3G6WA

Asymetric gtp bound structure of uprtase from sulfolobus solfataricus containing prpp-mg2+ in half of the active sites and r5p and ppi in the other half
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
215
structure length
215
Chain Sequence
PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uracil phosphoribosyltransferase
publication title Structural and kinetic studies of the allosteric transition in Sulfolobus solfataricus uracil phosphoribosyltransferase: Permanent activation by engineering of the C-terminus
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 63
structure length 215
sequence length 215
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3g6wA00
3OZFA 5KAPA 4QRIA 4RABA 4TWBA 5BSKA 1XZ8A 1P18A 1DKUA 1OREA 3ACCA 3LRTA 3M3HA 3DMPA 4RHYA 3N2LA 4WN3A 1QK4A 1A97A 1QCCA 1VCHA 1UPFA 2H07A 3OHPA 4RAQA 1FSGA 4P86A 3EFHA 4IJQA 4KN6A 4PFQA 2IGBA 4X44A 1U9YA 1GRVA 4LZAA 5KAMA 1I5EA 5HIAA 5IPFA 5K51A 1OPRA 1DQNA 1L1RA 2H06A 1TC1A 4S2UA 5JSQA 2DY0A 3ACBA 4F8EA 2H08A 1STOA 1UPUA 2PRZA 1Z7GA 3GEPA 1VDMA 4RHXA 4P3KA 1P17A 1A96A 2JI4A 3QW4B 4RHTA 1AO0A 2WNSA 1QCDA 1ECCA 3ACDA 1ZN9A 3O7MA 5BQOA 2C4KA 1XTTA 4P83A 3S5JA 1I0LA 1LH0A 2VFAA 1ECBA 4RQAA 2EHJA 4RAOA 1J7JA 4LZOA 1XTVA 3H83A 1BD3A 5BRNA 1ZN8A 2JKYA 2GEBA 4RV4A 1U9ZA 1ECFA 1A4XA 1ECJA 3KB8A 1D6NA 3MJDA 1BZYA 2FXVA 5BQPA 4RADA 1L1QA 3DAHA 4M0UA 4QYIB 2HCRA 2YZKA 1HGXA 1MZVA 4RANA 1I0IA 1W30A 4QYIA 3DEZA 5ESXA 4P82A 1Y0BA 3GGCA 1QB7A 2PRYA 1A3CA 1G2QA 4OHCA 1DKRA 4P84A 1A95A 1HMPA 4PAWA 3NAGA 2JBHA 1G9SA 1BD4A 4RQBA 1IBSA 1UFRA 2E55A 1GPH1 1I14A 1O5OA 4LYGA 4LZNA 1WD5A 1XTUA 5EUCA 2AEEA 3MBIA 1NULA 1I13A 1ZN7A 4RHUA 4JLSA 1XZNA 1R3UA 1A98A 4M0PA 1CJBA 1ECGA 4MB6A 3HVUA 1G9TA 3OZGA 5IAOA 1OROA 4P81A 1YFZA 1QK3A 1NONA 4JITA 4ZFNA 1V9SA 1P19A 4Z1OA 5E38A 1DBRA 2P1ZA 1VSTA 4P80A 3G6WA 1DQPA 4LYYA 2PS1A 2XBUA 1TC2A 1G2PA 1P4AA 1QB8A 3LPNA 1JLRA 4RACA 1QK5A 1O57A 5ESWA 5JV5A 4WMLA 4FYMA 1PZMA 4M0KA 3GGJA 5HKLA 4X45A 1JLSA 2JKZA
chains in the Genus database with same CATH superfamily
1IAQA 2QKYA 2GEKA 1NQAO 4BDSA 2BVNA 1XKQA 3EVFA 4XCQA 1UUFA 4UPVA 2EKBA 1PDOA 1JSZA 2GBLA 3L1UA 4MGYR 5LKAA 4ZVLA 1THZA 2JFPA 1PLLA 4OIMA 4BQNA 3ECSA 4BFLA 3H5OA 2IOQA 4CYMA 3OOJA 1OPXA 2VNKA 3HUEA 2OCXA 2F00A 3UW3A 1SCAA 1E59A 1LZKA 4AZTA 1T9KA 3QPDA 5JDCC 5KYNA 2D0IA 5DYWA 5FOQA 1J25A 3U81A 2D0DA 2VRNA 4XIGS 4P0QB 1ZGGA 4PM4A 2I6TA 1T2UA 4ZMRA 1XDWA 3B7GA 1AIPA 3LQYA 4EUHA 3BMNA 4Y2QA 5E9QA 3BDAA 4RMHA 2VTEA 4JP3A 4MQFA 4KSCA 4I50F 5HDQA 3SQXA 1QMGA 3IAS1 5JVDB 1R8YA 3LDHA 3RU9A 4IICA 2NSLA 1XBTA 2QAGA 2QSZA 4CR8A 5DEOA 4E70A 1QYCA 1S8AA 2WPNA 3FTFA 3I1JA 1ZJZA 4HWSA 4V1CA 3TDMA 2CUTA 3ICQB 1U8YA 2EG9A 3DVQX 3GBSA 4JX9A 3TR5A 1H2HA 4BGEA 2BKAA 2WVHA 2NZXA 4XTCS 2GO7A 1PD1A 4OSEA 3QE9Y 3DZFA 4WNAB 2YJGA 3WP1B 1T4CA 3Q3VA 4D46A 4EKIA 1X1CA 4PG5A 4TQAA 2QLTA 3WKEA 1KHHA 4MROA 2VHQA 3REOA 2XR1A 3HKBA 3WKCA 4GPAA 2B34A 4CM8B 4UVEA 4Q1BA 3ZVNA 3BDIA 3CQ9A 4YDHB 3LM8A 4F4FA 1JSRA 1WPGA 2EQAA 5AVQA 3ONEA 3KYBA 4RTOA 4ZEMA 4WKBA 3SK0A 3T7RA 1TL7C 2DPMA 4KJXA 1NRIA 2VT2A 2WABA 3K2BA 3GGCA 2QUKA 3WIUA 3NQ41 2J0EA 1MO3A 4HWTA 1KOFA 2VATA 2XA2A 1A95A 2XVAA 4S1PA 1Y81A 1XTPA 4ITRC 1RZVA 2EV9A 4RGBA 1C9MA 4Q1CA 3AR3A 2OBNA 1TO1E 1K5PA 3KALA 4B3IA 1UBEA 3DS8A 3IAXA 4B47A 2FWRA 2GAFA 3UFXB 3DV9A 3SZGA 1O0CA 1XZAA 2IXFA 4UUNA 2O52A 3KZOA 1OXTA 1GTZA 1CS4C 4UAVA 1SJ9A 1PLJA 4EKYA 4JN6B 4LJAA 3E3NA 3KOWA 1EP9A 3LDFA 2J6HA 1HA3A 1NI5A 3CUTA 5CVUA 4AG6A 2QN3A 3E5MA 1RKQA 3KUKA 4F6LA 3W90A 4F86A 1E3DA 1KZ9A 3LHSA 4FCVA 4FHGA 2Q62A 3JQBC 3H0EA 1P7ZA 3KD2A 4XGKA 4OIFA 4Y6OA 1E2GA 4F4IA 2I9KA 1F38A 2XDQB 3ED1A 4FFLA 1ZI9A 1ZNQO 4F06A 4L27A 3GRAA 4WFIA 1FX0B 3U3DA 3BWDD 3ZQKA 5K4GA 3FG9A 2ZCJA 4ZO8A 3SZUA 3MHTA 3VNVA 4MUEA 1ADGA 2P6OA 3DHWC 2GXAA 4OQMA 3REFA 3WRVA 5LVAA 3VOBA 5TJHA 4OSOA 3E7WA 1EK0A 3AY7A 3LLUA 3V1TC 4ZU6X 1U4NA 4X1KB 3WWCA 3NHYA 2OCKA 3RVQA 3WK5A 1AB6A 2BELA 3WL3A 4ZALA 2YCLA 5ALHA 2X4IA 3LGXA 4J0CA 4M38A 2IW3A 5EQTA 5BVHA 2O2ZA 3C14C 1I6MA 4IEIA 5DX8A 4C4PA 3JPYA 3BVPA 3KYCB 2R6HA 2UYGA 3E9EA 1WHTB 3O3NB 4L76A 4LGYA 2I4NA 2CMGA 2VK4A 2XW6A 1LPPA 3ZVMA 3BK2A 4N54A 1PVDA 1PUJA 1F48A 2VEDA 2QRKA 2VZEA 3DAPA 2EJUA 1E98A 1WY5A 2BLNA 2I3DA 2R00C 3PHHA 3T7AA 3ZDXB 3WGIA 2EF0A 1MO4A 2LWIA 3ZC3A 4GM0A 3VYSB 4F97A 4UVGA 3QJ5A 1FFHA 4F5EA 1DWUA 2ZPUA 5E2BA 3ET4A 3ZHQA 2GPWA 4X9XA 3RS3A 2B35A 4BNXA 4ZPJA 4WESA 1TA4A 1A04A 4B76A 1N3IA 2DHDA 4AMBA 5BT8A 1Z4LA 2TMKA 4C6SA 4GXNA 1PIWA 1DBVO 1JDBC 2R44A 4N3BA 4RW0A 4E4TA 3OMXA 5JMOA 2JASA 1N36B 1QUEA 4HWGA 4RDHA 4A5SA 4ZRMA 3G2PA 4NYIR 1JYEA 1A7AA 3VV2A 1VPTA 1SHUX 1VPLA 1SOAA 4L51A 1YRQA 5FORA 4FJ1A 3IT0A 1NVKA 2B1QA 2CLMB 1F5SA 4JMPA 1LGYA 4XD7D 1T91A 1ZNXA 4B7ZA 1QPZA 3V8BA 3QWFA 3RC3A 2BFWA 2WDPA 3LBIA 3AEUA 4UBIA 2HM7A 1JXAA 2EX0A 3IDZA 4UOQA 5KC9A 5EQDA 1N75A 3X2FA 3L5OA 2NTNA 4RTJA 5E1BA 5AOCA 2AYYA 3W79A 2GDZA 3Q15C 1G16A 4UHDA 4WASA 3JYQA 5E6RA 3HUFA 2QXYA 3F5FA 3I9V1 2MHCA 4Q9DA 4Z4HA 1J2UA 1T43A 1M8KA 1LNSA 1N8KA 2CWWA 2FZKA 3MMXA 3MTAA 5DSZA 2V58A 2CSUA 3MTJA 1XJCA 4A23A 1XP8A 3GEBA 3HXKA 2IS6A 1XA4A 3QENA 3JZDA 3VSCA 1J8QA 1P1KA 3FCSB 4K86A 1GNQA 3HCAA 1IXSB 2FSPA 1QG2A 2B94A 4MKXA 5G1PA 1ZXXA 1K4MA 1X8KA 2UZ1A 1Q1AA 4A10A 5ESDA 2MINA 4S35A 4EFKA 5C46F 2BCEA 3SFVA 4EB0A 3I42A 2Z4TA 2BHTA 1SUEA 5F2EA 4F93B 3DZGA 4XLTA 1M2WA 2HXGA 1I4DD 3DV2A 1NXSA 1XLTA 2Q4EA 2Z43A 3EQZA 3K2QA 3TEJA 5K0BA 1RZRD 4ERXA 2FP3A 1R8XA 1JYSA 3HJUA 4A0FA 4C4RA 1FB5A 3EF0A 2B3TA 2GBFA 1QP8A 4NEQA 2JEOA 2NVBA 1TJYA 1RM3A 1TMGE 1RXWA 2OCIA 4C78A 3PC3A 1KS9A 1Q12A 5K20A 2C96A 2ZS8A 3KL4A 3GRUA 3PQFA 4UASA 4C03A 3K05A 5JS1A 3QBDA 4HZUA 2A5DA 4NICA 1EEXB 4HGRA 3KV3O 4YRJA 4EG5A 2VJMB 2Y1OA 5DM0A 3HPRA 2Y1FA 4BV3A 5EP1A 2V9ZA 1GCUA 1JX6A 2PAAA 4XB1A 2YASA 1U2DC 4O2AB 3EZLA 3JQAA 4O5AA 4IUBS 3M0EA 1H22A 1V1RB 4WY8A 5BN4B 3K0SA 2YTZA 1TF5A 1YVUA 2NU9A 3X1DA 3QVTA 1P5ZB 2O50A 4EHBA 1ZBDA 2J4CA 1JPUA 1JKJA 5KOYA 2A9QA 3F7MA 2CNWA 3H13A 3K32A 3MWYW 3OA0A 4JJ7A 1P8JA 2GZ3A 2VP0A 5JO0A 2HYIC 4XJTA 5G2OA 1Q7GA 2BSQA 3O21A 2O2SA 1NJ8A 2B78A 1PR2A 2LP4Y 3GIDA 3H1FA 1U1GA 3H3FA 4QTYA 4O3MA 5CT8A 4R6WA 1L7MA 1PNQA 5E4JA 3K5WA 4V0SA 1W75A 1ZH2A 3LBHA 1Z7WA 3ABOB 1STOA 4UCFA 2BI8A 5COQA 3IAS6 3K15A 5LD2C 3DZIA 4Q03A 4MJLA 5JTUA 3NVKI 1C4XA 4L0DA 4ZVVA 1MOPA 1QH1A 1OH5A 4Z4FA 2CHVA 3F6RA 3LC1O 4LTMA 4AULA 4JI5B 3G8CA 1AMOA 2HX1A 1O58A 4FHEA 4AKIA 2JLSA 3AF0A 3E53A 3Q0IA 2PUJA 2ZU6A 5A5EA 1YR8A 2QI9C 4I9NA 4M83A 2ZWIA 3OO0A 5KNDD 3HM9A 4LF7B 2ZRCA 1HEUA 3FYDA 4RD6A 4HS9A 5K0FA 2EW1A 4YJGA 3OH8A 5FWXB 1GU1A 1GDTA 2BR4A 3FHTA 4MLZA 4NOKA 3QWIA 3WYNA 1AE1A 3ST7A 5K3DA 4CLRB 5CXUA 3TAXA 2BEJA 1K0UA 1EYZA 3TRHA 4QA9A 2GXUA 3BIXA 1N5JA 4Y2GA 4IIJF 4ZXFA 1Z36A 1VIYA 2P0AA 3R5HA 3IELA 3OPYA 3WLAA 4Z1MD 2QN2A 4EG7A 2HCRA 3SHWA 1NJ1A 4JXXA 2YXPX 4G8CA 4BU0A 1E4EA 2GVZC 2ODNA 2X5KO 3JRNA 4KK3A 3IQZA 2FFQA 2TECE 3AYXB 2VH2A 1H2EA 3IQEA 3ELUA 2AKEA 1XWWA 1A7KA 1XLVA 2YMPA 3QEJA 2E1PA 2P40A 1BMTA 2YS6A 3OY2A 4URUR 4CMGA 1K3FA 1ISMA 1O5OA 4Y1RA 5TS3A 4GX0A 1OY1A 4BZQA 4N48A 1H42A 1YL5A 3RSCA 3C3MA 5TF0A 1NPTO 4N1AA 2C92A 1FTYA 2W2KA 2YVQA 3D02A 3IQFA 2H2GA 4EG0A 3PEWA 1GWNA 2WT9A 2GPSA 1YZGA 5FHQA 4UD2A 2A8YA 3G1UA 2AXEA 4LJKA 3L7CA 4Q4DA 3ZNOA 2CUZA 3T5GA 2DKOA 3KUXA 4MA4A 4CLEA 4W5QA 3L1JA 3MN1A 1OXKB 4ZMBA 4WOKA 1ENYA 3QPBA 1RC1A 2Q2OA 2CBZA 2W6ZA 4JLPA 1CHNA 4G5FA 5H3HA 3EUWA 1M74A 5TPWB 2N46A 1GGHA 4MP6A 2YC2C 3MPUA 1TM7E 1J2TA 2AR0A 5J2TF 3ZE9A 1Y9AA 4EYSA 1DIHA 1P31A 2G3YA 1TAQA 2IY9A 5C81A 3OE7A 1KVRA 5FPHA 2A9FA 1V8BA 3N2EA 4ZYVA 3ZCUA 5KVCA 3PQ2A 4RU1A 3RUPA 2QJTA 2C7VA 1QDUA 1E9AA 1K88A 2J0VA 2J0UB 5EHGA 1Z74A 1WDMA 3H7AA 4A82A 4B81A 4C7JA 3QLUC 2IDKA 4H7FA 4MRSA 4NV3A 2HHHB 4MQFB 3WGZA 2JLQA 3WHKA 1BWQA 1M1UA 1N2SA 3MRTA 4EHJA 4RKYA 2F3SA 3U17A 3ZE8A 3CH7A 3N53A 1VKRA 2HRBA 1I7NA 3NGXA 4I08A 5GM2A 4DSNA 1DBQA 2PGDA 4V1CB 4HDSB 3SQWA 1NF8A 4I5IA 1JDZA 5B3AA 3UNXA 1ULBA 3TWOA 3UT5B 1L3CA 2XTJA 3ME5A 4FI3F 4P86A 2NO6A 4NAUA 1T4CB 3WZ2A 4L6AA 1C3OA 1UKEA 3AG6A 3LW7A 2P7IA 4I8DA 2HSWA 1YONA 3HKBB 5IPFA 5E3JA 3DKPA 1E99A 3UK2A 4LRWA 4TUYF 1VKJA 3I6YA 5K4AA 3ZWVA 1C1XA 2E2WA 4RC9A 1OJ7A 1JIUA 2JJ1A 1XCGB 4D25A 2OESA 3TOXA 1T0HB 5CJPA 4AJNA 5AHRA 4AP6A 2ZTUA 1KBQA 3SDZA 1DOAA 1F3LA 3HCCA 1M1YE 3MIIA 3ER8A 2V4MA 1ZMOA 2N75A 3QXGA 2FMIA 4MA0A 5DMXA 5EE3A 5IAJA 3FOEC 4JXZA 3U4QA 1T6XA 2XGOA 3HZOA 4BASA 2CD9A 4XQGA 5K3FA 2R48A 4N82A 1W5SA 4R98A 2FP4B 3V55A 3DMTA 4CLOA 2XCTB 2Q6OA 3DOEA 2X0FA 1PFWA 2GRAA 3TMAA 5KNCH 4TX1A 2H3HA 2YFKA 4DCVA 5L4NA 4UCXA 2EG5A 4R1NA 4DJDC 1SCKA 1E8DA 1LRKA 1N4DA 2EZUA 4GRAA 1JEDA 2W6JD 3OZBA 2XCRB 5EZYB 2C42A 3LCUA 2IXDA 2XWJI 2ZRQA 3GJYA 3QF4A 4MCJA 3W06A 4EYQA 2OORA 1RI4A 5EXXA 1OH8A 2VN8A 3K1ZA 2WP0A 5BRJA 1CUGA 4CN8A 2OVFA 3PT5A 2C2KA 4GSYA 3HO8A 4Q7JB 4BKPA 5KSYA 2IVFA 1DBWA 2D1YA 5DJ5A 2JLXA 5JTTA 1QRSA 3PDWA 4NG5A 3OQIB 4BPBA 4BNNA 1R4NA 3MWEB 3CEAA 3GAMA 1UXGA 4TT3A 2DKFA 3P2YA 1BJTA 4W1RA 2VKTA 3VI3B 3BGDA 4N12A 4U3JA 1SU6A 3A3NA 5IJ9A 1UADA 5CYGA 2PCLA 1JN0A 2JLYA 1HT0A 4QOJA 1IOZA 5JAHA 3ERCA 2WJGA 3DWEX 1T15A 4IQ0A 1SCBA 1E2QA 3M6MD 3P52A 2WJYA 4PZ9A 2I2BA 1JVBA 5AVKA 1NW6A 1YRLA 1M83A 3CR3C 4KO3S 4E1AA 4RCZA 2HF2A 4H1HA 1UJBA 2RGUA 1CUXA 4LAFA 3BSFA 4R0NA 2JFQA 4NV0A 1FF9A 3NHRA 1A5SB 3T4PA 5DNYB 1W29A 2H5EA 4Q24A 3DBVO 3KJXA 3GFSA 1K97A 1V9SA 4ANFA 1PWEA 1R00A 4L08A 1N1MA 4Z1OA 1VHDA 4X90A 2NAPA 1P4HA 4MI6A 1PJ8A 1II8B 4BU1A 5FXMA 1I2CA 2JGIA 1OB5A 4I1PA 4AY5A 1KOLA 4X7MA 1BC5A 3GJ4A 2DX7A 1B6RA 3X1XA 5KU7A 4IEFB 1OGJA 1RWXA 4KAFA 1UPBA 3ZI7A 3K6KA 4DQLA 4HWKA 4KN9S 4YMUA 2EDCA 3RUDA 1IN6A 3KEMA 1G6Q1 3SS9X 1ZD2P 3WK6A 4CUJA 2D54A 3O2QB 1PYOA 4M0KA 3UMRA 5JSUA 3A6EA 3BSYA 1AUPA 1TVEA 2ZSAA 5AVYA 4B7UA 3HWSA 1HX7A 3ZHTA 3FMOB 2NYAA 2QORA 3LNTA 4ZT3A 5J4YA 2H65A 1GNLA 1BU5A 4KQFA 5K8LA 1JIQA 1QP0A 2IEDA 1BMQA 2RI0A 1ESMA 4WY2A 2O5VA 4Y6LA 4ZEOA 4CTKA 4D9CA 3ENQA 4F5ZA 2ZROA 4AICA 1EX7A 2E37A 3DO5A 3NHAA 3D4NA 3L8FA 2R96A 2X7HA 2AVDA 4Q39A 3R0QA 4ZOLA 4I2VA 4Y1GA 5C53B 3ED5A 2X1MA 3EMKA 3IGFA 5DBHX 1EUDA 3T5PA 1J07A 3W5AA 4X1IB 3ETLA 3TXYA 5BN3A 2IUUA 1MB0A 3EPPA 5FI0B 3A6GA 4FYYA 1XMIA 1S3SA 3EA4A 3VPDA 3AB7A 4PR3A 1ZC4A 4XUCA 4PG8A 3DKKA 4DWWA 2PLAA 5IKEA 3CWCA 3HN6A 1R6AA 4C01A 5DTIA 1QGDA 4DMCA 4Q9HA 5G4KA 4DBVO 4JZKA 1MO6A 4E33A 1PEKE 1HDRA 2OM2A 1LBIA 3PRJA 4GZLA 4Y2YA 4IV5A 2XMZA 3ZQ6A 3N86A 4UAUA 3ZTYA 5HGXA 5CPBA 2QL7A 1W8DA 2B4QA 1PE0A 4L6IA 4YT2A 1HY3A 1AGXA 4NF2A 4YX9A 1Y8ZA 2GCOB 4O4LA 4FFOA 5FFMA 2BCGY 5KYVA 3F9CA 4CQMB 1S8NA 2G5CA 1Q77A 5BPFA 3H1EA 4N5IX 2PUEA 4EF5A 1PWYE 4LFAB 1ECPA 1MC5A 1C3JA 1JZQA 1UOQA 3VBCA 4RTLA 3EQ9A 3HB7A 1T36A 1TFUA 1L4EA 3M5WA 4PLVA 1KMCA 2CXRA 4EMBA 2PNJA 3N05A 4GXRA 4DM4A 3CRNA 1NT4A 3JQRA 4YJDA 3SYRA 2VQFB 5CMLA 1YJAA 4XTRA 4RUKA 1Q19A 1ENPA 3IRUA 1JSCA 3QUSA 4D44A 1BCSB 3GDWA 4JOBA 1M10A 4MAAA 4Q9NA 4TVBA 3BIWA 2H2WA 5E9AA 4FUTA 3C87A 2WB4A 4R2JA 4P7BA 1JEOA 4AS3A 4AYWA 2JAHA 1ENZA 2VS1A 4GPBA 3FD8A 4JR1A 1XYVA 4LYHA 4MVJA 4UEQA 2OQVA 2NU9B 4KLZA 4HAYA 2II6A 4TQGA 5EWLA 5DI9A 5CDGA 1JR6A 2Q9BA 5CGZA 1JKJB 3A1NA 3KBBA 1SCQA 1ZMBA 1V16A 2AUMA 2YRXA 3DH0A 3K0KA 1Z47A 4L4UA 2Y1GA 4PW0A 1A88A 1MB9A 3ITEA 4FN5A 1CQIB 5ICFA 3S8EA 2XHEA 4Y9UA 4MUAA 4D2IA 1IOLA 3SAJA 3RUAA 3WQBA 4WKOA 2ZT5A 3VSDA 3T0FA 4QYWA 3M5DA 3O1HB 4F11A 1HOXA 1SY7A 1R6DA 4UE6A 2HCFA 2JIQA 3TSCA 3D6VA 5J47A 1SPXA 4LIPD 4IMIB 2JGDB 5LOVF 5ELXA 4KTTE 3JD2A 5JCOA 3D7LA 1TUBA 4MIOA 5H4HA 3ZX4A 4NENA 2J67A 2WUFA 4OXKA 3TX6A 1GLGA 1U7DA 2A1UB 3G1TA 3Q98A 4MRRA 3KD3A 5KIAA 2R68A 2IPAB 3TNJA 2KS6A 1PFKA 2ZWMA 1H8HA 4UKDA 5IC4A 3H16A 4R1SA 4NFSA 1EVYA 4BVJA 4EKNB 1ISGA 4D0GA 4WAUA 4DMKA 4U02A 1P4RA 4HUTA 1NV8A 2IHJA 4BNHA 4LRQA 2I3BA 1VFPA 1EZ4A 3T7IA 3ZWCA 3AEKA 4PGAA 2CNOA 4LZAA 1SU8A 2B6HA 1SHZA 5IBPA 2X58A 5IJAA 2NO1A 3WDLA 4OKIA 4Q15A 5AM0A 3ACBA 3QFHA 1Q0RA 3PDJA 5J43A 2OTCA 3O4HA 3NDBB 4HQFA 1SXJA 3PBKA 2M32A 4FT4A 5J58A 3PS9A 5FNVF 1L5SA 3T0GA 1NPYA 2W6NA 3S99A 5BQ3A 3G7SA 2Q5JA 2ODWA 3O93A 4BNMA 3DLTA 3NBUA 2ZIZA 2GZHA 5AW8A 3LP5A 3OQHA 2AFRA 4R71A 5T4EA 1VG1A 2R1ZA 3RJ9A 3VR3D 1G98A 5CW2A 5DBFA 3LXRA 2NZUG 1Q6YA 4L95C 4Y1RB 1JR3A 4M9ZA 3S27A 3IEKA 1CHDA 3I52A 3BK7A 1UEIA 3EQ7A 5K0NA 5DT9A 2BJWA 3F97A 1VIDA 2OZEA 2RGAA 1PR3A 3I2JA 3HBLA 3O4VA 3OT1A 1N7HA 1YDEA 4C05A 5IVPA 2Z2JA 4BMYA 2JAQA 1O8CA 4CZ2A 2VSYA 1KXZA 3G9ZA 3ZDEA 1X80A 5AKJA 2OBFA 4G26A 2GAAA 3L6DA 1CZRA 2W48A 4HWOA 2HMAA 5IJ0A 4YQYA 1G20B 4ZDKA 1XZDA 2WMNB 3KPJA 1CDOA 2WWXA 4IOMA 4QUAA 4OQ4A 2NZYA 5B6PA 3H65A 2WAOA 2A4MA 3VC3A 3OTQA 4U7HA 1IZ9A 3BJEA 2FTKE 3I72A 4PAWA 1LDMA 2D74A 4JGBA 4NJEA 3VO8A 2ZAGA 2AOTA 2DYKA 2Q6KA 2PBRA 1XE3A 3BSSA 3RKSA 1ZX1A 1NVXQ 4HAVA 1CNFA 3LDUA 3SLKA 4AN1A 1P75A 4MYTA 2F2TA 3IQIX 5E2AA 1E60A 5GONF 4ER5A 4UNNA 1UDBA 1C4WA 1U2ZA 1XK6A 2F8MA 3IYLW 2A58A 4YASA 2YX1A 3HB1A 5ALFA 1AA6A 2IYQA 2ZU0C 1D9XA 3IVXA 3B3GA 4KRGA 5F77A 5JHGB 1X74A 1RYZA 2IHVA 4G37A 4OL0A 1NFQA 3IV7A 4M1EA 1WWKA 4CMIA 1SVNA 1TX4B 5AHOA 1VBFA 2Q8PA 4KPGA 5DTMA 1YZQA 3G23A 2BGLA 1XALA 4A6DA 3KKZA 3KQNA 2DY1A 1IHYA 3OTWA 4RNCA 1V8PA 3HP1A 4RGQA 1DCFA 4MULA 2FZCA 1UBRS 1ZL0A 3DD5A 3RC1A 3RRZA 1G60A 3IBYA 3O4FA 5LA6F 4MUXA 2XAAA 3N58A 1MRSA 3K1JA 4W99A 3H5TA 2HA4A 3C4VA 4FOOA 4JA2A 1TO6A 2P4EA 3TW6A 3TIVA 1UFOA 3U4QB 2BKXA 1ACJA 2OQ2A 2AD1A 4YI5A 3LQ4A 5EQFA 1Y42X 1UXIA 2VDOB 4E5MA 4QNNA 1OF1A 3AVYA 1GY8A 2DLDA 1C1DB 3OHPA 3WLTA 2B5WA 2REXB 3EZ9A 4J4HA 1YC5A 3FH0A 1PL7A 2I3ZA 3FOFC 2XYQA 3WYBA 5I8PA 2ZWOA 3ZGOA 1F1BA 1NI4A 1YS4A 2MMCA 5KC8A 1NL3A 1NVEA 1P45A 3LQFA 5HBGA 5KKAA 1YT5A 2OBLA 2VHYA 2QMYA 3WXMA 4ZZ0A 1G21A 1QHXA 4CDGA 4J1TA 3DXFA 2AOXA 1VYHA 3WK4A 4TMFA 3E9MA 3AV0B 4MUHA 1CULC 2DJ5A 2I4TA 4J1QA 4CV1A 3FHLA 3CW8X 3BE6A 1KK1A 3HEMA 1B8VA 3I32A 3LDAA 3M6XA 3EUAA 3O8LA 4MWTA 1EFDN 9MHTA 2C4KA 2WOJA 5HVNA 2CWDA 2XSZD 2C2ZA 4KIGA 4EJ6A 1IY2A 1YB7A 5B2EA 4MZDA 5JAUA 3OOYA 3PI7A 3SHFA 5TT0A 3RC2A 3HGQA 1VRWA 2WJIA 3GRFA 3OQPA 4HDOB 3ZZMA 1SKBA 4EX7A 1F14A 1SBHA 3O4GA 2A9RA 3JSXA 3OM9A 1K63A 4DCJA 2Q7OE 4IR7A 4Z4CA 3AUUA 4CF7A 3H0CA 1TA0A 1TT5A 3K0FB 4KE9A 2K7FA 3BWMA 1K4KA 4M9XA 3EPLA 1YOBA 2VUIB 2OA0A 5CYPA 1AKQA 2OV1A 3L6RA 3RVKA 1FFEA 2ZBDA 1ORRA 1U2GC 2PGXA 3AHEA 3IBTA 4YV7A 1SKUA 3VTAA 5IHPA 5M29A 4RADA 2DR3A 3LG2A 3T9EA 3E2IA 2F1OA 4FKMA 3U39A 4TN1A 2C04A 5TMBA 2ZIXB 4L5AA 3V46A 2ORED 4Z2YA 1UT8A 1XUOA 2REQB 5EUMA 3RD5A 2O4CA 4LSZA 2Y4OA 2ZTVA 1RBQA 3IA7A 5AOBA 5FFFA 4CCWA 3O3OB 4D4KA 5DGIA 4KEAA 2RCYA 3ORFA 1MFPA 4KQIA 5BURA 1RSZA 1PGNA 5D6NA 5ALOA 1LLFA 1JDJA 1NY5A 1XA0A 2ZRDA 3E82A 3KHTA 4X5OA 1L4NA 1IULA 1YKGA 4AO7A 4JYPA 3R3YA 3I39X 1YA6A 5LQMA 3FSRA 4ZVOA 4N5NA 1ARZA 2VPWA 3NDJA 4L0MA 5I7WA 3K09C 3ZDDA 5KO2A 4OFBA 2XMDA 2ZYVX 4WZAE 5CX1B 4ZVPA 1DC8A 2XQIA 1R9NA 4V0QA 5IBRA 2FR0A 3RI3A 2HJSA 1XTKA 4GLOA 1FNCA 2P9CA 3FYSA 2PEZA 3B2NA 2IE8A 4J7XA 1ODJA 3IFSA 4LMBA 1XWIA 4PG7A 2FW1A 3RVSA 2GZMA 2CZGA 1YGYA 2RGYA 4IXWA 3KZXA 2XZTA 4WJLA 4ZI2A 6PFKA 4MX8A 1R8JA 4NRDA 5DFAA 3GA0A 1CZLA 3HYRA 1YZVA 1NMXA 2FW8A 1FLVA 4PNZA 1PBTA 4FW8A 3WYFA 4EJSA 2RGNC 4D0LB 1Y80A 4P4SB 3KKQA 1XZEA 2AZTA 4U8HA 5BN3B 1NYQA 2ALJA 3QX7A 3AUTA 4KFSA 4MDHA 4DCMA 4CFYA 3AHHA 3BB3A 4ETNA 1UJ6A 3VVBA 5HKLA 2OAP1 4B5KA 5B4TA 4QPZA 2IPMA 2A78A 1L4FA 2YFYA 1ZQ1A 5BSUA 4DPKA 4BFSA 4YT8A 1NUUA 3BJRA 4IKEA 1GPAA 1DARA 1M75A 4RK7A 4OHZA 4ZEWA 3OE5A 4IMRA 3NVAA 1YAJA 1WXEA 3LUPA 3EOBI 3GGOA 3TZCA 1LQUA 1M2OB 1GO2A 3D3JA 3N2LA 4CG1A 1C8VB 1V9CA 2EJTA 2DFKB 2FFJA 1UJ5A 3F8SA 4IV8A 3A9UA 1H8ED 4I9GA 5K9ZA 5IM4A 4YAFA 4Z2AA 3OJWA 3F74A 4E4YA 4N6GA 3KAKA 4PFQA 3WQSB 2HW8A 4UUOA 1D1SA 1P4SA 2BR3A 4OXQA 4DLLA 4L0QA 2P2YA 5JUWA 2H31A 3OIYA 2ZUFA 3QU5A 1JQLB 1L5WA 1EHIA 4D8WA 4C0KA 4NY1A 4KE7A 1NAIA 2J09A 2ZPTX 1YS2X 1H5NA 4M0CA 2QNIA 1RAIA 5ALKA 4PPFA 1C7EA 2Q4BA 5DLEA 3GT3A 1O9HA 5HRCA 3EUEA 5EXTA 5FBVB 2HRZA 1C8KA 1PT7A 1PK9A 1LI5A 3AW9A 3DDOA 3DZ8A 3COPA 4GOOD 4L73A 4ZAWA 4A8HA 1JBKA 4A92A 3FWKA 1EFTA 2VJCA 1GUZA 2P11A 4RTNA 4NYIQ 4C7OA 4K6FA 4Q9JA 1VB5A 4ABTA 3HABA 1KH3A 2VF7A 4U63A 1TA9A 3OOWA 2R79A 1IIBA 4JWKA 1A5AB 2FSSA 4QULA 4RLQA 3BF8A 3OSZA 2PN1A 3DLCA 3V2UA 1F9EA 3DHVA 3H83A 4HFJA 1FCJA 2AI3A 3D0RA 2XUKA 4IKPA 1ECJA 2ECOA 3VNQA 4YHBA 3TDKA 1OAOC 4FINA 2G40A 3DMDA 4EHDA 4GVLA 4G0WA 1P0MA 3DAHA 1PNRA 3V3TA 3GVCA 3BRCA 2ISSD 1AKRA 1LK7A 2IXEA 2OHGA 4MGEA 5BVGB 4NWIA 4OTZA 1QB7A 3EAQA 3NNSA 1G2QA 4F7DA 3L9XA 1QXSA 3THXA 3E9YA 1I51A 4B4UA 2I03A 4KUGA 3ZHXA 4ASUD 1GA6A 4JMLA 1C30A 3UJCA 3NEPX 2GNPA 9GPBA 4DB2A 2GJ4A 2RH4A 4LXQA 2BMDA 3VHLB 1PX2A 3KKOA 3DW1X 4BFXA 1W52X 1BMFD 3GD5A 3B9PA 3QUQA 1E79D 3QOXA 2P9JA 2DCUA 1F3OA 4UHJA 2C54A 1NKTA 2NPFA 1U02A 3PX3A 1EB9A 4HX2A 4AO6A 5F35A 2W83A 4BKMA 3HEAA 4DQKA 4K9PA 4GP6A 5LJLA 1RYFA 2H29A 6Q21A 5LKRA 1VE1A 2HU8A 2O2YA 4JI7B 3QPWA 1CYDA 3CTMA 4NCNA 5C8ZA 3BD8A 3BRQA 2C7QA 3O2SB 1R9JA 1BDBA 4J3NA 4IGFA 4YQEA 3GZTB 2W90A 4QFMA 3WISA 1JA9A 1EXNA 1MAUA 2WZQA 4ZVTA 4BNDB 3WMEA 5IVHA 2FPWA 4AMZA 3PKIA 2ID4A 2B4KA 1M1ZA 1UBSB 1MPXA 4RO0A 2J41A 3IIKA 1OTHA 4PLGA 2O8VA 3W7AA 3WBBA 3GPIA 3N0XA 5HZMA 2JZNA 2GXSA 4BE9A 5CBPB 2NX2A 1N5KA 5DM2A 2ET6A 2XA1A 4BUZA 7REQB 3SVTA 1R6BX 3DBRA 4YRGA 1UKBA 2BUBA 5ALYA 1Y1KE 3A9SA 3T9CA 2OXIA 1Q3TA 1QF9A 4M9RA 2ZE5A 5IARA 3WKBA 1UAAA 5BV8A 3HRIA 3MM4A 4KBFA 4N9WA 1DWQA 5JEEA 3UEOA 1ZM7A 3C8DA 4OY3A 4B33A 3M82A 2HPHA 2FHPA 1IPEA 3VKHA 1BXGA 1JLLA 1GYQA 1RJWA 1ZJJA 2IUEA 1DJLA 2ID8A 1EH5A 3FVRA 3TQQA 3ZJVA 4TXHA 3PFNA 5DPMA 5E9JA 2L2QA 3RVBA 1A8UA 4KDRA 4OKNA 1XRLA 4D0NA 3LHKA 4R31A 3TTWA 3CVWA 3WBKA 3EVTA 1JEAA 2Y66A 4P4UA 4PAQA 2DG2A 4OAQA 5BR7A 2XTZA 5LLSA 2I6SA 1M8JA 1N33B 2FWJA 3LKDA 3MS7A 4HRXA 4GLFA 4O2BF 5K03A 3CM0A 3DKIA 3PGVA 3DUFA 1LQTA 4JXJA 1HFJA 1R7RA 4GS5A 4NJEB 4PC6A 2AOTB 4Z3DA 2UYHA 4CQLB 4I7EA 2YWDA 3AF5A 1LKZA 4F71A 1DV1A 3HFJA 3W3AH 3GVXA 4HAUA 2XUQA 2XUAA 4NNPA 4PX9A 4HG2A 1R6VA 1YCFA 4CG3A 5IW8A 2AZMA 3MLBA 5K0EA 3OUUA 1HDYA 3ZY2A 3WYDA 4IKOA 2PZMA 5HKOA 2ONYA 2ZIFA 1U9ZA 3BPSA 4X3OA 3RFVA 4OUDA 3TAHA 1Z5UA 2PJZA 1D0SA 2G09A 1R0ZA 3VYRB 5JQGB 1RFGE 3AG5A 3C39A 4DM7A 4U9HS 2VJYA 2R62A 1YS7A 1ZWKA 4OHKA 4R68A 4WOCA 5D7NA 1X2BA 3EQ6A 5FWYA 4PNEA 2G5TA 4KPFC 1DEXA 2ZJ7A 5A4FS 1NNI1 1WCIA 1ZXLA 3KCQA 4MKZA 1A9YA 1U3CA 1UKAA 2B98A 3CE9A 4FOTA 3KZ1E 5E0OA 1DFHA 4FLFA 5CCEA 2ORIA 1NUSA 3GG2A 4JYCA 4AD8A 1JEYA 3L18A 721PA 5IASA 3EGIA 4Q05A 2VSQA 3A36A 3ZYZA 2R25B 4TTIA 5CFPA 2HCJB 3WMRA 1N2GA 2G83A 1C50A 4CT0A 4Q1EA 3U3ZA 3PCXA 4RXUA 4Y9RA 3IC5A 1LEHA 4HXEB 5HM8A 2O23A 1JKMA 4JP8A 2WKRA 3CZPA 4PLWA 3WB0A 3JVVA 2AMJA 4UBMA 2V97A 4ROSA 3JVEA 2WUEA 3EIOA 4HN2A 1G9TA 2I7TA 2QW8A 4HLUC 4D02A 3KKKA 3SS7X 2EARA 2QEQA 5ALQA 1BXKA 2F4NA 3B51X 4Z0PA 5A1JA 3B36A 1NI4B 1GRNA 5CA0F 5LIRA 4KSBA 2V6GA 2VP9A 4ICIA 4QTUB 5C7IO 2IYLD 1L9XA 1UBUS 2QRVB 3DKVA 2Q0HA 4RA9B 1WLSA 2YZ7A 2LV8A 1G2PA 1D03A 1Q11A 4MR8B 4R9UC 3O1JC 1SD5A 4D0RA 3II6X 2QRZA 5BW8A 3ODPA 1M0WA 2I2WA 4GR4A 3T3NA 2DTDA 2F8TA 1EIZA 2GBLC 3Q8XB 4YYZA 1WTCA 1RLIA 5MGBA 3W8EA 3JAMA 5G53C 1DIGA 3VR6D 4LHWA 2Z8YA 2PBLA 2ZI3A 1S0UA 2G71A 1I32A 2F67A 2GR9A 1Z28A 2LKDA 4WADA 4UVHA 1JTFA 1PVOA 1LS6A 5KTOA 3ZI4A 1P9NA 3CNBA 2GERA 4YFYA 1PTKA 3TG2A 1GGMA 1URPA 1UWKA 4RM3A 1D09A 3ITDA 1Y7HA 4FLEA 4S2EA 2IKSA 3H9QA 4RJ2A 2ZI9A 4RPKA 5DULA 4C4OA 1OFUA 3QBEA 2ZYWX 1TT5B 4MI1A 3VZRA 2Y0EA 5JAPA 2CNLA 3LECA 4MARA 4YRNA 3NKFA 4I66A 5GOZA 3QTBA 3TW8A 3VSBA 1E5VA 1ZITA 3DT9A 4LOJA 2AC2A 2OFWA 4NC9A 4S2UA 2ZUEA 2HA3A 1CJTC 4O3FA 2RKWA 4UDXX 2C99A 2ZRIA 5T67A 3U5ZB 2UXBB 2NM0A 3NXSA 4PQRA 5FDFA 4LMRA 2FPGA 2QAGC 3D8RA 3ZWOA 4BVGA 5BUZA 3K6SA 4P5PA 3ASZA 3P9RA 1W49A 3ZZUA 1AUQA 1A9ZA 2ZCVA 1O5TA 1D2CA 1DADA 4H1VA 4YREA 2V98A 1LLCA 1ZN9A 1HM5A 3DMHA 3GT0A 4LVUA 4A16A 1MA3A 1Z26A 3AP2A 3GGGA 4MGZR 5DF1A 3OPYI 4AWBA 3P9QA 2Q3FA 1DE0A 3FDZA 2RCNA 1Y1QA 3G13A 3I5MA 2H4ZA 4ND1A 5DLDA 3WKAA 3PNBA 1R0LA 1H4VB 3Q8MA 3MOGA 3NEYA 4MYRA 4X7RA 4DPMA 3MWJA 5AIAA 4EGFA 4LVNA 3B53X 3JR3A 4JT9A 4IIEA 5A02A 5IDWA 2C95A 3H2SA 4LZPA 4A0GA 5F9FA 3WWDA 3IEMA 1K7YA 4EDHA 3VFDA 4A8PA 2X5XA 3QJGA 2Y1DA 2WG0A 4Y2UA 5D7BA 4NK4A 1COZA 2CW5A 4HLNA 1ZIPA 3IAFA 4I9HA 3PTAA 4KRFA 5F98A 5AM1A 2JCVA 1OFVA 3E4DA 3R3ZA 5D1HA 1RLTA 3BMQA 1WDKA 4FMCF 1KEWA 3X3HA 1QH0A 1ZO8A 1ZCAA 4JNCA 4MKGA 4MV7A 3W77A 1AF4A 1PGPA 1HT1E 1Y0BA 5ERGB 1NTOA 1SD1A 3W5BA 2J4DA 2BFAA 1NWCA 1UJ2A 4ND8A 3WI7A 4KITB 2Q29A 3GJTA 3JALA 3FWPA 1J42A 3UMSA 3S8MA 1V5EA 4U2KA 4BRZA 5JZVA 1OX5A 1J6UA 3ORQA 1B3RA 2HC9A 1EHYA 4BN4A 5K6TA 1Z4QA 2BM1A 1FP6A 2R1TB 3P94A 5SY9A 3RU2A 3OLQA 1C7IA 3C3JA 2DTXA 2PUBA 1I33A 1F2TB 2Y8EA 4TV9A 4K87A 4CTNA 5LYJB 2XUOA 2KLHA 3AF4A 4IDEA 4A6XA 1SB8A 5JO9A 4WCVA 2YZGA 1Q0UA 4D81A 4W9NA 3KQKA 1HRDA 3R5TA 1ABBA 4Z4EA 3NOVA 621PA 4EMTA 3R76A 5LQNA 4Q01A 3LK7A 3G5LA 1KAEA 3EX7C 1WZIA 2A94A 1OXMA 2D0PB 2FYTA 4JUIA 2CDRA 1PJ4A 1T9GR 1TJPB 2NOAA 2NV6A 4XSHA 3SF8A 3VA7A 1V2HE 5C32A 3VNUA 4DA7A 2YS7A 1PT6A 4BP3A 2IXAA 4XWYA 1RR6A 2H92A 3OCJA 1RRPA 4GWLA 4EY8A 1XD8A 2HZBA 1L7DA 1P4JA 1FYWA 5FQOA 5KYUA 1JE1A 1RAFA 4D56A 2FWPA 4PLHA 2JI4A 4CCYB 2RH8A 3U31A 5G3YA 3CX6A 4P7KA 4C7OB 1JECA 3G2NA 1DKUA 4WN3A 5AI6A 5DCYA 5DGDA 3UMVA 1YK1A 4AJ9A 1U0TA 4BN0A 4WBNF 2XUJA 4IGIA 2BF4A 4WVFA 1BFUA 1SC9A 2IYTA 4PO1A 1JG2A 3OC0A 2JEYA 3F6CA 1XJ0A 4BMNA 2AFIA 4D9MA 5BW5A 1YNSA 3PKZA 1U8UA 1RBZA 3AEQA 4UEOA 2B69A 2CBGA 4IDOA 5JWHA 1A2QA 2PX6A 1UJCA 2ATEA 2CUKA 4QT0A 1V11A 1NW5A 3KU4A 3VU0A 3WGQA 1IEWA 1O6CA 2RHDA 2VYFA 4D92A 1CP3A 1HYHA 2ZSUA 3KUDA 1RWNA 3WGVA 3ZV5A 4ZT5A 2GX6A 5KJ1A 2AR9A 3I4FA 3TLJA 4BXOB 3RIHA 4ESVA 3NIDB 3SQMA 2ORVA 2Z4RA 3VPHA 3V34A 4CM5A 5JY6A 1J0AA 5DWQA 1B00A 2Q9AA 4D42A 1CEEA 5M04A 2YUIA 3KFVA 2C58A 3G2LA 2Y6VA 3QFFA 4HAIA 1L4MA 3OX4A 5LYJF 1QHEA 1NP7A 2V74B 5FBKA 3H9EO 5IUJC 3HWWA 2X22A 4M7RA 5AM4A 1XPUA 3I6QA 3V8QA 1NIJA 3ZIUA 1JNXX 4JT4A 2XJ9A 3TLAA 5IZCA 4FYKA 1CR2A 5IEJA 1AHIA 1OX6A 4YRFA 1H3EA 2ANCA 4ES6A 3B9RA 3CKLA 1EESA 2D0OB 2DHQA 1GU0A 1Z4KA 5AK6A 4I1RA 2CK3A 2XKJE 3TB6A 1RW4A 5CVTA 3L2OB 3R0IA 2ZRBA 1GPYA 1MOQA 2RHWA 3EK2A 4LCBA 3FUTA 2QIOA 4NFHA 2BJHA 5C5DA 2RHBA 1KPHA 4WGFA 4BQRA 5P21A 1YVPA 1S4MA 3ZOKA 1I8TA 4JU8A 1P9WA 2F3RA 3KQSA 4IHAA 1D0IA 5EHZA 1S2OA 4E3WA 1YO6A 3KR9A 3LY8A 4RDXA 4S3MA 2WWTA 1KGSA 1GILA 1KR5A 4UBKA 4PLZA 1JFRA 3REQA 2CXUA 2XDYA 2FSFA 4PZDA 3OM0A 4H59A 4XR9A 4MVYA 1U99A 4H18A 3WWEA 2BZ1A 6LDHA 3M4YA 4ZCMA 5BWCA 1E8NA 4G36A 3P96A 3ZCPA 3LW8A 3WFZA 2QI9F 2GZ2A 3FMIA 3LSYA 2DWUA 2WYIA 4H1UA 4R1PA 5AVZA 1E0SA 2X8AA 3FOBA 1K6IA 1LC3A 2V5UA 3NCHA 3OWXA 2M6LA 1FSPA 1CUBA 1S4QA 1T5SA 4G9GA 1JWBB 1HTWA 1Q0PA 5BNIA 4GPTA 5AW7A 3CLTC 3QVMA 3BK1A 5E9WA 1JLLB 3B1YA 1U94A 2G9RA 1JG3A 4R3UC 2YOFA 2ILVA 2H0RA 4X97A 4J8PA 4Q4CA 3O2NA 1U0SY 4HYYA 4V0LA 1BE1A 4TSFA 4QJ5A 2WZCA 3QUBA 3FMGA 2I55A 4RK6A 3M9XA 1LPBB 1RTKA 1KAOA 3RVNA 6YASA 1P3JA 4E6EA 2ADMA 2P3LA 3LWNA 4IM7A 1NVFA 1KMNA 4O4IF 3I9LA 4ACBA 1YQUA 3QU9A 3DUFB 3HY6A 1EFCA 4KXQA 2HJ9A 2E49A 1E1KA 5FJJA 3FOAA 3HN7A 2OLEA 3DD1A 4FEEA 4KQHA 3UV7A 1P0CA 1A2KC 5THKA 1A97A 5HKBA 3F7TA 1W76A 2UXCB 1X1TA 1XMPA 4EHHA 4GH5A 4BFVA 3DAGA 1HFEL 3L4EA 3TOZA 2WU3A 3AZQA 4UMFA 4YPVA 5JT1A 4PLCA 4O4JF 1L8LA 3PA8A 4GOND 1T5IA 4GZ6A 3WR5A 2NVWA 1CVRA 4MW9A 2XNHA 4O02B 5MN6A 3ES9A 2XXAA 3L7YA 4NQRA 1Z2EA 3CX7A 4Z3KA 4IIFA 2QRNA 3A0RB 5CB4F 6ABPA 4PWZA 3GLKA 5L8VA 3I04M 2WG2A 4I5DA 4ESHA 1M1NB 3EYWA 3NWPA 1THMA 3CT6A 1OGYA 3EMBA 2YRWA 3GLHE 4L8VA 1DEKA 5KVQA 3FY4A 2EKPA 3ZWAA 3PXEA 1JEYB 1WABA 3RBXA 5L45A 1L7NA 2IWHA 1V6AA 1AKEA 4AQDA 1V3UA 3KLBA 2V5AA 2QMUA 1MQAA 1TDJA 1XDSA 4FWIB 1DOZA 2VHXA 5U4QA 1D2NA 2QRGA 3CEMA 4JHLA 3BE4A 5ENDA 2AQHA 3QNWA 4G5XA 4E08A 3W1VA 1J0BA 4MV4A 1PD0A 3MNFA 4C07A 1GT6A 2AEMA 3QJYA 3MOSA 4DAEA 4B46A 3B5JA 1A4XA 1O95A 2J9RA 4H16A 4KP7A 3X2EA 2BUAA 1KOJA 2J3MA 1KMHA 3AHJA 5AJVB 4JKYA 4N8EA 3FB1A 3FPCA 3U56A 2ZAMA 3UK6A 3NRJA 3X2SA 4RD2A 2DBZA 1LW6E 3JAKB 4TYYA 4D41A 3HFGA 1TQHA 4EMUA 1Y1TA 2V9PA 3JTMA 1XGKA 3DGFC 4WZBE 4MVJI 2O2CA 3QVXA 3L40A 1M1YB 4LHSA 3N2IA 4IRUB 3WRYC 3OUTA 1V4VA 4MRAA 1AC5A 3PQEA 1NVDA 1QHIA 1XD9A 3BEOA 3IJPA 4ZQEA 4DW8A 1C2YA 3WLNA 1FMFA 3RSOA 1ZUIA 3VO1A 5IF3A 4CBVA 2YW2A 3A6ZA 3PUIA 3AKYA 3ZGYA 4TVSA 1U8XX 4XUDA 5ENVA 2F43B 2VP6A 2COUA 1T3TA 3UG7A 4Q3NA 3MWLA 2RE8A 3H4VA 3OTOB 5TNXA 4ETWA 3L8MA 4ZU3A 5C34B 4WLVA 1DIOB 3FR7A 5JH7B 4Z4QA 1VI5A 2C9MA 4EMSA 1AQLA 3VZBA 2IBMA 2N1MA 2CJYA 2D5AA 3N1UA 2WMYA 3UWKA 4JHXA 2JLCA 3Q3GE 2YN4A 3FAZA 4LOLA 3N7TA 4AIRA 5C8YF 5JNLA 1ACLA 1BOOA 3OJXA 1LBQA 4DA9A 5TMPA 4L9RA 2QP3A 3WWPA 3K9CA 4M0MA 4RACA 2FPGB 2X0JA 1JSXA 5FPYA 5AXBA 4F45A 1XK7A 1GCAA 3ESQA 4RKQA 1NASA 1UBGA 3WL6A 2VSNA 1LBTA 2NUPB 1IOVA 1MC4A 2OBYA 4BVHA 4EYOA 3SY8A 1E7SA 4RPGA 4JI1B 2YV1A 3KV1A 3GJ8A 3OI7A 4GUDA 2BC9A 4R81A 2FE1A 4UMEA 4WX2B 1E4OA 3SXUB 3G02A 1JHVA 4I8IA 2C3MA 3ASVA 4D4JA 2DBQA 1TAHA 4PAMA 3I3OA 1QVRA 3SSNA 5IK2D 4TTRA 5J2UA 2EFCB 4QDXA 1I7LA 3WOHA 4ZT4A 1MQSA 5I01A 2LCIA 4LXTA 4DR2B 4OX9Y 3STYA 3UJHA 1CFJA 5J40A 1S1MA 3A4NA 3KQVA 4FFPA 4K28A 4R8RA 2P3QA 2MYTA 3VYUB 1MG5A 2A7QA 4ISBA 5B7GA 5KOJB 4WW0A 2CNNA 3BE8A 2KPOA 2QUHA 3QFRA 4YR7A 1SOWA 4GC9A 1SBNE 4H1TA 1SKYE 4MV6A 5F5NA 2O5EA 2F9LA 4RHTA 4DUPA 2WIKA 3ZIDA 3LK6A 3DMTC 3OJEA 2JHPA 5FBQB 3OEED 1G7TA 1XZPA 4UXHA 1RMQA 2AEJA 3N0WA 3AUFA 3HSKA 2DLCX 3PXAA 3IDSA 1JEEA 3EZ7A 3CRRA 2MDTA 1ZGBA 1BIFA 2QMQA 2OORC 4Z6KA 3T5AA 5EMMA 4UTOA 3GMDA 5DCUA 3UWDA 1QIHA 1WUJS 2ZRGA 1IUNA 4N47A 3V32A 1E9FA 2MSLA 3F4BA 4F2GA 3NAZA 1KRWA 3DV0A 4V3CA 5CPFA 2DPYA 3PJGA 2BEWA 3NPAA 5AOAA 1KU0A 3ENKA 5HF5A 4K9LA 2NUTB 2WSLA 5F1OA 4TVKA 2Q0QA 4HH1A 4DKXA 1KC1A 3MUNA 3SF8B 5CCBA 4XIYA 2VUTA 3S40A 4K0RA 2BKEA 3G0GA 1AV7A 3T7JA 4HH0A 4QXMA 3M49A 1EVJA 4Y6GB 3LX5A 1N2IA 5LQSA 4LF5B 2OHFA 3TGWA 1JR4A 5E8RA 2IOYA 1EVKA 2WNHA 3IIMA 5EPEA 4CIBA 1X3LA 2P3OA 4TRJA 3ZZ0A 2G6BA 3VC2A 2C7GA 2C2YA 1XZNA 3MJCA 4RKFA 4JX8A 4B6SA 3A2LA 2Z09A 3E4CA 3LD9A 3UAVA 2E6UX 2QVGA 4MYUA 1X19A 2AX4A 2CFOA 3RK4A 1ND5A 1M54A 4L74A 2RDMA 2ZT7A 4ZCRA 3QZUA 1NTRA 3D1VA 1O94A 1P5HA 4OMDA 5D3QA 4XYLA 4GGOA 3EEOA 2J0QA 2C5AA 5JC8A 2OPBA 4DC0A 1G8GA 2G4CA 2B4TO 3PD7A 3Q2KA 4DYVA 4HV4A 3M70A 3AR7A 2XOKD 3JAWA 4GEKA 5F5LA 3S7ZA 1H9AA 1SC4A 3LGAA 3LQ2A 1IJKA 1Q50A 3B6JA 1DEOA 1ZFNA 2JFHA 4MWGA 2IHBA 1C0KA 3UCFA 5IG2A 5DRTA 1NJSA 4LE1A 2Q3HA 2AJBA 4BVKA 2HWKA 4ARSA 3EB9A 4FK8A 4EEZA 2HB6A 2H1SA 2XT9A 5CDSA 2OYSA 3HDTA 3PG5A 5JV5A 2A5LA 3K20A 4JEIA 2C5EA 1UDAA 1IUKA 3F7NA 3CF2A 3IJ5A 1QORA 1QC5B 1X38A 2VHUA 3SHOA 3FLBA 1BDHA 1E0AA 4OK6A 3KS9A 1BDIA 4JUBA 3PEFA 1PQPA 5FTNA 1RPTA 4QBGB 4DJTA 1PFVA 2EZ4A 1U7OA 1YQWA 2X86A 1SUFA 2B9VA 1ISPA 1C8LA 1OI7A 2HDNB 2OXRA 3EEBA 4G4SO 3RTDA 2VTDA 4JJ4A 1ONOA 1SHTX 3HJTA 4UU1A 4AZ0B 3HU5A 3V2GA 2ORYA 1DG1G 5KSPA 4UFPA 5HZHA 1O2DA 1WB9A 1JG6A 1BX0A 4OAOA 4G9EA 4AZ3A 3ZK9A 1PL8A 3A27A 1LD3A 4G0OA 3H1GA 2ZBVA 1QIDA 2P4HX 2BM0A 3GNQA 3F1KA 3LPDA 1JG1A 4FZ3A 4E94A 4D9JA 1XL1A 1IM5A 2GZ1A 5AW3A 3N7UA 5LPNA 1ETHA 2G4VA 2YYSA 3OHSX 1X6VA 3QG5A 4IHJB 5IT9A 1FFAA 2FG5A 1FQOA 3C41J 1E7YA 1Z0DA 2OLKA 1UWCA 4CVNA 3GLQA 1ODTC 4IAOA 2YVAA 3TLBA 2D6FA 2H9AA 3KLMX 3KVYA 2X9VA 4JLUA 4I4TF 1XTSA 1MHPA 4KMOA 1OXVA 4RVFA 3PLNA 1ES9A 2ZS7A 3WMWA 3ZXSA 3AVUA 2XNSA 3GJZA 3CUWA 2FN8A 3CKKA 3SLGA 1EE2A 4IX9A 3FMFA 4PSAA 2WWWA 2FJ0A 1FXSA 4GSLA 4I36A 3IAM1 1ISSA 3MB5A 3O47A 3DVRX 5CLJA 2OQIA 1RCFA 1J7KA 1X1RA 3KPUA 1VL8A 3MT9A 2R8YA 4UARA 1G3UA 2NVOA 4ZO6A 3CZCA 5CB0A 4M1KA 3COZA 3KAJA 4GE3A 3I0ZA 4XJXA 5EA2A 3TL3A 4DRYA 4I1SA 4RGVA 5D5PA 5AW1A 4HDRA 3ULKA 4YAJA 2D7CA 1PG0A 3H4MA 4IXTA 4AKHA 4C1NA 4XWOA 4DMGA 3FETA 4YDQA 4OA5A 5CITA 3C3KA 3RPEA 1RM4A 2EWMA 4HDKB 3A4MA 5L4SA 3K8YA 3N2ZB 3CZ4A 3I8SA 3NTXA 3UY4A 4AMUA 4CIXA 1IFXA 2AYXA 3DC7A 5DN9A 3ZY6A 3MLEA 5JEDA 3GFTA 3VPXA 2HIHA 2BMJA 2R7KA 2PWYA 3CR8A 1L4GA 3G7UA 4RENA 5TARA 2Y0DA 5BSWA 3AVVA 2C4UA 4L5IA 5AJXA 3HI6A 2JVKA 5JXIA 4TKUA 4F2WA 3PE3A 2EGHA 3P71T 5A5DA 1QMPA 3IKLA 4NS4A 3SEQA 1Z3CA 2P9BA 2Z4SA 1FDRA 4M0DA 5ICMA 3Q2IA 2W2LA 3G17A 3O74A 4QJBA 4KRYA 3LUKA 3E18A 1GVNB 5EJ7A 5IN4A 4ACAA 4OFZA 2FSIA 3TR6A 4OP1A 1TM4E 1VBNA 1D2RA 2HN9A 4G8BA 4TV8B 4YP5A 3CR7A 1A5ZA 3CO5A 1NW3A 3MRXA 1N7JA 3ZXIA 1VJ1A 4NE2A 4ZD6A 2QN8A 5JCOC 1CJVC 4MZXA 1ZGHA 1RQPA 1X0VA 1OYYA 2L42A 2GARA 3FFXA 4KXMA 4B3HA 4GD3Q 4RPIA 5EE9A 5GOTA 1NBWB 4V2IA 5LNK1 3GUCA 2HGSA 4C1BA 1MRZA 1WQ1R 2HUPA 1C3XA 2RAFA 2IYPA 1ZISA 4C0SA 4Y2HA 3B3FA 4YAOA 2JFBA 5BNTA 3EULA 4Z3OA 1BVUA 2P78A 2ZWVA 3BWEA 2J7PD 3BG5A 3H9UA 4GMDA 4Q02A 1SCUB 3JARB 5CX4A 2LZ0A 3WYAA 4G1UC 3H1PA 3MCWA 3EQ8A 4E4RA 3THOA 3GK3A 3ONVA 1TLTA 3HHPA 2QTVB 3I5UA 1GAEO 4G1VA 4R40A 4F7WA 5CXQA 3MILA 2YZNA 4E14A 1XXLA 3S3TA 2ZYSA 3UCXA 3UTDA 4C6TA 4QX6A 2KWIA 1Y9EA 1I4TD 2JA1A 3TRIA 3EWSA 4R8KA 1KMHB 5H80A 4F6RB 1ZR2A 1TKAA 1W1IA 3N3AC 5ERYA 4PRZA 3W5HA 1U1DA 1O9GA 1OLSA 4MMXB 4XM1A 3HZRA 4ZAFA 4LRYA 2WMDA 1SIUA 3NVMB 4C0JA 4IGEA 1N2ZA 2YIVX 1F8XA 2VHZA 4QOHA 3TTTA 4XB6B 4XX0A 1SVIA 4JZYA 1TB4A 4DIUA 1SA0A 2BW0A 3EWNA 3K9LA 3NIWA 2WJWA 3FPHA 4NKRA 1R50A 3P9KA 3TB4A 3OE1A 4FFVA 4G8JA 1OQAA 2E1RA 1WU8A 3F2IA 3MAAC 3QITA 2GFIA 5EZQA 2V03A 2OAGA 3HL0A 1A8HA 5DP1A 3TQOA 2PUVA 3DMGA 4PHTA 2J8ZA 1OA1A 3H3JA 4XRGA 1UZLA 3PHGA 3NM4A 4H9GA 4RZ3A 1QAQA 3ZU2A 2BSAA 3MXTA 2DF8A 1JQAA 2UUPA 4TKVA 3A6FA 3H8JA 3I92A 1GPDG 4QDTA 4F9TA 1TRHA 3QE2A 3GLGE 3CIFA 4J16A 4L1KA 3D7SA 3E3LA 2PYIA 3KB8A 2J87A 3QM1A 4PV7A 4C4AA 3HCRA 1Q84A 3H1AA 4MS3A 5FBZA 4D6PA 1N8NA 3BQNB 2WJ3A 2XEXA 2PK3A 3GLUA 1HDIA 1GFIA 1V45E 1X1DA 5J5CA 2FF5A 4ZVNA 4KC0A 3ZBQA 3RK1A 1KVSA 2EJWA 3NCTA 3OE4A 1XZCA 2P79A 2QUJA 3FHCB 5CXXA 4G07A 1OFHA 5DWDA 1HMPA 1M3SA 2OCGA 3V4VB 4EG8A 4EABA 5CM8B 4C30A 4FC7A 5HZKA 1DV2A 1Q6ZA 5JYEA 2CBXA 1KJ9A 3QU7A 4PGHA 1Y4DE 2FOIA 1PJLA 3ZK8A 3EGDA 2IC5A 3ZUPA 1X1EA 2YUTA 4NBVA 1S9DA 4QBHA 4ITVA 4KXNA 4B40A 3RAEC 5K7SA 3STTA 2NXEA 5TVGA 4DQUA 2CJWA 3DWFA 2DLNA 4UHEA 2YR0A 3ETDA 3MMZA 3B1ZA 3MJEA 2PMDA 3GEEA 4R05A 3LFHA 4IDHA 1ORDA 2QWXA 1H1LA 3CZ5A 3PEUA 1K3UB 5EZ5A 4YAKA 2DPGA 3R5XA 3DW3X 1BRMA 3WTBA 4QTTB 2GS9A 1TIKA 2H5JA 2BKVA 2WAYA 4HFNA 4PC7A 4QGAA 4AUMA 5JISA 1W581 2IYZA 4RV9A 1CQPA 2W2QA 4GMGA 3OO1A 1PDVA 4FDUA 5EJIA 4IDGA 3MTQA 1IPHA 3Q0TA 2PWAA 4EPWA 5C8VA 1TEZA 1TMYA 2IELA 2X13A 2IU6A 3BD6A 4XQEA 4B2LA 1F1JA 5JD6A 3C7KA 1EK1A 3B7PA 3LBFA 1RHKA 4LRSB 5KCMA 2RBGA 3FCUB 1NM5A 3BXGA 3EEYA 3WMXA 2J0SA 1U11A 2UDPA 2VOEA 5KNDA 3WGLA 1E2IA 2QL6A 3K4PA 3RV4A 3MRSA 1YVEI 3WICA 5AIBA 7ABPA 3L8GA 2B4YA 4WUVA 4DR6B 4A0HA 3T5DA 1RYNA 3I01A 3CPJB 1VBMA 3TI9A 3CJTA 1BXRB 4XVHA 5GV8A 3BBLA 2Q50A 3JATA 3LJKA 2XRZA 1BVYF 4FX5A 2VVTA 4BFYA 3HACA 1WXDA 1XL0A 3BREA 1FDWA 1XT6A 1OZ0A 3GX1A 1P9LA 2QPLA 1QLWA 1QGUA 4FBGA 1E1YA 4HRYA 1CWUA 2ZIVB 2I2FA 4MUYA 4RIGA 3M4JA 4J1TC 4PGMA 4RSHA 1GQFA 2AK3A 1NW9B 1FP4A 2EERA 2G1JA 3ITKA 5JAMA 2RGEA 4MPPA 3RFXA 1T1JA 3OZXA 2FMHA 1Z6TA 3MWKA 1PQUA 2C4VA 4TLDA 4F3YA 4R2KA 3IP9A 3HCWA 1B0UA 5LXTB 2YXNA 3RVRA 1Y3HA 1AHHA 1XQYA 2KYRA 3DBOB 3DMNA 4JSTA 3FTDA 4ND2A 2H85A 3JQ8A 1DAIA 2E18A 5ENZA 3PHCA 4GKAA 4JC4A 1DPFA 2GCPA 3HPQA 1VSVA 3GAFA 1PYGA 1XVTA 2VHCA 3IAM6 4EUFA 2R8EA 4QD3A 1LDEA 2OLJA 3R6WA 4KI7A 1X7WA 4OQNA 1D1TA 1Z88A 2QP4A 4WSOA 2B92A 2IW1A 4UJ3A 1CZHA 4NPAA 5GJWC 2IDJA 4Q3AA 2O2IA 2QG4A 4PNHA 4PXAA 3U3MA 1LNZA 2ZREA 5GJCA 3ZU3A 2BEUB 2EBWA 4E5KA 5CU7A 5CGQB 2HHJA 3M5PA 2GUWA 5BMOA 3B2EA 1WE2A 3RH0A 2Z3WA 1S8FA 1MPTA 4ER0A 1ULUA 1AA9A 2O1EA 2ADOA 3OX2A 3KZKA 1KI4A 2B1JA 3DCNA 4IPTA 4K6GA 1E9SA 3D5QA 2I78A 3B38A 3Q7RA 3RUEA 4K9SA 4LJ7A 4QU9A 4Q9KA 4ND5A 2E48A 5JPCA 3VH1A 2WHPB 3RS7A 5C52B 2UZ3A 2RAPA 5D3ZA 5J5AA 3T5CA 4EPXA 3UBMA 4DRZA 1MV8A 1ZIYA 2PGIA 3RAFC 1T35A 3BFKA 4P54A 2B99A 4CLDA 4L57A 4KHZA 1XCOA 2J1LA 1ZK2A 3D5TA 1G4HA 3U7GA 4JYAB 1KVTA 3I6IA 2RAUA 1P7YA 1DAGA 2YIJA 3PITA 3P9NA 4JJEA 4DY4A 4DV4B 1FQWA 1TZCA 3W7VA 4CCAA 2P1RA 1CU1A 1M2GA 2X4LA 3JWEA 4GZ5A 4MB0A 4DCCA 2QS9A 2WQZA 5BNWA 5AW4A 3CIOA 3REGA 2RBEA 4DY6A 1F2UB 3LCMA 2I2XB 1I1OA 2AQ8A 1Y8AA 1MAAA 3EWIA 3UMFA 4EJSC 2Z0MA 3KEGA 3J81k 2JGRA 5BWMA 1UP7A 1Z06A 5M7EA 3B8EA 4AZ3B 9ABPA 1A9TA 1E69A 1KYIA 4L78A 4OI0A 2B2NA 3I1FA 5CVCA 4U7DA 1GCGA 1Q95A 4PPYA 5DI3A 3K9GA 3V1MA 1EX9A 3AFHA 3C4QA 4UBNA 2DHEA 2ZZMA 1UEXC 3DZDA 4LDJA 1QK5A 3NP9A 2ZIWB 4D3YA 1BHO1 1QFYA 3G8YA 4OQPA 3PQ5A 3SZOA 4W5JA 4G01B 1QQ6A 1S2MA 2QA5A 3B1WA 1RNLA 3NV9A 4FE4A 4R1TA 4BZZA 2BKLA 4OGFA 3CLTD 4OOFA 3L7AA 4KCGA 3UAYA 5JNTA 2OCAA 3G2OA 4BKQA 3F8WA 4JD5A 4YJFB 5IDVA 2OZPA 4DSAA 1V8DA 4FCCA 1G5HA 4PSCA 3CUEF 3WGGA 1ZNWA 1R5NA 2CMKA 3KXDA 1AUVA 5I9SA 5THXA 2C2XA 1B6GA 2R8ZA 3W5SA 4ALMA 1VL6A 3HKEB 3C16C 2WWGA 3R20A 4QXRA 4UNSA 5D3MA 1Z4IA 2CNWD 3KT8A 4L28A 3GFBA 4TLLB 1XD2B 1N5RA 1JIIA 3RYFA 3KTAA 2GAJA 3W5IA 1DHRA 3OBBA 2ZE8A 1YS6A 3RB8A 1WEHA 1L4KA 4URVR 2PIDA 3N70A 2HMYB 4TL8A 1MIHA 4KR2A 4M88A 1KQPA 3RABA 1WTAA 4D96A 2UUBB 4KLNA 4ZTZB 1DRUA 1UP4A 3ONNA 3AO0B 3RBVA 2W7TA 3W4KA 3PUXA 1J9GA 4NXMB 1PG5A 3QKRA 2YHIA 5A5FA 1T2NA 5ALVA 4P92A 1G19A 2G17A 3N59A 3QVJA 3IQDB 1RQ2A 2IK8A 1C1YA 2HIMA 1GIAA 4TKUB 4WLEA 5EIBC 2DQSA 4EPTA 1V25A 1KK0A 2JFNA 3M81A 4QIHA 1XCPA 4AMGA 4YV2A 3N2GB 1BD3A 3H4IA 1UC9A 3ZD8A 2D4HA 4Y2VA 1KFKB 3GLIA 3SWWA 4DKJA 2CHEA 1D6NA 2VF5X 3ADKA 1P2SA 3CPEA 4KXLA 4MQMA 1F0KA 4W9RA 3RUIA 1VLZA 4B3BA 2XBLA 3KVVA 4Q7MB 3P27A 3PRHA 2WE8A 5KVAA 3VBEA 2FA9A 1NZDA 4FGKA 5ELMA 2AEFA 2P0YA 3ROXA 1IE3A 4OUKX 3KQUA 4ATNA 1WNTA 1JIVA 2G0NA 3JWGA 3PFCA 3TLKA 1Q17A 2MIIA 3VKGA 5BSRA 3BMOB 1K6MA 3D6JA 3PQ7A 1JJAA 4I99A 2MSEB 4G4GA 3U6BA 1R4MB 5GM1A 1L8QA 2CL5A 1A5TA 1YKSA 3FPKA 1LJ8A 2X76A 2C59A 2NYUA 4JUFA 1H0SA 3S2UA 5A06A 2VHEA 3EUFA 3Q7EA 4YBRA 2QPAA 1WS6A 1R0BA 1F4PA 2I3GA 2VBFA 1LI7A 3AETB 3C15C 2V7VA 5IEBA 3GO4A 4N01A 3ZU4A 1FJ2A 1ZH8A 5AW9A 3TIGA 4JBGA 4YCDA 5AHKA 4ZANA 3W6OA 4JI2B 5JQGF 4BFCA 2F62A 4AG5A 2J7KA 1E89A 2TSYB 2TMYA 4MOWA 4YRKA 4GBJA 2MSNA 4V0KA 4N5HX 4PVDA 1AKWA 1OI3A 1YWGO 2G4LA 4NOMA 4ZFNA 5TMDA 1KJZA 1XVVA 1Y4ZA 3AONB 3COYA 3HVKA 4Z5XA 3KSAC 4GQBA 4OL9A 2GHQA 1MOZA 2QLJA 4IXDA 2UUAB 1P8AA 1OYWA 2QVYX 3GWGA 3ZHOA 3ANYB 1C0LA 1UOEA 4XX1A 3T8YA 5K4HA 1PR1A 1YD7A 2GA8A 1MW8X 3EXHB 2NPOA 5J59A 2IHYA 3F6PA 3FSEA 2IXTA 4MA5A 2GF9A 3NGMA 1N0HA 3OE7D 4D43A 1GXSA 4YYEA 5AHWA 2IS4A 1L6IA 4Q3CA 2G82A 5JXGA 5U1PA 2PUFA 1R6TA 3ACCA 2EQBA 1KY3A 2PLRA 3ZCXA 2ZQ5A 3V4SA 3HXOA 5E8JA 2X15A 1YASA 1BGWA 1L5VA 4I9FA 2PSSA 3UJ9A 4C4ZA 3KEQA 1WEKA 3EYAA 3OX1A 4G1EB 4M0EA 4O8ZA 4HPWA 1CS0A 2QY6A 3HDHA 4G65A 5HJ7A 4I4IA 2G67A 3I9KA 1JIKA 4WGGA 4Q9LA 1E6KA 4MV3A 2ISQA 3AEYA 3G7NA 1EM8A 2YJ3A 2J3IA 3QVUA 3RGWS 2Q5HA 1KK2A 1VJCA 3HCEA 3O73A 1OPRA 2EIHA 1W0CA 4JLNA 1QJCA 1X8XA 2VDRB 3ENNA 4Y2JA 5AK4A 1P4GA 1PQ4A 4CG0A 1NBMA 4XAQA 1NLZA 2HUNA 3PGA1 4E09A 3RYCA 5ALRA 1CC1S 5HIJA 1RZ3A 1AKTA 2K87A 2QBYA 1XZGA 3A1CA 3KJIA 3MGKA 1T1EA 4WVLA 2JJ1D 1QO9A 2QU8A 3QKIA 3R9KA 3EGOA 5AJZA 2J6CA 2P30A 1WO8A 3WHPA 4XKJA 4YCSA 2YXBA 3IR5A 3OEHA 3PXBA 3QOYA 3K9QO 1G63A 5CXSA 2P90A 3P4XA 2E4AA 4BPRA 3IPLA 3M1IA 3CF0A 2VA9A 3R3XA 5LB2A 4UEJA 5HP4A 5GY7A 2YJNA 1I6LA 2MYNA 3G8DA 2CJWB 2Q3MA 3LZ6A 3KDSE 4OSPA 3AF6A 1W4LA 3U26A 2C7BA 2XMSA 1P3DA 2LDBA 5D87A 1O03A 4MGKR 3CLUC 1FU4A 3EXG2 3KQPA 1H2FA 2X6QA 5DISB 4R2LA 1CUHA 2XUDA 3VPAA 2UVQA 3R7SA 4Y2TA 2YDYA 4R2IA 3V4PB 4D3FA 1OLUA 3QY0A 4DJEC 4ZO9A 2BMAA 5JOQA 4H35A 1PSDA 2Q1XA 4HEA6 5GQSA 3R7DA 3SBOA 2PT5A 5E6UB 4URXR 2DOKA 1ZAKA 4DA8A 3W8FA 1JFVA 3PGJA 3PE4A 1M5RA 2IUFA 4RZXA 5I3CA 1ZUNB 3PWZA 1E9RA 1BYUA 5EHIA 1OMOA 1JA1A 3K96A 1V47A 2QD2A 3PICA 1T9AA 4TLCA 4EF4A 4QPJC 4KO8A 1BX3A 3WLPA 4DMFA 2LCQA 1JJ7A 3ONWA 1ZVJA 3ZEIA 2HQRA 2Z1DA 1P1RA 3FCOA 3PC6A 3JQ9A 2F3TA 1L5NA 3E81A 4EY3A 2JK0A 1SU7A 3PQ8A 3Q6MA 4TT3D 4ZIRA 2GLXA 3PNYA 3K8ZA 2HTFA 4MS1B 5EP3A 3KOZA 1MGOA 2BCJQ 3NDRA 3PEVA 4G5HA 4R2WA 4YT5A 1XRRA 1TD9A 3R0ZA 1QANA 1VBKA 3QXHA 2BN4A 3NOQA 4ZCSA 3JATB 4B6PA 1CFZA 3I23A 1EVLA 3CLRD 4IF6A 4M0PA 1RHRA 2A5GA 3ORYA 3SVZA 4BO2A 1CF9A 1I6KA 5KDLA 2CT8A 1XXHE 2PT6A 2AJLI 2LCFA 1NYRA 2PUHA 2YBDA 1QGUB 3EVAA 1ZXBA 3KLPX 3NX4A 3CMCO 2X0RA 3Q7QA 3L8CA 4GP7A 1RJGA 1XTZA 2QVLA 3IDQA 2ZTSA 2BEVB 5JZBA 1MVLA 2VO1A 2SHKA 3EVGA 4J07A 5KVSA 4YJ2A 1GNSA 4INOA 4FDTA 1RWBA 2QLMA 3T34A 3TVYA 1HV8A 5DCWA 5JD5A 1NXXA 3UJ6A 3V4RA 2VUUA 1PN3A 4UTPA 3SEZA 4UPEA 2VDWA 3UUEA 5JDCA 3D0QA 1WETA 2YHSA 2LIPA 1QHYA 1FFCA 1V8OA 3IUNA 4L72A 4CFSA 5J23A 4NQZA 2NXJA 3ORHA 3HXQA 3PFGA 4IYJA 1SEPA 2IX9A 1MH1A 1YR3A 3VUEA 1FFSA 2H1LA 4BVFA 3KELA 4CTJA 3CB4A 4JSYA 4Q3BA 2DQZA 6ADHA 4MDFA 5CM2Z 1IXRC 1FXWA 5ALIA 4N65A 1ISJA 4XEUA 4GR9A 1C5KA 1NF3A 1ZZEA 4AP5A 4YUXA 2HSJA 3QFSA 4NJMA 3GV0A 3OFNA 5F4BA 3SYLA 4QTZA 4LZWA 1M72A 1YR9A 2GLUA 3I5XA 3L6OO 4L3VA 3PFBA 1E62A 4NZNA 4Y1EA 4RKEA 5CDUA 1KA9H 4FE3A 4DV5B 3RSQA 4B6OA 3NBYC 5J1TB 2VTVA 3S1AA 4OXXA 1RMYA 2WK1A 4DNOA 4HPXB 4LYJA 1LY1A 3B48A 4X8LA 4NCBA 2SCUB 1JB1A 2BI7A 2GM5A 4OB8A 3GRCA 4IIUA 1XJQA 4RKRA 2AN5A 3EEQA 3RAPR 1QPGA 1DXYA 3GA5A 1WUHS 3ZR4B 2B6NA 4BWVA 2PS9A 4EBBA 4YCMA 1RLOA 2YRFA 4EEXA 1ILEA 4RDCA 3BA6A 3WV4A 2C2GA 4D26A 2H54A 2XRMA 1QFXA 2RGWA 3F67A 3P2EA 3PNKA 4BRSA 5T4FA 4II7A 1ZW1A 3AI2A 3FCAA 3I28A 2X2EA 3KWLA 1KF0A 1TYCA 2YY7A 1YDWA 2HSZA 2J08A 4S12A 3WLMA 3OG9A 1V3VA 5BMVA 2VC2B 3IT1A 4MV5A 4ZJZA 3U16A 2KM1A 3JZMA 1QG4A 2XXBA 1Z6QA 2R6CA 1X9IA 4MW7A 3NJ4A 3T1YB 1M5TA 3FWHA 4QAQA 3TMKA 2FFBA 2ETVA 3N8DA 4H6WA 5CAEB 1KJIA 3RSLA 3K70B 4MIEA 4RMIA 4BNLA 5I9TA 2EATA 3LQQA 3PGXA 2DQKA 2W9XA 2DSTA 4HI0E 4KPUB 5DI3B 4BRUA 5BPHA 1PUXA 3ZDBA 2XD4A 3HV0A 3A26A 4IGKA 2G9VA 2A5JA 2EFDB 3CVOA 4G6ZA 1YRHA 2B2CA 1FFYA 2OGTA 2CNBA 1Q0QA 1VOTA 1KEPA 2FG6C 2F3QA 3EQ2A 2X3YA 1RXIA 2IQ5A 3MWDB 4PRLA 9LDBA 1BH2A 3CS3A 1P2VA 4LGCA 3D31A 1F8YA 1YZHA 3MW8A 1VJ5A 5KQGA 4B3RB 4W9NC 2OCDA 4K0KB 1JHRA 4FPXA 4GECA 4U7PB 4CEHB 1AK2A 3VR1A 2R11A 1Z08A 2ZR8A 1FDOA 3B3QA 3SKYA 1HNNA 5T7BA 4F1WA 4ITUA 3QA3E 3SQLA 3UHFA 4I19A 4AI6A 2E89A 4NHOA 4U2CA 4CM4B 4DQDA 4DA6A 2AK2A 2PKQP 2FX2A 3BIJA 3HJGA 3JYLA 3NRCA 4JIMA 4LY6A 4D97A 2WD7A 2GPNA 1B43A 2X19A 4KO4S 4N0DA 5EJ8A 3P0RA 5D3MB 1XI2A 3ZE1B 1LU9A 5AH0A 3I45A 1PWHA 3V7UA 4YAIA 2IF2A 3THWB 1B8PA 5KHOC 4U7TB 1TU0A 5ALZA 1XPRA 4B9AA 2QDKA 5CYFA 3L1HA 5KMGB 2C3YA 2FWNA 2ZB8A 3DOFA 5DVZA 4INAA 2LNDA 4BLPA 4BMOB 2C5HA 1FVXA 4RD0A 1JH8A 3A1EA 4L0CA 1KEUA 2LXNA 2WV9A 4ED9A 2W6QA 3QKRB 5JFGA 4BO6A 3HVRA 1ISIA 5E3IA 1DJOA 1XELA 4GBMA 3UG6A 4QEDA 4TTTS 2J9ZB 1E8MA 1J1ZA 4OHFA 5KEIA 4ZAGA 2H51A 5AKHA 4IIGA 1EJ2A 5I4BA 3K0CA 4B32A 2RFLA 5A2QA 1H8HD 1YR7A 1KEEB 3PZRA 1PEAA 2VNIA 1VKOA 5EKDA 4EATA 3L5KA 4OHXA 4NMHA 5JMTA 1L1RA 1Q1EA 2CVHA 3LIPA 3FPBA 2VQEB 2MSCB 2P9TA 2W4QA 3AFNA 4XFKA 4C08A 3HDQA 4NCAA 1B93A 3OPMA 5G40A 2TRSB 2XKAA 1QH8A 1YZTA 3FFWA 4FKZA 3STUA 4CW7A 5FUXA 5KOHA 1N2CA 2Y93A 1JWLA 3MJFA 3JQEA 4JYMA 4FEAA 1N6HA 4KIJA 3NHMA 1S2GA 1WM1A 2P1DA 3EEFA 3W9YA 3WLEA 5LQDA 2R7MA 5U9CA 1M1XB 1VLHA 1SHKA 1HL7A 3CT4A 3B1FA 3PGKA 3FYCA 2QXTA 5SYNA 5L9AA 2ZRHA 3SJAA 4MPTA 1T9DA 2I6GA 2B37A 4RXTA 2PAFA 1TIPA 1RI3A 4UQLA 5I9NA 5JJBA 4E0BA 3N6VA 4LQLA 3ZWPA 3PENA 1Z35A 1PTJA 1JR3D 4IUCS 4UTXA 1SXHA 2JLUA 4RESA 1YA8A 1WDLA 4NU5A 4J03A 1UBJS 1CDZA 2QT9A 1UJ4A 1VHJA 3O8DA 4I55B 4MUKA 4YT4A 3PFIA 1JALA 1CQWA 1LA2A 2CCJA 3E5HA 5C5EA 3I0NA 2A88A 3TKYA 2PX4A 1U7HA 1N5DA 2PGLA 2JVJA 5EJMA 4OHCA 1DKNA 1O97C 3HKCA 4OP3A 1JHXA 2O19A 2FRDA 4ENVA 2DZDA 2NSDA 2P69A 1PR9A 5FUQA 1E77A 3NIGB 1C14A 2ZAYA 4A2QA 5IXSA 1C81A 4L8FA 4RWEA 3ZJTA 3V4LA 4RQTA 3AL2A 3THRA 5KWIA 3RIYA 2C00A 4JC5A 5C5CA 2C5LA 2HF7A 1QP7A 4KX3A 1P7VA 2FJUA 3FPFA 2WF8A 1G64A 3L0SA 3OQMA 1YH3A 3L06A 4R54A 1OROA 3H75A 2BPOA 1NQTA 5HJ5A 2PDAA 3L7DA 4GR5A 4QQFA 4Z9BA 5JARA 2RIPA 2NV0A 1K0FA 5H16A 1JVNA 4ZODA 2FPPA 3AJEA 2CHUA 4LSGA 4PINA 1GNPA 4WZBB 4B74A 1K5DA 3PIRA 4GOKA 4OHWA 3I4CA 1Y7PA 1ACMA 3RTEA 4D9GA 2FR1A 3I34X 1EWVA 5CFMA 1GPJA 1TC2A 3AI3A 1FVOA 3MJRA 2C1XA 2PFGA 3RYCB 4P7JA 2C82A 3GUVA 1M2VA 3N2NA 4PLPA 4CM1A 2I2AA 1O4WA 3E7XA 2HREA 3H3XA 2ZB7A 4BO9A 4C6HA 5F33A 4J7UA 4D9IA 4Y2XA 3A6PC 2IZOA 2WJJA 3G89A 4WCFB 3U4GA 3HJFA 4NONA 3EZGA 4D4HA 2PT7A 4MTLA 3EXEA 2Q9UA 2VDQB 4D5EA 3JQ6A 3KJEA 4JLMA 1IZZA 1W36C 5EGSA 1F4LA 1FMLA 4MDYA 3TVDA 3PNMA 4GI2A 2ASEA 4K6CA 3O7WA 5HR5A 1AZWA 3CUSA 3NEJA 5BSHA 2HK6A 2OR3A 4YCJA 1LK5A 2E0IA 4C0WA 2XITA 3VYWA 3QG1A 4V24A 4YHHB 3PIIA 3EAFA 4MEBA 4QUIA 3DWGA 4J9UE 4IIXA 3ZGXA 1GPNA 3VMMA 4Q66C 2EGGA 1QPBA 3UMJA 3KKLA 4W5NA 5C0OE 3FYUA 5GPBA 1OUMA 2CC2A 2ZUUA 1K8XB 1Y9ZA 3RVMA 1PZGA 2W98A 4EYKA 3C2QA 4P5EA 5LMNB 4F8YA 2HT1A 1QGYA 4RHXA 4G0UA 1LQ2A 1J22A 3TM5A 1I9GA 5H59A 3V1LA 4ASUA 2AFHE 3UPTA 1K8RA 2QD3A 1HURA 1XEWX 2PVCA 4U2DA 5HCIA 3RUHA 2VPXA 3RS9A 3X44A 4V0ME 4Y0NA 4DG5A 3FBGA 4OQZA 3W5JA 1U0NA 2YMLA 1NE7A 3HLTA 4ZT6A 5TQ2A 4JWTA 2WUGA 3S70A 3PC8A 2WTNA 3CURA 4MMZB 5FWAA 1B42A 4J7CA 2FQYA 2QRQA 2H8KA 4F9FA 3C6MA 3C24A 1ONBA 2ZBUA 1AKNA 2JNWA 3R0XA 1ECFA 4Q0MA 3LA6A 3E22A 5HFNA 5AKYA 5B1EA 1OH7A 4P7GA 2I62A 1KS2A 3MBOA 3RV3A 1H3FA 2C1ZA 4S1WA 4U6SA 3EF1A 1WPRA 2SKCA 4DVJA 3ZD7A 1YULA 1Z56C 2YZKA 4LEIA 3N2KA 2D5IA 3GGPA 2ZATA 1UAYA 1WLYA 4WD3A 3GOHA 3GEIA 3O84A