4YGYA

Crystal structure of human scp1 bound to trans-proline peptidomimetic ctd phospho-ser5 peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
179
Chain Sequence
QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
total genus 53
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ygyA00
4OD0A 3QUTA 3L0CA 4YCLA 1T5SA 4XE5A 3KDPA 1ZS9A 4Y2UA 3UM9A 2AMYA 5AM4A 3ZWKA 3U26A 3U19A 3HLTA 1Z5GA 1YMQA 5AKGA 4BEVA 2R8XA 1WPGA 5ALMA 2CN1A 3WKBA 3IRUA 1Z4JA 4MWOA 1IWOA 4KNWA 3WK7A 3NRJA 1QH9A 2B8JA 2OM6A 3W5AA 5ALOA 4OFZA 5AKJA 1U7PA 1Z4MA 1ZD4A 3OCVA 3B8EA 4JDPA 5ALTA 3DV9A 2NO4A 4OHFA 3S6JA 5AI4A 1QQ6A 2IA5A 3KZXA 1TJ5A 4ZEVA 3AR5A 2C8LA 4EEKA 3K1ZA 1CQZA 4KX3A 3B9RA 4BX2A 2IOFA 4KX5A 4F71A 3FPBA 3FZQA 2FEAA 2GO7A 2MU1A 4Y2TA 2YMLA 4BYGA 2YMPA 2HCFA 3SD7A 3QGMA 2ZOSA 5A3RA 4KYTA 3FPSA 1RMYA 4H1WA 4I9FA 1PW5A 2AGVA 1TE2A 3FVVA 5A3QA 3CNHA 3KC2A 3IB6A 2FPSA 1EK2A 2B8EA 3EF0A 1J8DA 2MSNA 3E81A 5ALFA 4BNDA 3UMBA 2YJ6A 3WK5A 5IS2A 4L57A 4L6CA 1U02A 2OA0A 3ZVNA 1Q92A 3MN1A 3I6BA 4IFTA 4CF5A 1O03A 3J7TA 2ZBGA 2AH5A 3A3YA 3R4CA 3W5CA 1U7OA 1L7OA 2HF7A 1S2OA 3BA6A 3L5KA 1N9KA 1Z4PX 3KOOA 4OCZA 4F72A 2G80A 2G0AA 2B1RA 1K1EA 3NAMA 4G63A 3HYCA 5AK4A 5ALUA 2WF5A 3OCWA 3WK4A 2B1QA 2YJ5A 3N28A 4YIHA 1Y8AA 5AI8A 1ZD5A 3ET5A 5ALHA 3KD3A 3QUQA 5AK6A 1QQ5A 2PQ0A 5AW0A 4CNQA 1QQ7A 5AW5A 3U7EB 3EPRA 1RQLA 1Z4IA 3R9KA 2BDUA 2JGAA 5AVYA 5ALJA 3CZ4A 3TLMA 4KNVA 5AW7A 5AKIA 1LVHA 3E58A 5AK5A 3W5DA 3QYPA 2W4MA 4NFLA 3ZX4A 2RAVA 3F9RA 5ALXA 4AS3A 2ODAA 3AR4A 4XQ0A 2QYHA 2FI1A 4GIBA 1RC8A 1L7MA 5AW6A 4PNHA 3ESQA 5AHXA 5AW3A 2W11A 5AVSA 4NAVA 2R8ZA 4UM7A 4Y2RA 3VAYA 4XOUA 2G06A 2YMQA 2NYVA 3PCTA 1L8OA 1RLOA 4YCMA 1Z4NA 3L0YA 3WKDA 2R8YA 4Y2JA 1YV9A 4BKMA 2QLTA 5AW4A 3SMVA 3E8MA 1YS9A 2AUTA 1SWWA 4Y3UA 5AKZA 2B30A 3ZWDA 1RKUA 2GFHA 5AM3A 1SU4A 2Q5EA 2RBKA 3N5KA 5AM0A 3WGUA 1ZJJA 4EENA 3A1EA 2HO4A 4J2TA 3ED5A 4HAIA 3QU9A 1WZCA 5A3SA 3QLEA 2IOHA 4BX0A 5AKEA 1L7NA 4JB3A 2HSZA 3L8HA 5ALSA 1MH9A 3OTQA 2R8EA 3L8FA 5ALEA 3ZW7A 1ZRNA 2BY4A 4NV0A 5ALYA 5E0OA 4HGQA 4Y2VA 3ZI4A 2FPUA 3MC1A 2HHLA 5T41A 1CR6A 3L7YA 4C4RA 2X4DA 5ALQA 2OYCA 4CE6A 4XPZA 1AQ6A 1VJ5A 5ALPA 3ET4A 5AM2A 3QU7A 2HEGA 4G9BA 1U2TA 5ALDA 3SKXA 4KN8A 2HX1A 4J03A 4ZEXA 1NF2A 2FUEA 2I33A 5ALKA 4BNDB 1Z4QA 2VKQA 3RFUA 5AI9A 2FPXA 3NALA 5AIBA 5AM1A 1Z5UA 5IT0A 4UU0A 1S8OA 4YIKA 4YH1A 1ZD3A 5AVXA 5ALZA 4AS2A 2C9MA 3I28A 2G08A 4C4SA 3ZVMA 5AKLA 1VFPA 5AKXA 5AVTA 2WFAA 1X42A 2Q4TA 5AW8A 2FUCA 3PDWA 1ZOLA 3BWVA 2EAUA 4UASA 2YFYA 2EARA 1L8LA 3E84A 4EELA 5AVUA 1XP5A 3WKEA 1F5SA 3QU5A 3B9BA 3U7HB 4UMVA 5AK3A 4E88A 2ZG6A 3MMZA 2DQSA 3I76A 5AKYA 5AVVA 5AW2A 3QU4A 2FDRA 1YNSA 2RB5A 2P27A 1VJRA 1YDFA 4UW9A 5AKHA 1JUDA 2P9JA 4B6JA 3OCYA 2O9JA 3SF0A 3M1YA 3N1UA 3SHQA 2WF7A 5AVWA 2OBBA 5AM5A 2WHEA 1Z4LA 1NNLA 2HF2A 1Z4OA 3IJ5A 2ZBDA 2IYEA 2CFTA 4FYPA 4YCNA 3NIWA 3NUQA 4CF4A 2C8KA 3M9LA 1SWVA 4UAUA 5ALLA 3I1YA 5AVQA 2BDEA 3AR9A 1L6RA 1XPJA 1XVIA 4Y2YA 1RMQA 4UARA 3AR3A 2B82A 4FE3A 2EATA 2P69A 3U7GA 2WF9A 3EF1A 2I34A 3DAOA 3P96A 2Q4RA 3SLRA 1WR8A 5IT4A 3W5BA 4GXTA 2D2VA 2GMWA 4O8CA 5AICA 4EX6A 2ZXEA 3L8EA 5AI6A 1T9ZA 2C4NA 2CFSA 3EWIA 2ZBFA 3R09A 4DW8A 2FPWA 2W43A 4Y2XA 2B0CA 1Z4KA 2G09A 3L1VA 3ZX5A 5AVRA 5AI5A 4UM5A 3U7FB 4DWOA 2JAOA 3ONNA 1YJ5A 1U2SA 2YBDA 5AIAA 4CF3A 3QUCA 4I9GA 2I6XA 3RF6A 2FPRA 2RARA 3ZVLA 2G1AA 3OCUA 2WF6A 1RKQA 5FP0A 1RDFA 4QJBA 3DNPA 4UMDA 1RQNA 3WGVA 3N8GA 4DCCA 5ALNA 2HOQA 1TA0A 3PGLA 3ZU6A 2ZBEA 3QNMA 3AR6A 3WK6A 4EX7A 4IG4A 3SKYA 1RLMA 5AW1A 3AR7A 1L7PA 3QX7A 3D6JA 3L1UA 3OCXA 4Y2QA 1LTQA 4HGOA 2YJ3A 3ESRA 1ZD2P 3L8GA 2HDOA 4HGPA 5ALGA 1T5TA 3UMCA 1ZRMA 3MPOA 5ALWA 2IOFK 4NABA 4EZEA 5JJBA 5ALVA 1N8NA 1RRCA 1J97A 2NO5A 1RMTA 3U13A 5AVZA 2YY6A 3WKAA 3ZTYA 4MUMA 2O2XA 3FGOA 3GYGA 1KYTA 2WF8A 4QQFA 4RESA 2YMMA 3KBBA 3DDHA 3ZUPA 2PKEA 3A1DA 2JAUA 2JARA 1RPZA 2I54A 4BX3A 4HGRA 1TJ4A 4C4TA 3NANA 1Z88A 3QXGA 5ALIA 5AW9A 2YJ4A 3WK9A 2GHTA 5AESA 1RKVA 4HYTA 1O08A 2GHQA 2WM8A 2YN4A 2JAWA 1Q91A 4UU1A 3NASA 3QUBA 3UMGA 3ZTWA 4YGYA 4BEWA 2C88A 3L0BA 3AR8A 1NRWA 1RLTA 4UMFA 3PGVA 5AKKA 2G07A 4DFDA 1WVIA 1QYIA 3OPXA 3N07A 2I55A 4UMEA 3OCZA 4Y2SA 4AP9A 1FEZA 5ALRA 4RETA 4UAVA 2HI0A 1TJ3A 2CFRA 4HGNA 3WK8A 3AR2A 3FM9A 2I7DA 3A1CA 3WKCA 2P11A 4BBJA 4ZEWA 4NWIA 2PR7A 4UATA 3QU2A 4L6AA 4Y2PA 4FFDA 1EK1A 5AI0A
chains in the Genus database with same CATH superfamily
4TUYB 2RCYA 4MCJA 4YYZA 5EVJA 5KYWA 4FHEA 4OVKA 4MWSA 5IG2A 1HI9A 2M32A 3TKLA 4N65A 1UMBA 4WNCA 5LUBA 3S1LA 3CUUA 5FOWA 2W6JD 1F8UA 3P5BA 3STUA 2JGKA 2EGHA 3WLMA 4BNHA 5DBOA 4QDOA 4BLQA 2AMLA 4TM8A 4Q4HA 1OHHA 2MSDB 4D46A 3SJUA 1YMQA 3G6WA 3RUIA 2J7PD 2EEPA 5F1PA 5TARA 3HGQA 5B6IA 1MAVA 2W8BA 4QYIB 3IEVA 1ETHA 3K1TA 3IEKA 3K20A 3RBVA 5BYAA 1UANA 3A9WA 1N33B 4IZHA 4RJTA 3AO0B 3MQFA 1D6MA 1W36D 4AG5A 1A4UA 1IHDA 1T43A 2XA1A 1RVV1 2PGAA 1BQ3A 1T9CA 4OI4A 3GEHA 5BOVA 3VZPA 3KHTA 4GSYA 2O1XA 3CLUC 4CR7A 5CDFE 3BK2A 4COKA 5CDSA 5JDIA 2B34A 3USZA 1D7OA 3LQYA 2ODNA 3AEQA 1M6VB 4PZUA 1E9RA 1ODSA 1RT9A 2M6LA 4LHXA 4X63A 2MR6A 1DKOA 1V8ZA 2XGOA 3LCCA 1U90A 2EBUA 2O05A 4IIDA 1RTKA 3GY0A 2R84A 3CVWA 3EPJA 4RANA 1T9KA 4TT8A 3S44A 5KYXA 3D43A 1N57A 1FUKA 2Y9MB 3CY6A 4LRSB 4N12A 1QQTA 2WU3A 4OXKA 3WLIA 2YFKA 2FDXA 3E5HA 1UAYA 4B1FA 1RHMA 2B3DA 4I4CA 3D2CA 1N5MA 4LJ5A 4LV8B 3VPXA 4EDHA 3AERB 4HWKA 3VVMA 3HCPA 3MBOA 1TQ4A 2IVFA 2P8JA 3NCHA 3QHPA 5HEKA 3U9SA 2QK4A 3IAAA 1FXWF 1ULBA 4UCWA 3MJRA 1X8JA 4KB5A 4M38A 2FEAA 4C9BA 4YECA 2FNAA 3REQB 1B6GA 2GLUA 1VE1A 1DKPA 3DHEA 1KJNA 2AFIE 1CHNA 2CNKA 2MSCB 2VO1A 4J0EA 3USCS 2WWRA 4TWJA 2FMIA 3EJ6A 4WK2B 2J7KA 2Y99A 3ELDA 3LC7O 4HFNA 4S04A 4RE5A 3B20A 1CQWA 2R8OA 1CFJA 5FQOA 2ZI3A 2OXTA 1NW7A 4DWVA 4UFNA 3CO0S 4QBIA 4AQ7A 3B6MA 3QE9Y 2JHCA 1ZJYA 2JL1A 4O29A 1JTEA 4GWLA 2NP7A 3C85A 1TM4E 3W5HA 3D6TB 5B2EA 4ZTUB 5J58A 1I3CA 4GMFA 3U39A 2QMEA 1PQWA 4PXSA 2PJZA 3MZ0A 1ADBA 4U2CA 1F8GA 2BGTA 5HWSA 3N8DA 3RH0A 2BMWA 3R4CA 4DRXB 4TMKA 4HVTA 2C3MA 3BG5A 3QBVA 4JIMA 1VL5A 3BA6A 4D9FA 2EP8A 5JISA 3LFUA 2GASA 3T5CA 4MO2A 4BRZA 1XRNA 1N5JA 2LTAA 4R0VA 1WETA 1AXEA 1N1DA 1SQSA 2N1BA 4FHFA 5CUQA 5CX1B 5AJHA 3SBDA 1UWLA 5EPUA 4X61A 5LL6P 2IH5A 2CDBA 3AZOA 3DVQX 1BG6A 3QEJA 5C4IA 3X2SA 2YKGA 4ZVTA 4UPDA 3K2EA 4YXWA 2I71A 2O48X 1ESZA 5AVKA 3GLQA 1CE8A 2YJ5A 5TT1A 4UBLA 1A2BA 3CG4A 3OLWA 4I8XA 4IWYA 3PRHA 5FB3A 4KWCA 4WCFB 3IKJA 3TKAA 5FXMA 4S05A 1E9AA 2I8AA 3D3WB 1B6SA 3FI0A 1CIJA 3KQUA 4KG7A 3R7WA 3WRYC 1ZZGA 4DJTA 4ZFNA 3ZDQA 2GM4A 3Q98A 1VLMA 4IX1A 3O1LA 4L78A 4RW0A 4UOQA 5GWXA 4EGAA 2Z6AA 3U7JA 1L7AA 3O26A 3IIJA 1KFKB 4NK4A 5LCXA 4P32A 2WJHA 1J24A 3FTNA 3O3MB 4YJGA 4BDTA 3BERA 2B8TA 2RONA 2HUPA 3FMIA 4QXQA 1Q1EA 4DSAA 4GP9A 1YZHA 3OCJA 4N9QA 4DR3B 4JYCA 1DWOA 3K2BA 3CR8A 3PBKA 1UDXA 5IT5A 1UINA 1UKVY 2TYSB 4R2MA 4P3OA 3B52X 3HVRA 3H1EA 3GAFA 2J6IA 1SVUA 2O1WA 2ZWIA 4ZALA 5GINE 1AKQA 2PXAA 5FBZA 1ZDMA 4J75A 1K8ZB 2OFFA 1WQ4A 2BGNA 5AVSA 4R2XA 1O77A 1ZK1A 1IH8A 2W2XA 2OVFA 2QUHA 5HTKA 6LDHA 1RHQA 3TUIC 5JTUA 1GQOA 3BSYA 1J0DA 1JZSA 1MEOA 4P22A 4RGQA 3VHLB 4MCHA 3MT7A 4RH1A 1TFUA 2VFAA 4AY3A 3INNA 1JU3A 1VKNA 2IYZA 2V5VA 4R9NA 4J3NA 2BM8A 4D74A 3RK1A 1OZFA 2H3HA 1A2QA 1TEVA 5HF8A 1A3CA 1SXHA 1Z4NA 4HZUB 3ZLVA 1PS8A 2IS4A 1KZHA 4JGBA 4H35A 5KWSA 2FLVA 2JB9A 2R11A 4M4SA 1LLQA 1T4BA 1D09A 4NPHA 4EHDA 3O7MA 5AKZA 3X1YA 1RKUA 2L17A 4XIIA 1JJIA 2C31A 3UW3A 2IYLD 4JITA 1O9HA 1QHNA 3K9NA 4URZR 1CPYA 3MGKA 1QR6A 4UM8B 2O57A 2E82A 1PF7E 2V7VA 3NHFA 3PD0A 2H7VA 1L8XA 4DLSA 4B8WA 3UFBA 4FHZA 4LQCA 2O5RA 4HNUA 5GZ3A 4C2TA 2IDMA 2P6MA 4O4HF 4Z5XA 1PT5A 3VHRA 1Z0IA 5F9FA 1N32B 5JATA 2H48A 3JQ8A 2F1JA 5K8IA 3R7WB 3THXB 3U4IA 3NNDA 1R0LA 2BEWA 4OM8A 5ALEA 4WN9A 4L4ZA 2EC5A 4J7CA 3NHWA 5BSRA 2QL6A 4WNYA 3E1KA 3F49S 3H5RA 4M1KA 1OREA 1U0JA 3O1IC 2CWWA 4HYEA 4JFRA 4CV1A 5CHYA 2I7VA 5LQCA 1O96A 2BUBA 3Q4GA 2ZUCA 3LLSA 2R1ZA 1IXSB 2AA3A 4HQOA 3UMMA 2DERA 5CX4A 3AUAA 2DKOA 2JCVA 3ZN2A 4CFZA 2IS2A 3OAAD 4TZKA 2Y1GA 5JWOA 2GBPA 3TN7A 4MIKA 4X1YA 3I58A 2NUAA 5F2KA 1OB5A 4KMSA 1EM8B 3AG6A 5HKKA 1KJZA 3QU7A 3KB8A 4RMJA 2ZWVA 3IURA 2K7FA 4HRXA 1OWLA 1THMA 2JLXA 1LEHA 1ILWA 2HM7A 1IQUA 4WOKA 1G18A 3B1JA 3R3HA 4TTIA 4X3OA 1AUVA 2G1JA 3VPDA 1KI2A 5CFQA 1E1QA 4NOJA 4H1UA 1GR0A 2G1UA 1XXHB 1IMOA 4TMFA 3VHQA 4LV6A 3VR6H 3KJIA 2PGNA 5IT0A 2JZOA 4EW6A 1BH6A 2IF0A 1FFYA 1Y8RB 1P1CA 1R0XA 2C2BA 1NVTA 1GIAA 4RA9A 2P6NA 3GI1A 2CNBA 2UZ0A 3G5UA 2MHCA 4HN2A 1VDZA 2C9MA 5ALZA 1A27A 1HQDA 3KL4A 1YB5A 4Q3OA 5C3UA 3G5AA 1YHZA 2HD4A 1SHKA 3HI4A 1JHQA 2HA2A 2VJPA 4KJXA 4M0DA 5EZYA 3CVXA 2C7QA 4KSYA 3G0IA 4MV5A 1BDIA 3MT8A 3QKSB 4BIMA 1JPNA 1Z2OX 1X7YA 1WW3A 2EARA 3K8ZA 4IQ4A 2VDNB 4MW6A 3HE3A 5FD8A 1E61A 1L1FA 5A9RA 5JARA 1JAZA 1PV4A 3FTFA 4JLJA 1XP5A 3OUTA 3WAKA 5JAIA 3FROA 3SFZA 4KXVA 3T99A 1O3YA 2FX2A 1KBZA 3C98A 1JB9A 3HQ4O 2X8BA 2R25B 3NFYA 4IWNA 5J5CA 5T4FA 4EJSB 5AK3A 1KK0A 2ICAA 3L49A 1RI2A 3CNLA 3GZNA 3JQ9C 3MMZA 4FXPA 3B3GA 5EKXA 3TZKA 5EJ6A 1Z6GA 3CT6A 2AZXA 4G0XA 1XJ5A 1ENYA 2OCBA 4E09A 5AVJA 9MHTA 5AQ1A 1QC5A 5KYVA 2KMLA 1D2HA 5F4BA 3CNQS 2PLWA 2JVKA 2O8VA 2QOEA 1TF5A 1QAQA 2B36A 3BJEA 4G24A 4GD3Q 4MGYR 4WHMA 1UMKA 2W70A 3SDBA 4BAUA 1T2NA 2CD7A 3ACCA 2WF7A 2DH5A 4AUMA 1D8AA 2VTEA 5ESRA 1MMFB 5ECDA 2OZKA 4FQ7A 4G4SP 2MSEB 1A8UA 1Z4OA 3QVWA 1E2NA 2ZBDA 2EP7A 4P38A 4MUXA 4YCNA 1AVTA 3IBTA 1FSGA 4UE6A 4P3XA 1I9CA 5G1OA 3RARA 4F60A 5CA0F 3I9V1 3SC6A 4UAUA 1D8TA 4BVFA 4YMLA 4RPKA 2ZDQA 4MPRA 3DC7A 2Y8EA 3K6JA 1EM8A 1RWBA 5ICSA 1IBSA 1BCSB 4M87A 2Q1UA 1RMQA 3GJSA 3LPNA 3PDIA 3UF0A 4KREA 3UAVA 4EMBA 3OA2A 3ZY3A 4LXUA 3W04A 1YONA 3QLTA 1JIJA 3GFFA 4MW0A 3KAKA 3O3CA 4HDCA 3RIHA 3RGWS 2HWUA 4QUIA 4KN5A 4KPGA 3UJBA 3F7OA 4UBOA 3ZVKA 1H8ED 3W5IA 1M2NA 2SCUB 2ZE8A 5HUHA 5LBTA 1B8PA 3FDXA 1BWSA 1HNXB 2NYAA 3ROFA 1I7SB 3D1VA 2YOGA 1I32A 2M9MA 4CM9D 1IU9A 2H07A 5A0VA 5L3VA 1KI6A 3V5NA 4PG6A 5KTSA 1BROA 3W1EA 4DCPA 3OY7A 3QKSA 4G4GA 4KPFC 2AFVA 1STOA 3SHOA 1J2RA 3UUGA 4LKRA 2PCJA 4L3VA 5KKNB 1P4RA 3FG9A 1Y6GA 2B4QA 2R85A 3BE6A 3EXG2 3H9EO 1SGWA 3EGVA 3LDUA 4JVLA 3S81A 2CLCX 4NJMB 3UPTA 1DGQA 4ZYXA 3TPCA 3TOZA 4PZZA 1T8TA 4J9UE 3TLZA 3JQ9A 2AN1A 3HCNA 2PKCA 3EA5A 4CUZA 1EG7A 1TT7A 5DWQA 4BO7A 2H2IA 3E23A 3A1SA 2GF2A 4DMLA 1X2BA 2O2HA 4ZAFA 1QVZA 4UEKA 4B3IA 1T1EA 3JD4A 2YN0A 3F5DA 4O2RA 2NWQA 1YZYA 3WGVA 5JQWA 1PR4A 1DDIA 1OPRA 2V7QA 1P0QA 3Q0IA 4ZREA 2IY9A 3DXXA 2RC5A 1G59A 2J6HA 5JRDS 2PUGA 2VHJA 5JCXA 4F4FA 4RZSA 4K9OA 1B41A 1YFKA 5TV2A 1FFEA 4OSOA 2XVAA 1X1SA 2A30A 2B7BA 2I67A 3AR7A 4ND7A 1REQB 3WZLA 1V11B 2ZYWX 1HA3A 3GQBA 2B3TA 4MVJA 1UWCA 4DY6A 1MO5A 1JPJA 3K09C 1S8AA 3AL2A 4LY6A 3OPNA 1U3DA 3B60A 3DOCA 3QFFA 4RKEA 3VKGA 3K4QA 5JC1A 4BFXA 4OQZA 3UMCA 4FOTA 1MX1A 4GYYA 5D87A 3W2GA 1PAUA 2IOFK 3GUCA 4TKVB 2QAJA 3JQFC 5I9MA 4FFSA 3ZWBA 4YMGA 3RC2A 3RKUA 2FLKA 2MYTA 1GGEA 1F9AA 1QFMA 2D0OB 1C9DB 3EGCA 1MIOA 3T3DA 3SC2B 3U13A 5H3HA 4OV6B 5J5AA 1PNVA 2QBYB 3PEYA 2V9PA 4QQFA 1H05A 3SZMA 3S2YA 1PCXA 1OX4B 1QYDA 2VTKA 3AWDA 4L2IB 2R2GA 4DJDC 3BL8A 3ZKWB 3ZGLA 4YRDA 4W8HA 5IDWA 2ZCUA 1GPLA 1F3OA 1YMVA 2ILTA 3QVSA 1RCUA 1YDWA 2CFIA 4JYBA 5JD6A 4LS3A 6REQB 3AYZB 4KHZA 1HLDA 1YQGA 2BFEA 4IDFA 4KAAA 4XDHA 1G8SA 2ZJ0A 3QXGA 4RKQA 3F78A 3M82A 2B5VA 3T3NA 1PVOA 3AKYA 3E9YA 4FYXA 4QJIA 1BVHA 4LDPA 3MTIA 5CITA 5JAQA 3C16C 3EAQA 4D9EA 3O0TA 5IC4A 3FNRA 1R50A 4V3CA 6GPBA 2W58A 3CX7A 4Q66C 4E1VA 4EB8A 5JW6A 5HCNA 1LJ8A 3QUBA 1J8FA 4NJMA 4OHZA 3UMGA 4DWWA 1M10A 3BZBA 5TSDA 4YROA 2QSYA 3AUKA 1MA3A 2R62A 3PPXA 2E7ZA 5IVKA 3QIVA 4QBFA 4GEKA 4FE4A 4AZVA 1QGED 1TRHA 3GO4A 4NS4A 4Q15A 3N0WA 1BHQ1 4KW7A 5FNZA 4L9WA 3D4IA 1O95C 1QH0A 4KO2S 1MO6A 4OB6A 2XAAA 4CIWA 5DXFA 2B4RO 1DI0A 4EA7A 5C9ZA 5B5SA 5KNDA 1NPDA 3HSSA 1IZ0A 2OL4A 4ETIA 3WO1A 5TPZD 1HYHA 1BWRA 2VYVA 2FQ1A 3TG8A 4HDKB 4X45A 1AE1A 3JAMA 3PFCA 4KI7A 1NKTA 4NOMA 1LTHR 3BFXA 4CUJA 4J7UA 2QTCA 2X2EA 2FMFA 4OHRA 4KOAA 3OHPA 4EUKA 2BEJA 4HWRA 1QP7A 3QELB 3ZD7A 5COBA 1IBRA 2VP6A 1DZIA 3NBMA 4EHJA 2O2JA 1RFGE 1MFPA 3ND9A 3T4XA 3UNXA 2M6SA 4YRKA 2X8JA 4TL7A 5FWAA 1IPFA 3ZZMA 4WXYB 3UJ7A 3GRPA 3Q7TA 3BIWA 3AFOA 2H11A 5I5EA 2G88A 5JZMA 2HH9A 4GKVA 1Q12A 1S9HA 1TUBA 3HCRA 1ZD1A 1U4SA 1Z34A 5DJ5A 5HJ2A 3EPHA 4ED9A 4RLHA 1T4DA 2QD3A 3PWKA 3ZDEA 3MFYA 4C87A 5TR9A 5AJTA 5L7TA 3EC7A 4EY4A 1W2WB 3OOWA 4D96A 4JSRA 2JJ1D 1ZMXA 4QODA 4AXBA 1NW9B 4DQLA 2DXIA 4GZ3A 3AEUB 1ZM3A 1NUTA 3L0OA 3WRXA 4DLBA 4GPZA 2I5PO 1GRNA 5J40A 3DWFA 3NB0A 3DVSX 2QY6A 4H3VA 4DAEA 3F5FA 1JKMA 1SCUA 1J20A 2A86A 2RI0A 5BN1A 3C1AA 1M1ZA 4D6YA 1N1GA 1JEEA 1Z3CA 3FCEA 4I4LA 1EU1A 1GPWB 3ETGA 5JWHA 3PNOA 4EYGA 1CUWA 5DHRA 3KT8A 2E4ZA 3AM1A 2IIBA 3O74A 4JQZA 4DQUA 1W0JA 2UZ1A 5J2TF 2G6BA 3MCVA 4LDNA 3QNWA 4HH3C 2REQB 1FQJA 1GHTA 4TQ9A 1PR3A 1E2QA 1YRYE 2VRCD 3C0KA 1Y5MA 3NHBA 3T1NA 3UANA 2F8TA 1A72A 2H5EA 4ARSA 1Z75A 1W47A 3AV0B 4FFWA 2PD6A 4XVUA 1VB3A 3EF3A 2DHRA 5EZ5A 4ZJYA 3AUXA 4C5AA 2E85A 4H3SA 4DMMA 1DX9A 5B64A 4PW0A 2VP4A 2XKKA 4KYTA 5DWVA 1EWQA 1H0RA 1D6NA 3MIZA 5K3SA 2HIGA 4DDVA 2ZK7A 1ECFA 5E3HA 4I6EA 1VHLA 3OT5A 3WLLA 5EJ4A 5MN4A 1ZHOA 5AXDA 4UOEA 2OBXA 3KELA 2E6UX 2A5YB 3KUDA 2F3PA 3L7LA 1NULA 3LHDA 2PZKA 3OJLA 3OZUA 3ZH9B 1YF3A 1E2GA 4YHHB 4E3WA 1AS3A 1ZH4A 2WU0A 4K3VA 3CT4A 3QELA 1L1EA 1PWYE 1DG9A 1GYPA 1SKAA 2FK7A 4HTFB 3UK7A 1XKTA 4FWTA 4PQYA 2QTNA 4YUXA 4KQJA 2I6QA 4E03A 3VJKA 1OT5A 4YBZA 3SQLA 2WWIA 4M0UA 4OGLA 3OQOA 3WMWA 3K1AA 3D8TA 4L9RA 2ZVJA 2AH5A 1YKSA 5ADWA 3D54D 2Q62A 1UCFA 4M7WA 3P19A 4E13A 4PCVA 5JLJA 1H0KA 2Z6QA 1C5KA 1W4RA 3OIDA 4OG2A 2ODWA 3WV5A 2Q0XA 1MX9A 5EGSA 4MA5A 4PS0A 1OLUA 4FMBB 3ROXA 5K3CA 4JV5B 1R8QA 4UAGA 3EY9A 1KU0A 4KLCA 3UK0A 3OU7A 1GCOA 1O2DA 3P71T 3WRXC 1JIKA 4DY4A 1TIKA 5DCLA 4I9NA 4IYRA 5GOTA 3CN9A 3NZEA 5IARA 3WL7A 4B85A 5JRZA 2ZB4A 2FG7C 4IOKA 1YRLA 3RIXA 1S8FA 3EB9A 3AJDA 3IBGA 3QOYA 3HKBB 4FW9A 1SIUA 2FQXA 2DX7A 3LYLA 4EA8A 4MPJA 3IQWA 2CDCA 4NPAA 3AT1A 1UPUA 1JQ5A 4ENPA 3E70C 1O0BA 2CSUA 3NHSA 3AW8A 2A1UA 1YBVA 4LC1A 2XCLA 4JUCA 1OC2A 3ZGOA 3CZ4A 1T4GA 4C6HA 1RAEA 3BWCA 4WGFA 3A9CA 1EFAA 2JJ2A 3IJEB 1XMOB 4TT3D 5IDYA 4YXWD 1N77A 4BVGA 4Z3DA 3RS9A 2DFNA 2V7PA 5DXJA 1TM2A 4XEUA 1V71A 3NIFB 4LWZA 3NC1C 4F2WA 1M2EA 3KJNA 4MA4A 4QTUB 2FI1A 2K2QB 1EAYA 4YRFA 5DBFA 4GIBA 4Q02A 1ABEA 1BFKA 2QN7A 2ARKA 2O7RA 2OXRA 3JQ7A 5HX7A 5I47A 1LLDA 4JXZA 5BOSB 2OV4A 3TGWA 3PXUA 4F2DA 4R2WA 2OCLA 3HCEA 3A9UA 3GNTA 2VUTA 4ZWNA 4FXOA 3VH2A 3RJ5A 1KQGA 5ED0A 4AQYB 3UJCA 2C96A 4LE2A 3SBOA 4Q9AA 1ZSNA 2EX4A 2NYVA 3R9XA 4UCFA 2IZ1A 3EY4A 3IOYA 5CDTA 1EP9A 4PNPA 1BH2A 4P35A 4WKGA 5JCPA 4RF4A 4OFBA 3DHNA 4X7BA 3BGDA 8AT1A 5H8WA 2YJNA 2G67A 1P6QA 2QLTA 1W88A 4HN9A 1ADGA 2PZJA 1XO1A 3CX8A 3SMVA 2JGFA 1ND6A 1Q11A 2FR8A 3SF8A 2BEUB 4QLBA 4ZIRB 3L5OA 4QPCA 3UHOA 4D3FA 5BR7A 3TOVA 3TSYA 2OFPA 3L4BA 2PE5A 1MQAA 1WBJB 4L3WA 1N2EA 3A2NA 1ZH6A 2Y1LA 5EJGA 5EIOA 1GQYA 2Q5EA 2VZ8A 4Q4LA 3SI7A 3X1MA 3EVDA 4EENA 3VOBA 1CY7A 5LIRA 5ELXA 1ZGCA 2LP4Y 1S3IA 1VHJA 3BCSA 2Y6UA 3N0RA 4J2TA 4XYMA 5GIPE 3PVZA 4JMLA 1QH1A 1BCRA 2J3IA 1MRNA 2H2GA 2ZJOA 1QV9A 3QLEA 4QYWA 4BX0A 4C3VA 4HRYA 4DLRA 1CVLA 4LK2A 3SQNA 4ZHSA 1P2DA 1KMNA 3LD9A 4G0VA 1N7IA 1RRKA 1ZK4A 3BPSA 1Q0RA 1BJKA 1BMTA 2XPCA 5LDDC 2NOAA 4IGIA 4DLXA 2LKDA 1T9BA 3LX6A 3RJZA 3K09A 3PR2B 3W90A 5BN5B 1XDSA 4UVEA 3WLHA 1WDWB 2VYVD 3E53A 4R1TA 5DBGA 5A6SA 2C29D 3UV6A 2N0SA 3H1BA 3BTSA 4AMVA 4IJKA 3P2EA 2X0FA 2VDUE 3JQFA 4O6VA 1I2BA 4X8MA 5IYZB 1A5TA 1JEAA 2Q6TA 4B6PA 2P9EA 4P36A 4X20B 1CX9B 1SZJG 3P9ZA 4QELA 4NMMA 3L6CA 3EODA 2JBHA 4G9BA 4XGRA 3SKXA 1L2TA 2ZSJA 1ZAYA 3DOIA 2OZLA 2RJ3A 2ZSDA 1QNFA 4MR9A 5AHOA 1F2DA 1TQ6A 4MDEA 2OCYC 5SYNA 3AVVA 2ZQZA 3IDAA 3A6FA 4KQIA 2NU7B 1FTYA 1DB3A 1Q1NA 3RTGA 1U9IC 4Y9TA 5HVNA 4P4LA 5LWQA 2P1ZA 3MHPA 1XEAA 1Q1AA 3NEYA 3K9FC 2WVHA 3EZ2A 1Y6JA 1XJ0A 1QIFA 1WV1A 1N2SA 1R6DA 3PA6A 4TMVA 3VZRA 1TVKB 3HSYA 3LCJA 5JEDA 3AY6A 5HZGA 1WMEA 2FW9A 4Y2HA 5SZJA 1Z5PA 2G9NA 5A1JA 2WFAA 2EFDB 4FQ5A 2E55A 5K3DA 1SVLA 5EMJA 1QVRA 2PKXA 1ZOLA 2QT0A 2ZJ4A 2I2FA 5EESA 2YYYA 4CQLB 6PFKA 3AHCA 1BEUB 4OXQA 1FOEB 3ES9A 4JBXA 4KLNA 4BGIA 4IH1A 1E66A 1QF9A 1QLHA 3NMUF 4YP5A 5HMMA 3NHUA 3U81A 3K8OE 1EJBA 3LHSA 2OILA 2ZRMA 3LA6A 3V4OA 1VE7A 4FT2A 4Y9UA 3O83A 4YRQA 3BIJA 3THOA 1TJNA 2YICA 1DZ3A 3RTCA 1EXVA 3QU4A 1OVMA 2NVBA 3RBXA 3L18A 4Q37A 1N0HA 3A7DA 2Z8ZA 1YU9A 4B5LA 4ZGBA 2A6PA 3EVFA 4HAVA 1HNNA 1JUDA 4PYKA 2VQ3A 3TM4A 1N8SA 1T3GA 4Z3OA 5FOVA 1VYTA 2OBFA 1XRSB 3ZYCA 1QO7A 4TV9B 3DXZA 1ZICA 3SF0A 4D80A 4HWTA 2G4CA 1JHUA 2HHHB 2QRJA 2P9HA 3PTLA 4UZEA 3EG9B 2X2PA 2WILA 3LWNA 3EVBA 4IV8A 4MQLA 4ERXA 2ZR8A 3MJTA 4KQEA 1IPHA 5B3LA 5LC1A 1YE3A 1VSVA 3PR1A 4P6VF 1LDEA 5EKDA 4QVIA 1U2GC 1BGVA 1JIIA 4GP7A 4OLHA 4NEQA 3OWOA 1UJ4A 4DRYA 1L7EA 2ZEJA 2FW7A 4P4GA 3JQGB 4QXPA 2O0JA 2V59A 3G59A 1FMTA 1RP7A 1L5WA 1WCYA 4FFLA 3RIGA 4RD4A 3VSAA 3WIDA 2GK3A 4JVNA 4A10A 3F8WA 1FY2A 1QOZA 5BY2A 4OIFA 2J9GA 3SX4A 4UNPA 2A7QA 2PZBA 1MGOA 4OXYA 4ZVVA 3UK2A 5CJJA 1FXSA 3W5BA 2QTLA 5AICA 3LPAA 4F06A 2RBGA 2SKDA 1Q77A 3N6RA 4L4SA 3T9EA 2Q50A 2F3UA 3ND7A 1DX6A 3IUMA 4IVPA 3KOXA 4TS9A 2O06A 4R71A 3V1TC 1Y6FA 1IYZA 1IQPA 4MV4A 1IBCA 3IAS1 4EUHA 2ZYAA 3O8OB 1SKUA 3RYIB 3ZX5A 1T2AA 3DPUA 3GPIA 4FX2A 3B7PA 1LDNA 5ISMA 3P94A 4RHUA 1GDDA 4ESEA 1XZFA 2G5CA 2EFGA 4DWOA 1V16B 3ZU2A 3KVRA 1PTJC 4ZAYA 4ZICA 2XMPA 1YZUA 4ARZB 4HLUC 4KR9A 4HQRA 2AG5A 1BRTA 4CWAA 3PHBE 2BSQA 3JQAB 4RBNA 1XLVA 3LLCA 3LX5A 4DXHA 2EIXA 1KA9H 2GTPA 3R40A 1BXGB 2XEXA 4KV7A 1ST2A 2CBZA 3CNBA 2I22A 4G0QA 3HDYA 2UUCB 3DOHA 4W63A 1B0AA 4RTNA 1PIWA 4FPXA 2JLQA 4JBWA 2CMDA 4X24A 5B7NA 3SZRA 4FGLA 4S0ZA 3B13B 4PC6A 4KCGA 5I7FA 1T8UA 4KQKA 5EZQA 1PSDA 5C3MA 2XSZA 5A0FA 3IV6A 1Y7IA 1T8PA 2G63A 4N5HX 3ZCUA 4N18A 1ACLA 1X38A 4GWGA 5ALNA 1P9LA 4PPGA 1XD8A 2AFIA 5DNCA 8ATCA 2Z95A 2ZJ7A 3Q6MA 4LMPA 4PGFA 4DOMA 2XYPA 1X7ZA 2ZI9A 2XRZA 2IUEA 3SKYA 1I7LA 1RLMA 1T2FA 4WE3A 1DL5A 2JLRA 5I6DA 4C0AC 2R87A 2V3VA 1M0SA 1U2GA 4JNCA 4HGOA 2YJ3A 4K0RA 4MH0R 5ER9A 5ALGA 1SB9A 4FN4A 3JQBC 2AOTA 1ZW6A 3IV7A 6ADHA 4LZWA 1F06A 1Q3KA 4NABA 4NICA 1U6KA 1E32A 4AVYA 4D43A 1E9FA 3O1HB 1WKBA 1RMTA 2C4HA 2NMVA 3EOBI 4LSMA 2MMGA 2IU4A 2QUZA 1MUUA 1E3IA 2XIQA 2V9ZA 2ECKA 2M6KA 3TDMA 4C7JA 3A25A 1BE1A 1G1MA 3F6EX 4NEHB 4ZYZA 1T5BA 4GL4A 1V3UA 2VDPB 3MGCA 1FMJA 4TLMB 4WFQA 1ANKA 5DGCA 5THXA 1DFHA 2PX4A 1W94A 3GEDA 1ZNXA 3NYRA 3V8RA 4FWBA 3IMKA 2CJXA 3ELWA 2BWJA 3KT3A 5ERGB 2I54A 3A4YA 1FFAA 1OBVA 3P9KA 4MP8A 4HGRA 1TJ4A 3H9GA 4N6OA 5DM4A 3NANA 3DFZA 2W6ZA 2X15A 3O8OA 3V97A 4OSEA 4YAEA 5PGMA 1D1PA 4RACA 2FN8A 4O4IF 4INOA 4QATA 2DR2A 1JG6A 2WHPB 4DV3B 4CLHA 1ZI6A 1ZLYA 4HLUA 5JI3E 4KDRA 1I2MA 3NONA 5K4GA 3BTUA 2FG5A 2IPOA 1OXSC 1VJCA 1C3EA 2XMQA 2OQVA 4AU1A 3RSCA 3VR3A 3JQAA 4NYIQ 3ANLA 3BIOA 3SOZA 1ZOOA 4EARA 5B7PA 4A36A 1N2CA 3F7TA 5CU7A 1FVOA 1SMKA 1DIAA 2WHRA 1YVPA 2C88A 2BGKA 3AR8A 3T41A 1NRWA 3L1KA 4YJFB 3QBEA 1DE0A 1BMFA 4YFYA 3BMOB 3T5PA 4GOOD 2OK7A 1ZGZA 3JRNA 3GDOA 1D2EA 3JATA 4KC0A 1A7JA 2DY0A 2QVYX 1D03A 5HA5A 4AP9A 1CJSA 4NCXA 5DYGA 2CWDA 3HG7A 3U3RA 4XCQA 5IN5A 2C2HA 1GT91 3DJYA 2CFRA 4J3JA 2I66A 3ASUA 4KQ2A 5F5NA 2AR7A 2JEYA 3LBHA 3RVSA 1NLUA 3U0VA 2C04A 4DHWA 3T3OA 4BBJA 4TQUS 3QJGA 3LECA 3N0VA 1VMKA 4O4HB 3T0IA 1L5GB 1EK1A 5ICCA 3AKEA 4MB6A 4C2UA 4PHFA 2CL5A 3ZGYA 3CUVA 4CNBA 1QP4A 2FQWA 3KSMA 4ANFA 2HBZA 4BQEA 4D9HA 3KPYA 4DLVA 5JHGB 1ETUA 3I4FA 4R7ZA 4BFTA 2WAYA 1YB2A 4OHXA 3FX2A 3ELUA 4A92A 4BFLA 1ACJA 4E70A 1NJ8A 1SXIA 1TLTA 4QTTB 2X1HA 3RHSA 2X5JO 1QGAA 3A9RA 4Y2UA 4O63O 3IVAA 1SA0A 4BJHB 5DGDA 2I6UA 2VK8A 3BCHA 4E21A 5EJ7A 1SHUX 2VPZA 2XBUA 4HBZA 2IZ0A 2PQMA 3A28A 4X7RA 4PYRA 3NEAA 3DFUA 5MN6A 3HDGA 1KS2A 1IBLB 3LW8A 4QTYA 1OH7A 1MXFA 4REQA 3FLAA 4PHCA 4KUHA 1N9ZA 1PFVA 2HHJA 2YXDA 4O2AA 2NVUB 3ZBPA 1Q7TA 3ZQKA 3QVJA 2YRXA 2FX5A 4G56A 4NCAA 1XN1A 1YQDA 1G5HA 1TJPB 5FPSA 1R10A 5K8JB 4X65B 1NVVQ 4O5OA 1U3TA 5IKOA 2D4HA 3OCVA 5CFPA 2GD0A 1U3CA 5A5GA 1GL3A 2O2SA 4MS1A 4MHTA 1KJWA 4MVJF 5DBIA 3TTUA 4DEXA 4EITA 2I6FA 1YL7A 3DKVA 2VSNA 3FZNA 2HQRA 5KYUA 5E38A 4RVSA 2X5OA 5JWRA 5D84A 4WT7A 4K86A 3KZXA 3TOCA 4NATA 3BRCA 5CJPA 5LB2A 5KWVA 4N6GA 1IY1A 4IYJA 4DDWA 5HQTA 2BEWB 2I7CA 1EXNA 1SXJA 2QF7A 1ECPA 4GC5A 2GEFA 1N9GA 2Q9AA 4I19A 4U39A 4OXIA 2CK3A 1H2YA 2OHFA 5JASA 4EI9A 1L5NA 1IMJA 3EC1A 3IT2A 1KKUA 2NTYC 3NOVA 3HMKA 4KEAA 5FYQA 3VX4A 3UWKA 3CPJB 3R41A 3LBNA 2CCKA 2V0CA 4V0NA 2UAGA 3VC2A 2VKTA 4RK1A 2N47A 1RRVA 2VHTA 4ZOAA 3LC1O 5FF9A 3NXSA 5IMBA 4ZMBA 1C7QA 5A5EA 2WSMA 1WZUA 3TAUA 1U3VA 1K5GA 2BL4A 2PQ2A 5E6RA 3QTLA 2C5HA 3AY0A 4MYSA 1Q83A 2CLHB 2H1IA 4L75A 1BW9A 4O4JF 1N3LA 4H6XA 3WK5A 1N6HA 3O95A 4MMXB 3LG2A 4G8JA 2VDVE 1IXZA 1W9MA 3DV0A 3RWOA 5BR8B 5JNTA 1N2CE 1L3CA 2E0IA 5KYKA 3OZRA 5C37A 1W4BA 3PENA 1L7OA 1X8XA 1DKLA 3WLSA 1W8IA 4MRRA 1X1QA 3U3DA 3O90A 5CPFA 1YJQA 1Z4PX 4O4JA 1TCCA 3NW9A 2AQHA 4HB3A 1KYYA 4FC7A 2Q41A 2ZUEA 1YCGA 1T0HB 4ND4A 3UBTA 3GVXA 5IRCD 3AW9A 1CJKC 1K1EA 3OCCA 4D0NA 2DE0X 3GLFA 4PWYA 3EN0A 3T5AA 4B3GA 3RVKA 4WPGA 1U0LA 1R88A 3JD2A 4FGZA 3T7DA 1AHPA 4BV2A 4E12A 4DQDA 1E64A 2A9VA 4GUAA 5JAUA 4WBXC 4Y6RA 5ALHA 3QQ5A 5BW4A 2IITA 1ULAA 2F9LA 4WECA 4R5HA 1QGZA 3VR4D 3ETJA 3GZNB 3ZCTA 4CIAA 4Z49A 3CH7A 2VH2A 4MYUA 3F9IA 3H8SA 1RQLA 3OZCA 5FL3A 1XI2A 3SSAA 2WJ3A 2XTMA 3IUEA 1LSOA 3AQ4A 1AKWA 3VDQA 1EA5A 1U81A 1Q1ZA 4IRMA 4CKYA 2HU5A 3AG5A 2VF7A 1UMDA 4LZNA 4NECA 2OXIA 3TMKA 4CMIA 3T5GA 4EG0A 2IS6A 2C77A 4QGBA 4M9ZA 4MPTA 4WTOA 1RYYA 3A26A 4NJEB 1G17A 2CLSA 4WY2A 3KLBA 1ESMA 2GZMA 3O9VA 2OYSA 3FMOB 1R9NA 1YMUA 2HKIA 4BKQA 3OQNA 4LMAA 3U3KA 2J08A 1D9XA 1U8FO 1XRLA 1XTKA 1CZUA 3N7TA 4MAMA 4P86A 1ZR2A 4F7DA 1RM4A 1W0KD 2QJTA 4DL9A 1RC8A 3T4PA 5DKFA 1EWVA 2IEGA 1S2LA 3GT7A 1UMBB 1JQDA 2Z8YA 5CHEA 3H3JA 4MGIR 3T6KA 2WZQA 3WQSB 1HH4A 4UM7A 1ZGJA 1UXGA 3CH4B 2AR9A 3GFOA 3R7AA 3VGPA 1I24A 1HK7A 1TCBA 5B1HA 5KCZA 2ZRDA 2G06A 2F4NA 2ID9A 2HB6A 2GZ2A 3DBIA 3KU1A 3H5TA 3LS2A 4FMDF 4K1XA 4RPHA 1XP8A 4YJ3B 2QMZA 4WL0A 1HFKA 1S2DA 4Y6SA 3RODA 1FRVA 5KTMA 2BYTA 1WMSA 2GCIA 3QK7A 2V3WA 2OVBA 1P7YA 5FAXA 1ZK3A 3QVUA 3UT5B 2OCXA 4UULA 2XHZA 2PL3A 5GZ1A 1I3NA 3SQWA 2WHYA 5CBPB 4KO4S 4WY8A 3DE1X 3VOTA 2QP3A 4K6KA 1KETA 3G1TA 4FBLA 1UFKA 4JU9A 4BZZA 3L92A 3VNQA 1W25A 5EFZA 3SMQA 1QZTA 1AIPA 2PA3A 5FBLB 3ZWMA 5B30A 5JS8A 1TYDE 5CW2A 3E7DA 4GRAA 4RX1A 3WGUA 3RFCA 4OLBA 4NBSA 4QVKA 2BH2A 3WL5A 5FV4A 1MB3A 3IIMA 2HGZA 4ACBA 2CLKB 1UK7A 2GARA 2YV1A 3ED5A 3OJOA 3PZRA 4G23A 3QLUC 1ZISA 4I3FA 1QF6A 3HGMA 4TYNA 1Y8ZA 2EEZA 3R7SA 3M81A 3GFTA 4ZVRA 1IWBB 3AERA 1QG0A 3DR3A 1P7VA 1Z5OA 3D7RA 4S0XA 3HXMA 5EIXA 4CEIA 3E8SA 1YBFA 3I3OA 4YV0A 4FFMA 2D6FA 4HEJA 2FPIA 1J4AA 1M0WA 3DTYA 3HL0A 2HY7A 5HOEA 4D25A 3LFTA 2B6NA 1RJ9B 3ZI4A 1X3SA 1LLFA 1VG0B 1I3KA 5KTKA 1XQWA 5K3EA 2AVDA 3NPAA 2ZTHA 2HHLA 3DDOA 2H92A 1OGJA 3HBLA 2H5IA 2Q21A 4MMYB 5DYWA 4DN6A 3RLFA 2GQ0A 4DJEC 1T9GS 3PXDA 4V0ME 1M2GA 5HDQA 2H9IA 3NHYA 3GLIB 1REQA 2ZPAA 3KLPX 3OVMA 5E4YA 3VV3A 4OHPA 2BHTA 4Q9LA 4D3DA 5FLXA 2FMTA 4BJ5A 5DNYB 3EOZA 1LVGA 4QG7A 2ISSD 2P9YA 3BWDD 3JAKA 4JKOA 4KN8A 4K9PA 3CCBA 4OY3A 3UOAB 1I7DA 3S2SA 4DXDA 5JZBA 3WYCA 1KFBB 1TIPA 2IT1A 1OAOC 4GOJA 1FNBA 2OHGA 5D85A 4ALLA 2Q9UA 1DBWA 1N7HA 3B5JA 2FPXA 5CM8B 1E9DA 1V45E 5BQFA 4FC6A 1RC0A 4IS3A 1AQYA 2WG0A 4X94A 1IATA 4ZZIA 3HN7A 2P6PA 3B5EA 1S8OA 4YIKA 1A50B 3O8BA 3D6MA 3M5PA 2PRZA 1RACA 4JC8A 1JDBC 3SPXA 3WVNA 2WM2A 4N3BA 4P84A 3WLPA 3FYUC 1E4OA 2VAPA 3M3PA 3CGWA 2IKQA 4L5JA 3IP8A 4MKXA 4TKUA 5BN4B 3ZJ5A 2XTAA 4MWEA 1MEEA 5FFNA 1CP2A 1XHFA 1UZNA 2C8VA 4R9VA 2BFEB 5FLYA 3WIBA 2YFYA 3X1KA 5JFTA 4BLSA 2GJAA 3OLQA 4IUCS 4XDGA 2BPOA 3KKOA 4AXXA 5M5BA 2YWEA 3D6AA 2Z56A 1PT9A 2Q7OE 4DM7A 2GGSA 4KMMA 5EJAA 3FCUB 4W4TA 3PHHA 4X64B 1SB8A 1Y3CE 2PJUA 4QBGB 4A6DA 1K2WA 2QHXA 3JQCA 4B75A 3FYCA 2WJJA 4KGXA 4Z54A 2IZZA 4Y6GB 2FMKA 1U6JA 2Y1XA 3FZYA 1F2UB 1FTWA 1A9SA 1UFRA 1XYYA 3K16A 2AMFA 3H4MA 1OXTA 1E2HA 4F6RA 2P3QA 5EN4A 1F12A 5FAKA 5IPFA 1MTOA 2YHAA 2ZVDA 1XZBA 2HXYA 3EQ2A 4ISBA 2GLTA 1EUDA 4LI3X 5JJKA 2UZIR 4ZOLB 3K4PA 4HXEB 3BD8A 1VG9B 3RR2A 3UXHA 4WZBA 1F6BA 1EX9A 1Z4LA 2FXIA 3GRUA 3OIFA 3WQQA 2ZITA 3N3BC 1NWHA 3FPHA 5CEJA 4URUR 1V7CA 2CNWD 5TE9A 3NUQA 2WYIA 3UCFA 4BNLA 3Q88A 2P2CA 2OM2A 3OKFA 2K87A 2C03A 5DEIA 4BQPA 3GRFA 5CCBA 4ALIA 3CJRA 1QS0B 3PQ8A 1NM5C 3KVOA 2GVZC 4C4PA 1ZM2A 3CIFA 2JGEA 2D1QA 1Z2EA 5F21A 4R1QA 4KTTE 3WZ2A 3EEOA 2Y6VA 1ZVJA 3OPVA 4M6WA 1RJWA 2X1MA 3QEKA 1AA9A 3RRNA 2DY1A 3P96A 2QRGA 3PFHA 2JFYA 2IXEA 4H17A 3UFXA 2CXOA 1Q57A 4LNUA 1G2PA 4E5MA 5HPYB 1PD0A 3PJRA 1T9ZA 3QE2A 5DF1A 2QTGA 3DVRX 4GZ6A 1WWKA 4M7RA 1ZW1A 3EIQA 1X2EA 4IGAA 4C6TB 4QPJC 1ZMOA 3FB4A 1OYYA 1PR2A 2JGMA 4UTZA 3V00A 1P9WA 2ET6A 2J07A 4EHNA 4D5EA 5BN4A 1FLAA 4R1PA 3T7RA 2IFTA 3D3KA 1BC5A 1MV8A 4FDAA 3WMGA 3ZBTA 4UM5A 4JUIA 2Z3VA 3PX2A 4GVLA 2O3QA 3U9LA 3IS3A 3N2ZB 5D3MA 4TLAA 3VZBA 5ITVA 4KWEA 1A8PA 4OK3A 3V8NA 7ABPA 2K6GA 2OCAA 1VSTA 2AKYA 2Z58A 1LRLA 4L22A 5A4KA 2DP4E 2E87A 2HWYA 3RF6A 4AYWA 3TVYA 2DF8A 1LRJA 1BGXT 1V4VA 3IAFA 2PT7A 1GCIA 3LT1A 1THZA 2AQ8A 3MWDB 4NHEA 1DWUA 1K7YA 2DLDA 1SUPA 2RB4A 1JG1A 3GBVA 1N6IA 3DQZA 5FP0A 3W8EA 5SYAA 2AX3A 1IB6A 2C0QA 4RTRA 5DSXA 1CBUA 1S3SA 3N2NA 4L3OA 5EHNA 1VLQA 1Z0SA 1HV8A 4FU0A 2BBSA 4H4EA 1DDGA 1C4KA 1Z36A 3MT9A 2VJKA 1NQTA 1SBNE 2NT3A 3WLEA 4ZCSA 1E1KA 1IL0A 2H63A 1V4BA 5FEMA 2AC7A 2B2XA 1LQTA 3QI2A 4J1NA 5DTQA 4RTSA 1JJVA 4IG4A 1PD1A 2ZIWB 4V3BA 4O1HA 4MKGA 1G9TA 4X1YB 2XJ4A 2JJYA 4UDXX 3BHMA 2Z9DA 3G9QA 1IAVA 1U9YA 3HADA 3FPGA 3OI7A 1PDOA 4G1MB 5EOVA 4NZOA 4XD2A 3UJ8A 4DJ5X 4LF5B 1T8RA 2C95A 2EU8A 3BWYA 1Q14A 3WGMA 4ALMA 2YY7A 4NMXB 4KR6A 1DTSA 2CGEA 1RZRD 1J97A 1JMYA 1XG5A 4MHOA 3JZMA 5EP4A 1AGPA 4QAJA 2VHUA 2RI1A 1R6XA 2E89A 1NY6A 4LJ9A 4ZCPA 5KB3A 1BHSA 4DEVA 1VIVA 4DVGA 3AK4A 2A84A 2FQQA 4G9EA 2YASA 3QSGA 4EYKA 2OO7A 3DDHA 4FYVA 3ONFA 2Q5FA 2QT9A 3VJLA 1WOMA 4LHYA 3O31A 5KOHB 5A2QA 4O3FA 4YT5A 2HSEA 2W0MA 2D1YA 3RU2A 4CGYA 2ZBVA 2ZYDA 1RWXA 4K26A 2PUEA 3K9CA 1XMPA 3PGXA 1EWRA 4Y0AA 5ABPA 1VCMA 1AG9A 5BVHB 5LMZA 4FK8A 3NT2A 3OZSA 1Y6QA 2JLCA 4DILA 1FRNA 3LQFA 3SE0A 3UH0A 3B9QA 3EBLA 3THWA 3HZZA 2HR1A 2R8RA 4C14A 1PT7A 3FWHA 4TTRA 1GPAA 4C08A 2QZZA 1H8HD 3U7RA 2OD9A 2C99A 2VHEA 2Y2VA 1T8SA 3KKPA 1K7CA 4MUJA 3ZTWA 3MTBA 2I2CA 1E9EA 3TZCA 2B9EA 5IYZA 4LF8B 1F4PA 2CKMA 2GNPA 3PFWO 2X5KO 2ZAYA 4FTWA 4J1TC 4WCDA 1V1RA 3WOHA 4Z1MD 1FU4A 3OPXA 1PL7A 1KBOA 4MDYA 2HCJB 4ZXFA 2WAXA 3CKYA 5CB6A 4B3BA 4OBEA 4LHZA 1BVUA 1J33A 2Q6VA 5K45A 1ODKA 1DKQA 4UAVA 1Z08A 1B23P 3D4BA 3EIOA 5JQGA 2ZSAA 1UJ2A 3VU1A 2ZJYA 5FBQB 1GILA 3VPBA 2BFDB 2P11A 3HM2A 4L4YA 1GZSA 1V39A 2J0UB 4OHCA 1XN4A 3TB6A 3V8QA 2NIPA 2WSIA 4B6SA 5CFRA 2PD4A 2QLLA 5EQDA 3IXQA 1PK9A 2B0JA 4NZPA 2OLJA 4UCQA 5KSWB 5KYNA 1NVFA 3HWX1 2DUWA 3FUCA 2OB2A 4EHHA 3TNFA 4DV5B 5CJ2A 2YZNA 4TVOA 4URXR 3ONEA 1HQYE 2HK7A 1M6VA 2BLNA 3T38A 3OHSX 5AM4A 2EFCB 1TJYA 3ZE0B 4UDOA 2PA0A 1ZRHA 1EJ6A 2QX9A 3FYUB 3HXLA 3LKZA 3WNCA 4DGQA 3T7EA 3R9XB 3SG0A 2YZ7A 3I32A 3PPVA 1T6XA 2F2TA 3NV9A 1JFRA 2CN1A 4MW1A 1XFAA 4N7RA 5ALMA 2PSJA 3C48A 5KAPA 4A5OA 4DNFA 2VT3A 5DV9A 4BWFB 2CKDA 1NVGA 2P9BA 3HDJA 4UCXA 1OU0A 2ZRIA 2CNDA 4EPWA 1OB2A 3NRJA 4WLFA 3L7IA 1VL2A 2CB9A 2R3SA 2X8AA 4QOGA 3DLPX 1U0EA 2H2AA 2CLIB 2JI9A 3ZZ1A 1SPXA 1JAHA 3PI6A 3M2TA 2CZQA 3GP3A 3L8YA 4YRRA 3DL4A 4AT1A 3KJQA 1SXJE 4RUKA 1MT0A 3DA8A 3THWB 5IKXA 2WJIA 4KE7A 4L27A 1DRUA 2J46A 1DHRA 1SCNE 3AFIA 3MBIA 1W4LA 4HDMA 3S6JA 2P78A 3EVNA 4D0RA 1YZFA 3IESA 1ZXLA 2DWUA 1OI2A 4FGWA 3TDNA 5DNUA 1GU7A 4DADA 3FCYA 3TLEA 5JH7B 4RSRA 3HPRA 4AMZA 2P6OA 2FPPA 1MOSA 4OX9Y 2O2GA 1JDZA 3QBDA 1SBYA 1N6PA 3WFZA 2JEOA 4RTPA 3A1FA 4XTCS 2ATEA 1B26A 4ZT7A 2X40A 1KI9A 3RRBA 1NQOA 4MRNA 3FOAA 3HGTA 4W7IA 1MW8X 3M1IA 5L7YA 2HTEA 2MU1A 2PM8A 4Y2TA 2ZB2A 5FNVB 2IZ5A 5AP9A 4OLJA 1CEYA 5DRTA 1SC9A 1DEXA 5IFKA 4LV5B 4INJA 5LR6A 1EHYA 3EIHA 2UYHA 2GRAA 1G21B 2V55B 4RZ3A 2YV5A 1WSDA 3CN7A 3G79A 2PZLA 4YP6A 2CUNA 2VZ9A 1G20E 3HDQA 3VU9A 1NMEA 4PG7A 1H8HA 1DTEA 4ZAVA 3QITA 1Q0TA 5F3DA 4U7HA 3IMCA 3FVVA 1QO0A 3DH0A 5CLFA 3TRIA 1P3DA 4DQXA 3WLTA 3OTIA 5I7EA 2ZIFA 5K9ZA 2Y9PB 1XAHA 2AN3A 1KYQA 4JI5B 3EF0A 4JENA 3W4JA 4WA7A 1J5EB 1QHHA 1FNNA 2MSNA 3LNCA 2FPOA 2Q5CA 4NYJQ 3UMBA 4RXTA 2Z1DA 3PC7A 4P92A 1FFBA 2C97A 2JIBA 2BFNA 3RREA 3FZGA 4D99A 4X6LA 2PS9A 3V1NA 4XX0B 2OA0A 2X2OA 3WLJA 3X1JA 3PXXA 1KVSA 4PZYA 1V1JA 3FGNA 4WCFA 1OW3B 2J0EA 1PZMA 2XUHA 3H86A 1UPBA 1WXIA 1GTG1 2JAXA 2DFTA 3GJ3A 1CLUA 3IOCA 1VFNA 3HR4A 1XTIA 1M1YA 1FFHA 1BXZA 1L5MA 1ZH8A 4G85A 4ZU6X 1S2OA 1QRRA 2WSSA 2YS7A 2D06A 4A23A 1V3TA 2PRYA 3EIFA 1NI4A 5KNCD 2WM3A 1MKYA 1T5OA 3G88A 1HF3A 3M9WA 3QA3E 4K2AA 4KN6A 4NC9A 3ZHQA 1V95A 2BMVA 1YB1A 2KSQA 2QDKA 1Y5NA 4C21A 4CCYA 3LPCA 3HYCA 2PL9A 3H9JA 3JVVA 1LX7A 2WF5A 4F1JA 3DAGA 3X1WA 2UUBB 1Z2PX 3DMGA 2V3CC 4C06A 1K0UA 4BP9A 3IHKA 5J9FA 1RWOA 1VLZA 4P83A 3DJFA 5IBQA 3NM6B 3OJ0A 1BEEA 2Z83A 3OKCA 4W1SA 1J1UA 4H2DA 3Q12A 2HUNA 4MRVA 2NV2B 1PGQA 3DLBA 1NVAA 5D3ZA 4HOYA 1DELA 2XT0A 3LXMA 4N7BA 5C0OE 3RS7A 4Q93A 1MVLA 4W1PA 1KH2A 5F73A 4FZJA 3EVTA 5LKRA 4BCDA 4CV3A 4GW3A 1JEQB 1SG9A 4JJ8A 1SQ0A 5ALJA 5H82A 3NQ41 3TI7A 4C6SA 3ROGA 4CQMD 1NSYA 1WY5A 4HNVA 2QRUA 3N76A 1GZ3A 1GG2A 1NXVA 3Q9UA 1OPXA 2GK4A 4DAOA 4DTCA 4ZDKA 5KSZA 1ZY2A 1H3NA 1UZUA 3EEQA 2NAPA 5ENVA 3W5DA 4J43A 1P0PA 3ABOB 1GSOA 3WLQA 2E37A 4Q48A 1DTWA 1XZJA 1O6FA 2G83A 4B79A 1N75A 2ODAA 4QUJA 4U1RA 4PYIA 4LVCA 2UUOA 1Y7HA 4YRTA 5TLSA 4MS3A 3A2KA 2VCHA 4B8ZA 3PG5A 1AOXA 2R65A 4Q03A 4FFBA 4CIBA 1R4MB 3Q8LA 1JWLA 4OTZA 3U2QA 3U44A 2V45A 4MJXA 4OUKX 3EFHA 3OEED 4RKYA 4B48A 4P34A 1MOQA 4I6JA 3PPWA 5HMLA 1OX5A 4KGZA 4CKBB 1XRQA 4J16C 4JGGA 1PWXA 4XGIA 5BT8A 2IH4A 3WYEA 1OBFO 2DSNA 3RNLA 3VR5D 3KRTA 5JANA 4LY9A 2WU8A 1Q1QA 4IZIA 1EVZA 4L15A 2ZS8A 1YB7A 3HKCB 3OE4A 1AQNA 4ZQEA 3WWOA 2X8JB 4CMCA 1L8OA 4BMYA 1JQEA 1YR9A 3I39X 1H4VB 3PC4A 5IH3A 2AJTA 4WKOA 3FHJA 5I51A 4D02A 5IBCA 3GLVA 4R3WA 4BTVA 3DXYA 4HGYA 1UH5A 3KIPA 5IAAA 4LYEA 1MX3A 3QX3A 5EIAA 5KINB 4I50A 4L07A 4N01A 3FCCA 4M1ZA 4GPBA 4JOSA 2HZBA 3MSCA 2GTHA 3LDHA 1KO7A 2P6RA 2OOSA 3CKKA 1NMQA 4IOJA 4MV9A 2ZDHA 4KXYA 5AXBA 4OB7A 2NADA 3IE0A 3S68A 4D92A 4LZPA 3I9JA 2GNOA 4JJIA 1QO0D 4G25A 1LNSA 4KPUA 4RTQA 5KZMB 4LRYA 3CNOA 1KOLA 2AG6A 5LQJA 3EX7C 5KVCA 4PWZA 4ML3A 2NSLA 2BGJA 5EWMA 5A3SA 3E7XA 2HW8A 2YWGA 3KYCA 1GL7A 1F5NA 1TO6A 1BXGA 2EV9A 2I4TA 1XRMA 2RHLA 4J07A 4JWTA 4P5DA 4FLFA 2NUAB 3GLGA 4UM9B 3I30X 1QTQA 1U5BB 3L8HA 2D59A 3CPHA 4HNQA 4JB3A 3T7CA 4LZZA 3GA7A 4D57A 3I09A 4B7CA 5EZYF 1CS0A 2VDLB 2REQA 1LS1A 2KYRA 2ASEA 4LCJA 4UEJA 4X44A 4BBAA 4X1IA 5DCWA 3VU3A 4UTNA 4Q7JB 4GBMA 2ZZMA 1KO4A 1ODCA 1OWNA 1W85B 5A9SA 1RZVA 4KMOA 2FPUA 4W6QA 4BVAA 1J23A 1PL0A 1VKZA 1VJDA 2PKQP 1OJ7A 5LJIA 1KY5A 3B78A 1HORA 3M6FA 4RA9B 2FAXA 2X4DA 5FQNA 3ZLBA 1TLFA 2FFQA 2KM1A 4IQFA 2C7PA 3EXEB 3MA0A 1P1JA 3W1VA 4DUGD 2OXFA 4FFBB 4JL6A 3V7YA 3Q10A 1SZDA 4M0FA 5EE0A 2Z6VA 3MEQA 1Z0ZA 4ADSG 4J16A 3HABA 3SJ7A 1UM8A 2JIZD 1L7DA 1T1GA 3BB1A 1AQIA 5CNMA 3D3EA 4HTFA 1H1TA 4ZEXA 3P2YA 1NJ1A 1M54A 1VRWA 1G1AA 3SZOA 3TI9A 1V8FA 2VKQA 2XWPA 5K0CA 3SSOA 2Q2OA 3QVTA 3ZDXB 3AEYA 1DNPA 3IP7A 4I55B 3H87A 4G3XA 1VPTA 4L7VA 1QIIA 1SOMA 2A59A 2HA5A 4ME6A 1FCJA 1GUZA 2FWAA 4MR8A 4MWDA 4Q3EA 1SQFA 3HI6A 3NATA 4QUHA 3E27A 4U2KA 3EW9A 5HTOA 2OHJA 2IU0A 3KUUA 4YUVA 3OX4A 3O4JA 5C8YB 2OGUA 4KRXA 4LG1A 4NZZA 1MQ8B 1IUKA 2YWRA 4I50B 4C4ZA 3U6BA 3PX7A 1J07A 3F5QA 1XFDA 3NC0C 4FINA 5AW8A 1HT0A 3UHJA 4M0KA 2X7JA 4RZUA 5JLAA 1THTA 2FZ4A 4FHGA 1O0SA 4U63A 3DE4X 1I6MA 2AK2A 4EYQA 1XOIA 1XMQB 2F8MA 3UK1A 2JVJA 4ETWA 1DCKA 2ID7A 4EJ2A 3SP1A 4A8TA 2OKGA 2J3HA 4JB8A 4LPSA 4MUBA 1GNQA 5CW1A 5EMLA 4WBNA 5IM4F 2EJWA 5EWMB 4QVGA 1K89A 4D4GA 5BWBA 4UXJA 1FDSA 1PZNA 2VF4X 4RQTA 5ER6A 3ZK7A 3ZS9A 1YJXA 3ICOA 1ECJA 4O4LA 1IG0A 1V0JA 4YJFA 2A1UB 1JSXA 2GN8A 2V0GA 1KRXA 1OQAA 3MK31 4QUDA 4NCBA 2PL1A 1CEEA 3D0QA 3L0ZA 1U9CA 3VI3B 1U4NA 2C4VA 3PDIB 4DNQA 5I48A 1NC1A 2MMCA 3DMYA 3OQ1A 4JSYA 2IYUA 2RDMA 4EPRA 1AN9A 1R2QA 3D2AA 1GFSA 2RK6A 2G7ZA 3KR0A 2ANBA 3WGKA 4RMGA 3DUFA 1S7GA 1ZGGA 5AM5A 4CV2A 1NIJA 2OFXA 3LJKA 2WHEA 4LJ8A 3D3NA 3NAZA 4CEHA 1Y5RA 5EL0A 2GCOA 2JIRA 2X42A 1KZ7B 1CUEA 1OOEA 3NNSA 5AVOA 4CV0A 1KQFA 4W5RA 3KX2A 4TGLA 1H8EA 4TL9A 1Y98A 4HX2A 4WKBA 1GG5A 3PP8A 2V1XA 4Z9AA 2W5UA 3ZJVA 2Y93A 3E9NA 3MOSA 5KCMA 2QG4A 1JEJA 1I7PA 4PS1A 5EHGA 3AUSA 4MEAA 1ZIYA 2JBAB 4GLJA 3RU9A 1K8QA 5EPEA 2QRNA 2WG1A 4N8EA 1HMYA 4Q4CA 1TKCA 4O02B 2WV7A 5EKSA 3T12A 4BO6A 3DAOA 3KVNA 4XPIA 4QGGA 2XCTB 4I55A 3WXBA 2D2VA 4KIUA 2ZROA 3R76A 3PEUA 3NOOA 3PFGA 3W5JA 4RTKA 3V2UA 5AI6A 3KO8A 5BQPA 1U1FA 3MFQA 3VX3A 3CLUD 4NOKA 3MTGA 3CUWA 2PFGA 2G82A 2GVDC 4EG8A 1CRLA 1JLLA 5I4BA 1CZNA 2W43A 3LNTA 5DZSA 4D9KA 2Q5LA 3CLVA 3KQSA 2PVCA 1YU6A 1CY8A 3IDZA 2AG1A 3V55A 3S2FA 2P9TA 3HFRA 2RHRA 1ZBQA 1C4WA 2GAJA 4P3NA 4L5IA 5KWEA 2XADA 5L3ZA 1YQEA 1MP0A 5DHAA 3ONNA 4GWKA 1T9GR 4HWOA 5LA6B 3PHCA 1KO1A 3F3MA 4RELA 2VN8A 3JZDA 2GKSA 4RQBA 2GBLC 3OFKA 4KQGA 4Q4JB 3HN6A 4YC7A 2Q9BA 2WP8J 2OMKA 3EZ7A 1XZLA 3NC4A 4EFKA 5JCJD 3QYJA 2IUSA 2V97A 4L9SA 3M89A 2FPRA 3ZDAA 4YUZA 2G77B 1YE8A 3H9BA 5E3JA 3VPAA 3WMFA 5AR1A 1A4XA 3G8YA 3CUKA 4YT4A 1RDFA 5BQ5A 1H23A 3TQRA 4DDKA 4GU5A 1HNZB 1U0GA 3GRYA 2FPGA 5AOBA 1O58A 4XQ9A 2D54A 3A1TA 3QM1A 4B87A 1M34B 4U8GA 2W6CX 1VPWA 3MD9A 4HVAA 4BMOB 1S2IA 3F97A 4RH3A 3GGGA 2XQVA 3Q7RA 2D2XA 1UPCA 2QRKA 2ZE5A 3VISA 4JT4A 4FILA 1XTVA 1YS7A 1GG9A 1L7PA 3D6JA 3QX7A 4PX2A 3T95A 1GV1A 4M46A 4KVFA 4LSGA 1FNMA 5CTAA 2IV7A 3ZKWA 1KHTA 1L5ZA 3EVEA 4BAGA 5DW3A 3H7IA 1SKBA 3CM0A 4YMWA 3RYHB 4ZZ1A 1RM3A 5ADVA 1E92A 2A5JA 5KBYA 4ONEA 3ZXUB 3ZR4B 4Z7JA 2X13A 4N82A 1EE1A 1PWHA 4YRGA 1EVLA 1GKKA 5E6RB 3UVEA 2AE1A 2ZJBA 4KDEA 4M1TA 3IVGA 4BQOA 4EUFA 1ZCJA 2HIAA 2YXBA 3E0QA 4V38A 2YYAA 5BW5A 4H7HA 1NQWA 4MUMA 3DV0B 1KXZA 3K0CC 3SHVA 2PS0A 3L4SO 3Q3GE 3NKLA 4R2IA 5L3QA 4KFSA 5L4SA 2YMMA 2XZDA 4PLGA 4JB2A 1C9JA 2GN6A 1VP9A 4K6HA 1S6YA 4D0LB 5IVHA 1GTJ1 1QGUB 1KP3A 5T6BA 4DBLC 1NQAO 1VI5A 3K31A 1H4SA 3BT7A 3ROMA 4R1SA 4H7KA 2FHPA 3CEJA 1VMIA 2FN9A 3DD1A 4DA7A 4E22A 1C1YA 1H2RS 1DIGA 1JDJA 1X7DA 3MLBA 4CU5A 4ERNA 5J47A 4CIVA 2ZBQA 1P91A 1THGA 2ZJ2A 1NJFA 2VQFB 1NBIA 1OXXK 1T2EA 1NZDA 2PH7A 4INZA 1BDJA 2GCEA 2XW6A 4KQXA 1YA4A 3RRJA 1KOGA 1W0CA 1QF7A 2PXHA 4DNXA 4S3MA 3A6ZA 5C7YA 4EHAA 1BS9A 1Z18A 4JR0A 2W2LD 2JAWA 2Y05A 1EMDA 3F8SA 3P2OA 4KE8A 1TU3A 2D0DA 4YRIA 1C2TA 2D5LA 1QG2A 5JPCA 4UOZA 5E9WA 1D9ZA 1AQJA 3G9UA 4PX3A 1WD5A 1GPUA 1ECLA 4G0MA 4BHTA 3WDMA 1PU2A 3I72A 1R7RA 3MVEA 4NFSA 5SV2A 1FYEA 1MNQA 5B4UA 1JHDA 4FE7A 4QNRA 3THRA 3VYTB 2B21A 2ACVA 2WE8A 4DV0B 2Q3MA 2RGGA 4L85A 2RE8A 3BRSA 4LOJA 2IEDA 1WL8A 3DBOB 3KEGA 4HDQB 4JT9A 1HTTA 5G0WA 1ONOA 3REQA 3VO1A 1HDYA 1T5LA 2XUPA 4HGNA 1KOFA 2O8BA 1RQ7A 3C3YA 3FM9A 3WL3A 2I7TA 2DPYA 4H27A 5T8KC 1K7EB 1CV2A 1PVVA 1U3WA 2X9LA 3A1CA 4QUKA 1ZXBA 2BMAA 2IYAA 4GNKA 3CTMA 3O3NB 4ZEWA 5A7GA 2ZJ6A 4BASA 1JX6A 4MYRA 1HT1E 5B3JC 5I01A 3INYA 1YI8A 2G9QA 1XVUA 2JKZA 5E7QA 4Y0NA 4N5MA 4OAOA 1B43A 1RBZA 1NMSA 1XGKA 5CB8A 3E2PA 4AZSA 4YCLA 3I5YA 1VSUA 2VJLA 2WPNA 2DEUA 2GHIA 2IYPA 1JJAA 1NBOA 2PK3A 3KU4A 4KSBA 4XB2A 4ENUA 4CL2A 5C53B 1OH6A 4FQ8A 4FYYA 1YOVB 3AIMA 3EQZA 4V24A 1I1HA 4WJLA 5JMTA 3LTNC 2WHQA 1CRPA 4OHMA 3DKRA 4TTJA 3AKDA 4AJLA 1Z83A 3PFKA 3U26A 3HP4A 4CMEC 2BFOA 2QLNA 5FYDA 4TMXA 2XZPA 5FNVF 4KZKA 3L01A 4NI5A 1XKLA 2HRZA 4QXMA 3RV4A 1HETA 3ST7A 1IUPA 1HZJA 4WXEA 1WTCA 1GUFA 4HDSB 3WKBA 4DRXA 5BPFA 4YNBA 3FE2A 2EDAA 1Z4JA 1M7GA 3UUEA 2JJQA 4PPYA 2YVAA 5H80A 1QWSA 2IXTA 2V4UA 3GCWA 5KSYA 1W0JD 5KYGA 5TMBA 3RIYA 2PZGA 5F1OA 1T4MA 1NW5A 2PZFA 4K46A 1VP3A 3OZEA 3QVGB 3I5MA 4OJNA 3MWLA 2ZI5A 2Y3IA 4LW8A 1H2EA 4PVCA 3S8EA 5LZ8A 4XFDA 1KJJA 1I01A 3DGEC 3TW8A 4AZ0B 3IR6A 6CHYA 5HIMA 4E5SA 1T36A 3GN2A 4K87A 1V2GA 2ACEA 2JFOA 3F46A 3PKJA 4EVSA 1WKCA 4CF6A 3RQSA 3CSUA 1CG6A 5CT6A 3U56A 1QG4A 4UUMA 1NN0A 2Q6IA 3CBGA 3ICPA 3SE7A 2ZM6B 5L53A 3H0CA 3JYNA 4PHTA 4G09A 3W78A 4PGGA 4EEZA 3KV1A 1EX7A 4FCWA 1AKUA 4BO9A 1RHKA 3KKQA 4F3KA 4X7PA 4BX2A 2I1LA 3QEOA 2Z0MA 3L7DA 3TLCA 1SKQA 4EY8A 1HYBA 4GPEA 2HK6A 1U7HA 1U5CA 2DBRA 2I87A 2AEEA 1TKAA 3BHIA 3W06A 3WE7A 5HW0A 3MRXA 2JLUA 2HV8A 1G60A 4PO1A 3VYWA 4OBBA 5CRIA 4BYGA 2EBHX 3W9BA 2ZZKA 4COOA 4XQCA 4B2YA 5CFOA 1M8FA 2Y0PA 3CRNA 3RVMA 3GLIA 3PVCA 1TGVA 3P9YA 2BBWA 3DNFA 4HWPA 4NV3A 2LXNA 2I65A 3DZDA 4F4CA 4ZI7A 3VH4A 1Q7EA 1QOQB 3TGLA 4B4KA 3BBPA 2A57A 3PPYA 3FR7A 2DHDA 1KIFA 4LE1A 3LGXA 4WINA 5CYGA 1NMYA 3FTPA 4D41A 3GRVA 3CRVA 1EGMB 2D4AA 3KDSE 1J8DA 4RV5A 4JBLA 3CF6R 3NHAA 4YWHA 3NH9A 4RPIA 1RBMA 4B3RB 5FTKA 4TZ6A 4X00A 3PPIA 2LUOA 4R6WA 5EWJA 4KKVA 2IZ6A 3KPVA 4YRCA 2IDZA 1J0EA 4KIWA 4FZ5A 4HBGA 3S27A 5LU9A 1MAHA 2C9OA 2CJYA 3AU8A 1PNTA 1K4KA 5I7VA 1PFQA 3QX8A 4KQMA 2Q28A 3IIKA 1KJYA 4L0QA 2AC2A 2CF5A 5BMOA 3EGXB 3IVXA 3CLHA 3O92A 4LQLA 2PUDA 2UYOA 5IBRA 1YIDA 2GJ4A 4XSVA 4WLUA 5E1MA 1SUDA 3KB2A 3NAMA 4GPAA 4R2JA 3T7KA 1VLJA 1JHOA 2YCLA 4XW2A 1JKJB 4OOEA 4QX6A 3L07A 1Y9ZA 2VHXA 3H5AA 3CUYA 4YIHA 3OPQA 5AI8A 4ZO6A 1DFGA 1HMPA 3NBZC 3WGTA 5I3ZA 3GJ7A 3W1WA 5EJ8A 1N2CB 1NR7A 1FUIA 1ZU4A 4A6XA 2YJTD 3VA7A 2VJOA 4E7PA 3BX1A 3SX2A 3EULA 1W76A 2O3UA 2BDUA 3ZZ0A 3EIUA 4KQFA 3HO8A 1VLVA 2F3SA 3S7ZA 3AILA 3V3KA 4P8RA 1GLGA 1R12A 1HM5A 1NI3A 2FOXA 3IDFA 3TR6A 1E94E 3E58A 3UB2A 3WS7A 1NDQA 1P5HA 4OP2A 5IKPA 3L02A 4WLNA 5I9IA 4BYMA 1LDBA 5F98A 4NFLA 1KORA 1L7RA 1G2OA 3AR4A 3BK7A 4IZ6A 4O59O 1AMOA 1OZAA 2WA1A 4EAQA 1E2BA 3H5VA 3EWSA 4OU5A 2XKJE 5CK4A 2AZMA 4BFZA 3I5XA 4HKTA 5JTTA 1J1ZA 3O9MA 3EXG1 2XB6A 5IBPA 2X6QA 4I08A 3A58B 5HRAA 2PANA 4KXUA 1FMCA 1Z5ZA 2FX3A 3H5OA 3EGWA 3L7OA 4RK7A 3LF2A 3SEAA 4N03A 2EG5A 3C3MA 3OLYA 1JIUA 4KXWA 2D5AA 4XOUA 1ID8A 2BM0A 3AFGA 1TM7E 1W30A 4UZSA 1RLOA 1ZYUA 5KEIA 2RFLA 3KNZA 4GT1A 3KXDA 3PFIA 4FNMA 4N1AA 5I7RA 3ZCRA 4KNYA 1K9VF 4ZU3A 2JRLA 3EA4A 3HKEB 1JVBA 1CTQA 2HN9A 2NPOA 1P2GA 5JSFA 1OR8A 2FPKA 3UJ9A 3K1JA 3K8QA 4AF6A 2HADA 3TLYA 3V1UA 3ZJ4A 3PQCA 3L8MA 5JNUA 1MQSA 3LHFA 2B30A 3M6WA 4M98A 5GADl 2GFHA 1KJ8A 4DA0A 1I14A 4DS3A 1AUQA 1J00A 3UXEA 4ZAZA 3PCRB 2W83A 5FTWA 1E3QA 4LGMA 1X87A 3OLCX 4Q1FA 1JKJA 3T1TA 3OTGA 4V39A 2YHSA 4ER7A 1NBMA 1AY0A 4M2LA 4AZTA 1VECA 4MVJI 1H2XA 4XYEA 2O0MA 3SLKA 1YULA 3EYAA 5K8UA 4ILEA 1G7TA 5LXTA 2PLRA 4QM7A 3MELA 3IHTA 4FIZA 4G36A 2K2WA 4XD7A 4ZK6A 3EDMA 3S3TA 4XJSA 1C3OA 2IP2A 5GVRA 4A0SA 3RTAA 1RI5A 4XVCA 2OZLB 4TSFA 4P2BA 4ENTA 3AF2A 4D9NA 4MYDA 1J7JA 3H6KA 1KP2A 4NG4A 2Q2QA 3KSAC 1W96A 3ACDA 1EP1B 3GFRA 2D7CA 1XVTA 3I45A 4M0LA 2J4FA 3PEVA 3WWEA 5TS2A 4DRZA 5BV8A 3J81A 1ISGA 4JUDX 3ZCVA 3WLKX 3RS2A 2EHJA 2WQ7A 4HH1A 4EG6A 3N86A 4I1RA 2FWBA 1KERA 4DEYA 4OQEA 3QSYA 1AQ6A 3I2HA 1CDOA 4Y9DA 5EIBC 3I9KA 4ER0A 5ALPA 1TB4A 3DBRB 1TQ2A 3BRQA 4UAJA 5EPOA 3TRDA 3CZAA 4AJHA 1GNSA 3TJMA 5ALDA 1GYRA 4N41A 1UQTA 1C8KA 1MB4A 2FPMA 4IH9A 4CQLA 5C18A 2FUEA 2XECA 3SXUA 1QYXA 3LUBA 5KNCH 2EJTA 4C4AA 3EHDA 4TMYA 1DUSA 3VH1A 1JHAA 4D8UA 3KKKA 4Z7NB 5ITSA 3TZEA 2OHXA 1QVAA 4NX2A 1WZEA 4LA4A 2J9FB 5K3AA 3TOXA 4XGNA 5BSTA 4ZOLF 4B9AA 4BMDA 1F2TB 4ZVSA 3CLRD 1M5UA 1NNUA 5H68A 4L8WB 1DQZA 4XIFA 4IP0A 1OBCA 3H0KA 1UR5A 4S2UA 5DU2A 4BBPA 3HJFA 1P6UA 3WL6A 4XVQA 5IM4A 2HJSA 4TL6A 1IAQA 2KE5A 3UYLA 2AX4A 2V03A 1KYVA 3S5UA 2O0LA 2R60A 3IEPA 4FMCF 4F9FA 2GPTA 5BPHA 2IUUA 3UZUA 4UASA 3EWAA 1E7WA 1Z74A 1OTYA 3FUUA 1QQBA 5I8PA 4JA0A 2UXDB 4JDUA 1QU3A 1VDMA 1N3YA 2P3SA 1EBFA 1UK6A 3EG9A 3LL7A 4HUJA 4BMPB 3SSMA 2XGSA 2CJWB 4TVSA 1AKYA 2PNJA 3STWA 4L95C 2JIMA 3CMCO 3II6X 2I80A 3PSAA 5AKYA 3UENA 1J22A 4D1YA 1FJHA 1XB2A 2HXGA 3IHLA 3IP1A 4TZTA 4UTVA 2WP0A 3K71B 2OGWA 3Q1KA 3A8TA 4Y6OA 2AEFA 3ISTA 3RFFA 2QTFA 4YUAA 4BNWA 4Q9DA 1MHTA 2QTAA 2ZB7A 2HA3A 2C5LA 4MQBA 2CLMB 3SGLA 4CMIB 2FCRA 5DX8A 1D04A 3AKCA 3U3OA 4KE6A 1KVUA 4W7HA 1I6KA 3QA9A 4IIHA 1UBNA 4G81A 1W2GA 4FOPA 4EKEA 4HNSA 5K8CA 1LBTA 3KJFA 4J76A 3AEKA 1P8JA 5TMDA 3UGQA 2RHBA 5IVIA 1V11A 1ZHHA 4F97A 2PPVA 1IRIA 4MVWA 2PKYX 1JECA 2FFAA 4ER3A 2W9XA 4L4RA 5B53A 4RD6A 3I1YA 1MB2A 1S5PA 2PT6A 3RFXA 1HY3A 5T4HA 3OBIA 4ND6A 3RG2A 3DBRA 4DF3A 1RRGA 3MGAA 3UV3A 5CX1A 4P5PA 3VKHA 3EOAI 5TNXA 4A9AA 4PF1A 2IEAA 5BXQC 3OM9A 4WKCA 2XNDA 2I8LA 4KLZA 5BSVA 2WF9A 4DUZB 4C5BA 2O2IA 1UKEA 1NXTA 2PXCA 4CRWB 1GPKA 2RHWA 2VXBA 3DEAA 3RABA 4D4HA 3ZDBA 3DB2A 4PSVA 4JYAB 3QG1A 1F0NA 1JL3A 5KNLA 2D0IA 3C3KA 1OX4A 3V4SA 3TFWA 3BHJA 3CWCA 3SZUA 3A6HA 2CV0A 2ZBFA 3L6BA 1G8PA 5LD2C 5ICFA 3DEZA 3UKDA 3I0ZA 4Y6PA 3RVBA 2KHZA 1HDCA 1ZNWA 1Y1KE 3OAAA 5IJAA 2C78A 3GIDA 4BNMA 4BEJA 3K6SB 4YFVA 4HD8A 5AI5A 3UOGA 3FR8A 4GYJA 1FL9A 3TCNA 1KMCA 3UV7A 3T7IA 3ZE8A 3L05A 4E5KA 5JBIA 3GG9A 3NG1A 4OYRA 3UTCA 3GDHA 1JIQA 4B9EA 4II3A 2QMOA 4PPQA 2D2EA 1QRDA 2ZJ5A 3D5EA 3OZGA 4PC3A 2WR8A 2JLWA 4FDUA 4H60A 4XWOA 4B3MB 4A26A 1GRCA 2ZXFA