4D7AA

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda, in complex with amp at 1.801 angstroem resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
243
Chain Sequence
SVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPGFGAATMVTATFGFVAVSHALKKMMAKAARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA THREONYLCARBAMOYLADENOSINE DEHYDRATASE
publication title The Crystal Structure and Small-Angle X-Ray Analysis of Csdl/Tcda Reveal a New tRNA Binding Motif in the Moeb/E1 Superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 83
structure length 243
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d7aA00
4U0JA 2ZATA 4FD3A 4YVFA 1R6DA 1DFGA 3B1KA 1L7EA 3F3SA 4GVXA 1XIVA 2J5RA 2G5CA 1QORA 1YJQA 3A28A 1FJHA 3R1IA 3OIGA 3R3SA 4FQ8A 1P0FA 1S7CA 2VWHA 2X6TA 4B3JA 4ZD6A 1KEWA 4NBWA 3HUDA 3IOYA 3W4IA 3QE3A 3TZKA 5COQA 4BNNA 4D3FA 5THKA 4BNWA 4BMVA 3ZWWA 4LVUA 1PZEA 4PLWA 1P77A 4FFOA 3QVXA 1LC0A 3VPXA 4QO7A 1T2CA 5I9NA 4PLCA 1NHGA 2ZJ0A 1W6UA 1IZ9A 3JCZA 1JAYA 2PH5A 4RVGA 4J4BA 3KLMX 1X0XA 1H93A 2H63A 1XEAA 5AXAA 2EP7A 2VHVA 2A92A 4OGWA 3ROQA 1KEUA 1CRWG 3LZ6A 4LMRA 4F45A 5EESA 3INGA 2FZEA 4ZQBA 3V1TC 4P4NA 4UAGA 3NV9A 2OO5A 4R9RA 4DYVA 1U4OA 1E3IA 2UAGA 3KLPX 4OQZA 3R6DA 3EC7A 1E7QA 1NR7A 3SBOA 5TJ9A 3RD5A 3PJDA 1OOEA 3ON5A 3EUWA 1GEGA 4IMPA 4IXWA 3D3EA 2V6MA 3DBRB 1E6UA 3GZNA 3RKRA 7MDHA 3FSRA 1T4BA 1TT5A 3DONA 1EBFA 2NADA 3ADPA 3KRTA 3WJAA 3PI7A 1A71A 1N7GA 2A4KA 1V3UA 1HLDA 3E5RA 1ZXBA 4G2NA 3Q2IA 3UF0A 4MIYA 2E4AA 5COBA 2EGGA 5IZCC 4URFA 1PJ4A 1B26A 3CIFA 3QWHA 4L4RA 3PIDA 4YYZA 4CLOA 3TFOA 3RUHA 2FMUA 3AI3A 5MDHA 2IDZA 4DC1A 2J3KA 2PD3A 4RGBA 1O9BA 4FFNA 5EIOA 1I2BA 4HP8A 4D42A 4NJMA 4R5HA 1EK6A 3CINA 2DTXA 1YBMA 1IHYA 1UXHA 2BGLA 2OUIA 5EQDA 5TF4A 3DXFA 1P44A 4W6ZA 2C7VA 1Y9AA 3GZ4A 5B37A 3NUGA 4YPOA 3PLNA 1NAIA 1YBVA 1EEHA 4J16A 3PPIA 5DOZA 3DZGA 3WWZA 6LDHA 1QYDA 1C1DB 3TN7A 1LLDA 4B79A 3GAFA 1HSOA 4GKBA 2G0TA 3OECA 4BQRA 4WLVA 2PGLA 4ID9A 1DPGA 3HDYA 2BI8A 4FR5A 1PJ3A 2E48A 3DAFA 2I6TA 4BGEA 4OH1A 5HS6A 3E03A 3FNEA 4IJKA 4A2CA 1YS4A 1V3TA 4BO5A 4CM5A 4BMNA 1EVZA 3NJ4A 1B3BA 1P1HA 1MA0A 2V6GA 4M55A 2OBYA 3AI1A 4J4HA 1XU7A 5T67A 4C7KA 1CETA 2C20A 4A0SA 3W1VA 1ZSNA 3GMSA 4CM9A 1GCOA 1DIRA 3GN1A 4CMKA 4O0LA 3SC4A 4IY1A 3C7CB 4PGFA 2Z95A 2FPGA 1P0CA 4YCAA 3DZKA 2YDXA 3I6QA 2IEDA 8ADHA 5GY7A 3ZNNA 3GF4A 3QWAA 4JBHA 2FP4A 1KS9A 4L4XA 2JL1A 5C3MA 4D46A 2OBNA 4O59O 3NT2A 2ZYAA 3ETGA 1D1SA 3K96A 1HYGA 2FN7A 4NR0A 3PLRA 3ZWCA 4TVOA 3WJ7A 1I32A 1U2GA 3UXYA 5ENDA 1K6JA 3WGTA 3K8ZA 2WE7A 1L7DA 4LSWA 4J7CA 2E37A 3CSDA 1DLJA 3OJ0A 5ADHA 3FF4A 2EWMA 3NX4A 3W8EA 4XQCA 1B2LA 3E9QA 5JW6A 3VH4A 4OOEA 2WDZA 3L07A 1SPXA 2FSVA 3OMLA 1QR6A 1YQXA 3F5QA 4ND1A 1FDWA 2B4TO 4Q3NA 4QFCA 3G3EA 3QVSA 4EW6A 1NQTA 3EDMA 4M49A 4GX2A 5A9RA 3BTOA 4NZ9A 4M54A 6ADHA 4TWRA 1WZEA 3ETDA 3TFQA 3DFZA 3JQ7A 3OJEA 1M75A 3RJ9A 4BNIA 3OQBA 1J49A 4O1MA 4QXMA 1GY8A 2YUTA 3L9WA 2PH3A 3NGLA 5EL0A 3GEDA 2DKNA 1KC3A 2Q2WA 3F5SA 4KQXA 3WYBA 5JDIA 4YJHA 2Q4BA 3RBVA 3DAGA 1E7WA 1E3SA 4YRBA 4BNGA 5JC8A 1N9GB 1HE5A 2WYWA 1A72A 2IZ0A 1A9ZA 4RPGA 1NVMB 3IQDB 5KWEA 3DMTC 4NBRA 2DUUA 4Z9XA 4J49A 1B15A 5CDYA 4XGIA 1J0XO 2AW5A 3UHAA 2ZB8A 4YAGA 3IKTA 1GR0A 2EGHA 4Z9YA 3T7EA 2AHRA 2F1KA 1YH3A 4W7IA 5AOVA 1PU2A 4RLHA 1BW9B 1BG6A 3FTPA 3JV7A 1PJLA 2NVWA 1Y8QA 1YRLA 2NV6A 1DRWA 3LLSA 4MDHA 3H2ZA 1VC2A 2WTBA 1NVGA 4UEJA 3C1TA 4PLGA 1YWGO 4XX0A 5JDCA 1PJCA 4JCOA 3RUDA 2TMDA 4C4OA 1BSVA 3HN7A 1BGVA 1EVYA 5ER9A 4BNJA 3JQ9A 1A9YA 1Q7BA 2W2KB 3GVHA 4FFMA 5DCUA 5FI3A 1TT7A 4JLWA 1NHWA 1I8TA 1U3WA 1LA2A 1LQUA 1DIAA 3DBRA 3PQEA 2RCYA 3NT5A 2JD1A 2EIHA 1KY5A 1ZNQO 2IXBA 4IDDA 1R4NA 3F4BA 1HF3A 1DHRA 1JLLA 3I4FA 4AG3A 2GZ2A 1SC6A 1Y5MA 3RU9A 4YWJA 1LDMA 1PZHA 4RL6A 2QRLA 4BS9A 1OZAA 5DBGA 5ER6A 5BSFA 4CLRA 2GF2A 1G0NA 4WPGA 5THQA 2P5UA 4CQMD 2Q1WA 4TROA 4LSMA 3RUEA 2HDHA 3NEPX 3KYCB 2Y1CA 1NM5A 3PYXA 1LRJA 2NUAA 3RUAA 3ANMA 3VPGA 2X58A 3RCBA 3UVEA 2ZYDA 1HTBA 4O63O 5KVCA 4D0SA 1TVEA 2I66A 5KVVA 5G0TA 4A5OA 2X0RA 1A7KA 1PSDA 4K9DA 3DZIA 1GQYA 4YR9A 2JCVA 4DBZA 2DT5A 2VT2A 1EFLA 1LX6A 1QYCA 2B5VA 1LI4A 4A03A 5CEEA 3RWBA 4HNHA 1E7SA 1GCUA 4YAKA 3K2EA 2CVZA 1PQPA 5U4QA 1WMBA 4BKUA 4A27A 2PKQP 2GUGA 2HUNA 3U62A 3D4PA 1FXSA 1M2WA 5DCYA 2AA3A 2OXIA 3GOHA 4D79A 1RM4A 4YT8A 3I52A 1YOVB 4XDYA 4IDBA 3HDQA 3T4XA 3WFIA 4AFNA 5HWSA 2DC1A 4JBGA 4TZTA 1TLTA 3UKOA 1H94A 5L7TA 3U3XA 3EVTA 4RQTA 4LW8A 4BNXA 5IFLA 1P1RA 2NQTA 5C7LO 4UULA 1C1XB 1PS0A 3ICCA 3K31A 3O8QA 4OOFA 4WNCA 1EZ4A 3NDJA 4IIVA 3ZHXA 5K6AC 1QKIA 5KJ6A 3ZW8A 2VUUA 3ZU5A 1CWUA 2UYYA 2Q49A 5G4KA 1T1SA 1PQUA 3GN2A 1LTHR 4P4LA 2E49A 2QW8A 3MCVA 3E1KA 3NDRA 4PFJA 4WASA 2HMWA 4ZQGA 3BMNB 1JQBA 3H6KA 3RFTA 2BGKA 4FPXA 4KOAA 3AJRA 5A03A 1I30A 4XRRA 1UZMA 1DBVO 4CUKA 1HDCA 3ROPA 1EUZA 3JQAA 4J43A 1NQOA 3WFJA 4OM8A 3M1LA 4TKMA 4U0KA 4EZBA 2Q2QA 4E3ZA 3TNLA 2HKIA 4RZIA 2I3AA 1ZMTA 4CM6A 3ZN2A 4RPHA 1I5RA 2ZTVA 1IHXA 5DP2A 1MG0A 3FRJA 1BXGB 4TSKA 5JAIA 1J4AA 3TZ6A 3M2TA 3L4BA 1BRMA 3CXRA 4YJGB 1EVJA 3ITKA 4H15A 4XYBA 4J0FA 5A3VA 1ADFA 1VSUA 3C7DB 2PK3A 3BA1A 3PQFA 4JK3A 3VZPA 4IUYA 1KBZA 4W7HA 5A06A 1EDOA 4L76A 3GUYA 1LSOA 4DLAA 2HO5A 4RPKA 5L7YA 1DXYA 4I9UA 1MGOA 4DUPA 1BWSA 5JCJA 3GNTA 4OKNA 4R41A 1I3KA 2ZQYA 4NDNE 3E82A 1GAEO 9LDTA 2J8ZA 2O7SA 9LDBA 5CPFA 3G17A 1QSGA 2RHCA 2VRCA 4WJZA 1YL5A 1PR9A 2VYVD 4EJMA 3PWZA 4J3FA 1N9GA 2WEKA 5A5FA 5K9ZA 4OKIA 5I7FA 3C7AA 2GRAA 4CLDA 4R1UA 5I8WA 3QVOA 2DM6A 4WCDA 2I65A 3DOCA 4BO0A 1U8FO 1C14A 3RAJA 3VVBA 4BNTA 1P1IA 1CDOA 3GNSA 1BW9A 4XQGA 3RU7A 1LXCA 3JYPA 4NBVA 1VJTA 2HK9A 3JD2A 4XGNA 3L6EA 4FC7A 3G49A 1K89A 3IAHA 2LDBA 3SEFA 1ZK0A 1WDKA 4ALKA 4BNZA 5CDSA 4II3A 1IL0A 3UH1A 3L0DA 4BKOA 2DFVA 1P45A 1UDBA 2O2SA 4J7XA 3U9LA 2A9FA 3ANLA 1R4MA 5CDUA 3ZU3A 4AJEA 3KB6A 4F3YA 1A7AA 2VOEA 1YO6A 5C5IA 1U3TA 5TJHA 4EBFA 3SLKA 2B0JA 1X15A 3ETEA 5B12A 5EINA 1RM3A 3VOSA 1IY8A 3Q3CA 3WDSA 3K2BA 3WICA 1N1GA 2OGUA 3ZU4A 3D0OA 1Q0QA 2VTEA 5I9MA 1GPJA 4DQXA 3OJFA 4E2XA 3WGHA 3ST7A 5TIIA 1UH5A 2NTVA 1B0AA 3JYLA 3GZNB 4A26A 5T8KA 3K9QO 4M89A 4OL9A 3VAZA 3I83A 1TT5B 3WSVA 4R5MA 4ALMA 4M8SA 4EUHA 4J1NA 4YA6A 3W4KA 3KYCA 3TRIA 1Q2XA 1N92A 2CNBA 3DOOA 1GUFA 1T2DA 2NWQA 4B4OA 1T25A 1DJNA 5L4NA 4CLOB 4UEOA 4WLEA 5BSGA 3GHHA 1GL3A 4B4VA 1X7GA 3IIEA 3JD3A 3TQHA 4D43A 2GSDA 3DQPA 5FYDA 1E0DA 1B8UA 4NJMB 1LDGA 1DAPA 4NFYA 4CMJA 5TQVA 5A9SB 3QVWA 1B7GO 3BMOA 3GVPA 3H5NA 3ZWPA 5HS4A 4GGPA 1W8DA 3AWDA 1E1KA 4ALJA 5JFOA 4MJLA 5L4SA 5DBIA 3T4EA 2ZTUA 3I5MA 2GNAA 3WLFA 1E5LA 3Q1LA 4B4WA 5B4UA 3OICA 2W2LD 4DLBA 1KVRA 2FPIA 4DPKA 1ONOA 3KV3O 1YOVA 3JTMA 2QZZA 5FI5A 4RPLA 2AXQA 2JHFA 2UVDA 3FBGA 1D7OA 1QMGA 3INTA 3U09A 3FWZA 3MWDB 4Y67A 3VDRA 2PTGA 4J0EA 3M2PA 3PK0A 3IJPA 3DBVO 3NYWA 1C1XA 4QUKA 5TT1A 4EJ0A 1EMDA 4CMAA 3ABIA 5IJZA 2X86A 2JFFA 1U1IA 3ZH2A 4FW8A 5IN4A 2YV3A 1P1KA 1P31A 2FPPA 5I7SA 1MV8A 3ANNA 4NFSA 4PG4A 4LGVA 2P9GA 3WTCA 3P19A 4PVCA 3JQGA 4I5DA 3ZWVA 4WCFA 1PJTA 2AE2A 2YYYA 3PJEA 3LF1A 4OO3A 1IPEA 5IXSA 1YBAA 2GD1O 3JQFA 2C7GA 3MJCA 3UGKA 1N8KA 2JD0A 4FBGA 4YAEA 2WD7A 3JYQA 3B6ZA 1T1RA 3V2GA 1XU9A 4OYRA 4E2YA 2X5JO 4BL5A 2GPTA 3FBTA 4KP7A 1E1LA 3H9UA 4OMUA 1VJ0A 5IDXA 5HA5A 3OHSX 2V6BA 4CM8A 4L8VA 4PLYA 4YQYA 2GN9A 3TOXA 4H3VA 3N58A 1P74A 3U4IA 4OIMA 4FIZA 1IOLA 2DPGA 1XKQA 4MKZA 4MIEA 1H9AA 2JD2A 4YB8A 2ZB3A 3RVDA 4DTIA 2VT3A 3KZVA 2D59A 3NTQA 4E5PA 3DZJA 4R4JA 1XELA 2DBZA 4YRAA 3QY9A 2Y66A 5JAMA 1M6WA 2G1UA 3SVTA 4B4UA 3DZFA 4EEZA 1V6AA 1WDLA 3WMXA 1MFZA 1ZBQA 4D3DA 5GZ6A 2BF7A 4ZQEA 1DDOA 5KOIA 3ZDFA 2BELA 1JKFA 1V9LA 3WQSB 2X9VA 1SCUA 2HLPA 3JQ7B 1SNYA 3KTDA 4JP2A 5JY6A 3LK7A 5G2OA 3PFWO 1M66A 1U7TA 3A4VA 5CP8A 4UREA 4DVJA 1KIFA 4W9NA 3K92A 3GFBA 2CDAA 4CODB 3I9NA 1DRUA 1D4FA 4FOOA 4YJHB 1CEQA 4IS3A 4HY3A 2NM0A 1X14A 4Q3EA 4BO3A 4RJTA 2W98A 2F00A 1BVUA 4ZN6A 4R01A 2QYSA 4UVGA 4WGGA 1NXQA 4CMEA 4C7JA 3P7MA 3F6YA 3AM3A 1E1MA 1E3LA 4L4SA 5I9LA 3G1TA 2GYYA 1WLYA 4GWGA 3A9WA 3RBXA 1NTOA 2EKQA 4FGWA 1DRVA 3ZNQA 3HB5X 3B20A 1F12A 1HDYA 4EUEA 5L7WA 4MVJD 1Z45A 3VPSA 1Y8QB 1BVRA 3E6AA 3K73O 4NU5A 1NPDA 2VHYA 2Z1NA 1U8XX 3OIDA 1SMKA 3HFSA 3JQBA 4IDCA 5TGDA 3HJAA 2H1SA 4JJIA 4N5LA 1JKIA 4CMCA 4EGFA 1UZNA 3A1NA 1U3VA 2O2YA 1R12A 3GK3A 4K28A 4J2HA 4YJFA 3QWBA 1FDSA 1NQ5A 2Y99A 2O3JA 3C24A 1NFFA 1B14A 1MC4A 5I7VA 3DDNA 2CF6A 3ZU2A 2VNSA 2X7HA 3O38A 2W90A 2DBRA 5JPIA 1LSSA 1H9BA 5JY1A 1R4NB 1YXMA 3QHAA 1DSSG 2OP0A 4FFLA 1VL6A 5JDIC 1BDBA 1VKNA 4GX0A 1O6ZA 4BVAA 1VL8A 1LNQA 1LLCA 1VLLA 1I24A 4CLRB 2DBQA 1B3RA 1KY4A 4GLLA 1JW9B 3FI9A 5CFZA 5KIAA 1T2EA 1MG5A 1MXFA 3WTBA 5DNAA 3E8XA 2B4QA 1WWKA 3QVTA 4ESOA 4DPMA 3F1KA 3AM5A 5AXBA 2YQ4A 4P8RA 4XQ9A 1V35A 1QV7A 3ENKA 4OXYA 3SXPA 2YQ5A 3PWKA 3VZSA 5A9SA 3STHA 5HTOA 1H6CA 2HMSA 1HDXA 1PJBA 2D2IA 4ND2A 1ZK1A 1E7RA 2X5KO 3LYLA 3ZWBA 3DHYA 3E48A 3MTJA 3TL3A 1N5DA 2NU6A 4CUJA 3F9IA 4Q9NA 4E30A 5HM8A 4DQVA 4OXKA 1LU9A 3WB9A 1P9LA 2X0IA 4Q3CA 4ZGWA 4B7XA 1YB5A 2VWQA 2NTJA 3MJTA 3CUKA 1DIHA 2W4QA 2WWRA 2ZK7A 2LDXA 3GG2A 3DAPA 4IBOA 5A4DA 2DLDA 5JBIA 5F5LA 1P1FA 2GZ3A 1I01A 4D3SA 3AK4A 4UUOA 1JA9A 2JAPA 4J1TA 4Y8VA 1M76A 4J1QA 2VUSA 4II2A 1EFKA 3I9OA 2C82A 3PRJA 3DTTA 1ZZEA 3PXXA 3S1LA 4DL9A 3D3WA 2Y68A 2YFQA 2RH4A 3D5QA 3IDSA 3O8QB 1HDOA 1S6YA 4A10A 2BGMA 1UAGA 3PQDA 1MXHA 3FWNA 4B3HA 1CQJA 3BTUA 1Q0LA 4LVCA 1K0UA 1ENZA 3MOIA 2X9GA 5G4KB 4DMMA 3FR7A 2Q50A 3VKUA 1YB4A 4IMRA 5DN9A 1QYVA 1GYRA 4OSPA 1HE3A 1JAXA 1HZJA 3IJRA 4J9VA 1JWBB 1XQ1A 4Z9FA 1HT0A 1NQAO 1E6EA 4XYLA 1FDUA 1JVBA 1O0SA 4N5NA 3WX0A 1CYDA 3JQAB 2YHIA 3DL2A 4PG6A 1KYQA 3H8VA 1T26A 2EHDA 3H7AA 1UDCA 2ZIZA 1C0KA 3HB4X 5C7IO 1F14A 2JHGA 4TQGA 1BXKA 2HU2A 5ILGA 4FB5A 3KM0A 2WJPA 4FS3A 4ZRMA 1ZJZA 2X1HA 2Y1DA 3H4VA 1M67A 4MP6A 2NLOA 4O5OA 4OXNA 4HFJA 5JO9A 5JAZA 2OL4A 2VYND 4RORA 4UEKA 4Y9DA 2PNFA 1GTMA 4BB6A 3DBLA 1FF9A 3FNHA 2GGSA 4JIGA 3AOEC 2CZCA 3GUCA 4ZQFA 4YBZA 5AXDA 3B70A 1OC2A 3PGJA 3AUSA 5F3RA 1AHHA 4BMSA 4KTTE 3MWEB 5B1YA 1DC6A 1PGPA 1VSVA 4Z0HO 4XZ3A 2Y1GA 5BQFA 1ISJA 1PJSA 3S55A 2DBVO 4YEDA 1KEPA 3I23A 3GAZA 3INRA 3RC7A 2G76A 1HDZA 1DB3A 3B1FA 4GL4A 4K6CA 3PWSA 1ARZA 2Q1UA 3E9MA 4MVJP 5F1OA 3AM4A 2O4UX 3HNPA 5IDYA 4XEHA 4IJUA 3GQVA 1ZEJA 4PRKA 5F1KA 2HSDA 3PHIA 5A5EA 4IPTA 4MO2A 3TZHA 1I3MA 1N7HA 3JD4A 3NJ8A 3RC2A 5HBRA 4PG8A 5AXCA 2EJWA 1DOHA 4RV9A 3FPLA 1EBUA 3RFXA 4EUFA 1ZK3A 3LC7O 1I3NA 1MX3A 5C37A 3S8MA 3U4DA 4CV1A 3OBBA 1YVEI 3D4NA 4E2WA 3ICPA 4CM9D 2BHLA 1H0KA 4AICA 4A73A 1BDMA 2BRUA 5EMHA 2UV8A 2ZTMA 3VZQA 1A4UA 1HYHA 3DTYA 2R00A 5TS3A 4CR8A 3L4BC 2EW2A 4N54A 4PLHA 2QZ9A 3VDQA 2EEZA 2Q45A 1X1TA 1E77A 1R4MB 5ES3A 1C0LA 3WMWA 3LC1O 1RM0A 1PZGA 4LRSB 1LDEA 4RF4A 5L45A 4NJOA 4BO8A 4DPLA 4FOSA 4ALLA 1LEHA 5CEJA 1E92A 3OQ6A 3PDUA 3DR3A 3PIIA 4MVJF 4HFNA 5JSFA 1CJCA 3WGIA 3ZWOA 4WKGA 1IULA 1Z73A 4FJ2A 3AUTA 4TRJA 3T7CA 4BQPA 5CG1A 4BO1A 1D8AA 2P2SA 2Y0CA 4CR6A 1WW8A 2YZ7A 4D44A 4PLPA 5TRTA 5L9AA 5JMPA 2VCYA 4NH4A 1E3JA 4BO4A 4DIFA 1UR5A 4WLNA 1OBFO 2EKLA 2YV1A 1O89A 3EK2A 2I76A 4N7RA 4QECA 3W8DA 3GDGA 2PLAA 3QJ5A 1O8CA 4AJKA 3ZWAA 3DBHA 3WNVA 3RI3A 3P2OA 4WUVA 1P3DA 1HKUA 2Q1TA 4R16A 2XOXA 1SOVA 1OAAA 4MIOA 3UAGA 2NQ8A 4CM1A 5ITVA 2O4CA 4RCVA 1BMDA 3LLVA 4I5EA 2AQHA 3FPCA 1RJWA 1G1AA 1PX0A 1ZO8A 1KEVA 1UXKA 1DC5A 1YL7A 1H6BA 4ZHSA 3QA9A 2CF5A 3O4RA 3BMOB 1JTVA 3D4OA 2BH9A 3E18A 3TDKA 3P2YA 4MVJM 2EP5A 4R3WA 3DFUA 3PYLA 3UFXA 1UP4A 4GMFA 4HADA 4WLFA 4EJ6A 4HX5A 3OH8A 4YRDA 3CTMA 4BB5A 4E4YA 3EZYA 3OJOA 1GQ2A 1GV0A 2ILTA 4OSOA 5JAQA 2V65A 2ZTLA 5A02A 1VRWA 3M1AA 3DHEA 1XWFA 3H2SA 4ND4A 2C2YA 4UUMA 4GLOA 5G4LA 4PCVA 3GEGA 2HRBA 1M6HA 4NFHA 3UOGA 4B7CA 4GMGA 1ULSA 4NK5A 3EHEA 4JGBA 4JP3A 1C0PA 2VYVA 3KSUA 2GDZA 3GVIA 4UUPA 2Y0EA 5T8KC 3HQ4O 4KMSA 1LSUA 5A9TA 4ITUA 4E31A 3C1AA 1AXGA 4MP8A 4FSHA 1YE3A 2Y05A 3JQGB 3BMQA 2DFDA 4WCFB 2PZMA 5K0ZA 2BI7A 3WYEA 4XR9A 3V8BA 4IZIA 1EK5A 2G17A 4FFRA 5F21A 4TRNA 1Y81A 3VH2A 2OOSA 3SC6A 4NK4A 2GR9A 2FRDA 4MVJE 2GERA 4JJGA 1WPQA 3BZUA 3LSYA 1MP0A 4GGOA 2WD7B 5FFFA 4OQYA 2ZKLA 5T6BA 1ZKMA 1AE1A 1DHTA 1UZLA 4W4TA 1VL0A 4XB1A 5KKCA 2ZYGA 1BHSA 1PTJA 1HDRA 3K5PA 3H3JA 3RJ5A 1JN0A 2J5QA 4CM8B 3L6OO 3AU8A 4JQCA 4CLXA 1G6KA 1GD1O 3E9NA 4D41A 3AY7A 3AUAA 4XA8A 1ENYA 3ZV5A 3GY0A 4RDHA 2YJZA 5HRUA 4J9UE 4CM4A 3NT4A 4XJSA 1F8FA 2G82A 2JJYA 1XDWA 5L53A 2NVUA 3CKYA 3PHHA 3DHNA 3ONEA 4LRTB 4L0QA 4E0BA 4ILKA 4HBGA 1T4DA 3RUFA 4CV2A 4R54A 2RHRA 1YDWA 1ZSVA 1DFIA 1UDAA 2VRBA 5JE8A 5L40A 1OMOA 5DT9A 2ZQZA 1WVGA 1VE9A 1HZZA 1Z82A 3COSA 2GN8A 2HQ1A 4KTVE 1YQDA 4NBUA 5CDTA 3GRPA 1B16A 1RKXA 1ZXLA 3JQ6A 4DWVA 3ZCXA 2X4GA 1E3WB 2AQ8A 1U28A 4J6FA 1I3LA 4YT2A 4ND5A 3H9JA 4E33A 4AJPA 3ZNOA 4NU6A 3EGOA 3GC6A 4NI5A 2OP1A 4RVFA 4KDEA 1PS9A 3OETA 4E5MA 5G0WA 4BUCA 1GEEA 3S2GA 3UW3A 4Y6RA 5FWNA 3AFMA 3LT4A 1R0KA 4BIIA 1SOWA 1GUZA 5FEUA 1HL3A 4BGUA 4UVEA 2AEFA 5ICMA 3DOJA 2FR1A 3FD8A 4GH5A 3HADA 4WLOA 3PP8A 4BHTA 2VOJA 1QG6A 2W2LA 1EDZA 5EERA 3BYZA 4KWHA 3RUCA 1LRLA 5LCXA 4WE3A 1KETA 2A94A 1ZW1A 3ADOA 2XF8A 3CMCO 5IDQA 1BTOA 1KOLA 4JNKA 1R0LA 3KVOA 5CDGA 3FN4A 3TF5A 2PKRA 4NHEA 4BV8A 4YJFB 3LU1A 4I08A 5EJ2A 2DTEA 3G79A 1O95A 3UCEA 2X0JA 1LQTA 3TPCA 2EF1A 3GG9A 3ZWMA 3SJ7A 4KZPA 5DP1A 1ISGA 4W9NC 5ICSA 3AUUA 3NTOA 2H5LA 2FY8A 1U2DA 3IS3A 3JYNA 2VWPA 5TC4A 1PGOA 3U5TA 3TL2A 4M1QA 4IDGA 5KJFA 1QLJA 4U5QA 3K30A 5H81A 1IYZA 4Q3BA 4F6LA 4Z0PA 4YT4A 1ADGA 3NTRA 5H83A 5LC1A 2R2GA 3BAZA 5K6AA 1HYEA 3BIOA 3QP9A 2IZZA 2IYOA 2NU9A 2QIOA 3ENNA 3JSAA 1U5CA 4N18A 3CEAA 2C59A 1I33A 4GSLA 1H2BA 3FR8A 2PZLA 1ZK4A 4K1LA 1Z75A 1ZK2A 3PHLA 4YJDA 4U8GA 2D8AA 5GZ1A 1KC1A 1NPTO 3JQBC 3ZHZA 1NWCA 3WOHA 4X54A 3NDIA 1NVTA 4XIJA 2VZ0A 4TZKA 4ROSA 4BGIA 1E3EA 2X8LA 4CR7A 1JU9A 4E2ZA 3O26A 5EQFA 1X7DA 4QEDA 4XYEA 2Q3EA 1TEHA 1T24A 1LLUA 2HCTA 2PD6A 2VZ8A 4RPJA 2V6FA 3PFFA 4GWKA 1XA0A 1ZFNA 2VWGA 3DZBA 1LLQA 3LVFO 1NBOA 3WR5A 3BTVA 3KYBA 5T5QA 4PZCA 3WSWA 5JNLA 2O50A 1ML3A 1Q0HA 2ZCVA 3FNGA 5KVQA 1W4ZA 2FSSA 2ZCUA 3D3WB 4BNFA 1EUCA 5DOVA 5ILOA 5G0VA 4XCVA 4XD2A 2UUOA 5CPBA 1LSJA 5EPOA 4ZJUA 1HSZA 3UICA 3ZHYA 5KNLA 2FR8A 1TXGA 3GFGA 3RFVA 3KSZO 4YACA 3TZCA 3JQDA 2I9PA 1ENOA 4ZA2A 1PQWA 3W8FA 3C1OA 4CMHA 1OFGA 4INAA 3WBBA 4S3MA 3QV1A 3RSHA 2RBEA 3LDHA 4DXHA 1EQUA 3WIDA 1J6UA 2HRZA 3AY3A 4PZDA 4MVJA 1U3UA 4O6VA 1GUYA 3BHMA 2CVQA 2YHIB 4HFRA 3JQCA 4GVLA 4AJ1A 2I99A 2DU8A 3A06A 1E7MA 1E5QA 2PR2A 2C07A 1K2WA 1TI7A 2AG8A 4HNGA 4CV3A 2FR0A 3KOUA 1NR1A 4YT5A 4OJNA 2E82A 2PWZA 4MINA 5IN5A 4KUEA 3LT0A 2JAHA 2CUKA 3ZV4A 4Z6KA 3U0BA 1Q7GA 3PGXA 3F1LA 3AW9A 2VZ9A 4XR4A 3FCOA 4UUNA 4CMIA 1Y1PA 3ONFA 1FDVA 4WK6A 5COAA 3DBLB 4R9SA 1NYTA 3OA0A 4IXTA 3GGPA 4E12A 2Q4EA 3OF2A 4W99A 5GZ3A 3FHLA 3GHYA 2Q1SA 1Y6JA 4I1IA 2AQIA 2BFMA 1SEVA 3WBFA 4A7PA 4D0RA 2VNAA 4WEQA 3LQFA 2YY7A 1E3WA 5T64A 2E6UX 3QWIA 4TMFA 4CQMB 1JDJA 2Q99A 1EQ2A 2AG5A 3S2EA 1PWXA 4B8ZA 2PKQO 3ROMA 2FZWA 1N1EA 2POQX 5IXYA 2Y67A 4WLUA 1PEDA 4ALNA 1ISMA 5KJCA 2B37A 3HHPA 3VC7A 2RH8A 3PZBA 4MVJG 4YAJA 3HFGA 4BNKA 3KSDO 4PVDA 3AOGA 4I9HA 4P38A 1NP3A 1X7HA 2BMAA 3EYWA 4EEXA 3GH3A 2OORA 2RAFA 5TSDA 2DPHA 3BHIA 4F6CA 4XDZA 4F46A 3EW7A 4EI2A 2UDPA 3PJGA 3CPSA 5JCXA 1XGKA 3ONDA 1YDEA 2DAPA 4I8XA 4GX1A 5DZSA 4FFPA 4R68A 4XWYA 2NU8A 3OEYA 4H7PA 1GU7A 1W73A 3KEQA 4XQEA 4BNVA 3I1JA 3QIVA 1LRKA 1NNUA 3R3JA 3V2HA 2IRWA 2JCXA 1LBEA 3I6IA 4BO6A 4S1VA 4FJ0A 3B1JA 5CAEA 4XIYA 1SZJG 2WSBA 2O3TA 1X1EA 1ZUD1 2QRKA 2VTDA 4H16A 1X0VA 4GKVA 1GZ4A 4AJLA 4QFDA 5AVOA 3TOZA 3O9ZA 1HXHA 1F17A 4CL8A 3HE3A 4MVJI 3WLEA 3PVZA 4R51A 3WWYA 1DC3A 2IZ1A 1N2SA 1O94A 1YJ8A 4P22A 4DC0A 1YKFA 1IUKA 2JCYA 3V1UA 2V7PA 3H9EO 3GLQA 5DF1A 2HMVA 3AI2A 3EZLA 1Y7TA 1I2CA 5G0UA 4IJVA 1OI7A 2PFGA 1GZ6A 4GI2A 2BD0A 3DBHB 3F46A 1ZVMA 1V8BA 3V5NA 2HJSA 2PY6A 5T57A 4E5KA 1XSEA 2GZ1A 3IUSA 5TLSA 1SB9A 4DIOA 5BR7A 1MB4A 4RQUA 2XXJA 3WGOA 4D7AA 5IAAA 2R00C 1DEHA 2IYPA 1UXIA 2HK7A 1WXDA 1ORRA 1A5ZA 2X0NA 3EAGA 5JDCC 3R0IA 5I7EA 3WGGA 4PZEA 4AVYA 2PZJA 1H6DA 3ASVA 1GZ3A 2VYNA 3UCXA 1VKOA 4QT0A 2DTDA 2P5YA 3JQ9C 1PGQA 4CMBA 1Q7CA 2QG4A 4AJ4A 4KDFA 1P1JA 4Z3DA 3N74A 4IIUA 3PHGA 2O3QA 4EITA 1AN9A 3I9JA 1A4IA 4CLEA 2VHZA 5CHEA 1O5IA 3VPFA 2H9IA 2FOIA 4PRLA 4RVUA 1RM5A 1YONA 3VKVA 2O3UA 4BO2A 3O03A 1LDNA 4RLSA 1Z74A 4QTZA 4U6QA 1Q1NA 4PLVA 3QSGA 4L74A 3X2FA 3ULKA 4ALIA 4YXFA 1UJMA 7ADHA 4GBJA 3DC2A 5L4LA 3BMQB 4IINA 5F5NA 3OQ1A 5IF3A 2X23A 4DMLA 1NFQA 4GX5A 2DUWA 2EERA 3GGOA 1WP4A 4IQ8A 2YFHA 5IG2A 2YHUA 4MVJH 4LCJA 4ND3A 3PYMA 1XR3A 1B8PA 2QHXA 3H9GA 3ITDA 3HZZA 2Y93A 1H2HA 3VH1A 4E6PA 1Y5RA 4HUJA 1F8GA 1CERA 3V2UA 5L51A 1KVSA 1VM6A 3BMCA 2QX7A 4U6SA 4IS2A 3IP1A 4IDEA 4RDIA 1I0ZA 2CSUA 3TSCA 3OM9A 3QWFA 1X13A 4PLTA 4CM3A 3Q9NA 4QQRA 1U7HA 4BKQA 4CQLB 2RIRA 1I2ZA 3L9XA 5I8ZA 4DBVO 4QX6A 4YQZA 3I9KA 2I67A 1Z6ZA 1TA4A 1Y8RB 3ZW9A 3AFNA 2B5WA 4HWKA 3WQRA 2NTNA 3WXBA 2C2XA 4CM4B 2O23A 2PZKA 2NVUB 1IB6A 3DZHA 1R0SA 3JQ8B 3PJFA 2AMFA 3BXXA 4KUGA 1KERA 3D7LA 3RBZA 4CQMA 2HMUA 4E5NA 3JD1A 3IP3A 4K6FA 4ZRNA 4BO9A 3KETA 1R66A 1VI2A 3N7UA 1H5QA 4ZVVA 2X9NA 5AYVA 4B7UA 5B4VA 2AEJA 3FTNA 1HE4A 1JWAB 3PEFA 4RVSA 5BNIA 4OHUA 1MLDA 4Z3KA 4UVHA 2Y1EA 1ID1A 3D1LA 2WYUA 1E7YA 3LC2O 1PL6A 3IUPA 4RO0A 1EE9A 2EJVA 1PZFA 4L73A 5CEFA 4BGVA 1MUUA 4MOWA 4U7WA 4DYDA 5ENVA 4J4TA 5IZCA 4BNUA 1QYXA 1SO8A 1UP7A 2D1YA 3UN1A 1VPDA 4HKTA 3HWRA 5L95A 2NSDA 3GEMA 3CMMA 1C0IA 5LDGA 2R6JA 5JS6A 2B69A 2IE0A 2BFPA 2NNLD 3JD0A 4RF2A 4IDAA 4IGEA 3W6ZA 4BNLA 2EW8A 4IJWA 3SLGA 2P4QA 1DO8A 3E5MA 4KUHA 2DQ4A 3OP4A 4NNJA 4XYGA 3ZV6A 1IE3A 2YDYA 3PHJA 1GQQA 1PGJA 3EY4A 4PIVA 2J3JA 1RYDA 1FDTA 3OIFA 4G65A 3KYDB 1HEUA 1GFSA 3IC5A 5A05A 1QXSA 3RC9A 1XHLA 4AJOA 3A14A 4NBTA 4NPCA 1EUDA 3C85A 4KWIA 3VTZA 4LISA 1IZ0A 3MJVA 2IODA 5TNXA 1ONPA 2JKVA 3RKUA 4WOJA 2YW9A 4GPD1 3Q11A 2YV2A 3MZ0A 4IQ0A 2PA3A 4HXYA 1PL8A 4JJFA 3PTZA 4JXKA 1CF2O 3HSKA 4AJ2A 1F0YA 4G5HA 4Q3AA 3TZQA 3VZRA 1YB1A 2CVOA 2I5PO 4I5GA 3GVCA 3HG7A 1R16A 3ZWYA 3FNFA 1PL7A 5DULA 1R37A 1DAOA 3KBOA 2PGJA 2VHWA 3GDOA 4YTEA 1PJQA 3CZMA 4K26A 1UP6A 3MJSA 4G81A 3IL2A 2OFPA 5H82A 4BKRA 4IM7A 1MFPA 3QLJA 2Y1FA 1AHIA 3VHRA 2P68A 3L6DA 3ZI0A 3G0OA 4PN3A 1PWZA 1L1FA 5C7OO 4WEOA 1K6XA 3OA2A 3LT1A 4TRMA 1QYWA 2NACA 3I3OA 1ULUA 4FC6A 2BLLA 2J5KA 3MJEA 2WMDA 2WM3A 2Z5LA 3K6JA 5ITWA 1RWBA 4LCEA 3W4JA 2PD4A 4TVBA 1UXGA 1U5AA 1DIBA 4Q39A 4OAQA 2AEMA 1AUPA 1C1DA 4JBIA 3RASA 3GNQA 8LDHA 2J3IA 3H5AA 2AE1A 1A27A 5U1PA 4WECA 1EE2A 2C5EA 1PGNA 2ZB4A 3HDHA 4D45A 1HE2A 1YL6A 3GA0A 2B4RO 2D4AA 2Y1OA 3DWFA 3VTFA 1JKJA 3UCFA 2DVMA 4N5MA 5JMWA 3OSUA 3U4HA 1GADO 1VJ1A 3GT0A 3AOEA 2EKPA 1GPDG 1NPYA 3EMKA 2HK8A 2HMTA 1XYGA 3GR6A 2PV7A 3UUWA 5BSHA 2FWMX 3ROKA 1HDGO 2TMGA 2OZPA 1Y9EA 1H6AA 3WIEA 3U49A 1U4SA 4MPDA 4WNIA 2EG9A 5DBFA 5IDWA 4PG7A 2WD8A 3WYCA 4B8WA 1ONNA 4FN4A 3GGGA 1UAYA 4KQWA 4R3NA 4IGFA 4AJHA 4PLZA 1WDMA 5JLAA 4R1NA 3DMTA 4PLFA 4CQLA 4MKXA 2BKAA 1WNTA 4L9RA 3RQSA 3VH3A 1E1NA 1TB4A 3WS7A 3ORFA 3SX2A 1K3TA 4BNMA 5BT9A 5KJEA 1PJ2A 3PZRA 1Y8RA 4UVIA 3WGYA 4FCCA 3RIHA 3S2IA 3WNQA 5CG2A 3SJUA 3RC1A 5J23A 1KVUA 4CMIB 4DGSA 1NFRA 1WMAA 3ASUA 4GQAA 3CZRA 4B3IA 1WAMA 3DO5A 3KEOA 1QV6A 3JQ8A 1NWHA 1ZJYA 1RPNA 3GVXA 4E21A 2Y0DA 4CL3A 3H65A 3U4CA 3M6IA 4DQUA 4HV4A 2VQ3A 4UVDA 4Q3DA 1SAYA 2D5CA 3L4SO 4YDRA 1D1TA 4WCFC 4Y6PA 1LDYA 3EVNA 2I3GA 4AL4A 2O3RA 4DREA 3JQFC 3ZHBA 5A3JA 4MKRA 1F06A 4AJJA 3D5TA 2D5AA 4J90A 2CFCA 5L3ZA 2JFGA 4DA9A 4YAIA 2IEBA 1MC5A 3WG9A 1GYQA 5MGBA 2O48X 2VUTA 2GCGA 4J1SA 4W82A 1IPFA 1QP8A 2GLXA 1NX6A 5BSEA 3Q6IA 1FMCA 3OJLA 4XGKA 5GMOA 5FF9A 4BV9A 1SBYA 3BTSA 2CD9A 3ZWXA 5KJ1A 3Q2KA 4M87A 1CIVA 2P9CA 3KO8A 3QW2A 4TRRA 1B8VA 1KVQA 2P91A 3MJ4A 4J2OA 5TX7A 1ZEMA 4GSKA 1V3VA 1LC3A 2IXAA 3W6UA 1I10A 3I9LA 1ADBA 4I5FA 5IZ4A 3MEQA 4DIBA 3V1YA 2CY0A 4XKJA 3JQAD 2BFAA 1ISIA 4IQGA 5DDIP 3VVCA 5A1TA 4NMHA 2QYTA 4Y6SA 4XJTA 1K6IA 1LUAA 2J3HA 1Z7EA 2OHXA 3IMFA 3WGQA 4DRYA 3KYDA 2O3SA 1K5HA 2QRJA 4RF3A 5B4TA 1SEPA 2XPCA 2CMDA 4Z0TA 1ZH8A 3DMYA 3PDJA 3TJRA 1YQGA 1DFHA 1T2AA 1OC4A 2W2KA 2W8ZA 3KHUA 2C54A 3S2FA 1DIGA 1ZSYA 4Y98A 1NASA 1WZIA 2VHXA 1D3AA 4EYEA 3DEYX 1C3VA 4PG5A 3L77A 1XLTA 5AQ1A 4FJ1A 4CV0A 5JCJD 1XCBA 4CM7A 3HN2A 3GRKA 4CMEC 4R1TA 2CDBA 4RVHA 5KVSA 4LK3A 4WOKA 4BNYA 1UUFA 5BNFA 1EVIA 3CH6A 2EV9A 1AGNA 2VRCD 2B35A 3OFSA 2WE8A 3H3FA 2O7QA 4ZQHA 2C5AA 2B83A 3Q0EA 1ADCA 4AJIA 5KKAA 2GN6A 2P4HX 1GDHA 3GPIA 4LMPA 1NAHA 1HETA 2Q2VA 1UXJA 2VN8A 3GDFA 4RF5A 1LJ8A 2H6EA 4AJNA 1J5PA 4J7UA 4CJXA 1ZMOA 4EDFA 3NKLA 3AU9A 1V0JA 3P5SA 1PR3A 1E6WA 4JX8A 4E32A 4CMGA 2X5OA 2EXXA 3GPDG 4ONEA 2D0IA 4XYMA 2GASA 2HJRA 1DJQA 3QQPA 2X22A 4P4GA 3DB2A 4FGSA 4M86A 4HFMA 1ISHA 3C3XA 3JYOA 4E13A 1KVTA 2XAAA 1HWYA 1R15A 4I9NA 1HLPA 5TT0A 5JO0A 1HRDA 3NAQA 1W0CA 2BFOA 3D64A 3WGZA 3TWOA 3F47A 3OEWA 4XB2A 2NU7A 3BHJA 4BNHA 2JFHA 4QSMA 4FDAA 4IZHA 5KCZA 3ZNPA 4L75A 1GYPA 5JYEA 2B36A 1SB8A 4MP3A 3LT2A 2UUPA 3WQQA 2ET6A 2FHSA 3RROA 3KUXA 4E5YA 3ZV3A 5JYDA 1PIWA 3RUIA 3MTGA 1ZCJA 4BO7A 4ZICA 5G0SA 2GO1A 3HDJA 4NQZA 4J91A 5JC1A 2PGDA 1RYEA 3F4LA 4R69A 2C29D 3NRCA 4ZU3A 5A04A 1GV1A 2ZB7A 5LDHA 4BKPA 3BMNA 5DCWA 1ISFA 3VPHA 1JVSA 1BXZA 1YGYA 2GN4A 2HAEA 3BMCB 2C0CA 2Q46A 3ZWNA 3Q9UA 1XG5A 2CDCA 1G0OA 3JQEA 1ZIDA 2SCUA 1DLIA 3ZGYA 1QRRA 1FK8A 3IKVA 4RVDA 5BNTA 5U9CA 3AY6A 4CPDA 4R1SA 4XRGA 1PS8A 3MOGA 1P33A 3G1UA 1QLHA 2WYVA 1T2FA 4NG5A 3X2EA 5EN4A 4JROA 1Z7BA 2AQKA 3H9QA 3LF2A 1BXGA 2D3TA 2A35A 3KXDA 4RZHA 4YJGA 3I4CA 5JXWA 2ZJ1A 4TKLA 1XQ6A 2Z1MA 4LN1A 2J6IA 4QO8A 3H5RA 1DC4A 2NVBA 4CLHA 1LDBA 3GMDA 4NIMA 3ZZNA 3CE6A 1AXEA 1ENPA 3I9MA 3C8MA 3NGXA 4BOYA 2XXBA 2QQ5A 1I36A 4JN6B 5KTKA 4DLLA 5F1PA 4IDFA 2P9EA 1U9JA 2OMEA 1CQIA 3QRWA 4CUZA 4GAEA
chains in the Genus database with same CATH superfamily
4HNAB 1UM9B 1F6BA 4U0JA 1Z5GA 1HNXB 1BMFD 4YVFA 3SC3A 1OREA 2QXYA 2J85A 1L7EA 3F3SA 4MTLA 1Z2EA 1DJPA 1N2ZA 1PEAA 1TM2A 3CFYA 3K8YA 1PWEA 4FYJA 1A9SA 4LRYA 4XM1A 4ZEWA 5I5EA 3S28A 2FWJA 1SOAA 3R3SA 2BKLA 4RXMA 1DUIA 1JAHA 3DM5A 4FQ8A 4KE6A 5C7YA 4W5RA 2HXGA 4ZD6A 4EG8A 2ECPA 4PX9A 1KEWA 2IUFA 3IOYA 1PYOA 3W4IA 3B8EA 3GQBB 3SFZA 1VQ1A 1WF6A 5COQA 1Q44A 3V00A 5AW6A 3ZWWA 1H8ED 1WABA 3MELA 3OFJA 4XWTA 4B71A 3ZLVA 3ICQB 4HB0A 2Z56A 4PQRA 1DNPA 4X97A 5KYXA 2WIGA 3G7UA 3PVSA 3QVXA 2AFHE 3MD9A 3FGOA 3NOXA 5A6SA 3CRNA 3FWHA 3QXJA 3RAPR 3B5IA 2CJPA 3D3JA 4YO8A 3IUMA 4D4IA 2JPDA 5JMTA 1CEXA 3H11B 1W6UA 4IIHA 2IPMA 3V7UA 3ZTWA 4X41A 1PJRA 2BY4A 1X0XA 2GN0A 3H1TA 3H6HA 2C2ZA 3KLMX 3N2KA 3TX6A 3VSCA 2H63A 3OQIB 3KUDA 3DULA 2VVTA 2GBGA 4OGWA 3ROQA 3WRYC 1E98A 5KSPA 4KRYA 3X43A 5KQRA 3AF6A 3F6BX 2B2XA 5CDHA 4WZ6A 4ZQBA 5GONF 1H1LA 1TEXA 3IRVA 5IJ9A 2R84A 1UBTS 2IYRA 2ZIFA 3HUFA 3DPIA 4Q1CA 1QANA 1E7QA 1GOTA 1NR7A 5MGNA 2IH5A 3UHFA 4ZYXA 5AHOA 4MQFA 4N5HX 4B76A 1GEGA 5IULC 4IXWA 4D9JA 4ZI7A 1C9MA 1ZYUA 3D3EA 1YQWA 3HU1A 4FKBA 5FULA 4R8MA 2QTHA 1JX6A 4YCMA 4RTOA 2JH8A 2HQSA 3RKRA 7MDHA 3FSRA 1M7BA 3NBUA 4B3BA 1T4BA 2J45A 4DRZA 1T8RA 1EBFA 2DFTA 1LH0A 1HLGA 3P52A 3IA2A 1KPHA 5BV2P 1W5EA 1CY6A 2P67A 1SKYB 3N2GA 3PI7A 3NQ41 1V3UA 4D2IA 4XCQA 1ZHHA 4HN4B 1MB9A 1YMVA 2DECA 2E4AA 1NLMA 2TYSB 4D9MA 3K6SB 2XVYA 4G84A 5C5DA 1NUUA 4QVKA 3WJ1A 4YYZA 1GSAA 5TF0A 1XWWA 5KREA 1FYEA 1KYTA 2YIVX 4DA6A 2XYRA 3AH8A 3IKJA 4JU9A 4YK7A 1O9BA 4MPRA 1ESZA 2W4MA 3V8MA 4R5HA 5IW8A 1EK6A 2PO7A 4BU0A 4PHTA 2DTXA 4HNUA 3PNMA 2OUIA 2XHEA 5TF4A 2XF2A 5EE1A 4OI0A 1RLJA 2EP8A 4W6ZA 7REQB 3JAMA 2C7VA 2HF2A 2X42A 3DTVA 3I2KA 4RK1A 4B47A 4RTMA 1B4DA 3PLNA 1VIMA 2PRSA 1KAQA 1KF0A 2QPOA 1EEHA 3KDSE 3LJKA 3PPIA 1ZLXA 5DOZA 2EKBA 1ZD3A 4OYLA 3WWZA 1XZEA 3LG2A 1QVAA 4C7MA 5K0CA 5LSAA 2LIPA 4WINA 3PRKE 4BWVA 5LQJA 2OA0A 3K9LA 4H17A 2BMWA 4HAZA 1FLAA 5KOHB 4ARCA 4YUXA 2HJ9A 2ZJ6A 3K72B 1Z07A 4FN5A 5JVDB 1M1UA 1WD5A 2QL5A 3PSAA 2RHDA 1ZM4A 3FOCA 2HQRA 3O91A 1QE3A 4MW0A 2R44A 4IV0A 3V6MA 2IYSA 3IBTA 3QTLA 4JX9A 4BO5A 3EUAA 1EVZA 3VI3B 4TT3A 3I8XA 2V6GA 4WKCA 3BCRA 4B33A 3AI1A 1F51E 1VJ5A 2ECFA 3E7WA 1CETA 4G8CA 3LKZA 4A15A 3DE0X 4L22A 3BE4A 2NZVG 3KL4A 4IIDA 2Y9MB 5EP4A 1W1IA 1QAOA 1ZSNA 2CLLB 3ZJ5A 1W4AA 3GN1A 1RPTA 1U0TA 2HK6A 4Q7KA 3SC4A 1ABBA 3C7CB 5B3JC 4MB6A 4Z2YA 3A58B 2P30A 3VOTA 3N70A 3D1JA 4FQ5A 3NNNA 1XRNA 2GAAA 1P0CA 1KDTA 2IHJA 3DZKA 2YDXA 1M2FA 3I6QA 5M29A 4BX8A 2EL7A 3HVIA 3X44A 3IQEA 4P4SA 5AUPB 3ZNNA 3GF4A 3QWAA 3T3GA 2QTVA 2II6A 4L4XA 2XWPA 2FXVA 2QJRA 4NE9A 2NZWA 3AESB 5C3MA 2OE2A 1DC7A 1U0HC 4O59O 4ZYWA 4DM3A 3VR5A 1KIAA 1V71A 4EHNA 1NJSA 4GOMD 3UMVA 3PLRA 1NMSA 3UBMA 1I32A 3TUIC 2ZIXB 5ENDA 1SBQA 2BHTA 4OP2A 1V8OA 2RB4A 2HEGA 1JIVA 1L7DA 2FQWA 3K8ZA 2JLWA 3GL9A 5EI5A 2LXNA 4LOAA 3FJ1A 2V98A 1IBSA 3KBBA 2X6QA 4ND8A 5EWJA 1EP3B 3VH4A 1US8A 1IIBA 4FSDA 4OOEA 1SPXA 4KPUA 1KZ1A 1M7GA 3IUJA 4TWBA 3RRXA 2FCRA 4MWCA 3DHVA 5DLPA 5EWMB 1TQ2A 3TTVA 4DZRA 1TTTA 1U31A 4EHLA 4BRWA 4HNAA 4AYXA 1RXUA 2COKA 3G3EA 3NZEA 4OHMA 2IS6A 1NQTA 1SVSA 5FJIA 1MABB 4YBRA 5JECA 3VR3A 5GVRA 6ADHA 3QLVA 4QU9A 1WZEA 4NCKA 5K3CA 1W25A 2C4HA 5JLJA 4ARUA 2A9VA 4QXMA 1GY8A 3ENQA 2YUTA 1AD2A 4MHOA 1GFWA 1VJRA 3NGLA 3AR8A 3LWDA 4P4UA 1NMEA 2Q2WA 3BIJA 3MVEA 2DHEA 4KQXA 1PFVA 4JVNA 3LM8A 4CIBA 2ONKA 3U40A 4ZO8A 1T3TA 3GQBA 3L8CA 3QU9A 3TIIA 3RIMA 1U04A 2APJA 4YRBA 1YAJA 2R60A 2ONZA 1U65A 4LYAA 4YRRA 1A9ZA 4IDHA 3T38A 3EGWA 4J2TA 3DMTC 4S1PA 4UM7A 4PE5B 5JYCA 2UUBB 2TS1A 2DUUA 4NBRA 4R71A 2PLNA 2ODNA 1QC5A 4ECEA 3N2EA 1F0NA 3DF7A 1XOIA 3LBHA 4N3BA 1SWWA 4IIXA 1CQZA 4ER0A 3HCCA 5DNCA 4C5AA 3UT6A 4EYQA 3GMTA 3SXUB 2Q6IA 3CR7A 4Z9YA 3JVVA 3VDMA 5AOVA 3KX2A 1PU2A 1Y9ZA 1BW9B 3MUNA 3OQIA 3PGA1 2DX7A 3FYUA 4N39A 4QPNA 3A1DA 4RZ3A 1C1YA 1YRLA 3D4LA 3VYTB 1I4TD 3L0ZA 3OOHA 4Y1RA 4FCVA 2NXCA 3IXMA 3X1WA 3IUEA 1WDTA 4PLGA 4Y9TA 1I4WA 1JR4A 5K8IA 4RTRA 5F7ZA 2YWXA 2Q28A 4S24A 3HN7A 1BGVA 2WIBA 4OQFA 1HO3A 5ER9A 2NPFA 3JQ9A 4JC8A 4QYWA 2GJ4A 3ZUPA 3R6LA 1OGIA 1Q7BA 2W2NA 4Q5IA 4RE5A 1XUOA 1BN6A 5DWQA 1MHTA 3JARB 4ZZIA 1WW3A 4LJRA 4RACA 1NHWA 1SJ9A 1I8TA 3T0GA 2ZIWB 1U3WA 2E1PA 4B6GA 3PQEA 3CRMA 4GMKA 2Y1WA 4UHJA 2JD1A 1GPKA 3TAHA 4EUNA 2H5IA 3FSJX 2IXBA 1L8XA 2RSLA 1P7WA 3CLSD 5TARA 4F1KA 4W8HA 3F4BA 4BLTA 3I4FA 3PD1A 5JD3A 3CUWA 3OT4A 1SC6A 4GPBA 4YWJA 1Z4NA 3OWOA 3QG5A 4EW1A 4ZDIA 1OZAA 2WU3A 3E70C 3EDQA 3O3NB 5BSFA 2GF2A 2E4YA 4KQCA 5THQA 3BGSA 2P5UA 4WK0B 2J6CA 3I12A 1Z06A 2P9BA 5DHSA 1HMPA 3E2MA 4QGHA 4I1UA 1S01A 3LPCA 1WPGA 3LWZA 2AN3A 4BAZA 5MF6A 3DE6X 3KYCB 2ZR9A 1B1CA 1A4RA 2Y1CA 4HS4A 5EJ6A 1G17A 1KYZA 3PYXA 3NATA 1AF7A 2NUAA 4MV8A 3ANMA 1BAPA 1TJYA 1GG2A 3UVEA 4I46A 4MQEB 5HJEA 1QGOA 2I66A 4ILEA 1N75A 4QPCA 3H18A 1VB3A 3I2GA 1SQ6A 3ZIAA 4K9DA 1P1BA 3DZIA 1LW6E 2AK2A 1GQYA 5JYDA 4N0EA 1FC0A 4FEYA 2IOHA 1MJFA 2VT2A 2ZYIA 4LJSA 1LX6A 1V96A 3DEJA 5CEEA 3GJ8A 4YN3A 2QDKA 2Y3IA 1E7SA 1C0EA 1E2DA 4KVFA 4CCSA 4KR7A 5IT0A 3KT0A 5CVJA 2QNIA 4I3FA 3AW8A 3K2EA 3COWA 4KBFA 4BMYA 3KVVA 4UJ5A 1O95C 3A9TA 3EAQA 3C8ZA 1X8JA 2PRJA 1GT91 5DHPA 3PQCA 4QYTA 2OXIA 4YXWD 1FLNA 3KXPA 5A4IS 1XTRA 1CFJA 4D79A 1HEIA 3DVAB 2YRXA 4LNUA 5EHGA 4YT8A 1E1QD 1SC4A 2ZDQA 5FYQA 3WFIA 2OBMA 4AFNA 1NN0A 1XLTC 4W5HA 3ELDA 3LC0A 1RYFA 4YCBA 3SSOA 2HO4A 3AF3A 4BFZA 4ZDWA 3SG0A 2P6NA 2GILA 1RHJA 4LW8A 4AO8A 4HNRA 1H1DA 2XQJA 2P9YA 4ZOEA 2VIIA 3B78A 1RJDA 3W6OA 4UZEA 1HV8A 1UK6A 4MYCA 5EJ8A 5HJ5A 3NDJA 3RLIA 2OR3A 3BIFA 2W6OA 3CGWA 4Q4LA 1QKIA 5KJ6A 1KI6A 3ZW8A 3ZU5A 4FEAA 1ZGHA 3ZCUA 3L8YA 3OHMA 1F48A 2FFAA 4IHQA 1T1SA 3SICE 1PQUA 5I4KA 4ESVA 3GN2A 4WKBA 3SHOA 1R10A 5A4KA 5HX7A 3EXEB 3ZE6A 2QW8A 4ZQGA 5GONA 4F4CA 5LZ4A 1KK0A 3AIOA 2AUTA 2NYVA 3BMNB 3DEKA 3MRXA 3H17A 1MIHA 3BF7A 3U60B 1MVOA 2HL6A 3IDQA 4ZPXA 4KOAA 4MV5A 3AESA 3IVGA 4O0MA 3ACDA 4WD3A 1J1IA 4A8JC 1I30A 4PPNA 3GH1A 4Y6LA 1UZMA 4CUKA 5IKPA 4Y9UA 2MSCB 2IPOA 2SCUB 2YWJA 3JQAA 4J43A 4OHBA 2HJGA 5IC5A 1XEXA 2Q2QA 1U94A 1IY0A 3RG8A 2V8OA 1DE0A 1QGUB 3AHHA 1CUFA 1MAHA 2H11A 2GPNA 4RPHA 2ZTVA 4AQ7A 2YJNA 4O3MA 1SKUA 1GPBA 2HTEA 4NPAA 3HJCA 5DP2A 5AI9A 4TSKA 5JAIA 3TZ6A 1BRMA 3RTEA 1HE8B 4J0FA 1ADFA 3GJZA 4WDQA 3D59A 3BA1A 1ULTA 4MR7A 5FLKA 4W7HA 5A06A 1EDOA 1X80B 4O29A 4MJ7A 5C9ZA 3LXXA 4DQ0A 5TE9A 3SZOA 2HO5A 5L7YA 4MWBA 1LLFA 1MGOA 2WF7A 2G4LA 3QM1A 3PBKA 4MLCA 1G4AE 1QQ7A 4JQZA 1F2TB 2C04A 5KNBA 1UQUA 2LTAA 2V59A 3GCXA 4BEWA 3QLEA 4C4PA 3TLMA 3AEKA 5T4BA 4F96A 4EKEA 4YP9A 2IBTA 2CLMB 2G88A 2VJMB 5ALKA 4EHHA 1KO1A 1CQIB 2ZWIA 4M9XA 3NHLA 4JZYA 4D81A 1XTUA 5FORA 2FFHA 3V4VB 2B92A 3DNFA 4UM9D 2O7SA 1XRRA 1NNSA 2PT5A 3M4JA 4EKNB 3G17A 3H0CA 2RHCA 2LGJA 2IYYA 1KFBB 4EJMA 3JVIA 3VFDA 1VFNA 1YJAA 5FO1A 5E4FA 4AP6A 3MHTA 3C7AA 5JJBA 4ZCRA 3ZKWA 4UTPA 2DM6A 2JVIA 1PHPA 1R4ZA 1Y48E 3R74A 3AHJA 3B6KA 5CTAA 2QTMA 4YRTA 3MYRA 4BFXA 3ETHA 3MJHA 3ND7A 2FGKA 3VVBA 3ACCA 3PUVA 1R27A 2RKWA 3NFYA 4JJAA 3GNSA 3RU2A 3SQDA 1BW9A 1JEQB 5AJZA 4ZOLB 3ZG6A 2MYNA 1QVWA 3JYPA 5A2QA 5L3QB 2XKKA 3WLJA 1ZL0A 2QTRA 3MJFA 4CWAA 4ZHQF 4PZ9A 4GRAA 1ZLYA 5C80A 3U3DA 4IIBA 4JKYA 2NPOA 1UZAA 3EZ2A 2W58A 3LHIA 1WDKA 1K4MA 4ALKA 1ZINA 5CDSA 2RHHA 4HZUA 1IL0A 2W8BB 5AESA 4N8EA 5AIBA 1CUHA 3H5TA 2Q5JA 4ZO6A 4DMHA 3AVPA 3GCWA 1FIUA 3U9LA 3DP7A 3C0KA 2F3QA 4KC0A 5L3VA 6AT1A 1R4MA 3MYYA 4H60A 5CDUA 3RWOA 1MQAA 2WIJA 1TOAA 1SUWA 3NKVA 4GQIA 1YO6A 4U63A 2MINB 3C15C 4V03A 5CLIA 5AP9A 5C5IA 1IQ0A 5LL6P 1USIA 3ND9A 5L6MB 1LGYA 1X15A 2ZCJA 4W7SA 1OD6A 3FHJA 5EINA 1RM3A 2IP1A 1ES9A 1IY8A 1UMBB 2C98A 1R6AA 4LSZA 4XW2A 2VTEA 3C5WP 5DSTA 3GUUA 3CRRA 3OZXA 1XXLA 2QROA 3CW9A 3HLTA 4MUHA 4PYMA 4EYKA 1BKDR 1E2QA 5TIIA 5E9WA 4MICA 2NTVA 5JSHA 3RYCB 1NSFA 5T8KA 5SYMA 2QL6A 3HZRA 4AP9A 4R7ZA 4KN5A 3WHPA 4FFWA 5IKEA 2I4IA 2G71A 2ISQA 4R5MA 4P33A 5FTJA 2J59A 1QVVA 1SUEA 5DIZA 3W4KA 3KYCA 3TRIA 2YOFA 2HY7A 1Q2XA 2RHWA 3DXZA 1T2DA 2NWQA 1CR4A 1YMUA 4WY8A 5DTEA 2Z5GA 3SEQA 4EA7A 4DIEA 2WFLB 4CLOB 1BQ3A 1OW3B 4UTOA 2O06A 5BSGA 3GHHA 4F5ZA 3U7RA 1T43A 1X7GA 3BIXA 5TMPA 4GMXA 4FE4A 2W2PA 3IHLA 5FYDA 2UZ4A 1J90A 4NJMB 4QULA 1FL9A 3ML1A 2O59A 5GP1A 1B7GO 1DARA 2H59A 3BMOA 1V45E 2BE9A 4C1BA 3GVPA 2G0NA 1BZYA 1MTZA 3Q1KA 5B53A 3ZWPA 2LBPA 1K4YA 2DKFA 2FCAA 3LS2A 3AWDA 4NYMQ 1QGDA 1E1KA 4OA8A 3HDGA 2NU6B 3P9YA 1HM5A 5F76A 3WZLA 2JFOA 2VKQA 3QEMB 3HBMA 3Q1LA 4OQLA 1PFGA 4E1BA 4EMBA 3BEOA 1JF8A 3OICA 1VIDA 2GHTA 2W2LD 4Q03A 4DLBA 2Z9CA 4MW5A 5KU7A 2OV4A 3JTMA 2QZZA 1TEZA 4RPLA 2AXQA 2XUPA 3HY4A 5F7OA 2Y9PB 1E2KA 3HUTA 3NP7A 1UEXC 2OOKA 3UJDA 3FWZA 5TV2A 2COEA 4PO8A 1L3CA 5CVCA 3UZUA 1TCAA 3M0EA 3PK0A 4M3NA 2PKCA 5FTMA 3L7NA 3PA8A 5DCLA 5K3SA 4EJ0A 1KAMA 3E7FA 3DV0B 3R5HA 4F8JA 3SBXA 5HOQA 1W36C 2X86A 5I3CA 2OWEA 1VHTA 4YP7A 3B7GA 1JH9A 2DF8A 1T0PA 3JTEA 2YV3A 4FW8A 2FPPA 3DLTA 4X90A 3RYTC 1E2GA 4IF4A 3ANNA 1UBNA 4X24A 2PUGA 1O95D 1O4VA 4PG4A 4Q4DA 1G8GA 2B8EA 4L28A 4CKBB 3WTCA 3IFSA 1MB3A 3EXEA 3ORSA 2XGSA 3PQ8A 2RC5A 1I9GA 3N7TA 4HEA1 3ZWVA 4AWXA 1RACA 1E89A 3OI7A 1PJTA 5G02A 2C9MA 1K92A 4LJ6A 1IPEA 2A5LA 1I2DA 2QI9C 3JQFA 4H18A 3L8ZA 1W5SA 4IUDS 1A97A 1TAGA 5IAEA 1JSCA 1CB0A 4CNQA 1U0BB 3MMPA 4KRFA 3JQRA 2WD7A 1W85B 3JYQA 3VU8A 2JHCA 3BFVA 1XU9A 4IDOA 3LPNA 4OYRA 4TXHA 3C3BA 2BSXA 4YRQA 1AKUA 1NXPA 2GCOB 2GPTA 4BL5A 4E2YA 4B3SB 3EJWA 1E1LA 1E79A 4I50A 1VJ0A 3KSAC 3OHSX 1T0UA 1T0BA 2QM3A 3HL0A 4MAAA 1E9CA 4M0LA 3L4EA 4L8VA 2GN9A 4DUGA 1Q3HA 1JYSA 1FVHA 4H3VA 4UTZA 4MR8B 9GPBA 4FIZA 2DPGA 2ZT8A 2QR3A 4H1WA 1MO5A 2ONYA 3F49S 5HQ3A 1D2RA 3BWCA 4FX2A 2H2IA 4HPJB 3T0FA 2X40A 5I45A 4OJYA 4X1YB 4E5PA 1R8QA 1DS6A 5KNBH 3RC3A 3HKDB 4K81B 1EX7A 4LJAA 4WOBA 1WKBA 5FXMA 5DW0A 2QXTA 1F2TA 3LGAA 1PNQA 4JU8A 2P0AA 5UKDA 3L1KA 5JAMA 3EGCA 3B48A 3K8OE 2QRHA 3QPDA 3DZFA 5BV7A 3SVTA 4RD1A 3V33A 2D13A 2VJKA 3KOOA 4A36A 3OFNA 1WVIA 5GM1A 1KP9A 1UJCA 2XBUA 1UFRA 2BELA 4CT0A 1GL9B 1YSCA 3N07A 3SOPA 2X9VA 2HLPA 4LZZA 1AX9A 3KTDA 2YJ3A 4JP2A 3PFWO 5EG5A 4ZOCA 4F3CA 2OBBA 3C6XA 3L1IA 4C14A 2RHBA 1KIFA 4W9NA 1UPBA 1YULA 4GZ3A 3I9NA 3ZHOA 4YJHB 1JAZA 3WB0A 4M0FA 1U7XA 1N1DA 1K63A 4BO3A 1RS0A 1JE0A 5HE9A 4NE2A 1D9ZA 4CMEA 4JYZA 1RPZA 3PEVA 1J07A 1OFIA 1KMMA 3P7MA 1YD7A 2P8JA 4H7IA 1I13A 3N3AC 1V1JA 1NF8A 1E1MA 4UDYX 1H3EA 2DR2A 4PSVA 3C48A 2GEFA 1TK9A 1EAYA 1WLYA 2XMDA 2AYYA 3PX3A 3RBXA 2OGSA 1I1NA 1SD5A 4B32A 1UBGA 2W8BA 3HB5X 4X00A 4P3NA 4EUEA 5L7WA 5IAJA 4MVJD 5FQNA 4WA8A 1TU4A 3PFIA 1X1QA 2J7PD 4IEFB 2QR5A 3UXMA 4R1PA 5TXGA 2VHYA 4KN6A 2CHUA 4UXJA 5DX1A 2DYKA 1SMKA 4HYTA 4ZVNA 4EY6A 2B9VA 4MUEA 5JHGB 2G4VA 3H16A 3LXRA 2H1SA 2VJOA 3IIJA 2C2WA 3TLXA 5CMLA 4CMCA 4EGFA 1X9HA 3RAGA 2O2YA 1R12A 1ULHA 3GK3A 3LIIA 3EIOA 1UMBA 4KZKA 4D9GA 1TMYA 3V97A 2NZJA 3CKLA 3OQVA 1RIIA 3FDZB 1DQNA 4RKRA 1CDDA 4HWOA 3I8SA 5ELLA 5EQJB 2B30A 3SM3A 3U4AA 2IV3A 1B14A 2HIMA 1MC4A 5JIBA 1L9XA 5EPEA 5HGJA 2VNSA 2PTHA 3SC2B 3RYCA 1S2OA 3O38A 3FYTA 2DBRA 2ZITA 2Z43A 1XLUA 2PIAA 1JYEA 1YZKA 4H0CA 3THOA 5LYYA 2VXOA 4FFLA 5HFAA 5JDIC 1JMYA 1Q0RA 2W6NA 1BDBA 1KKLA 1JU3A 3PS9A 1EHIA 1J8QA 3F6RA 4GX0A 3M4YA 4BVAA 2PSEA 1VL8A 1LLCA 1VLLA 3SSNA 4Q01A 5FUVA 3RYHA 1UWCA 2JLUA 2VT7A 3IALA 1MXFA 1N2CE 2Z3VA 4TYNA 5EVJA 4REOA 4UNQA 1XEFA 2XECA 4LBYA 3D8TA 4AF7A 3F1KA 2VAXA 4U6QA 1Z6YA 2BUCA 2AK3A 2ZQ5A 2DG2A 2QU8A 2QPLA 1X87A 3RIGA 3RF6A 5IYZB 2PG3A 3LWBA 4G0ZA 1H6CA 2ZIUB 5HTOA 1HDXA 4OFBA 2VH5R 1IC6A 3C3KA 2B1IA 2WSIA 1XJQA 3IESA 2K2WA 4PPGA 4XVHA 4BLVA 1WIWA 3FVRA 3H1EA 3DHYA 3TL3A 2L19A 3FTEA 1MQSA 3N2YA 1EE1A 2NU6A 3DG9A 1Q2UA 3AF5A 3F9IA 2HIAA 1L7MA 3PNSA 4BEVA 3RSQA 4DSZA 2P3SA 1LU9A 1FQKA 5CBPA 3N76A 1T9GS 4D5EA 1OLUB 2PLRA 4ZGWA 1K86A 2JIRA 2KM1A 3VYWA 2VWQA 3GP8A 2F4NA 1P5HA 1CUZA 3MJTA 2H7YA 2IYWA 2WWRA 4UAVA 1JXMA 3HGMA 3SS9X 5JD6A 1JSRA 1ZISA 2OFFA 2V97A 3Q3IA 1USVA 4ZU1X 4DBLC 5TS3A 3M9WA 2RHOA 2W4IA 1P8JA 2PFKA 4FCWA 1YZHA 4UHHA 1QO0A 3ETNA 4HC4A 4QJ4A 4EA6A 1P1FA 5JCOC 3WFZA 3M6WA 2G1PA 2GEDA 2NXWA 2P2DA 3UO8B 3U4QA 1K8XB 2AZTA 3EZNA 4J1TA 1M76A 4X71A 1WU7A 1G19A 1PW5A 1S2LA 1Z18A 4GM4A 4J1QA 4KDRA 4OXRA 4RJ2A 3BH7A 2C82A 3H4IA 3PXXA 4ZHQA 5B36A 3D3WA 1V5WA 1V5IA 2YFQA 2PMFA 2RH4A 2XNHA 3IDSA 3O8QB 3UXHA 1RQ7A 2JLVA 4AMUA 1P75A 2DERA 3PQDA 5C3UA 3ZDEA 1FJXA 3VR2D 4I19A 1CQJA 3SFTA 3TYXA 4KXXA 1N3BA 4Q1BA 3TNJA 5EKXA 3BWVA 4ZYYA 2WAMA 3HJRA 4QXQA 3GBVA 1K88A 4CZ2A 1KOJA 4IMRA 3WIVA 2LPMA 4OJKA 2CWDA 4TYYA 4ZIRB 4JLUA 1XTVA 3LUPA 1G9TA 1JWBB 2VDOB 4US2R 1W85A 1JHDA 1WZCA 4H7FA 1HT0A 5BWLA 3TI7A 1W36D 4LG1A 3VA7A 1LPAB 1E6EA 2Z6VA 5JSKA 4C05A 1JVBA 2O54A 2HSJA 1KEKA 2XCIA 1VIAA 2TSYB 4RZXA 1E1CB 1RW4A 2NVOA 2P2YA 5FOTA 4Y2RA 3ZDZB 4C0SA 4DHWA 2QN6A 3IDOA 2EHDA 2P90A 4FFBA 1IIRA 4MR8A 1IN4A 3KT6A 1UDCA 3OPYB 1SRRA 4L15A 3E4DA 1F14A 3PDIB 2JHGA 3NGMA 5FL7D 3N8HA 4G5SA 3MK31 3R5KA 2FPRA 4ZRMA 3F8TA 2JH9A 3KPUA 4J0KA 3W2IA 3BE6A 3HYNA 1PSZA 2GJ9A 3C4JA 3ZD7A 2OD9A 3H75A 5I7UA 3DEZA 1SKAA 3NBKA 4HFJA 3MWJA 4OXNA 4JXXA 3N3BC 4DR1B 1XX6A 3NMUF 1H2YA 3IEXA 1GTMA 1E9RA 1T6XA 1Z7YA 2CNWA 2H2HA 2P7IA 3KZKA 2FA9A 3DBLA 3OTGA 2BBTA 4JLBA 5AOBA 3SIRA 3T7AA 3WHLA 4E5SA 4EPTA 1WA5A 1IWOA 1QOZA 3B70A 3VNBA 1DDGA 4NAVA 4X7PA 1CDZA 5EHQA 1RXWA 2B5OA 2RGXA 3ZV7A 3KT8A 1DC6A 1PGPA 3PL1A 4H6XA 4Z0HO 3T3DA 1KBQA 2G1JA 2WB4A 4PC7A 3EFBA 4U7PB 3HXOA 2J9YB 4OGFA 5T4HA 2FEMA 1J2EA 2IZ6A 1A5TA 1RYZA 5BN3A 1EWQA 4YEDA 1LJUA 1KEPA 1ZN9A 2D7DA 1AIPA 1M74A 1O2DA 3WBKA 1T5OA 3INRA 2HOQA 2G76A 1QIIA 3I2FA 4KSBA 1HYBA 4RWZA 3WY9A 4AMYA 4YGXB 4EPVA 4N48A 4K6CA 2WWWA 3PWSA 1ARZA 1IHPA 2Q1UA 2WSSA 2X8BA 3VHXB 5F1OA 3AM4A 4OK3A 4QM7A 1XZMA 2R751 3IHKA 4L8FA 4LWQA 5IDYA 3WGLA 4IJUA 1K9VF 5BQ3A 4KMOA 3PNLA 1COWA 1Z4QA 3FH0A 2JCGA 4RMJA 4IPTA 4B85A 4BATA 4R2LA 4RV9A 3V46A 2WA2A 3B82A 3H2JA 5LBUA 4D02A 2CYAA 4TTIA 3NHSA 5K3AA 3QQ5A 4HLUC 1F8XA 3LC7O 4ZEMA 1MX3A 4CHGA 4DCSA 5BPHA 5C37A 4F9FA 1ZMRA 1MEJA 2BVNA 3PPYA 1YVEI 2RHMA 3HPQA 3KNZA 4PZZA 1NXXA 4S1OA 3VHLB 3LUCA 3ICPA 3OO1A 4MV7A 3UOWA 4WZAE 3U81A 4E2WA 1OB5A 2ORIA 3TD9A 4G9GA 5EMHA 2WG1A 3WA6A 3UK2A 1J0EA 1PT9A 4NENB 9ATCA 3O7MA 1A4UA 3VJRA 3DTYA 2R00A 4MYTA 5HSGA 4CR8A 4N54A 1GGJA 3AUYA 4EW2A 4PLHA 3HM9A 4L95C 2BEWB 1FTNA 3OLCX 1AHNA 2JFVA 3V3KA 1H85A 1CR0A 1OZFA 2C2MA 4CIDA 1R8SA 4WY2A 3HPRA 1ETUA 2YCBA 2YZNA 3OZAA 3P9KA 3VJMA 1L4MA 1JQJC 2ZWPA 3GLFA 3G6KA 5IP5A 3G8YA 2FWNA 4CEIA 4LRSB 4EFNA 4HWGA 4L08A 3NV7A 4NJOA 5DPMA 1U8CB 4HUTA 3A2LA 1QJ4A 1RC1A 3ZVMA 4M21A 4F6RA 4KIUA 4NZOA 3PDUA 3DR3A 1KYYA 1L6IA 3PIIA 1W4BA 3ZWOA 1HURA 3DZDA 3BBLA 1JEJA 4FJ2A 2WU4A 4LTDA 5TB5A 3R7WB 3WZMA 4B1FA 5CDFE 5CG1A 4BO1A 1D8AA 2P2SA 2Y0CA 3AYXB 2YZ7A 4R2KA 2C2HA 3AR2A 4D44A 2RK3A 4XJXA 4JEIA 3VYSB 5CD9A 3BRWA 4EX6A 3CVJA 2ZETA 3T3HA 5JMPA 1Q15A 1CU1A 4RY8A 2PLWA 1OZGA 1PG2A 1UR5A 4DIFA 1H0HA 2YV1A 3EK2A 4QECA 3THWA 4F97A 4U7FA 5KYUA 3QJ5A 1O8CA 1NXWA 13PKA 2CNDA 2H17A 3RI3A 2AXNA 2YR0A 2L42A 2Z4SA 4WUVA 4XTRA 1NE2A 3EEOA 2Q1TA 5E2AA 1OAAA 2IUUA 3A2KA 2NQ8A 4L4ZA 5ITVA 3CS3A 3FCSB 1G5HA 4MW7A 5AR1A 3KALA 3CRQA 3F6SA 2RI6A 1VI6A 2AQHA 1Z5NA 1G1AA 3OP1A 4CKCB 1PX0A 2AX3A 5LA6F 4AKTA 1UXKA 5BNWA 1DC5A 1V8FA 1E4YA 1P80A 3HSYA 1NLUA 2C57A 2F3RA 4ZHSA 2I2WA 3QA9A 4P7JA 1J97A 4G23A 3D4OA 3E18A 1EFHA 4MVJM 2R9VA 3PUJA 1U80A 4KQGA 2DCUA 1OLUA 4UCWA 1NV9A 4JQSA 5FUWA 3LX5A 3ZCPA 4H4CA 2AKAB 3TTUA 4HADA 1Z2OX 3N2NA 3U3ZA 1WQ1R 3OH8A 4HX5A 1QIKA 4FCTA 2IS2A 4OQDA 3G2NA 4WZBE 4BB5A 1G18A 1GV0A 1M1XB 2ILTA 3NB0A 3DD5A 5IEJA 5MN5A 4OHVA 5A02A 4D8YA 2UZ1B 1N7JA 3DHEA 3NM6B 2BHSA 2GBLC 4KEAA 3FOAA 4D0GA 1RP7A 3T5MA 4TN1A 2FSGA 2C2YA 3K9FC 3FCXA 3NRJA 4GLOA 5G4LA 4CCYB 2R48A 3T7JA 2QZSA 1M6HA 3ZY4A 4X20A 4MDFA 3KKPA 4GMGA 4PGAA 1KO8A 2V7UA 4E2FA 4Q6WA 3BSWA 1Q92A 3PF9A 4NRDA 3SPXA 7GPBA 3FMFA 4FYIA 3VPDA 3G0GA 1N78A 1GGHA 1Q17A 3BSSA 2IHKA 3DCJA 4KMSA 3L5OA 1D8TA 5GADl 4LXYA 2XH8A 3OCVA 3GLGE 5A9TA 5I7OA 1G6HA 1RZVA 1Y8CA 2XOEA 4TSRA 5B55A 1DZIA 4PHHA 1W8IA 3TE7A 3BMQA 4R8RA 1X7ZB 4C7VA 2PZMA 1OYVA 2XQGA 5JJLA 1NYLA 2G1AA 4XR9A 4G6ZA 3V8BA 1EK5A 2G17A 4FFRA 3M5WA 2PV0A 4C2UA 3CURA 1VSBA 3EG5A 3A4IA 4H7EA 5ARBA 2VQFB 5DE3A 2FRDA 4JQOA 2GERA 3EMVA 3IOBA 4QGFA 1MZVA 1Z4LA 2JVKA 3PGMA 1WPQA 3BZUA 3BCUA 3TMYA 1E1CA 5CCBA 5SZIA 3A4LA 4FTWA 2CB0A 2FYTA 2JDIA 3A9VA 4O4IF 2OXTA 3OF5A 3OPYA 1KMNA 1SRQA 5DSXA 4LYEA 4POAA 3S8EA 1VFPA 4QNRA 2BEUB 3GO4A 1NVDA 1EB8A 3IBGA 3SU8A 2ZYGA 4MV1A 1PTJA 1V16A 3K5PA 3H3JA 3M6AA 3MTQA 1NBAA 5JBNA 5DM2A 3TQCA 2L0XA 1Y4DE 3KE8A 4D41A 2QL9A 2WJVA 4KXYA 1RKVA 4EG3A 4H2DA 3VR4H 3OM8A 4DE5A 4UE3S 4MI9A 3SIPA 3FG9A 3S8YA 4S1WA 1CUXA 1GA6A 4E46A 3MWKA 3VKGA 1ENYA 4PNEA 4AZ0A 3PITA 4RDHA 3ZZMA 2GBIA 3L4KA 2YJZA 4PYRA 2A0YA 2G80A 2YW2A 4RD4A 4MGHA 4J9UE 5DWDA 1HH4A 2JJ1D 1IY1A 1F8FA 1KMHB 2E4XA 2FSFA 2GZRA 3CCCA 5DTQA 5L6LB 4RKFA 3A6DA 1CUEA 1U1FA 4M1MA 2G70A 3LBAA 3PD7A 4JS0A 2PUBA 4LRTB 3WGKA 1P4RA 2ZSBA 3DZCA 4MYRA 3FB4A 4EEKA 3DGFC 4E0BA 1QB8A 5DNWA 2ORWA 2UYCA 1XZFA 3RUFA 4CV2A 3G2PA 4ZXFA 5JZ9A 2LE0A 4B5LA 3U44B 1DFIA 1UDAA 1W88B 4IIYA 3ZDYB 3LA6A 2ZQZA 4W1PA 1USUA 1VE9A 1WVGA 5LA6B 3CKKA 1HZZA 2B1GA 1XXHB 3TJRA 1S2MA 2HQ1A 4NBUA 5B7NA 4MRSA 3VAYA 3AV3A 4DWVA 1IM2A 3JQ6A 3P9PA 3KQLA 2X4GA 1E3WB 2OD7A 1XE3A 1HK7A 2AQ8A 3EB9A 3L7KA 5FBHA 4EO7A 5KTNA 2CLKB 4OUKX 3LCMA 4PPQA 3ZNOA 4L2IA 1DKPA 2PCLA 3IVMA 5DV9A 3S1SA 2GPJA 4QYMA 2IIBA 1SG6A 4CT4B 1DQRA 1XVUA 1UK8A 1WZUA 3DEAA 3IH5A 4NESA 4NONA 4E5MA 4MCAA 1VMKA 4YLEA 1QHYA 3A1TA 2WTNA 4DAEA 4BJ6A 4FGLA 4Y2TA 1ZIXA 5FWNA 3TVTA 3LT4A 1SOWA 1XZ8A 2HFJA 4IUCS 4UVEA 2IYAA 1A98A 2E9SA 4XWKA 3SBEA 4ITVA 3OLYA 2FR1A 5CK4A 3TB6A 5ICMA 3ANYB 2WF8A 1F0PA 2N1BA 4GFDA 1JSXA 2VOJA 5JALA 2IVZA 1XT6A 2Z2XA 1LD3A 4FFDA 4WZAA 1OI2A 1C4WA 3RUCA 1XCJA 3DT6A 4S1NA 4JASB 2I4RA 1GL7A 5AKXA 2D2EA 2QUZA 5C34B 1ZW1A 3CMCO 4X65B 1OXTA 4TM8A 1BTOA 2R7KA 3IPXA 5IDQA 2CFIA 1J2TA 3KVOA 2E2WA 3LQQA 2PKRA 1Y3IA 1ZX1A 4M36A 4Q37A 4B81A 2RGAA 4V0RA 4TN5A 4BN0A 4NV0A 1JQLB 4G5XA 3PPXA 1MAUA 5EJ2A 3ZK8A 2QRNA 5J2TB 3R7WA 3T52A 1Y1RA 2AI3A 1JUDA 4K9QA 1G7TA 5IJXA 3VKHA 5EMMA 5TQ0B 2YMLA 3VUFA 2GK7A 2JEYA 4DDVA 3CUVA 3S2ZA 2P40A 3SJ7A 3VO9A 5CNIA 4MO9A 1BIFA 4MMZB 3SVLA 2H5LA 4D8WA 121PA 3P2IA 5DGTA 2VWPA 4G0VA 2Q8PA 4LEIA 1E1RA 2H0QA 5CDFA 5LQDA 1FJ2A 5BO5A 2G36A 3DCYA 2D8MA 3JY6A 3NNDA 1WTAA 4HZIA 3BRSA 1WPRA 3K9BA 1X6VA 4M9UA 4RJJA 1G20B 1MT3A 3RYFA 4Q82A 4P93A 2H4YA 3Q7IA 4F6LA 4LBWA 4Z0PA 4YT4A 4MPJA 1ADGA 1KQPA 1TCUA 2FOLA 3ENZA 4XFKA 5IDVA 5H83A 2B8WA 5LC1A 1JHXA 3GAAA 5BT8A 4RA6A 5J4VA 3CW8X 2IU4A 2IYNA 3KLNA 5JNSA 2IZZA 4CKCA 1L4KA 4MLZA 1CZRA 3CEAA 3DDZX 1EFPA 5ALGA 3T61A 5K7SA 2RGUA 3KSRA 3TAUA 3ZCTA 4GECA 1H2BA 4M0PA 3RS9A 2X7JA 4R0MA 3MILA 4J7AA 5D51S 3KCQA 1ZK2A 1JBQA 5DLEA 1YQEA 1N3LA 1ADJA 3RTAA 4LRQA 3SD7A 1ZH0A 1BCSB 3H1FA 3JQBC 1ZS9A 2FJUA 3ACBA 2JEOA 3LDUA 4IWYA 1HQCA 1NWCA 4GQBA 4M0CA 4MRAA 5GIPE 2NTYC 1NVTA 3HYLA 4AD8A 4U7TB 4ROSA 3OFKA 1A2OA 3UJ6A 3T5DA 4E2ZA 4ISCA 2NSLA 4L85A 4MUYA 1CY7A 4HMPA 5MFZA 2Q3EA 1T24A 1LLUA 2HCTA 2VZ8A 5HE8A 2YWFA 1SIUA 1KI4A 4PYLA 3RRNA 2H85A 3MPOA 2IH2A 4WZBA 1H22A 1ZFNA 4BX2A 4C7BA 4DA7A 3EASA 3DZBA 3M81A 4IIJF 3WI7A 3LVFO 4BTLA 3K32A 4MRNA 3K09A 4QICA 2GYVA 1XRSB 2F1RA 2Q3CA 3CH7A 4KYVA 5FOWA 4PZCA 2AFIB 5IJ0A 1G9SA 1SURA 1TA9A 4P2BA 1SOMA 2FSSA 3ROEA 2F1OA 2K7FA 4X94A 4LOHA 4AS3A 1V25A 2BDEA 3Q88A 3TNDA 1TPYA 1NUSA 4LIPD 1JECA 2PAFA 4PX2A 1EP1B 2OKCA 4ZJUA 1HSZA 3KZ1E 2W6PA 4MB0A 2FR8A 1TXGA 3HJUA