3G6WA

Asymetric gtp bound structure of uprtase from sulfolobus solfataricus containing prpp-mg2+ in half of the active sites and r5p and ppi in the other half
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil phosphoribosyltransferase
publication title Structural and kinetic studies of the allosteric transition in Sulfolobus solfataricus uracil phosphoribosyltransferase: Permanent activation by engineering of the C-terminus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 63
structure length 215
sequence length 215
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g6wA00
4RHTA 5K51A 4RABA 5BRNA 4RACA 2PRYA 1DQNA 2WNSA 1ECGA 1G9TA 1VSTA 1QK3A 1DBRA 4LYYA 1I0LA 1QCDA 1IBSA 2AEEA 3ACCA 1G2PA 3QW4B 4LZAA 4P3KA 2JBHA 1Z7GA 1U9YA 5BSKA 1XZ8A 1MZVA 1QK5A 2C4KA 4P81A 1V9SA 1VCHA 5E38A 5EUCA 1BD4A 3S5JA 2P1ZA 3ACDA 1D6NA 1AO0A 1P19A 1PZMA 2JI4A 1A96A 4P82A 4RHUA 1A4XA 4F8EA 1I5EA 3LRTA 1NULA 5BQPA 4RHXA 2YZKA 4IJQA 2GEBA 2PS1A 2XBUA 4LZNA 4P84A 4RQBA 1UPUA 2JKYA 1XZNA 1L1QA 4P80A 1A97A 1O5OA 3DEZA 5BQOA 1I0IA 1L1RA 2IGBA 4OHCA 3H83A 2H08A 1JLRA 3NAGA 1A3CA 1ECFA 4P83A 1ECBA 4Z1OA 1TC1A 1YFZA 3MJDA 1TC2A 4M0PA 1P4AA 4RADA 1Y0BA 1DKRA 2FXVA 1HMPA 4FYMA 4WMLA 2HCRA 1ZN9A 5HIAA 5IPFA 1I13A 3HVUA 3OZFA 3EFHA 4MB6A 1DQPA 1HGXA 3N2LA 4JLSA 3ACBA 2DY0A 4ZFNA 1NONA 4PFQA 4M0KA 1XTTA 4QYIB 4RHYA 1ECCA 1W30A 1JLSA 3OZGA 3GGJA 4RV4A 4PAWA 3GEPA 1BD3A 3OHPA 5IAOA 1P18A 4KN6A 4RAQA 1QK4A 4M0UA 1OROA 1U9ZA 3M3HA 1P17A 2PRZA 3G6WA 4LYGA 1ZN8A 3DMPA 1GPH1 1LH0A 1VDMA 4RQAA 5HKLA 5ESWA 5KAPA 1XTUA 3O7MA 1ECJA 1QCCA 2H07A 4QYIA 3LPNA 1CJBA 4RANA 2JKZA 1J7JA 5JSQA 4TWBA 4LZOA 4S2UA 1O57A 3MBIA 5ESXA 2VFAA 4X45A 1WD5A 1A98A 4P86A 3GGCA 1DKUA 2E55A 1OREA 4QRIA 2EHJA 1R3UA 1G9SA 1ZN7A 1I14A 1QB8A 1FSGA 1OPRA 4JITA 1STOA 1A95A 4WN3A 1GRVA 3KB8A 4RAOA 1G2QA 5JV5A 3DAHA 1QB7A 1BZYA 4X44A 1UPFA 5KAMA 1UFRA 1XTVA 2H06A
chains in the Genus database with same CATH superfamily
2XQKA 4DMGA 2I99A 4ZO8A 1DHTA 3L8EA 3QLTA 2UXDB 1XZFA 2Z56A 4ZVRA 4D8TA 1KZ6A 1T8SA 3RDPA 1VBMA 1H1LA 3L7OA 2J0VA 3FRJA 3AFGA 4RLSA 3OE4A 3OE1A 4PPQA 1DC5A 2KPOA 4G4IA 4QJ5A 4ZQGA 1JHPA 1V1RB 4QU5A 5DKFA 3D8NA 4Z9BA 1QIGA 3KJHA 5J59A 3ZWOA 4EKIA 4NBKA 3ZEAA 1T6XA 3LKZA 2R87A 4BP3A 1TEZA 4GP7A 1DIRA 2BP7A 1ZH8A 2VKTA 4PSVA 1XZAA 2TS1A 1MB0A 2ZYVX 2DFKB 1CD5A 2BN4A 1GNVA 1FYFA 3EE6A 4LOHA 2PRIA 4L08A 4B3RB 5AKEA 4QODA 2R8EA 3IEKA 3GFRA 3M3DA 5JH7A 1U8UA 2P4HX 2PLWA 2X8LA 2ZYAA 3LCVB 3HB7A 3LZCA 2QZZA 3MWYW 3I5YA 4J0KA 4WIAA 3U60B 1N9GB 1EP2B 2QUKA 4A6PA 4UQLA 2G70A 1ZGCA 3SZOA 3COJA 2EARA 3IMEA 2XAUA 1Y37A 4IIJB 1WPXA 3MZ0A 4QPPA 4YRNA 4GX0A 4DJ5X 4CTNA 5K09A 2QLMA 5DYWA 1VB3A 4TN5A 1L6RA 2FVYA 5FPPA 1G6Q1 4YUAA 1CE8B 1RZVA 4O0LA 2YKGA 1BA2A 1EG2A 1X7HA 1DFGA 2PV7A 2IHZA 1NMXA 3B9RA 3MRSA 1D2AA 1N57A 1Z15A 2JGMA 4CTJA 1QQBA 4HZUA 2APJA 3WTCA 4EA9A 1B0ZA 3IVRA 4C78A 2CV2A 4X1IA 5JG7A 4L0QA 1E94E 1M72A 1C3VA 3EOZA 2VVTA 4Q3NA 4WY8A 4DCJA 1EK5A 1THTA 2G28A 1XVUA 2W71A 3DKRA 4ARSA 4AT1A 4EB0A 4KREA 1LGYA 4X1YB 1CVLA 3I01A 3TB4A 3GZ4A 2ZITA 3E5RA 4MV5A 3X44A 1KJYA 1G3UA 4LFCB 5BW4A 5TEVA 2UZAA 1C7JA 3WGUA 1XE3A 2G9RA 4PTZA 1JZTA 3LMKA 5E3HA 4ZOLB 5LNK1 4EPXA 2DWUA 4DLNA 3TW4A 1S8NA 2ZBDA 1EQUA 1FFBA 3CZ9A 3N3BC 4INJA 1ODTC 4Q4DA 1CIJA 3RJTA 1TI7A 2OWEA 4CZ2A 4D0RA 3RASA 2OMKA 2I78A 4ZKDA 3ZYZA 3TG8A 3PXUA 4REMA 4S1VA 1R37A 1Y42X 2IZOA 1XSEA 2C58A 3REQA 8OHMA 4I19A 3QTBA 10MHA 1M33A 5DHRA 5HKLA 1NXTA 3ABIA 1NW5A 5JT1A 4LGCA 1LQTA 4GF5A 3L8ZA 4UC0A 5DI3B 3T0GA 1ZXBA 4EB6A 2O8EA 3OTQA 3L7IA 3UV6A 4ZKEA 1G21A 1CPYA 2YMQA 1E0SA 2E21A 2VHYA 2WG2A 2XYQA 2GZ3A 4O4IA 5EVCA 2CNWD 1AMNA 4YMIA 3I9JA 4WACA 2IYOA 5FUVA 2I7XA 3O8RA 1A98A 4JD5A 2CJWB 2YNMD 2AEMA 3PRHA 5BR7A 3IP9A 2FPOA 3I45A 1HM5A 1OOEA 2EYUA 4OGFA 5JY1A 1OQAA 5FUXA 4XRGA 2L2QA 5BT9A 4M1QA 4JP2A 1UBEA 1PX2A 3EIXA 4NONA 2DLCX 4YJGB 3RVDA 5K4HA 4H27A 4CL0A 4OBXA 2OORC 2HF2A 2OMEA 5A06A 2AS0A 2IKQA 5DOVA 1C14A 3GJ7A 3BREA 3NBFA 2HJSA 4OQ4A 3TLBA 2KW5A 2PT5A 4B3TB 1RD4A 1RZUA 1GO2A 4RJKA 4R2HA 1N6KA 3HCEA 2F67A 1C7QA 2ZSIA 3ASUA 3DE0X 3LQKA 5D00A 3HFRA 5ARCA 4YAGA 3J7AC 4YCSA 4ZC8A 1BGVA 1LJUA 2GEJA 2O5RA 2PGNA 3OO1A 2P67A 4MS4B 5FV4A 2VJPA 1Y48E 3E4CA 4N03A 3Q8MA 4L9SA 1UBJS 1GRNA 3F5FA 4IIYA 5LQUA 2BSAA 1YQDA 4DVJA 3SM9A 3A4LA 4BMOB 1FDSA 3MB5A 5SICE 3MXOA 4KQJA 2PA3A 2YWBA 4IWXA 5E9QA 4AWAA 4CEHB 1C1YA 4BV3A 3LCUA 5H1YA 3WYFA 1VBKA 2JD2A 4EG1A 3ZD6A 4BKMA 2BI4A 1XNGA 1CEEA 5K0TA 1QYRA 2FZGA 4YR9A 2UKDA 1YBMA 5AI0A 3X3HA 3JRWA 2Q0QA 5CXXA 3EFOB 1YI8A 2IBMA 2NO4A 3I4FA 4GWLA 4B6FA 2GPBA 1XZCA 1ZVKA 2WJIA 2HMAA 4WPGA 4I81A 4H77A 4YT5A 3CNEA 4QEKA 1G5IA 1AHPA 5IHXA 4F4IA 5T6BA 3BSSA 1G5FA 4CM4A 3GB9A 3E3MA 1ZM2A 3CF4A 4ZOBA 1SU7A 3TJRA 1Z34A 4AJJA 3I5UA 5T6MA 5KHLB 1MB4A 1LLDA 3B51X 3BKXA 4GXRA 4MIOA 3UGTA 3V3TA 1XELA 4XJVA 1CY4A 3L8FA 1WXIA 1UWLA 2ZUBA 3G85A 1R4AA 3O3CA 1MA3A 4QQ8A 2IU6A 5DGTA 4BO2A 1CF2O 4PPGA 5HZHA 1AV7A 3E9NA 3IMKA 4PG5A 3ZCUA 4UCFA 3LL4A 2DC1A 4DGSA 1QKIA 3WC4A 4R0MA 2K7FA 2VDKB 3BTUA 4D4IA 1JHMA 3VBEA 2VK2A 4KIFA 3H13A 1SPXA 1CF4A 2V7TA 5K0BA 3RJMA 3A1NA 1RWPA 1EFAA 1YT5A 3LFTA 1YQWA 2O3QA 4O59O 4F97A 1YR2A 3GRVA 1D1SA 2KMLA 1OB5A 3HB1A 3MCZA 2MMGA 1WSWA 3DHNA 3OJOA 1M6WA 5C5EA 3HDTA 3IQGX 1M34E 3MWFA 4LF5B 1AGYA 2PO5A 4JELA 1QBKC 1Y6QA 1UEJA 2EFHB 3NX4A 4C7OA 5E6SB 1W93A 3FUUA 5JNLA 4AJ2A 1FSSA 2V58A 1U3FA 3VU0A 2O2XA 3AX6A 5JY6A 1G7TA 2GR9A 3BKWA 3WNBA 1XLTC 3W78A 4JBIA 4Q34A 3PT5A 4MV6A 1XNHA 2CHQA 1GM5A 1ANKA 1GKIA 4B82A 13PKA 2ZUUA 1T9BA 1Z06A 2VNJA 3GGDA 3M6IA 4HWOA 2VDWA 3ZY3A 3GPLA 1E2DA 3KQNA 1XROA 2R2AA 2R66A 1QQ7A 1U2SA 3QF4A 4KXFB 1XB2A 4LJ6A 1H0SA 1MO5A 3A6DA 4OREX 1NY5A 3I58A 3O90A 2QSZA 4EPYA 2EL9A 4Y0VA 1YS7A 5AVOA 5A4MS 2Q6VA 1V9CA 5J43A 1ZMBA 3K8QA 4IOLA 5KYYA 1X1TA 4AZ3B 2NSJA 3AONB 3QEJA 3NCTA 3UT5B 1HLPA 1GWNA 3JQAA 3JXEA 4TXJA 1TFRA 1FS5A 3PFWO 1KI6B 3ASVA 4EHHA 1X3SA 5KKAA 1U5CA 1SCUB 1KERA 2X86A 3K1JA 4XKJA 3TXYA 1DXYA 1SD5A 2ZYGA 3ZDZB 1CUUA 4J4BA 3DL2A 3E4DA 1J2JA 1DQRA 4G01B 4CMKA 4F7WA 5HZGA 1W87A 4NKRA 4GOMD 1K5HA 2C4KA 2OK8A 3EGXA 4ZC1A 1LBQA 4R71A 1UBHS 4WAUA 4YRJA 3HB9A 1D4FA 4UUQA 3PE4A 1SBTA 1H94A 3F3YA 3PF9A 1JR3E 2BDUA 4I8XA 2II6A 1VE3A 2DKNA 2Y6VA 3L93A 3R23A 4NBWA 1DRVA 2G83A 2YWGA 1CY7A 5B3JC 2DTEA 3UMFA 3A11A 1V96A 2HI0A 1QQ6A 4I1UA 1PUJA 2UUOA 2VCYA 2YFYA 1QE5A 4X97A 1F0YA 3U7QA 3KKLA 1CYDA 2IGBA 1MTZA 1UXOA 2XOKA 3C6KA 1ADGA 1QUFA 2JIDA 1OWOA 2F1JA 2ZJ8A 3OH8A 4X92A 2KYRA 2WPNA 3BX1A 4QWWA 5G53C 1FMCA 5BUSA 2HNBA 5L3SA 4MKFA 2P30A 4BZWA 1EX9A 1QH0A 3ZCVA 2E82A 2WUFA 3IQEA 1OFGA 2GM9A 1D6MA 3GFBA 4DIMA 3EX7C 1G8SA 1IXZA 2Y77A 3NRCA 4K81B 3OD5A 1EHIA 1K9VF 2AW5A 3JARA 2FAXA 2H0RA 3W1WA 4HGQA 1T5SA 5FLKA 2V5VA 4WD3A 5KMGB 2C2XA 1YH3A 1M7BA 2OG2A 1E9BA 1B26A 2P2GA 3FG9A 3KVOA 1KI3A 4LYHA 3ZQ4A 3H4IA 4JB3A 1LK0A 2ZQZA 2ZYDA 4OYYA 4S12A 2WABA 2VJAA 1FQKA 3PEYA 3H87A 4UVGA 3EMDA 2YCBA 2CZCA 2O8VA 4TPKA 4YCDA 2VXYA 2ZRDA 2O0HA 4LV5B 2VBFA 4WBSA 1C30A 4RKEA 3WGTA 2AGVA 3N86A 4ZO6A 5F5XA 1URPA 3EMVA 2O06A 4P4SB 3TIVA 1JB1A 3THXA 4J16A 1K7EB 1J8MF 4KXWA 1ZK0A 4P0TA 3OE7D 4FDVA 4ILKA 2Y93A 4XX0A 5DYNA 3RU3A 5JU6A 4BECA 4L8WB 4BGVA 3DBRA 4I50A 2DR2A 1WV1A 4FFPA 3EEFA 4GP9A 1AQIA 2O8BA 5TDHA 4KRGA 4DV0B 2IYTA 1SG9A 4HX2A 3W3AD 4JLKA 4HLUC 3VDMA 1A88A 2CLSA 5L45A 1EFRA 3DVRX 4PC6A 3OESA 4MAAA 4A4DA 4MUHA 4HYQA 3SHFA 4QRIA 3V1YA 16PKA 5ULLA 1VMDA 3C3JA 4HDNA 3VNAA 2QLFA 1CUWA 3E61A 2HIMA 2XA1A 4DMLA 5COQA 5JNRA 2BFDA 4PX9A 1CRLA 4GE3A 3Q8XB 6LDHA 1N6NA 3LDGA 1FRQA 2OOKA 2W6PA 2C83A 2EJVA 4Z3DA 2RK6A 1F0NA 3Q7SA 4U2DA 4CKYA 3B5IA 3W9SA 3EPPA 5D8DA 4GQBA 4EJ2A 4B75A 5GINE 4PC7A 3KE8A 4ZPXA 1YVPA 3UJAA 2C00A 4LRXA 5LP6C 2VHZA 1P7ZA 1ZI6A 4MVJA 2VQ3A 2HJ9A 2J0UA 3MD9A 1I4LD 4YACA 5IC4A 4TL9A 4PY2A 2H85A 3QLVA 2NUTB 4KAAA 3C14C 4GOXA 1KVUA 4FJ1A 3Q1LA 2GEDA 1ZGBA 3P9SA 4P92A 5HSGA 3T8YA 1LZLA 1QRRA 2YMLA 5AHOA 1N2HA 4PSUA 1E2QA 1RRGA 4J3FA 4MPPA 4B83A 4DEVA 1F7VA 4D9NA 3I23A 3F2VA 3KZKA 3B3GA 2CUKA 4RCZA 5C5CA 3F7MA 3K1TA 3OHMA 3S81A 1WHTA 2KQUA 2YZNA 1G20E 5CYOA 4DLWA 1XXLA 2P5YA 1UPUA 1LTKA 3LUKA 3RTBA 3Q9NA 4AIRA 1M67A 2H59A 3A04A 3OZDA 3BRQA 2H7XA 2VWGA 5DTIA 3RHSA 1G7RA 3FWKA 5KCMA 3O74A 4Q1AA 2L42A 4YRDA 1O97D 1C0KA 1EKXA 1SELA 3AB7A 5AVVA 1G0NA 1W6RA 1YMVA 1KZ9A 3LDHA 1MJ5A 3LCJA 1YCHA 1W5TA 2RH8A 3HVHA 1FUIA 2PUBA 4U7JA 4PAOA 2IFTA 4IZ6A 1PHRA 4GC5A 1GILA 3A32A 5AVUA 3S7ZA 5KTRA 2YWHA 2WKRA 3FFTA 4XSGA 2Q3BA 1AUPA 1JVBA 2OQIA 3FDJA 4ITUA 3PX2A 4MH0R 4RM2A 3RVRA 3QFTA 4RSHA 3LVFO 2CF6A 4RK5A 3WAGA 4R2JA 4TL8A 1L7RA 1WXXA 2ZM6B 1OLOA 1JLSA 1IPFA 1OC2A 4HAXA 4JSTA 4MV3A 3SLRA 5ANRB 4C6TB 1CFZA 1J22A 1RLMA 2EW1A 1LNSA 3L8GA 5F33A 3K96A 3QELA 1MO3A 2AG0A 4I1IA 3NI2A 5DX0A 1E5QA 1NXSA 3V42A 4NE9A 4J94A 4BS9A 2BFFA 4L51A 4DVGA 5B36A 5I47A 1VYHA 2PT6A 3PDJA 2FPPB 4PZ0A 3ZVKA 4N39A 1YA6A 3FR8A 4ZYUA 4KSCA 2FA9A 4L9RA 3QOWA 1HDOA 2W8BB 5EIBD 3RAFC 1Z45A 4R8VA 1OBCA 2PN1A 4OQMA 4K9OA 1BS9A 4X65B 4XZ3A 4XEUA 3JSXA 1H0KA 4X6YA 5BN4B 2W42A 2LKCA 3B36A 4BO9A 3W5AA 4TWBA 5AD1A 3LGAA 3V80A 2QOEA 5J23A 1PDOA 2XOXA 4AY3A 3K9GA 4ES6A 4YPVA 3OMXA 4X24A 4M9CA 4WDRA 1Z7BA 3DOFA 4JR2A 5C1IA 1I33A 1ULSA 5CFLA 1NBHA 1JG6A 4MR9B 3IEMA 1XCJA 2D0PB 2NUPB 4JEMA 1D1QA 3AM4A 3GU3A 4HFNA 4YJ2F 1E61A 1KARA 4EFMA 5A05A 1QVVA 2WM8A 1GL7A 3L0OA 4OPMA 1BCRB 3K0AA 5ES3A 5JNWA 2JLVA 3TOXA 2VPQA 4O08A 2XITA 3LF2A 1R88A 1U98A 2F9FA 5HE8A 4V3BA 1WPRA 4TM8A 1NBAA 1PJ3A 1QV9A 3RS2A 3K5WA 1F6DA 4BLWA 3TFOA 3PNBA 2G9UA 4GC9A 4YMLA 2XI4A 2ZSJA 4IAOA 3QLUC 3HBNA 2HADA 4F72A 1ID8A 1ICEA 1PKXA 3EISA 4Q7QA 3JPWA 3C3WA 3GLSA 4FC7A 5TRTA 3I6QA 4JX8A 4S0ZA 3ZHCA 1SAYA 5JQGF 3UK0A 2RB4A 4QUHA 3PUJA 2E4YA 2PMWB 3O4IA 3JVUA 3KYBA 4XIGS 5DV9A 3SM3A 4HDSA 1VCHA 2ZI3A 3T5DA 3TIGA 3ACDA 4OLJA 5T8KA 4MDHA 2D54A 1G8MA 3KOZA 4CTKA 2K6GA 4MLZA 1YULA 2XTAA 3SHWA 3AWIA 2IDJA 2XR1A 1QKJA 1NQTA 1VIVA 4X1OA 1OGIA 5F1PA 3L05A 4KOAA 2FMTA 3LC7O 4B6OA 1V41E 3DCIA 4HATA 2XUQA 2AOUA 4CV1A 2CVFA 5LVAA 2H51A 3UV7A 4HDRA 1BA3A 4GOKA 4XFKA 1SVOA 1QX3A 2X8JB 3GH3A 3ZIDA 3H4TA 1EXWA 4W5JA 4KO1S 5GONA 3LY5A 5FO0A 4EATA 3JR7A 2E5LB 4AJ9A 4O63O 4QNMA 4Q3DA 3CG4A 3VR4D 2ZUSA 5BQ3A 4YUVA 1N2CE 2PQMA 1Q91A 1L7AA 1WPGA 3C3MA 3KKKA 8GPBA 1GDHA 3EZXA 2Q4RA 4D3FA 5KOHB 1E2EA 3Q6IA 2RHWA 3VZSA 3H6HA 4J0DA 2RHCA 1JEQB 4YALA 5KTNA 1AX9A 1QO7A 4RHCA 1SA0B 3UUFA 1ECCA 2GPAA 3LRXA 3MOSA 3RBXA 1F14A 4ZOQI 1L7PA 1NJFA 1UP7A 5EJAA 1CB0A 4I4LA 4RD2A 1HT3A 1EGHA 1XTPA 1UKYA 3BWBA 3UF0A 4BV9A 1R9GA 2AXNA 1PL8A 5BVGA 2LVBA 1UR5A 4GECA 4DG8A 5K8CA 1HFKA 2GF9A 3QYFA 4O2AF 1YBAA 3DCYA 4HXFB 2NNLD 4XJTA 3U3XA 4EY4A 1EVKA 1ECJA 4RA9A 1EYZA 3HPRA 3LF1A 3PEEA 2V7EA 3IAM6 4MHSA 3VYWA 1C9JA 1RRMA 4L0DA 4DA4A 2ZIWB 3GVCA 4TLAA 5H3HA 3VJLA 3TLJA 3GAAA 2Q0XA 2BM8A 4M9ZA 2VT2A 1EI9A 2YN0A 4D5EA 3CLTC 3OCZA 2X3UA 4C05A 2EJUA 1DEXA 5DNUA 2QD5A 2YJ4A 3U7EB 2OD9A 5CT4A 5FOSA 1H1LB 3DDCA 5AMXA 2CXOA 2H1OA 1QB8A 3MOIA 1F2TA 4LI3X 5LBIA 3RSSA 3V6MA 1YS2X 4QG3A 3T1HB 2ECFA 1B93A 2XUIA 4LISA 4DA6A 4ZDIA 1BRMA 3PJRA 4P33A 7ABPA 2ZBRA 5J4KA 1KC1A 3MLAA 5A62A 5I51A 3E0XA 3TL2A 3IOBA 3G0DA 4NCNA 5JAPA 3GDGA 3OC0A 3KUDA 3WL6A 4DUZB 1AHIA 1UBGA 3LBHA 1ZRMA 2WT8A 4E07A 5JH7B 3VR3D 1KY5A 4Q00A 2C92A 2X2PA 2A1UA 3NHUA 2BONA 3UAVA 3CVYA 1UC9A 4NHEA 3X2FA 2D0DA 4EX7A 1NQ5A 2OYCA 1PLJA 2FF5A 1M1UA 2JHGA 3NB0A 4UM9B 4KE7A 4PO9A 4DCVA 2C3UA 2J30A 1Y8QA 1UFQA 4HGZA 3NPAA 3EZ2A 1DXOA 2DT8A 2V6GA 5BW6B 4WA7A 1PS0A 4XTCS 3IUNA 4A91A 1PZNA 3R0QA 4W9NC 4HZUB 1D2HA 4Q9KA 4NTZA 4X1IB 3D5QA 3N8KA 4BASA 4M7OA 2OD7A 3HYTA 4FGZA 1RRPA 2PWYA 3P2KA 4KMRA 4L8LA 4O1HA 4XB1A 1PEYA 2P4SA 5C1DA 9ABPA 1HDEA 1KAOA 3AXTA 2FN4A 3KXPA 3OC6A 2OGZA 3W0LB 4PYLA 2YZGA 4FCCA 1K63A 3L82B 4C0QC 4N5MA 3KJNA 3TLGA 3MWEA 1XMJA 2WJPA 2NTJA 1UODA 2Z8XA 4FOSA 5EAIA 1JX6A 3PGKA 4G84A 4M8KA 4RNDB 1VTKA 1OZAA 1TIPA 3KJGA 4M36A 3PIDA 2AJTA 1K2VN 4YFYA 1XV5A 2ERXA 3N1UA 4QTTB 4A8HA 4EKDA 2GCIA 2REQA 3QBEA 3OD1A 3S2SA 3OT4A 1MW8X 2LKDA 3REQB 1F1JA 3SBEA 3CEJA 3H1GA 1YJCA 2ZIGA 2VYFA 2OLKA 4MUBA 1BWPA 2L19A 4E2ZA 4EB6B 2O8EB 1YNOA 1JWLA 2HMYB 3LVBA 4JWKA 1G21B 1OD6A 2CNWA 1S4MA 2OFWA 2P78A 3FSRA 3HZZA 2Z0MA 5FF9A 5KNCD 3V1LA 5AVYA 4ZVSA 2YNMA 2IV7A 3KSRA 3VSBA 5LWQA 3OP1A 3VU1A 5LLTA 4NJMA 2IYFA 1PV2A 2TYSB 5AK5A 5DI9A 1NATA 5JSYA 3TH5A 4GBED 4KWEA 4MARA 2WINI 1BFKA 1RI3A 4FLFA 1TTTA 2DF8A 4Z4EA 2NP6A 1G19A 4TMFA 4Y9SA 2X1HA 1TAUA 4BWVA 2XRMA 4QC2A 4QXOA 3PCXA 4N9QA 2QNRA 2FQWA 2B37A 4XUDA 3RR2A 2DKOA 3C8UA 4R54A 2BISA 5LYJF 3O6VA 4NH4A 3EPLA 1OCEA 1OX4A 2C54A 4N0QA 1QIJA 2WD9A 1YGPA 4EEKA 2ZATA 5LA6B 1FB5A 1HOTA 4QJBA 2WF7A 4JC5A 3ZVMA 2ETVA 1CUSA 3G9TA 4DJTA 4L74A 4XQ9A 1P2SA 3NHMA 2OHFA 1ZEMA 4RMHA 5EFZA 5HGJA 3H3JA 4D92A 5LU9A 1GNSA 2DBZA 3FNGA 4O6VA 3V9AA 3ZTTA 5CHYA 2RHHA 1OY1A 1T2VA 1U9IC 2OVBA 5EKSA 4L95C 4EW6A 1XLWA 4R1TA 4KIUA 3HVKA 3WQSB 2FDCA 2JW5A 2EV9A 2EEZA 3NZEA 3U5ZB 3RK1A 2WJVA 3BK2A 3MCVA 1HZJA 4XWOA 3U7IA 3L1IA 5B6IA 1UOEA 1GUFA 1DU4A 1QGUB 4RJLA 2XGGA 1Z7WA 3OZAA 4FINA 3M2PA 4GQAA 1Z7GA 4TTAA 4F2WA 1UZAA 3IBTA 1ND5A 2Z57A 1J1ZA 1W5FA 4B6GA 5BUZA 3V2IA 4MP6A 2YJZA 1V9SA 1H5NA 1MR3F 4Z5XA 2V65A 1DC4A 1CY6A 3IUBA 1J90A 1O9HA 1C8KA 2A9QA 4C30A 3F9RA 4YRMA 4CM4B 4PEVA 4FDUA 1FLDA 5K3OA 4MUGA 4BNWA 3F4LA 4A6XA 2IL1A 1UAAA 5IEBA 3D1LA 2I1LA 5ALUA 2FX3A 2PSFA 3WGOA 1L4EA 3JR3A 1UQTA 1V35A 2I4MA 4ML3A 1DAMA 1WZEA 1X13A 2R1ZA 3LU1A 3PCTA 4G86A 1KL7A 2C4TA 4X8LA 4KQWA 4JEHA 3ZKAA 1G5TA 5AHRA 1NUUA 2QY6A 4ZZ3A 4Z1OA 3ANSA 2JVJA 2FWMX 3SR0A 1Y1LA 3CIOA 5KQMA 1KNXA 1RS0A 1FRZA 3WZ2A 4KPUA 3EXIA 4YP6A 4LKOA 5BURA 2J7KA 2QZJA 1R00A 4D99A 4LOJA 4PCVA 4P36A 2GBLC 3OZFA 4G0VA 4C0LA 4JUDX 2Z5LA 4MZDA 4BEBA 3ZCPA 4FM9A 2XXAA 3EF3A 1W76A 2C2WA 2PUVA 3VDQA 3U16A 4C7OB 1IQ0A 2EFEB 5GADl 4E4TA 5I9NA 1XCOA 2IXDA 2QW0X 4JSYA 3A3YA 2G9VA 1QO9A 1UXIA 4W5QA 4KN6A 4WXEA 4A2CA 2OCYC 2RH9B 5A1TA 2QDKA 5IAJA 4CDNA 1Z2PX 2XTZA 3HCFA 2XTJA 4QXRA 1EWVA 2WMYA 1L4BA 1DJNA 1GVHA 1NVMB 2VDWB 2VRBA 1Z9BA 1AGXA 4LCJA 2JZOA 1ZVJA 3EF1A 1WNFA 3ISVA 3QF4B 2AD5A 4KDRA 2YV2A 4M83A 4NU0A 3RADC 1HEYA 8ABPA 1XTUA 2Y27A 2H07A 1GZSA 5LL6P 3T3MB 4KXNA 2RGNC 3D3NA 3PL5A 4RQTA 1X1EA 4WGFA 4AN0A 4M37A 5LDGA 2FGJA 3UWKA 1VG9B 4KFTA 4GYKA 3BGIA 3NHZA 4O1MA 1KI2A 1X8LA 2W48A 3MBIA 4AL4A 4E5SA 2I71A 4PS1A 5KYYB 1ODSA 3WGIA 1U7ZA 4ND8A 4EHAA 1C1DA 2QN6A 3JQAB 4L0CA 3GEMA 3TO5A 4BMXA 2GTIA 1NJSA 4AY6A 5C31A 5HXAA 3NHWA 2P9ZA 3RKRA 1SC1A 2B99A 1ISJA 1VM6A 4NEGA 5A0VA 1OPRA 3AP3A 3OCJA 2R6AA 4KR9A 3WADA 4EJ6A 1K7YA 5EHXA 2ZTHA 1PR3A 3EGXB 3G13A 2V5UA 3H2GA 5IDYA 4HK4A 3CISA 1BKSB 4F3CA 4Q24A 2CL7X 2BC9A 4I55F 2O20A 5J4VA 2I2XB 2F00A 5IH7A 1KZ1A 5H9VA 1NBME 5HVNA 5A9TA 2YXDA 4R8LA 1QF7A 3JVVA 2XDYA 2XLBA 4MTLA 4UJ3A 1XTIA 2H0QA 3RVKA 2O8NA 1EWQA 1S6YA 1K6JA 2ZUTA 2ZRKA 421PA 1HQDA 2GARA 2RIRA 2JFQA 3G2QA 1N7GA 4FI3C 2MSWA 4D4GA 5C3MA 4XJXA 1CVRA 2H9YA 3QU7A 3U7QB 2XW6A 4A0HA 1YMUA 2WAOA 1T3SA 3CM0A 2RKBA 4DL9A 1J33A 2I4LA 4OUDA 1C50A 1BXGA 3LRPA 4FMDB 1LNQA 4DCGA 1ZMOA 4RZSA 3DYVA 3GNLA 3ZJ5A 2PZMA 5ECWA 5CBPA 1H0RA 2A5YB 5L3SB 1NOJA 1T8UA 3V4VB 1IXYA 3PFGA 3H17A 4P93A 5ALOA 3O5AA 3OJ0A 4K86A 5EIFA 1N1MA 2C8JA 3AUTA 2ZJ5A 1OU0A 1IY0A 1GGHA 2OB1A 4HHEA 5BVHA 3JARB 1FP6A 3M6XA 3RVNA 2WUVA 1ZINA 4UNPA 4DJAA 1U2DC 1RZ3A 2RCNA 5F9MA 4J9VA 3T1NA 3DEZA 4KYTA 4GKVA 3B1FA 1UMBA 2CLHB 3DO6A 1YCDA 3DD1A 1B1CA 1LSUA 3ROZA 1W44A 4DAEA 5DTMA 4PZUA 5DSZA 4N5LA 1ZDMA 1EZZA 3HYSA 3KSMA 2QP4A 3A4TA 4UAUA 1C30B 5JOQA 4UATA 3OE7A 4H6WA 4IQ4A 1LUAA 1YU9A 2V9CA 3THXB 3IMFA 2ZK7A 1JHQA 1G5PA 2QUHA 1YR9A 3GOHA 4FYMA 1MHPA 1R6VA 2X9GA 2JI6A 2FQQA 1NN1A 1ZICA 3DBRB 4I50B 1VYUA 1JDZA 3W8RA 3HDVA 2WHQA 5IDWA 2J3LA 4INOA 3BGWA 4KQGA 2O8BB 3QX9A 3W3AA 5HZMA 3SU8A 2R4TA 4Q01A 4ZAGA 5K4AA 1EB9A 1KEPA 4RBNA 5K0EA 2ZLBA 3FPKA 1AK9A 2C2YA 3N7AA 4ZO4A 4BYGA 4MI1A 5L8VA 4DLVA 5E7IA 2Q3MA 3PITA 1DV2A 2V9PA 3G0IA 4NIMA 2Q7OE 1CZOA 3U7FB 1CQJA 5EOVA 2O8FA 3HH8A 3IDQA 3T5GA 5LOVA 2ZTVA 1P5ZB 3W1EA 3QVGA 3KUUA 1AU9A 1MO6A 2JFNA 4HDNB 2ZW9A 1R50A 4G5XA 3QMVA 2FI1A 5F2OA 3IULA 5IXSA 2XCLA 2GKSA 4LGMA 4CCYB 1HO3A 2OZKA 4S04A 1ZD3A 2BFDB 4LF6B 1CJBA 2H31A 4RANA 4ZI5A 2H1WA 2A0FA 5EE5B 2AN3A 3MWKA 4M1MA 3T54A 3WV5A 3TUZC 3IOCA 2ZKIA 3BHIA 1CZLA 4WXYB 3TLYA 5DTQA 4MVJH 3DUFA 1PG2A 4TTJA 3ODGA 4IJ5A 1KJNA 2GJ4A 5FPSA 3KLNA 3N76A 3NDJA 1QFXA 2X76A 4YP1A 4CLXA 2QNIA 2XE6A 1N0WA 1QE0A 2FK7A 3DF7A 3DDSA 4P7GA 3H4MA 2DQ4A 4FD3A 4RPJA 1ZH2A 2PVSA 3OBBA 1Q3TA 1L4YA 2E1PA 2PD3A 3D8HA 4TMWA 4ZCPA 4DXDA 3AZOA 4LZWA 4EHFA 4FYHA 3BHNA 4QELA 4MWBA 1DELA 1BXRA 2M1XA 3AHIA 4GM0A 3CPJB 1QS0A 5HILA 3DOUA 2CCKA 4HC4A 1JAXA 3VMFA 4QDJA 5HOEA 1FDTA 5CLHA 3ZGOA 2O59A 4Y2PA 2NVUA 3WISA 4UEWA 5LKRA 4URYR 3VTKA 1G8HA 3RVBA 1E92A 3WNVA 2Q07A 1K7XB 2LCIA 1GFIA 3ND9A 4GR9A 1W73A 1WHTB 2HO5A 1VE7A 4EQZA 1O0SA 1XYVA 3WWOA 4WOBA 4E2YA 2OFXA 3A9UA 4L5IA 4UUBA 3SHTA 3UWPA 4BIMA 5C46F 3FTDA 4DWJA 3WY9A 2QPTA 2D00A 2WJZB 1NE2A 3IP7A 1YMQA 1MDFA 2VZ8A 2NQ8A 2I2AA 1UDXA 1V71A 2KI5A 3DSRA 4HEHA 1HFWA 3U0BA 2IEIA 2ZWVA 3IKJA 1ZEJA 4M7PA 5AVSA 4NMXB 4G56A 4CU2A 1SPBS 3RRBA 1IEXA 2FRVA 3GJSA 4RXUA 4ZZ1A 1DCFA 3BCRA 1P39A 3UTCA 1V9LA 3O4JA 3NBUA 3W5UA 2FPXA 4V1CI 1GT6A 3L46A 4HJXA 3CWQA 5AJWA 4B35A 4ENRA 5JJLA 3A4VA 3GR6A 3OWOA 1HUQA 1F0PA 4TM7A 5H68A 1IVSA 2YC2C 2OAGA 3CLSD 1QO0D 1SU4A 4YROA 1GPKA 1JKFA 3SDBA 3RHTA 4H7IA 4Y2YA 2GD2A 1CUIA 5CNJA 3MCAA 2JATA 3SX4A 2R86A 3QELB 3OPQA 4Z7OB 1SQFA 4B0OA 3Q9UA 2OQRA 1POXA 4C4TA 1Y6FA 2H2IA 2BFFB 5I5EA 5GWXA 1ADFA 3SY8A 5C37A 3JZIA 5ITZB 1XTRA 1O94D 3BFVA 3K70D 1HI9A 2ONKA 3KDAA 3T1TA 3TS1A 1NR1A 2DY0A 3CLVA 2GPWA 4IOKA 1F6WA 3UAOA 4UCWA 2F1HA 3GBPA 4LWQA 2ZJFA 1PN3A 5I7RA 3RYCB 2I0FA 2BAGA 4KBYA 1QHIA 1ZUIA 3DE6X 2RGCA 4CMCA 2C88A 4G4JA 4D25A 1XXHA 3FPCA 2ZCUA 4LYJA 4C7BA 2J07A 2D5LA 1K6EA 3PHJA 3TTUA 4DB4A 4DIEA 3V9PA 1OXUA 1Q1AA 3ZLUA 4AJOA 1H2FA 1JXOA 1XVVA 4G5HA 1A77A 2DFPA 1ZUWA 4OQFA 5FI0B 1JHAA 3TGPA 1KS9A 2H00A 1RLUA 1P2DA 3EIQA 3EDOA 3QYPA 1RM3A 4QQFA 4EI7A 5HKKD 3TVYA 4IYRA 3MT0A 2FDXA 3K0AB 4PX5A 1E2BA 1QGAA 3I30X 4UREA 1NRXA 4YQFA 3ZGVA 4FYYA 5AXCA 3NXSA 2WWRA 4FHGA 1HL7A 1E4EA 1ZFNA 1FYVA 3F3MA 4DTCA 5BWMA 1Q7EA 2VS1A 2BJWA 1EGQA 3NNDA 5I7WA 2Y6UA 2AVDA 3E1SA 5B3LA 1U9CA 1TJ4A 3F73A 3ZHYA 4BX3A 3N75A 3IVMA 1G3QA 4YJDA 4F38A 4GOLD 4CLRA 3BXGA 5JBQA 3KO8A 3X1YA 3K9QO 4KX5A 3S2YA 1F60A 2YHAA 5FPTA 4M1OA 1JTVA 4JP1A 4XCQA 4HDSB 1P0CA 4ZZ0A 3X1ZA 2OXIA 2H1FA 3WK7A 1Y9JA 1A2OA 5KYNA 3BE5A 3U7RA 4I4CA 5L51A 3M4ZA 1JIVA 4BDTA 2HBZA 2IU4A 4RY8A 5FOXA 3A1CA 3E5MA 2G80A 1BKDR 4RNCA 4U2FA 3RS3A 4G63A 4EIWA 1K66A 4B09A 4DUGD 1FQOA 3HLYA 3UIEA 1AF7A 1GGNA 3CEMA 1QWSA 3ZBPA 1NQUA 4JBYA 2AOUB 3ZU3A 3BFXA 1SBYA 2I33A 1I1QB 1IAQA 1U9YA 5LZ7A 1H8ED 1EGAA 4HDRB 4Q7EA 4CG0A 3IESA 1YQTA 3VR4A 5EC8A 5GONB 5MN5A 4KPFC 1R6DA 1TQHA 5KX5F 3I6YA 3T5AA 1S01A 4JYBA 4GDFA 1ISHA 4KMSA 2R8PA 4OX9Y 1BG6A 3CZ5A 3IIMA 3PYMA 4ZVVA 1MCZA 5CLJA 3VMMA 2XYRA 3CRRA 4ZIRA 2XHZA 4HH1A 2QRNA 3KSDO 4ITRC 3OAAD 2DP4E 3UXEA 3KEQA 2I8CA 4H2DA 1MOZA 4WKNA 3S28A 2YWFA 3JTMA 1VGRA 4B7XA 2RCYA 1Y89A 1W5BA 4CF4A 2QMQA 3GLRA 2PIDA 3BZUA 4MUYA 1KI1A 1KK3A 3GLUA 3LIIA 5ALFA 2AFHB 2ZROA 3M9LA 4KKVA 1ZYUA 2CHUA 3PZBA 3IOMA 2AA3A 3JQFC 4AZVA 2F3TA 5EIAA 3L7AA 4Q5IA 3RLFA 2MT9A 3RTGA 3T3HA 5ALIA 1NW7A 4EY8A 1XN1A 4YB8A 3UT0A 1QOPB 4PYQA 3GFSA 1ZJWA 1N6IA 1HF3A 1QH1A 3D6VA 2NX2A 2ZE5A 4OAQA 5M3BA 4ZCMA 3U4DA 1UBLS 3LZ6A 5JW6A 2IUYA 3P2JA 4KR7A 4TKUA 2UVQA 4WKPA 1TVKA 1N7IA 3E18A 2INGX 3EZNA 2ID9A 4Z0NA 5IH3A 4YCLA 4WZAA 4RA9B 1HNNA 1Y7LA 4BY9E 1SFRA 1O08A 2C1XA 3GROA 4HBGA 5MHTA 1ORRA 2GPNA 1OI2A 4JJEA 4Q0MA 1RI2A 2Z2IA 3UO8B 5ESDA 5AVZA 3QQ5A 3BJEA 5A6SA 4RTNA 3QNMA 1RCTE 3BWDD 5C52B 1VJ1A 2GEVA 3AI3A 3KYCB 1YO6A 1P1IA 4ALMA 3UHFA 1WDMA 1E2PA 4XSHA 1K8XB 1NVAA 3NHPA 3AK4A 1R74A 3UMSA 4KXYA 2PL3A 3DAOA 3ZZ1A 4FNMA 2PSJA 4D9CA 4YPFA 1Z36A 3A9CA 4UBOA 2FX2A 4EG7A 1F2TB 2V7QD 3BM5A 2G36A 2Q4DA 2QF7A 3O95A 2PT7A 1RJWA 1RU3A 1K08A 3QFHA 3CVXA 2VUTA 2Z1DA 1E3TA 4EJSA 3RWOA 2C77A 2PTHA 2VI5A 4QOIA 5FBWB 5LBTA 5BOSA 4QM6A 3ZI0A 1LBIA 3INTA 2G5PA 3MTJA 5FAKA 5LP1A 1ZK2A 2A9VA 3VR3A 5ISMA 1RQ2A 2CBGA 5DNWA 4DOMA 3NMUF 2BFBA 2GJSA 3NTQA 3ETEA 1RYZA 4HYTA 1O54A 4X8MA 2CYCA 5CEFA 3FJ1A 3N2ZB 1OFUX 2A1UB 3PEVA 3SMVA 2JLXA 1PTJA 3JQEA 1JEAA 4UHBA 3NJ4A 3U4HA 3C6ZA 5K3FA 4BQEA 2OWDA 2XB8A 1U7OA 2N0SA 9LDBA 1Y8QB 4DUPA 2QRVA 3GQBA 4LN1A 1E5DA 7ADHA 3N6VA 3I9V1 3KXDA 2IHTA 1MBZA 2WNSA 5IUKC 3RGWS 3QPUA 4AF7A 5ALSA 1ZM9A 4KQ6A 2WE7A 4B6JA 5HJ2A 2BHTA 1JR3D 3HGTA 3BL6A 3OZEA 3B5EA 3SP1A 2BEUA 1D9XA 3EGOA 4NPCA 1J24A 1LF5A 4Z51A 1AH2A 1JZQA 4QNRA 1JVSA 3K35A 5CT9A 5HQJA 4P81A 4DBLE 2PRSA 4OK6A 1IXRC 1XTZA 3GWZA 4L28A 5H9WA 2H4HA 1XI2A 3BF7A 3L1KA 3MWEB 4XB6B 2G9NA 3TLGB 2D1YA 3L5OA 3ESZA 1A4XA 1UBKS 4JFAA 3D6HA 3BS4A 2BBWA 2IITA 5JCZA 1V3UA 1BMDA 4DFDA 4IXNA 5DXFA 4BJ1A 2CE7A 4YT2A 4LRWA 1RHQA 2REQB 1EK1A 3P32A 4JJ4A 4N0PA 5DM1A 2RG1A 5K0LA 3FWHA 1D09A 4JC8A 3ZCSA 1GV0A 4ETIA 2OC9A 3QUTA 5E1DA 1SU6A 1I0IA 1X1AA 4IDBA 4KIWA 4D1YA 1U7WA 3QUQA 5IU6A 3ZDRA 4BRZA 3GP8A 4BGEA 4EBBA 3TWOA 3GHYA 3IOYA 1UXKA 4CN8A 4YAIA 1S2DA 3CJRA 4LK2A 4IHKA 5KNCA 1W6UA 2QM0A 3SDZA 2Z09A 2J9RA 2XXBA 4EUFA 1G1AA 1ZSYA 2GJKA 4MWOA 3GGSA 4GKKB 4ERXA 4RYLA 2WDZA 3O3NB 4NJMB 1Y63A 3OTWA 1FX0A 5G02A 3GVIA 3LT1A 1E8MA 4QLBA 1P9OA 1TQ8A 2X4LA 4GNRA 1NUAA 4WT7A 4JKIA 3ZX4A 4Y1RA 2DHCA 4HG2A 4A2QA 5BN5A 2P6PA 4GGPA 5K9ZA 4B3MB 3AETA 3VYTB 1RP1A 1K8RA 1F5SA 4FMCB 1K98A 4B45A 5HUQA 2I34A 1RXWA 5H8WA 1UH5A 4NPAA 4HRYA 3U4AA 1CNMA 3KQPA 2IH5A 3ZVRA 2H1SA 2H0AA 1O7JA 4MV7A 5JHGB 5FQNA 5JBIA 1OX4B 1OLUA 4JBNA 3QPVA 1YASA 3OOJA 3O84A 4IDOA 2Y68A 3QMPA 1H4SA 2J85A 1JFRA 3NTOA 4NBLA 4OB6A 2RHDA 4RH1A 1HFJA 1ZISA 3K8OE 3LOUA 4XB2A 4DYVA 1G3RA 1Y7HA 1I8TA 1A82A 1ADJA 2FUKA 1P1RA 4W1RA 1PJAA 3M82A 1RYMA 6CHYA 3NIBA 3LY7A 2DULA 1QR6A 4FYKA 1QDEA 1AXGA 2V6FA 2ZBUA 4AG6A 3ZCRA 4KN5A 3KQLA 2QXTA 1BTOA 2RHRA 1OZ0A 3HJHA 4LJ8A 1WCV1 4B47A 3U5TA 1Z0UA 4C3VA 4C4RA 4F21A 1W36D 2H4JA 3DEFA 3OUUA 4ECEA 2ASEA 2OV4A 3AKYA 4I9FA 4OBEA 2F90A 1ESCA 1SD1A 4J2HA 2X5OA 3OQBA 4BKUA 3TYXA 4X7PA 5ADVA 1JTEA 2B0JA 2I7DA 3HGMA 4RY2A 5GV8A 3WIDA 2GXAA 4W7SA 4QRHA 3V4FA 4ERNA 1DX6A 5JAZA 2QVBA 3MJRA 3QX7A 2E0IA 1GRCA 1Y7PA 1QFYA 2UXBB 3LW7A 4PCAA 3U9SA 4XR4A 3LLSA 1SKBA 3MRTA 1IONA 1CZNA 4XDZA 3U4GA 5HS6A 4B44A 2BYTA 1VIMA 3W2GA 4CR6A 4TKMA 5KC8A 1JQEA 1PL0A 1FYXA 1UK7A 1U2GC 1Q0UA 4BNIA 3X1JA 3KE9A 3OEED 1A5BB 1NI3A 2WSYB 3LT0A 2ZUDA 4OAPA 4DRYA 3CKMA 4RXMA 2HMWA 1XLVA 2PPLA 2YY5A 2E4AA 1PFYA 3FTFA 2AYZA 1KBZA 1R8JA 4R01A 1LPSA 2BFAA 4MIEA 5IEJA 4DR1B 3M1LA 2ZCJA 2ZBVA 5KCZA 1XEWY 2ZIAA 4KPUB 3OZXA 2YZKA 4FFNA 4XQ0A 4Z4FA 1P8AA 3EQ2A 3WB1A 2WAAA 3TTVA 3THWA 3TSCA 3F7NA 3QNWA 2GO7A 4CE6A 2YTZA 5EESA 5TX7A 1U7UA 5BWLA 2O3JA 3UY4A 5DNCA 2JZCA 1FJHA 3A14A 3I9KA 5DWDA 3U3JA 3FBTA 4Y2GA 2C2OA 4P5EA 5AW5A 4UPEA 1N6OA 2XXAB 5FTNA 2YS6A 4JR0A 3ESBA 3ZWXA 1CUAA 3DBLA 5C4IA 1C2TA 1LCIA 5JXGA 3DPUA 3O82A 4I0WB 2K7ZA 4Q1FA 1V47A 3NANA 2HMUA 4KLNA 5BVGB 1WR8A 2HJVA 2P4EA 1ODJA 1IMOA 3BERA 3MTDA 4J16C 4QPNA 1TGVA 2Q41A 3QMWA 4IQGA 3JZMA 3L9XA 3FSEA 3FBGA 5ITVA 3ECCA 2ZJYA 1CG6A 1HC7A 3TX2A 3ZWNA 3HJUA 4CKEA 3IXQA 2E1RA 2R62A 1Q16A 1BU5A 4IDFA 4LF8B 1R0XA 3Q8LA 3WRVA 2FJPA 1V6SA 1WCIB 4P5DA 1V3VA 2YHBA 4GMDA 2R8OA 4RV4A 3BCSA 3H9GA 4RKWA 5FO1A 3UATA 4D0GA 4KXQA 1Z38A 3G5UA 3OTGA 1MHTA 4ND8B 5HCUA 4N9WA 1C1DB 1OVMA 1ONSA 3DLHA 1JI3A 4EF4A 1DRWA 3HN2A 3B6KA 1RIIA 2VP2A 4MV1A 4ND7A 4QUIA 3COZA 1FRNA 4PZ9A 4WVLA 4Q3AA 1PW7A 2CDAA 2QPAA 3T3PB 3SZGA 1M3SA 3VJRA 3GA5A 1RYYA 2FW9A 3E3NA 4J0QA 4PPYA 3UMRA 4DIUA 3VHQA 1PJBA 3JRNA 1C8VB 4IUDS 1AV6A 4JXZA 4BB5A 4S2UA 1M2JA 3A2LA 1K9SA 4KC0A 3NGXA 2BOVA 3M6AA 1GPNA 2HMTA 1C0EA 5KYXA 2HXSA 4FFRA 2J4CA 3SS7X 3FCUB 1ZU4A 4BLUA 3O47A 5L4NA 4YP7A 4C5CA 2IK8A 5FL7D 1TT7A 1VJDA 1E5LA 4IIVA 4YRGA 5BSGA 1ZW1A 1OFIA 3FVTA 3G8BA 1M1NA 4XA8A 1ZONA 2C5BA 4M89A 2HFKA 1GG8A 4IQFA 4IRUB 1L7VC 4QL3A 4TWRA 4UXJA 2F8SA 1DAEA 3N87A 2CEKA 4P7BA 1W19A 3KZNA 4W7IA 5TGTA 3THRA 3GT3A 4MGZR 4OUDB 4QUEA 3RTDA 1BXGB 2UDPA 5GJWC 1AZLA 3FSGD 2ZJZA 4BNZA 5CBPB 4QU0A 4XX1A 4NZMA 1GZ3A 5KHAA 4IHQA 4OHMA 1EK0A 3WL4A 2ZT7A 4YRZA 4RV9A 3R0JA 1ZMXA 4LS3A 4OTZA 1XWWA 2HJGA 5BVHB 2XDQA 2PANA 2PSEA 2JGRA 4Q4AA 3QEMA 3TL3A 4FHDA 1LPPA 1ZNXA 2FWJA 3GPCA 3I37X 1YZGA 2O2JA 2ZJ1A 2PUWA 3AUUA 2RHLA 3G8YA 1XMSA 3L77A 3HXPA 3BGVA 3IALA 3KUCA 3MLEA 4F4UA 1WD7A 2DPYA 3DNMA 5T3YA 1N2EA 1OLSB 1YRWA 1OX5A 2FP4A 1FUYB 1UMBB 3QPAA 2P1ZA 2PGJA 5DBHX 4C14A 3OLXA 3ICEA 3LD9A 2PYIA 5JROA 3FJOA 4Y3UA 3OFJA 5FJIA 5JQWA 3RBVA 4C2TA 4Z2YA 1G291 1RJ9A 4LRSB 5CFMA 2GZ1A 2V7BA 2W9XA 3U1VA 2HA6A 2XKAA 4LSGA 1ZGHA 1SM4A 3W3AH 2J45A 2JF0A 4H17A 4JDPA 1EQAA 3UMYA 3G0OA 4NRDA 3DFKA 4LMAA 1WRBA 1ZRNA 3V8VA 3EEQA 2HA0A 4X61A 2BKVA 2HA5A 1RXCA 2JA2A 5ALGA 5EMLA 5GMOA 3UJ3X 3CNBA 4A82A 4BMDA 2H63A 2JFUA 1U28C 2HY7A 3PD0A 4F93B 5DT9A 4DV2B 1MEJA 1T2AA 2B7LA 2X4GA 3EEYA 4JS0A 5DHTA 1CQJB 2WUEA 5DO9A 4V03A 4BNHA 2O8FB 4JB0A 3FVQA 1SG6A 4U6NA 1GRRA 1U81A 1R27A 2AD1A 3L9WA 3QVGB 3G2IA 4DDMA 2J0QA 3AHCA 5DSXA 1ZNWA 3H18A 3OOHA 2PQ6A 4CM3A 1VQ1A 1NMSA 4HP8A 4DR7B 4RHYA 4P4UA 1LBHA 1RQ7A 1E2GA 2C7RA 5D2CA 4BC1A 4UBMA 2W8ZA 4XYBA 2XDWA 3HVJA 4XFDA 4GZ5A 5C81A 1PRYA 2DYKA 4PZCA 2AUNA 3DUFB 3ADCA 2PGAA 1OROA 3KWLA 4AO8A 3SBXA 3JWGA 1XD9A 3KKPA 4KQFA 5DT2A 3A4YA 5TT0A 5HHTA 3MTEA 3G6WA 1RI4A 3T9AA 4CETA 2AF4C 4IX9A 2Z58A 5KDDA 3HL4A 1QCZA 1M76A 4LOAA 3P2IA 5AI6A 3PE3A 4HDAA 4QBFA 1JSRA 2CLCX 3OQIB 4DNOA 1FP1D 1P2BA 5REQA 5AVKA 2QK4A 1ODLA 3ZLBA 1BXRB 5FDFA 1GFWA 3TQSA 1JHXA 1UJMA 4X60A 4ACAA 5ITZA 5JMTA 5KS2A 1QS0B 1IBKB 2JFXA 2A92A 2CXXA 4IKEA 2VA9A 1FYDA 1O4VA 1O87A 1KEWA 3WSVA 3N05A 2B1IA 3GG2A 2MMCA 1XRPA 4OHFA 4ZANA 2DH6A 2W6NA 4CCAA 2AC7A 1BVHA 2GGSA 3AY6A 2BGNA 4Q3CA 4OXNA 4BU0A 2VLBA 3G2OA 4YRTA 4BPRA 1TA4A 3G49A 3D7LA 1JE1A 4EA6A 2XRYA 1EWTA 4Y2JA 4V3CA 5LZ5A 2XZLA 1SXIA 2WA2A 3AOEA 3FUVA 4P2GA 3X2SA 3OJLA 4BVKA 4BQFA 1ZU5A 1M2VA 3NVDA 4X85A 1IBMB 1OWPA 4HDKB 1Y3AA 4JLBA 4X7RA 1IHPA 4MVJP 3CU5A 2Y1GA 5KTOA 4J7AA 4TYPA 1ZBQA 1M6YA 2A0KA 3CLUC 4K7JA 5J9FA 3S99A 3PENA 2G3YA 2VDUE 2FUG6 3WL8A 1AS0A 3RRYA 4JJZA 5CA0A 3DKKA 1JE0A 2XD4A 4PSCA 3TMKA 1U6JA 2B4AA 1XJ5A 2BLLA 3RE1A 3FIUA 4ZAWA 3CG0A 1VPVA 1ZZEA 5DLEA 5H02A 1QO0A 1BEZA 2BFEA 1KOLA 5AOVA 4EGSA 4CODB 2AWOA 5HKBA 1QU2A 4RIEA 5TQVA 2HA2A 5IS2A 2DHRA 2JI4A 2A0YA 3L3BA 4ETWA 2PBZA 1OXXK 2HLPA 2Q2VA 1YHZA 3DZKA 4F8EA 5CDGA 3ADDA 1NULA 1XAGA 1P33A 1XP8A 5J58A 4TVSA 1C29B 5CPFA 1O94A 3S8EA 1XDZA 2Y0BA 2A5JA 2MINB 2ZRQA 1A4UA 4ZK6A 4AUEA 4BRSA 1M5RA 3NEJA 3V7NA 2RKOA 4JYAB 4AB1A 1Y5LA 3KD2A 7MHTA 3CLKA 5JD5A 2WUDA 2ZYSA 4QEZA 4FN4A 3K6SB 1WWKA 3WBBA 3OMWA 4Z4QA 1JFFB 1G8AA 1Y6JA 3N58A 4EYKA 1IOLA 5A03A 1JECA 1IIRA 5CVDA 4D74A 5BP7A 1ADYA 2XD9A 3PC6A 1P74A 4BDSA 3ABSB 3CNQS 3IERA 4UTVA 1Z8HA 1EVYA 4EHBA 1XXHB 4AXXA 4B8ZA 1GUBA 2FLKA 5BUCA 2A9JA 2ZR9A 3T4EA 3BXOA 2ZUWA 5HKKA 5ED0A 2Y92A 3FLEA 1Z07A 3MFYA 3U3DA 4EI2A 4G5SA 1G7SA 4QKQA 1P0MA 5G3YA 2LBPA 2HWWA 4MR7A 4UUOA 2X0IA 4FDMA 3VI4B 3BWEA 3M83A 1KDZA 4YIHA 3I52A 1P7WA 5TEWA 4W82A 1Y4DE 3K09A 4N7RA 1NVVQ 3OE5A 1KU0A 4X00A 4DCNA 1E4EB 4YGYA 5IMBA 1ENYA 2WIAA 2A6PA 3L6UA 3QENA 4LYGA 3WTBA 3IE2A 2LXNA 4LDZA 4QUJA 1YTUA 1E1KA 1NJ8A 1ST3A 1ID1A 4ALJA 4XIYA 2BLNA 5AUOB 1ILWA 4TQ9A 2NSLA 4MTCA 5I5GA 3S55A 2XMRA 3ROPA 2HUNA 5EIHA 2JKZA 2AXQA 2LD4A 2ZTSA 2G9ZA 3G8AA 5HE9A 3FFWA 4IS3A 5FQOA 4UM7A 1UXJA 3IEXA 1NU6A 1K8YB 1PLKA 1IY8A 1ZK3A 4GSKA 1DPFA 5DTEA 5F2KA 2I3BA 4EJMA 4Z4HA 5C8ZA 1NNEA 1RXYA 3G1TA 4PYJA 1EU1A 4QPDA 5CHEA 5DM4A 3HEMA 3CRVA 1DBPA 3VR4H 4GPD1 1TEXA 4WH0A 3RFCA 3HBAA 2P0AA 1UK6A 2WP8J 2P9HA 3ECSA 4MKHA 1P5JA 4OGKA 4AF6A 1ZJYA 1FU4A 2ZRNA 3S44A 4EHDA 1AKRA 3P5SA 1V5WA 1IFXA 2AI3A 2JIMA 3OEWA 5C1PA 2H3EA 2AG8A 5DB4A 4UCQA 3OZVA 3M5DA 3CRNA 4B4WA 1OH7A 4BMZA 1DJLA 3HNOA 2QJRA 1QB7A 1G5QA 1GDTA 4H3VA 5HCIA 4JEIA 2D13A 3RSQA 3SS8A 4EZEA 2G6BA 4IEIA 2BKLA 5LDDC 3PEWA 3DL0A 5DBGA 4AUNA 1PYOA 1ORVA 2QU8A 3OAAA 4MQLA 4UFOA 1T5IA 3QLJA 1AUQA 1VSTA 3DWFA 4ZIRB 5K05A 2Y71A 5TNXA 1W96A 3WGLA 4A5SA 2E87A 2WZQA 3G2NA 4JGBA 4NYIQ 1N1GA 2AUTA 4Z86A 4YCMA 3RG2A 4Q82A 3C3AA 4KUEA 3ZNOA 9ATCA 1RE1A 5A6VA 5C4GB 3AV0B 4HO1X 5K7SA 4OXQA 3QEAZ 4NDNE 2CKDA 4CIYA 1FTSA 3A28A 3HV0A 3OJXA 4YLEA 1JBQA 2CC2A 3MGGA 1KE2A 3I1YA 4MP8A 4F96A 4J9UE 2Q2OA 4H4DA 2C1EA 2WIJA 4OBBA 1EDBA 2ET6A 2GBCA 2ZBQA 4A8TA 2LNDA 1ZS9A 1EFDN 1PCXA 3YASA 5DXAA 1SQSA 4XYMA 3IQDB 5ICSA 1XNRB 3X0DA 3PQEA 1QH1B 3EG9A 1M0WA 4MV0A 4OHOA 3TK1A 3HKDA 3M7IA 1YZUA 3MWJA 4URZR 5AKHA 1UJ2A 2HU2A 1WXEA 4J0FA 1Q21A 2DWOA 4TKUB 2XVAA 1TVKB 4ALNA 1CP2A 1L1RA 4Q37A 5JFTA 3DV9A 4P98A 3BOSA 3MIIA 4JUAA 2JIBA 3K0EA 4WZAB 2OB2A 2G77B 2VXBA 3C1OA 2OG1A 2H08A 3DB2A 2O2SA 1AQLA 3K2IA 2GRUA 3F6YA 5FP0A 3RUEA 1M34A 4Q66C 1B6TA 1XFDA 2B8JA 3KK0A 4GS5A 2Y0CA 4WTOA 5A6SB 3ULKA 1GSHA 3GRPA 3STVA 5L95A 3E7WA 1OAKA 4X91A 2ZUFA 3D2AA 1Q6ZA 1SCNE 1L7OA 1E20A 2C2BA 1TOAA 2COKA 3TCXB 5LQSA 1PJ8A 3B1YA 3LYAA 4JVMA 2J3QA 2V7QA 3PFCA 3TTXA 1NW9B 4QHYA 2I55A 3ELWA 4HS4A 4YLGA 3N2LA 2YW9A 1VLMA 2IEYA 2C4HA 4LWPA 3SEFA 1E2JA 3RTCA 1JG2A 4O4HA 1DEOA 3ZWPA 1Y8CA 5K3DA 1SKYE 3MJHA 3FRIA 3OURA 2A5LA 3HBLA 4EJSB 1AG9A 5IC6A 5BOSB 1OLXA 3FI9A 2X8BA 4KSYA 4A2WA 3CB2A 2BVNA 4DMRA 1X92A 1Q2XA 2Q3LA 2DERA 1JI0A 1PR0A 4UTXA 3Q7EA 2BFBB 3UMMA 2BMAA 3SGLA 1GZ4A 3G1UA 3N2KA 1E32A 3PD7A 1M8JA 2WU4A 2YQ4A 3LXRA 1Q5PA 1UXGA 4F56A 5HM8A 2J5QA 5K3FB 4EEXA 4REQB 4WK4B 2HBRA 3RRFA 1ZH0A 4QBIA 3ZWYA 1TU4A 3WDSA 1GSIA 5ENZA 1XTQA 1HTWA 2VBGA 1RABA 1XA3A 3D5TA 1RM5A 1EDEA 2DUMA 2EJCA 2Q3DA 2YHIB 3GQBB 4L4XA 1GPWB 4QUAA 2ZGVA 5LD2B 3N5CA 4HAYA 3ROMA 5CXQA 2P79A 1JR3A 3KRTA 4EELA 3TB6A 3M0EA 4FHFA 1NKSA 1FA9A 3EGDB 2XB9A 4ZARA 4BFWA 1HT0A 5CG1A 5JZMA 1NBMD 3KUKA 1RT9A 2GN4A 5L53A 3WFZA 1A95A 5U4XA 3IMCA 1N5DA 2HA7A 3E9CA 3K1YA 5F4ZA 4B81A 2QR3A 4J7UA 2G8NA 2ID7A 4IBOA 3BSFA 4S1WA 1EX6A 5FNVA 4ZEWA 4DMCA 1Y0BA 1WXWA 2BBSA 2GYVA 1FFHA 5HS4A 2PKQP 4FZJA 2HMSA 1J2TA 3BYZA 3HUTA 4HRVA 4XUEA 5D87A 4XWWA 3AUYA 1GZUA 1TCUA 1YUBA 1Z33A 1QMGA 4IF4A 4KIJA 1QCDA 3ZDEA 5JAUA 3KQKA 2E4VA 5EHNA 3N7TA 4OJMX 1VA5A 3UPDA 5F1OA 5KNCH 2D59A 3COPA 2UUAB 5EKXA 1BVYF 1H2HA 1UBUS 3C5CA 3BH6A 3ZV6A 1QF6A 2RE8A 4FTWA 4MW4A 2VDVE 1IPHA 3HY3A 4QGFA 1WCXA 1VG1A 4HWTA 1KA9H 4GW3A 3NKLA 1TJNA 4LPKA 3VX3A 1BKYA 1NP7A 3QOXA 1TM1E 3BEDA 3LRTA 3QXXA 3GMSA 3RC1A 1RKBA 1ULHA 2VF7A 3EH1A 3SJ7A 4LQLA 3BDAA 1XU9A 3QXSA 3FHJA 1L0BA 3CF2A 2ROQA 2CEAA 2JFFA 3JQ9C 1QR2A 2VHJA 3PJEA 5E95A 5I01A 1I3LA 1W0CA 3BMQA 2ZE8A 1M54A 3IBFA 5H59A 3R9IA 1VIAA 4N7JA 5IFLA 3KS9A 4BP8A 3MSCA 4AU1A 1VZ3A 3DGFC 3P9IA 5BN5B 4EH1A 3NTXA 4L57A 2WAYA 4Y1RB 5F2EA 2FZLA 1NNUA 3AETB 3OLQA 3PGXA 5C8DA 4MDYA 5T4FA 3RAGA 3Q98A 5AJVB 3T0FA 5C2JB 3BQMB 2DLNA 1TC2A 4EG6A 1VHQA 1AQUA 1BIFA 2XNDD 5COBA 1HE3A 5JE8A 1N34B 2AKAB 1SD2A 2ZRPA 1OLUB 1R12A 4KZPA 3A1EA 2Q6IA 1FDWA 2OR3A 3AIIA 1S3FA 1IG3A 1AUVA 2OBMA 3KSBC 2HJRA 1DWOA 4FZ3A 1NVEA 1IRIA 2HDNB 2J3EA 4JP3A 2N1BA 2I5PO 2JFBA 4KSBA 1G2OA 1KYZA 3GJ4A 2A3NA 1PW5A 1TD9A 3VOBA 2R60A 1IJEA 4WY5A 3IHKA 2HEGA 4FUQA 5IZ4A 2O14A 4ZMSA 3AF4A 4RFSA 3HQ4O 1I9GA 3HHEA 3DAFA 3GGGA 2DCUA 3PUYA 3ZGZA 1BE1A 2GJ9A 3TTYA 5T4BA 4KK4A 3PQ2A 1HWYA 2OCIA 2ZIVB 1J20A 1F12A 1XL1A 2J32A 4ZTBA 1FIUA 2HEIA 1E6CA 2XHEA 3QGMA 4OIFA 1YRHA 4DILA 4UM8B 1QAQA 4YJHA 1KU6A 1AJEA 1W4CA 2QROA 1A71A 4LXGA 3UB2A 2VH1A 4QBGB 1T1EA 1N5LA 2PMDA 4XQGA 4ZYXA 2B69A 1NMYA 1VE9A 3N8HA 3PJFA 3QW2A 4PGGA 1T3HA 3SSNA 4BJ6A 5D86A 4OFXA 3WLJA 2BGJA 1HSOA 1FLAA 3N59A 4D8UA 1A72A 2RJNA 3OEEA 3V2HA 4DPLA 3AJ9A 4MQ4A 2BWJA 1JSCA 2IYXA 1Z5ZA 4OQQA 4NCXA 2Z6UA 1AF4A 3G9XA 3UC5A 2VK8A 5BORA 3IHTA 2FMFA 2V3CC 2IXEA 2ODBA 2P2ZA 4EA8A 4S0XA 2XNHA 3PHLA 3U4CA 1G20A 2VAVA 3WS7A 1RHJA 1RWXA 4EHLA 4G0ZA 4NVRA 1LC3A 1Y1TA 1RAGA 4V39A 2GYYA 1UDRA 1PVDA 1LFAA 1I4WA 4G1CA 4QBKA 4BWYA 3L0BA 1P91A 3K32A 4NDZA 5EEGA 3VTFA 3ONNA 1B6RA 1PT5A 1MAHA 1XDGA 3CNOA 5DLQC 3U7GA 1SBHA 3OTOB 3PGLA 3THWB 2R5NA 3IUQA 4JIGA 4R9SA 1T3TA 4QTZA 2PAAA 4ND5A 3MJ4A 3ICWA 2ZCVA 3BT7A 1M2HA 2Q1XA 1AKUA 1GAJA 3VR6D 2H1VA 3JWPA 4GWKA 1ZIYA 1L7BA 3QI2A 3UAZA 2W43A 2A78A 2QTHA 3DBLB 4YIKA 1YZ3A 3GNSA 5KVCA 1YZVA 2V55B 3KZOA 4LRQA 4RL4A 4PX3A 1RDFA 1YRBA 1Z8FA 4FSHA 1BVUA 2YW2A 4I5FA 1AB5A 5BW5A 4W5WA 5C7OO 3C5HA 4U2GA 1DIBA 3I8SA 4BUJA 3AU9A 1LKZA 3M9XA 3PNMA 4CKEB 4CQMD 1L6IA 1GAEO 2B3TA 3K0SA 4NFHA 5AW6A 1OXSC 1W4AA 1F4LA 4WFIA 4QAQA 1JDNA 1JLRA 1OVGA 1NVVR 4V24A 1J4AA 3N2NA 2FNAA 1T4DA 2FPLA 3VO9A 1EVIA 1T8TA 2CN1A 5KNLA 4JT2A 2RGGA 3AW8A 5K4GA 4D9EA 2G5CA 3U49A 1YD7A 2GX6A 4X7BA 4E1VA 4NBSA 1A8HA 1GYRA 3STWA 3DW1X 3SJCA 3ZXXA 1JXMA 2WTXA 5A4DA 3AZPA 1KXJA 1PR5A 1ZJ5A 5IDXA 1NQVA 2XSZD 4OF4A 2VP3A 4BMPB 3AI1A 3ICVA 1P73A 3FLAA 2JI8A 2CJPA 4UW9A 4BO1A 5FUQA 1E6LA 2VOJA 4M21A 4M6WA 4HGNA 1QLJA 3F8WA 1EAMA 3AEYA 4JHLA 3ZG6A 3UHPA 5H70A 1QHYA 3OZSA 3KU1A 4A9AA 1FLVA 2IU3A 2VPIA 4MXDA 5IZCC 3K9FC 3ET5A 1DIGA 3CBQA 5CDTA 5FL7A 1SCAA 2GXQA 3JQDA 1G6HA 3MJSA 4PHCA 4PYMA 1UXHA 2IBTA 3PDWA 3UK6A 1PU2A 3FOZA 1FTYA 5KYKA 1WEHA 2C3YA 1UP6A 4Q4LA 1LU9A 4BZPA 3DTYA 3LM8A 1M1NB 5AK0A 4WL0A 3V1KA 1IY2A 4Y8VA 3FSGA 4L0MA 4L85A 1WB5A 1K75A 3E2MA 3LC1O 4WFQA 1T9GS 4GPBA 4LBZA 1UOOA 2NZYA 4P08A 2W22A 5DULA 3ELDA 5IKEA 4XH9B 4P4NA 4HEQA 4E94A 4RE6A 2AQ8A 2FFHA 3H8JA 1PO7A 1Z6QA 3CRQA 4DJJA 3H5VA 1SN7A 3IUEA 3LCMA 4TVOA 2XDQB 4ZAFA 1VP3A 4IKOA 4F4HA 1W52X 4Q4AB 3QEMB 4G8DA 3MRVA 5I8WA 1JHRA 4C07A 4RPIA 5A3SA 2Z3ZA 3IE1A 1GRVA 1OT3A 3ZI4A 3R76A 1M8KA 2AE1A 2JCYA 2HK8A 2R7MA 2FP4B 3ENVA 5BYJA 3AUSA 3WFJA 5FX2A 5I4IA 3QBDA 3H6GA 3QVXA 3SYTA 2BTEA 4PLZA 1QU3A 1M9NA 5IJ0A 5BXQC 4PRYA 4FYJA 1U2QA 4PYRA 2WWYA 1RJ9B 1Y3DE 4G65A 4RACA 4BLOA 2V4MA 1VCIA 1NZDA 1S8FA 2E5FA 1T26A 1TYAE 3MELA 3MTAA 3O8NA 4LHYA 4KLCA 4UUPA 3RU2A 5JIBA 4GKBA 1T2NA 3R7NA 4K6FA 5G1PA 1N2CA 1MRZA 2AHRA 1Z8DA 2Q21A 3G6KA 2BZGA 1JKIA 1OXBB 1QK5A 5IC5A 1KAHA 2PGLA 6Q21A 4IH1A 4R8MA 1SY7A 1TJYA 4F0JA 1LPOA 3EZFA 3R9WA 3MJTA 1SBNE 1W46A 4K9LA 5KYGA 4XQEA 3B12A 1CLEA 2RHMA 3BTOA 1EXNA 5AR1A 4DM3A 2WHYA 3OX4A 3KD3A 5JAIA 2KSQA 4D98A 1NRWA 2VTDA 1X1CA 4Z8XA 4E30A 4XPIA 4MI3A 2OZEA 5EA2A 5EIBC 4YXFA 4QJIA 2VPYA 4Q21A 4QVGA 2X1MA 3I9LA 2QR2A 4N4AA 5K3CA 1U1FA 1LD3A 3R8CA 4BQRA 5JPCA 2XDAA 4BNTA 3EUFA 4X0EA 4WZBE 5LC1A 1PSZA 4B6SA 2UZ4A 2PBFA 1P6XA 1X14A 3TZCA 2YFHA 4TQGA 2FCAA 1E66A 3W5VA 3ZCXA 4F5YA 1E1CA 1L7MA 2OKCA 1PD1A 2P5TB 4RK7A 5KQGA 3BEOA 3FUTA 1UC4B 1DQYA 3E5HA 1U02A 2PH1A 4CUKA 1IE3A 1Q0LA 4K6GA 1U0LA 1WX1A 2R3SA 2XBLA 5CA1F 2VP6A 3DXZA 3HGQA 3R0XA 2QT1A 5E9JA 4W9MC 2XNKA 1GLGA 1Z6PA 4E3WA 3L7NA 4NBRA 2H5JA 5REQB 5A4AA 2F3QA 1OH6A 5CD1A 3FETA 1SC3A 5TR9A 2WYIA 3D0RA 1PNOA 1LNZA 2B98A 1PBTA 3E7XA 3L0IB 4OY3A 4RAQA 4Y2UA 5MDHA 1JWAB 2F6RA 2H57A 3OFKA 4JI7B 3O8OA 4YASA 2FUG1 1V16A 5DMXA 5EVJA 3ROKA 2PDAA 4FEAA 4HNQA 1PNRA 1N6RA 1PD0A 2A9RA 2B4QA 3RT1A 5LQRA 4FR5A 1IIBA 1SR8A 3WMEA 1FZQA 4WN9A 3G68A 5F12A 2IW3A 1J06A 1OFUA 2NU6B 3BFKA 4YJ3A 4ZHQA 3ONWA 2I3GA 2YJGA 3OEHD 1GQOA 4QGAA 3VTZA 3BGOS 2OBBA 4IDDA 1C1HA 3I39X 3KL4A 2ZI4A 2B8EA 3N74A 5B3KA 1U8XX 3CTPA 2ZJBA 2PFKA 1P7CA 1SHTX 4BFVA 3ILVA 1Q7CA 2HNAA 3EVDA 1A8PA 2I1QA 3D7RA 2YIVX 2IYRA 3WI7A 1NQXA 3ZJUA 1I10A 4KAJA 2H52A 1XO1A 2XE4A 1CCWA 2WYOA 4AO7A 4C21A 1E2KA 3LWZA 3PNQA 5CA0B 3OIVA 4IV0A 2IS1A 3B1XA 4OKIA 5I7UA 3A26A 4S1OA 2FWNA 3MVEA 1JFLA 1NJ5A 2BFEB 3NBXX 3CR3C 3CTMA 2NO1A 3F74A 3Q10A 4U7PB 2GJ8A 2FN9A 2R25B 2YQ5A 5KAMA 3I3OA 1RI5A 5FKJA 3V4PB 2L82A 2V6IA 3SYKA 3ZDBA 1MT0A 2UAGA 2IXBA 3WKBA 4EUEA 3H9QA 1T2CA 1KJ9A 3IH5A 1HLGA 3BIXA 1GGEA 2IELA 3A1WA 3M9WA 3N39C 5JZSA 4DV7B 3K70B 5EGNA 1QGED 4LZZA 3WYAA 2NZUG 1L5RA 2OEPA 4JLAA 5BSTA 2GM4A 5JMOA 3A2MA 4M4SA 2VSQA 4A0FA 3M1YA 1CUEA 3N0XA 3K15A 3LHDA 3CW2A 3LI2A 1ZH6A 1R4ZA 2EKBA 1JTFA 3TR5A 2REXB 4FFDA 3D02A 5JDIC 2WLTA 3EARA 2C7QA 2H7CA 4WSOA 2GKOA 1L7QA 1DBWA 3DTVD 4JR1A 5LA6F 2GVZC 4IX1A 2XEDA 3S2EA 3TW8A 4B8YA 4MRMA 2WIFA 2CXNA 3EGWA 3TUIC 3OZTA 1KJIA 1XJQA 1YKGA 2PS1A 2W2QA 3KL2A 4BO8A 5LB2A 1OAAA 2C2GA 4L1KA 4OLAA 1HR0B 4UEOA 4PINA 1NAHA 2I29A 2CF5A 2OO5A 5LZ4A 3AFMA 3T1QA 5EZ5A 3HB5X 1IRXA 3E27A 4MR7B 1XWIA 1M6NA 4J4TA 1W4ZA 2WM2A 3AUAA 1KYIA 3HUUA 3S2UA 3R5JA 1S1MA 1ZCZA 3NHYA 4YAKA 3L7YA 4R40A 4E5PA 2HOQA 4RADA 3JD2A 3O0TA 3ZDQA 2QGFA 4C4XA 1VIYA 3HBJA 3DM5A 3IBYA 3JWIA 3Q72A 4EL5A 2DQKA 3UUGA 4LQCA 1HMPA 1SK8A 1YOVA 2RK3A 4FYPA 2OPHA 4BLSA 1W88A 1N5KA 2PXAA 3IXLA 3AMVA 3JQPA 4MLPA 3T4UA 2XWQA 4LE0A 3GJQA 3UENA 5IM4F 3TPCA 4JLSA 2OSBA 1DKMA 2C5HA 5GIOE 3QQPA 4DEYA 1R9MA 1X1DA 3T7TA 5AVRA 1OMOA 4BCDA 1A8IA 1W30A 3D6NB 3HUEA 4U02A 3B1JA 3M6FA 2ZZMA 5G4KA 4EJSC 2X0FA 2BFNA 5EMNA 1Z4PX 3QXJA 2AR9A 3R3UA 2BKEA 1J0DA 1KBQA 4EY5A 4EY6A 1QHXA 1OE0A 5DCLA 1XU7A 4RWZA 3MINA 1C3LA 2EJTA 1WVMA 3O31A 4JI0B 4K9PA 4TYYA 2QE7D 1N1DA 2JH3A 2C07A 2I4NA 2RI0A 3NW9A 4MAFA 3S8MA 3Q0TA 1VL2A 2ZTUA 4JV5B 1K68A 1E7WA 3U3KA 3A6FA 4I6EA 1CC1S 3JQBA 3DDUA 3GNTA 1ZJZA 3QF7A 1N4DA 1PTJC 3QBVA 4MW6A 1WKVA 1DIOB 3Q11A 3U7HB 4CG2A 1VPEA 3DJFA 3FB4A 3LGSA 1YB2A 1Z6GA 3SFTA 3TZBA 2FSPA 3FYHA 1F8GA 3R5XA 2VHEA 3CNNA 4JP5A 1WB9A 1WKBA 2JJ2D 4MHOA 2C04A 3V4LA 2VQDA 1WDWB 3IMGA 3MIZA 3ZBTA 3UCXA 3R0IA 1J8QA 1PZXA 2ZS9A 3E1GA 2E55A 2IPNA 1G8YA 3EF0A 3L07A 2W6ZA 2IPMA 3EB9A 1YE3A 3LUHA 2W2KA 3DZJA 1E2FA 4C4OA 4RTMA 3DFZA 3SR4A 1S2NA 2TMDA 4W1SA 4AURA 5IT9A 1PG5A 3DLBA 1IUPA 5F64A 4CG1A 5SV2A 1OH5A 1J6UA 2D7DA 4I5IA 4YEDA 1KAGA 2ZSAA 1JB9A 2X5XA 5EGSA 4GX2A 1UBRS 3PEFA 3WGNA 1VL0A 1NSYA 1RQNA 1Q1NA 1EWRA 1M2NA 1M73E 2I6GA 3JYOA 4JLPA 5LBUA 4I3HA 3UJ7A 1QP7A 1ZD8A 3T7SA 3EG9B 4NS1A 4DIOA 1XZLA 2YZ7A 3HKDB 1IBSA 2XVXA 3DDZX 2IOYA 2GM3A 3QTLA 2AI2A 3P9RA 3OX2A 4J8PA 4LXQA 5FCDA 3SQNA 1D1PA 3E9DA 3WLPA 2J3KA 2AQHA 2X15A 4OB7A 1K0UA 5IP5A 1GLNA 2BZSA 1K3UB 3IPYA 5AKYA 5T5QA 4MO2A 3WLSA 3MFQA 1M34B 4GFDA 4P82A 3FNHA 1QH9A 1FUUA 4CRWB 4IVPA 3NONA 4FZ5A 4DHWA 2C98A 4GM1A 4IDPA 4CGZA 2IXGA 3HCOA 4ZCTA 4JXXA 2FMKA 1HE8B 2B8NA 3QVLA 4JK3A 3ICCA 4NATA 1KMMA 2X23A 4PBTA 4C0BA 1L3BA 2GCGA 1USIA 3GCDA 1GG2A 1Z37A 3D3WA 3EDYA 1TCCA 3ITKA 1P7VA 4TV9F 3MJCA 4O4LA 4A27A 3STUA 4JN6B 2C42A 4UNRA 5ED4A 1PZFA 1N5OX 4J1NA 1F7UA 3VNUA 2J6HA 4O4HB 3GD5A 2JCXA 2CFTA 4W9RA 3KALA 3MJDA 4WY2A 2JKVA 5EFOA 1OLXB 1LBEA 3T52A 3SAJA 3OZWA 2FXIA 1Z0AA 4FEYA 1XKTA 4OAOA 2F62A 1B8PA 1LLCA 1V1JA 5FAXA 4EUNA 3T15A 1W49A 3EXFA 1G4AE 4KWIA 5EXEA 1HEUA 1CQPA 1RWBA 3N2KB 4M0LA 4ER5A 3TDNA 1KOFA 3K9BA 3A7EA 3FKSD 3R5TA 2PZFA 3GD7A 1B8NA 3DNFA 4DQUA 3DQZA 3FIJA 4DANA 4MVJI 2EBUA 1JIXA 3P4YA 3RC8A 5ILQA 3VZCA 1KO4A 1VJRA 2QP9X 3V8PA 2V3WA 4MV4A 5C8XA 2CNLA 1KJQA 1SB9A 3KKNA 5DCUA 2CVQA 1WP9A 3M3HA 3RVPA 3UA3A 1EA7A 2A33A 5D1NA 3CKKA 4J0JA 3ZU5A 4KQ2A 1GTMA 1P81A 1U0NA 1NDQA 5CB4F 1KPHA 3D1VA 3V8BA 1NBMA 2OV2A 1X9IA 2XQGA 3EAFA 4EITA 4EKNB 3H65A 1ZG3A 4BFTA 2AFRA 2WKQA 2ZWIA 4MUKA 4INPA 4MUJA 3CGWA 2YUTA 4FBMA 3KM0A 4JIMA 4YFVA 3JAMA 3IIJA 3QNUA 3QH4A 1WXFA 4WNYA 1MG0A 1VKOA 4Q7MB 5ADUS 3B85A 4JYPA 2AW3A 4BO5A 5JISA 2P6NA 3B6MA 3D6AA 4L75A 1XRMA 2WJHA 5KJ6A 1Z2EA 5JYDA 5FNVB 1HK7A 2VJCA 4XD2A 4GVLA 1Q1ZA 5JS2A 1F17A 3NC1C 4MKXA 4P86A 2GDJA 3DLAA 3R3HA 3M5CA 2P7HA 4LTMA 3SF0A 4ZAVA 3LLUA 5JADA 2V3VA 1QYDA 2ZI7A 4U7HA 5E7QA 2J87A 1IOZA 1I0ZA 3SHQA 4QPZA 4UJ5A 3VVLA 5CB6A 5IAAA 1RRVA 1E9AA 2HK9A 2C1ZA 3W77A 4J2OA 4EGJA 5KKNB 4Y9DA 4JYZA 3GFVA 1GKUB 2DMRA 2WPDD 3AKCA 3HEAA 1TU0A 3LUBA 3T41A 2D1SA 1U9JA 3FOWA 2ZRGA 5BRNA 1X3LA 4W1QA 4G8BA 1ULTA 4QYXA 3RVLA 3MA0A 3W04A 4EYSA 1SUIA 2XF2A 3AF3A 1NDHA 2EZ8A 5ALTA 1FP2A 1MT3A 1ZD9A 2ZBFA 3GUHA 2GMWA 3QW4B 1EM6A 4WKCA 3LLVA 3VHXA 1NW8A 3BMQB 1KORA 1V6CA 1GTZA 4QYTA 3QFSA 2C2MA 3AEXA 1XPJA 1TK2A 2Q3FA 3CFYA 3P9XA 4UMVA 1AVTA 1U1CA 4AQYB 4EPWA 1BX1A 2YS7A 2HU7A 3FW1A 4FR0A 1SQ6A 4AROA 1W48A 2VT7A 2VDRB 3SIXA 2ZS8A 5A2QA 2XNDA 5EJ4A 1EEHA 3EQ9A 1QHFA 3IR5A 3OEYA 1C7FA 4GVXA 4MS3A 1I24A 2WHRA 2CXQA 2PX0A 4ZMRA 1YJ5A 4Q6WA 5TQJA 3W2EA 1M0TA 1W0KD 3RHFA 4NOKA 1KMCA 1XU4A 2P5UA 3AQIA 4CM8A 1JYFA 3KZVA 4DZTA 3ZWVA 1WZNA 3IP1A 1KIAA 3Q3EA 4YP0A 2YN2A 3DDWA 3WVNA 3LQFA 4F3NA 3I64A 6ABPA 3ITDA 4LYAA 1CS0A 1A3CA 1DOAA 3GPDG 4EYQA 1PT8A 3MRXA 3RFVA 1JW9B 2JK1A 5A02A 1ORHA 4RS4A 2IXAA 1Z5OA 2IP2A 4FYWA 3RS8A 1W36B 1E1QD 1R6UA 2G82A 4RFSB 3LDFA 3LHKA 3UT6A 4ABYA 4D8YA 2Q28A 3K0KA 4S2EA 4GLJA 4GYYA 1YRLA 1LPNA 1IQRA 4YRQA 5J2UB 1NTOA 3KXIA 4X84A 1W25A 3LP8A 3E22A 1RWMA 4ZVLA 3CLRD 2FR8C 2JGEA 4LSWA 4OX9B 5JFOA 4J0IA 4R2KA 1SVUA 5DM60 3PV0A 5D6OA 4YJHB 4K9QA 1SO8A 5EJGA 2ZI5A 1EK2A 4XFJA 2GTPA 4F4JA 2B5WA 4CGYA 5A7FA 5ICCA 1I01A 2YFKA 1E2HA 3D7KA 2VNHA 3DHEA 3GQVA 3IHLA 4LHEA 1GFZA 2F3RA 4F6CA 1JDPA 1XLUA 3GLVA 1E98A 2QYHA 4UHEA 1TO1E 5H80A 4CMIA 2PRZA 2XGOA 2QU7A 3U9TA 1VG0B 3EAGA 4AKHA 1DS6A 2Q4TA 4H4EA 1YCGA 2XCOA 2W2PA 4QBTA 5T4HA 1WBBA 2XB2A 2YYSA 1VDMA 3AUFA 4Y2RA 3GDWA 2IUUA 1EPUA 3CZRA 3NM6B 1KP3A 2ZU0C 2YYAA 1FNDA 4ZQIA 1YF3A 1RKVA 3HM2A 3IUMA 3TKLA 1G20B 4K9KA 5HW0A 3D8SA 2EP7A