4D7AA

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda, in complex with amp at 1.801 angstroem resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
243
Chain Sequence
SVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPGFGAATMVTATFGFVAVSHALKKMMAKAARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords TRNA THREONYLCARBAMOYLADENOSINE DEHYDRATASE
publication title The Crystal Structure and Small-Angle X-Ray Analysis of Csdl/Tcda Reveal a New tRNA Binding Motif in the Moeb/E1 Superfamily.
pubmed doi rcsb
source organism Escherichia coli
total genus 83
structure length 243
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d7aA00
1DAPA 3PWZA 3U62A 5K9ZA 4YEDA 1BVUA 2FR8A 4KZPA 1RM0A 4MVJG 4CM9D 4ID9A 1K6XA 1KVUA 3A14A 5G0VA 2HK8A 3TOZA 1HRDA 4BV9A 1LSOA 3H5RA 1SB8A 4R51A 1TLTA 4J2HA 2AE1A 5C7LO 3SVTA 5I7FA 4HKTA 3TSCA 5TX7A 1P1FA 2FR0A 1UXIA 4L4SA 4RPKA 5HBRA 3H9EO 2QRKA 1W4ZA 1NR1A 4OH1A 2WTBA 4RLHA 1NAHA 3AOEC 5A05A 3OSUA 1ADFA 3GVHA 1LEHA 3I52A 4BMNA 3RASA 3WJAA 2FHSA 4O63O 1NFFA 4XYLA 5F3RA 4WLUA 3I9NA 3QVTA 4FGWA 2F00A 3NAQA 1PQUA 3FCOA 3RAJA 2E48A 3OP4A 5K6AA 1YONA 1ZFNA 3G3EA 2XF8A 2ZKLA 2DBQA 4Y6RA 4DQXA 1IOLA 4EYEA 4YRDA 4P4NA 1DIHA 1N92A 1OOEA 1LRKA 5FEUA 3LLSA 4J43A 1EBFA 1M76A 3DMYA 1FF9A 2Q1WA 4NBUA 4BNHA 2JCVA 4B3IA 3D64A 2PV7A 2VWGA 2I76A 3PWKA 4RVFA 5GZ6A 2ET6A 2DM6A 3TRIA 3AY6A 2Q49A 4ZN6A 1E7YA 1T26A 4YCAA 4FFRA 2EJWA 2X5OA 5G0WA 1E3IA 1DLJA 5AQ1A 1S6YA 1UXJA 2DUUA 4OQYA 2POQX 4PFJA 5BSGA 5JBIA 2RHRA 2VTEA 3I5MA 5KJEA 2BF7A 3JYQA 2AXQA 4NK4A 4FC7A 3OQ6A 3F5SA 5L45A 5FWNA 2IZ1A 1E1KA 1IPEA 3GNTA 3H4VA 1B8UA 1LJ8A 1HTBA 4K26A 2HJSA 2AQKA 5BQFA 4EZBA 2NTVA 4II2A 2NVUA 1DHRA 3I3OA 4FC6A 1A4UA 3AM4A 5A9RA 4PZEA 1F06A 3E8XA 4KWIA 3BMOA 2AE2A 1DXYA 5EQFA 1XELA 1PGQA 1ISHA 4GBJA 4GKBA 4XGNA 3AU8A 4BGIA 2BGLA 4B3HA 3L6DA 5I9MA 3OH8A 2CZCA 1E3WB 4N5NA 4WCFB 1C0LA 4XKJA 1QLJA 3MTJA 3B70A 5ILGA 1LLCA 3HHPA 3EC7A 1GYRA 4ROSA 1QKIA 1ZSNA 3DHNA 4BO5A 4IUYA 2PZLA 4EDFA 4Z3DA 3TN7A 4ZQGA 1JU9A 3JQGA 3RBZA 1PIWA 1R4MA 4CJXA 2OBYA 2B0JA 5IXSA 4LMPA 1QORA 5A1TA 3QSGA 4YAGA 1H2BA 4JXKA 4WEOA 3PPIA 4DTIA 4E6PA 3IC5A 1AE1A 1RPNA 2O23A 3LVFO 5EINA 2PNFA 4GLLA 2OUIA 1YE3A 3DFUA 4UAGA 3U4DA 1KEUA 1PGNA 3BA1A 4L9RA 3RC7A 5C5IA 3OIGA 1DC4A 4TKLA 4U6SA 1V6AA 4BQPA 4QT0A 1VKNA 3KUXA 4CM4B 1SOVA 4BV8A 4BO9A 1LBEA 3DZJA 2RBEA 2GNAA 1CEQA 5TS3A 1E7RA 2WYVA 5L9AA 1MXHA 3GY0A 1S7CA 2EJVA 2PFGA 3JQAB 1UXGA 4ND3A 5G0UA 4Q39A 5H83A 4GVXA 3F3SA 3FPCA 1QV6A 1PJCA 1JAXA 3KSUA 3HJAA 4BKRA 4I5FA 1Y8QA 1EFKA 4RVHA 3DQPA 5G4KB 1LX6A 4PLHA 1FJHA 2PD4A 2P9CA 5JLAA 2C5AA 4XGKA 3RUIA 4H15A 3ASVA 1AXEA 1H9BA 1ZXLA 4IQGA 3NDIA 4I5DA 4LK3A 4URFA 2NQ8A 3GK3A 4NJMA 2CD9A 2D0IA 4MKRA 5T57A 5JYEA 1U5AA 2VYNA 3PRJA 4GMFA 1HEUA 4XIYA 1B3RA 3OEWA 4FBGA 2J3KA 5DN9A 1Q1NA 3ZGYA 3KSZO 5K6AC 4ZRNA 3EDMA 1WNTA 3QP9A 2Y1GA 3WLFA 1YJ8A 2Q1UA 3VZQA 4DYVA 1X7GA 1B16A 1K2WA 2DLDA 2BMAA 2Q2QA 3R6DA 3NDRA 3JQ7A 3RFVA 1RWBA 3HFGA 5DT9A 5T6BA 4CQMA 1O95A 2I3GA 5TNXA 1I2BA 2D4AA 1UDAA 1ZMTA 4KDFA 5FFFA 5TGDA 1MC4A 2Q45A 4TZTA 4WCFC 4ALIA 5AXCA 4BO3A 4M55A 5JPIA 5B4UA 1XQ6A 3WSVA 3AK4A 4B3JA 2EW2A 3STHA 4MVJE 1AN9A 4D42A 2VWHA 2FPIA 3KLMX 4AJNA 1E3JA 4U5QA 5C7OO 1MFPA 3QW2A 4TMFA 4UEOA 5CG2A 1Y6JA 4NU5A 2BD0A 2IODA 2BH9A 2PH3A 4Z0HO 1BXGA 1KC3A 3G1TA 2FRDA 1I36A 2UAGA 2FZEA 3MWEB 2Y1OA 1GCOA 1B14A 2B5VA 3VH4A 4CMBA 4B4UA 4H16A 4CMCA 4BOYA 5A5FA 3DBRA 3MJSA 1U9JA 1A5ZA 3VKUA 4CV2A 5BT9A 1GV0A 3PI7A 2PA3A 2ZJ0A 5HA5A 5KJFA 3S2GA 1A9ZA 2VHVA 5CPBA 3W8EA 3FD8A 2EKQA 1MC5A 2O48X 4B4VA 5I9LA 2HQ1A 2P5YA 4RDHA 3LQFA 4F6LA 3KXDA 4G81A 3TZCA 1YQGA 3ADPA 4D46A 4BKQA 3PXXA 2VWPA 1P77A 1H6BA 2FPGA 2V6GA 3I23A 5C37A 4OQZA 4AL4A 2YFHA 1E1MA 1L7EA 3G49A 4D0SA 3ZW9A 1H6CA 2E49A 2VHXA 1LRLA 1V3UA 3TZKA 2C2XA 1ZXBA 2H5LA 3JQ9A 4XCVA 4MDHA 1HKUA 3ZHXA 5HTOA 3O26A 1MX3A 1YB4A 4YT5A 3H3JA 3UUWA 5B4TA 2P9GA 4CM3A 4AJKA 4CM6A 1HZZA 5ADHA 5U9CA 4GX2A 3MJVA 3C1OA 1GEEA 1DC5A 2ZTLA 5F1PA 1PJ4A 1HLPA 4UVDA 1EK6A 2B4RO 4LVUA 2AG8A 1PZFA 4PVCA 3DHYA 5ES3A 3LC1O 1ISJA 4MOWA 1KETA 3MCVA 5EIOA 3GG2A 4D43A 1OC2A 2UDPA 1NFRA 3CPSA 4XRGA 2DPHA 2AG5A 3VVCA 3GDFA 1R37A 4BMVA 4FW8A 1PWZA 1WAMA 4G5HA 4K9DA 1D8AA 3PJFA 1E77A 3ZH2A 4AJEA 3C7CB 3C24A 3KEOA 3OJ0A 4GGPA 4IQ0A 4L73A 5DOVA 1I5RA 3RC2A 2E82A 1I33A 1W0CA 3HN2A 1YGYA 4ESOA 3ULKA 2BI8A 1ADGA 3VPGA 4IJUA 2Y99A 4A27A 1B3BA 4E3ZA 1E0DA 4NH4A 3WB9A 1T2DA 5L7TA 4Y6PA 3QRWA 1VRWA 3HUDA 4J7UA 1PS0A 1ZSYA 4BO7A 4YA6A 2DUWA 5IN4A 4ALJA 3G1UA 3A4VA 1X0XA 1KEVA 3ETDA 1XCBA 1R15A 2FPPA 3D3EA 1ZKMA 3AI3A 2QYTA 5KWEA 4LRSB 3E6AA 3GF4A 4GQAA 1P3DA 2QG4A 4G65A 2DTEA 1NM5A 4CV0A 3EMKA 2J5KA 2PD3A 4ZQEA 4NPCA 5KTKA 3U9LA 3H9UA 1JLLA 3E5MA 1VL0A 1GUZA 1OBFO 4CQLB 2NU8A 3GVXA 3TOXA 5T64A 2GLXA 4BNGA 1C0IA 4ALLA 1P0FA 2NNLD 3PYMA 4KUEA 1P1JA 5AOVA 5JAQA 3LF1A 4JJIA 4EEXA 3HE3A 2YYYA 4AJLA 5ER6A 2YV1A 3WX0A 4E5NA 4FB5A 1MV8A 3VZRA 2OXIA 3E9NA 3OA0A 1E6EA 4RPLA 5JC1A 1BGVA 3LDHA 5TT0A 3H65A 3AUTA 3RFXA 3RIHA 2YJZA 4DUPA 4NBTA 1ZBQA 4DIFA 3ZV3A 2V6BA 5IAAA 4Y98A 1B2LA 3DEYX 2AEMA 3GEMA 2B69A 1GADO 1T2EA 1OFGA 5IDYA 3F1LA 3DOJA 3PWSA 4Y6SA 2PKRA 4KTTE 1XLTA 2EF1A 2VZ0A 2YV3A 4XJTA 1LTHR 1LDEA 1CIVA 2NVWA 2OO5A 4BGEA 1MG5A 3RSHA 1JVBA 1R4NA 4NHEA 3E5RA 3IAHA 3BHMA 3Q11A 4CMIB 4DPLA 3GZNA 4PLFA 4FJ2A 4DC0A 2YDYA 4YYZA 5JW6A 2D59A 2J3IA 3FBGA 1MA0A 4E12A 4WNCA 2PZKA 1D3AA 4AJPA 1VJ1A 4BVAA 2VYVA 2OOSA 2X23A 3JD1A 2WWRA 1GR0A 1UR5A 3GHHA 1ISFA 2O3TA 3BMNA 1N7GA 4GSLA 5B1YA 3F6YA 1R6DA 2YUTA 2UUPA 5DCUA 3OMLA 2X9NA 3ZHBA 5EL0A 1Y9AA 5JMWA 4K6CA 4BNZA 3UW3A 4CM8B 5A9TA 3JD3A 4XD2A 1QG6A 2HSDA 2GERA 3PDJA 5JSFA 2HU2A 1CYDA 2W2LA 4FFMA 5L40A 1E3SA 3C3XA 5CP8A 2Q1TA 3SXPA 1WMAA 4HFJA 1V0JA 4U0JA 1J0XO 4BNLA 3WFIA 4FS3A 4PZDA 3ZWNA 2FR1A 1XA0A 5CDUA 2IXAA 3AWDA 2AA3A 3JQ9C 5A4DA 1E1NA 2DKNA 3ZWYA 3PHJA 1B8PA 3EUWA 4W7HA 2LDXA 4RGBA 4BNMA 4D3DA 4OSPA 4R9SA 5TT1A 5G0SA 1LU9A 1R0KA 1CQJA 3RD5A 5A3JA 1AHIA 4QX6A 2VTDA 3ZV6A 3RUHA 3OM9A 3WQRA 1Q0LA 4IQ8A 4AJOA 3AOEA 3JCZA 2EKPA 3ROMA 3H9GA 3TZ6A 4KOAA 1NPYA 3AUSA 1DIRA 3IUPA 5COBA 6LDHA 1UZNA 3TF5A 1UDCA 4WNIA 1ENPA 3CMCO 5DCWA 3FSRA 1Z7EA 2B35A 1JKIA 4YQZA 3UF0A 2JHGA 4HV4A 1TXGA 2OHXA 3HDJA 3BHIA 3IJRA 4NBVA 2X5JO 4QECA 4XR9A 3JQ8A 1HDXA 3IL2A 1DRVA 5A02A 1ONOA 3PK0A 4XQCA 1ZEJA 5DZSA 2C59A 3O38A 1WXDA 1D1SA 3IP3A 3ZI0A 5A9SB 5EQDA 4O6VA 3WSWA 4NQZA 4R4JA 4UUOA 5A04A 5KJCA 3A9WA 1V3TA 4JQCA 3ASUA 1M75A 1NPTO 1PR9A 2OORA 2YHIB 5F21A 3PQEA 3W4KA 4CMHA 4JROA 4HXYA 3PYLA 2GO1A 3C85A 5CDGA 4N7RA 5BNIA 3D3WA 3ZU4A 4IDCA 1GCUA 2Q2WA 3VPFA 2JAPA 4NJOA 2DBRA 5ICMA 1Q2XA 2X86A 5JNLA 4HADA 1BTOA 4R5HA 3KYCA 3ZHZA 3ZCXA 2YW9A 1RM3A 3Q9UA 1X13A 5JS6A 2IEBA 4RV9A 1P1RA 1GZ6A 4HFRA 4N5MA 5DCYA 1CDOA 3IMFA 4HNHA 2VCYA 1GUFA 2IYPA 4JK3A 4UREA 3K9QO 2GN9A 5HS6A 1YRLA 1UP4A 3AI2A 2NU9A 1UP7A 1ZUD1 4YJHB 5C3MA 1I3LA 1LSSA 3IQDB 4Z6KA 2GRAA 1QYXA 1WWKA 4AVYA 3M2TA 3EGOA 2O4CA 4EJ6A 2X0NA 5JFOA 3ICCA 2X0RA 5TQVA 4RJTA 2ZB3A 3WGTA 4L8VA 2VHYA 4WLOA 4PG8A 3LT0A 4ZD6A 3PGJA 4EGFA 1QYVA 3NUGA 2X8LA 3PZBA 2VRBA 4GSKA 5TC4A 1SPXA 1K3TA 1EVIA 1KEWA 2GCGA 1ISGA 3TZHA 2O2YA 1LUAA 2VHWA 2VZ9A 4YR9A 5U1PA 1Q0QA 1UH5A 4WECA 4M87A 4I08A 3SLKA 2CDAA 3HB4X 3UXYA 4CMKA 3INGA 4CMJA 1NWCA 1XGKA 5B12A 1H9AA 1NASA 4C7KA 3KVOA 2IE0A 2FY8A 3WDSA 4ZU3A 3ZWAA 1KS9A 1HE5A 1MFZA 3U49A 4E2YA 1NYTA 3F5QA 4DYDA 5DOZA 5JE8A 3ZU5A 1GY8A 3CIFA 1I2CA 3ZWBA 2I6TA 3LT4A 1NAIA 4R1TA 3RQSA 3P2OA 3W6ZA 3EYWA 1U3VA 4B79A 4GKVA 4YTEA 2CNBA 5GMOA 2EEZA 4TRMA 1HZJA 1BXKA 4IDBA 3HDQA 3DHEA 3S2IA 1G1AA 1H6DA 3WGOA 3ZZNA 3C7DB 3DBLB 1AHHA 1P31A 3KOUA 3DBHB 1XHLA 4IJKA 1SB9A 2O3RA 3MOIA 4NG5A 2A92A 1ONNA 2CDBA 4NFSA 4PLCA 5I8WA 4XA8A 1HDOA 1KEPA 1M6WA 1HSZA 3TFQA 1RJWA 3DL2A 4TRRA 4D44A 4PRLA 4OYRA 5JAIA 1Y81A 2I67A 1H93A 3WIDA 1DFHA 2NSDA 3ONFA 1ZVMA 3K92A 5JCJD 2NQTA 4INAA 4IXWA 1U2GA 3DMTC 4YB8A 3O03A 3DZFA 4FPXA 3JYNA 3NYWA 2NV6A 4IDAA 4CODB 3S2EA 2HMWA 2OFPA 3P2YA 4HFMA 4CL8A 1C1XB 5J23A 2RCYA 3BMQB 3KZVA 1Z74A 3PIIA 3ITKA 4PZCA 4J4BA 4CM1A 3OQBA 5ILOA 2NU7A 4JGBA 3WMWA 4JIGA 3C1AA 2JD0A 1XYGA 3QE3A 3W8DA 1N1GA 1MGOA 5KOIA 2C20A 5EMHA 1YH3A 4PG6A 3M2PA 1E3WA 2WD7B 1SEPA 1YQXA 3A06A 3SLGA 4E5MA 4WCFA 1ZEMA 1Q7CA 1TT5B 1VL6A 4ZQFA 3S55A 4KQWA 4ZJUA 1EVJA 1SC6A 1LC0A 2A4KA 2JHFA 4YJFB 4RVGA 2Y66A 1KY5A 4H7PA 2DAPA 1X7DA 4MVJF 4Q3DA 2GDZA 4GPD1 2YHUA 3BIOA 4YPOA 2UUOA 2IYOA 4OMUA 4U7WA 2VT3A 1VSUA 3KHUA 1IY8A 4Q9NA 2NUAA 3JSAA 1KVTA 3GH3A 1OI7A 1U8FO 4XX0A 3H9JA 2X5KO 3E03A 3QVOA 4IGFA 4L75A 2FMUA 2YZ7A 3GA0A 3KYDB 1BMDA 4KDEA 2VNSA 5CHEA 1XU9A 3INRA 5CDYA 1DJQA 4L74A 3JD0A 1U2DA 5KKAA 1EFLA 3LLVA 2C5EA 1K6JA 4J4TA 1NQ5A 3K2EA 3PLNA 2NLOA 5BSHA 4CM4A 4OO3A 4UEKA 1PJLA 1YBMA 4M86A 3WMXA 3KEQA 4L0QA 2GR9A 5G4LA 4YT4A 5AXAA 3JQAA 4GH5A 4KUHA 4WLVA 4O1MA 4DL9A 4BL5A 1T2CA 4BNIA 2Y0CA 3NT5A 1HYEA 2DU8A 3ROQA 1ISIA 5I9NA 2PWZA 3IS3A 4B8ZA 1YBAA 2YY7A 1QRRA 5CEJA 4DVJA 3B1KA 1VKOA 1NWHA 5G4KA 2Y93A 4Q3CA 1TEHA 1MLDA 3FWNA 1V9LA 2RH4A 4MIYA 2B83A 2BKAA 4ZICA 5FYDA 1HE2A 1U28A 3LYLA 2AEFA 1CRWG 1ZIDA 3DZHA 3ORFA 1LDBA 4AJ1A 3WYEA 3JQCA 1O94A 2QRJA 3ON5A 1GEGA 4Q3EA 1OMOA 1CETA 3HQ4O 2HK7A 3QWBA 1EQ2A 1HSOA 2DQ4A 1I0ZA 4CLOB 4YAEA 3NTRA 3PGXA 3WTBA 1G6KA 3ZWXA 1E5QA 4M49A 3RU9A 4ALNA 4MVJA 3WIEA 1JWBB 1BG6A 4ZA2A 4WOKA 3ITDA 1DIAA 4FFOA 1JW9B 1KVRA 4DQVA 2I99A 3ZWPA 1CJCA 2Y1EA 3M6IA 3UN1A 2X0IA 4BNXA 1UZMA 3NEPX 4IBOA 3GGOA 3PQDA 1F17A 3Q2KA 2EKLA 3P19A 1IULA 3L0DA 4BNVA 2BRUA 2O7QA 3WG9A 5IN5A 4B7UA 3RC9A 4P8RA 4E0BA 1I10A 4W9NA 4BKOA 4RF5A 1Q7BA 2VHZA 4WGGA 3QJ5A 3WQQA 4PGFA 2TMDA 5JDCC 3DZGA 4A10A 4BNYA 2PTGA 4B4OA 3WICA 3QV1A 3OICA 2ZATA 1HDYA 1ULSA 2IDZA 1GPJA 1ORRA 4DPKA 1XG5A 4TWRA 2HK9A 4I9UA 4QO7A 5L4NA 3BTSA 5IDQA 3RC1A 3ROKA 1ID1A 3DTTA 1DB3A 4EBFA 4WE3A 2GF2A 1ZH8A 2GYYA 3VZSA 1CWUA 5CDSA 2CDCA 2ZYGA 4F3YA 2CMDA 1PJQA 4PN3A 3K2BA 3H7AA 4ILKA 5JC8A 2G82A 1TVEA 3O4RA 4DREA 2WM3A 2BFOA 4OIMA 1C14A 1QYDA 5DULA 2NACA 5DF1A 3LK7A 4RPGA 3K8ZA 1TA4A 2JCYA 1I24A 4IDGA 5KKCA 4BGUA 1PL7A 2W90A 3EZLA 1HWYA 1XKQA 2DBZA 3BXXA 2VRCA 3V1YA 3NGLA 3SC4A 3JV7A 2C7VA 1EEHA 4JP2A 4DMMA 3ZV5A 3ONEA 3U4HA 4RDIA 1LRJA 3VH2A 1BRMA 3E18A 3CEAA 1NVTA 2Y05A 4D45A 4MP6A 1LA2A 4R54A 4CMEC 3B1FA 4BB6A 3E82A 3WFJA 4R5MA 2BLLA 2ZB8A 4NI5A 5JY6A 5THQA 2ZYAA 3TWOA 3CSDA 1A9YA 1D4FA 3NTOA 1JKFA 3BHJA 4R16A 2WEKA 4N54A 1YL7A 2X7HA 4J9VA 4WJZA 1E7MA 1O9BA 4BNUA 1AGNA 4N5LA 1LNQA 1IE3A 3FR7A 4MJLA 3DC2A 4Z0TA 1U3UA 4M89A 3CUKA 3WS7A 1LLUA 3WXBA 3U09A 3I83A 2CVZA 5JXWA 3KSDO 1NBOA 4AICA 2J6IA 3JYPA 3LC7O 4I5EA 4J1TA 4E2ZA 5I8ZA 3WJ7A 2Z95A 4KP7A 4PLYA 4TROA 1J4AA 2A35A 3VH1A 4XB1A 1MG0A 1D7OA 1WPQA 1LXCA 2X9GA 3EAGA 2PGLA 4YRBA 3PFFA 4CR6A 4P4GA 1FDWA 4LGVA 4CM9A 4K6FA 3AUUA 1GU7A 1NQOA 2Y0EA 1U8XX 1PQWA 4CQLA 4GI2A 5JO0A 3RUCA 2Q3EA 3H5NA 4QXMA 1PJSA 2FWMX 1Z6ZA 3WR5A 2DPGA 3O8QB 1EVYA 1PJTA 4PG4A 5T67A 1DRUA 4PIVA 1LDMA 4MKXA 1YL5A 1A4IA 4DGSA 2ZQYA 4JJGA 3VHRA 3JD2A 4M54A 3DB2A 5DDIP 5F1KA 4K1LA 4D0RA 3MJTA 5AYVA 3CKYA 5U4QA 3PEFA 2P5UA 2GN8A 1B0AA 2PKQO 1A7AA 1PX0A 2ZB4A 3DO5A 5KVCA 2Z1MA 2DVMA 5GZ3A 1PJBA 5G0TA 2HDHA 3W4JA 4OHUA 4CLRB 5KIAA 3RJ5A 1DOHA 2CF5A 4Z9FA 1DO8A 2FN7A 3MJ4A 1PWXA 1HDCA 1BVRA 4JCOA 3PHGA 1HYHA 2BHLA 4W9NC 3V2GA 3AW9A 3WGGA 1NP3A 4J1SA 9LDTA 1W73A 1H94A 1U4OA 4P22A 1IPFA 1ZSVA 1J6UA 2C7GA 4QUKA 4OKIA 4UVGA 5KJ6A 1P0CA 4CMIA 2R00A 2QZZA 3GZ4A 1T1RA 4YXFA 1O8CA 3GVIA 1JKJA 3D4PA 4YVFA 2ILTA 3U4IA 4IZIA 1UXHA 2H63A 4EEZA 3BZUA 1GL3A 3X2EA 1KVSA 4CR8A 4DLLA 1BSVA 4J9UE 3RU7A 2JAHA 1JN0A 5DBGA 1RYDA 1M67A 2DBVO 2QZ9A 2ZCUA 2Y0DA 3F4BA 1H5QA 3V1TC 1GQ2A 3IIEA 3BMCB 1WZIA 1GAEO 4WLNA 1FK8A 3U0BA 2RIRA 4B7CA 4J49A 4CUZA 1EVZA 1KYQA 5IZ4A 2RHCA 3PZRA 1LLDA 4WCDA 4CM8A 1NTOA 4MVJM 1EQUA 1XIVA 1ISMA 3F47A 4XYEA 3VDQA 3TNLA 1X0VA 4UULA 4XR4A 2NVBA 2G5CA 3ONDA 4E13A 2OBNA 3NT2A 4FJ0A 3WNVA 3GGPA 1QYWA 1E3LA 2H9IA 1A7KA 3ADOA 4BO1A 3LZ6A 2X6TA 1MB4A 4GWGA 2VQ3A 2DTXA 3SX2A 2J3JA 3PQFA 3ZNPA 2UYYA 3UICA 5ITVA 4GLOA 5CEFA 2G17A 1YJQA 3GQVA 4RZIA 3VPXA 2H1SA 1FDTA 3AY3A 3ENKA 3VPHA 2LDBA 3V8BA 1GUYA 1I8TA 4TVBA 8LDHA 1OZAA 1UZLA 3MJCA 4ZRMA 5L7WA 4FFNA 4CUJA 4DIBA 3FBTA 4XYMA 2YDXA 1YWGO 2XPCA 1VM6A 4BIIA 2OP1A 3EVTA 1PJ3A 1IB6A 3M1AA 2EV9A 4XDZA 1ZO8A 3K30A 4NR0A 1SNYA 5MGBA 4Q3BA 4NMHA 5KCZA 3ZWMA 3D4NA 4EITA 3I9LA 3RBXA 4GL4A 2JD2A 5IF3A 3GDOA 5DP2A 2GGSA 3GRPA 2V6MA 3ETGA 3SJ7A 3WGHA 2QYSA 4G2NA 4PVDA 4DWVA 1NVMB 4JJFA 3NT4A 4RF2A 2ZTUA 2BGKA 3OF2A 4X54A 4XB2A 3QY9A 2Y1CA 1ENZA 2PZMA 1O89A 1GD1O 1Q0HA 1VI2A 4TRJA 1PSDA 2DC1A 4OOEA 1GFSA 2Z5LA 5A9SA 3QWFA 2ZK7A 1DEHA 2B5WA 2NU6A 1RM4A 2D5AA 3G0OA 4RPJA 3HZZA 4BKPA 5L4LA 3W8FA 3GMDA 2YHIA 5DNAA 4AFNA 3K96A 3MOGA 2YFQA 3KV3O 3T7EA 1VE9A 2HRBA 1E7QA 3JQ6A 4PLTA 2AQ8A 3KM0A 4OL9A 4D41A 1SCUA 2GUGA 4WKGA 2I5PO 4JX8A 1L1FA 2F1KA 4GVLA 5L4SA 4IZHA 4IY1A 2C54A 1KC1A 4MIOA 1WLYA 2J8ZA 2Q1SA 1EBUA 4RVDA 3ZV4A 2X9VA 2Y67A 3WTCA 3ABIA 3GVCA 3EZYA 5IZCC 4YJHA 1BW9B 4DA9A 4MIEA 4XWYA 3Q9NA 2ZTMA 3DMTA 3QWIA 3UKOA 5TIIA 3GUYA 1U4SA 4CMAA 5AXBA 1DJNA 1QMGA 3NJ4A 1C1DB 1SMKA 4AJ4A 3PHHA 3HADA 4HP8A 3OQ1A 3R0IA 5JDIC 1I32A 1PGOA 3DAGA 1LLQA 3OJFA 3GFBA 1OC4A 4GX0A 4MKZA 5AXDA 4MVJD 1PZGA 1CERA 2AHRA 3H9QA 2R00C 3IJPA 1ZK4A 3PVZA 3NX4A 4OSOA 3BTUA 1I01A 3ETEA 2FSSA 1WW8A 3WLEA 1GDHA 3KO8A 3L9WA 4EI2A 3DDNA 3S8MA 2NWQA 1JTVA 2PGJA 2VUSA 4LSWA 1SO8A 4IDEA 4KUGA 2FSVA 3OIDA 5LCXA 3WWYA 3EHEA 4I8XA 4O0LA 4NBRA 2XAAA 4U8GA 4WK6A 2A9FA 1NX6A 2JJYA 4WOJA 4YJDA 1R12A 1R66A 3D5QA 1HE3A 1R0LA 4TKMA 4R3WA 3EK2A 5BNTA 4E21A 4DC1A 2R2GA 5JY1A 4DBZA 3W1VA 4ZVVA 1HF3A 1IHXA 5THKA 1N7HA 1VJ0A 4BGVA 4R01A 1L7DA 4FOOA 3GMSA 5KVSA 1CQIA 4JBIA 1HL3A 4KTVE 3RJ9A 2P91A 2RH8A 3TQHA 3SBOA 5CDTA 3UCXA 3V1UA 3WGZA 2C07A 4W6ZA 2VYND 3AJRA 2OL4A 4E5PA 5C7IO 3SC6A 1Y9EA 4Y9DA 1ZK3A 1T4BA 1QSGA 2HCTA 3ZWWA 4CV3A 3KRTA 1Z45A 1P1IA 2W2KB 3DBLA 3UFXA 4LCJA 1I2ZA 3DBHA 4J0EA 3VZPA 2X1HA 1FDUA 4FQ8A 1ZNQO 2P9EA 4J91A 1N8KA 4XQEA 1ZW1A 3UGKA 2JFGA 4LVCA 4CQMD 3DOCA 3Q1LA 1GPDG 2WDZA 4J6FA 4TVOA 2GD1O 3UCEA 1QYCA 2BELA 4YRAA 5KVVA 1T2AA 3JTMA 2G1UA 4IIUA 4UVHA 1H2HA 1VC2A 1F0YA 2J5QA 3U4CA 3Q6IA 5JAZA 1B15A 5TJHA 1F12A 1ZJYA 3FNHA 4PLGA 1E6UA 2FP4A 1YDWA 6ADHA 1DC6A 3AUAA 2AQHA 4CLEA 3GPIA 1Z75A 2EGHA 4WLEA 1C1XA 4DXHA 2O2SA 4ONEA 4U6QA 3BMQA 4FCCA 2PD6A 2ZQZA 3HG7A 4IM7A 4DQUA 4F45A 2ZIZA 4GX1A 4J0FA 1ZK1A 2XOXA 3PDUA 1I30A 3ZWVA 4EUFA 4RF3A 3QLJA 3E9QA 4PG5A 4KQXA 3JQBC 3DR3A 1ZJZA 1GQYA 3GNQA 4NZ9A 4IS3A 3CE6A 4YJGB 4RCVA 1EE9A 1P1KA 2WD7A 3UH1A 3AM3A 1C0KA 1TT5A 2IZ0A 4EJMA 4NU6A 4W4TA 1KBZA 4CM5A 2OZPA 4YJFA 5F5NA 4H3VA 1RYEA 3DZBA 1O0SA 1ONPA 2PKQP 1X1TA 3JQEA 4IPTA 5DBFA 3C7AA 4A2CA 1DC3A 2V65A 1JA9A 3D5TA 3P7MA 1IHYA 3L4BA 1EE2A 2JD1A 3H8VA 2UV8A 5B37A 3OJLA 4BO8A 1IZ9A 3KB6A 4XIJA 4ND2A 5JDCA 4FSHA 5FI3A 3OBBA 1B8VA 1XWFA 3KYDA 2C0CA 1SZJG 4JBHA 1DIGA 2CVOA 4NNJA 1ADCA 5ER9A 2ZYDA 3LSYA 4ITUA 2W8ZA 2I66A 4QTZA 5ITWA 1MP0A 1IL0A 3QWAA 5JYDA 1U7TA 1NQTA 1YO6A 2FZWA 7MDHA 1ADBA 3WNQA 1HDGO 1Y8RB 4ALKA 4DIOA 4S3MA 3TPCA 1ZK0A 2YQ5A 3QVSA 5L7YA 3LU1A 4R3NA 4I9HA 3NRCA 3Q0EA 4FN4A 2I65A 1T25A 2PY6A 2P68A 4DBVO 5K0ZA 4PRKA 2E6UX 3GNSA 3I1JA 3JQFC 1G0OA 1P44A 1LDGA 2OMEA 3I9JA 4IIVA 2AMFA 2AW5A 4CUKA 2ZB7A 1WDMA 2GSDA 3N74A 4WUVA 3RUFA 3GG9A 3F4LA 4R1SA 1BHSA 1E5LA 1XU7A 1YQDA 2BFAA 1VJTA 4E33A 3JYLA 4KMSA 5T8KC 4AJHA 3H2SA 3GGGA 1QXSA 1YOVB 3VC7A 5I7VA 4BS9A 3GPDG 5A03A 3L9XA 4RL6A 5A5EA 1GYQA 1I3NA 4BKUA 4J4HA 4WASA 2PR2A 4GMGA 1EUZA 1F8FA 3L6EA 4W99A 2HKIA 4CLHA 4OM8A 4XQGA 3ZNQA 5JCXA 4FFLA 2WMDA 4CMEA 2IZZA 1IYZA 4M8SA 4R1NA 4CLOA 3H6KA 3QQPA 3NDJA 4GGOA 3COSA 3OHSX 1ARZA 2Z1NA 4LRTB 1PZHA 1HLDA 4IINA 2WYWA 5LC1A 5BSFA 2CY0A 2CF6A 3GT0A 4OGWA 4I1IA 3ZN2A 3CXRA 5KNLA 1EZ4A 1WMBA 2GPTA 2GZ3A 5BNFA 3VOSA 1ZK2A 7ADHA 3GOHA 3RBVA 1EDOA 3CZMA 4B4WA 1UP6A 2P4HX 3HNPA 4R69A 4XJSA 2GZ1A 1YVEI 2DTDA 4HBGA 1YDEA 3WYBA 4MINA 1NHWA 2EP7A 2EERA 1MXFA 5GZ1A 2BGMA 2HMSA 3P5SA 3IKVA 3H2ZA 4TRNA 4J2OA 3E1KA 3HWRA 2Q50A 3K73O 4UVEA 3FPLA 2VOEA 4Z9XA 2QHXA 4JBGA 2NTJA 4JN6B 4CPDA 3V2UA 1XR3A 4AJJA 4HX5A 3GR6A 3ZU2A 3OIFA 4JP3A 4BHTA 4L4RA 4AJIA 3HB5X 5KJ1A 1GZ3A 4XYBA 4A73A 3LT2A 1XEAA 3RKUA 2B36A 2HO5A 4TQGA 2D2IA 3ZWCA 1F14A 5COAA 3WGIA 3RUAA 4QEDA 3NTQA 3PYXA 3RFTA 4ZGWA 2O3UA 3FR8A 2VYVD 3JQDA 2Q4EA 2TMGA 1E6WA 2JFFA 1I3MA 1TB4A 1XQ1A 4ND1A 3Q2IA 1DLIA 3ANLA 3OJOA 3LF2A 1ULUA 3L07A 1LDNA 4DRYA 4TZKA 2HJRA 4A5OA 1E3EA 3I4CA 4AG3A 3ZHYA 3FNEA 3L6OO 4N18A 4O59O 3DZKA 3GC6A 2PK3A 4HFNA 3ZNNA 1YXMA 5IXYA 3OJEA 3L4BC 5CEEA 1LSJA 1DRWA 3QHAA 1DHTA 3M1LA 4OAQA 1EUDA 2W2LD 3RUDA 3LC2O 1X1EA 3FTPA 4Q3AA 3VH3A 5IJZA 2EHDA 4XEHA 3CH6A 1UDBA 2G76A 4AJ2A 5HS4A 4XRRA 1O6ZA 2NVUB 5COQA 1Y7TA 4MPDA 5L95A 4FDAA 3RROA 4E4YA 3E9MA 2H6EA 1E7SA 1PL8A 3BTOA 2EG9A 4OOFA 3BMOB 1T24A 4LW8A 1NNUA 2E37A 2BFPA 3PHIA 4D3SA 4RF4A 2X58A 1BXZA 1M66A 3QWHA 3D0OA 4YACA 1YKFA 3GUCA 1DIBA 5HRUA 2C2YA 2O50A 4BO0A 5CG1A 1KIFA 4YAIA 2JL1A 4IS2A 4QFDA 5HM8A 5AVOA 3W4IA 1ZMOA 3A1NA 4WEQA 1ZCJA 3WGQA 5DBIA 3ZWOA 3U3XA 1VPDA 1GZ4A 4S1VA 5JO9A 1KOLA 4Z3KA 2EIHA 4Z0PA 2EGGA 3GAFA 4XQ9A 1WDKA 3JQGB 2E4AA 4EW6A 1R4MB 4OXYA 4YWJA 3BAZA 4O5OA 4FD3A 1PZEA 1TI7A 5TF4A 4D7AA 4E30A 2YQ4A 4D3FA 1ENOA 3ST7A 1NVGA 3O8QA 4XYGA 1EUCA 4R68A 3MJEA 4I9NA 1K89A 4PLWA 1KVQA 1F8GA 1QLHA 1X14A 3ZU3A 2QW8A 4RQTA 4HNGA 3SJUA 3TJRA 5LDGA 2EP5A 1HYGA 4UEJA 1DFIA 1BDMA 4IDDA 2ZCVA 1V3VA 8ADHA 4FR5A 1X15A 4E2XA 1AXGA 2HLPA 5EPOA 2NTNA 1XSEA 1PU2A 3L4SO 3PIDA 3PJGA 3WBBA 4CLRA 1E1LA 3RI3A 4QSMA 4FJ1A 3D4OA 4YAJA 3QVXA 3KETA 3IUSA 1K5HA 1C3VA 3EY4A 2PH5A 2OGUA 4L4XA 3AM5A 4HUJA 1JDJA 3ANNA 2VNAA 2VOJA 1Y8QB 4NFYA 3TDKA 3ICPA 1V35A 2QX7A 2WJPA 1NFQA 3VKVA 1LQUA 3PP8A 1NHGA 1YBVA 2WD8A 4EUHA 1YL6A 5FI5A 3DFZA 1J5PA 3WOHA 4R9RA 1FXSA 3WGYA 1P45A 3QVWA 4NJMB 5GY7A 5ICSA 4P4LA 2QIOA 3AU9A 3FN4A 1DFGA 3B1JA 2HMVA 3AFNA 3VDRA 4EUEA 5CPFA 4R41A 4CV1A 4J90A 3PTZA 3I6IA 1ZZEA 1FMCA 4CM7A 4Y8VA 2IXBA 1YB1A 4MP8A 4RLSA 1U3TA 5A3VA 3BMCA 3ZDFA 4A7PA 2WE7A 5JMPA 2VWQA 4MVJP 3JQ7B 5EN4A 2HMTA 3V2HA 1FDVA 4CQMB 1VL8A 1PR3A 1LQTA 4UVIA 1GYPA 5IFLA 3KLPX 4QO8A 4Y67A 3NV9A 2ZJ1A 4OJNA 4BNNA 1E7WA 4J1NA 4DMLA 3MZ0A 4BO6A 4MVJI 5IZCA 3JYOA 3DAFA 3VVBA 5JCJA 2P2SA 4BNFA 4BMSA 1P74A 1Z7BA 1Y5RA 4BNJA 2VUTA 4YBZA 5CFZA 1SEVA 2W98A 3AY7A 5MDHA 1T1SA 1A72A 3I6QA 2IRWA 4YQYA 1Y1PA 5JDIA 2O3QA 4GWKA 4NBWA 1BXGB 1M6HA 4JLWA 2D1YA 1GTMA 3DAPA 2XXJA 1DSSG 2HRZA 3JD4A 1LC3A 1U5CA 1UJMA 3FHLA 1U3WA 3I4FA 1P33A 4DLBA 2J3HA 2J5RA 3ENNA 4CR7A 5JAMA 2JKVA 1B7GO 5KVQA 2O4UX 3RWBA 3U5TA 3DBRB 3DZIA 4F6CA 1I3KA 2B4QA 4YAKA 2GN6A 2GASA 2QQ5A 1R0SA 3FI9A 3K31A 5CAEA 3UOGA 1H0KA 1N2SA 3I9OA 1PTJA 3AOGA 1J49A 1ENYA 3FRJA 4MO2A 3X2FA 1K0UA 1MUUA 2CUKA 2I9PA 4LSMA 3D7LA 5IDXA 4B7XA 1JWAB 4RVUA 3E48A 1UAYA 3H5AA 1T2FA 4WPGA 3ROPA 4NK5A 4Z9YA 2HAEA 2HMUA 5ENVA 4CMGA 5L51A 4ND5A 3UHAA 2R6JA 1JAYA 2PGDA 4ZQBA 4E5YA 1UAGA 4PLPA 3SEFA 4BQRA 1BWSA 4IMPA 3VAZA 1NQAO 1U7HA 2V7PA 4E5KA 2PLAA 4RQUA 3RCBA 4PLZA 3MTGA 1T4DA 4LN1A 3FWZA 4XZ3A 4UUMA 3R3JA 1IZ0A 2CSUA 1TT7A 4PCVA 4J3FA 3GLQA 4ZQHA 4FOSA 2BI7A 3EVNA 4MP3A 2V6FA 3GN1A 1YS4A 1HETA 3MWDB 3GN2A 2Y68A 4II3A 3ANMA 4IJWA 3I9MA 4L76A 1LDYA 1X7HA 2X22A 1K6IA 4C7JA 4EJ0A 4CL3A 3B6ZA 2WYUA 1EMDA 4ND4A 1BW9A 1KY4A 2NM0A 3KBOA 2B4TO 4WLFA 3GAZA 3Q3CA 4FFPA 1VSVA 2EXXA 4HY3A 4E2WA 3DXFA 4K28A 3F46A 1C1DA 4P38A 3KYBA 4B8WA 2EWMA 5T5QA 3CZRA 1QR6A 3DBVO 2VZ8A 3K6JA 3MEQA 4MVJH 5TSDA 2HUNA 1WVGA 4W82A 3T7CA 2VUUA 4FGSA 4CLXA 2CFCA 3JQBA 3DWFA 1WZEA 5EERA 4BNTA 1Y5MA 1O5IA 3T4EA 5IG2A 4UUPA 2W4QA 3FTNA 2D8AA 2NADA 3FF4A 3GRKA 5FF9A 2YV2A 3TL2A 4DLAA 1QV7A 2EW8A 1LSUA 3VTFA 3KTDA 4GX5A 1R16A 5ENDA 3ZNOA 2AEJA 2A94A 2Q2VA 1JQBA 2GN4A 3IKTA 3IDSA 5DP1A 3DOOA 2VT2A 4YDRA 3ZW8A 3WBFA 3JQAD 1PQPA 5EJ2A 3IP1A 3RUEA 1W6UA 1N9GA 2Q99A 4NFHA 4YT2A 4OXNA 1DDOA 2C29D 3QIVA 4IJVA 4QQRA 3WYCA 3HSKA 3GVPA 4CLDA 4F46A 1EK5A 5F5LA 4LCEA 4JNKA 4DPMA 2ZTVA 1D1TA 3OEYA 5H81A 2XXBA 1PGJA 3I9KA 1U1IA 3GFGA 3GHYA 2JFHA 3CINA 3HN7A 3OECA 1SAYA 4J7XA 3GEDA 2W2KA 4IGEA 1B26A 1PEDA 1EDZA 4BUCA 4C4OA 4YT8A 4IDFA 1R4NB 4HWKA 9LDBA 5EESA 3O9ZA 4J16A 1ML3A 3JQFA 5IDWA 2X4GA 2OP0A 2G0TA 4ZHSA 1HXHA 4A26A 5BSEA 3GZNB 5TRTA 1IUKA 3CTMA 3PJEA 2CVQA 3GEGA 3B20A 1Z73A 4KWHA 1HT0A 3H3FA 4BNWA 1HDZA 3NJ8A 4UUNA 1Q7GA 2WSBA 3BMNB 2Y1FA 4Q3NA 5L3ZA 2WE8A 3DONA 4OKNA 3IOYA 3C1TA 5T8KA 3L77A 2C82A 2P4QA 4U0KA 3BTVA 3C8MA 1N5DA 4LISA 4TSKA 1BDBA 4D79A 3FNFA 2O7SA 2FOIA 2DT5A 1N9GB 4W7IA 3F1KA 3EW7A 3K5PA 3R3SA 4BO2A 4J7CA 3WQSB 5A06A 4IXTA 5BR7A 3S1LA 4A0SA 5B4VA 2RAFA 2Q4BA 1A71A 3PLRA 4YJGA 3OA2A 3OFSA 2Y1DA 3PFWO 3R1IA 4RORA 3PJDA 1RKXA 3RVDA 4NIMA 1E92A 4XDYA 1Z82A 3N58A 2B37A 3QA9A 3UCFA 3BYZA 1N1EA 1JVSA 3A28A 3NGXA 4FIZA 3CMMA 3DTYA 3TZQA 4IMRA 3OETA 2QRLA 1PGPA 4GAEA 4BO4A 1NXQA 2DFVA 3AI1A 1HE4A 4BB5A 4E32A 1GQQA 4I5GA 4A03A 1OAAA 2GZ2A 3HFSA 3F9IA 1DBVO 2O3JA 1SOWA 1XDWA 1QP8A 1SBYA 3GDGA 3WWZA 1HDRA 2O3SA 2VRCD 3HDYA 5I7SA 2D3TA 2AQIA 2X0JA 5HWSA 5I7EA 3FNGA 5LDHA 1PL6A 1Y8RA 1UUFA 3W6UA 4J1QA 1GV1A 4PG7A 3UVEA 4RO0A 3HDHA 1H6AA 3INTA 2PZJA 4PLVA 3UAGA 3JQ8B 5TJ9A 1DPGA 1PJ2A 1VLLA 1RM5A 1CF2O 5F1OA 3VPSA 1C0PA 1G0NA 4E31A 4RPHA 2BFMA 2UVDA 3T4XA 2SCUA 4LMRA 4R1UA 3S2FA 1FDSA 1UXKA 1W8DA 3G79A 5TLSA 3D1LA 1AUPA 3AFMA 1KERA 2IEDA 4QFCA 3VTZA 2JCXA 1P9LA 4NDNE 4RVSA 3D3WB 3N7UA 5G2OA 3PHLA 1A27A 1PS9A 1WP4A 1LI4A 1WDLA 1YOVA 3KYCB 4BNKA 1NPDA 4XGIA 3TL3A 1YB5A 5H82A 1DAOA 2DFDA 5L53A 3LT1A 1M2WA 4ALMA 1NR7A 1V8BA 1P1HA 2Q46A 2VN8A 2I3AA 3G17A 3TFOA 2D5CA 3NKLA 1PS8A 4RZHA 4OXKA 3RKRA 4M1QA 3V5NA
chains in the Genus database with same CATH superfamily
1DAPA 1SQSA 4UPEA 3IAXA 4YEDA 4KZPA 2C7OA 4CM9D 4MVJG 5JISA 1EWVA 2NUTB 2WZBA 4ENQA 1KU0A 1HRDA 2QMEA 1LSOA 1SB8A 1IN8A 4PEVA 4UFOA 4YIHA 1JTEA 1TLTA 1CJUC 4R51A 2VDPB 5C7LO 3BIJA 3FHJA 3U7IA 1IPHA 3B2NA 3CBGA 1GA4A 4C08A 3NIWA 3KLBA 3TSCA 1KZ9A 4GI7A 5BOSA 1ZC3A 5CK4A 3PGMA 4Z49A 4MDEA 3O8RA 1XTKA 3DAYA 4L4SA 4RPKA 3LCVB 1KY3A 2GNPA 4HDRA 2FNAA 3VBEA 3ONWA 3LH5A 2JLYA 3K0AB 2WTBA 4RLHA 3T52A 2D1RA 1ZMXA 1SR8A 1XJQA 4EY5A 2BBTA 1CJTC 1LEHA 2RGUA 4BMNA 5LIRA 1F6DA 3UYLA 2YV4A 3K7EA 4G07A 2RHDA 3AJ9A 1Z0AA 4O63O 1D2EA 2OK8A 4WLUA 3CO5A 2ZT5A 5J5CA 3NAQA 3TLAA 3HCFA 3FCOA 4JEMA 3RAJA 1GGFA 5KVAA 1P8JA 3OD5A 3OP4A 5JYBA 1X6VA 2GAFA 2XF8A 5TS3A 4EGQA 2YJ3A 3QOXA 4LQCA 1UPCA 3H8WA 1JHXA 4NOKA 1EFPA 2B1QA 3KE9A 5F4BA 1LRKA 1PR4A 5D84A 1IM8A 2GM4A 1QM5A 3Q7RA 3G23A 1AZLA 2JFXA 4NCIA 4EUSA 1JB1A 1PV1A 2C3PA 3BILA 4YRTA 1LW7A 1N0UA 1J07A 1TC1A 4HDKA 1NKSA 2OORC 2PV7A 2OWDA 3PWKA 4RVFA 1RYFA 5GZ6A 3I0ZA 3S44A 3TRIA 4ZN6A 1TAGA 3FAKA 1HT2E 1QB7A 2C04A 2NT4A 4YCAA 3UANA 5K8CA 4HLUC 1P9OA 4L3OA 5G0WA 4YUVA 4HLNA 3F67A 5IJXA 2IEIA 2YMQA 1QOPB 1L7OA 3IILA 3ETLA 3S3TA 2PLNA 4G0ZA 1PFVA 2ZSIA 1SBNE 5E1MA 5KJEA 1V5GA 3LPMA 1U04A 3JYQA 1CP2A 2Z9DA 3E8SA 5H1YA 3THYB 1CZOA 2QF7A 3F5SA 4QGAA 5KYUB 1IIRA 4UM5A 1IPEA 1B8UA 1CTQA 1LJ8A 3LK6A 1HTBA 5AUPB 4F92B 1BX1A 4DMHA 2IITA 5EIBD 2J4FA 1T8SA 2POCA 4Z4IA 4PIPA 1JYSA 1I7PA 2OXTA 3MTBA 2GEBA 4F71A 1QANA 1UPUA 4DNPA 1AD2A 5IH7A 2W5UA 3SIPA 4HGQA 1SXQA 3PKIA 4ZZ3A 3UK1A 1HNXB 2A5FA 1DHRA 2KS6A 3DVAB 4G2TA 4D4MA 3ZDEA 2XCIA 3OX3A 4H35A 2TYSB 2FMFA 1DS6A 4X8HA 5AOBA 3VR6A 2Z58A 4JIMA 4E46A 1F06A 4QUBA 1IY1A 4QDXA 1YI0A 4HRAA 5IUKC 4BFXA 3OFKA 1XELA 3ZZ1A 4R1OA 1F2TA 3UK0A 3K3PA 1A97A 3AU8A 5AW5A 1GLVA 3D8TA 1NVVR 2AOXA 4UARA 3KB8A 1DAEA 3BE4A 4MQ6A 4ZODA 1KI6B 4MWCA 4MAAA 3EVAA 5A6SB 2PZFA 1NURA 2CZCA 1E3WB 1R6XA 2BEUA 3SIWA 4BDTA 5J4LA 3IAS6 1EFRA 1PN3A 4FXOA 4LHWA 2IU3A 3BUSA 4BGDA 1HE1C 1I5EA 3B70A 2JH9A 2XI4A 3H13A 3Q12A 2BKEA 1RWQA 1ONBA 2PZLA 3HA2A 3K1AA 1SGWA 4UBJA 4ZQGA 5E95A 3JQGA 4BV2A 2QSJA 3K8YA 4CJXA 2WAMA 1WUTA 4MI1A 3CR3C 1YULA 4D0GA 1DAHA 1PWEA 1UODA 3NAGA 2QNRA 4I3GA 4JXKA 1E66A 5CNKA 3Q3JB 3PPIA 2JLUA 4F96A 3Q6NA 4W8HA 4DTIA 5IDVA 1HQKA 3BA6A 1R6TA 2O23A 3LVFO 4J0KA 4TT3D 4GLLA 5CBKA 2OUIA 5TE9A 4UAGA 1J7KA 5AKKA 1PGNA 1WMFA 2HRRA 3CH5A 3TE7A 3AKZA 1FLAA 1ZD9A 2B7LA 3Q15C 1COWA 3QX7A 1Y8CA 4HS4A 4B2IA 3ABZA 4MQEA 4C87A 1QP7A 2XDQB 2J07A 1E6CA 2FR8C 2PANA 2ZWOA 4BQPA 1NMQA 4BAGA 2XCQA 3LV8A 3NTUA 4JLJA 3HKEB 2FPWA 2R85A 1KMHB 3PDWA 2DSTA 4AZ0B 1JG2A 1UT6A 2FCAA 3Q7PA 3S2SA 1T6NA 3GY0A 1S7CA 2EJVA 3EQ7A 3JQAB 4Y9SA 4ND3A 4M9CA 3DG9A 1P7CA 4J3JA 4XCQA 4D92A 4CRWB 4Y18A 4REQB 2YIMA 4KIJA 4D82A 3AVYA 2BONA 4NYJQ 1NONA 1CQXA 1PJCA 1JAXA 5TQJA 1IK4A 4ZI7A 4NXMB 3G2PA 4L5YA 1EFKA 1VHWA 1YI8A 1Z0JA 2BZ1A 3KWFA 1Y7IA 4JVLA 1LX6A 4LTMA 3CZ5A 4Q15A 5G4KB 2I2AA 5BW8A 3A9UA 2P9CA 1TEVA 4JEHA 2AFIB 3NHUA 3R9XA 3M9LA 1GKKA 1AXEA 3BF7A 3PQ2A 1CUXA 3NDIA 5FB3A 1W36B 5IHPA 3EX7C 5FNVA 4PO1A 3QF7A 5JYEA 2B6HA 4HJRA 1BS1A 3UJ6A 4FI3F 5HQ3A 1SD2A 3E1GA 3AP3A 5BMVF 4FBGA 3ZDBA 1KOFA 5J4HA 3OC6A 2AFIE 5G1PA 2E85A 1GTG1 1WNTA 2WR8A 1SIBE 2PT6A 1U7DA 3QG5A 4QODA 4UKDA 4JI1B 3WLFA 1LVGA 1SBTA 1OU0A 1E59A 1IWBB 1Q22A 1RXSA 1X7GA 2G5GX 3GXBA 4UQLA 2W6ZA 4AI6A 3R6DA 5LXTA 3NDRA 3JQ7A 4DLXA 3GCGA 4LCBA 2F3RA 3P0EA 5T6BA 4CQMA 4BMCA 3LAWA 4F2DA 1AQ6A 3GWGA 1F4LA 1UDAA 3YASA 3TE6A 2HXGA 4M1KA 3FPAA 2B6NA 3DDCA 1GTL1 4JX9A 4KK3A 1ULHA 4M55A 3ACCA 4NAHA 1YD7A 4UHCA 5JPIA 3SIXA 5JASA 3LP6A 4B6RA 3LXXA 2EW2A 4G4SO 1YACA 2CC2A 1JIJA 2P9YA 2Q5CA 3EA4A 3KNZA 3STHA 3WRYA 4PZ9A 2PS3A 3TRFA 3WZ2A 1Q3KA 3WL8A 2FPIA 3KLMX 4JBWA 4AJNA 1E3JA 2PL3A 2PX6A 3QW2A 1MEJA 3KB1A 1TEXA 2P0YA 2BGJA 2WTAA 1AS0A 1J09A 1YDMA 4QQKA 4P3KA 5DLEA 2VHCA 4YGXB 5B3JC 3G1TA 2FRDA 3BT7A 1I36A 2UAGA 1U0OC 3HBAA 1E2MA 2GXAA 2SKCA 1N6LA 2FZEA 4F38A 2Y1OA 5K4GA 3MTEA 3RJMA 2Y0BA 4PWZA 1T1JA 1X1RA 4FFBA 1U2DC 2PMBA 2GT1A 3PC4A 3PUZA 3E58A 4KNWA 4B4UA 3TGWA 5A5FA 1RQLA 4OEHA 3HA7A 3WE7A 2G5PA 3F0TA 3OX2A 1XKLA 2J1LA 1X7ZB 3VKUA 1TJ4A 3BD9A 4IDQA 4RHTA 2OM2A 5FOQA 1GV0A 3NHRA 5EJ9A 1XCMA 2D1TA 5DRYA 3S2GA 2DH6A 2Z43A 3RAEC 1XXHA 3FD8A 3SQXA 3SWWA 4XCXA 2XOEA 5AQ1A 2YWCA 5LWQA 1D2NA 3TTVA 1ZH0A 4DCVA 5I9LA 1DEKA 1II8A 2PS9A 3KAKA 5CYFA 3KXDA 1RMTA 3D6HA 1IEVA 4P2BA 1BKSB 1WTCA 2GBLA 4A2WA 4B1FA 2C88A 1USVA 2H7CA 4MAFA 3QEAZ 4F2WA 1A5BB 1PKEA 3PXXA 1NW5A 1P77A 3TMAA 3MUOA 4YAUA 4G4IA 1W48A 2DWUA 2UZAA 3LHKA 3ZKWA 5FUWA 2ZZMA 1QTQA 1W4BA 4RY9A 4PGMA 1GRCA 4CKWA 2QM8A 2WFLB 2C5SA 3R5TA 2JVJA 3G49A 4NSNA 2QZSA 3QUTA 1YR1A 5A62A 3OTGA 2VDWB 3I05A 3KL2A 1HKUA 5HTOA 4YCJA 3O26A 1V11B 3H3JA 4CM6A 3F8WA 4GM0A 4M8IA 5ADHA 5AVZA 3MJVA 2W9XA 1AK1A 1YZVA 3C1OA 3MTDA 4QPDA 1VE7A 2PFKA 2WM9B 4L7VA 1VJRA 3EUFA 3L46A 4DFDA 1R4ZA 1VXOA 2B4RO 2OC4A 2AG8A 5AJYA 2XB4A 1PZFA 3UMRA 2FF7A 2HNBA 2ZS9A 3LC1O 2GWRA 2NUPA 2W6PA 1AKNA 3P9QA 4HRXA 2XYRA 4TVSA 1D09A 2E5WA 5BPHA 1OC2A 1NFRA 3CPSA 4G5XA 3H2IA 1RJ9A 3VVCA 1A76A 1O58A 2X14A 3LBYA 3Q9LA 2G3YA 4EQZA 3K5IA 1RBQA 1YKSA 1LGYA 2BWJA 2WU1A 2HTEA 1E77A 4EUNA 1U0BB 4MW9A 4S2UA 4WXRA 4GGPA 1UJ5A 4CIXA 1I5RA 2I55A 2J9RA 1I33A 1W0CA 3DDWA 3KHKA 3LCUA 3BCUA 4IIDA 3GZTB 2E89A 4G89A 4HEHA 4U63A 3GOQA 3VPGA 3DLIA 4IJUA 1AQJA 3DTVB 4KEAA 2P1ZA 4BTLA 3W7VA 3L8GA 2WKQA 3HJGA 1ZESA 3I4LA 3W5AA 4Y6PA 4L0MA 1XPUA 5BPFA 1PS0A 4PSDA 3TW4A 3TOCA 2ZIFA 3LZCA 3FY4A 4UUBA 4MICA 3IQGX 4U9IS 4ZT4A 3AP2A 5EMMA 3IAEA 4KVFA 4W7SA 4AQ7A 1XJWA 2F43A 2J30A 1KAEA 3A4VA 2QN2A 1SKQA 3F2VA 3D3EA 4UASA 1SOAA 5LBTA 3R09A 2IS4A 2B3TA 2ISQA 4PO3X 4X91A 3SYTA 1K2VN 2ZT6A 2O2IA 5B2EA 2CV1A 4G65A 4QDOA 1NSYA 2DTEA 2FFBA 2P2LA 1N2OA 2J5KA 3WL5A 4CV0A 4F9EA 5A5GA 3RYCA 5AWFC 1H4QA 3H9UA 1JLLA 2VTVA 3E5MA 5DHSA 4DC9A 2HV9A 4S1OA 2NU8A 3A6DA 2FXVA 3VTKA 3ITEA 2VK1A 3HBJA 4URUR 2GLXA 1XZBA 3ES9A 1WW3A 2NNLD 2BHTA 3PYMA 4QBHA 2DKOA 2N47A 4WN3A 4KUEA 5EOVA 3ZIAA 1NUTA 1SU7A 4QREA 2JGLA 4QZVA 1TVKA 4EVRA 3TGPA 5L3SA 4AJLA 1ADYA 1J9EA 2YYYA 3BD6A 5ER6A 4DM3A 2QT0A 3C6YA 4FINA 4FB5A 1OGJA 5DHAA 3VZRA 2NSYA 2OXIA 1ZI8A 3OA0A 2CCGA 3JRNA 2WV9A 1BGVA 3LDHA 3QXXA 4Q66C 2OV4A 3B3JA 5A4KA 3C3WA 2OGSA 4DUPA 1ZBQA 3ZV3A 5KYTA 1N4AA 2I4MA 1G8HA 5G1OA 2D5IA 4P54A 2ILVA 2ZITA 3U19A 1T2EA 1YCFA 1UJBA 3ZHCA 3ZEIA 3DHVA 2NX2A 2E4UA 3PWSA 1ICEA 4F4UA 3KT6A 4P93A 1XLTA 2J48A 2YFKA 1ILEA 1D0SA 1FRNA 4MCIA 1LDEA 5I4BA 2F55A 2CK3D 4UUQA 1CIVA 4XLZA 4YALA 1CUBA 1MG5A 4DCPA 4HS9A 3AFIA 3SIRA 4C7OA 2HSZA 5ALLA 2RH5A 3IAHA 3BHMA 4LSGA 4ZV4A 2F8MA 4CMIB 4DOMA 4DPLA 4D3XA 2D59A 2ZAOA 2GF9A 4IIJB 5H3CA 1MA0A 1Q84A 4MEBA 9ATCA 2PZKA 4UU0A 3C4QA 2JANA 4LQDA 4BVAA 2VYVA 1A7UA 2GPJA 2X23A 3QBEA 4GI3A 1V96A 3U0VA 2BJHA 2OVBA 3SHFA 2O3TA 5A3RA 1Y80A 5JNUA 3DM5A 2GD6A 5DWDA 3I37X 2FN3A 2GN1A 2KW5A 3GZJA 4OM7A 3AGPA 4EQ6A 3JXEA 3OMLA 2ZQ5A 2A5DA 3DE7X 3PC3A 5EL0A 3GFSA 1Y0BA 4D6YA 1JDTA 3EUAA 3GLHB 1PT7A 3HJNA 2XEXA 1KE1A 4AJ9A 5EHQA 3CS3A 3F5FA 3UWPA 2YJ4A 1X19A 1JJFA 4CM8B 2CE2X 4G5GA 4UCQA 4L51A 3A4TA 1QF7A 4LKOA 3TBFA 1G59A 1O03A 2HO4A 4MV5A 2YHSA 3LBHA 2X8JA 3CUTA 5JSFA 5DNWA 1VPWA 4DUGD 3GLHE 5FL7A 5BVGB 2BR3A 1TIPA 4RIFA 3LXMA 1Z6XA 3SXPA 2ZJ4A 4DYHA 1U3CA 4QOHA 1WUKS 3I04A 4JR2A 3JAKB 1J22A 2IXAA 3PPWA 4W5JA 1BN7A 1Z28A 2PLRA 4O4IB 2I4RA 2IU4A 4KQFA 1OXXK 2P2YA 3FPSA 1PNVA 3WLTA 5TXGA 1J23A 3PHJA 3A6LA 3EUWA 4DQDA 2LDXA 1OHHA 4D3DA 2R6AA 1DAKA 3SGLA 5I4KA 1D8TA 3BSYA 3ORSA 2Y1XA 4R9SA 3CSSA 1MOPA 5G0SA 1U5BA 3UAZA 1LU9A 4L0DA 3RD5A 3F49S 3F90A 4YS6A 1IBKB 1R9JA 2ODAA 2VTDA 3CY6A 3GJQA 3ZV6A 1C8KA 4Y2JA 2UYHA 1EFRD 4MLCA 3RF6A 4ME6A 2EKPA 3ROMA 4PYQA 4C4RA 5DN6A 4QGHA 3H9GA 3PQ5A 2HK6A 4EX6A 3RYFB 2JAQA 4KHPB 3BAFA 5IM5A 3TF5A 1V4VA 1UDCA 1U6IA 1HOXA 4WIAA 1ENPA 3ESCA 1FXUA 1P5HA 2D2EA 3P4UA 3RFFA 4G1BA 4LOLA 4C0XA 1YMQA 3PCXA 4R9NA 1RIIA 3EC1A 2ZYVX 2OHXA 3HDJA 4LXGA 2X5JO 4XR9A 4CKBA 1MRNA 3C8HA 3IUYA 4IJQA 4OP1A 5AKYA 2JW5A 2VNHA 3HYNA 1PSZA 3UUEA 3S27A 3V4ZA 1H2RS 2WFZA 1ONOA 4Z4QA 3B3AA 4XQCA 5CIWA 3ED5A 3MUEA 2QE6A 3K9FC 5A9SB 1RXUA 5EKUA 2GARA 2WV7A 3P2EA 4YRGA 1S2DA 4R4JA 4UUOA 2J09A 2AJLI 5KYVA 3RVMA 5A04A 3ASUA 5JT1A 2PHZA 1OLSA 3W4KA 1ZI6A 1QH9A 3OZRA 4JROA 1K9VF 2C5LA 2OXEA 3FVTA 4QUDA 1RCFA 4KIFA 4EJSB 5B7PA 4F56A 1QZXA 3HVIA 4RBNA 5JNLA 1Q2XA 3HS3A 2XSZA 3DVSX 5D01A 1RCTE 3VSEA 4IXDA 4RPCA 3L7BA 3L8ZA 5CCBA 4X6YA 1LY1A 1NW9B 3EZNA 4AX4A 3DNPA 4MDYA 4EVIA 5BN1A 4JT4A 5JS6A 1XQYA 4WFIA 4AW9A 3PDIA 3GI1A 1YUNA 3F96A 1O97D 1GZ6A 4Q3LA 2FJ0A 4H6XA 3MLBA 2CN1A 4DEVA 1UKEA 2ZCJA 5TEWA 3ZK7A 1IXZA 5HK9A 4GM1A 1DG9A 1QK4A 4RESA 5AMXA 3UMSA 1GLGA 4UREA 5FWXA 2GN9A 1F9AA 5HS6A 5J43A 2BMVA 4AIIA 1LI7A 1XMSA 1RLMA 2LIPA 4RAQA 5EIBC 1EX7A 1I4EB 5L8VA 1XHFA 2MINA 5C3MA 2IYAA 5K3BA 1Y89A 4EPRA 3AEZA 3SHOA 2HDOA 1KR5A 3IQDB 4Z6KA 2GRAA 4AVYA 2A30A 3EGOA 3OQNA 5IUJC 2A84A 2GN2A 4XPIB 4EAQA 5HQTA 1IQRA 3L04A 2HJVA 1S4MA 4BRUA 4Z4EA 4ML3A 3RV4A 1D5WA 2AR9A 4L8VA 5KNDH 2RSLA 5FLKA 3A27A 1CNEA 3PGJA 3ISJA 5TQ0B 2V0GA 2X8LA 3QLTA 4OG2A 1H1DA 1YRQA 2VRBA 2BFCB 3DW1X 3EC2A 4GSKA 2QRQA 5SZJA 1EVIA 2XYPA 4S0XA 5SYNA 2Q7OE 3CZAA 2ZJOA 3QYJA 5AKXA 4B6QA 2HFJA 2HEIA 3ZY2A 2V98A 2O2YA 2VHWA 2VZ9A 3AEKB 4MYHA 5U1PA 4F1KA 4OHYA 5K4HA 1CUEA 3UWDA 1JE1A 1H9CA 3ZCVA 3OY2A 4QG3A 4D3YA 3WWOA 2HQOA 2L69A 3GQBA 4I08A 1WE2A 1Y1QA 2CDAA 3U1TA 2VDKB 2P2CA 1TX4B 2OO7A 4N0PA 3VR1A 4CMKA 1GTRA 1M8FA 3IKLA 4ANFA 2W2MA 3SHTA 4KCGA 3FLAA 1J90A 2FY8A 3VX4A 2X0KA 4RNDB 4I50B 4ZJPA 2Y92A 3VC2A 2PZBA 2IS6A 1PLJA 5JE8A 1GOTA 4DMFA 1XZ8A 1V16A 1K7FB 3ZE7A 2WIDA 5KOHB 3T7IA 4RENA 3DV0A 4HTFB 3HY3A 1ORTA 4P0TA 3V4RA 1SURA 5GMOA 2HMAA 4DHEA 3BXPA 4P3PA 1JPNA 1BQEA 1QG2A 3FOZA 1H6DA 1FNCA 5BRNA 5FNZA 3MJRA 2IGBA 1ZMRA 3GFPA 3MT8A 3PPXA 2XJ4A 3D6TB 4MQFA 4ZTBA 3C7DB 3DBLB 3I1IA 3ZZNA 1AHHA 3CQ9A 3HA5A 3UFXB 3PFNA 3ETJA 1DKUA 3L8YA 3LGXA 1XHLA 4JSYA 1Z8NA 3KZKA 1SB9A 2D6FA 2CBZA 3PGKA 3W5SA 2EEPA 4A8JC 2M6SA 5JQWA 4HAIA 3RH0A 2ZYHA 3P0HA 4AZSA 3HXPA 2MSWA 3I1FA 4D44A 4TRRA 2UXCB 2XNSA 4PRLA 4OYRA 4R1LA 5JAIA 3HVRA 3P9CA 2P6RA 4CEJA 2NZJA 3R6LA 4BKMA 1MX5A 5HZKA 4JLNA 1H93A 2HCJB 1PD1A 3EIUA 1JLRA 2DHCA 1SG0A 3FDZA 1G20A 2ZIVB 1ZZGA 3W2FA 1TNDA 5A6VA 5K0FA 4X97A 2FP4B 3G9ZA 3HNOA 5DGIA 3O03A 4EG7A 3E2MA 4FPXA 4HNQA 4EP1A 1WF6A 4UMEA 3S2EA 5K0BA 4HFMA 3FYDA 3LHFA 1C1XB 1PWHA 5KQRA 3NBFA 4J07A 3B3QA 4RKWA 3F74A 5ERXA 1Z74A 4RANA 3PIIA 5TGZA 5JNWA 2YWXA 2Q41A 3ECSA 4CM1A 1GL7A 2ZUSA 5I7UA 4JGBA 1FJ2A 1T15A 1M10A 4ICIA 4JGGA 3C1AA 4NARA 2FPXA 4PYIA 5TMBA 1JS1X 4FHCA 3S6JA 4BZPA 1XYGA 1U7WA 4OMFG 2UZ4A 2C2ZA 1MGOA 5KOIA 2O0MA 1E89A 1ZJ4A 2C20A 2QR5A 4PG6A 2BM8A 3M2PA 1SEPA 1OI3A 3AHCA 4YMSA 3FLBA 4UZFA 4WCFA 4GBGA 1ZEMA 4IG9A 4ZQFA 4TYPA 1RXVA 4KQWA 4PYLA 2QVCA 3ZI4A 2XGSA 4EBBA 2A4KA 3C6KA 3MQ4A 2JHFA 1Y42X 3ZUPA 3T3NA 2QX8A 3JATA 4L3VA 4Q4HA 4ZKEA 1J97A 3O8CA 1GJRA 4YPOA 1ZVKA 3BIOA 3BM5A 3BCRA 4L78A 5FOVA 2IIBA 2YZGA 3G1WA 1KFJB 2VT3A 2JLZA 3VNBA 2HA7A 5JFGA 2X9QA 3D3JA 1NUSA 4A0HA 4AF7A 4OGLA 1CEXA 1C3OB 4G8JA 4I66A 6AT1A 3WKAA 3KYDB 1BMDA 1K4YA 4ZVKA 1EM8B 4KDEA 4HDSB 1B8OA 3INRA 5CDYA 1MB3A 2QPOA 2F1JA 2QGNA 4L74A 4OD0A 4AG5A 3IULA 3OC0A 1ZRNA 3DB1A 4A3SA 1SIOA 4O02B 3VQTA 4N41A 1E1QD 1D6JA 1NU6A 4J4TA 5AO9A 3HY6A 3PLNA 1VMKA 4UEKA 1NQUA 1PJLA 2W6JA 1NBEA 3ZD8A 5DW0A 3ZIAD 1OYVA 3N2KA 2PVSA 5FTWA 3N0XA 4HI0E 4UTOA 2GR9A 5IUNC 2H08A 4WK2B 4GH5A 4EDHA 4K9LA 4OYLA 4BL5A 3KZ1E 4EL5A 4BNIA 4JT2A 5JROA 2EFJA 4N47A 1YBAA 2YY7A 1LF5A 4CT0A 3GMIA 5CEJA 4IQ4A 1QC5A 2QENA 1AMUA 1DUVG 5JIBA 1MT3A 4OA5A 1FNSA 1MLDA 1Y48E 3ZZUA 1V9LA 2V3WA 5JTUA 2BKAA 2OG2A 1DX4A 4ARCA 1NNI1 1T36B 4NYMR 1U28A 3L7IA 1WSAA 4OB8A 2AEFA 4WW0A 1CRWG 1ZIDA 3DZHA 4H6VA 1U65A 2QRGA 5DLDA 4TMKA 3FCAA 4AJ1A 3P45A 3KQOA 4MI9A 3V8PA 5ALSA 1ZOOA 2ZETA 3E3AA 4RE5A 1JFSA 1JSXA 4WZ6A 1NY6A 2QRJA 3ON5A 1PFGA 1QJCA 1SRQA 3MUNA 4GOKA 3JAMA 2V6IA 3NP9A 3DAHA 3U80A 1M6VA 1P72A 1XZMA 2FEWB 3WHPA 4JI8B 4DR6B 1VPLA 4WVLA 2NIPA 3Q0TA 2HW8A 4QOGA 1YCDA 1G5QA 5CA0A 4I3HA 3D54D 3ZWXA 2F8TA 2WB4A 1GFWA 1GGNA 3OSZA 4M49A 3RU9A 3S2YA 4COOA 4HNRA 1XEWY 2IYFA 3U44A 3H9CA 1U3GA 4WOKA 1RYMA 4FFOA 1IU9A 4YP5A 1VCIA 2I99A 4RX1A 2VKQA 2XMDA 3M6IA 4UTPA 2I1VB 2X0IA 1SD5A 1UZMA 4OK3A 3DUFB 2Q4TA 3PQDA 2OHIA 2EKLA 1KORA 2BRUA 1NRJB 3E4CA 5IN5A 7MHTA 2DJIA 3GD7A 2B61A 5LWHA 2H59A 3AHEA 5CR9A 3RAPR 4W9NA 4B3DA 1Z22A 2PT7A 1UFVA 2QE7A 3I0MA 1ANKA 3MTQA 3NIBA 3T5MA 3GRAA 3TW6A 4DB2A 2JA2A 2EWVA 3B9RA 4P7KA 4PGFA 3CJQA 4DJDC 2C42A 3LKZA 3VPDA 4TXHA 3REQB 1YU6A 1R8QA 3DZGA 3CB2A 5HGJA 5F33A 4B4OA 3VKWA 4YIKA 1HDYA 4IHKA 1E18A 1ULSA 1Z62A 2IDZA 5LQDA 5EWMB 2TECE 5FBKA 4CVNA 4GPAA 1IZ7A 3DDHA 3E2IA 3G6WA 1NXOA 1E6MA 2WKWA 2VHQA 5EI5A 1II0A 5IDQA 3ROKA 4J0IA 1U0RA 1O8BA 2BMJA 1OCEA 1QH0A 1P4GA 1DB3A 2DFTA 2GM9A 3PX3A 4QJBA 4EBFA 3VZSA 2OEPA 3SR0A 1YVUA 5DLPA 2D2XA 2ZYGA 3AWIA 2H2HA 5ED0A 2ZREA 1WVMA 3H7AA 5EMNA 3UWOA 121PA 5JC8A 1JHMA 1X7WA 2WM3A 2DG2A 2BFOA 4OIMA 1C14A 1QYDA 1SBZA 3Q98A 4P36A 2ZJZA 3KKEA 1XVAA 1NXPA 3SF8A 3K8ZA 2XT9A 4NKRA 5C4IA 5KKCA 2Q4DA 3ICQB 1D6SA 2IEZA 4KGDA 4QXQA 1M3SA 3O3MB 1ORIA 2DMRA 1UK8A 4JC0A 4UHEA 1SXJA 3HDGA 1AVTA 3CPJB 5TS2A 3SZRA 1T5TA 3LT5A 1U2ZA 2OFOA 2C61A 2WA2A 4JP2A 3PXBA 4DGQA 1ESMA 1SUFA 2B1GA 4GT1A 4IKOA 3RK4A 2ODPA 4ASUD 3DE0X 2AVNA 5K7SA 5H3LA 3BWDD 4TYWA 3U4HA 3O47A 4CIAA 3VH2A 1BRMA 2FEXA 3CEAA 1NVTA 5M5BA 2QZPA 4FDLA 4XWGA 1LA2A 4EPYA 5C5EA 1V7ZA 2PJUA 4LVOA 2F8LA 4BB6A 1QE5A 3E82A 5A4MS 1UXOA 4BWGA 2ZYIA 1ZD1A 2BLLA 2IU6A 2OY0A 2DWOA 2ZB8A 3EAFA 4NI5A 4YK7A 1TIKA 4M0FA 1E60A 3CH7A 1D4FA 2I6XA 5FYQA 5THQA 1EUDB 3RAFC 4ZTZB 3RK0A 3I1YA 2WEKA 3R5JA 4H1HA 4HYQA 1Q1AA 3QKRB 1E2KA 4F8YA 1KRWA 2HWYA 1YL7A 5CX1B 2YWDA 1XC7A 1E5DA 1G17A 3E9DA 1DU4A 1SQGA 4J9VA 2QWXA 1O9BA 4XSGA 4AX8A 4BNUA 1NZFA 2ORIA 2A5YB 2V4UA 3DGFC 3BQMB 4ZT2A 1NOIA 1W2HA 3DYBA 4MR8B 4F0JA 2OCIA 3X1MA 4O2RA 1V8DA 3DJFA 3WS7A 3W5BA 2GKGA 4KRFA 2GN0A 1BD3A 2R6R1 2XQJA 1ZR4A 2Y71A 2PUJA 4IIJF 2FYTA 1KDZA 1REQB 1FMJA 3TOVA 4AC9A 4NX2A 2C3OA 2J6IA 3LC7O 4L22A 2SICE 4UOEA 5I8ZA 4DV0B 1ZWLA 4TROA 4KBFA 2OBBA 1A3CA 5GINE 4JC5A 3Q5GA 3BL5A 3DF7A 2OGTA 1B73A 2GUWA 2QM3A 4L85A 4UDYX 5EUCA 5CA1B 1K75A 1MIOA 4HUQA 3HXLA 1Z08A 3LP5A 4G1CA 5CVEA 1CR0A 4P84A 2X9GA 4LUCA 4QU9A 2PGLA 3R74A 5IFKA 1IATA 4MQBA 4DCGA 3PEVA 3VV2A 1QP0A 1GU7A 1NQOA 4NZMA 2Y0EA 4ZHQB 1Z5OA 4BP3A 3U3ZA 1PQWA 2EJBA 1VDMA 2Q07A 5JO0A 1V1RA 4D9BA 3H5NA 1LPMA 3LNCA 1J8DA 3EPPA 3H5WA 2FWMX 2XNJA 3H2KA 2Q3JA 5LLDA 1OZFA 1EVYA 3CTPA 2BEWA 4PG4A 1D2GA 3ZS9A 6NULA 5K8UA 3IDOA 1VIDA 3I34X 5EXPA 2PUCA 1C5KA 1I6LA 3CBQA 1IFXA 2V59A 2G0NA 4RDCA 4KG7A 4C6HA 3VHRA 3JD2A 2A9KA 5F1KA 2G36A 3AW8A 2VYCA 2QXUA 4O4IF 3PEFA 4HBZA 1OX4A 4N0DA 2AZXA 1RHQA 2RHJA 3NC4A 2PKQO 1A7AA 3O91A 5FTNA 3DO5A 4KMMA 1E0SA 5KVCA 4L95C 3VNQA 1XVLA 5G0TA 4XVQA 2HA3A 4RFSA 2ERXA 3W4JA 2D00A 1AT1A 3RJ5A 4CLRB 3SQWA 2DLCX 4G5QA 5T7BA 2P6UA 3IHKA 4DMLA 3UIEA 3OCVA 4MAMA 1A2KC 1OROA 2EJUA 1W5BA 1V1MB 3KEMA 3LQ2A 3V8RA 5CLGA 5LA6B 4JCOA 3DEHA 4PYOA 4FWTA 2XB6A 1I80A 2BHLA 2XGOA 4FT2A 1OVMA 3AW9A 4J1SA 3V2GA 9LDTA 1H94A 4G97A 4E7PA 4P22A 1IPFA 1ZSVA 3UJBA 4LF7B 4Q4LA 3K0FB 3OFNA 4LRUA 4QUKA 4G8BA 1FRVA 4OKIA 5KJ6A 2CLDX 1AS3A 2QZZA 1VG1A 2HJ9A 4HQFA 4HX2A 5CT6A 3ZGXA 4MV1A 3O94A 5ALVA 4K9PA 3LY7A 3GVIA 3FCUB 5ICCA 1U7UA 3D4PA 5NLLA 4YVFA 3CV3A 2GX6A 3C14C 3D7RA 1V9SA 1VG0B 3OESA 5GVSA 1KVSA 1CY6A 2OZLB 4UM8B 3VYRB 5JS8A 3IVGA 5EZQA 3ENWA 2HPAA 3IXLA 1RP7A 5DBGA 2OMKA 4Z7NB 4AT1A 3OF3A 4DRXB 2Y0DA 4YV7A 3KEFA 1GQ2A 3DL0A 3IIEA 3BMCB 1WZIA 1JQKA 2C2OA 4GPEA 4J8PA 4ZCLA 4CN9A 1UF9A 3OLWA 2IBMA 4CUZA 2PLFA 4JGIA 4CKCB 1XCGB 1XWWA 3D1JA 1C8BA 3BD7A 4MB2A 1ACLA 3KXKA 1C1HA 2ZU6A 1CUSA 1EQUA 2W2PA 1HY3A 3LX8A 1ISMA 4LZWA 3SHQA 3SHWA 2QU7A 1QU2A 5ERGB 3WJ1A 3N86A 4WNAA 5FI1B 2IIVA 4GBMA 2W83A 3UM9A 2QW1A 4YNBA 4QQNA 1U7OA 4E13A 2XIJA 3Q8MA 5AVYA 3NT2A 1JDVA 4JENA 4IHJA 1KBOA 2Q1XA 3NB0A 4A8TA 3UJPA 3LZ6A 4A5SA 3RT1A 2X6TA 4FFWA 1W1UA 4GWGA 2GAIA 5G41A 3EVEA 5IPFA 1VTKA 2DTXA 3C5EA 3SX2A 2XUHA 3PQFA 4B6OA 3I01A 2AOVA 4GLOA 1BS2A 2QUBA 2G17A 2VEDA 4ZO8A 5CEFA 4FCVA 1T8RA 4LDPA 2H1SA 1FDTA 1KEKA 4XX1A 2LDBA 2NO9A 1I8TA 3AHIA 4AURA 4TLDA 3Q8LA 3AR6A 4D25A 2DT8A 1ZS9A 4K03A 3E3LA 3DCJA 1CIPA 1U2SA 3X1DA 2MHCA 3EXEB 2BR4A 2BP7B 5DXJA 3ROGA 4W6QA 4BEBA 4ZZIA 1O0CA 1FJXA 2DCMA 1YK0A 1ZO8A 2IQIA 2O2JA 3KPJA 3BKWA 3OPVA 1SOUA 4NMHA 3CRVA 1GU1A 2YYSA 4Y6OA 1RAIA 3I2YX 3Q85A 3W79A 4NENB 3MNFA 1EKXA 2R4TA 4PVDA 4PQGA 4E09A 4HD8A 2AG0A 5FDFA 2O8FB 3NT4A 1VBKA 2ZTUA 4J1TC 4XOIA 2BGKA 3OF2A 1HA3A 3HUFA 4X54A 4IH9A 4EW1A 3IOMA 4Q7EA 1Q0HA 1GD1O 1VI2A 2JLVA 1PSDA 1XKXA 2DC1A 5CBPA 1R74A 2V7QA 4G1UC 5AKLA 2ZK7A 3VAYA 2QTFA 3HM9A 3MSXA 1T29A 2AW3A 4I50F 3OKPA 3G0OA 1MDFA 2NW6A 3NBAA 2VT6A 2IXEA 3WZMA 3HZZA 4AMBA 4BKPA 1IXRC 1UDXA 3W8FA 1VPVA 5DNAA 4YUWA 1QH8B 3MOGA 3NOVA 3HGTA 3IPAA 1F1BA 2JFQA 2DULA 1E7QA 3EQ8A 5C81A 5IF9A 2H29A 2RK4A 1P1CA 4F4FA 2ZUFA 1EK1A 1SCUA 2M1ZA 1D2AA 3ZE6A 1YR6A 1X7YB 1ZCAA 3GJSA 4YRRA 5I4CA 1VP3A 1JT9A 2F1KA 2CNLA 2HC9A 4IJ6A 1NBAA 4E51A 3AUFA 2XLBA 2FPUA 1E63A 5EHIA 2GCNA 1F7VA 1LNSA 1Y6RA 3G5AA 3IOEA 3G9TA 4EZIA 4XUCA 4POOA 4BLWA 2HTFA 2OCDA 3ABIA 4HDMB 4I1YA 2ZS8A 3AR7A 5GM2A 3KSAC 3IPLA 1AB5A 4KPUB 5AFSA 5IZCC 1SHUX 1RI2A 3AEQA 3MYYA 3PE6A 2JIBA 4CF4A 3PF8A 4DA9A 4MIEA 2FMIA 3QKUA 4XWYA 5SZHB 2UVQA 3Q9NA 4URWR 1TQ6A 3HCOA 2C9OA 3PQCA 3KPUA 2IV7A 1HK7A 5M04A 4MHTA 2IV2X 1U4SA 1KJYA 2VPZA 2WAXA 5JHGB 3KQKA 2GWHA 1C1DB 3NJ4A 1SMKA 4W5RA 4AJ4A 3PHHA 3OQ1A 3GUVA 2QTBA 2EHJA 1I32A 3LECA 3L1IA 2EW1A 3TSWA 4QBKA 5AW1A 1JG6A 1RTTA 4Q4CA 3GFBA 1OC4A 3T4UA 4MKZA 5FBVB 4V3CA 2F2TA 3LS2A 1UMCB 1PZGA 4IIBA 4FMDB 4KIGA 1LZKA 4NS1A 1E99A 4CKXA 3BTUA 1E1RA 3ETEA 2JKYA 4PXAA 1KL7A 1HLGA 5C2JB 1WOYA 2VPPA 3DDNA 2N9UA 1BU8A 1SO8A 4PBSA 2FWPA 2JARA 1DKPA 3HDTA 3IPYA 2CFTA 2XE6A 2YIVX 4O0LA 1QOZA 3FGOA 4QBIA 5LLTA 1UC5B 5BXQC 1VYUA 1VI6A 5I9SA 4WOJA 2AN5A 3G89A 4YJDA 5EXTA 4R83A 1XZIA 4L5IA 1ZD3A 2PPLA 4O2AA 3A9RA 1E3MA 3D5QA 1K08A 4TKMA 2NZWA 4DR2B 4AO7A 3R3WA 4E21A 3LWZA 2R2GA 3TMKA 3UT5A 5JY1A 2Y4OA 4P1ZA 4KE7A 1PT5A 1IHXA 1OZGA 1NG1A 4DKJA 5AKEA 5BV2P 5IC4A 1N7HA 1NMZA 3BMXA 2D4HA 1V5WA 1KF0A 4EY3A 1YA6A 3OCYA 3AHGA 1Z6AA 1HL3A 2PG3A 4HC4A 3MMZA 3N39C 4FHZA 3NCHA 3AP1A 4IGIA 3WGVA 3TJZA 3HCNA 2KSQA 4IAOA 4P3OA 2XH8A 1JQ5A 2KE5A 2WHYA 4KN5A 3VZBA 3QU7A 1UL1X 1UMBA 2IPXA 3CISA 5B1EA 5BYJA 5IP5A 4LF4B 4ZEWA 1Y9EA 2QAGB 2XQGA 1HTWA 1LTQA 2HCTA 3KZNA 3NANA 1XALA 4MR9A 4YMGA 3CHYA 1JNXX 1HG0A 3EXG2 3SZOA 5IANA 2O8CB 3OZTA 2VNKA 4MMZB 1ZNQO 1RRKA 3N75A 4B6SA 3OZFA 1HG1A 1ZW1A 3NCTA 1USGA 1WPRA 1AV7A 3VHXB 2FPMA 3Q1LA 2OFFA 1QIGA 2YJ5A 3DMDA 3O8NA 4KNYA 2V9ZA 3LJKA 4HSEA 1H4TA 2WDZA 4QYWA 3O5AA 1MAWA 4J6FA 2RHTA 3EFHA 3H2GA 4TVOA 3OVMA 1QYCA 721PA 1AUOA 3I9V6 4EHNA 1M6EX 1T2AA 3CWQA 3JTMA 3RK1A 3RC3A 4IIUA 3WLPA 2R66A 3DDUA 4JKOA 4YGYA 4OHCA 2J5QA 3ER8A 3UTCA 4KODA 4GZLA 1B15A 4B46A 5AR1A 3I3SR 2JPDA 3VYSB 1ZJYA 3FNHA 3N2IA 4PLGA 2WF5A 2CWDA 2WSSD 1CZNA 4MI6A 4DLZA 3PUXA 1DC6A 5FRDA 1CUYA 3OCUA 1ZAKA 3C74A 2BHNA 2EGHA 5CH3A 1V71A 4ZDJA 1HYBA 3HG7A 4IM7A 2QDXA 4GX1A 2XOXA 1PJZA 3ZXXA 4OHBA 1KIMA 3KQYA 4TN1A 2QK4A 1MO5A 3RV3A 3ZGLA 3E9QA 3TNJA 1HUQA 4KQXA 2FZ5A 1L8XA 4Q9AA 1ZJZA 3GNQA 1IG3A 3OZAA 4KGXA 3CE6A 4YJGB 2Z2IA 3NHLA 5EIHA 1P1KA 3RSZA 1PT9A 3DZDA 2XYGA 3UH1A 3JASA 2IZ0A 4KREA