4D7AA

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda, in complex with amp at 1.801 angstroem resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
243
Chain Sequence
SVVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPGFGAATMVTATFGFVAVSHALKKMMAKAARQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA THREONYLCARBAMOYLADENOSINE DEHYDRATASE
publication title The Crystal Structure and Small-Angle X-Ray Analysis of Csdl/Tcda Reveal a New tRNA Binding Motif in the Moeb/E1 Superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 83
structure length 243
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d7aA00
1E5QA 2GZ1A 3NJ8A 3OIGA 4Z0PA 2RAFA 1HDXA 4XZ3A 3C1OA 5IZ4A 2UAGA 3S55A 4IDCA 2WD7B 5HS6A 3OQBA 4J1NA 1EQ2A 1F12A 3FTNA 3ANMA 3ZHYA 2EEZA 4J4TA 2VZ0A 1JVSA 4II2A 3LT4A 2DU8A 3IUSA 3UW3A 2E6UX 1X14A 5BR7A 2FOIA 5B37A 3ORFA 1LQUA 4JK3A 1GY8A 1C0PA 3NTQA 2HK7A 1LDNA 3U4IA 5KCZA 2VRCA 4J6FA 2X9GA 1PSDA 3VH4A 3FI9A 1YGYA 1F0YA 4IJUA 4KTTE 1ZMOA 3CSDA 5JYEA 4JNKA 2Y1OA 3I4FA 4BS9A 4F3YA 4Q3AA 4A26A 5A3JA 4YJHB 3WJ7A 2I65A 1YBAA 1VJ0A 3HG7A 1HE3A 5DBGA 2AQKA 1E6UA 1E3WB 2J5QA 2EP5A 3HN7A 1YJ8A 1MLDA 2V7PA 4XA8A 2BFPA 4BVAA 4IS3A 3PK0A 5ER9A 3ZZNA 2PNFA 3EC7A 4PLGA 3CINA 3WMWA 1CIVA 3DFZA 2P9GA 3C1TA 4J49A 3HDJA 2IRWA 1XSEA 5AVOA 3STHA 3WSWA 4BO0A 3W4IA 1TI7A 2A4KA 1R0LA 2DAPA 4D42A 2PA3A 3HZZA 3ITDA 5DZSA 1A5ZA 1QV7A 2OMEA 2DLDA 2NQTA 4DLLA 2CVZA 4PZDA 5JC8A 4CV3A 3D4NA 4ZQFA 3U62A 2OZPA 1E7SA 3IC5A 1H5QA 4BQRA 4R01A 6LDHA 9LDBA 1ADGA 3R0IA 4CM4B 5G2OA 4MIOA 3WX0A 4E2XA 3OICA 1GL3A 3H2ZA 2I99A 5JDIA 4R41A 4N5NA 3KXDA 1T2EA 4UUOA 5H81A 3ONDA 1UXHA 3HWRA 1U9JA 4MVJM 4C7JA 3NJ4A 2FHSA 1DRWA 2Y93A 4FCCA 3IJPA 1RJWA 1V0JA 3M6IA 4W82A 3I6IA 1DXYA 3ZWAA 4MKXA 1EUZA 2O3RA 1PWXA 4XKJA 1YS4A 4E21A 2JCYA 4YTEA 2ZYAA 5BSEA 1PWZA 3RVDA 5EPOA 1D3AA 2C20A 3TZCA 1P3DA 3SC6A 2VHXA 4PLHA 4XJTA 4II3A 3LF1A 5T6BA 1E1NA 3Q0EA 3PDJA 4IBOA 4MVJH 3B1FA 5A3VA 1BXGA 2E82A 1JA9A 2OGUA 2V6GA 3X2EA 2D0IA 3N58A 3QLJA 4GAEA 5IDWA 1F17A 3H9JA 1ADCA 2D5CA 1LRKA 2CDAA 4QECA 3QQPA 4GLLA 1NR1A 4D3DA 4WCDA 3I5MA 4RVDA 3GGPA 1K5HA 1KVUA 4IINA 3VH1A 1LX6A 2W2KA 1NQTA 1QYCA 4CODB 1PQUA 2JKVA 1PGOA 1MP0A 2Q2WA 3QA9A 4BNTA 3HE3A 3JQFC 2Y1EA 3TNLA 1Y9EA 1T2AA 3DBLB 2GLXA 3G1UA 3Q9NA 5DDIP 1JLLA 2R00C 4GMGA 4BIIA 2VT2A 1U7TA 4BGIA 1LNQA 2TMGA 3F5SA 3OFSA 4BO3A 1B7GO 3JCZA 1LLQA 3ABIA 1DSSG 2AQ8A 4B7XA 5U1PA 2VOJA 3MOGA 1JU9A 5IJZA 4B3JA 5IDXA 1EK5A 1XYGA 3DOCA 5EERA 5HRUA 4DBVO 1U3UA 5AXDA 2GERA 5EN4A 1N9GA 4PG8A 2X0JA 1WLYA 3PHIA 4PLTA 3T7CA 2AEMA 3PQFA 1V6AA 4CV1A 5TLSA 4WLFA 3QE3A 1CJCA 4FFOA 1LEHA 4E31A 1LLUA 4PLFA 3ZI0A 1Y5MA 2XF8A 1KOLA 4IGEA 2H6EA 4DXHA 2HRZA 1EDOA 2JFFA 4YRAA 5BNFA 1NFRA 2J6IA 5EL0A 1QYWA 2QZ9A 1J6UA 4BO6A 1HDGO 1UUFA 1BMDA 3VDQA 4BO2A 1C0LA 1NX6A 1VJ1A 5FF9A 4CMEA 3GN2A 2NTJA 3AFMA 1Y8QB 3AM4A 3BHJA 3KYBA 5B4VA 3GDOA 3I23A 2W2LA 1YDEA 4RLHA 2FR0A 1HTBA 1BXGB 1ONNA 2YJZA 2XXJA 4L9RA 3EZYA 3W6ZA 1O9BA 1IPFA 4BGEA 3DZJA 4PLVA 4JBGA 4PLPA 1ML3A 3FPCA 4TRJA 1B26A 3ZWPA 1MC4A 2BMAA 1IZ0A 4PRKA 4CM9D 2W2KB 4NBTA 4C7KA 4OJNA 4P8RA 4RVSA 1YDWA 2YHIB 4NZ9A 2I6TA 3B20A 3OECA 3GLQA 4OXKA 4AJEA 5IDYA 2X23A 4Z6KA 1F8FA 2HO5A 4CMIA 1NFQA 3ITKA 1BSVA 1YB5A 3TRIA 3SEFA 3KSDO 1ZK2A 4BO9A 5A4DA 4MVJI 4TMFA 4DPLA 4URFA 3C7CB 4IIVA 3WOHA 4DIOA 1JN0A 1TLTA 3FPLA 4NU6A 4CM1A 1T24A 1KVTA 3ZH2A 1JWBB 4LVUA 3ROMA 5DCUA 2EKQA 1P1FA 3RU9A 2PGDA 4L73A 4FC7A 4LK3A 5COBA 1KEWA 4AJ2A 4BNGA 2GR9A 1O0SA 3JQFA 4IQ0A 2OORA 3INTA 4KUHA 1PJCA 2Q1WA 5AXAA 1KEPA 4EUEA 3U5TA 1NFFA 3F1LA 1WMAA 4ZQBA 5FYDA 4DL9A 5DNAA 5BNIA 1SEPA 1ZMTA 3DBRA 4KWIA 2Y0DA 2OO5A 2ZJ0A 1SBYA 3Q2IA 3DZFA 2PGLA 4UVDA 4EEZA 4WECA 4NR0A 3JQ8A 5G0WA 4OQZA 5JCJA 5G4KA 4O0LA 3ETDA 1DRVA 1TT5A 4WOJA 5JAMA 1TVEA 4W9NA 3NDJA 2IYPA 4DYVA 1YWGO 3HDHA 4NBRA 1GAEO 4CLEA 4PIVA 2V6BA 1BDBA 1QSGA 1N1EA 2Y1GA 3H9QA 4I9UA 4I1IA 1SO8A 3DR3A 4RQTA 3NT5A 1EBFA 3E18A 1DB3A 3LZ6A 2XXBA 3FSRA 2HJSA 2JL1A 3RWBA 4A5OA 3IAHA 2JCVA 4U6QA 4L74A 3HSKA 5CDUA 3W4JA 3VPSA 2JJYA 1V8BA 1V9LA 3IQDB 1D8AA 3I3OA 4M49A 4YJGA 4Y6PA 3RUFA 2IZZA 1H93A 2YW9A 3OEYA 1HSOA 5JMWA 1EVYA 3GFBA 1I3MA 5L45A 4ND4A 3AU8A 5KVCA 5DBIA 3QW2A 3P2OA 3PVZA 1WDMA 3IDSA 2Q1SA 3P19A 4YWJA 4OAQA 2I3GA 1I10A 3E82A 4XGIA 5DOZA 5DF1A 4CUJA 5L3ZA 5TJ9A 1WPQA 4BKRA 1I01A 3L6EA 1MFZA 2Q2QA 2QRJA 3EY4A 1SB8A 5GMOA 3F47A 4KUEA 2BELA 3FR8A 4GVXA 1TXGA 1UJMA 5IXYA 1SOVA 1CF2O 3TPCA 2ZATA 1ISFA 3EVNA 3AY7A 2NU9A 1YQDA 3F1KA 4NI5A 1IULA 4QXMA 4Q3EA 4P22A 3K6JA 3UVEA 1NPDA 4GVLA 5JC1A 3OETA 4QUKA 2VTEA 4F45A 4XWYA 1KY4A 5L4SA 4D3FA 3DBRB 3FCOA 4RVFA 3RI3A 4WE3A 1DLJA 1Y1PA 3HFGA 1PGQA 3ON5A 3H5AA 3TFQA 3JQ9A 1L1FA 4TKLA 3JQ8B 5ITVA 4R3NA 3A14A 5G4KB 3SC4A 4MP3A 1TT5B 1HLPA 3RBVA 1DHRA 4WGGA 4K9DA 2Q3EA 2D4AA 4ZU3A 2YDYA 2D8AA 3JTMA 1B16A 1ISJA 3FBTA 1RYDA 1HL3A 3V2GA 4H3VA 4HP8A 5LC1A 3DHNA 4RPKA 3VPFA 4Q3DA 3PLNA 5IG2A 4R9SA 1M6WA 2HMSA 1OZAA 2IE0A 3OMLA 3PHJA 4AJLA 4Y8VA 3D7LA 1ONPA 3UH1A 3RROA 2DTEA 3E5RA 4GI2A 3R3SA 2NU8A 3WDSA 5GZ1A 3CMMA 3JYOA 4MIYA 1G0OA 1YBMA 3D4PA 4MVJD 2J3KA 1TT7A 2NSDA 3A06A 1KYQA 1N1GA 1RWBA 3RKUA 3KVOA 5C3MA 1MA0A 5A1TA 4YT5A 4HX5A 1HF3A 4IZIA 1ZFNA 1FDSA 4IDBA 4OL9A 1LI4A 1RPNA 1LBEA 4PZCA 1SMKA 2B5WA 2PKRA 1ZKMA 2VYVA 4EDFA 1PZEA 3KHUA 2UVDA 2Q49A 4XIYA 2ZYGA 2VUSA 4JJGA 3SLGA 1N2SA 1KS9A 3T7EA 1NVMB 1KERA 3HN2A 1R66A 1VSUA 2O3JA 3A1NA 2DVMA 3LK7A 4NJMA 4DREA 3PPIA 1P1JA 3GGOA 1LLDA 2G1UA 1PS8A 4GH5A 4ALLA 4MINA 1F06A 2VWPA 4BKUA 1HRDA 4K1LA 4UUNA 4BMVA 3FRJA 4UUMA 3ADOA 3VOSA 1LRJA 3JD4A 3EK2A 2PGJA 3FNHA 3ZNQA 3I9JA 1MG5A 4R9RA 4RGBA 1T2CA 4OKNA 3HQ4O 1GYQA 1I8TA 2A35A 3DOJA 3FWZA 4BNMA 3N74A 4IDEA 3PFWO 4E30A 1SEVA 1ZW1A 1BW9A 1E7MA 1DFHA 1HXHA 1I33A 1R37A 3AUSA 4Q3CA 1P74A 4QEDA 4XQCA 4QFCA 5COAA 1C1DA 3UCXA 1R6DA 4OHUA 3OJ0A 1E7YA 1DO8A 3OJLA 4OKIA 2ZB3A 4L76A 4I8XA 3PI7A 3OBBA 4CQLA 1O89A 1W0CA 4BMNA 5TF4A 7ADHA 5H82A 3ULKA 1M75A 1HZZA 3ZW9A 4CUZA 4XYLA 4AL4A 3JQ7A 2EKPA 3TL2A 4Z0HO 1E7WA 1E7QA 4J3FA 1LQTA 3CIFA 3GZNA 3KRTA 1V3VA 3Q6IA 3O8QA 1X0VA 3OJEA 5JE8A 1XCBA 4EEXA 5ENDA 4BNKA 1M6HA 2FPGA 2OHXA 1T2FA 4ZQHA 3RC1A 3WGYA 3JQEA 3JQGA 2VWHA 4JX8A 4N7RA 1RM0A 1TB4A 3ZHZA 1HDZA 2DKNA 4LRTB 2JHFA 1JKFA 1P1IA 3Q11A 4HFRA 3SX2A 2X7HA 3ENNA 2O2YA 2NTNA 1DFGA 2AW5A 4HFNA 4RO0A 4YJDA 3O9ZA 3H8VA 4ZD6A 1GEEA 4A73A 2BFOA 5FI3A 4IZHA 4ONEA 4LW8A 1E77A 2IXAA 5KKAA 1DIAA 1GUYA 2FSVA 2YDXA 3WQRA 1XU7A 2DTDA 2D2IA 3JYPA 2Y67A 5G0VA 2O4CA 1H9BA 3ROQA 1AGNA 1DDOA 4P4NA 1R16A 3LU1A 1M66A 2O3SA 3AK4A 4XYGA 4D79A 1YONA 2FP4A 2C2XA 1ZCJA 2LDBA 2E37A 2VNAA 1GQQA 4M89A 3ZV4A 2AMFA 1BW9B 1TEHA 2O50A 3ZNNA 3WLEA 4YPOA 4I5EA 4MVJP 5JNLA 1VL6A 2FY8A 4WPGA 1VSVA 5DBFA 3RD5A 5JYDA 1B14A 1GTMA 4S3MA 5A9SB 4KQXA 1M67A 3FNEA 4Q39A 4QO8A 2VWQA 4YT8A 1D4FA 2ZYDA 1HE2A 2Z1MA 3H9GA 4OOFA 1NR7A 2YQ5A 4QTZA 4ND3A 3OQ6A 4O59O 4BGUA 4IQ8A 5KWEA 4YVFA 1J49A 3GVPA 2I67A 3QVXA 1U28A 2EERA 1K6IA 3JQ7B 3NDIA 4XRRA 3KM0A 1LSJA 2O7QA 1SC6A 2OUIA 2WTBA 5K6AA 3WQQA 1LDMA 2BGLA 3BMOA 1RKXA 4CM5A 5T8KA 2AQHA 4FJ2A 4ND2A 1UP4A 2GGSA 2GSDA 4RPJA 2NADA 5L7WA 1E3EA 3GZNB 3L9XA 1IY8A 1GDHA 2EF1A 4P4LA 4GL4A 3UGKA 3NUGA 1DC3A 1NTOA 3L4BC 4BO5A 4NFSA 4XDZA 1EFKA 4QQRA 1PJTA 4YAIA 3DZIA 4MVJG 3ONFA 3VPGA 4D46A 4ZVVA 3OF2A 3JQBC 2NVWA 1QORA 4H7PA 2FPPA 1Y5RA 1MC5A 2WSBA 4DLAA 2WE8A 3C85A 3AUAA 1K0UA 1LRLA 1LUAA 2ZCUA 3F4BA 4XGKA 2IEDA 3IUPA 4TRRA 2HJRA 4D0RA 3RC2A 1HKUA 1U8XX 2PZKA 3KETA 4DGSA 4IXWA 2GN6A 1NHWA 4FDAA 3TZ6A 5KKCA 3ONEA 3C8MA 2B4TO 3UICA 4JXKA 3VVCA 3X2FA 2BI7A 4FW8A 1P31A 5CG1A 2C7GA 4HFJA 4UVGA 3OHSX 3NV9A 2BLLA 3PQEA 5T5QA 1X7DA 3GPDG 4XYMA 5TSDA 3KV3O 7MDHA 4KMSA 2P2SA 4RLSA 4QSMA 3PWKA 1UZMA 3T4XA 5A06A 2CVOA 4WEOA 2JHGA 1YQGA 3RC9A 3KYCB 1U3TA 1PJLA 4RJTA 3KYDB 2BD0A 3KTDA 2O23A 4NBWA 4M1QA 5ILOA 1QYVA 1IE3A 3JQ6A 2CD9A 1YL5A 3GC6A 1NPYA 3PJEA 5IXSA 2Y0CA 1YH3A 1ADBA 2PFGA 4EJ6A 1HDYA 4AJHA 4JQCA 4J0EA 1ISIA 1ORRA 3O4RA 3FWNA 1B3RA 3BMOB 1AN9A 5JY6A 3GUCA 2VT3A 3FN4A 3TN7A 2UYYA 4CM4A 3H65A 3DZKA 2HMUA 3IJRA 2C5EA 1EVJA 1NP3A 5GY7A 4DQVA 1PZFA 3GFGA 4Y6SA 5THQA 3HB5X 4DMMA 1GU7A 3TF5A 4E0BA 2WEKA 4EI2A 4FJ0A 4MP6A 3WS7A 4ID9A 4CLHA 4UEKA 1WDKA 1A72A 2FZEA 3RSHA 5H83A 3FNGA 2DC1A 2PH5A 3KEOA 1SCUA 4RDIA 1UDAA 1ZNQO 2AHRA 1ZIDA 1PEDA 1WWKA 4M87A 3WFIA 1WDLA 2YV2A 1PJQA 2O48X 1E1LA 4W99A 3ZHXA 2Y99A 2Q4BA 1QG6A 5TIIA 3WTBA 4WKGA 3LLVA 4CJXA 1N8KA 2QG4A 3W4KA 2Q50A 3SBOA 2ZJ1A 1KC3A 1A7KA 3P7MA 5DCWA 3B70A 3JQBA 4MPDA 4RF2A 3BHMA 3O26A 1PX0A 3ZU5A 4K6FA 5C7OO 5MGBA 1NVTA 3WWYA 2CNBA 1NM5A 3DTTA 4AJOA 5JO9A 5AXCA 5DT9A 5I9NA 2UUOA 3VZRA 5U9CA 3QWHA 3DBLA 4UREA 3MJTA 4R1SA 3OQ1A 5KJ6A 3GDGA 2X58A 3FD8A 3JD2A 2GUGA 3FTPA 2Y1DA 4JLWA 3I9KA 2ZK7A 3WLFA 4IJVA 3N7UA 4PRLA 4XGNA 3ZWNA 5GZ3A 4P38A 1P1RA 3SLKA 1I3NA 2Q1UA 1T4DA 3PHHA 4BNNA 4J90A 4WLOA 2G5CA 2ZTMA 3CTMA 1XQ6A 3HNPA 2BFAA 2G76A 3F3SA 4CR8A 3WYEA 5JAIA 1EUDA 1NHGA 3RUEA 1LJ8A 4IQGA 4DWVA 4PLZA 2X5OA 1XQ1A 1JKJA 2ZB7A 1EZ4A 1ULUA 4K26A 1OOEA 4TQGA 3ZU2A 4YT4A 5F5NA 4YDRA 4ALMA 3ZV3A 2YV3A 1BHSA 4DTIA 4FJ1A 3DMTA 5L40A 4DUPA 5BNTA 1BXZA 1IHYA 1Y8QA 3GY0A 2JCXA 4NMHA 1Q1NA 2HMVA 1K3TA 1N92A 1KETA 3MJCA 4Y9DA 1JAYA 2VYND 4M55A 4NDNE 4HUJA 4GWKA 3KB6A 3VVBA 2AA3A 3Q2KA 1DHTA 1FDWA 2EG9A 1DC5A 1VRWA 2C0CA 3Q1LA 3BTOA 4G81A 1ENPA 3L0DA 4GSLA 4JBIA 4LN1A 4PLYA 4RV9A 2E48A 3ICPA 3FF4A 4WK6A 2GPTA 1R4MA 1AE1A 2R2GA 2YHIA 3DAGA 2HAEA 4WLEA 3G1TA 4EGFA 1HEUA 1GYRA 1JQBA 3RASA 1S7CA 2BGMA 2FR8A 5TNXA 4L75A 4F46A 4Z3DA 3UCEA 2HMWA 4D41A 1WVGA 3R6DA 3NKLA 1R15A 4N5LA 2X9NA 3PWZA 3E9QA 1Y81A 5JSFA 3ZV5A 5CDYA 2GYYA 1DFIA 1H0KA 2I9PA 3C1AA 4LMPA 3QJ5A 4RPLA 4WASA 3E8XA 4JIGA 1UXIA 4Q3NA 3WICA 3HUDA 4GMFA 1YB4A 3GT0A 5L7TA 1NVGA 1ZK0A 2NQ8A 1ISMA 4IM7A 4J2OA 4KUGA 2X0NA 3I6QA 5A5EA 4OXNA 4AVYA 3I1JA 3KOUA 3V5NA 3TOXA 5K9ZA 3PYLA 1HDCA 3GHYA 2ZKLA 2G82A 4IS2A 5AOVA 5I8WA 1MFPA 3A28A 5CPFA 4J1QA 2PD6A 1WZIA 1DAOA 3JQAD 3GGGA 4G5HA 4KOAA 2FR1A 1ULSA 3GHHA 4L4XA 3WIEA 2WYUA 3NGXA 1NBOA 2B4RO 1NPTO 1KY5A 3EW7A 2I66A 4R16A 4G2NA 4C4OA 2F1KA 3MEQA 3JV7A 4HV4A 2GN4A 3VKUA 3T4EA 3MTGA 1VM6A 3DWFA 3GAFA 1U1IA 2ZB8A 1PS9A 2J3IA 2C59A 3OA0A 5C7IO 4EUHA 1I0ZA 4JP3A 1R4MB 2NM0A 2ZB4A 2J3JA 4PLCA 1NWHA 2VRCD 5I7SA 4TVBA 2P4QA 3L77A 2EGGA 5B1YA 4CQMD 4XQGA 3ANLA 3BZUA 2CDBA 4TZTA 4RF3A 3WGTA 4TZKA 3GEMA 3DOOA 4QT0A 3LYLA 3V8BA 3D3WB 4FR5A 4TSKA 5EMHA 1A4IA 3SXPA 2Q1TA 3JQCA 3ZU3A 3NTOA 4GBJA 3E1KA 5A04A 3UXYA 5LCXA 4PCVA 4LSMA 2QRKA 1D1TA 2I5PO 3ZWVA 1DAPA 3H5NA 3RQSA 4J43A 2JFGA 2P4HX 5BT9A 4E2YA 1JDJA 4A7PA 5L4LA 1CYDA 3KZVA 4AJKA 3LT1A 4YB8A 4IMRA 4CUKA 4U6SA 4YACA 1WMBA 2X0RA 3EAGA 1JVBA 4TRMA 4ZRMA 4LRSB 4FB5A 3GA0A 3MJ4A 2R00A 2NUAA 2AE1A 2IDZA 1GEGA 2Q99A 4XYBA 2J3HA 3AY6A 4GWGA 5B4UA 2AG5A 1G0NA 1I32A 5EIOA 1AXEA 2O4UX 4INAA 1DLIA 5I8ZA 4JN6B 3V2UA 4OSOA 3UF0A 5TRTA 3ZCXA 3PJGA 2ILTA 5ILGA 2W8ZA 4H15A 5EESA 2JAHA 1E0DA 1XGKA 1GCUA 1N5DA 4L8VA 3BMQA 4L4RA 3UFXA 4CLXA 1FF9A 2CDCA 4FIZA 1CETA 3A9WA 1BDMA 1JW9B 3QIVA 2JFHA 8LDHA 1EBUA 4E5YA 1U2DA 4KQWA 2QQ5A 1DIBA 4BO1A 2NU7A 2WE7A 2OOSA 2B35A 3QVWA 3VPXA 4B4WA 1BXKA 2ZCVA 4Z0TA 4YEDA 3WSVA 3PEFA 5KVQA 1B15A 4U5QA 4XB1A 1NQOA 4XYEA 4BNVA 4YAEA 2FSSA 1GPJA 4AJNA 3O03A 4ZICA 2BH9A 4E2WA 4R54A 2QIOA 4A2CA 4R3WA 2WJPA 3W8DA 5JFOA 2AEFA 3GRKA 3KLMX 1ZK3A 3M2PA 2X6TA 5A02A 1GUZA 1Q7GA 4QFDA 4B4UA 4OQYA 1PZGA 4RZIA 4J1TA 3D5QA 4GX0A 3GK3A 3DTYA 3I52A 1DRUA 5ES3A 5AQ1A 2EHDA 2QZZA 5JLAA 1YE3A 1GD1O 2WYWA 3LSYA 4W6ZA 5KJ1A 1Q7CA 4N5MA 4L0QA 4GSKA 2C29D 4YR9A 1H6CA 2E49A 2VRBA 4R5HA 4I9HA 4BNLA 4WCFC 1HE5A 1WP4A 2I76A 3E9NA 1Z6ZA 2E4AA 3GVXA 2TMDA 5CAEA 5KOIA 4GKVA 5CEFA 4WLUA 4CLRA 1M76A 3BMNA 5C5IA 3UCFA 2WMDA 1AUPA 3BMQB 5TQVA 3E48A 4L4SA 3WIDA 2CFCA 3DBHA 1FK8A 5JXWA 2DFVA 3CUKA 4G65A 2W98A 5ADHA 1XR3A 2QRLA 4CM7A 1HT0A 3BMCA 3DL2A 2P9CA 4ITUA 5DULA 4YCAA 4DMLA 5L53A 3OSUA 2VHZA 2A94A 5THKA 4YYZA 4OMUA 2AE2A 5G4LA 1A9ZA 2X0IA 1ENYA 1UH5A 4ZJUA 1T1RA 2PKQO 1FXSA 1X7GA 3BIOA 2NVUB 4LISA 3AFNA 5HS4A 2BRUA 5KJFA 1PJ2A 2GNAA 3H4VA 1Z7EA 1P1HA 2CSUA 4ALKA 3VH3A 1CWUA 4E33A 2JAPA 3NX4A 5HBRA 2IZ1A 3IKTA 2OFPA 1KC1A 4RZHA 4B3HA 5L51A 4GX5A 5CHEA 2Z5LA 3DZHA 2DBZA 1P0FA 1UAGA 2FWMX 3BAZA 5JCXA 1L7DA 1XU9A 4E32A 3KSUA 3R3JA 4TKMA 4BL5A 3IS3A 1NNUA 1Q0LA 4U8GA 3DEYX 3KO8A 3WWZA 4J9UE 1EEHA 2EIHA 4U7WA 4UEOA 3H3FA 4YJFA 4DBZA 1MUUA 3QWIA 3TWOA 1G6KA 3K2EA 3TDKA 4PVCA 3CMCO 1E5LA 3DHEA 2B37A 1ZZEA 1XHLA 3AUUA 3G3EA 6ADHA 2B69A 3DC2A 3LQFA 4CLRB 1RM3A 2FMUA 4J7XA 4J7CA 3BMNB 4QX6A 3DAFA 4LCJA 4K28A 3TJRA 1SPXA 2DUWA 4CMGA 3EVTA 2BI8A 2VHVA 3DBHB 3VHRA 2NTVA 1J4AA 4BOYA 4WEQA 4B7CA 4XRGA 4I5GA 4JJIA 3BMCB 5JCJD 4NU5A 5A9SA 3WG9A 2ZTVA 1R4NA 4KP7A 1GR0A 4HKTA 3EDMA 2AG8A 5DOVA 4AICA 2EKLA 2RHCA 2RHRA 4BGVA 4DC1A 1JTVA 2W90A 2B36A 5HM8A 3I9OA 3ETEA 4OM8A 4R1TA 3RC7A 1ZJYA 1HYEA 3LC1O 5U4QA 4CR7A 3AJRA 5FI5A 4E5PA 2OP1A 5IAAA 3PDUA 3QWBA 3K9QO 3DBVO 1HZJA 4DIFA 3TOZA 3PTZA 3LC7O 1HYGA 2HKIA 3U0BA 1DBVO 2A9FA 2UDPA 1ZVMA 3PJFA 4WLNA 2GZ3A 1GV1A 4A03A 3MOIA 4BNFA 2PD4A 4DA9A 4J4BA 2A92A 2PLAA 4FOOA 4ZN6A 1LSSA 4GPD1 3GVHA 1IZ9A 2H5LA 3F6YA 4AJJA 1Z7BA 4BB6A 1GUFA 4AFNA 4ALNA 1MB4A 4Z3KA 1HDOA 1BVRA 4FS3A 4YJFB 4BQPA 9LDTA 4IUYA 3H7AA 3H6KA 2P9EA 1ZK1A 4AJIA 2VHWA 4J2HA 5IN4A 4MDHA 2O3TA 3QRWA 1X15A 2GD1O 2EXXA 3H2SA 3PLRA 3OA2A 1YKFA 2DBQA 4OSPA 2DBRA 3NTRA 4PLWA 4OGWA 2EW2A 3QV1A 2DFDA 3WQSB 3ST7A 3KYCA 1JAXA 3IMFA 2GDZA 5G0TA 3KYDA 4GX1A 3QY9A 4J7UA 1E1KA 4YA6A 3DAPA 3WGIA 4I9NA 3LVFO 1QR6A 4FFNA 1X0XA 1EFLA 1UP6A 1AXGA 4Y98A 4TVOA 4AJ1A 2PWZA 1NAHA 4OYRA 1GCOA 1C14A 1R4NB 2C07A 3PZBA 5JAQA 1GZ3A 4WCFB 5CEJA 5JS6A 4Z9XA 4ALIA 3GMDA 3K2BA 1LU9A 4DQXA 4NK5A 4ZGWA 2QW8A 3IKVA 4CLDA 1S6YA 4R69A 5IF3A 3I9NA 1CDOA 5CDGA 1EUCA 1YOVA 1I2ZA 1PIWA 5J23A 4J9VA 5ER6A 5F1OA 1U2GA 1DEHA 2HRBA 2X5KO 3INGA 4WUVA 1C1XB 4HWKA 1VI2A 4OO3A 1U7HA 2Q46A 3WFJA 4U0JA 2QYTA 1ONOA 3U4DA 1LDYA 2VTDA 4DPMA 4S1VA 1EK6A 4E5NA 1P45A 5DCYA 1BGVA 1CQIA 1KBZA 1T26A 1UDCA 3ZN2A 4MP8A 3GMSA 3GEGA 2IZ0A 3SJ7A 3ZGYA 1Q2XA 1ZSVA 1MXHA 3EGOA 4IDGA 3UAGA 1Q7BA 3VZQA 3ROKA 3AI3A 4CL8A 1EE2A 1QV6A 3I4CA 2EGHA 1MXFA 4IPTA 1A9YA 2X9VA 5HTOA 4FSHA 2Q2VA 3D4OA 2VYVD 1PJSA 1UP7A 1ZSYA 3WGGA 4IGFA 4UAGA 4NG5A 2O2SA 2Y66A 3B6ZA 4IDAA 4J1SA 1A71A 1N7GA 5AXBA 3AUTA 1DOHA 1PTJA 4NFHA 3H5RA 1PL6A 1U5AA 1O94A 4NFYA 4NJOA 4CR6A 2FRDA 4CM3A 1X1EA 2C5AA 1UAYA 1B8UA 3BTVA 1ZXLA 5T57A 8ADHA 4WLVA 3F5QA 4WNIA 4EJMA 3BTUA 1LDEA 2G17A 2VUUA 3MZ0A 4YAKA 2HSDA 4BNUA 3PHGA 4J91A 2J5RA 1ISHA 4PZEA 2D5AA 1E1MA 2OP0A 3OH8A 3RIHA 1P44A 1H6DA 1V35A 1Y6JA 4MJLA 1YOVB 3GEDA 2P5YA 2VZ9A 3MJSA 4RL6A 1VJTA 3PFFA 2D1YA 2PR2A 3O38A 2YUTA 4TROA 5BSFA 3MJVA 3EMKA 3RCBA 2GN9A 1C3VA 3GN1A 4N18A 4OH1A 2X5JO 5A9TA 3V2HA 3G79A 2VHYA 1XKQA 5AYVA 1ZEJA 2FZWA 2P68A 5C37A 3JD3A 3L6DA 4E5MA 5COQA 2H63A 4RDHA 3ZWCA 5JW6A 5MDHA 3GUYA 1CERA 4E5KA 1OAAA 3F4LA 3NDRA 5GZ6A 1U8FO 3VAZA 3OJOA 3QHAA 4ESOA 5JO0A 3KUXA 4JBHA 4EZBA 3K8ZA 5CFZA 5L7YA 2HDHA 2X4GA 2F00A 3F46A 1F14A 1ARZA 3L4BA 1U4OA 3IP3A 4A27A 3ROPA 1NQAO 1DIHA 4BKOA 2BFMA 2VN8A 2JD1A 3IOYA 5JAZA 4O1MA 1IOLA 3S2FA 1ZEMA 1VC2A 1Q0HA 5KVVA 4CM9A 4XIJA 1PL8A 3SVTA 4RVGA 1B0AA 3RJ5A 1UZLA 4X54A 2RBEA 3QVTA 5JDCC 5F21A 4CQMA 4DQUA 1VKNA 1SOWA 2J8ZA 4XQ9A 3DFUA 3JD1A 3JYQA 3TSCA 1O5IA 3WYCA 3JSAA 4CM6A 3INRA 4A10A 1DJQA 5IFLA 1ZSNA 3ZDFA 3ENKA 3U4CA 2V6MA 1Z73A 1KEVA 4FPXA 1C0IA 3AOGA 3RUAA 1BRMA 4B7UA 3B1JA 1PJBA 2OBYA 2C7VA 1FDTA 3LT0A 3QP9A 1E7RA 1DJNA 1Y8RB 4EYEA 1ENZA 3K92A 4XJSA 5TS3A 3AWDA 5CEEA 4EW6A 2DT5A 3MCVA 2C82A 3AM5A 3K5PA 4ZQGA 2PH3A 1I3LA 4J16A 3M1AA 4R1NA 1B8PA 1WAMA 3I83A 4YAJA 3TQHA 1K6JA 5EJ2A 3VZPA 2CMDA 1A4UA 1Z82A 3PRJA 4PG5A 1IL0A 2VUTA 2GZ2A 3I9MA 2YZ7A 2I3AA 4HNHA 4CMEC 4IXTA 2WWRA 2YFQA 4MKZA 1ENOA 3D3EA 3JQAB 4JGBA 5BSHA 1H6BA 1FMCA 3AOEC 4ZHSA 3ANNA 1QLJA 3B1KA 3NT2A 3RUHA 1GZ6A 3LC2O 4OXYA 1I5RA 2VOEA 1P9LA 1LTHR 1YL6A 2WM3A 3C24A 1PGPA 2GRAA 3Q3CA 1TA4A 1I3KA 2PV7A 1LDGA 1NAIA 1GFSA 4RPHA 1XG5A 2LDXA 4O6VA 1YQXA 4ZA2A 1KVQA 3H9UA 1KVRA 1NYTA 4CMKA 4DPKA 4UULA 3WGZA 2VNSA 4Y67A 1UDBA 1YRLA 4CQMB 2X22A 4Z9FA 3ZWXA 3GRPA 4RORA 3S2GA 4DRYA 3DZBA 2IODA 1E6EA 3GG2A 3GVCA 1X7HA 3JD0A 4XX0A 4F6LA 4BNZA 5F1PA 4Q9NA 3D3WA 4NK4A 2HLPA 4LCEA 1QKIA 3WGQA 1Q0QA 4RPGA 1I24A 3OIFA 4BO4A 1LA2A 1LXCA 3E6AA 4DIBA 5L9AA 2RH8A 3DMYA 3GZ4A 1T2DA 3W8FA 3ZW8A 2Y1FA 1R0SA 1PZHA 4ALJA 2NU6A 5A05A 3CKYA 4XR9A 5B4TA 3L07A 3VC7A 5KTKA 1G1AA 4BNJA 5JDCA 2IXBA 1IB6A 1QXSA 3FBGA 2VWGA 1FDUA 2HU2A 4AG3A 4OIMA 2DUUA 1YB1A 5ICMA 2XAAA 4W9NC 3FHLA 3HADA 4BV9A 3Q9UA 5CDTA 3IL2A 3QWFA 4E13A 2Y1CA 2O7SA 2Q45A 4D44A 2C54A 3E5MA 1XLTA 2IEBA 4GLOA 1L7EA 3OM9A 4EUFA 5JY1A 2O3UA 4GQAA 4E3ZA 4M54A 3V1UA 1I30A 1U3WA 3M1LA 1BWSA 3UKOA 2DPGA 5T67A 4LVCA 1P33A 1OMOA 1E3SA 2G0TA 1XELA 2Y0EA 3COSA 2CY0A 1EVIA 3PZRA 4H16A 4DC0A 5A5FA 3IP1A 3ZWYA 3KLPX 5HA5A 1PQWA 1QMGA 1NWCA 2UUPA 2WD8A 4PG4A 1QYXA 2PD3A 4FFMA 1JWAB 4O63O 4NQZA 4MVJA 1P1KA 1J5PA 1C0KA 3AOEA 4BKPA 4HBGA 4GX2A 1HLDA 3RAJA 2DQ4A 2P91A 2PZLA 1GYPA 1A27A 4KTVE 1I36A 4CMBA 1D7OA 3DXFA 3K73O 4R1UA 1O95A 4YQZA 5BQFA 3D64A 4BKQA 2ZTUA 2ET6A 3EYWA 4HNGA 1MG0A 1BTOA 2DBVO 4MO2A 3M2TA 3ASVA 3W6UA 1VL0A 5FFFA 2QYSA 4XR4A 4WOKA 3PYXA 1UZNA 3RKRA 1V3UA 3ZWWA 2HCTA 3RUIA 1RM5A 2GN8A 5ENVA 4BNWA 4KZPA 3WJAA 3S8MA 3JQ9C 2OL4A 3ASUA 3WGOA 3WNVA 2Z95A 5I9LA 1D1SA 3AW9A 1PR3A 4D3SA 4W4TA 5A03A 5TGDA 2H1SA 1GADO 5T64A 1FJHA 1K89A 4XCVA 1QYDA 4FQ8A 4MOWA 4IMPA 3W8EA 4I5DA 1HYHA 4YXFA 1N9GB 1OFGA 3C3XA 3PP8A 1WW8A 1H6AA 3AI1A 1VL8A 3QSGA 3WTCA 2B0JA 3EZLA 3PYMA 4ZQEA 1ISGA 4FFRA 1HDRA 1M2WA 4CMJA 3ZHBA 2YV1A 4I5FA 4I08A 2ZQYA 3TZQA 3H3JA 1HETA 3WGHA 1U5CA 2Y05A 4GGPA 1YXMA 1ZBQA 2B5VA 3TFOA 4YBZA 3CPSA 5DP1A 4EBFA 1P0CA 3DQPA 4CV2A 2CF5A 4RVHA 3HDYA 3RFTA 3GG9A 1OBFO 3D1LA 4FFLA 2PK3A 4B8WA 2CZCA 4B4VA 4DVJA 5C7LO 3SJUA 2WDZA 3NGLA 4JP2A 2NVUA 3LF2A 1CRWG 5EQFA 2VCYA 3CZRA 3U9LA 2NACA 1LSOA 1YVEI 3CE6A 1PGNA 3A4VA 3NAQA 5FWNA 3CH6A 1E6WA 4NHEA 5F3RA 1KIFA 3K30A 2V6FA 4TRNA 3KEQA 2IYOA 3K96A 1QRRA 2AQIA 4CMIB 1V3TA 1NQ5A 3G0OA 4P4GA 5B12A 1Y9AA 4CPDA 3EHEA 5DN9A 4PG7A 4GKBA 4UUPA 5K0ZA 1PJ3A 3H9EO 3P5SA 3ZU4A 4FN4A 4FOSA 3NEPX 3ZWMA 4PN3A 3VH2A 2EP7A 4R68A 2PZMA 1LLCA 2EWMA 3WNQA 3PWSA 4CM8A 1PS0A 3DONA 1H94A 4ZRNA 2O3QA 2DTXA 4BHTA 1JKIA 3EUWA 4YAGA 3L9WA 1SB9A 4D43A 3ETGA 5KJEA 4PVDA 3QWAA 1YJQA 3GPIA 2DPHA 4CMAA 3V1YA 4E6PA 4OOEA 2X8LA 1W8DA 1H2BA 3DO5A 3RUCA 1FDVA 1W4ZA 2POQX 1LC0A 4BNXA 4YRBA 3LDHA 5TX7A 3VTFA 1ZK4A 4HADA 4NIMA 3PQDA 1DIGA 1PGJA 4JCOA 1H9AA 4BV8A 5JPIA 1CQJA 1Z75A 4E4YA 3S1LA 5CDSA 3L4SO 3GNQA 1GZ4A 1MV8A 2W2LD 3VKVA 2BGKA 1O6ZA 4J0FA 5TJHA 3WBFA 5I7FA 5KNLA 4LMRA 2PY6A 4Y6RA 1CEQA 3P2YA 2BF7A 5G0SA 3DHYA 4YQYA 4RCVA 1PJ4A 4D0SA 4CMHA 4MVJE 4KDFA 1ZJZA 4KDEA 1U3VA 2X86A 3ICCA 5CG2A 2OBNA 2CVQA 5TT1A 1WZEA 2GF2A 4F6CA 4EJ0A 4BMSA 3ZWBA 4YJGB 1J0XO 2YQ4A 3QVOA 2W4QA 3HHPA 3ZNPA 3RU7A 5I7VA 1KEUA 1VPDA 1XWFA 3JYLA 4Q3BA 1OC2A 4BB5A 1A7AA 2X1HA 4UVIA 3WR5A 3LT2A 3G49A 4RQUA 4EITA 1UXJA 3WYBA 5IDQA 3I9LA 2RIRA 1W73A 2B83A 4JJFA 4M8SA 4O5OA 4TWRA 4BO8A 2FPIA 5IZCC 1X1TA 2NV6A 1RM4A 4FD3A 3WMXA 3NYWA 5IN5A 3VZSA 4AJPA 3VDRA 3RJ9A 1DIRA 1UR5A 1MGOA 1NXQA 2VZ8A 3PHLA 4LGVA 4CM8B 3E03A 2JD0A 4E2ZA 5F1KA 1NASA 3RFVA 2RH4A 1AHIA 1PL7A 1I2BA 2AXQA 3GQVA 4XEHA 2NNLD 4CMCA 1DC4A 1P77A 2XPCA 5FEUA 2HUNA 2ZIZA 3GF4A 1XEAA 3HJAA 4XQEA 1HE4A 1ZH8A 4PG6A 3ZWOA 3D0OA 3BYZA 4XD2A 4CL3A 1YBVA 5L4NA 3E9MA 2B4QA 2JD2A 1DPGA 4M86A 4WNCA 4U0KA 1EE9A 5K6AC 1EDZA 1B2LA 4MVJF 5EINA 1GQ2A 4IJWA 3RBXA 4WCFA 3GNTA 1SZJG 5T8KC 3MTJA 3OP4A 4B3IA 1IUKA 4R5MA 2SCUA 3AU9A 2HK8A 2EJVA 1ZO8A 1VLLA 1IPEA 2NLOA 1LC3A 1LSUA 3FNFA 1E92A 3L6OO 5TC4A 3MWDB 2P5UA 3AI2A 4B79A 1XIVA 3JYNA 3GH3A 2PTGA 3NT4A 2WYVA 5I7EA 1C1XA 1YL7A 4E12A 4FFPA 1B3BA 2ZTLA 1XDWA 3UN1A 1H2HA 3TZHA 3RFXA 2Y68A 4CLOA 4IY1A 5G0UA 1R0KA 2ZQZA 3GVIA 2Q4EA 1E3JA 2HMTA 4BUCA 1QLHA 5KVSA 4FC6A 4GGOA 1Z74A 1Z45A 2Z1NA 4RF5A 4NH4A 1E3IA 2YFHA 4RF4A 3BXXA 5JBIA 4W7HA 3AM3A 3PXXA 4UEJA 4AJ4A 1UXKA 1B8VA 1PQPA 4NBVA 1XA0A 1EVZA 3UHAA 3GAZA 4BNHA 4RVUA 5ICSA 3MWEB 1BG6A 2R6JA 3CXRA 4DYDA 4NBUA 2EV9A 2GCGA 5ITWA 3C7AA 4NPCA 3S2IA 1PU2A 3NRCA 2EW8A 3TZKA 4B8ZA 1LDBA 4NJMB 1K6XA 5CP8A 1YO6A 4FBGA 5EQDA 3CZMA 4W7IA 1ZUD1 2GO1A 3BTSA 4A0SA 5IZCA 2C2YA 4MKRA 1AHHA 4YT2A 4ILKA 1X13A 2NVBA 3U4HA 2BHLA 4XDYA 4K6CA 2QX7A 3OJFA 3HB4X 2CF6A 2HQ1A 2YHUA 3AY3A 4KWHA 3LLSA 1GV0A 2QHXA 2PKQP 5F5LA 4D45A 4ND5A 3ZNOA 1DC6A 3UUWA 2YYYA 4BNIA 4Z9YA 1WXDA 4BNYA 3F9IA 2XOXA 1C1DB 1O8CA 3BA1A 3VPHA 1IHXA 3WXBA 1PR9A 1OC4A 3K31A 3QVSA 3VTZA 1ADFA 2RCYA 2YY7A 3ADPA 4CQLB 3GDFA 4CLOB 4N54A 1QP8A 2BKAA 1KVSA 5TT0A 3WB9A 1WNTA 3WBBA 3PJDA 1GPDG 1SNYA 5KJCA 4IDFA 3U3XA 4FGSA 4DLBA 3O8QB 4HXYA 4BO7A 5LDHA 3G17A 3DZGA 1N7HA 1Y7TA 2D3TA 3ZV6A 3TL3A 4PFJA 4LSWA 2WD7A 5A9RA 5HWSA 2H9IA 2VYNA 2DM6A 3U49A 3JQGB 5CPBA 1K2WA 3R1IA 2GASA 4XB2A 1IYZA 1OI7A 5L95A 3V1TC 3PGJA 3RBZA 5DP2A 1I2CA 3DB2A 4IDDA 2EJWA 2J5KA 2UV8A 4D7AA 3BHIA 4YRDA 2AEJA 3U09A 1ID1A 4UVEA 1F8GA 5LDGA 2FN7A 3D5TA 3KSZO 3GNSA 3OEWA 1VKOA 4R51A 5JMPA 5I9MA 3PIIA 3W1VA 4JROA 3GOHA 1EMDA 4YJHA 1HWYA 3MJEA 4HY3A 2CUKA 1T1SA 3IIEA 4FGWA 4IIUA 1MX3A 1E3WA 4MIEA 1GQYA 3DDNA 1EQUA 2NWQA 3S2EA 1R12A 5JDIC 2VQ3A 4R4JA 3HDQA 1T4BA 4WJZA 1VE9A 1Y8RA 2V65A 1W6UA 4B4OA 1T25A 4HFMA 2HK9A 4PGFA 4ROSA 1RYEA 3HFSA 3FR7A 4CV0A 5KIAA 3C7DB 1UXGA 1E3LA 5BSGA 1ZXBA 3KBOA 1SAYA 1HSZA 3GR6A 4UVHA 3DMTC 3RUDA 3UOGA 4J4HA 2PZJA 3PGXA 2OXIA 3OIDA 3PIDA 4NNJA 1BVUA 4QO7A 4IJKA 4ND1A 3JQDA 2D59A 3JQAA 3CEAA 1U4SA
chains in the Genus database with same CATH superfamily
3NJ8A 3AJAA 4MI6A 1KYIA 4FVTA 1WLSA 4RIHA 1UWKA 1HDXA 4PN7A 4IDCA 1I1QB 1OU0A 2QTVB 4LE0A 4EX7A 1RW4A 5TGTA 4PPNA 1F12A 1SVKA 2ZYWX 3FPGA 5KTOA 5H8WA 2EEZA 4J4TA 4II2A 1JEOA 1SC3A 4NG4A 4B2IA 2PLWA 5TEWA 1GGJA 3C6MA 1X14A 3NGMA 3O2QB 5F52A 5B37A 4AN1A 3L1KA 4URVR 3ORFA 5FYQA 1PJ8A 2QR5A 1BE0A 4B84A 1A4RA 2HGZA 4W8OA 4P9NA 2HF8A 3SD7A 1C0PA 1E5XA 1Q6YA 3CLUC 4RS4A 3U4IA 3PEYA 5TMPA 3O8RA 1UC8A 2X9GA 5CD9A 4KTTE 3ZGXA 4YX9A 1QDUA 1ZM2A 1L4GA 5KBYA 1OIWA 3CSDA 2NTYC 2Y1OA 1U7WA 4DUGA 3C7KA 3EBLA 1NW7A 3GO4A 3PB3A 1N0HA 3BKXA 3N07A 5EWJA 3TX6A 3WLNA 3UENA 4BLPA 3T7AA 2IYXA 3KVNA 1E6UA 4B82A 3Q5GA 4F8YA 2G1JA 3P52A 3ANTA 2EZ4A 1WSAA 2EP5A 3EOAI 1KIAA 1YJ8A 4JR2A 1E1DA 4KIWA 3QKRB 3T34A 3OZTA 1KEEA 1YAHA 2BFPA 2VNKA 3PK0A 4IS3A 4PWYA 3CINA 1O8BA 2AEEA 2B99A 3PXCX 4TS4A 2GKGA 1FBTA 1CUVA 1UODA 2PX3A 1WXIA 2Q07A 3AF3A 1ZGHA 3FPKA 1GSIA 5AVOA 3BH6A 1TI7A 1XL0A 1WMFA 1ISRA 2WF9A 3O82A 3ROXA 5AW7A 2HPHA 1LWOA 5BQ5A 3TSAA 3FDIA 4D42A 3HZZA 1RAEA 1PUXA 4MX8A 1A5ZA 3QU7A 4G0QA 3U7RA 1P4JA 1C3XA 4HD8A 4QDXA 5L3RA 2OZPA 1E7SA 1K92A 3FH0A 1LVGA 3AHCA 5JJCA 4YRLA 1H5QA 3QMPA 3R7DA 4E7PA 1IK4A 4CM4B 5DNWA 1JSRA 3MERA 1SU4A 4IP0A 4E2XA 1DKRA 2ADFA 4G8JA 4K6KA 5GOTA 4JXXA 1BU5A 4N5NA 3I28A 1JQ3A 2OGZA 1T2EA 3EXHB 5HZMA 1JU4A 5ERGB 3ONDA 3ANXA 3S2ZA 3OMXA 3FCSB 4EGFA 3T3GA 3HXMA 4CKWA 1ZUHA 2JZCA 5EIBC 5TQ0B 5CK4A 5I5GA 3RFFA 1MVNA 3HKBA 4ARBA 3QE2A 3EG9A 4Y2YA 4F92B 1BNCA 1TK3A 4JLBA 2XKAA 3SMQA 4BBJA 4DE5A 5A4KA 4E21A 3EASA 4XUCA 2JCYA 3SPXA 2V7XA 3HDVA 4YTEA 4UMFA 4GGMX 5YASA 4DVGA 2VDPB 4EB3A 3I05A 3RVDA 3N2NA 2F8SA 2I62A 1AS3A 2G7MC 2G71A 3H16A 3SC6A 2VHXA 4M1YA 4DSZA 1OBVA 2ZSUA 5PGMA 2PUEA 1P80A 3LF1A 1Z4LA 1H2ZA 2ASVA 5T6BA 1WU8A 1AKMA 1LV7A 3FW1A 3Q0EA 2Z5FA 2C57A 2OBFA 1Y4SA 2QTWB 5DV9A 4MVJH 3LQQA 4EM6A 4JMPA 3O4JA 5A3VA 1BXGA 3AVYA 2XMDA 3Q7IA 4JLSA 4FS8A 4MWDA 4PZYA 1EFCA 1GQFA 1ADCA 5AM0A 4QECA 3VR2D 3IUJA 2O5VA 1OCEA 2AZXA 4QTUB 1J99A 1J0AA 1F6WA 3L8MA 1NYLA 1CEXA 4J0DA 1NQTA 3LBHA 4CODB 4F7DA 4L2IB 5BT8A 2Q2WA 4BNTA 1HR0B 5K45A 3SDZA 3W78A 1O94D 5C7YA 3QPAA 1FPQA 2G1KA 3BE6A 4NZOA 3CZCA 1JFTA 2OD2A 1T2AA 2NPOA 3Q9NA 1BC5A 2PXCA 2V9CA 3WL8A 3KJIA 3AFHA 5JT1A 1JLLA 2PLNA 3E84A 2FQWA 4GMGA 3BWDD 4L22A 5FV4A 1LNQA 1NBWB 3IKJA 2J6HA 1IWBB 4BO3A 3VYRB 1B7GO 5F1YA 4F6RB 1DSSG 2AQ8A 5FTNA 1WF3A 2WSLA 3GRUA 1QFMA 2C31A 5TMBA 4ZI7F 2NYRA 5AOBA 1P2TA 3MOGA 4H1TA 5IJZA 1EFUA 3GW8A 2QN6A 2VDVE 5ALEA 1WE2A 2DETA 4QXRA 1VE5A 1Y63A 2LKDA 5HRUA 1U3UA 1I4DD 2C8VA 3PTLA 4I2NA 1TK9A 3CONA 1ZN7A 4L4UA 4XARA 3W3AH 1BDHA 2COUA 1NU8A 2AEMA 3DQZA 1V6AA 1SQ6A 2AFHB 3QXSA 3VNBA 4CV1A 5KO2A 4WLFA 1CJCA 1T5OA 3K9CA 4DC9A 1T36B 4E31A 1LLUA 4PLFA 3ZI0A 3PUJA 3N9IA 3FPSA 2H6EA 4IFIA 3BJMA 1PCXA 1YS7A 2WK1A 3SC2A 2JFWA 1KO7A 2G4CA 2JFFA 2XA9A 4F4CA 2AK2A 3BGDA 3EWIA 1JG3A 3OESA 4IICA 2I2BA 2J6IA 1L3CA 3Q98A 1J6UA 4ZP1A 1R4ZA 3VUEA 1HDGO 4U7JA 1UUFA 2G80A 1AK1A 1LKZA 3VDQA 4M99A 4PSCA 5EZ6B 4B8YA 3RVOA 1UBCA 2NTJA 3AFMA 5HKAA 3AM4A 2C7BA 2H3HA 5B4VA 2B7LA 1OI4A 1MRNA 4U9HS 4CIWA 2OY0A 4RLHA 1JX6A 1BWRA 4X24A 1CXZA 2M9MA 4XM2A 1ONNA 1ADYA 1V5IA 4L9RA 1UMCB 4DNOA 1NSFA 4NZZA 1NKSA 3QFFA 1WMEA 4PLVA 4PLPA 4WY8A 2DY0A 3FPCA 4ZYZA 2CUNA 2MU1A 5FD8A 1H22A 3OZDA 1CUBA 3A7DA 1TAUA 3ZDRA 1IZ0A 1KI4A 2W2KB 1BXRB 4PO3X 4C7KA 3EX7C 1G7RA 4P8RA 1YDWA 4Q7MB 2CV1A 4J1TC 1T3HA 1J7KA 5K2OA 2BE9A 4OXKA 3UJDA 5LLSA 4GZ3A 5AW1A 2QRHA 2AFVA 3CBQA 1IJKA 4YAWA 1HQKA 1E9EA 1MX9A 3DW1X 5LL6P 1BSVA 1PT6A 2QG9A 5EZYF 3TRIA 1OAKA 4BZXA 4EY6A 4BMXA 1OLUA 4REQB 4TWIA 3HSYA 4FHGA 5KYTA 1Q1GA 1ZK2A 4BO9A 6PFKA 3ZEIA 3ESZA 3ZJTA 3CNNA 2HFKA 1W36C 1UFOA 1YR9A 2N3ZA 2YZ2A 4IIVA 3U3DA 3WOHA 4DIOA 4PYNA 5GJWC 2J33A 5JS1A 1QWSA 1SC9A 4KIGA 2VRWA 3JATB 4IDHA 2GTHA 3VR5D 4GMXA 2EKQA 3ZLVA 1RWMA 4ACAA 1MRZA 3FWPA 3PGVA 4M1WA 4C0AC 4Z7NB 3NUZA 5COBA 1YJAA 5G1PA 4O4JB 4RADA 2PYZA 4AJ2A 2GR9A 1GZ5A 2OORA 3INTA 4KXUA 3HCBA 5EMKA 3TRFA 1KEPA 3RYCA 1NFFA 2O8FB 2ZIEA 5FBKA 4ZQBA 4EENA 4QHTA 1SKMA 3T0FA 4DL9A 3IIIA 3N05A 2HLNA 4MR9A 3DBRA 4HAZA 4LHEA 4KQMA 4RNDB 1YJXA 1T8WA 4A36A 2ZJ0A 3DZFA 1ICIA 1U8YA 4ZGGA 1USIA 4H3KB 4F5YA 2V1XA 2Z3WA 2IDJA 2GEDA 4MMYB 1I51A 3SS8A 2C3PA 2QJTA 4YO8A 1TT5A 2J4CA 3RU2A 5E6SA 3ZPXA 2W11A 3TJZA 2BKUA 4DYVA 4HDMB 4KR2A 1T6NA 2Q5LA 3NETA 4O4HA 2AL7A 3HDHA 2R8YA 3LUHA 4G4SP 1Z2OX 4OCZA 3HCEA 1Z83A 2OSVA 4WMLA 1K9SA 2HT6A 3EPPA 4I36A 4JI6B 1G18A 1N1EA 3R6GA 4TV8B 3TRHA 4E1AA 4JODA 5FA5A 4XVCA 3E1GA 3LZ6A 1KNXA 2BIFA 3FSRA 3DO8A 2JL1A 4JZKA 3MBKA 3FFAA 5C53B 3IAHA 3E61A 4U6QA 1Q1ZA 3HUFA 2AOXA 5AD1A 5GTDA 1QVVA 5IVPA 5CDUA 3ADKA 3K9HA 2BJWA 3FTCA 3VPSA 4AQDA 1KFCB 3PXEA 1V7PC 3I3OA 3RRBA 2YRFA 1YFZA 4Y6PA 2DWPA 1SG0A 2IZZA 4FCVA 5BR8B 3LQ4A 5KSOA 1HSOA 2WKPA 3I6MA 3GFBA 1I3MA 4H7KA 1DRKA 4IV0A 1K4YA 3IAFA 3WYAA 2GXSA 5FPKA 5KVCA 1NUHA 3QW2A 3AJ9A 4G0YA 2P6MA 4R1OA 1Y3DE 3ORYA 2WU4A 2PHZA 1N8SA 2R7LA 3C87A 3FIJA 4XSGA 1I10A 5B1HA 4AP9A 1LZKA 4ZU6X 1Z25A 5L3ZA 1WJGA 3DMHA 1JDBC 1F8XA 3EY4A 2QRJA 4GR4A 4YO7A 3C0KA 3UA4A 4H35A 5LZ5A 4NJEA 4KUEA 3KPWA 4I1OA 4TMXA 2EFJA 5JXGA 2AWNA 2ZATA 5EP2A 1MX1A 1DBPA 3EIOA 2XUZA 1U8ZA 3EVNA 4KX3A 4MW2A 1YQDA 2X8WA 3BQNB 4IZOA 4TTVA 4QLAA 3PFNA 1KYZA 4I4TA 4QXMA 5LUBA 4Q3EA 3WV5A 4LF9B 2AC2A 2CVFA 2FDRA 2Z5GA 4GVLA 4RHXA 2IYTA 3RH0A 4B6JA 4MGIR 4RDCA 4AKIA 1W4AA 5HQ3B 1UFVA 1SBIA 4IWXA 4QUKA 5ALVA 3KS9A 2GD0A 3K4HA 4JUBA 5LQRA 2WJHA 2YINC 1P7CA 4OHPA 4XWYA 3GLFE 2QR3A 3NV7A 3W34A 1D2HA 1M5TA 4RVFA 2CGEA 4U02A 3RI3A 1GCIA 3MAAC 4C4AA 3RS7A 3R09A 3TCKA 1H65A 3ON5A 3ILSA 3OVMA 3JQ9A 4MV9A 5BN4B 3UOAB 3JQ8B 5DXFA 2RGGA 3AQ4A 4TVKA 5SZIA 1WXQA 3A70A 1FTGA 3KAQA 2O1XA 4YPVA 2QY6A 2FF7A 1Q92A 3RBVA 4IMJB 4JI0B 1J09A 1SULA 2Q3EA 1L4UA 3W04A 3VO8A 4R0MA 4DR1B 4LXTA 1X87A 4PCLA 5GPBA 1DQNA 3SR4A 1YFJA 2Y4OA 3KWJA 5H3LA 3V2GA 1VMKA 1Z13A 2GJ4A 4L50A 3RF7A 2OLKA 2PSJA 1IBCA 3W2GA 4Z4QA 3AKZA 2JVIA 2P7IA 4UATA 1SELA 4PC7A 1NN5A 1J8YF 1Y8CA 5FPPA 5FWXB 4N41A 2X2FA 1G59A 5FOSA 3LXXA 3Q40A 4GBGA 2IE0A 1OZAA 2XE6A 3HVUA 3PHJA 2PX6A 4AJLA 3IULA 1ONPA 2JFUA 4H6XA 3UH1A 1P5HA 3E5RA 4LGMA 2NU8A 4F7WA 2XB8A 2QPAA 3ME5A 4GXRA 3G0DA 2PRYA 3VTKA 1DE0A 5BWOA 2O2DA 5JLJA 1DBWA 1FMJA 1BJTA 2NZYA 4B43A 4HVLA 1EIZA 1QOQB 4P58A 1KYQA 1UFRA 1RI4A 1YACA 3KUKA 3EWAA 1D0IA 2H4FA 2JGDB 4E22A 1R10A 1IZ7A 3KZ1E 2CB9A 3S2UA 2VF4X 1A8UA 3ELUA 4S0ZA 1HF3A 1KSHA 2FJPA 1Y3BE 1O95D 3H13A 3QKSA 4GEKA 1QH1B 4I5IA 2WZQA 2H06A 4NNOA 2ZRMA 1N36B 3QEMA 1LBEA 5LP6A 1V8ZA 3HB1A 1C4KA 2B5WA 2RHDA 2PKRA 2V58A 3T52A 4IG4A 2PGNA 1V3QE 4MAFA 1PZEA 2C4MA 3KHUA 5FL3A 4JL8A 4L5JA 1OWLA 1HYQA 4XIYA 2VUSA 3QY0A 4DSAA 4NSNA 1L8QA 3TIVA 4EFLA 2JBAB 2VYQA 3HN2A 3O21A 4WA8A 4Y2GA 721PA 4OJQA 3N0RA 1T0UA 2DVMA 5IS2A 2YQZA 4KLRA 4TS1A 2AN3A 4M6WA 1B0ZA 4KQEA 3R8XA 2GESA 4OSEA 2OYRA 4X62B 5LQAA 1HQCA 3HVIA 2ZJ7A 4M36A 1S2OA 5IM4F 4GH5A 4CL0A 3MC1A 4MV7A 1Z6GA 5HKLA 1OWPA 4ALLA 1F06A 2VWPA 4MUXA 3EVAA 3UTDA 1E1YA 1BH6A 2F62A 3MAJA 3P97A 4UUMA 1M34A 4FDTA 3BX1A 3ETLA 4ZVOA 5CYOA 3FNHA 2OXTA 5CYFA 4D80A 2GJAA 4WBNA 3JASA 5EXXA 5SY6A 4RGBA 1VCNA 2ZR8A 3V3TA 1YFKA 4N3CA 4EI7A 4MQBA 4JI4B 3FWZA 3A05A 3MELA 4PYRA 4UOQA 1M8PA 2PX5A 5E38A 5E2BA 5A7HA 2GPNA 3PFWO 1I4TD 5NLLA 4E30A 4AMYA 1SEVA 1BW9A 4ZT7A 3NC0C 4AJ9A 4KIUA 4NZPA 4XQCA 3UCXA 4JQYA 4N0DA 1E8NA 3OJ0A 1C5KA 3LPLA 3WWCA 5IARA 1KMQA 3RG8A 3ILVA 1KQPA 4E46A 4LA4A 4RFLA 1T5TA 4I8XA 4JJ6A 4Q9DA 4WZAE 4DCCA 2QU7A 4BRSA 1TEVA 5T4FA 1K6MA 5H82A 3ULKA 5EAIA 1MZVA 2IQIA 4X7MA 2EL7A 4LC0A 4GZLA 4D8YA 4MRMB 4J0IA 4Z0HO 5IAGA 2PU7A 2ID9A 4BECA 2ZJ3A 1NXVA 4BQOA 3E0XA 4IIEA 2O8DA 3NWBA 3CIFA 3KQTA 3KRTA 4M4SA 3Q6IA 2PKEA 3O8QA 2BEKA 2WIJA 4GSYA 4XASA 3UKDA 4LRYA 2GJSA 4D96A 1Q0RA 2V7GA 3FY4A 4FILA 3MT8A 3WGYA 3JQEA 1E1RD 5ENZA 3UV6A 2NX2A 1R6VA 2VWHA 4JX8A 5DN6D 2BH2A 1GKIA 1M5UA 4DQ0A 1JQEA 4Z5XA 2ZUFA 2BMWA 4LRTB 2OFFA 2H92A 1G3IA 3OPNA 4M9XA 3JR7A 1WPXA 4MRVA 4WL0A 1IY0A 4JI7B 3TMAA 4O8CA 2C04A 1W5TA 2QL9A 4DG5A 2I3ZA 2FRDC 3O9ZA 1GRCA 3VYSB 3H8VA 1V8DA 2IPXA 1CR4A 1CR1A 3ACBA 4ZT5A 2BFOA 3N87A 1IONA 4A73A 5KPDA 3SWWA 4EABA 2A0KA 3AR4A 3E7PA 3OHPA 4M7RA 5HFAA 1XYVA 1WOYA 1VJGA 2FPSA 5GP1A 2CSXA 3WQRA 5IFKA 3N86A 4MQ4A 4K9KA 2Y67A 2O4CA 4MDYA 5HDQA 2IEYA 2AMJA 3A4LA 1DDOA 3I2FA 3KXLA 4P4NA 5D85A 3VHXA 4Z7JA 3UB3A 3AK4A 4U2GA 4D79A 1SY7A 3DT9A 3JVDA 4CKXA 1CUXA 2HF7A 3RIXA 1ZCJA 3KT8A 2LDBA 3MQ2A 4JKIA 4GMKA 1GPUA 4M89A 3MQ4A 5EWLA 4O2BB 4RQBA 5DW0A 4G37A 2CXTA 1TEHA 2O50A 2GXAA 3SHQA 4PR3A 4RZUA 5HE9A 1MJNA 4M0EA 1T4CB 4ZEMA 4I5EA 4B4DA 2DOKA 5DBFA 3RV3A 5KQGA 1FOEB 3SS7X 1FFBA 1PHRA 3E3OA 4ZHQA 1RCFA 5D3QA 3EN0A 4Q39A 4RA9A 2A9RA 1Z2EA 2VTKA 1RXSA 1D4FA 4LX8A 2HPZA 2Z1MA 3H9GA 5HMMA 1NR7A 3TXAA 4PR0A 4LFCB 3T1HB 3DMNA 3C6YA 5CRIA 2O0JA 3NWJA 3VV2A 2F1RA 3GVPA 3AUJB 3QVXA 1J0DA 1K6IA 2WAOA 2DSTA 2WTBA 4QTXA 4CQMD 2BGLA 4CM5A 3AL2A 3ZIUA 1G7CA 2RAPA 1KJQA 2W6IA 1GQRA 4Q0MA 2GGSA 2GSDA 4ISBA 3TQTA 1ZJWA 3L9XA 4NENA 3ESAA 4P4LA 4GL4A 1O03A 3T3MB 1DC3A 1IN8A 4L9SA 5FOTA 4JJZA 3ZE0B 1CUDA 1P0PA 1W0KD 2QTVA 4GOND 3CPJB 1EFKA 2FPGB 5EUBA 5DH9A 2IIPA 2PZAA 2B0CA 4DR3B 3O3CA 5CM8B 1MIHA 3ONFA 3IUQA 5JADA 4ZVVA 2G06A 2Q7OE 4MRSA 4H7PA 2A7QA 2GH1A 2WE8A 2EQAA 4QM7A 3CV3A 3C85A 1APBA 1X1DA 5AVSA 1LRLA 4RTJA 3F4BA 3LHKA 3IUPA 1JEDA 4BP8A 2ZUSA 3MD9A 1BJRE 4AM8A 4RWZA 1K06A 3KV1A 3RC2A 4D0RA 4OGKA 3AVWA 1WBDA 5MN5A 3DLIA 4JCCA 1I4WA 3UICA 4HO1X 4JXKA 2DFTA 4NECA 4OLJA 3UWPA 4EOGA 1TQDA 2I4LA 4MPPA 4OM7A 4TWAA 2PMCA 1VFNA 2ZIXB 3IAUA 4UVGA 3ER9A 1F3OA 2J3LA 3NV9A 2MMGA 3PQEA 2WWGA 3MTQA 5T5QA 5M04A 3EEYA 4G0ZA 3OSZA 1G4HA 2P2SA 2FPMA 2XAUA 4QSMA 1RJDA 2XYRA 1XF1A 2HXSA 3EXEA 4YV2A 2A3NA 3B82A 1J97A 4GIBA 4QD3A 3N6RA 3KYCB 1EDBA 2I87A 2Q6OA 3HXQA 3QE9Y 4LF4B 3M5PA 4M1TA 4TTTS 3FOAA 3GA7A 5EGSA 2GLTA 2P30A 3X1MA 3SQWA 2DY1A 1XZDA 3MWKA 3E23A 1CUJA 3OLYA 4I7EA 4OXXA 1XTKA 3L05A 5SZKB 3H2BA 4NBSA 2CD9A 4CIDA 5ALXA 2RH9B 3GC6A 3PGMA 4K6MA 2QF7A 2Y0CA 5EHIA 1PNQA 1T35A 3RK4A 2OR3A 1ADBA 2PFGA 1D9ZA 4WNAB 3SF8A 4EJ6A 2YMPA 4EPVA 4AKTA 1B3RA 1U9CA 1EWYA 2H17A 3CVXA 4YFYA 2XZOA 4WCVA 2VT3A 3TN7A 2YWHA 4P34A 4ZARA 5T41A 4CM4A 1EJ6A 4HK4A 1UKZA 2HMUA 3ETNA 3NONA 3CEPB 4PS0A 1DVRA 1EVJA 3ESBA 1WPGA 4TN1A 2J45A 5GY7A 3RR2A 5HR5A 1KMHB 3GFGA 3MCTA 1E9CA 4M9ZA 3UPTA 1QZTA 3GGSA 4D9NA 4FZVA 4L02A 5M34A 4NS1A 4X92A 2IP1A 3QW4B 1MO6A 5A3SA 4E0BA 2WEKA 3M5WA 4FJ0A 1E66A 3VMMA 4EI2A 4D6XA 2WKQA 1NI4A 2PEYA 3T3OA 1E0JA 1A72A 4KNYA 4MRNA 1FRNA 3GDWA 1J2RA 1PWYE 4FMPA 3GEHA 3T3PB 5IASA 1QS0B 4BWVA 1OLXB 3P1JA 4D5EA 2ZSFA 5HGXA 4O33A 4WINA 2WDPA 3AGQA 1ZNQO 1IHPA 4ETWA 3I1YA 4YUAA 4Z4EA 2CXUA 1WDLA 4JUCA 4W99A 2J7PA 2QSJA 3KDSE 4CKBA 3E5HA 4UTXA 1Z0IA 2R44A 5TIIA 3WQHA 1AURA 1CRPA 2N47A 4HGPA 4UXHA 3QLUC 2VXCA 2HLHA 5F7XA 3AIKA 3F98A 1T9GS 1F3LA 1FJ2A 3IV7A 1XNRB 2GBLC 2YOGA 3SBOA 2OGSA 1A7KA 3T41A 2LV8A 5FLXA 3CUYA 2Q29A 1FFXB 3B70A 3FYCA 4UBKA 5DCWA 3U31A 1PX0A 3VYWA 4RY2A 1SIBE 4CEHB 1Z9BA 1ZJ5A 2CNBA 3GPBA 1NBMD 1XZJA 2R5WA 3QYPA 4L2IA 4NFLA 4RTRA 4EG1A 4BVJA 4ZJZA 2AC7A 4YUXA 2XDAA 1SVLA 2G5TA 5B53A 3D6JA 1QP0A 2UUOA 3VZRA 5LOVB 3QWHA 2V3VA 3IAEA 2GMWA 2FN8A 2A78A 3DKIA 4R2WA 4WXEA 4R31A 2CLLB 2I4OA 3N0WA 1JV2B 2QL6A 2X58A 5FUMA 3CURA 4MKIA 4HI0E 3WLFA 2XQJA 3N7UA 3QUBA 3SLKA 2D4HA 3HCPA 3PDIB 4P31A 5HQJA 2ZXEA 1N57A 5DYIA 2WJZB 3PHHA 5LMNB 1PJZA 4J90A 2IP2A 2J07A 3LECA 4QSHA 5TEVA 1RWNA 2VNJA 1XQ6A 2BFAA 3F6CA 1NP7A 1SD2A 3NDBB 5ARDA 2G76A 2XMPA 1NVEA 2QRPA 1ML4A 2BW0A 3NC1C 4REOA 1KZHA 4HZUB 2JHAA 3RV4A 4IQGA 3GLTA 4PLZA 4ZCTA 5LQDA 1Q0UA 2UXBB 1W94A 4DG9A 4KK3A 1W85B 2WHPB 5K0JA 2RI6A 4B6RA 4HUQB 1BKYA 3THYB 1LPSA 3REFA 4BMPB 1N25A 3TLCA 4LJKA 1G17A 4ALMA 4MROA 5AW9A 4DTIA 4HEQA 2BSXA 2YNMA 4L78A 5CNKA 4EY8A 5L40A 1J0CA 1Y5NA 4IX9A 3CLVA 3PCTA 4LXHA 4YJ3B 4CF3A 4I3HA 2HMVA 2ZJBA 1UOEA 3GJ8A 3WQBA 4JX9A 1W46A 2QMYA 3QVKA 1UK6A 4YDSA 4BXOA 1QK5A 3HI4A 3P71T 4DLPA 4NDNE 1O7JA 1UMCA 1H3FA 3KB6A 2CVPA 1XRJA 2HHHB 1FDWA 1Z6XA 4M9SA 4HNAA 3MUEA 2IU3A 3SOPA 3U6BA 1U80A 1VRWA 1YS9A 2G7ZA 2WNIA 2Z43A 3BTOA 4LN1A 4JBIA 3V7YA 1HH4A 3ICPA 1BXRA 3FF4A 3IMEA 1R4MA 2AFIE 1U1EA 1F2VA 4H7JA 5FRDA 3HXPA 3WNZA 5G53C 3OQHA 4LNUA 1JJ7A 4S2EA 5H4HA 1JQBA 4P3PA 3FUVA 3I3SR 5EJ4A 1H69A 1WUIS 2FR8A 4Q21A 1FU8A 5TNXA 2XGOA 1U94A 2R4UA 4Z3DA 3R6DA 1L4MA 1SFRA 1IDOA 1K8QA 3B7PA 3NLLA 2YWCA 3E9QA 1IZYA 4BNDA 6ABPA 3HY3A 5LD2C 1A5AB 2R1ZA 1MAUA 1LLFA 3AKEA 4BFUA 3UMYA 1DFIA 1JR6A 3SZ3A 5HSGA 4HJRA 4TMKA 4GZ6A 3JATA 4B6PA 4M0DA 4WASA 3ELBA 5DLYA 4EJSC 4TXLA 3WICA 3HUDA 4BV2A 4UXJA 4ZDJA 1JPUA 4O4JA 4RELA 3TLXA 1X19A 2P77A 4LZAA 1ZQ1A 1S2IA 1U9IC 4EUNA 1K3FA 2NQ8A 2VP9A 1B43A 4IM7A 3ZW7A 4B6QA 3I6QA 4RV5A 1SVWA 2VAWA 4F1KA 2HPAA 3EXG1 1P5FA 3CH4B 3H2JA 4ZPJA 3VAAA 3HO1A 1E6LA 1JJFA 1HOXA 1T2NA 2BHNA 2MSEB 3WNDA 2FK8A 3PYLA 3KLBA 5I8WA 3BPSA 1M7HA 1U11A 1MFPA 2XYGA 4J1QA 1R9MA 2PD6A 3PE3A 3JQAD 2HV8A 5DE3A 5GM2A 3NWPA 4KOAA 2JFPA 2SKDA 3NNDA 3CVUA 1C7RA 1ULSA 5BVHB 1QPZA 5L3VA 3NGXA 2JLUA 1NPTO 4FMBB 4AKGA 2BFFB 4XLLA 3DDWA 5ECDA 1C9NA 2I66A 3SQMA 5BW8A 3O8CA 1T8YA 4ZK2A 4C4OA 3X0DA 4WDRA 3AKDA 1I7NA 2ODQA 3MEQA 5CA1F 2BJHA 3PQ8A 4OXQA 4HV4A 2IZOA 5CB6A 5DBEX 1KO5A 3T4EA 1VM6A 1QP4A 3GAFA 4PNPA 3HKEB 2XCLA 2IK8A 4C30A 1L4FA 1JLHA 2N75A 3OPQA 1RHQA 2REXB 2W22A 3OX4A 4RSRA 4Y0NA 1I0ZA 4S35A 3Q3HA 4K6OA 4TWZA 2OAQ1 2ZB4A 3LUDA 2J41A 3UQZA 5LJLA 4OVKA 3CT6A 2P4QA 4TVBA 4IEIA 3WLOA 1EFRD 4OXIA 4XQGA 2EARA 4L85A 4NMXB 2I4RA 1DUSA 3N39C 4N3GA 1O57A 4RIGA 4XX0B 4YONB 2SKEA 3I09A 4B17A 2H8KA 4WZBB 2M6KA 1A4IA 3SXPA 4FMDF 4C22A 2Q1TA 2XCOA 1Y8ZA 2ZRCA 3ZDDA 1NF8A 2OECA 3UY4A 3QG1A 3FSJX 2HWUA 3IVMA 4OAOA 4V0QA 1XD9A 3UXYA 3WRYA 4B34A 4QXOA 4C05A 4D9JA 3ZWVA 1D1TA 3OFJA 3VKGA 1DAPA 2BFCB 3CLSC 1RYFA 1Q17A 3LYUA 3QITA 5D3ZA 4J43A 1G38A 1NONA 2Q6VA 4JITA 5BT9A 3N0TA 3W1EA 1Z18A 2B9EA 3QUAA 2XHEA 1KEZA 1TLFA 1CYDA 1UEXC 2FX2A 2QR2A 3STVA 3KZVA 4KPUB 5AI9A 4MWTA 3GJQA 1NRJB 2LGJA 4CUKA 3N6VA 4U6SA 1ZWKA 1MB2A 1NY6A 3K70C 3IQFA 4JLNA 3TM4A 1X94A 2ZWPA 4DCPA 1H0RA 3B9PA 3MJ4A 1A1SA 1NXXA 2F4NA 4KYVA 4UM7A 3SDSA 3UK7A 1EWQA 1HT3A 2IDZA 3DD1A 1LK7A 1R6BX 1S2MA 1VPEA 5CVCA 5BN4A 2IBTA 5E0OA 1R64A 2WSMA 2HWKA 3CEMA 1CS0A 3M4JA 1G0NA 4I4CA 3KBBA 4OP2A 1SU8A 2ALJA 4I55B 4H7EA 2O4UX 3P9SA 1T8RA 3EQ7A 1KP2A 2V7UA 3EARA 5I8ZA 3C6QA 3AP3A 3IESA 4JN6B 4UJ5A 3V2UA 3PJGA 4JVMA 5AH0A 5CT4A 2FPOA 3QFHA 4BQIA 4KFCA 5BN1A 4RPIA 2CCGA 5ILGA 2FUCA 1E0DA 4L8VA 3BMQA 3BERA 1OROA 3E3AA 2YZMA 4G26A 4RMIA 2CDCA 4HQOA 4MI9A 1BDMA 1J7JA 5A5VA 1G5RA 4PC6A 4RK1A 2R62A 1EBUA 3TE7A 4M1ZA 4IHQA 1U2DA 1MJ5A 2K2WA 5BSKA 5BYBA 3PXBA 4PHCA 3VPXA 4B4WA 1K7FB 2WWHA 1W49A 1E1CA 3PEFA 4JD5A 1ECFA 3G7NA 4HQRA 5KVQA 4ZIRB 5HQTA 4RTNA 1TC1A 3FGNA 3EYAA 4BNVA 1OH8A 4DRXB 3ZKWA 1KZ9A 2PT5A 1BVYF 2FN4A 2QAJA 3K53A 1GPJA 1OX6A 2XUJA 5HOEA 4Y2HA 1YRHA 3O03A 4HPJB 4ZICA 5D00A 2IY8A 1P2FA 5EUQB 3OEED 2E55A 3UXEA 1EP1B 3TW8A 3LHSA 1HNWB 1XXHE 4RK6A 4ARAA 3W8DA 4GOOD 3GRKA 5JQGF 3WLLA 2BUAA 4RVNA 4MV5A 1XI2A 4HGRA 4GOLD 3WISA 4F2PA 3DOFA 3TD9A 2YL2A 1Q7GA 3IT1A 4E14A 5LNK6 1G4UR 1PD1A 3EDRA 4DM4A 3ZXIA 1GPNA 2JARA 2FRVA 1PZGA 4PAOA 3M6WA 3OUUA 1F7VA 3FPHA 4GX0A 4TTSA 4C2UA 1P3JA 5IMBA 1NYQA 2JBAA 3TUJC 1U8UA 1ORDA 1X9GA 3HCWA 4FR0A 5FI1B 4DCGA 4DSOA 1GD1O 2WYWA 3LSYA 5BSUA 3Q3JB 4FTWA 5J47A 5KJ1A 1KK1A 1YI0A 2V7VA 1Q7CA 5H5JA 1VP3A 3YASA 4AUMA 3JQRA 4L0QA 3UMVA 4GSKA 4B47A 2C29D 4UFPA 3NP9A 1KPHA 2E49A 3T0GA 2ZYSA 5DSTA 4R5HA 4ENQA 1Q44A 4I9HA 2W2OA 3B7GA 1HE5A 3T7RA 4S12A 1T6XA 4BNLA 3W5BA 4NHOA 4ZTZB 3GMIA 2I76A 4S1OA 1H05A 4B83A 1QQ6A 3DVLA 4FEYA 1NMZA 5M7EA 2TMDA 1FY2A 5K0CA 1XYYA 1PF7E 4C6RA 3I2IA 1O58A 1M76A 3SZRA 3OPXA 3PS9A 5JRJA 4CFSA 3DH0A 4Y2PA 1JBQA 2GAOA 1D9XA 2VSFA 3RS4A 2YBEA 3KAJA 3N6XA 3KUCA 3PEUA 4RXMA 1FK8A 1JECA 4BWGA 1GKYA 2CHGA 4MNTA 5JXWA 3CUKA 2B3TA 2G70A 2GKSA 1XR3A 3WV4A 4OK5A 5CXSA 3O4IA 1BX3A 3CJRA 4LZNA 1WF6A 3OUZA 3R5FA 2RONA 4UU7A 3ZWDA 2XBMA 2VRNA 4JB2A 5DULA 5FJJA 6GPBA 3N7AA 3UA3A 4W1SA 4M83A 3TUZC 3WL6A 3DE2X 4ECEA 3NHMA 2P62A 2WZDA 1RYHA 4R2KA 3VDMA 2QVCA 5LQCA 4OMUA 1AK2A 2AE2A 1AKWA 2IW1A 3Q85A 4XDHA 1YUBA 5G4LA 1O97D 3T5AA 1ENYA 1W5AA 1M6YA 3IQEA 3DBOB 4MRMA 4LG1A 4FQ7A 3ZDAA 1CUFA 3TL6A 1IMOA 3W2HA 4K9QA 5HS4A 1QIKA 2BRUA 1MH9A 2WWFA 4NU8X 5LBIA 3C14C 2HX1A 4DDKA 4LFBB 1HG0A 1Z7EA 1QHNA 2M6LA 3BFPA 1M73E 1BWQA 2BUCA 2P2LA 3CRZA 1CWUA 5LJIA 2JAPA 3NYQA 4QYXA 1F2TB 2YV4A 2OZKA 4LXGA 5CDHA 3ZXSA 3QNWA 1DTSA 2OFPA 1K86A 2EZUA 3NB0A 3NRBA 4JWTA 3L1JA 3AYZB 5HUJA 3GCDA 4B3HA 1K1EA 2VJCA 3F97A 1RLMA 2AX4A 2DBZA 2I7TA 1ODSA 1IHDA 1UAGA 4I8DA 4JLDA 2PMBA 4KG7A 4OHVA 3TTVA 5JZOA 3IIJA 3NBKA 4E32A 1H4TA 3BSFA 3DKVA 1YS1X 3LWZA 1JI3A 2QVGA 4ZGBA 4TKMA 2P9TA 1RZ3A 4BL5A 1B6RA 1NNUA 1NXWA 2QTFA 2BMEA 3RIMA 2W70A 4RENA 3V2IA 1EEHA 5E7QA 4U7WA 2JGFA 3D6VA 4PPGA 4KO2S 3WAJA 4O3FA 1OXXK 4WAUA 1XBTA 3QU9A 4DBZA 1P6UA 1X39A 4HYEA 1MUUA 3E2PA 3QWIA 1FLNA 4PFKA 3SR3A 5B3KA 3QEBZ 1PT9A 3W05A 3TDKA 4PVCA 3O8OB 1O96B 3E53A 3B3JA 1ZZEA 5FUYA 3AUUA 4LV6A 3MTIA 4YI5A 2B69A 2GCOA 3DC2A 3LQFA 1RM3A 3BMNB 2D5BA 4F5EA 4QX6A 1Q84A 3UHPA 1HFEL 4K28A 1RP1A 2NO9A 2AN9A 4FKZA 2VO1A 3U48A 2ZUEA 3CS3A 3L0CA 3Q7TA 4WFIA 5BSTA 3DBHB 4O2BA 3WRVA 1EXVA 5G02A 1POWA 3B9QA 3VHRA 2DF8A 5F35A 5FFNA 5IANA 4WEQA 5F73A 4EL0A 1OT3A 4CG2A 5K3CA 4DY6A 1B1AA 4HYYA 1H2EA 2VZLA 3BMCB 3GRCA 4X71A 3HVKA 2PL9A 5EPEA 4DQKA 5ECGC 3WNCA 4OJTA 1V4NA 1R50A 4AO8A 4NU5A 1XNQB 4JA0A 1YU6A 2ZTVA 4FYXA 4PHGA 4Y2RA 4CTKA 1KJ8A 4KP7A 2CXSA 1E6CA 5FOVA 5KX5B 4HKTA 1TIPA 1RRVA 2GBFA 2BEWB 2BONA 2C1ZA 2Q8PA 1FQWA 3M70A 1A97A 2JI6A 3CLKA 4L7VA 5D1NA 2RHRA 4DC1A 2CV0A 3G89A 5EEHA 2VS1A 4QZVA 5C3UA 3VRHA 4R1TA 1LB1B 1JJIA 2RHHA 2QN8A 1P7PA 3SIPA 3LC1O 1LPPA 2ZIUB 2ZBRA 3JRNA 1SIOA 5FI5A 2A58A 3PDUA 5IAAA 1TEXA 2RGRA 3DAOA 4C04A 1UC9A 5DTIA 3DBVO 4CVNA 2B1GA 1HZJA 4A92A 3T3HA 4DIFA 2QU8A 2HKIA 2RB5A 3U0BA 1DBVO 1HA3A 1E9SA 1OKKA 2ZBFA 3SSAA 2WWYA 4COOA 1SJ9A 1ZVMA 3K05A 4RH1A 5J40A 5CH8A 5E8JA 2NUTA 1TGYA 3ZWKA 3B51X 3MOIA 3OEHD 3SR0A 1THZA 4J4BA 3ZIAD 1LSSA 1UF9A 3GVHA 1DL5A 2H5LA 4ASUA 1YRYE 4V0RA 4AFNA 2IGBA 5KNDD 2XCRB 3ZC3A 3S1SA 3P8ZA 4LHVA 2G0AA 1SBHA 2IHBA 2XMZA 1UFQA 3BXHA 3QX7A 2H1RA 4QDZA 1JDBB 3H7AA 3H6KA 4LOJA 4HVTA 3SZGA 3TOCA 5HIMA 4UCWA 4OK6A 4YP7A 2ZIXA 3QMMA 3BJEA 4LHXA 1SUCA 3R7LA 1X15A 2X3YA 2EXXA 3N70A 1EJBA 2Z9DA 4V1CI 1PT8A 2CVHA 2I8AA 3CZAA 5IYZF 4XIFA 1T5BA 1YKFA 2DBQA 3KALA 4OSPA 2DBRA 4PLWA 3AUYA 4A2PA 2EW2A 4YMWA 3QV1A 2DFDA 4ZYVA 3WQSB 3E3MA 3KYCA 4IF4A 1DJOA 5G0TA 1Z68A 2BN4A 1VJDA 1Q2UA 5BW5A 3KQKA 4I9NA 4EA6A 4BJ5A 5C81A 4FFNA 5LIRA 1EFLA 1AXGA 1L7NA 2ZSIA 4EVSA 3IMCA 4G0MA 4RUKA 3ZDQA 1Z4JA 1GG9A 1GCOA 3QM1A 4CEJA 1R4NB 2C07A 3R7SA 1NVUQ 2L18A 1GZ3A 1YZFA 4N3AA 4WCFB 4WNAA 4CKEA 2WJ6A 1WMSA 5JS6A 8MHTA 2CYAA 1BYIA 4RTKA 2XR1A 3TCNA 4NK5A 2XYHA 1QH9A 4BMYA 2SCUB 1UJCA 4ZGWA 2VDQB 3QTBA 1Q0PA 4JLMA 2BVNA 2QN3A 5HF6A 3IKVA 2A5GA 2FGJA 4GNRA 3TMKA 1IDN1 5IF3A 3GZJA 3VC3A 2PUBA 3VSEA 5DM70 4ZO9A 2HXYA 1PIWA 2H2HA 5C4IA 3P0FA 3G0CA 4ND6A 5F1OA 3PC8C 2HRBA 1JHOA 1WRBA 1N3LA 1BROA 1VI2A 4HWKA 4FOLA 5E2IA 3WYGA 2Q46A 4PW0A 4U0JA 1QP7A 1ONOA 5ESXA 3DNFA 2FW7A 2VTDA 3CTPA 1RHJA 3M9WA 2IV3A 1EK6A 3PPWA 1VPLA 3ADCA 3F49S 3BFJA 1ODJA 1BMFA 5DCYA 4IFTA 4TQ9A 3W5JA 2ZJYA 5F2NA 2FG7C 4W5TA 1KBZA 1Z4MA 4ZREA 5FNVB 1I14A 4RQAA 1XZLA 3GMSA 3SJ7A 3ZGYA 3G85A 3GGJA 3N0VA 4I4IA 1MXHA