2VK1A 4TXMA 1X7DA 1I13A 3T7RA 2P6PA 1JHUA 3QBJA 5DNAA 2JJ8A 4N7JA 4WKOA 3JWPA 1S8AA 1CXZA 1YRQA 2X0DA 2BW0A 3JTEA 2I7TA 1T3HA 2FF5A 2X9VA 1ISSA 2DVMA 4AYWA 4MROA 3LFHA 4DM4A 3KQKA 2WF6A 4IY1A 4R0MA 1KI4A 3TOXA 5CK5A 1GRVA 2WM2A 3PNPA 1DINA 3KKEA 2GJSA 3L4BC 3KHUA 4GLOA 3MWKA 2Q6TA 4PX2A 4YJDA 4F4JA 1CF9A 1PEAA 5I4BA 2CE7A 2VJPA 1SQGA 1DXYA 1XMJA 1N3IA 1E79D 4ZGBA 3Q40A 4WASA 4F4FA 4ENSA 3MIZA 3FOWA 4AT1A 1BCRB 3K8YA 3P4UA 3UXYA 1QFXA 1LRKA 2PQ0A 3D7LA 1PZHA 4R1PA 3VTZA 2UU9B 3FYUA 2PSFA 1H5UA 3K0EA 4V0KA 4Q37A 4R9NA 2NZ8A 3U5TA 1PLJA 3D8NA 3H9CA 3FHCB 2BFFA 3KDSE 4Z7NB 1CQWA 5ESWA 4KOEC 5T8KA 3N0XA 2QT9A 4Q3KA 1T26A 1YJBA 2XMGA 1OZAA 2G3YA 3NQ41 4RV9A 3O8QA 2QX6A 1VL5A 3IUEA 4S1WA 5AVXA 2D7JA 2B69A 4LF4B 4ND2A 1YB4A 3WQBA 2QD2A 3PKIA 5TC4A 2LNDA 3VNAA 2Q27A 5I7WA 2VJNA 3LKBA 5JHHB 3BWEA 2R1TA 1PGOA 2R6FA 1EK5A 1JDBC 1H05A 3PXEA 3C6KA 4UBOA 1ESMA 4AJPA 1HYHA 3GFTA 1J0DA 3UCEA 5CVEA 2X4GA 1SURA 2Q9UA 4EVSA 4UOQA 3CR8A 2H1CA 2HDWA 1BVUA 1TMYA 3LIIA 3USES 1ZCBA 1RXWA 2JF0A 3SZLA 4X93A 1M73E 4KNYA 3SQMA 4Q15A 1EB9A 2JGLA 3FAZA 3NBKA 4YACA 3WI7A 1TFUA 4HVLA 2HWXA 3T35A 2WI8A 5F52A 3TRFA 2X2OA 3BMQA 2A9FA 3BXFA 2IQIA 4LRQA 1EKXA 4YUWA 3FLEA 4EHLA 4TKMA 2EEZA 2BMEA 1XTUA 1XNGA 2VJDA 3CB4A 2I8CA 2VTVA 4U2BA 3EGEA 4BBJA 1P31A 2A9RA 2VZEA 4OXXA 9LDBA 1GNQA 3HP1A 4GL2A 2W90A 5EINA 3H18A 1I6KA 2OP1A 1AQNA 2J9XB 4AL4A 3U1VA 1X8JA 2IHTA 2IUEA 1MV5A 2IXTA 2FEAA 3GHYA 2ZBEA 4GL4A 2RFLA 1QCZA 3G9TA 1BZYA 3MS4A 3ZU5A 4ZT2A 1P1KA 2IYTA 2G04A 3KUXA 3LP5A 3RFXA 1I01A 3I6ZA 3ICWA 2P3LA 5ELLA 1AF4A 1YZNA 2OBNA 2P7HA 4LDPA 3ROFA 1WZ2A 5KWVA 1U7WA 2A9KA 3AUUA 1OYYA 4FZ3A 5WRFA 3U9TA 4C4AA 4F2DA 4Z3OA 1HR0B 4AD8A 1Q44A 4BJ3A 2FB9A 4UTVA 2GXAA 2OCIA 3IJ5A 4IKPA 4PQEA 2X2PA 2OCBA 2WSMA 4Z9YA 2ODEA 4IIBA 4LRWA 4DRYA 2GVDC 2J32A 4DZTA 1YR9A 2HQBA 2O2DA 3MCTA 1BD4A 4WADA 1UODA 5CLGA 2OYSA 4DA6A 3TZBA 2WM3A 1IHOA 1SVIA 3AHFA 4AO7A 1LQTA 1QO0A 4JU9A 1EQ2A 1WDWB 1GTRA 1JR6A 2Z8XA 3QXGA 2HAEA 1JG4A 2IYWA 5ALMA 1MP0A 4C03A 1H6AA 3IR6A 2Y68A 2Q5CA 1RAHA 4N6OA 1A27A 3VISA 4DJFC 1TAQA 2GJ8A 2RHWA 2BZ0A 1WZNA 1NVDA 2BGTA 3B3QA 4KI0A 3BB3A 4UE3S 2Q5EA 1W1IA 1QZUA 4EKEA 3MT9A 2CVZA 2HQ1A 3CV3A 4MYDA 4IDBA 5PNTA 2BMVA 2F1RA 3W9BA 4L0DA 4ZEOA 3HACA 4XWYA 3LUHA 3UFXA 5JNTA 4RULA 2FPUA 3IGFA 3C3BA 3S0JA 3TQQA 4AQ7A 3DE6X 4II2A 1IPEA 4LECA 4EJSA 3Q8MA 3FRHA 1M72A 1M74A 1X6VA 1ZI8A 4ON9A 4LWQA 2W6JD 1IUKA 3GH1A 3T7CA 1USUA 2YMLA 3OZWA 3R3WA 3RVRA 3C48A 2FQ1A 3EIQA 2WQ6A 1LDYA 4F1KA 3R4CA 1TTHA 5E2AA 1FSFA 1Z5OA 1PX2A 2R751 4FFLA 4HWGA 4OSPA 2EJVA 1AO0A 4CTMA 2WP0A 2BBSA 2JIQA 4I08A 5BQ3A 5JPIA 5IAJA 1GZ7A 2Z9BA 4IBOA 3TEMA 3OFSA 3NATA 1JRLA 3OLCX 4LFBB 3LVQE 1ML4A 1X87A 1Z2NX 1E60A 3K5HA 4I81A 4EJ0A 1L1EA 4XAQA 16PKA 1DBPA 1NFQA 3U81A 4FQ8A 2XNKA 5TB5A 1YWGO 3WDKA 2HA7A 3GXBA 2XWBF 1IVSA 4KIUA 2YWHA 2O6LA 2GKOA 5BVGB 3Q5EA 3Q0TA 4B43A 1OH7A 3MF4A 4DR7B 2XDYA 3ORYA 2BFBA 1K0UA 3GXOA 4YMSA 1JKXA 3OE4A 1UPCA 1H2ZA 2JJ1D 2JAUA 4COKA 4FUTA 3R3XA 2I6UA 3EIUA 3AGQA 3CZPA 2C4WA 4LBWA 1UZAA 1DAIA 4GMHA 6NULA 1UJNA 1HFKA 2WAMA 2UXCB 2X9LA 1HT3A 2ZIEA 3MUFA 4LPKA 1RI2A 1N8TA 3PL5A 3F5DA 4ETIA 2AJ8A 1FUKA 3L49A 1DO2A 2XMQA 3PUYA 1YQXA 1B6RA 3D8BA 5ENZA 3INNA 4CF6A 2FWIA 3KQYA 5F73A 5K6TA 2J4FA 4HHEA 5JV5A 3F47A 5ITZB 4D26A 4B87A 4IO1A 1T0UA 5KVVA 1XEFA 4I5GA 4MPJA 4Q3EA 4ENPA 1BXGA 4QBTA 4P58A 2VZ9A 1XA0A 2EFEB 1F3OA 2HC9A 3N2LA 3RYIB 3V2GA 3D6HA 4YYZA 4ZDIA 5HILA 1CEEA 4MHOA 5BNZA 1MEJA 1XZQA 2YX1A 1OAOC 1ZG3A 2F43A 3JATA 3WGHA 1CVLA 4YP5A 3RU2A 1I4WA 1XQXA 1A4IA 5L3VA 2X8WA 3KWJA 3VR2D 4V1CI 3SDSA 2Z3ZA 2JCGA 4PG8A 1JR3E 5AVOA 4FYKA 4JCCA 4QLOA 3KYIB 1DBRA 3FGZA 3WOHA 3OZSA 4FLMA 4PS0A 2AMLA 1NVVR 2AOUA 2W58A 3HJTA 1QDLB 4NBVA 4CIAA 4K9SA 1ZXXA 4KVGA 1QLHA 1PT5A 3MJVA 1SBQA 3FSGD 1FLVA 1I8TA 3LDAA 4BX0A 4U7DA 5IZCA 2H7YA 3GRPA 4G37A 5LPNA 3H1EA 2QY9A 3DVLA 5C1PA 2OQIA 3A3PA 1R0YA 3OAAA 2GPTA 3IVAA 1RMQA 4Y8VA 4JYAB 2IU4A 4PZLA 5B1HA 5ERYA 3EOAI 4W1SA 1ZIDA 5EIOA 1T9BA 3R3JA 1W35A 4KDFA 3R3SA 4RANA 3AJAA 3IBFA 3CXRA 2MWMA 4KKVA 2HSGA 4DYHA 5MGBA 4P3NA 2ZIUB 5DF1A 4LY9A 1ZK2A 4E14A 3R0JA 1KSFX 2JDIA 4ZOLF 4NNOA 1V3UA 1IB6A 4GW3A 1OTHA 4L72A 1QHYA 3V00A 1DIHA 1QKIA 2CGEA 1UT8A 2I29A 4IDAA 1XVLA 1KJ9A 4DYDA 4HY3A 1N2SA 2XNJA 1ZISA 4RSHA 2BVNA 4GPZA 1N9KA 5FV7A 4RTNA 1OOEA 4MO9A 4E33A 1ODIA 3A2NA 4OHRA 4BO0A 1JW9B 2GF2A 1T5OA 3HXQA 2I71A 1Z6AA 2P35A 4LJ6A 5B1SA 3JAMA 4KX5A 2Q3CA 4HPWA 3DBRA 3I64A 3WK7A 2WWHA 2PRSA 3LHDA 4YHBA 4N41A 2QQEA 3E82A 1U3FA 1QGUA 4B6OA 1YVRA 4ZODA 3LSYA 3L8CA 4KRXA 4DR4B 3HWRA 3FHOA 2BTOA 1JHQA 1M2WA 3O1LA 4DIOA 3FRJA 2W8BA 4BNDA 2WOOA 1ZMXA 1JMYA 1DAPA 2H1SA 3AMVA 5LBUA 1KHTA 1MJNA 3CVYA 4W7IA 1YQEA 2XMCA 5JH7F 1YCDA 3BILA 4UTOA 5JD5A 1NQXA 1XRSB 4C6HA 5J5AA 3G88A 1F8YA 2GERA 3H5IA 4DARA 1AQLA 1G20E 1UMKA 1EFHA 1T8PA 2EKQA 2V1XA 3PJEA 3A70A 4FU0A 4NPCA 2D5LA 4DLRA 1X9HA 1U7UA 1D0VA 2R44A 3RRXA 1N2EA 1ST2A 1ENOA 1SKMA 2DXIA 1UBTS 2XCIA 5DEIA 1CJUC 1FP4B 3LT0A 4W6ZA 4X63A 4O4LF 4XX1A 2WSLA 4DNFA 1QP4A 2WIKA 4FLEA 4GIBA 4OI4A 5ALVA 3ILYA 3GJ3A 1Z73A 3NYRA 5CLFA 4FC6A 4E2FA 2VRCA 4KRGA 3RADC 5E0OA 3WBFA 5JDIA 1TM3E 1Z0JA 3M82A 4LHYA 4Q1EA 2GAAA 1WCIB 3OPMA 4O4JF 1SA0B 3WR5A 1Z25A 3WBKA 2ZT6A 1E64A 4HAYA 2WFZA 3L82B 1WF6A 2OILA 3PIDA 4Q21A 3OWOA 4QHTA 5EJ4A 3VI3B 1QSGA 1IUNA 2HA4A 4GU5A 3U0VA 1B6GA 1DP4A 2HWKA 2RH9B 4JLVA 3JZDA 4UHFA 5TARA 3WSWA 5DXJA 3GZJA 3GY0A 2PLFA 4BNTA 4DJTA 3ZXUB 1U2RA 2R8ZA 3JPWA 3AEZA 1RC1A 1DKPA 3I6BA 3UAYA 3FTEA 1KBOA 3GCWA 4MCHA 4KXQA 1HKHA 3BICA 3STXA 3CKMA 4UE2A 2Q1UA 5CJ2A 4D6YA 4L6CA 2I80A 4DXHA 4CM5A 1VE9A 1S6YA 3WWYA 3C15C 3K6KA 4HL6A 3VJLA 1QYVA 3G2OA 3EH2A 5F9MA 3AIKA 2V7TA 3E22A 3R2JA 3QPWA 4P93A 4GECA 2ZCJA 1OF1A 3WNCA 4ZXPA 5C80A 1EFVA 2IDKA 1MB3A 2VDMB 3KLMX 4M0UA 3GLFE 4UUAA 3GAZA 5CA1B 2REOA 4K8OA 4YDSA 1FFYA 4LGCA 1CHDA 1HLGA 1RJ9B 2I2AA 5JVDB 4IF6A 3PT9A 2P68A 1GGHA 5IEBA 1CQIA 1OY1A 1PGJA 4PG7A 3O3OB 1M67A 3PPVA 4C78A 4OBBA 3OP1A 2DKOA 4DRXA 1E1NA 4ZMBA 3LWDA 1VMAA 4N12A 3PE3A 4BFUA 5LKAA 2CDRA 2X1MA 3RS5A 4JBLA 5AVQA 4XYLA 4CT5A 4EEZA 4EF6A 3TYXA 2NACA 1DWPA 2I7DA 1JHDA 3OTWA 1XSEA 2PMBA 4V03A 1OFGA 5LDHA 5HK9A 1XKXA 1Z75A 3JARA 3VPFA 4CIYA 1RHKA 5IAEA 2DX7A 1SKQA 2NYUA 3DMRA 2JFNA 3JYNA 1GPNA 2OCYC 2GSDA 3HYCA 1P2FA 4ZV4A 5J23A 1WVMA 4Y2SA 4ZHSA 2C1XA 3BD6A 4P33A 4Q01A 2OHHA 4KGXA 1L9XA 2Z0MA 5IFKA 2EZTA 2WLSA 4CNBA 4NG5A 3HFRA 4FYYA 1DFGA 3I2YX 4RA9A 1ZK3A 3KB1A 4PWZA 1X42A 1BRTA 1PF7E 4M0LA 4TYQA 2P8JA 3TS1A 3ZHSA 3WICA 1M2JA 1QQBA 4OQXA 4A1FA 2I67A 2WTMA 3D3NA 3A9CA 3GJ5A 2EWVA 5TPWB 2GSWA 3G2HA 5ALGA 3SIXA 2Q5OA 2IEAA 3QBDA 4V0LA 1NY6A 2PRZA 3AV3A 3I04M 3GEMA 3LCCA 3LAWA 3AOEA 3LUKA 1SG0A 3JQ6A 3F1KA 3NOOA 4JUDX 1F2DA 1AM4D 1G3IA 1JU9A 1T29A 5K0EA 3HKCB 4P4GA 3IUSA 5L3QA 4WOJA 4I14A 1SPXA 1LW7A 1H8EA 1NY5A 4JOCA 1QVAA 2O3UA 4QTTB 5AW9A 4TZ6A 3EW7A 3IV9A 1WEKA 4WVFA 1XRMA 2P27A 5LDGA 3IQGX 2HT1A 2JHAA 5FQOA 2AXPA 5HF6A 1OFHA 4IQ0A 3RM3A 1TQ8A 5EUCA 3IT1A 4YONB 1THGA 1UZLA 2WB2A 1MB0A 1R8YA 2JB9A 4RHTA 1YS7A 3V1UA 1OHHD 1SR8A 4M2LA 5BQPA 1ZJ4A 1J97A 2ZCVA 4KRYA 1WKBA 3RUFA 3RHFA 1A5BB 5AESA 3R24A 4AICA 1KFCB 2G4VA 4N8SA 4YRRA 3RS8A 2PUBA 3EH1A 3S1AA 1L4MA 4EJ2A 2YDYA 1Q7BA 2VYND 5CBKA 1FTSA 4FWTA 2OGWA 2W00A 4KDCA 4YO7A 2GLTA 1HYBA 5J9FA 4EHHA 1TF7A 1KK1A 1TO2E 3EDQA 4WK6A 2YQZA 1LXCA 4FFPA 4D5EA 2G1UA 4IH9A 3KQNA 3LX4A 2JFZA 2B3DA 5INTA 4UVIA 4B3MB 5A62A 3AF6A 2HWUA 3I37X 4HD8A 1EHCA 1U8CB 1Z07A 2VWPA 5T6MA 4S1TA 1ZK0A 1I1OA 4BASA 4ZI7B 1Q0QA 2O2JA 1NAHA 1QJ4A 3KBOA 4N18A 5CGQB 1XEWX 1ENZA 1CK4A 1QIKA 3A1CA 3C0KA 4UQOA 1VCOA 1ZMTA 5EJ9A 5DHPA 4YYEA 3FNQA 2DCMA 2OD2A 3MCAA 3C3PA 2IUSA 3JQ7A 4ITRC 1ZONA 2EBFX 2B4QA 3K1AB 5E9QA 3LYHA 2PM8A 4EYKA 3AQ4A 1OTXA 2QDKA 4KPUB 1OI3A 4D8YA 3FMVA 2COUA 1H2WA 1OC2A 1C1YA 2FTKE 2GPSA 2J7PD 2QP4A 3I72A 4MVJA 3SLGA 2QUJA 3A4TA 2HHCA 4Z53A 2RK3A 2WVHA 2Y4NA 2QX7A 1D2NA 2GO1A 2IHYA 2ECFA 5KNBH 2Y0DA 3H83A 4CKCB 1A9OA 3NH9A 1IEXA 2IYFA 3VR6D 4A0FA 1V3TA 3A4IA 4DLPA 1ZVJA 1K2VN 1OUMA 1YSCA 2R7AA 3E23A 2IW1A 4D80A 2Z4TA 5I9IA 4L7QA 2WWFA 2PX3A 5F7OA 2O7VA 5CX1B 3V1MA 5ITSA 5IXJA 2ZJ3A 1RPZA 5DLPA 1EX7A 4K46A 1COZA 3GRCA 3ZHTA 5IHXA 4TZ0A 4TTAA 4KN8A 4TSFA 3VAYA 4C7MA 2BFDA 3Q9SA 1SUIA 3DEJA 4F6CA 1FC0A 1EBFA 2G9QA 4MGEA 3OZCA 3HUUA 3T4XA 3W6OA 3IAM6 1ABBA 4DB2A 1EI9A 3QVVA 1QWSA 2QQGA 3GJ8A 3HJRA 1VBMA 4DQVA 3F8WA 4O4HB 5FJIA 1WPRA 2H1VA 2HU5A 3NHFA 4JUFA 1FOEB 1QQ5A 3AR2A 5E6SA 3VSDA 3RT9A 1SXJB 2WY2D 5F21A 4JZKA 1SXIA 4S1PA 5LN1A 1MORA 1HA3A 3KRTA 2A0YA 4H0NA 3LVBA 5AOVA 5ICMA 3SGLA 5DLEA 3EXG1 4RZQA 4HDOB 1FSZA 1I51A 1UM8A 1Z8HA 3D6TB 2X9NA 1K5DA 5H7XA 4D96A 2O54A 3T99A 3PFKA 3UH1A 2BEUB 1WB9A 4PGAA 1P2GA 1DJOA 4LOJA 3CUTA 1KY2A 2ZLBA 4XM1A 1D7AA 4R2WA 5FYDA 3SE7A 4AF6A 5KWEA 4NE2A 5HSGA 2AYYA 4ALKA 3EF1A 3UWOA 4E70A 1LPOA 2CFRA 1Y48E 5I9LA 4RY9A 1E4EB 4EL0A 1G9SA 2UZ0A 3RDPA 1SVMA 1SG9A 4BLPA 3IURA 4FFWA 4AJ1A 4CT0A 4ZJYA 1EDDA 1KYQA 4K9NA 4L02A 3GGOA 2QTNA 2CHEA 3B12A 3PXBA 4OHOA 1XJ0A 3BCSA 3G0IA 5ALKA 3R74A 5BMVF 1O5TA 2XTAA 1TM2A 1GO2A 2BPOA 2EIHA 1Q3TA 4F1WA 4KN6A 3PEVA 4L8LA 2A1UA 4QC2A 1LLUA 1BQEA 1U3VA 1GTZA 2OTCA 4FXOA 4X64B 2XWSA 3JAKA 4PCLA 1N6LA 3Q3EA 2PWPA 3QKUA 4WT7A 3NWBA 1Y6GA 3U3RA 5A9SB 1LPSA 2D7DA 2EHJA 1XZLA 2AKEA 4F3YA 4BL5A 4LF9B 4I4CA 2FW8A 5AM4A 4NXMB 1G8JA 2Z8YM 4V39A 1N5IA 3CCBA 3D0KA 4YCJA 1GY8A 8OHMA 4ZOLA 3WA7A 2XCOA 3EXG2 3VYWA 3O5AA 3T4UA 3EHEA 3IUJA 3TUZC 1BKYA 4NCNA 3KDAA 3LNTA 4IDNA 1XC7A 4CI9A 4IEIA 4QE3A 5CLLA 4GP9A 2MR6A 3TRHA 1Z6TA 2I3BA 2Z43A 5TMDA 4ZGWA 5I47A 1DJNA 1RE1A 4FNOA 3Q8LA 1X7YB 3P4YA 2WNIA 1HZJA 2FZ4A 2V7EA 1PS9A 1M6NA 1KORA 1U0EA 3OOWA 4QYTA 4KUGA 4DA7A 1Z13A 5JHGB 3ZOKA 2ID9A 4CMIA 1AA6A 5P21A 4QGSA 1VC2A 1OT5A 3KVYA 4G85A 3UT5B 4XOIA 4QOGA 1H2AS 2IYNA 2JI4A 3HLKA 2H48A 2NUBA 4ZAVA 2EGUA 3FTPA 5I5GA 3BGWA 3ZX4A 2HZBA 1QTRA 2WABA 4BVHA 5KJ6A 1OB5A 1VZ3A 2FGKA 2QEQA 4KH0A 3C3EA 2W22A 5FIUA 2XNDA 2H92A 1VA5A 4GSLA 5JH7A 1FX0B 1QJCA 1KETA 4O1IA 1I36A 4MP3A 1RLIA 4N0PA 4RVSA 2DPHA 1RXEA 5LYJF 1U31A 1W2HA 2PH3A 1FMJA 4NC9A 1Y8QA 5D3ZA 3KHTA 4DS3A 1RU3A 4TL8A 3Q4GA 4CUJA 1YRWA 3LT2A 5FRDA 1X7HA 1KEKA 4Z4FA 3DTVD 4HF7A 2I66A 1GFZA 3NRJA 2BF7A 3FG9A 1NQ5A 3GJRA 2Z1DA 4L4XA 5ER9A 3BXZA 3MJSA 4LMPA 4M6WA 3H7AA 2PWAA 4D9EA 1V4NA 3R8FA 4C88A 5BMOA 4G1EB 1EVZA 5ITVA 3HCFA 5CH3A 1OWPA 1JPJA 1OW3B 4LDAA 4O4JA 4Z54A 1X2EA 3E2MA 2BYTA 5CT8A 5BY2A 4G4JA 1ZN8A 1J2UA 2UDPA 1K7CA 1UZUA 2ZUUA 3OF3A 1CUJA 2VUUA 3N2GA 1NN0A 2ZYRA 4CL2A 4ZEWA 1FSSA 1TLTA 1ZFNA 3OLXA 5K0TA 1K6XA 3MUNA 3DOHA 3LVFO 4BZZA 4RZHA 5K8UA 2QORA 1PS8A 1YQQA 3QFSA 3L4JA 1N2ZA 1R0LA 1MQAA 3ILHA 3SDZA 4DKXA 2E4YA 5IYZB 1KYZA 4PRZA 2Y1OA 3DL0A 2PZBA 1EFDN 1RQ7A 2YJ6A 3QELB 4N6NA 4R1TA 3JS5A 3VSAA 3MHTA 3WIBA 1O96B 3RK1A 1ZITA 3S5UA 1T43A 2OESA 2WHQA 2CNWD 2I7CA 1NLUA 2GDZA 4F4CA 4JZYA 1G19A 1JA1A 1RP1A 2R60A 4B9EA 4C0SA 5FUMA 1G4UR 3ESXA 4CKXA 4UMFA 1HNXB 2X6TA 4Y2PA 4YC7A 5DBGA 4DA4A 3P9PA 1W36B 1J5EB 4G0MA 1I9CA 3BK1A 4Z49A 2ET6A 2VS1A 4NOKA 4Y6GB 1CZLA 1NYLA 4OHXA 3BTUA 1XDDA 3MS2A 4HO1X 1BOOA 4BUCA 4KHPB 5FEMA 3OFNA 4E22A 4X94A 2WFLA 1XD8A 5FWDA 4KFRA 2X8BA 4BQQA 1ZUNA 2RD2A 2OXCA 4YAKA 4LBYA 3OKAA 3VNSA 1GOTA 2QAGA 1EA5A 2JLQA 5EYPB 2JI9A 3BSFA 1VI6A 2C4NA 5HVNA 1A8HA 1V3QE 4ALJA 3IP9A 3JQDA 4GEGA 3VUEA 3ZV7A 1Z33A 2P11A 4LEIA 5J58A 3VYSB 3X1KA 4D9MA 1VHLA 5J4KA 3CEJA 4Y0AA 3K0HA 4FYVA 4N0MA 1J0XO 2EZUA 4IYJA 4XB2A 3GRVA 1B1CA 1TADA 1XMPA 4NU5A 1QGYA 2IPNA 3U4QB 2B94A 2ZRCA 3OSUA 2OZLA 3CWZA 3NJ8A 1R4ZA 2QUBA 5FDFA 1E7YA 1QPBA 4A0HA 3HU2A 5A02A 1R0ZA 1ZSVA 3EARA 3I5MA 3U3OA 3DEYX 1XROA 1EESA 3EGDB 5DHSA 3URKA 1JSZA 2CT8A 4CM4B 1UKBA 3VU8A 1XFAA 3RUEA 3PCRB 2WHPA 4QJIA 4EA7A 2LP4Y 1P81A 2PGNA 1P75A 4PQYA 5CB4B 2HBZA 2UVDA 1JWLA 1CRZA 4MICA 1ULAA 2WLTA 4M89A 4R8LA 5HIIA 2OOKA 2Y8EA 1XZCA 3AZPA 5HM6A 3TGPA 4K86A 7ADHA 4ZI2A 1L7MA 4PHHA 4UMDA 1EU1A 2P6MA 1G60A 4TVKA 4ZKEA 2CL0X 1Z9BA 3UAOA 1E0JA 1JXOA 5C1BA 4F91B 1IJBA 2IYEA 2VXYA 3USCS 2CNKA 3G1TA 4FGJA 4PLGA 3V1LA 5KU1A 4AY2A 4JP2A 2JAXA 2NWQA 2D1SA 1FTWA 4EGJA 1P3DA 1PJSA 5AVYA 2XB4A 2W2TA 5J5CA 2JGMA 4YRKA 3O4JA 2OHFA 2XB2A 4Z0TA 4TRRA 5JU6A 1KC1A 3ABRB 3ESCA 4L57A 3F5SA 5KDLA 3VAZA 3W4JA 3MCWA 1OXMA 3ND9A 4EW3A 2CEAA 4GZ5A 4OXRA 1Y7HA 2RK4A 4Q9AA 1EUCA 3BULA 3M2PA 3JYLA 4YECA 2GN6A 4B6RA 2HZ7A 3WL4A 4KYVA 5E4TA 4CODB 3AR8A 3IMEA 5DCLA 5BYJA 2B3TA 1GGVA 3WGJA 4DG8A 4YJ3F 3B48A 1LZKA 4ABYA 1FSGA 2F62A 3NM4A 5TVKA 1ECLA 3QWHA 5EP2A 2ZIXA 5FR2A 4BNHA 3DEFA 4RM3A 4BGVA 4Y2RA 1JHYA 1RC0A 4E4YA 121PA 3R9KA 1KU6A 2X41A 1VA4A 2ALJA 2IXGA 3HGTA 3KELA 1Z45A 4OGFA 1GPJA 4P84A 4YI5A 3VR1A 1KI9A 1CTQA 1IXSB 1E69A 1KZ1A 2NVWA 2C61A 4ZPJA 1TO1E 2PZGA 3IEUA 5EHGA 5KPDA 3MOIA 2OZVA 2P2CA 3T3OA 1RJWA 5AH0A 2C7RA 3CBQA 3PXAA 5TE9A 2GLXA 3QOXA 3P5SA 1V45E 3A3YA 1K8YB 2C8JA 3R40A 2Q5LA 2H0QA 2IGTA 5E7IA 1DRJA 1BG6A 1YIAA 2ZJOA 1DV1A 5AR1A 6ABPA 1W5BA 1IXKA 2GARA 3CMCO 1X15A 3BXOA 2E4UA 4I3HA 3WV4A 1P17A 2WBLC 4PAWA 2HXGA 2WHEA 3CNLA 3E8SA 1ZLYA 3O26A 1DELA 4Q1DA 1P5ZB 1EQUA 3SJAA 4ES6A 7MDHA 4QFDA 5REQB 4X65B 4YRSA 3EZ7A 3DXFA 2Z09A 4JFRA 3W5UA 4C2BA 1WULS 3T3PB 3G2PA 4DNXA 3EVNA 4H6WA 4CU5A 5K9ZA 5BSEA 4RBNA 4ZZ0A 4KGZA 1YIOA 3NC1C 3AV0B 2J5RA 1XQ6A 2DQ4A 4U4AA 4Y7CA 5EKDA 4GKVA 3RTDA 1YJAA 3NBZC 3P7MA 4YGXB 3U39A 2IS2A 3E9MA 3UXHA 3EYWA 1BFKA 4IMJB 4MRPA 2V4ZA 3DMTA 4GG1A 4KL8S 4M9XA 3KUUA 5AW7A 1AUQA 1WTAA 3EG9A 3OPQA 3AI3A 4CKBB 2QSZA 2WVAA 1P9RA 4HKTA 3NGMA 4LZAA 4BP8A 2AA3A 1G17A 5LNK1 1RKUA 2O2YA 1KNQA 4OQPA 2RHJA 2FQXA 3JY6A 4TKVB 1CZNA 3I9FA 4TTSA 3D6MA 1TC1A 3CLUC 3SK0A 3ZHRA 3DNFA 4ZOEA 5CIYA 4DCJA 3W5AA 4F3TA 3DBHA 3R7DA 1QHFA 3RFCA 5JPCA 4C6SA 1FDRA 5K6RA 2K2QB 3UYLA 1NSFA 3RUDA 2VKQA 4GX1A 2R65A 2PZJA 1SCKA 1UWVA 3CRVA 2C5HA 4PRLA 3TR0A 4WBNF 3KJIA 4MJLA 1E2KA 4A8JA 4YMWA 1JDSA 1WXDA 3NPAA 1T2NA 4PWYA 3JWEA 4IYRA 1LSUA 1O6ZA 1C30B 2FZKA 4PQRA 3L7JA 3QU5A 5BMVA 1VMDA 3U4MA 3H4IA 5BV2P 1KZ9A 1Z2PX 2DM6A 3G8BA 1PG2A 3IHKA 3JQAD 4FCWA 1C9MA 5GZ1A 2IF2A 3DBLB 5AJWA 3UK6A 5BSTA 3LI2A 4PAMA 3H97A 1FFBA 1XD2A 3LUAA 4OM8A 1TAHA 2J3IA 3KSAC 1FYWA 3TSYA 4RMHA 5TEVA 3NHZA 1GCGA 4UMEA 3RRMA 3SOPA 3AVXA 2ZTMA 3FMIA 1UBMS 5CBPB 4J0GA 4UJ5A 2AMVA 2BGNA 2PGAA 3DKIA 2QD1A 3ES9A 4F6RB 3GCZA 3MRSA 1PYOA 4CI0B 4ILEA 4H3HB 4NCJA 1Q12A 4HBGA 2YWGA 4GI3A 2AFIB 3TTXA 2CLHB 4JENA 5FTMA 3GUVA 4ZIRA 4V2UA 1RYFA 4I6EA 5KDOA 2REBA 3LBIA 1UDWA 4Z9XA 4G5FA 3HKDA 5AHOA 3ZHZA 1SULA 4WFKA 3TIXB 3W79A 5AKEA 5T4BA 2GK4A 2Z95A 2C2YA 1YVEI 4OV6B 4DWWA 1U2GA 1HDYA 3FDJA 5BW8A 1V8OA 2C59A 3C8ZA 5DDIP 4Y2QA 2W98A 3FSGA 1SBNE 1JR3A 5EKSA 5I01A 2XF2A 4G81A 5CIQA 1EP1B 2E21A 2QI9F 3IV6A 3O8OA 1KH2A 1J23A 3QV2A 4JODA 4QODA 1G5HA 4UULA 3D31A 5HMLA 4Q3CA 5CFOA 1MT0A 5ALIA 3QMMA 5HYVA 2X3UA 1ZINA 2HMAA 2X5NA 3B5JA 2EJUA 2YIJA 5BVHA 4MI9A 2C9YA 3LMKA 2P3QA 3ZGXA 3GDHA 4B32A 5HGJA 4CLRA 1L3CA 2XB8A 4QPDA 5FI0B 1NXWA 5CG1A 2K6GA 1R5JA 4RTKA 2CHGA 3U56A 2W6OA 1ODTC 2VHZA 1R0BA 4JBIA 1FYDA 2J5XA 3D3WB 3H2IA 4LVNA 3KYCB 3D3QA 1P2TA 2PGDA 4G1CA 5IJ0A 3SX2A 2M98A 4JJAA 4IIJF 3U17A 4A92A 1Q0HA 3HH8A 2QN1A 1ZD1A 2Q8PA 4JL8A 3WHLA 1B74A 3QVXA 5LQRA 1IBCA 2G71A 3DCYA 1UJBA 3KIPA 1EINA 2P77A 4ZQGA 1NP7A 3M5DA 5FOTA 5TQ2B 5KMGA 2WP8J 3L4EA 5COBA 1XKLA 1JF8A 1OH6A 1C5KA 1H0HA 2FFHA 3ET5A 3I6IA 3PHIA 5LZ9A 1KSHA 5A7GA 5HCUA 4CMEA 3BWCA 3PFFA 4CQMB 1CDEA 4G8BA 4U2EA 1ISIA 4IHJB 1TAGA 1UINA 2XUQA 1GKUB 5CB0A 3MJTA 5LMZA 4WFJA 1YB5A 3ANYB 2I2CA 4LXGA 1A50B 1ESZA 4KR6A 4ZQFA 1HF3A 3JQFA 1YB1A 1W34A 2FFBA 4N9WA 3FZNA 4DILA 2LGJA 4J49A 3A6LA 1L3IA 1RJDA 2A1TR 1JE1A 2JVJA 3SLKA 2FPIA 4BKMA 5K8CA 3OQMA 2BUAA 4EDHA 3NTRA 4UQLA 1E9AA 3ENZA 4M1QA 1KIMA 3V3TA 4CR8A 4QYIB 2GB4A 3R3YA 4JYBA 3FDZA 4RLFA 1X70A 1U8UA 1ZP6A 4UPVA 3UVEA 2YXLA 1E6LA 1RYYA 1SK8A 3I73A 1KE2A 4B34A 1T1RA 4C3UA 2A9JA 2AD1A 1QVRA 4X20A 1G20A 3O94A 6REQA 3DCNA 5AKKA 1P4GA 1ZHOA 1VYTA 3GUUA 1Z7YA 1ENYA 2Y93A 3SAJA 5IC4A 1E9BA 1L7NA 2BEVB 3LT4A 4J7UA 4TMTA 4NXNB 1LRLA 4O2LA 4D92A 4ARIA 2FQYA 4P98A 2XQJA 3UW1A 4C2AA 3O21A 4FS8A 1RYMA 3TH5A 2YQ4A 1U7TA 2VJOA 4EWLA 1F0YA 4O8ZA 4LHEA 3ODPA 4TV8F 4XVCA 3GFPA 1RI3A 2B2CA 4TTQA 4EI2A 3EPJA 2P5SA 2WTBA 3ACCA 4IDHA 3QKRB 2ZJ2A 4CCYA 4BBPA 3CH6A 3GL9A 2A14A 1BA2A 1NJ2A 2HGSA 4X61A 4C1BA 4DAEA 2FFJA 4Y2VA 2ZWVA 1NR7A 2HSZA 5H83A 3LOQA 4XCXA 1HI9A 2CXPA 2HREA 4WXPA 2NUTB 4UZSA 5B1IA 3DZIA 1UT5A 3QBTA 4J7CA 2XUJA 4H3SA 3PENA 3DNPA 2WSIA 4MTCA 3TGWA 3UT6A 2FVYA 2VNKA 2HQOA 3DHWC 2PDAA 3O4IA 4PBSA 4RDCA 1YRYE 2AQ8A 3HDVA 3CGWA 3IVMA 4WCFC 1RKVA 2I33A 2VSXA 4RPHA 1NXOA 3O47A 3HXKA 2XVXA 5IC6A 2ZJYA 4J1TA 2RCYA 4OAQA 5E6UB 2R8PA 3O83A 3GLHE 3X1ZA 5JC8A 3KUDA 5IBPA 3VSCA 3ZXYA 3GLFA 2VHXA 4FSDA 4HDSA 4QVKA 2PQ6A 1AMOA 1MOZA 4HN2A 1ZEMA 2QLFA 2YZMA 3PPYA 1H5QA 1UOOA 4EI9A 3THXA 1BCSA 4R41A 3G49A 2B35A 1PL0A 2XE6A 4LMBA 1XDWA 3QLUC 4BIIA 3N8NA 4P36A 3IOBA 3E3LA 5FWYB 1ZN7A 3DHNA 1DLJA 1QGOA 3O31A 1JECA 3NT5A 2YC4C 3ED1A 4XIJA 5CAEB 3X2EA 5LR6A 4MQFA 1PL6A 1J8MF 1JHPA 1FCJA 2ST1A 3NBAA 2Q1XA 3I6MA 5L4SA 1SBIA 1EAYA 5CCDA 4FONA 3PU6A 2DCUA 1C0PA 1ZN9A 4Q1VA 3KAQA 3HB5X 2RJ3A 4M22A 4AG6A 5BSFA 4UTXA 4TZKA 4Q3AA 1FVOA 5FR1A 1PUJA 1QVVA 2QE7D 3RJ5A 4QOHA 3HSKA 4UAGA 1LPMA 6ADHA 4U7TB 4BJ6A 1MOSA 3EGXA 3T4PA 5K8TA 2Z5LA 4DJAA 1OXBB 1F2TB 3EUFA 3T41A 2V7XA 3LKVA 3E1SA 1GGNA 3F74A 2RBGA 4C0KA 1V96A 3E5RA 1N5OX 1F0KA 3ZE9A 1CUBA 3BGIA 2GCOB 2LCFA 4RJKA 3O4VA 3EFBA 2ZZNA 3CUYA 2RHRA 4J1SA 1ISPA 1I32A 3D2LA 3MWEB 4HTFA 4JLPA 1NRWA 4RCYA 3ZJTA 4YJ3A 3IIKA 1C3OA 4JBYA 3WAGA 1XMXA 2H57A 4DMLA 1L5RA 1HEUA 5EEHA 1ESDA 2HF8A 4CM9D 1M2GA 1CUWA 2QRHA 4S12A 3TFQA 3ZPXA 1FIUA 1HMYA 3N87A 1RRCA 1R9GA 1K5PA 3LDUA 3T1OA 2Y1LA 1QYRA 4UUOA 3TTYA 2PN1A 3Q1KA 5I9BA 3LF1A 4Y2UA 1ZZGA 1NKVA 4DEYA 3RS9A 1ZJWA 3DE2X 4LYDA 4C4RA 2JGRA 3MAAC 3M4YA 3H16A 5AQ1A 2DWCA 1VGQA 4HQRA 1KWGA 2ORED 1XHEA 2V9PA 4QA9A 2AQHA 1PU2A 5AVKA 2HW8A 3UOAB 4YJFA 2VWQA 4HXEB 3SQOA 1MAHA 1O9BA 5IT5A 3AG5A 4AZ0B 1Z74A 1TDJA 2Y71A 3ETHA 3OY2A 3BEDA 4JD5A 4XRRA 4LOKA 2AEEA 5ES3A 5BUCA 3OFKA 1Z06A 4F2WA 4A27A 1LDEA 1QQTA 4LW8A 3QITA 2GXUA 4NWIA 1TJ4A 2D0IA 3ML1A 3OEWA 2OLKA 2V74B 5HW0A 1NBIA 2ZI3A 2P2GA 2JGKA 3EUWA 2PXCA 2WTNA 3BK7A 4F3CA 4OB6A 3TCXB 5DK6A 2ZDHA 4FKBA 4U2FA 2NAFA 1LV8A 1W0CA 3VDRA 3ZHQA 4ZN6A 8AT1A 5CW1A 1B43A 1TQDA 5FA6A 3SVLA 5F9HA 3O1HB 3KD3A 4FBLA 3UO8B 1ATIA 2VP2A 3PXDA 3NC4A 4EDFA 4TLDA 2O59A 1T2DA 3LDGA 3DM5A 2VTKA 3FFAA 3GUZA 3A6JA 2V5UA 4RVCA 3T7JA 1U4OA 4QICA 3H9JA 2NTJA 3NYQA 4JLKA 4YRTA 2Q3LA 2IYSA 4XIGS 3ROZA 3ONVA 4MPPA 4MR9B 1DG3A 4XLZA 5DOZA 4QXOA 2Z6AA 1E7MA 1H69A 2J7PA 4D3ZA 1N8KA 1X80B 1P1BA 1JEEA 2EJBA 3CT6A 1H1DA 1DKLA 3E8MA 3FNHA 2PYIA 5EC8A 4CM8A 1G3MA 2ATXA 3VOAA 3FYHA 2GT1A 3OEHA 4BCCA 5C8YF 1P74A 4NJEB 2RGYA 1NWHA 4NK4A 4M9CA 1X13A 3DYVA 5ALWA 421PA 1Y4SA 4KPEC 3PE6A 2B37A 1GR1A 1XJ5A 4YIHA 4B31A 3SU8A 2N3ZA 2E1RA 2YMMA 3CGGA 3JVIA 3VXKA 4WBNA 2WMDA 1PKEA 2R0QC 4IHQA 3RVOA 5B6PA 3JWIA 1N6OA 1O08A 4PNHA 3IIMA 1L7PA 3G8YA 3K31A 3PQDA 1T24A 4J0EA 1BW9A 1QCYA 2RH5A 4RHCA 2QN7A 2X8JB 3BJIC 2DAPA 4FIZA 2YBDA 2ZJ6A 4RQUA 3F4LA 1QH8A 5I7EA 5LOVB 2CFCA 3C85A 4O5OA 4KE9A 4JYZA 3AUXA 3PUZA 4IIXA 2ZP1A 5CT6A 2W6ID 5JARA 1WW2A 1PR5A 5L4NA 3BHNA 3CX7A 2R2AA 2FPWA 2EF0A 5GONF 1YS4A 3A11A 3KTFA 3UJCA 1IOWA 5ALYA 2DPMA 1NF3A 2RKWA 1QDUA 2ZT7A 2OQVA 4DKJA 3F9IA 2QTFA 3Q3GE 1VGVA 2EYUA 2MR5A 3CZCA 4WLFA 2G76A 3CUUA 2OGSA 5A4KA 1TQHA 5M7EA 4R0VA 4UPDA 1AF7A 2ZJZA 2R47A 2D2IA 3WIUA 4FNGA 1PFYA 5IARA 4MS4B 1AUPA 4CV2A 4QHSA 4NZOA 4DSZA 3N6VA 4L9AA 1X7ZA 4KOAA 1E66A 2ZKIA 2W83A 3HV2A 3KCQA 3RJMA 2ZI7A 4HDQB 4QEDA 3TWOA 3TTVA 2R25B 5C31A 4O4LB 5CB8A 1JIXA 1Z88A 3P9QA 4D79A 1VFNA 3A1DA 4DIKA 4HPXB 2RGBA 1K63A 3CNEA 1DO0A 4K1XA 3EY4A 4H16A 4PSVA 3IL2A 4YPOA 3A1TA 4DR2B 2AMFA 4P83A 1C50A 4TKUA 3V6MA 4AZ3B 2BP7B 1DTWB 4TXHA 3X2FA 3S70A 3VDXA 1H2XA 3WLEA 3OWXA 3WGVA 1B6TA 2C2OA 5A5VA 2R6R1 5CXXA 2N47A 1Y4ZA 1ZRSA 2Z9DA 5DLYA 2FV8A 4LXUA 4MUHA 4QAJA 3M89A 1AURA 1JU3A 2G9RA 2QL5A 3AB8A 3HJCA 3MJEA 5I9SA 3I9OA 1JS1X 1V8DA 2DFTA 4RPKA 4WPGA 3K9GA 4X3PA 3BE8A 2QZJA 4FGLA 5FBHA 1D09A 4A2WA 1O58A 1QP8A 4QG7A 4CG0A 3IA2A 3L7MA 5DXFA 5H59A 3MCVA 4AJOA 3HA2A 4ND8B 5LDDC 5IVIA 3CCCA 1I4DD 4IIJA 3WMWA 4EHFA 5JALA 2JL1A 1RXIA 4HX2A 1M5UA 4Q00A 2ID4A 4QM6A 1XCMA 2WWTA 4DLNA 4N3NA 3K1YA 1K3TA 3FCCA 3ZDRA 3WLJA 1USIA 4CQJA 2AF4C 2AG8A 2RJNA 1IAQA 5CW2A 3QVGB 2C9ZA 1RKQA 4UVHA 4Y6OA 1HY3A 5EJAA 5JT1A 4RM2A 1GNTA 3OM1A 1GTJ1 5EESA 3B78A 4DN6A 4LK2A 2C31A 4RFVA 3IHWA 821PA 4CMBA 4KLNA 4JNCA 4AC9A 1DEXA 3TRDA 4QUGA 4YP6A 5B58C 2YINC 4V1CA 4OX9Y 1Z4OA 2KHZA 4K6GA 2YHIB 1G8GA 4RZSA 3TB4A 3WMXA 1KSJA 4RNCA 4KK3A 1IBRA 1HE1C 2YXNA 1BJKA 1I0LA 4EG4A 2R6ZA 2CCKA 2B1JA 4BLOA 1NDUA 4L9WA 2GUWA 3IESA 3JAWB 1ND6A 3C4JA 3KLBA 3DT6A 5CNJA 5DN6A 5A3JA 2HRDA 3FZGA 1T3TA 3F2VA 2AN9A 3RS7A 1P7PA 1RPNA 3T0GA 3IOEA 1GRNA 1JKJA 4ZK2A 1TUBB 1DQSA 4NBKA 3CLVA 2WZCA 1R4NA 4R83A 2Q7XA 1EWTA 3PC3A 1KVRA 3OT1B 3PGMA 3HB4X 2IZOA 1N1DA 2B1IA 2A33A 2Z9CA 3A7DA 1QIEA 5G40A 1VHQA 1E6UA 2I4RA 2QMHA 2M1XA 3EDCA 1YI1A 4NARA 4XYGA 2CLEB 3RVJA 5KYNA 3PIRA 1KMQA 4EJFA 4Y2GA 4LHWA 4B2YA 3FNEA 3FPLA 3RHZA 5AVZA 4H31A 3DAYA 2C42A 3O2JA 2RONA 4Q9JA 3G85A 4OHWA 1Q21A 4EUFA 3A6DA 3S2ZA 3P8ZA 2O8CB 2J1LA 3HA5A 2PLRA 2QK4A 4DQLA 2ZE7A 3D64A 1NJ5A 3SICE 4QLBA 2OVBA 3ZHYA 1R15A 3E9NA 2AT1A 3PI6A 4ZO6A 4E2XA 2G8LA 2OPHA 2A92A 4YR9A 3K0AB 1KJJA 2YRXA 2ZXFA 4FX2A 4RKRA 1KKLA 5GVSA 2CNWA 3S5JA 1FTGA 1G5RA 1W2WB 2XCLA 2HUPA 5E2BA 3TLZA 3L77A 3MJHA 4HLQB 3ZBTA 4JEHA 3E3NA 1ADYA 4PTYA 2CXXA 4RQAA 5FLXA 1W7AA 1W88B 3VPAA 4DY6A 1BH6A 2G77B 4CDNA 4GWKA 4N48A 1FX1A 4V0QA 4CFYA 1P7YA 3H8JA 2IXBA 2HF2A 3AESB 3MWJA 4EG5A 2M9MA 3HVKA 1RWOA 1K7FB 4AKHA 2M6KA 3WA6A 3ZK7A 1H9CA 4KQXA 3T0FA 1R6VA 1SAYA 1WP9A 2G7MC 4JYCA 2NPFA 2VSNA 3T7SA 1K4KA 1S2MA 2O2HA 3EDOA 4ND5A 3W90A 4AY6A 5BRAA 4K5QA 2GXSA 1E8MA 2NV0A 4B4DA 1MT3A 3LT5A 3BRCA 3G2KA 4IFIA 4Q4AA 4M49A 2FU5C 1BNCA 3PQ2A 4RL6A 2WWVD 1G2OA 4FI3C 5F33A 1V2HE 4BBAA 2WE7A 2WT9A 2A7QA 3DFZA 3L6EA 2O5RA 5KSPA 5SY6A 1ZUIA 3SHQA 3TLGA 1EUDB 4F60A 4QOSA 3VNRA 2GVNA 1WJGA 4XUDA 1K27A 2PKQP 2GPBA 4ACAA 1Y8CA 1HSOA 2ILTA 3ILVA 5LKRA 2PT6A 2XAAA 5JZSA 1RZRD 4CQNA 2Q3JA 4BQSA 1V95A 1H3EA 2QHXA 1I30A 1JPNA 3H1TA 3ZI7A 3AIMA 1TGYA 2DBYA 3RROA 2Q46A 4KVFA 3UV6A 3QOYA 1Z4MA 1JG3A 2VJBA 4MUKA 1JYSA 1MN6A 2F90A 2IWRA 5FI3A 4BJ5A 2JH9A 3SSAA 1AKTA 2JZCA 1VTKA 2CJXA 1KR2A 4RGBA 4GM4A 1YL7A 3WIOA 2Q4TA 2V7UA 5IHPA 2AFHB 1Q1QA 1SC1A 1SIBE 5K3SA 5EWMA 4RKQA 1IB0A 3DZHA 4D97A 1Y82A 2EP5A 1O0SA 1Y1LA 2DKNA 4CVNA 3H3FA 4X1OA 5C3MA 1GG9A 3P96A 5EXDA 3K5PA 4CQLB 2JFQA 1TO6A 1RWNA 3D7SA 4JASB 4WOKA 1IUPA 1XWFA 5HIJA 4KWCA 3W34A 4KQFA 3BXEA 2ZFUA 1HRDA 3MT0A 4JJ6A 4LX0A 3DL2A 3LCUA 2CLLB 1PKXA 2Q41A 3COJA 3N2KB 1K2WA 4NVRA 2LZ0A 2MOKA 3FGPA 4FDMA 2WTAA 2ID7A 3S2IA 1W2GA 4QYSA 3T06B 4H7FA 3DOEA 1Q95A 4UBLA 2ZRDA 1ML3A 1KOGA 3UAXA 4RTRA 1WU7A 4G0PA 2XE4A 3ROEA 4CF7A 2J59A 2PEZA 1QAMA 2W2MA 1CJSA 1R2QA 3SHTA 2CLDX 1U8EA 4LTMA 3IJEB 1VSBA 2HJVA 1CU1A 1UAGA 3LSTA 3WB1A 2CL7X 3M3PA 1PJLA 1ZIYA 3FROA 1S2IA 1LJUA 1M7BA 2GJAA 3FSEA 4K6HA 5B2ZA 4Q18A 5K3OA 3K16A 3FPEA 1U5CA 1VCNA 1Z22A 3HUTA 1HEYA 2Q2NA 2HLDD 3EZ6A 4ZCRA 1KI3A 1LWOA 1SOUA 4GR5A 4UU8A 1V0JA 4Q05A 3HABA 3UXEA 3BJMA 3WRXA 1U3UA 4NZ9A 4OLFA 3QEKA 4RFSB 3ELUA 2H4ZA 4QGGA 1TQ2A 2NM0A 2ORIA 3HDYA 4U6SA 4RZUA 5JAOA 2GEKA 3ZZTA 3FCUB 4C22A 2BFMA 3EGIA 4LXQA 2CJWB 2IHBA 3V4RA 2NN3C 1KPGA 3MPUA 4DLTA 2OZEA 1JFSA 2H4FA 3LXXA 3BA1A 4BVJA 1Q7TA 2A3RA 5DZSA 3ZZMA 2YS6A 3T1QA 3BKWA 4WN3A 1ZNYA 4QTYA 1X1DA 2XX3A 3B70A 1TQ4A 2WNHA 5DGIA 4CG2A 3GBSA 5JDCA 1FMFA 3EAQA 4K88A 5C35A 1PWEA 3Q7QA 1XQ9A 3AYXB 3ASUA 1AN0A 3HBMA 2O2CA 3W7VA 4KK4A 5KC9A 4IDCA 1M0WA 3SQDA 3CRW1 3FZQA 2ZSEA 4L15A 4LJ5A 3KT8A 5C8YA 2VSFA 3ZY2A 3ZDEA 2O6HA 5JNLA 1M0EA 3E7DA 1DTSA 3N3AC 4LOLA 3WLOA 2VO1A 5TQVA 1E0SA 2B4AA 1LV7A 1IMOA 3BWBA 1M1NA 4BBZA 1J1IA 4TT8A 2AW5A 1E99A 3HR4A 4HDKB 4HYYA 1DQYA 4LJAA 4CL3A 1H0RA 2GLUA 5U1PA 3BN3A 3PDUA 2GDJA 4ZVSA 4UKDA 1JVBA 1GITA 1OBFO 1IY8A 1W0KA 2NV6A 4FFVA 3HJNA 4PGHA 4RD6A 9ATCA 3UBTA 1V6AA 4G1BA 1V9LA 4MVJM 3DP7A 1ZD9A 4BMZA 3MEQA 4D9BA 2YYSA 4BKRA 1P2VA 1XU4A 2ZQZA 1LA2A 3MWGA 3KQSA 3B1JA 4PHCA 4TZTA 2PRIA 2R9VA 4UHHA 1FS5A 3A1UA 4NENA 1FNMA 3KR1A 5GONA 3RT7A 1TEVA 1X1AA 1E5XA 1RHUA 4KDRA 3TW8B 1GUYA 3RWOA 4EFNA 2EHDA 2VAPA 1SUFA 1PWYE 1BGVA 5FD8A 3BL5A 2IV3A 3JQ9A 4D98A 4FHZA 3I1IA 4KO1S 3AL0C 2VAMA 1PGPA 2NLOA 3WLLA 4NFLA 5BR7A 3BGOS 2P1DA 13PKA 4UCQA 2Z2XA 1ZU4A 5LYJB 1UFRA 3OMWA 2C03A 2QT0A 1C9DB 4WW0A 4EPVA 1DG1G 2I1WA 4HEA1 3ONFA 1T36B 3HUEA 1SHZA 1OYOA 2PLNA 3VO2A 4BNYA 5CYGA 2FGJA 1U98A 4QOIA 3ME5A 4TLEA 5DHUA 4I2NA 2YIDA 4INJA 1Z3CA 4G1VA 2LKDA 4QT0A 3LA6A 1IJKA 1KY4A 2OAQ1 4E6PA 2ZB4A 2IJGX 2XECA 4BY9E 1I2MA 2FZEA 3JQAA 5ALSA 5DYNA 4PN7A 4QDUA 5IJZA 1MB2A 2EX4A 3LNCA 1I4EB 4G8DA 5ED0A 4DPMA 1Z16A 2XRYA 2DHDA 1FA9A 1MPTA 3WKCA 1V5IA 1L7DA 2RJOA 1US8B 3NDRA 5UKDA 2VT2A 2ZU0C 5C8ZA 1IPHA 3BA6A 4GYKA 1KS9A 4URWR 3WE7A 5AM2A 1E5VA 5J2UF 1NI4B 1R74A 4A6XA 3QEJA 4K1LA 4INPA 1VRWA 3OT4A 4D4IA 4P1ZA 4BAUA 3NANA 5JCPA 1CRQA 3T7TA 1YGYA 2QLMA 2ZUDA 4XCVA 1ISRA 1HM5A 3LWNA 3BK2A 3Q2KA 2P9HA 2I4NA 2YN2A 3UW3A 4Z4GA 2BMAA 2A1IA 3H7IA 1XXLA 2JIZA 5FOWA 3HR7A 2AE1A 4XA8A 4AVYA 3RV3A 3S2SA 5AVVA 1RACA 1HE3A 2QAJA 1V39A 2ZUVA 5JMWA 3OO0A 2FWMX 1QF7A 3VKUA 3HM2A 5FI5A 4DDMA 3QQPA 3A6PC 4MRMB 1DC7A 2FN9A 1XTQA 2RI0A 3AWIA 3I1YA 3MBIA 4FR5A 5KVQA 4AS2A 2HNBA 2QXTA 1YA6A 3EQZA 3NXSA 3SIPA 3VAAA 3ZXXA 5IKOA 5MF6A 2E3JA 4W1QA 3BSYA 3I58A 4QX6A 2HSJA 1DPGA 3DOFA 2QM0A 3ORSA 1QNLA 4O59O 4F9GA 2VFAA 4YCDA 5C5DA 1ISGA 1DXHA 1P9OA 1S2OA 2JLRA 2QLJA 5KTRA 5L8VA 3MSCA 5AVJA 1R0KA 2BDEA 2R5WA 3ANTA 3UF0A 5F7XA 3PXUA 2KPOA 1W4RA 2HMSA 4ZFNA 3QWFA 3DAHA 1YZGA 4II3A 3W9YA 3F7MA 4QQ8A 1T5SA 4FW8A 1Y1SA 4G56A 3GT3A 1TTTA 4URUR 5KYGA 3HKEA 5MDHA 4AP5A 1WLYA 4B75A 3DQZA 2DFKB 5CDFE 1KZ7B 3D4BA 5KCZA 3CN9A 1VKZA 4I19A 1QC5A 1W4CA 3M9WA 3GLRA 3KQOA 2A86A 3SC2A 1IL0A 2OPBA 4DLVA 4DLWA 1WETA 1X8LA 3TLMA 1YF3A 2XQIA 4MV5A 1OLUB 4MKXA 1J00A 3FBWA 4FR2A 2ZRKA 1XMVA 3ROPA 3VH2A 5DTJA 3NEAA 1JILA 3LGAA 2WD7A 3HBFA 3SR4A 1ZMRA 1DG9A 1PEYA 1JDZA 3RYFA 3SYNA 1BXKA 2DHRA 3VZQA 2JAPA 1WUHS 3BIWA 1K0FA 3RIXA 4AKIA 1BS9A 3AUKA 1KP9A 1FP2A 2ONZA 1PO7A 1G98A 1UEXC 4H7KA 1YJ5A 3K92A 4O25A 4UNPA 4N0QA 5DNDA 1CVRA 3B5IA 3UB3A 1QTIA 2XHEA 3TQHA 3QMVA 4QUKA 1UKVY 3GGPA 4CTJA 3WNQA 4EG8A 4AI6A 3D2BA 5JI2E 1JB9A 4RMNA 3S68A 2ZPTX 1SVNA 1V7CA 3TOSA 2O23A 1Q19A 4AB1A 1THZA 4B8WA 2HJGA 1L5NA 1E9EA 4NJMA 4Z4QA 1NL3A 4GZMA 1C8BA 1N7HA 3LQ2A 4KR3A 5EIWA 2A0FA 4Z4HA 4OYLA 5E3HA 1WE2A 3TI9A 1QWOA 3OI7A 2F17A 4RK6A 3GRAA 2BM8A 1XKQA 5FTKA 1V6CA 3PFGA 2Q7OE 2FR8C 2XYQA 3GJZA 4WECA 2UVPB 3H0KA 1BGXT 1KL7A 4B3XA 3NPMA 4IEFB 3PR1A 4FGWA 5CVVA 3WLFA 4F7WA 3K6SA 4HWKA 3PUJA 3PSAA 2HY7A 4WVLA 3K0BA 2PUEA 1RXUA 2WJWA 3CE6A 1EDOA 2UZIR 3HCAA 5D3MB 4A6DA 3W4IA 4AMVA 3PNLA 1G42A 1N34B 2VHJA 3KEGA 1K7SN 4XR9A 2YXBA 1ZK4A 3DCIA 3NOVA 2JLUA 2ROQA 5K6AA 1NVEA 2GESA 3FE2A 4ZYWA 2JH3A 2C94A 1DKNA 2P41A 4A8PA 3G5MA 1QHHA 4BMVA 4Y1RB 3GRZA 4F97A 1PJBA 2V7WA 3NEYA 4U39A 4J2TA 1XU9A 3NBFA 4TLCA 4Y98A 2G1AA 4CLOA 1QK4A 4P08A 3IQIX 1RZVA 1E9RA 3JD1A 1CZOA 1NJ1A 1RP7A 3H42B 3P19A 2QVLA 5CYOA 4YMUA 4GOLD 2YJGA 1Z6GA 3KPJA 2GD1O 1YVPA 1QQ6A 3EMVA 2F7SA 4C9BA 3KPVA 5KYYB