4MRMB

Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist phaclofen
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
415
structure length
400
Chain Sequence
SPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/antagonist
molecule keywords Gamma-aminobutyric acid type B receptor subunit 1
publication title Structural mechanism of ligand activation in human GABA(B) receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 137
structure length 400
sequence length 415
ec nomenclature
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01094 ANF_receptor Receptor family ligand binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mrmB02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mrmB01
3LUCA 2PUDA 2MYNA 4RWEA 4G0XA 1H9CA 2GWRA 4MQFB 2QSJA 3LKVA 3HVRA 1L5ZA 3C3MA 3EDCA 2FQYA 4Q6BA 3T8YA 4FB4A 3KLOA 1ZDMA 2M1ZA 2NZUG 4ML3A 5T3YA 2FMFA 2LBPA 2PAFA 1MAVA 3T6KA 3KG2A 1NXXA 3RVMA 3I42A 1ZH4A 2TMYA 2WJAA 1D2AA 3RVSA 1WETA 3DLHA 2IPMA 1I3CA 1XHFA 4RK0A 4YLEA 4MS4A 3N0RA 1ZITA 3O2SB 5TQ2B 5TQJA 3O1IC 2PUEA 4MR9B 4RK1A 4EVRA 1BA2A 4F12A 1USKA 4EYGA 4YCSA 4OLAA 4KVFA 3CHYA 3R0JA 3F6PA 4N47A 1KRWA 3RVOA 1ZAYA 2FW0A 1YMVA 2HQOA 5EWLB 2Q5CA 4QYMA 5KC9A 1BVHA 1K68A 3KHTA 1APBA 4GPAA 5F64A 4QPJC 3GYBA 3LMKA 1E2BA 4LE0A 2MSKA 4CBVA 2ID7A 4KFCA 1Z26A 2JRLA 3MMNA 3RVJA 3GV0A 5TPWB 4MQFA 1KMIY 4N03A 1EHCA 4NICA 3KYIB 3SQNA 3IP7A 4F3TA 4W5RA 3JVIA 1OXKB 4RDCA 4PZ0A 4EYOA 1EWTA 3O2QB 4HYEA 2BGGA 4W5OA 3BRSA 1ZY2A 4L4UA 2E4ZA 2X7XA 4IRXA 3H5VA 3FFWA 5HKOA 3QEMB 2WMYA 3MA0A 1M5TA 2R25B 1GUDA 2AYZA 1YVUA 2ZAYA 3OLWA 3IPAA 1RPJA 3HDVA 3M9XA 2PUBA 4XFKA 2FLKA 2MSLA 2VK2A 4ZMRA 1SXIA 3LUHA 4EYQA 5IBQA 4RY9A 5KQMA 5CNIA 3O21A 3NHZA 1ZESA 4YRZA 3TO5A 1QNLA 3FDFA 2H0AA 2JBAB 1EFAA 3LUDA 1LJLA 3MM4A 1DCKA 4RK6A 3TB6A 3QLVC 1T34A 5TPWA 3OLZA 1YS6A 1XWWA 2HPHA 3QX8A 5EWMA 1NY5A 2E4UA 3OO0A 5JNUA 3RVPA 1FQWA 4JB2A 4HNQA 3GA5A 1ZGGA 4PYRA 3JVDA 2FMIA 3EQ2A 3GRCA 5C5CA 3OO1A 4IMIB 2PUGA 2H3HA 2L2QA 5DCLA 4Z0NA 2WY2D 3LTEA 4WUTA 4M88A 1ZVVA 1QKKA 1NATA 3GL9A 2E4XA 4RXMA 1JHZA 4FE7A 3CS3A 3SAJA 3H5OA 4G0OA 4D6XA 3MYYA 3E3MA 4MRMA 2IKSA 4Y9TA 4RXUA 2FKAA 1D1QA 3JS5A 4MS4B 1YK1A 4NCBA 2O20A 2PJUA 3E61A 4RXTA 3HS3A 3T38A 3A3KA 5B3JC 1YMUA 3DGFC 5FBHA 3SY8A 3L6UA 4YO7A 2VYCA 2A9RA 2AYXA 3GBVA 1JYEA 3C97A 1D5WA 2J48A 2QZJA 1DC7A 3K9CA 2A9OA 3KLNA 3HUUA 3N53A 1NXTA 1P2FA 2R48A 4IMJB 4ZMSA 3FMVA 3EULA 3EJWA 1U8TA 2YHBA 3QX9A 3G1WA 2FVYA 1D4ZA 2OENG 3C3WA 2IPAB 3VNAA 3FFXA 3EAFA 4KV7A 3GBPA 5KWSA 3QK7A 5CNMA 4EYKA 3CKMA 5BRJA 4G0QA 1SRRA 4G86A 1P8AA 1C0EA 1Z2DA 3NHMA 2GX6A 3RH0A 1JWLA 1IIBA 2QW1A 2MSWA 1PUXA 3EQZA 3QLTA 4TMYA 1JF8A 3IP6A 3TX6A 6CHYA 2L19A 4DADA 2ZWMA 4XLTA 3S99A 1CHNA 3H75A 2NZVG 1JBEA 1U0SY 4HNSA 3O74A 3JTEA 5E3JA 1NXSA 4WXMA 1NXOA 3DBIA 4RS3A 1QQAA 3GWGA 1USIA 4LE2A 4N41A 1PNRA 4YGXB 3F6CA 4JP1A 2FEWB 1BDHA 1DRJA 5IULC 1PEYA 1JH9A 1LBIA 4KQCA 2E4VA 2RGYA 4RKQA 2XDYA 3JPYA 2HQRA 4RK7A 5D2CA 2QU7A 1HEYA 4OATA 5EWJA 4LE1A 4N0QA 1OXBB 3N75A 3ILYA 1Z15A 4RK4A 1GCGA 3SNKA 1AB5A 3O2JA 4PE5B 5EWMB 5IUKC 1K66A 4MLDA 4EVSA 1Z13A 5IEJA 1ZHHA 4MR8B 4MS1A 5FBKA 2FMKA 1BDJA 1DBPA 3H5TA 1B00A 1ISRA 2N9UA 2NUBA 1JDNA 3FGZA 3F7NA 1QO0D 3H5WA 4F06A 5DKFA 4G0PA 4Z4IA 1KRXA 1R8JA 1YS7A 5DLEA 4MR7B 3IDOA 5HM6A 2A9PA 1DC8A 4N0PA 1USGA 2PE5A 4KREA 1J56A 4KZKA 2GBPA 4OBBA 1A2OA 3RVRA 1FFWA 2NT4A 3LKBA 1LBHA 4MRMB 5CNJA 2PMCA 3CG4A 1MB0A 1QO0A 4LDAA 1YK0A 3RVNA 3SG0A 4DQDA 2B1JA 2DRIA 3A0UA 1LJUA 4ZJPA 1PEAA 5BR1A 1JX6A 1FSPA 3NNNA 3H5IA 3UUGA 3MQ4A 3HK2A 2P9HA 3M9WA 4MS3A 1D1PA 1QP0A 2JVKA 8ABPA 4MYRA 4UHJA 2FEKA 2HJ9A 3N8IA 1U2QA 3H1GA 3OLXA 3Q7RA 4PEVA 3TMYA 1VKRA 2R47A 2RJOA 1S8NA 3OLVA 4LDZA 4YWHA 4OG2A 3ROFA 4JAVC 1EWKA 4G0ZA 4H60A 4Z9AA 1GUBA 1NXPA 4MR8A 3MF4A 1NXVA 3W9SA 3Q7SA 2ID9A 3H6HA 3HSYA 3KCNA 1E6KA 2QXYA 3KTOA 2JB9A 3LUFA 3Q7TA 3GT7A 3URMA 3LUKA 5KQPA 2FLWA 2JVIA 4QICA 2V0NA 4Z9BA 2QVCA 5IUNC 3HCWA 3MIZA 3O75A 3N6VA 1NXWA 4MR7A 2HSGA 2IDMA 3ROTA 2QR3A 3KYJB 1Z2EA 5DGCA 4Z4EA 4NCAA 2RDMA 3LUJA 3DZDA 5GOTA 3K4HA 2PLNA 3BILA 4MGEA 4YP9A 3CNBA 4EUKA 3CZ5A 3KKEA 4WXEA 4KK3A 2GI4A 3Q9SA 3JPWA 4KRFA 2LIVA 4H3HB 4WWHA 4PICA 5IUJC 1TJYA 4RKRA 4TLLB 3A0RB 4D6YA 2IOYA 2MYTA 2IYNA 4H3KB 1RZRA 1BAPA 4S05A 2PL1A 4GNRA 1SXGA 5DTEA 2FEPA 1EWVA 3CRNA 3I45A 3N0WA 5EWJB 1MIHA 7ABPA 3HEBA 3P9YA 3QLUC 4QYWA 1DBQA 4XXHA 4YV7A 1ZN2A 3FFTA 3HV2A 2NT3A 2PL9A 1FFGA 5KQGA 5CHYA 3HUTA 1Y1LA 3RVQA 2M98A 4MS1B 1P6QA 4F11A 1W25A 2FXIA 5BQ3A 2FQWA 1LK0A 2R4QA 3Q15C 2GKGA 3IPCA 4RU1A 1DJMA 1F4VA 3QELA 5JNVA 1QMPA 2E4YA 3QEKA 1TMYA 4L85A 1MVOA 3H5LA 4ETIA 4S04A 3F73A 1GCAA 4O1HA 4JB0A 5TQ0A 2WB4A 4O1IA 4P98A 4KK4A 3G85A 3UK0A 4MQEB 3CU5A 5FWXA 2FN8A 4Z99A 4ETNA 1ZGZA 3CFYA 2F8SA 3EODA 5JNWA 5KI6A 1NTRA 3D02A 4WT7A 4G0MA 4TLMB 3UKJA 1JLKA 5FWYA 5T7BA 1KGSA 1RXIA 5BRAA 1TVMA 1EAYA 4WZZA 4MLCA 4MS3B 4EVQA 1M2EA 2QVGA 1DCMA 2FTKE 4KPYA 1JL3A 4EY3A 2QV0A 2WJWA 1CEYA 2RJNA 1MB3A 3LFTA 4RK5A 2WWVD 5ED4A 1Z17A 5JNSA 1TLFA 3OMXA 4HNRA 1QP4A 1ISSA 2OQRA 3BBLA 3I09A 5HQJA 3KSMA 3NNSA 2JCGA 3OQOA 1SXHA 2MYPA 4Z4GA 3HM9A 1DCFA 4E7OA 3HDGA 2JVJA 1A04A 4RY0A 2JK1A 9ABPA 1DP4A 4MQEA 4Q6WA 4JASB 5C5EA 3QLVA 4W5TA 3M6MD 4G97A 4XAQA 4YS6A 4YR7A 3A10A 3KJXA 4F8JA 4NV3A 5I4CA 3L49A 3NBMA 3C6QA 1E6LA 4OTZA 1A0OA 3H6GA 4JA2A 5HSGA 1JFVA 1DBWA 3CLKA 4G0YA 5TE9A 1F51E 1YIOA 4MAAA 1Z12A 1JFSA 5IEBA 6ABPA 4OLBA 3H1EA 4XARA 4Z4HA 4W5NA 5JS1A 2FSPA 3OQNA 5TQ2A 1Z16A 3OLYA 2PUAA 1VLZA 1QQBA 3D8UA 2FN9A 4MR9A 4UHKA 5IC5A 2L17A 3VNBA 2IPNA 3SM9A 3TD9A 1JFTA 4NQRA 2W42A 2LPMA 3ILHA 1YTUA 1E6MA 4EGSA 1RXEA 4LRQA 2A9QA 5EWLA 2PKXA 3N0XA 1ABFA 4E7PA 1XHEA 1SD5A 1Z25A 3JY6A 3KS9A 2PUCA 1Z18A 4LZLA 1GLGA 1U04A 1AB6A 3B2NA 1ABEA 2L18A 1FFSA 5B3JA 5KC8A 3HXMA 1QP7A 3LUAA 2FMHA 3OMWA 1VPWA 3CZCA 3OM1A 2VUIB 4Q7EA 1RZRD 3HZHA 4LX8A 1URPA 1P6UA 4TN5A 2IPLA 3QELB 4RY8A 2MYUA 3HJFA 2CD7A 4ETMA 3DGEC 5CNKA 5TPZD 3RVLA 3DLBA 1M2FA 1TM2A 1W9HA 3LOPA 4XASA 3O1HB 4P1ZA 5ABPA 3NNDA 5KQLA 3IP9A 5TQ0B 4W5QA 4JOQA 3QEMA 3T95A 3QLUA 3Q41A 1BDIA 1DRKA 1PNTA 4KMRA 3RQIA 4RZSA 5FWXB 2B4AA 5IX8A 2LUOA 3C3KA 1DG9A 1JDPA 5TPZA 1RNLA 5FWYB 2WRZA 4Z4FA 4RSMA 4IF4A 1UDRA 4O5AA 3O1JC 2P4UA 5GQSA 4D74A 4B09A 3CG0A 4N76A 2KYRA 3IP5A 3EGCA 4KNYA 1DZ3A 1JYFA 1C4WA 1QPZA 2VUHB 3HO1A 1M5UA 2YHAA 2JBAA 3H1FA 2LP4Y 5PNTA 1PHRA 5JS2A 4Z4CA 2PUFA 4FE4A 2FQXA 4ZPJA 3BREA 3OQMA 2CHFA 2F8TA 3OM0A 1VRVA 4DN6A 5JNRA 3LUGA 4RV5A 1CYEA 4MPTA 1ZH2A 2HQBA 4IGAA 4ZYLA 3CTPA 3RVKA 3BRQA 1U2PA 2CHEA 4KQ9A 5JNTA 3I5AA 1L5YA 2CWDA 2I6FA 4IILA 2E4WA
chains in the Genus database with same CATH superfamily
1XK6A 3VPAA 1WP4A 3TEJA 3VAAA 1CUJA 1CJUC 2OT3B 4FMCB 2DHQA 3T1TA 3TUIC 1HDIA 2E82A 3EOBI 3F5SA 5LZ8A 3NANA 3FVQA 3CF6R 1CXZA 1VE3A 3PENA 2FEXA 3E35A 5LQNA 4OJTA 1AXGA 1Y9JA 4H77A 3AUUA 5HYVA 2XKKA 2WBLC 2X1MA 2NVUA 3PI7A 2FMFA 2HWKA 4V0KA 1EJBA 2CFIA 3DTYA 1E2GA 4DNPA 2ZRMA 4S24A 5DBFA 1D5CA 4NPCA 3HXOA 4AYXA 3SQMA 1NVUQ 2YZ7A 4BNXA 4Z1MD 4BX9A 4KOAA 1CUGA 5UKDA 2CFCA 5JVDF 2OCBA 2NYVA 1DDGA 1V8FA 5TQJA 3QSYA 4LF4B 3LHSA 4RK1A 1VYVA 2B4RO 5K8LA 1E1RD 2XNCA 2IZ5A 3C41J 4IDPA 3R0JA 2I2CA 4QQKA 4WSOA 3MB8A 2VSFA 4RZ2A 2C3OA 3TXYA 5DBHX 4Q00A 4RZUA 2H1IA 4X7PA 1Z4QA 4ENSA 5DYIA 1BVHA 3W6OA 4CQMD 2IYUA 2QJTA 1B73A 4XSVA 1G16A 3ABIA 3HJHA 4M22A 5E1MA 3G2HA 2QGZA 5FADA 2PL5A 3I01A 4F96A 4IDQA 4OV6B 4F04A 5KSWB 4DR1B 4ZICA 4CL8A 3IPRA 3LXRA 1EHCA 1XUOA 3G0OA 3MCAA 1P29A 3IJPA 3KLBA 3WV5A 3WGIA 2CVPA 4X64B 4Q3EA 1EUYA 4QGBA 1UKZA 1ZXLA 4WQMA 4CM4B 4BRUA 2H07A 3U61B 3UXHA 2OUIA 1P19A 4P0TA 2OBYA 4K6OA 3WL5A 4N9WA 3ZY4A 3L41A 3DD1A 2FFAA 2J5QA 5EFZA 2XI4A 3DO6A 2QG4A 4HZGA 5B1EA 1NW6A 1UPAA 4FOOA 4XUEA 4JOCA 4H08A 4IDGA 5AMXA 1V6SA 3G9QA 3B1JA 2RBKA 2C59A 1LDGA 4N1AA 3DQPA 1FEZA 3LLCA 4DMGA 5JCZA 1HFKA 5CT6A 3GFFA 5CVEA 1U5BA 1K06A 4P5EA 4Q47A 1T8YA 2FHSA 1RWVA 4LV6A 4QM6A 3GGJA 1XOIA 3M5PA 2HDWA 1YRLA 1FJXA 2CKDA 2D8MA 2VDLB 3R3VA 2XDQB 3DXXA 3L1HA 4X95A 3FTNA 5DXFA 1B8OA 1VGRA 5B2EA 4YT4A 1V3QE 5CH3A 3TLAA 2RHLA 1AUOA 1BHJA 1J22A 1H2WA 1DARA 2F6RA 3F5FA 3KX2A 4RHEA 3UV7A 3WL6A 1GNVA 2RBEA 4JJGA 1JAZA 2Q50A 3NOQA 2A0XA 4L5IA 3GCZA 4LZJA 4P3OA 5G0UA 5TPWA 3JQGA 2QNBA 2KWIA 3TE6A 1BXGB 5G3ZA 5LNK1 4BB5A 2CV2A 2C0QA 3PFWO 3AEQA 3I73A 2HDOA 4Q3CA 2F8LA 3I37X 3IMEA 3TW8A 4HNQA 3WTCA 1FBTA 3JVDA 4L75A 2JGRA 4OAQA 3KSBC 5GTDA 1W5SA 1J1ZA 3OO1A 4DSAA 4YMVA 4WKNA 3B3FA 3D8BA 5IWCA 1VJ0A 3U5TA 4FZJA 1FFEA 1MC4A 1R6XA 4FDMA 1DXHA 3A6LA 2BKXA 2NO5A 4IX9A 4AJPA 1ACLA 2XF8A 5GIPE 4BLTA 4EHLA 3DL4A 4XDYA 5CM9C 4CM3A 1ORWA 3WYDA 4CUKA 1J9ZA 5HNKA 3RBAA 3C1OA 3X1WA 1ZAKA 4AD8A 1WBDA 2AHOA 1XNRB 1GSOA 3PHJA 2A1UB 3DLCA 5D1NA 5AXCA 3FW1A 5DSTA 3ZQUA 1G7CA 3P9NA 4D8TA 2EQ5A 2MJLA 1XXHE 2R87A 4DQLA 1NVVQ 4MRNA 2PGNA 3GCXA 2COEA 3RRNA 2PZEA 1OUMA 3UHJA 5KNBD 1GPYA 1AF7A 2G40A 2NLOA 3I9FA 3P8ZA 4YCLA 1DKRA 4J94A 4HQOA 4B0PA 1WUJS 2Q8NA 1N2OA 2E18A 2IE0A 2A9RA 2ILVA 1DMSA 1XEFA 3TLGA 3VPXA 5AKLA 1WMSA 5TS3A 1TYZA 5D3MA 3K9CA 4EY6A 4NKRA 4XQCA 2Q1UA 3N53A 2ISCA 1UINA 1CJCA 2GNAA 1BMFD 4UBMA 1OT3A 2HAEA 3T52A 5JQGB 3Q3HA 3FPAA 3B5JA 1L5OA 2C2YA 4DC1A 4W1QA 1AZWA 1T8PA 1VLQA 1HDOA 1NW4A 4HUQB 2E85A 2VF8A 3VAYA 4CN9A 2A0FA 1EFUA 3EW9A 2CNLA 2M1XA 1O1YA 2JZOA 3PVZA 1T0BA 3RBVA 2IYQA 3TR5A 2XTNA 4W6ZA 5I7VA 4YAKA 4GLBA 4HXFB 3IHTA 3S2SA 3KEMA 2PLWA 1YOVA 2I6UA 4LAFA 1J8DA 3QNWA 4M0EA 1DU4A 3LFUA 1BMDA 4QRIA 3ABRB 3R09A 6CHYA 5T6MA 5CXQA 4L4RA 1R15A 3HDJA 1IPEA 1ZVQA 4IIJA 3D6UA 5AKKA 3TIVA 4CR7A 1NW5A 3ST7A 2ABWA 1Z2CA 5DHRA 3VYVA 4C88A 3O74A 2OV4A 4GZMA 4XQ9A 1P4GA 2QM0A 3AIKA 3JTEA 1WXDA 3DE2X 3PKJA 3U1VA 5F5LA 1ZMTA 5ISMA 1U7OA 2I3DA 1HNWB 1XDWA 3KQTA 2ACKA 2AN1A 2XRYA 2QJRA 4LJ8A 4AG6A 3MAAC 2D1FA 3WADA 2PMFA 2Q45A 3ICCA 2XITA 4GLJA 4DV7B 1V39A 1E2FA 1AKVA 1Y1KE 2BGRA 2EGGA 4YGXB 2O2SA 3SX0A 4Y18A 4ZO4A 2J0EA 1EA5A 4BE9A 2HJVA 3HVKA 4FHFA 2RJ3A 2NX2A 1KKMA 2PKRA 1N77A 1OTXA 1PEYA 2QQFA 1UKCA 5ALYA 1U0JA 1U2ZA 2B2XA 1TMGE 2Q1TA 3JPYA 3BWMA 3EXFB 3T61A 4I55B 3WBJA 3BQ9A 1G21B 3EIFA 4I50A 4CMEC 4Z53A 3S55A 3BK7A 2RH8A 3BJRA 3QFTA 2E89A 5TT1A 3VHXA 3N2NA 1UEJA 5LXTA 5JY1A 2AG0A 2GFHA 3UWMA 3HCFA 4AZ0B 3RYCB 4MUEA 4BV2A 2ZATA 1L5GB 4ABTA 5FBKA 3PC3A 3L6DA 5JZ9A 2CB9A 2GLTA 2Q9BA 1TEHA 1KY3A 1MV5A 4XCVA 5DKFA 1C4XA 4CL0A 1LLQA 2WM3A 1KRXA 5JUWA 4KG7A 4Z3KA 1T8RA 4HDQB 2A9PA 1C7ZA 1IPFA 3GW8A 4BJ3A 2F00A 1XXLA 2CXXA 2VXCA 4HDRB 4QULA 3FPFA 5LQJA 3S8MA 4Q93A 3IVGA 3TOVA 4YPVA 5BW5A 1KU6A 4RTKA 1KZ1A 1H3NA 4UE6A 1KMQA 3DC7A 1C4KA 4X63A 4ESHA 3HADA 3E6AA 3ZHXA 1DIAA 1Z28A 2V9ZA 3NNNA 2WMDA 1FSPA 3WB0A 4OGLA 1DC5A 1ZSVA 2JKZA 3ZS8A 3NRBA 3T94A 4QAQA 4HAUA 2W2VA 3IEIA 4Z3DA 5GZ6A 3W06A 4ENWA 4PFQA 3AIMA 3HCAA 2HJ9A 2V7QA 4WZBA 4CRWB 2QY9A 3G9ZA 2Z2JA 1FVXA 2TMDA 2YY6A 5IF3A 2LGJA 3LW8A 3TLJA 4K9KA 1EWKA 1JW9B 1A82A 1Z2AA 2CLSA 2P6MA 1U4OA 5T5QA 4E1BA 1IEVA 2HWXA 2V5VA 3L8YA 5J5VA 3KNZA 3KD3A 1XA4A 4ZPXA 3Q5DA 5BV2P 4WTOA 4DARA 5GPBA 3OZDA 1N5MA 2GN2A 3RTEA 1YGYA 3R3YA 2HSGA 2PSJA 3NUZA 1L3IA 4KXXA 4ZOQI 7MHTA 1CQXA 2FX5A 5EJEA 4HYYA 4L5CA 3RE1A 4DV4B 1Z07A 3FOAA 3AXSA 2HXGA 4LXYA 3WL7A 3PC8C 2WIAA 2ASEA 1MABA 3RADC 4F1KA 1UWLA 5H70A 3V1MA 3ONVA 3LZCA 1FP4A 3WK7A 1J0EA 4QDOA 5FUVA 3W2FA 3BGDA 1P1CA 3P71T 3K53A 2CKMA 2IW1A 4P7GA 4E5YA 4HVTA 2RE8A 2GPYA 3NX4A 1CB7A 4I2VA 1PWHA 1VECA 4N5HX 4Y7DA 1YKFA 5EMMA 1KOFA 5FYQA 2R7NA 3ZH9B 1QWOA 3R0IA 1OWPA 3LK7A 3PXCX 4RVCA 4X41A 4O2AA 2CNOA 3SDBA 4OGKA 4AMYA 5LSAA 3CRNA 1QUEA 1TIBA 1RQNA 1HDCA 5AQ1A 2FN4A 1X13A 1EDOA 1S7CA 2FZWA 1BCRA 4KXWA 3RQSA 3GPBA 5EVJA 3WR5A 5BN4A 2ZPTX 3HDHA 2ZTMA 4PANA 4OL0A 2G1PA 1O8BA 3ZCUA 5JD3A 2D0PB 3M1LA 5AR1A 3OZCA 1DUSA 4J49A 3EGDA 1IHYA 5G40A 2R1TB 1JHXA 4DV2B 2XBLA 3JQFA 4CKEB 3M3DA 3TZQA 3WYFA 3ZC3A 3T5AA 3RYFA 1ZI9A 2EF0A 1YL7A 2HSWA 1LK0A 3CEAA 2R4QA 1I6KA 4KDEA 3VVMA 4WLUA 3UHFA 4V0SA 3AMVA 4F56A 3LT5A 1NP3A 5JXIA 3LW7A 1Q17A 1TAHA 1Q1NA 3O4RA 4XWWA 3UV6A 1I2DA 3UK0A 2B92A 1IONA 2QORA 1NC1A 3LLVA 1N2SA 5FOSA 3U26A 1L9KA 1DINA 2ZFUA 4CEJB 3B9BA 1ORDA 3TNYA 4LHZA 2QMZA 1HA3A 1JT2A 1X8XA 3QU2A 4U5QA 1JLKA 5EZ5A 1V96A 1T1EA 5F5NA 1ZRHA 4LJ7A 1QYRA 5I7UA 1AE1A 2IF0A 2RONA 3GOHA 1L1EA 4BB9A 4C04A 1Y8RB 1E1QA 2HNBA 3D3WA 2NNWB 4S2UA 2P9QA 3SM3A 4CCSA 1IBLB 1BH6A 3ND8A 3QVUA 3I8OA 3NEYA 1Z4LA 3P32A 4OHMA 3SP1A 2GZRA 5JH7B 3KQLA 4G5QA 1VE9A 4YT2A 5CFZA 5EHXA 5LVAA 3ZD6A 5KKAA 1C0LA 1ZQ9A 1E3EA 2ZTLA 1JE1A 1GN8A 1HLPA 3A1CA 4GT1A 4WKPA 1RQXA 1EXDA 3IAXA 1TZ2A 1WF3A 4I14A 5BNFA 3T4UA 3UPUA 3G2PA 1DEKA 1WAMA 4PZEA 4QECA 3RRZA 4BNNA 3ZDAA 4JI7B 1YQQA 1TX4B 2VDWA 3VDXA 3GFOA 4CDMA 4WBNF 3DZJA 3JWEA 4YCNA 1C4OA 1RD4A 3CVWA 3NKVA 1YNSA 2F3RA 4MUKA 4RJLA 3EFEA 1TA4A 4RIEA 2G0NA 5D6OA 1C7FA 4I50F 3WIDA 3TGWA 4MGYR 1DX6A 9ABPA 4B3TB 3EA5A 3LP6A 5C5EA 5JS8A 2QXTA 3M6MD 2JJ2A 2ZAGA 3C39A 4QHYA 4UCWA 2NXCA 1TEVA 3JRXA 2WUFA 1PJBA 4OQMA 3VHQA 3NT4A 3QVGA 3VRHA 4F8JA 3NBMA 4JKOA 4IO0A 1DHRA 1SUAA 3H6GA 3E70C 4HMOA 4OP3A 4YXWA 3ADKA 3ADPA 2IXAA 4M55A 3KZCA 1VYHA 5TE9A 2Z1MA 4CETA 3INGA 1TYCA 1NVFA 1PR1A 1PZFA 2FNAA 2HJRA 2VHCA 5T4HA 4JJZA 1OYVA 2EDAA 4Z4HA 5EJIA 2ZUUA 5DH9A 4DV0B 4MULA 3AFIA 5IHXA 4CTMA 1Z16A 2GVNA 1ML3A 2I6GA 3H4IA 1NOIA 4MR9A 3IUSA 4ZU6X 1WPXA 4A0HA 4C4ZA 5AVZA 2V7VA 2QSZA 2AMVA 3OTIA 1US8A 4LW8A 4UTZA 4PRYA 3REQB 5BUSA 2CC2A 3JALB 4HDKB 1UMKA 1RU3A 1MTOA 1D0VA 3VVBA 1JXQA 2HCJB 2F90A 2IIQA 4LRQA 1E3SA 4JT8A 2V4ZA 5JBNA 1HDRA 2OORA 4OSOA 4MO9A 5TV2A 2ZSHA 1AOXA 4HDSB 4K1XA 4LZLA 5BPFA 1U04A 2CLCX 3RV4A 5EINA 2F7SA 2P3LA 1SBQA 3PYXA 5JPIA 1AGXA 4BCBA 4G1CA 2I55A 1NONA 4NYIQ 3COJA 4PXAA 3B6MA 4R98A 4BZPA 2PGXA 3S40A 4DCPA 3PGMA 4E94A 2X4GA 3H18A 4H9GA 3CH4B 4NEGA 2JFZA 2AW3A 5B2ZA 2BJWA 1M2FA 3DULA 3SXPA 4O3MA 1KTVA 1XK7A 4ND4A 5ABPA 1N1EA 2J07A 4NFYA 4WEOA 5WRFA 3QEMA 4TVBA 3TBHA 5CEJA 2GM4A 1TYDE 3DT8A 1E63A 4JY7A 2RH4A 4EPXA 3QUBA 1E7MA 1E0JA 3LXMA 4AMBA 3Q10A 2XE7A 1CULC 2POCA 2XNJA 2Y0CA 1K6XA 2WYHA 1QJCA 2B5VA 3C3KA 1BS9A 2G08A 3D5EA 1GTZA 3MCTA 4KSYA 4NCKA 2GPTA 5HZKA 2RI6A 1C9JA 3DCNA 4KRGA 3Q85A 2H9IA 1F0NA 1V9LA 2VNKA 4DB4A 4QQFA 1H05A 2REBA 3I83A 1KIFA 4O3FA 3UGTA 3V1TC 3W05A 5HIAA 5KU7A 4FYXA 2AX4A 1C7JA 2X15A 3HO1A 1Z7YA 3L6EA 4Y9SA 2D13A 3PCTA 2JBAA 1H93A 1QFYA 1GT6A 3LA8A 1NMZA 4N40A 1GLVA 2VSYA 2HHCA 3HVIA 4PHHA 4DXAA 3KQSA 2FQXA 5K0CA 1XMJA 4NMWA 3GLSA 3LF1A 3MAJA 4ZYWA 3SBXA 4S12A 4UAGA 2QRPA 4CM9A 3AB7A 4LJ5A 4BPRA 3IE0A 5HPYB 1U2PA 1YFLA 3BFXA 2EFDB 3VR6H 3VYWA 5E6SB 3U17A 4GMKA 2R4TA 3I8XA 2R6GA 5JAMA 3TTSA 1H9CA 1N2BA 2C7BA 5HWSA 1PWEA 1W6RA 2ZU6A 4UAUA 5K3DA 1YR1A 5SICE 3NFRA 5IN4A 1IXYA 1MIOA 1OHHA 1R8QA 4NK4A 4QBGB 4HG2A 1NJFA 1U65A 2P4SA 5T3YA 1RQPA 2ZP1A 2OV8A 2XAAA 1DEXA 4PPQA 1EXVA 1A9XA 3WAJA 1Q7EA 1WTAA 1P1JA 2QUJA 3MCUA 4JXKA 2WTEA 3L8CA 3VOAA 2YJGA 4CLHA 5ILQA 3L7MA 4LA4A 3SZRA 3WYAA 4J2HA 2SCUB 2ET6A 3F71A 3E0XA 5EXDA 1ANKA 1KZ7B 5EMKA 3SJ7A 3QPVA 4EYGA 4YCSA 3ECAA 4XIFA 2V5UA 4IUYA 2WD9A 4E5SA 1KRWA 4CCYA 3DZKA 2HQOA 3DP9A 3UUFA 3K70D 3DFZA 4HSGA 1APBA 3WK4A 3QG1A 1JIXA 2YXPX 3OX4A 1N6RA 1IIRA 1UPFA 2WIDA 2YIDA 3P1JA 2CL5A 4KGVA 2BHSA 4WGFA 1SOUA 3P9SA 4CQLA 5AW7A 4GI1A 5CIYA 2WINI 4ID3A 1QGED 1OTYA 3NAZA 1GGHA 2YHIB 1QV9A 3H9GA 4ZIRA 1U5CA 3P0RA 5LMCA 3SQNA 4URHA 1F0PA 5HE9A 4BV3A 4N3NA 1RJ9A 5KOYA 2MSNA 5A7FA 1YR7A 2P2LA 2FW6A 2VP2A 1GA4A 1ZY2A 4REOA 1XR3A 2E4ZA 3HJCA 4BQSA 3KAQA 1E2UA 5SYMA 1R7RA 3O0DA 4BFXA 1JHVA 4DIKA 5AW8A 3R5KA 4AZSA 1Y1RA 1ZMRA 2BFMA 3F90A 2PZBA 2R25B 1A8IA 1YVUA 2CJXA 4RL6A 3DCJA 3MCWA 5E7JA 2AVDA 4MYTA 1KMMA 4TKUB 3TZLA 1JMVA 2OMEA 3MGKA 2R96A 3S5JA 4DC9A 1GUZA 4E03A 4RFSA 3THWA 1EIWA 2W6ID 3KSDO 1T2VA 2R00C 1P75A 3DFUA 1QYDA 5EA2A 4DCUA 4MWSA 4RY9A 4DNOA 3LM8A 1UBLS 1YZKA 1WXWA 3HA2A 4CW7A 2ODTX 1R50A 2VG8A 4YRZA 5HFAA 4FINA 3W4IA 5JC8A 5F9FA 1TGYA 3BQNB 5GM2A 1U5AA 2DWPA 3CVJA 3D64A 5H82A 1X0XA 4G8BA 1HMPA 3VSCA 1EFAA 1B4DA 4WK0B 2BHLA 1I0ZA 4JQYA 5GMOA 3TG8A 5DX0A 2H29A 3FCOA 4MW9A 4YCMA 2PBRA 2D5IA 3VPBA 4BNDA 4U0JA 3F6RA 4JI2B 4AN0A 3WDMA 3T7RA 5BWMA 1DI0A 5K03A 2VZ8A 4PXSA 5CK4A 5FH9A 4ITUA 1XRMA 2P2YA 5DK4A 1CRPA 4PPGA 4LSZA 1C3LA 5FTNA 4AN4A 5K20A 1C0IA 4XD7A 5IRCD 10MHA 4FFSA 1BS2A 3GA5A 2ACEA 3R0XA 4E21A 5C5CA 1OFUA 4BYMA 5LDDC 2OVBA 4HLUC 5IN5A 4CM7A 3CIFA 4UQLA 3U3XA 3ZCPA 4HADA 4DLNA 3ZD9A 1U8EA 4K9OA 2DFNA 2XD9A 1OZGA 4CMIB 4KR6A 3DZIA 4WY8A 1QKKA 3GNLA 5KDOA 4K8OA 1Q0RA 4NSNA 4R68A 1N92A 2HNAA 2QJOA 4X6LA 2D00A 1XDZA 5FO0A 3PE4A 3V2HA 2OESA 4W9MC 3SE0A 4YALA 2YFYA 3AF0A 2GN9A 4LQLA 2H5IA 2OFFA 1H1DA 2YWEA 1LBQA 3HU2A 3VYUB 3ZVMA 1JEYB 2OGZA 4DA8A 3EEQA 2B1IA 1QAMA 5ALIA 3X2FA 4ZV7A 3VR3D 5DRYA 3WSWA 1P44A 2CNWD 4PLYA 4S1NA 5DNYB 3SY8A 1T6XA 4JT2A 5CH8A 1W93A 4YO7A 5LUBA 4GYWA 1ZWKA 1WZUA 3U31A 4LK3A 3UMRA 1M8FA 3HCNA 1YKGA 4PNZA 3UN1A 4RTMA 3EQ9A 4IMJB 3TI7A 1SVOA 3ZXUB 2R8XA 2UUPA 2F67A 2HRCA 2I2AA 2FE4A 4HRXA 3MIIA 4DMMA 4DS3A 5KJ6A 1E58A 2FZEA 3FFXA 4Y6LA 5AJWA 3DL7A 4BE7B 1HNXB 3BDIA 3I3SR 4RH0A 3WLTA 3OFSA 3UK7A 3TRFA 2AQIA 3RIHA 4RIIA 2XTAA 2FSSA 1H2EA 1LJ8A 4YRNA 4YQFA 2EP7A 1F8UA 2OFXA 3GGSA 3PJDA 3PNQA 4M46A 1GQYA 1UP6A 5F3DA 4DADA 2V54A 1LK5A 4Z51A 1ZH6A 1CRLA 1WDTA 2HJHA 3H75A 2AD5A 3BE5A 1GR1A 1GL6A 3ITKA 4MGHA 3DXZA 1VM6A 3FIJA 1NXSA 5ES4B 3UYKA 1X8KA 1P1RA 3JSXA 3LC1O 1JR3A 3OIGA 4JLVA 4JYPA 4KTVE 4LIPD 2CV0A 3FYDA 2H7YA 2WP0A 3OIYA 4PZ9A 4WOCA 1W0KA 3V55A 1Q84A 4C7OB 3ACBA 3F6CA 3AY7A 1NRWA 1GADO 2HQ1A 3OLQA 4MQ6A 3T54A 2JAXA 3KTAA 1T0PA 2PKEA 2YJTD 1LUAA 3I5YA 2JJ1A 1PUIA 3HEAA 5IAKA 3CGGA 1J8VA 3F3MA 1XF1A 5F7XA 3LHIA 1PCXA 5E7IA 4DNFA 4MLZA 3OVMA 2ZM6B 4L1KA 5HKKA 2O3TA 4BFTA 2DZDA 5DB4A 3FNQA 2HWYA 4FGUA 2VCYA 1SOAA 1U8AA 4R1OA 4UPEA 5CA0A 6AT1A 1WBBA 4OLJA 4BASA 3PXAA 3SC4A 2VJAA 3RK1A 1DXQA 4WVLA 1EX7A 3WGHA 3TPZA 1PV1A 2FMKA 4LXHA 3DEFA 1T2DA 2H9AA 3M6VA 1YF3A 2NUBA 4F4HA 3PJFA 3DMYA 1ONOA 2AMLA 5K3BA 2QRLA 2P7IA 2P9ZA 4TT3A 4HQLA 5CVVA 5F51A 1E2NA 3AC0A 1QVZA 2HV9A 1Y1PA 2AK2A 2PIAA 2YIMA 2ZTUA 2AOVA 3VO9A 3FPSA 3FHCB 5LQCA 2OFPA 1ELOA 3KUXA 4QGSA 5A0VA 2B4TO 3VHLB 1MXHA 3GRZA 4FQ7A 1B0AA 2CLKB 3IV6A 1TB4A 2CB0A 2OY0A 3R5JA 5FPTA 4J7AA 5JJLA 2C83A 3UM9A 2XQKA 1Y7PA 4IIXA 1XKQA 1XDUA 3TOSA 1KFBB 1T8UA 3WGLA 1DBVO 4JP2A 2E87A 4RO0A 1N9GB 3FRHA 1N0IA 1QHXA 4B74A 4E08A 3HHEA 4YH1A 3W9UA 3BGWA 5DXJA 4GOXA 1AGPA 2NZ8A 4GKVA 2ZRQA 8ABPA 1PZNA 1ZK4A 2OYRA 2QUKA 1Q0HA 4AW9A 1N7GA 5K0GA 1NMXA 2GXAA 1QYVA 4TWRA 1UBOS 4JEUA 4AJOA 4AY5A 5DVZA 2J67A 2IEDA 3RUAA 2R47A 3VI4B 3VKHA 5JR3A 2BGTA 3J81A 2QE7A 4OP1A 1K4MA 3ZV3A 3FPJA 4D81A 4G8DA 1O94D 3DOHA 5F12A 2XSZD 3N6XA 5A62A 2R1UA 3H2YA 1JPJA 3MTGA 3LUFA 3H84A 4NE7A 5E2IA 2ZJYA 5H83A 2L69A 3EVGA 1QRUA 5LC1A 1GQQA 3ESRA 2QJFA 4YRDA 1NVXQ 3GBSA 5ALWA 3R7WA 4BQRA 2WTXA 1DOHA 1KFJB 1M2HA 1Y81A 3A04A 3N7TA 1NXWA 4MW1A 4REQA 4UQPA 5EJFA 3RYHA 3W78A 3WRYC 1JIQA 2XDWA 2ZT6A 4U3JB 5HRUA 3I9LA 2PWPA 1MH1A 3KJFA 3QYAA 2G28A 4I1SA 4LDQA 2ZJ2A 3U49A 3WGUA 2Q21A 3RSCA 4C7VA 4JI5B 2HK7A 1YZNA 1WU8A 2BFBA 3AP3A 5THXA 3KQQA 3PBKA 2Q4BA 2JPDA 1WHSA 3X2EA 1IU9A 4UM9B 2VXYA 1X7WB 3GMIA 1KYTA 2FRVA 4AY2A 1ZR4A 4P3KA 3F98A 5B1SA 2XB9A 3QE2A 1OLXA 4HDMB 1HYBA 4WOPA 3NEAA 5IJ9A 1K7EB 1WUKS 3BMNB 3GEHA 3QIVA 4WKCA 2VP4A 5DTEA 1V5IA 1L5FA 2B94A 3SYNA 3EZGA 1YASA 4KBYA 5ESDA 3I45A 5K6AA 4KLRA 1JR2A 3K5HA 4DVGA 1N2GA 4NH0A 2NXWA 1V7ZA 3LX8A 3UF0A 1AU9A 1UBFA 1FFGA 1KEWA 4HEA6 4UREA 1VPLA 2DQ4A 1N75A 1RI1A 2ESRA 2IXTA 3MCVA 4JGGA 4JVLA 2PZMA 4N5IX 4CG3A 1HSOA 1K08A 1ISPA 4D42A 3QX3A 3JX9A 3RVBA 4D2IA 1EU1A 1T3SA 2IHBA 2Q1XA 4EHDA 5A3RA 1TEZA 3W8FA 4WZ6A 4ZOLB 5ENVA 4QRHA 1OROA 2A8YA 3MUFA 3UC9A 3N3BC 3H9EO 2GHQA 1MAHA 2VDPB 5HKAA 2GZDA 1PR9A 2EKQA 2VRCA 3F73A 1QDLB 4DREA 2RARA 3VJRA 1DIRA 3GDOA 3JYPA 3A6PC 1UJ5A 3R75A 5H8WA 1VGQA 5AM3A 1ZGZA 2WJVA 4BO0A 5ALLA 4YN3A 4A15A 1EVJA 1R1DA 3LAWA 1ZIYA 2NQ8A 5IKXA 3UKJA 1NHGA 2C78A 1U3GA 1OAKA 2IQ5A 3KXDA 3NALA 1F38A 1TVMA 2V45A 4QVIA 2BISA 3B5IA 3WOHA 4MYUA 3F5QA 4EVQA 3ZLUA 1YZFA 3HB1A 2C2OA 1IQPA 3GEGA 2JI4A 2FTKE 1W8DA 1Z5UA 1JL3A 4MQ4A 4EY3A 5C18A 4MVJG 3Q3VA 2WWVD 3LBYA 3QVJA 2NYAA 3DP7A 1FXSA 4UVEA 4PGGA 3EUAA 2VSQA 4IS2A 4A2WA 1GYPA 4EJSB 1ECFA 1O0SA 2PT6A 1RZUA 3O3OB 1CZHA 1B6SA 1F48A 1PGNA 3L5KA 1V1RA 1EFPA 2CNDA 3M5WA 5K4GA 5K0SA 1DEAA 1KC3A 4Q48A 2HLDA 2ZUCA 3WJ1A 1JEJA 3FKJA 4NZPA 4RKYA 5JIBA 4I1IA 3MOIA 4FHCA 2M6SA 2NAFA 3OQPA 4CQJA 1Q21A 1EX6A 5HTKA 3B5EA 4F3NA 3DG9A 2ATVA 2JD1A 5IK2D 3V8QA 1A3CA 5C7OO 3G89A 4IOJA 4RIHA 2AF3C 4Q6WA 4DLVA 2X9QA 3ENVA 1A9ZA 4JASB 4X6XA 4DA0A 2BBTA 4J3NA 3V34A 4NDAA 2IHJA 2BZ0A 5IBPA 5KSZA 3R23A 1ZO8A 2EJVA 1G3MA 1PJLA 1JHDA 1ZH8A 4P92A 4Q05A 4RLQA 1E6LA 2GZAA 1XQWA 2H1OA 4JSTA 5BY2A 4OU5A 3GAFA 3OKPA 4ZANA 3W2IA 2ZXFA 1XZAA 3RFTA 3QTLA 1C9MA 2C4VA 1EP1B 1P9WA 1DFHA 3ABOB 4RV4A 4Q4AB 1JXMA 3BTSA 2PV0A 3HZZA 5IEBA 2R6CA 1OI3A 1KJYA 4QL3A 1ZGBA 2C92A 2E21A 5DPMA 3LH5A 1ISHA 1T4GA 1Z39A 3EH1A 3RU9A 1WMDA 3PRHA 2VI5A 1QQBA 4WCFA 1A7AA 3HKCA 1PSWA 1P5JA 1Z3CA 3S2IA 1G0OA 3OZBA 2ZVDA 4P3YA 2O5VA 1GN9A 3PRKE 1N8SA 3LWNA 3RW9A 1NF9A 5HF8A 5C8YF 5TMDA 4UUPA 4CCWA 1VG8A 5FULA 4Z86A 2QAGA 5H9WA 2OC9A 4PHCA 1RVV1 2HDHA 3KBOA 2CFTA 3ZXXA 2DX7A 1URPA 3F5MA 1BRTA 5ALUA 1ZUIA 3RHTA 4ZTBA 2P11A 5GJBA 3OURA 4ZV4A 2CLIB 4FJ1A 2J5KA 4HD8A 4INPA 5H1YA 2Y8EA 5JV5A 3PRJA 4ZALA 4UBIA 1QHHA 4Q7QA 3HXPA 3CUVA 4LXUA 5G4KB 3SFTA 1TFUA 3G0CA 2PS1A 3TTVA 3R6GA 3DCIA 4US0R 3WFJA 1IJKA 1I3NA 4QSMA 3FKQA 4EG0A 4N82A 3EEFA 1IZ8A 1DC4A 1FX1A 2WRZA 1H5QA 2Z9BA 4IF4A 4UXHA 5DLDA 2DY0A 2O54A 1QKIA 5K8UA 2F3TA 3OT1A 1XA0A 2WMOB 2YR0A 4M0MA 1RIIA 3IOMA 3A2KA 2APJA 3RLFA 2QPAA 4R31A 1L5HB 2F3QA 1T36A 3BL6A 4UDYX 4F8YA 4NG4A 1KIMA 3EXHB 3FYHA 2PN1A 3E81A 2H1VA 1GCUA 1JQ5A 2JKYA 2FRDA 2XUDA 1K7CA 1LWNA 1I7LA 1PGQA 3MHPA 3G2JA 3PF9A 3PGA1 4TZ0A 1Z88A 1NY6A 5H68A 1GPNA 3BXZA 4PCUA 1EMDA 5JALA 5LBTA 3SXUB 2EZ8A 4Q1EA 2EKPA 1A4UA 4I9FA 3BA1A 3CX8A 1QIHA 3R20A 4PYIA 5EUBA 4R8RA 4MDEA 1T5LA 2PDAA 3GIDA 3HJRA 4KUGA 1FMFA 1BN7A 2VHYA 3B70A 5D6NA 1Z0UA 3HWSA 3JARB 4OFWA 4Q0MA 3LKVA 1U2EA 1TRKA 4QC2A 5AW9A 2XMBA 1ZK1A 5CFOA 3HVRA 4OXXA 1KF0A 3STVA 1NIJA 1QGYA 5ALMA 3RFXA 3K2BA 5IKOA 2HF2A 1NUHA 4BEJA 2QX6A 2GN1A 1QK4A 2OBFA 3MWDA 4QA9A 5CBPB 4W8HA 4LJYA 4PPYA 5CLLA 4GC5A 5JMPA 2JFHA 3FOEC 3G7UA 3H2JA 1EI9A 2TMYA 4N5DA 3QMWA 3B8HA 3FI9A 4FPXA 2IPMA 2HCRA 3WKBA 2FUG6 4RK0A 1XD9A 1XN1A 4C0XA 1XPJA 4WDRA 4OQDA 4JYMA 1GTMA 5LA6A 1Q3KA 3SMQA 3VC3A 1J25A 1Z0FA 5C51B 3IUPA 3EJ6A 3NRJA 3PQ6A 1UCFA 4EQ6B 5ALJA 1HT0A 4H1WA 1QNFA 2D62A 3CHYA 2QTCA 3AVQA 3PX3A 3SHOA 4U1RA 1N3LA 1VHJA 1M34E 2A4KA 2D06A 1UKEA 4I1OA 1CR2A 4B7UA 3PUHA 3RK0A 1P39A 3IT3A 1EQUA 3H19A 3OZIA 4M1ZA 4CTKA 4LS3A 2CF5A 1A5AB 2EBFX 5CDSA 3HY3A 4R01A 4NJMA 5JCPA 3MJHA 1P9OA 4GR5A 3C4QA 2P78A 2WF8A 5IXSA 2QU8A 3TIFA 4RTJA 4DJEC 1DUVG 3EVEA 3W6NA 1DDIA 4BIIA 2W2KB 3A1FA 4H16A 2BGGA 2GHRA 2MT9A 2PPLA 4M99A 3BK2A 2CUTA 9ATCA 2Y67A 3BBPA 1FW8A 1KK0A 3B6ZA 3NH6A 2C42A 2JFQA 4FQ5A 3S5UA 1W4LA 4QARA 3ZQ4A 1ZW1A 2H31A 2A7QA 3KL4A 4JWTA 3H3JA 1Y1SA 3JQ9C 3UOAB 3DDWA 3S4YA 4DTIA 4OQXA 2IYZA 4BWFB 3QENA 3AVUA 2Z1DA 1Z8DA 2FLKA 3OU7A 4GAEA 5BV7A 3WGMA 1WMEA 2ATEA 4OVKA 5DSXA 3AF3A 2Q3MA 4CM8A 1DFIA 2AOUA 4IICA 1ISMA 3SQLA 1F2TA 4KR2A 2YCBA 4LGVA 1GUFA 1ESNA 2VRWA 4RTNA 3GLHE 2ZCVA 3EIWA 1UZNA 3LSTA 1HUQA 3CR3C 5G53C 3AGQA 5HILA 4XYLA 3Q8MA 1GAXA 4X1KB 2HA5A 1CVRA 1Z47A 2IS4A 1GHTA 4OQNA 3PPIA 2C4KA 5HCUA 2AS0A 1JQBA 3B8EA 1T8WA 5ALSA 3DM9B 1W49A 4YP7A 3ZY3A 3KQOA 4FU0A 4GI3A 3TL6A 2X14A 1OY1A 4YP6A 1GPWB 3ZHZA 1VJ5A 4Q1AA 3U7JA 1H69A 1M0TA 4CTJA 1L1FA 1VFNA 3CH7A 4HDNA 4R16A 3EQ2A 3VJKA 1VCNA 4DF3A 1GGNA 2ODEA 3KTFA 2L2QA 3T0FA 4ZDWA 5K9ZA 3A36A 3U5ZB 2XUAA 1I5RA 3ZWOA 1UADA 1F60A 1N0VC 3FDIA 4GM1A 4QU9A 5FJJA 4JLWA 3WWYA 5JATA 5ELLA 1L7DA 3W79A 2OO5A 1V37A 3E5MA 2RGDA 1GPUA 1OAAA 2PKQO 2HBYA 4FE7A 4RXMA 4TL6A 5KWVA 2Q3DA 5GONB 4LI3X 1MJHA 1AKRA 3E3MA 4O59O 4D6XA 5LP6C 1C1XB 4ETWA 3NM6B 1D1QA 3K9NA 1S2LA 4P53A 2PWYA 3E61A 3IIMA 4QLAA 2YKGA 4XOIA 5YASA 3FFBA 1J99A 2Q6TA 3MD0A 4OBEA 4Q4HB 5TLSA 3NTXA 5HE8A 1T5HX 4C0WA 3ITEA 3AG6A 1IM5A 2ZM5A 1ZIDA 1JYEA 3ZKAA 2ONCA 3C97A 5EQFA 1UT8A 3EGEA 4TMKA 2BWJA 3NVKI 3HGQA 4BNWA 4EW3A 2I6QA 3DQZA 4GI7A 5CA1B 1GVNB 5K0LA 1Y4AE 1TFRA 3FX2A 3BOSA 3SOPA 1ZJWA 3VNVA 1I94B 1XKLA 2WJHA 1QLWA 2WVJA 1R3UA 4GXNA 5A9RA 4I1PA 5JJKA 3GGCA 4MQMA 1L7VC 3V33A 3FJYA 4RHCA 4M36A 4MHSA 1HTBA 1VYUA 1NNLA 4KVGA 5FBZA 4D82A 1EQAA 1L4GA 1IZ9A 4BLRA 4PNEA 1WZCA 3W5SA 4J9UE 4EPTA 4F46A 3QKWA 2X86A 5KOJB 3M3PA 3AFNA 4TMYA 5TT0A 6GPBA 3UAZA 3IP6A 5LMNB 1MVLA 1JZSA 3BD6A 4XLTA 1UM9A 2C9CA 1RZVA 1D07A 1SIUA 2UDPA 2YBDA 3RUCA 3WO1A 3WNDA 5IZCA 4MKFA 5EHIA 4K8RB 1GG2A 4PSVA 5FFMA 5DWVA 4QOEA 4QVGA 3PWTA 3NHJA 4JC5A 3QVTA 3TX2A 1XAHA 5CBKA 1M1NB 1NBEA 2WV7A 1XXHA 2NUTA 3VPHA 2GOYA 4P35A 5T4EA 2A7XA 5A6SB 4PY2A 2POQX 2NSDA 1G21E 2YXBA 3TWOA 3V4FA 4LXIA 1BDHA 2FMTA 2GBCA 3DKIA 2AB0A 4P4UA 1L1RA 3FI0A 2F1OA 1Z34A 4LDNA 4RM3A 3ZNNA 3WAGA 1EB9A 5LMUB 2YVLA 3MGBA 4I36A 2R86A 4LXXA 3PXGA 3IDQA 1GYRA 4N0QA 1RADA 1C3JA 2X0RA 2XF2A 1BH2A 9LDBA 4MV7A 5IVPA 3ET5A 1XTRA 3BH7A 1YDHA 1E9FA 2AN4A 4CGZA 3U60B 1UQTA 3URKA 1XQVA 1RWWA 2ZBDA 3JQ6A 1FYEA 1KQFA 4DM3A 3QSGA 5DI9A 1BDJA 1E4YA 3CCCA 3TKAA 1BCSB 1OFUX 4OBXA 4ZC8A 3UUEA 1JDNA 2AJLI 4N5NA 2ID8A 3WLNA 1SXJB 3P9KA 1ISGA 2J9FB 3CE6A 5EIHA 5EGSA 3QNMA 4L9RA 1R8JA 3OCVA 3OG9A 2KSQA 1GZDA 2Y4NA 2YV1A 4ITVA 4XX0A 4RDIA 1W46A 2C98A 3IDOA 5DLEA 2GYYA 4EB6B 3P2OA 4KREA 4I2NA 1JXAA 2VJYA 4KZKA 2GBPA 2VQEB 3ZE1B 3A1TA 1RYYA 4HTAA 3PFKA 3S2YA 2HA7A 2J3HA 3OI7A 3QWBA 5AVQA 1VPTA 5E9WA 3HXLA 4N8DA 1KO1A 1AQUA 1KDOA 1R0WA 1RI3A 3M6WA 3GF4A 3MJFA 3QKSA 4NBUA 2QN2A 2A9VA 4MUAA 4ZREA 1TADA 3NETA 1P0CA 2Q5LA 4EA8A 4ZJPA 2DPYA 3FBWA 2HSZA 1JQLB 2FX2A 3MQ4A 4O25A 2QMQA 1FQOA 2PR7A 2WWIA 2ZUEA 4TMVA 1PKXA 1PJZA 3DLTA 1WCXA 3TDKA 2HNKA 5J4KA 3ZDCA 3C8MA 4RVNA 4TXJA 4O02B 3M1IA 4ZK2A 3U1BA 5A0TA 3LJKA 2OP0A 4E5KA 1SQFA 1AX9A 5FD8A 5D5PA 2WQ7A 4TMZA 4B84A 3DAYA 2FP4B 4MMZB 4UUOA 1VE6A 4LDZA 1CWUA 1AG9A 3UICA 2J6BA 2OXRA 3GJ3A 3FVWA 1CCWA 1XLWA 4IYJA 3BXPA 4R1NA 5HW0A 2DHCA 4HDAA 5JAIA 4H7KA 3HCOA 4GEGA 1GD1O 1PN3A 2X19A 3QVOA 2QKYA 4W8OA 2WDPA 1VKNA 4AS3A 5KB3A 5P21A 2ZPUA 3KP1A 1L5LA 1PYGA 4ARCA 4KJZA 3AETA 1N34B 4FOLA 2XCSB 1UJ6A 1XZ8A 4QVKA 4QPNA 4MROA 2P9CA 3IT1A 1YCHA 2C1EA 2DQZA 3AFGA 2HPVA 1N25A 2ZRJA 1QB8A 1XVTA 2PLNA 1M2GA 1CZLA 2PMBA 3NOXA 5AOCA 3FPLA 1ILWA 1T91A 3C6YA 1EYZA 4PPNA 3TVYA 3KSAC 3SJUA 2ZWPA 4MI6A 3GLFE 3K20A 4G4JA 5BQFA 1U1CA 5ICGA 2NP6A 3RREA 3JPWA 1SCDA 4PWZA 3ZG6A 4LI0A 5IUJC 5DHTA 3PEWA 4QZVA 1XC7A 4X8MA 1JJBA 4D6YA 2CGEA 1VBMA 4JZYA 2HYIC 3DV0A 2H4XA 3UH0A 1ZM4A 5FOUA 5EUQB 1U28C 4R2JA 2JI9A 1F20A 2C97A 2JJMA 4YJHB 4ZJUA 3EK2A 1JFFB 1K8RA 2XADA 2XJ4A 3GO4A 4BMDA 1OIVA 4MV8A 4EHIA 2IS1A 1EWRA 2NSJA 3HEBA 4ANFA 3RB8A 4QYWA 1DBQA 1BVUA 1U02A 3BAZA 4TWJA 4KL8S 4UW9A 3AEYA 3KUDA 1FSGA 1D6MA 5CAEA 2VNSA 4LJAA 4CVNA 4ZJZA 4D44A 2VHJA 3QY0A 4MI1A 2FYTA 4IXDA 2E48A 4HK4A 5AJYA 3FSGA 3TTYA 3W5DA 5BSUA 4DLBA 1NYTA 1Q5PA 1BOOA 5I3CA 4D9FA 4CT4B 1ZN7A 3I5UA 3A9VA 3ANXA 3CPHA 2VDRB 3K71B 2XHEA 3HWRA 4KZPA 4ZQFA 2E4YA 3QEKA 4BDTA 5CCEA 1TJ3A 4DMUB 3CKKA 4Y7CA 1WM1A 4ETIA 1J5EB 1VRCA 2WB4A 4RUKA 1U8XX 2VP5A 5B6JA 1YL6A 3CU5A 4XJSA 3BS4A 1HNNA 5AJHA 1TJNA 4AMGA 4L8YA 5HXAA 1SJ9A 2GD6A 3AR8A 1L8XA 1LPMA 5JNWA 5KTNA 3SJBA 3CY6A 4NF2A 4RETA 2ACVA 2A59A 1T0HB 3VH2A 2RIRA 4FFWA 4BQQA 1H6CA 5KNDH 2JLSA 2WVAA 1LS1A 2WWYA 2QTFA 3SVLA 1ND6A 4YJKA 3WK8A 4DHEA 4TYNA 2I4TA 3B1WA 3DKRA 1MNQA 3WY9A 4KE9A 4AU1A 1CEYA 2RJNA 4OK6A 2ZLBA 3HSSA 5BQPA 1O5TA 3N2LA 5JNSA 3QPDA 3N2GB 4IMRA 1C9EA 1XL1A 4UU7A 1F5NA 2XUOA 1ZCJA 4HWKA 5IH3A 2GXQA 1GRRA 3VR2A 1ZOPA 1IY9A 3UV3A 3MMXA 2HMWA 2I9PA 5A9SA 4KYTA 2X2PA 3PZRA 4I08A 1R5NA 2MR6A 2JJ2D 3A7DA 2F55A 3QPCA 4OA5A 5IYZB 5M34A 4JUBA 1XWFA 1S2NA 1XRLA 2WTBA 3I5MA 1XV5A 4AF6A 3L6CA 1J5XA 4YXWD 1JVSA 2OO7A 3EPRA 5DYYA 4PYQA 3PQ8A 4NS1A 4BCDA 2OAQ1 2RGCA 3H2KA 3NIDB 1KK2A 1PJRA 2WLTA 1NKSA 3UAGA 5LB4A 4GHWA 1XU4A 3OU2A 4PPFA 4WAUA 4MI9A 2YWGA 3OE7A 3GGOA 5C4GB 4YFYA 3MTBA 3A6FA 2PR2A 2Y1XA 1XYGA 3HR7A 1G8GA 2XA1A 1J49A 2ZGVA 2I3ZA 3O4JA 4EFDA 3O4VA 2HMYB 2JS7A 2PSHA 2J6CA 1BU8A 2VAMA 4L50A 4DWWA 3C5EA 1ODFA 3LDHA 4D8UA 1YUBA 3EBLA 3O91A 2C9DA 4ZQBA 3VNBA 3M8KA 4PC2A 5E8JA 4XGIA 3PDCA 721PA 3BIXA 1CJTC 3NOVA 1I6MA 4C0QC 3NHUA 3JZIA 3VYSB 4JHLA 1L4YA 3D54D 4D3DA 1FTWA 2CHVA 3PX2A 1E5QA 4U7JA 4KLNA 4V0RA 4EJ0A 1OLSA 2QA5A 4NK5A 1T5BA 1FFYA 2Y9PB 4MWEA 1UJNA 2YFQA 2IYFA 2VUIB 3JQAB 2I71A 2R97A 4BVEA 5DN6A 4IZOA 1RJGA 2YZMA 4H7DA 1AY0A 3O1HB 1WRBA 2ZR0A 1Q1GA 2Q3BA 4FDAA 2X1LA 1U7WA 3F6SA 5IT9A 5CB4A 5F4ZA 3RQIA 1VYTA 1SEPA 1U1IA 1W19A 3BZBA 2VT3A 3D1VA 3BSYA 3OEED 4NONA 4RZSA 4CKBB 4D9MA 5KX5B 4WLNA 3V9AA 3HV0A 1JDPA 2GD0A 5TPZA 3K96A 3K9BA 4CIXA 1RE1A 4RQAA 4IJ5A 3SGLA 4JVOA 4C29A 2A1TS 4AN1A 3B1VA 4PHFA 5CGQB 1TJPB 5EJ8A 4G0UA 1SC4A 3LY8A 1G0NA 1U0FA 1X0VA 4DIBA 3HVHA 4F1WA 2VJBA 2ZRGA 1C4WA 1ECCA 2C5GA 3KWFA 5BOSA 3I01M 1IBSA 3GG9A 5EIXA 2JLRA 1MX5A 2BM9A 2YCLA 3DBHB 3K4PA 4H7IA 4IFBA 2DBVO 4URUR 5DHFA 4N18A 1MT3A 3BREA 3TI9A 1Y7IA 3F4BA 3K30A 4GSKA 3VTKA 1VRVA 1GQ2A 5JDIA 4G5FA 3C24A 2NP7A 2BFEB 2HO4A 1PNQA 2JC3A 3IP8A 2BFAA 2DWUA 1JG6A 1VPDA 2NTYC 1JU4A 2O4CA 1QO7A 3P4XA 1TUGA 5M7EA 4FEYA 3LUCA 1NAHA 3NDJA 4X8HA 1M8PA 4CMEA 2PK3A 3AXTA 4ACAA 5JXGA 1E2IA 2XB8A 3DF7A 5EGNA 4B9AA 1WIWA 1HM5A 2JFXA 2AC4A 4TTTS 1IG0A 1ZRSA 1GTJ1 2L42A 3BXXA 3V9PA 4AQDA 4E2XA 4R0MA 3C3EA 1QH0A 4QTZA 3RJ5A 4KQIA 5KYYA 1EVZA 4P6VF 4BJ6A 1AQYA 4CF6A 3BCHA 1TUIA 1DV2A 2QLJA 3NBYC 4P4SA 1E1MA 5MN5A 4EGAA 2JGEA 4MO2A 1DDOA 3UPDA 1XHFA 4R3UC 1FFXA 2MINA 3E0QA 1FZQA 2DLDA 3B89A 3RRJA 2ECQA 3X1JA 2F43A 1CDEA 3O1IC 1D9ZA 2OR3A 2OSVA 4JB3A 2ZVPX 1BA2A 1AH2A 1CUBA 2ORWA 4DZTA 5KOIA 1Z4MA 3HC7A 4JYBA 3RRXA 4DLKA 5L53A 2ZYVX 3B12A 1YMVA 4R1SA 5L4LA 2PZKA 1L7BA 2Q5CA 3BA6A 4JBHA 3U3ZA 1OIXA 3HDYA 5F64A 5LDGA 3TJMA 3TQCA 3WGJA 4Z4QA 5EMNA 4BFWA 4LECA 5KDDA 3LL7A 1QCZA 2R1ZA 4GMFA 3OP4A 3HQ4O 4N6NA 1H5NA 2CL7X 4QLBA 1I3LA 3A31A 2RIPA 3V8VA 1N2CE 3SS7X 3UFBA 3TM4A 5ARCA 2QMYA 3WMXA 2W7TA 5B55A 4W5RA 2AWNA 3TQIA 2GZSA 4OOEA 5C1IA 3HBFA 4ERNA 4RMGA 1AV6A 1OU4A 4AJNA 2HOQA 1ACJA 3K9QO 1MEEA 2XY4A 2WJ4A 3QTTA 1SXQA 1NBMD 1PFUA 1HTWA 2CUNA 3EASA 3KKLA 2NIPA 2C2XA 5REQA 5E8RA 3ZZNA 3AY3A 3IPAA 5SV2A 2J3KA 2QW0X 4GU5A 3SR4A 5BMVA 4EJ6A 2BSXA 1W88A 4S1TA 3TLBA 4D3SA 2BFCA 3P2IA 4M4SA 1QIFA 3TPFA 2WE7A 3DMFA 2VT7A 1ZUNB 4P32A 4J1TA 1NVAA 1U7HA 2DHRA 1T6ZA 2PO5A 4OX9B 1MQSA 4I6EA 3FDFA 2CVFA 2HL6A 3A27A 3K0KA 4QBFA 5BO5A 3LUDA 3W5JA 2HW8A 2LNDA 3FMFA 1T4BA 1BKYA 3QNUA 4C5AA 3C3CA 3RAEC 3P0EA 4F71A 5AJXA 1S02A 3B1YA 1MUUA 5JQWA 1L6IA 1MC8A 1O9GA 1Q0TA 4ALKA 8MHTA 3AP2A 4B8YA 4I19A 3QX8A 4KH1A 3ZCQA 4PTZA 1TYBE 1HF3A 4G6ZA 4JR0A 2MSEB 1Y3BE 2QMOA 3HLYA 3OEHD 2IDZA 1NYRA 4Y0VA 1RYHA 4LY9A 1L7PA 3PUYA 2RCYA 1U8CB 2YVKA 3D7MA 2NOAA 3C6ZA 1A27A 1ES9A 2GJAA 2IE8A 3ZIAD 4CZ2A 3IB3A 2JCBA 1OFVA 4QXPA 4B6JA 5L45A 1C29B 1RXWA 1I4OA 3M4YA 4NHEA 3DE3X 4QASA 4EJSC 5FTLA 1JHZA 4II7A 1M1YB 1H6DA 1ZW6A 4M53A 2R6FA 2Q2NA 4CV3A 4F6RA 3INRA 3UT5B 1J06A 2IYAA 1ZZGA 2O2EA 3SYKA 4DC0A 2P2CA 5DYNA 2WAOA 1YK1A 2W2TA 2XX3A 4UBLA 1NDUA 2VTEA 6NULA 2OXIA 1JAIA 1UJ2A 1N6KA 2EV9A 2NO9A 3YASA 2A14A 2YW2A 4IUDS 2AYXA 3Q98A 3GBVA 3QJGA 4KPGA 1DO2A 5BVGB 5CB4F 4RTQA 4BQOA 2P2SA 4XEHA 4DBLC 5ICCA 1Q6ZA 1PTJA 2A9OA 3TZBA 3M6AA 5G41A 4ALLA 3I4CA 4Q9KA 4L8LA 1MB2A 1UZMA 3D6FA 5FA5A 1XZKA 4JUAA 1IAVA 4H3SA 3UENA 2GRJA 1X1DA 2J9YB 5JTUA 4KU4A 1N4DA 3WBKA 1YJ5A 1NULA 2W0MA 1GPDG 2IDKA 5C8XA 1ORIA 2GN8A 1QU3A 1P8AA 2AGVA 3E05A 4IRMA 3OWOA 4INAA 1LI4A 2N3ZA 4WERA 2QW1A 3S1AB 1A8PA 1QB7A 3C3DA 3KDSE 3HU1A 3L8DA 4OIMA 4Q7KA 1JDBB 3ER6A 3OZSA 4ZDJA 3TCXB 1DG3A 3RAJA 1U0LA 3V8RA 3GLGB 3EA0A 1Z5PA 4UDOA 1NMSA 3EZFA 1VSUA 4LJRA 1CY0A 4DDHA 2O8DB 3U40A 3CZRA 5JSZA 2N75A 4LRSB 1YXMA 3ORYA 3UMGA 4QXRA 4YUVA 1BFUA 4M1KA 3MT0A 3FF4A 1J07A 2G72A 1GKUB 1XP8A 4LWQA 3CH6A 1I14A 3HU5A 3ZQ6A 3OD1A 4IGKA 2FZLA 3KVYA 1JAHA 2CBZA 4HH0A 1ATIA 4F6CA 5FLXA 2UXCB 1PT6A 3BRWA 4GSLA 2DFLA 5JCXA 2GBLA 4N3AA 4ENTA 2WJPA 2EFJA 4FFMA 3D9QX 1COWD 1L9XA 4HAYA 2FR8A 3HCCA 2X23A 3W3AH 2HC9A 2QU7A 4YJ2A 3NZEA 1E7QA 2CHGA 4LV8B 2ODNA 1W44A 3MTJA 3L5OA 5F3WB 3U39A 3FBTA 2HA6A 1N5DA 1KAGA 4GICA 4BLVA 4I5IA 2DBZA 2X8AA 5AHXA 3KWMA 2NUAB 1XZFA 3KKZA 1VKJA 3SICE 3ZHCA 1QIDA 4XCXA 4AS1A 3BL8A 2X77A 1SKQA 4IINA 4UNSA 1GRNA 2G06A 4ABYA 3HMQA 3HDTA 4YAOA 3VSDA 3H5TA 1ISRA 2V8BA 1WXGA 4FLEA 3GFRA 4QGFA 5CVDA 4KOEC 3RF7A 3SX2A 4WN9A 1PL6A 2EHJA 4AX8A 3PKIA 3JYOA 3HA7A 4L15A 1GQOA 5JZOA 1RXCA 2FXVA 3IH5A 1PLJA 2EWMA 2RK4A 2B4KA 4UC0A 1VFPA 1G8KA 2WKPA 5LOVB 1DC8A 1BGVA 1FPQA 3EXHC 1OAOA 1WKVA 1GUYA 2VEDA 4LDJA 2ZS9A 1A2OA 2J32A 3CWZA 3IESA 1PGOA 2WT4A 2VPIA 3EGXA 2OE2A 1FY2A 5ITZA 3R5SA 1P5ZB 4DAEA 2PANA 5AIBA 2DRIA 2R7KA 2GK4A 4LHEA 3U3MA 4U7WA 5C4IA 2E9SA 2EZTA 4DRXA 4Y9UA 4ATNA 3KT0A 3TTUA 1PJ4A 1V7CA 4KQFA 4R9NA 4ZYXA 6PFKA 3C0KA 3T7SA 2CEAA 3L6BA 4ZVMA 1FL9A 3TL2A 2ZRAA 3A6HA 2J8ZA 2B5WA 1DKMA 2BM1A 4K6MA 1A77A 4WKBA 3MINA 3DFFA 3SF8A 4PG8A 1JEQB 2XMGA 2VPPA 3AI3A 3FNFA 3NDRA 4TN1A 4Y2QA 3ROFA 3ZWQA 3UCXA 5ECYA 3OESA 4DXDA 5BMVF 5IMSA 3TG2A 1XPRA 1NZJA 4PLHA 4XJTA 4B6FA 1P91A 2LV8A 4O8ZA 5HRCA 2Y71A 3GEDA 4Q15A 1NXVA 3MWEA 4B7CA 1PJ3A 3HSYA 4C06A 2QM3A 2IY9A 2YFKA 3SKVA 4HS4A 5TR9A 5HIMA 4TWIA 2PXAA 2FLWA 3E3OA 1I9CA 3EG9B 3V4VB 3ZCSA 4BZXA 5IT0A 1YVDA 3RAPR 4R2HA 1ND5A 2AFHB 2OWDA 3IOCA 1KR5A 2XE4A 4NMLA 3STYA 1JVNA 4LGYA 1M2VA 1Q7TA 3NDPA 5SY9A 1AQIA 3KYJB 5E6UB 4OCZA 4WXHA 4CUZA 1LI5A 2GT1A 2JZCA 3K6JA 4MK4A 4DCNA 1QHGA 1P4RA 1WCIB 3PE6A 4J0CA 2VP9A 3WIOA 2WWRA 1KI6B 4HLCA 4RESA 5F1YA 4HWGA 4RSRA 4XRRA 4F93B 1ZL2A 1ZN8A 2ECOA 3KKEA 3NEJA 1GDTA 3PFFA 2CMHA 1KKLA 1UJCA 3OPYI 3RS4A 4IHJB 2PBZA 1P73A 4PICA 1PFQA 2XYRA 3LVFO 1TJYA 3KWJA 4RKRA 4TTAA 3ZJUA 2QPTA 1CTQA 4EG8A 4LY3A 5MGBA 2MYTA 3PC7A 2K7ZA 3L3BA 3SSMA 4MIYA 4MRAA 3GFBA 4IJ6A 1FDWA 4N6GA 3QFHA 4GNRA 1G8HA 4WKOA 5F7OA 4LBWA 1EBBA 1U3CA 2BH9A 2QRHA 1TYAE 5MF6A 1HE1C 2HU5A 4FNMA 1LXCA 4XXHA 3T1HB 1ZN2A 5HCNA 3R4CA 1DT5A 2PL9A 3LYAA 1GKIA 1M8GA 4IV8A 5J63A 3SZGA 3W5BA 2ZRBA 4AK9A 1E7YA 3ZLVA 4K9MA 3R5XA 2HKIA 3TW4A 2VRCD 1F5SA 3TQFA 1TUBA 4HLNA 3X44A 3AT1A 4MMXB 2ZJBA 3BMOB 1I9GA 4U8HA 4OJKA 4LNAA 4CTNA 3ND5A 4MA0A 3FWNA 1Z68A 3ZGVA 1JNXX 3WQRA 1BS1A 5DOVA 1D2HA 3H5LA 3NKLA 3M6UA 4EKDA 1NQOA 4R7ZA 4XVUA 3HPQA 4QREA 4F4CA 1OREA 1XTZA 4U0KA 5DP2A 4DDUA 4F2PA 3F7OA 4HEHA 4HPWA 2CDRA 3PNOA 1KZ4A 2YQZA 3KT8A 2XWSA 1G3IA 4BX8A 5KS2A 1R4ZA 1EFHA 3G1TA 3L7YA 3BWDD 4UEQA 1SPXA 4QWWA 2I76A 5T7BA 3SZOA 1PNOA 2V55B 5DV9A 5J1SB 3WKEA 4X62B 3TXXA 1MZVA 1X80A 1M1ZA 3FTDA 3RJZA 3VQTA 2O8CB 1Z4NA 3FB1A 1X7XA 4TKVB 1ZYUA 5DASA 5FNVF 4BO9A 5ERYA 3TSCA 4KPYA 4AKSA 4LF7B 4B6GA 3HFRA 4ZZIA 2QV0A 2I1LA 2WJWA 3QU9A 4MARA 3L79A 2I2WA 3FVTA 5D5HA 3ZDRA 3ZWNA 3KB6A 5J2TB 1CKEA 2QN1A 2J41A 3FOFC 3HI4A 4JX8A 4M8IA 3IRUA 3LOQA 1QP4A 4KFRA 4LSMA 3UZUA 3ZW9A 2IUUA 1VG1A 1J2YA 1PQYA 1P5FA 3S2GA 2B8TA 2HRZA 4KR0A 1V6CA 3Q7EA 4NBVA 4EGFA 2ZJFA 2X5NA 4RYDA 1F6DA 5ERXA 3EVAA 2OGTA 1L8QA 1ODJA 2X76A 4NZZA 2VYFA 2C82A 2QP9X 2QRQA 4DBLE 1X1BA 3CXRA 2CCGA 4YJ2F 4RY0A 4ISCA 2O57A 1BX1A 2V7GA 5ADUS 2WHXA 2UYHA 2FPWA 3AGPA 1FU4A 3ZBQA 1RCTE 3P9XA 5KPJA 4NZMA 3OHMA 2J09A 3ZD7A 1DX9A 3L49A 3S8YA 3MGCA 2VDNB 2PH1A 3F3KA 3JD4A 5K3EA 3I39X 4PBTA 2AR9A 4FHZA 4DEXA 1RR6A 4B4WA 5IW8A 2ZRIA 2P30A 5IAAA 2EBWA 3H5AA 3M49A 3IULA 4FFVA 4PBRA 1KJIA 4W5NA 2H1FA 3LXXA 4WGGA 3R1IA 1JDSA 4XDGA 3G0IA 3KYCA 2L17A 3PG5A 1FJGB 2Y1FA 3FMOB 3UAWA 3HKEA 3FETA 1KI7A 1MC5A 1WZNA 1PZGA 2AMJA 2CY0A 4JEIA 5FOWA 3P2MA 3UO8B 2A5JA 2ZEJA 4RD1A 1ULTA 1SBYA 1NJ2A 1U2DA 3U62A 3UK2A 2BCGY 1RAIA 3TJZA 4XOUA 4D7AA 1GEGA 3A4MA 3KS9A 3JY6A 3D3KA 5DTIA 5ER6A 1QC5B 2D7CA 2IXEA 3B2NA 3B7WA 1I30A 4N3CA 5B1HA 1OZ0A 3DBRA 4CR6A 4DE5A 5FPYA 3G7SA 3KOUA 1N6PA 3N07A 4LDRA 1SZJG 1H2AS 4C9BA 4CL2A 3V48A 4JYZA 2JD2A 1X7YB 3HZHA 3IILA 1HTTA 2VEOA 1N5KA 1U3VA 1QZUA 2YTZA 1AO3A 2NPOA 2P2NA 3BCRA 1K6JA 3HNRA 1O3YA 4OGFA 2YDXA 3ZN2A 4O4HB 4G85A 3GG2A 3HKDA 2W8BA 1UC4B 3VNSA 4W5QA 3R40A 1Z29A 3V8EA 3DZFA 4DVJA 3OJFA 4PYJA 1NL3A 1JI0A 1QLJA 2X7JA 3T41A 2X1VA 3H7IA 3H9QA 3HUDA 3OFVA 3PGXA 4JIGA 5LQSA 3SC3A 3AVVA 1TYEB 2XWPA 2Q2QA 2PUWA 3KLMX 3QU5A 2X8WA 3ESCA 3C85A 1UDRA 1FSSA 1XWIA 2PSDA 3DR3A 1KP9A 4GSYA 4QOSA 5FAXA 4RIFA 4FYHA 5CURA 1UOQA 3WLLA 4X66B 1FRZA 2HADA 2W6NA 5TQVA 3EGCA 3FA2A 3G82C 3SR3A 5J2UA 1JYFA 1AZLA 2CVOA 1SXJC 1TF5A 2XTMA 3NWJA 2H59A 2Q7DA 2QB5A 3T1YB 2RHOA 2G67A 3WI7A 1U7TA 1GXSB 5KCMA 2G4CA 4MZXA 1H94A 2JIPA 3E1GA 3U2QA 1D4FA 5AI8A 4FE4A 4ZPJA 5KMGB 2QT9A 2J7PA 2OGSA 4R84A 4TQ9A 2H2AA 2VNHA 4HQRA 2ODQA 1W4ZA 4AY3A 5JI2E 1RSZA 2R7LA 3GCWA 3BC1A 4FYMA 4YHBA 5C4MA 2I4RA 1W4CA 3EMVA 2N46A 3E9RA 2XZLA 1JGTA 3F1KA 3HB5X 1NQAO 2WZCA 4KQ9A 1ENPA 1KDYA 4DB2A 3EXG1 4ZFNA 2VHXA 4BC1A 2PZJA 1JQKA 4P4GA 4IILA 5FV4A 4G09A 1ZCAA 5LIPA 2IELA 2H65A 1E5DA 1ECLA 1GTVA 1GL9B 5K8CA 4UXIA 2VVTA 1U8FO 1OYYA 1A72A 1O89A 2J3IA 1NU8A 2GEKA 2HU2A 2IKQA 2EYUA 3JZAA 3PUVA 1KVQA 4GX2A 1DS6A 2HDNB 3RHSA 4DCCA 1WSBA 4YRPA 5BP7A 4QU0A 2Q99A 3EVBA 3HJAA 4WOBA 4BVHA 3T0IA 5J4LA 1DCTA 1QIIA 2FGKA 4KE7A 2LKDA 4HRVA 4D4IA 4DM4A 5BURA 4MVCA 1SZPA 2L82A 2HMVA 4FCCA 1WOMA 3O31A 4ZVOA 1E1CA 3GAAA 1NUTA 1P0QA 3SYMA 4OHZA 4BPBA 1M6VA 1HH4A 3KQHA 1ZLYA 5JARA 5F98A 4B3GA 2ECKA 4FONA 2XA2A 4KPUA 5AK5A 5FWDA 3IR7A 4RORA 4OHKA 4UNRA 5CFMA 3BFPA 5AKZA 1AMNA 1MVNA 2SECE 4WI1A 1XEWY 2AZMA 4GPZA 4D0RA 4DDTA 4CQNA 4ZVPA 4XLLA 5IDQA 2OHOA 3NO4A 4LVCA 4CU5A 1XJ0A 3L01A 4I3GA 1XMXA 3KHTA 5AH0A 2QBYA 1L3BA 2YOHA 3OH8A 4HH4A 5HZGA 1W5TA 1RACA 2M32A 4HQFA 4NEHB 2O2GA 1M0EA 2O3SA 2J45A 3VR5A 1XDSA 1PQWA 2ECFA 3MMNA 2OXEA 3H99A 4QTXA 4W1SA 4AC9A 3AVXA 4N03A 4YJFA 3BTVA 1R0KA 1EE9A 2FZ4A 2ZSFA 4G8CA 4B79A 4DZZA 3A4NA 3BIOA 2JJQA 2P91A 3RC9A 4EYOA 3AYXB 3NUQA 4LY6A 2PT7A 2ADMA 1ZA1A 2XYQA 2GFQA 4L6IA 5G2OA 3OZUA 1WB4A 4OY3A 1N9KA 4X97A 4DKJA 4TS3A 2CJFA 1YE8A 2OLEA 2GD2A 3BD9A 1U98A 2FK8A 2OCIA 1Z0JA 3CTMA 1UZLA 1S3FA 2NU9B 3ZGNA 4AAYA 2YMLA 4J8PA 4X7MA 4TV8B 4DIMA 2IYLD 5C8YB 5JXWA 4BO2A 5IPFA 1H6BA 5J43A 3U56A 1VI5A 1QM5A 3WRYA 3ROXA 1ECGA 4EYQA 5LKRA 2QD4A 3T34A 3GLKA 4DG8A 4RVGA 3DA8A 3UXMA 4U2EA 1IUNA 1ZESA 2OKGA 4HC4A 3DLAA 2V96A 4BFLA 3AM3A 1DKNA 4DY4A 2BKVA 1X9GA 4BE4A 1BU5A 2ZT5A 3AYZB 4I0WB 4UMEA 5FLEX 1RRCA 2QVBA 1E1DA 1U3TA 1NP6A 1OX4B 1M34A 2AEJA 2AT1A 2ADOA 1HT1E 2PUHA 1M2KA 4KGZA 1TC1A 4JLOA 1ZICA 2VQSA 2WD7B 3EE6A 2XT9A 3AR3A 5CG1A 2B99A 2XNHA 2WF6A 1E99A 2XVZA 4AIRA 3FYTA 3A6GA 2IP2A 1WEHA 1WWKA 5ERGB 4OX9Y 1X2BA 2BM8A 2XE8A 3AIIA 5JADA 4J0GA 1M1UA 5BN3A 2XMCA 3A6ZA 2V9PA 3E9DA 3EZNA 3N2KA 4NZOA 1NJ1A 4IVRA 3KEQA 3QOXA 4PZDA 1IN5A 3TRKA 3AEKA 4TUYA 4LCBA 3GRKA 3JU3A 4C2BA 3VR6A 1NJ5A 1Y6ZA 2C84A 4HR7A 2X5JO 3TAUA 2BLNA 1CUHA 7ADHA 5G4LA 3RTCA 5BQXA 2JFWA 3B2QA 2P2GA 3ZJ5A 1L4EA 1NVKA 2IVFA 1Y4DE 5K7SA 3NW9A 2XNDD 4GC9A 4K6CA 1RC8A 2QI9C 5EMLA 4HQNA 1Y8AA 3LO8A 3NBUA 4Z8XA 2LDBA 3RTBA 2YWFA 4C7KA 1G20B 5ALNA 1NI5A 4G3XA 4BN5A 4HT3B 4BUZA 1RPAA 4WXRA 4CEHA 2Z3WA 3U4AA 4HV4A 2P1ZA 5BN5A 1FP7A 3AI2A 3OQIB 1T24A 5HQ3A 4J43A 1M5RA 1QTQA 3GLHA 4R9VA 4QSHA 3CKLA 3KQUA 2J48A 2EVWX 4RMHA 5K01A 2YWHA 2I80A 3L8FA 4OHVA 2AZ4A 1PJTA 2W6ZA 5ALDA 4Y2XA 1HZZC 2B20A 4XIGS 3B85A 3HA3A 4PZUA 2GPNA 4DAOA 3RKSA 5JAHA 1XRPA 1SCUB 1HQDA 1I80A 1XKXA 1WD5A 1EK0A 2OENG 3KT6A 1TPZA 4KAJA 5ALEA 2XQIA 1LF0A 4M38A 5M3BA 5J2UF 2RHBA 2AJDA 1SWVA 1WD7A 1SU7A 2R6JA 3MXTA 4RH1A 3PGVA 4M9ZA 4EBBA 2IHVA 4G86A 4EG6A 1IY1A 3R3ZA 3I0NA 1T0UA 2DF8A 1UFRA 3ED5A 1H66A 1L7QA 1GZ3A 3GXBA 1DAPA 2XZPA 4LHSA 2HIMA 4ZQCB 5HIJA 2H00A 3BHJA 3DW1X 3FSEA 5JYBA 1B3RA 4FX2A 4DCTA 1Y0BA 4E51A 4FOSA 1BXKA 2WSSD 3FTCA 3WV4A 1GYQA 3SK0A 3C70A 2Z58A 1E60A 3UMCA 1UJBA 4OYYA 3PYLA 1U0SY 4MP8A 1L5NA 2IYEA 2O1SA 2P6OA 4G5RA 1VXRA 1RHJA 2X0FA 5EYPA 5FV7A 3PQFA 4P34A 4C4RA 4UU0A 3JR7A 4UM8B 1MNAA 4FBLA 3T1QA 3DDZX 4XQ0A 2I9KA 3PIIA 1Z5GA 3NP7A 1KEKA 2Q6IA 2Q4TA 4KQCA 4KQ2A 1SHTX 1QANA 4W5WA 1AD2A 1DKOA 2GM5A 1V43A 1QHSA 2E6KA 2QZZA 3BUSA 4FUQA 4O0LA 3ESZA 4QELA 4HF7A 5EWJA 4AJJA 1JKJA 5B6IA 3WG9A 5ESRA 4ALMA 1OMOA 1O95A 4PE5B 1OXTA 4RBNA 4A16A 2GM9A 1N78A 2W2LD 4Q5IA 1HFEL 1DAOA 2C3UA 2PX2A 4JP3A 1P4HA 3BB4A 1SXJE 3FDJA 1TI7A 2DQYA 5HCIA 3ZDDA 4WK2B 1TOAA 4NMMA 5L4SA 2UU9B 4U9UA 4RZHA 3F3SA 4KQMA 4HP8A 2HI0A 1C9YA 1I5OA 4ND6A 2C95A 1C0KA 4QUBA 3S0JA 2PSEA 1Q0SA 1AF4A 1XJWA 1ZJZA 1EX9A 1OD6A 3OETA 3VISA 2BBWA 2G9VA 3AV0B 3ZKWA 3L6OO 2ZTVA 1Q16A 2G17A 2VDUE 4G56A 1HT2E 4RA9B 2AUTA 2GEUA 1YZVA 3DJFA 1ORRA 4FMCF 4TPKA 1LBHA 2JCXA 2ZE6A 1SHKA 4JI8B 1Z2PX 5AHRA 1R74A 2C2WA 3RNLA 4B34A 3EA4A 2BF4A 5T67A 1FU7A 1RP7A 3BHNA 3EGWA 1FJ2A 3NG1A 3D3JA 2Q9CA 4ECEA 4CFZA 2HU7A 2CZQA 3GLRA 3H5IA 5MDHA 2H2GA 3UGJA 1M0WA 2HWWA 2OMKA 3K35A 5B3LA 7MDHA 1QP0A 2CCKA 4XWGA 1I7PA 3TSOA 3G17A 2BV3A 3CEMA 4TXLA 4EA7A 3GXOA 2FCAA 8AT1A 2ZZNA 2CBGA 2YHSA 4I6GA 5ALVA 2HK8A 1Y3IA 5FAKA 4FKMA 4F5WA 3OLVA 5L6MB 4YWHA 4A2PA 1QK3A 1ZA2A 2NYUA 5EE0A 4JQCA 1VLVA 3E3NA 4H0FA 4GYKA 2VHUA 3OSUA 1M7BA 3KAKA 3PHBE 4BBZA 5HRAA 2D2VA 3LUKA 2RI0A