4YGYA

Crystal structure of human scp1 bound to trans-proline peptidomimetic ctd phospho-ser5 peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
179
structure length
179
Chain Sequence
QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Chemical Tools To Decipher Regulation of Phosphatases by Proline Isomerization on Eukaryotic RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ygyA00
4G9BA 2FDRA 2AMYA 1MH9A 3EPRA 1VJRA 3CZ4A 3AR3A 1QQ5A 3RFUA 2DQSA 3KZXA 3OCVA 4Y2PA 3OPXA 3ET5A 1RMQA 4BYGA 5AW7A 1QYIA 4UM7A 1RKVA 3OCWA 2G80A 3B9BA 3NIWA 4MUMA 1YS9A 3DDHA 2RAVA 3SD7A 2NYVA 3HYCA 5AI0A 3N1UA 2YMMA 2CFRA 4XE5A 5ALQA 1Q91A 4YH1A 4KX5A 4BEWA 2YMPA 3FM9A 5AVSA 3VAYA 5ALWA 2OM6A 3OCZA 5ALXA 2WM8A 3PCTA 1L7PA 4J2TA 5AVZA 1L8OA 3OCYA 3P96A 1Z4QA 4KNVA 1QQ7A 5ALLA 5AVXA 2BDEA 4UAUA 3R09A 3L8GA 4Y2XA 3L0BA 4NV0A 2HSZA 2YJ6A 4Y2QA 3PGLA 4B6JA 1YDFA 1Z4NA 2OA0A 3PDWA 5ALYA 1Z4LA 3WKCA 5AI8A 5AICA 3PGVA 2B1RA 4DFDA 3ZUPA 3DV9A 4C4TA 3W5DA 4OHFA 5AI5A 2CN1A 4OCZA 3WKBA 5AK6A 3BWVA 4NWIA 3KOOA 1YNSA 3KBBA 1JUDA 4ZEVA 2G0AA 5AKZA 4JDPA 4EX6A 2IOFK 5A3SA 1S8OA 2C9MA 5AKJA 1Y8AA 4FE3A 5AW8A 1VFPA 3E58A 2HF2A 3W5BA 3DNPA 3E81A 3WGUA 2C88A 1QH9A 2O2XA 1T5SA 4UM5A 2IOHA 3OCXA 2MSNA 2AH5A 3AR6A 3NALA 2YMQA 2CFSA 3RF6A 4QQFA 4DCCA 2ZBGA 2G07A 1Z4OA 3EWIA 3MMZA 1Q92A 3SMVA 3WK5A 3I76A 3L8HA 2OBBA 5AHXA 4OD0A 3IB6A 4AP9A 4Y2RA 3ZU6A 1RMTA 3QX7A 4IFTA 2BY4A 4CF3A 1J8DA 3UMCA 3WK4A 1F5SA 1TE2A 2EAUA 2YMLA 4HGQA 1L7MA 1YV9A 3AR8A 4Y2VA 3WK9A 3WGVA 3SHQA 4HYTA 3NAMA 4J03A 1RPZA 3QU5A 1RQLA 5ALFA 3QU7A 2I34A 1CR6A 3M1YA 4YCNA 3QUQA 2W4MA 3ZVLA 5ALHA 1L7OA 1VJ5A 3WK7A 1L7NA 2ZBEA 2ODAA 5ALTA 3UMBA 4ZEXA 4HAIA 5ALNA 3ZVNA 1U02A 2W11A 3A1CA 4GXTA 5ALJA 1WVIA 3MC1A 2AUTA 5ALSA 2CFTA 2HF7A 1O08A 4UU1A 2W43A 4YCLA 3ZI4A 3NASA 3SLRA 3A3YA 1LTQA 2EARA 1SWVA 3L8EA 2B8JA 1IWOA 3L0CA 5ALIA 1SU4A 4E88A 1XVIA 5AKGA 1RC8A 2C8LA 4KYTA 2EATA 3L5KA 5AK5A 2YFYA 1ZJJA 3SF0A 4EENA 3N5KA 4BX0A 5AM3A 2OYCA 2YBDA 3QXGA 1RLOA 2VKQA 5AKHA 2FPUA 4NABA 5AM5A 5ALKA 4KNWA 1EK2A 3AR4A 3QGMA 5AW2A 3ED5A 5A3QA 4UU0A 5E0OA 5ALRA 2I6XA 4PNHA 4HGOA 4NAVA 5AW3A 3WKAA 2WF6A 3ZX4A 1NNLA 3AR2A 4HGNA 4BBJA 5AKKA 5AVVA 3I1YA 4O8CA 1U2SA 4CF4A 4Y2SA 2JGAA 2RARA 5AK4A 4Y2YA 4FFDA 2WF9A 2NO4A 1Z4JA 3QU2A 3WK6A 5AM4A 3UM9A 4F71A 2R8YA 2HEGA 1WR8A 1ZD5A 3N8GA 2FPXA 3B9RA 2B1QA 4KN8A 4UMEA 3EF1A 1AQ6A 2ZBFA 3WK8A 5AW9A 1RRCA 2P11A 1PW5A 1RKQA 2HHLA 3I6BA 3QU9A 4L6CA 2P9JA 5AVWA 3ZWDA 3QNMA 4UARA 4UASA 4QJBA 5A3RA 1O03A 3D6JA 1L8LA 1LVHA 5IT0A 2YJ4A 3AR5A 1CQZA 1ZS9A 3F9RA 4NFLA 3FVVA 3L0YA 2I33A 5ALOA 4AS3A 2PR7A 4RESA 1X42A 2FPRA 3U7EB 3U7FB 3N28A 4Y3UA 5ALEA 1TA0A 2WF7A 3U7GA 2I54A 2D2VA 4I9FA 4Y2JA 2RBKA 4DW8A 2FPWA 4YIKA 4BKMA 1U7PA 3ZX5A 1ZD2P 1FEZA 3W5CA 2MU1A 3OCUA 2BDUA 4UAVA 1RQNA 3QUTA 4CF5A 3E84A 5AI6A 1QQ6A 4C4RA 4UATA 3I28A 2I7DA 3NRJA 4XOUA 5ALDA 3EF0A 4L57A 2C4NA 2HI0A 3MPOA 3R4CA 2JARA 3AR9A 3ZWKA 2GMWA 3KC2A 1U2TA 5AIAA 3OTQA 5T41A 4G63A 1SWWA 4Y2UA 2WF5A 3J7TA 1S2OA 2ZG6A 3QYPA 1Z5GA 1XP5A 2GFHA 2C8KA 5AKXA 3ZW7A 3KD3A 5AI4A 1Z88A 2JAUA 3HLTA 3ZTWA 3U7HB 3B8EA 2FEAA 3AR7A 5ALPA 3ONNA 5AW5A 1Z4MA 3U13A 5AW4A 1ZRNA 4BNDA 4UMVA 2B30A 4YCMA 2FI1A 5ALMA 3IRUA 5ALUA 4YGYA 4FYPA 2X4DA 2I55A 1T5TA 5AM0A 4OFZA 2R8EA 4UMDA 3R9KA 2GHQA 2P27A 4IG4A 3BA6A 5IT4A 5ALGA 1RDFA 3FGOA 5AW6A 5IS2A 2YY6A 4JB3A 5AI9A 2HOQA 4I9GA 2GO7A 1TJ5A 2IYEA 5AESA 1ZRMA 2Q4TA 4DWOA 1XPJA 2ZOSA 2B8EA 1Z4IA 1Z5UA 4CNQA 2ZXEA 2WHEA 5AM2A 5AKIA 4BX3A 5AVUA 4EEKA 5AIBA 1N8NA 4F72A 2B0CA 2Q5EA 5AKLA 4Y2TA 1WPGA 4C4SA 3WKDA 3QLEA 2HCFA 4BX2A 1J97A 4HGRA 1ZOLA 1RMYA 1Z4KA 3IJ5A 3L1VA 1KYTA 2WFAA 2FPSA 1T9ZA 3CNHA 3U19A 1TJ4A 2FUCA 2ZBDA 2JAWA 2HDOA 2RB5A 2WF8A 3L1UA 3QUCA 3ESRA 2PQ0A 2YJ5A 2G09A 5ALVA 4KX3A 4CE6A 1RKUA 4YIHA 3FZQA 2G1AA 4XQ0A 3W5AA 5AKYA 1ZD4A 4XPZA 1NF2A 4RETA 4EELA 1WZCA 3NUQA 3L7YA 3S6JA 3ZVMA 3N07A 1N9KA 5AVRA 2B82A 3TLMA 3M9LA 2JAOA 3QUBA 5AM1A 2R8XA 2Q4RA 1NRWA 4UW9A 2AGVA 2QYHA 3K1ZA 5ALZA 1TJ3A 3KDPA 2PKEA 3ET4A 4EX7A 1YJ5A 5JJBA 2G06A 3WKEA 1L6RA 2G08A 2HO4A 3A1EA 3A1DA 4H1WA 2QLTA 2YN4A 1ZD3A 4AS2A 3QU4A 1RLTA 5AK3A 4BNDB 3E8MA 4GIBA 1K1EA 2IOFA 1U7OA 3GYGA 3NANA 2P69A 2IA5A 1YMQA 2GHTA 3U26A 3UMGA 2HX1A 3FPSA 4UMFA 5AKEA 2YJ3A 2R8ZA 3DAOA 5AVTA 4EZEA 4ZEWA 4HGPA 3L8FA 5FP0A 3ZTYA 3MN1A 3ESQA 4BEVA 4MWOA 1RLMA 2NO5A 5AW0A 3SKYA 2FUEA 2O9JA 1Z4PX 5AVYA 3SKXA 4L6AA 5AW1A 3FPBA 1EK1A 5AVQA
chains in the Genus database with same CATH superfamily
4G9BA 4QSHA 1NW8A 3QBVA 3SM3A 3ZDRA 1K2VN 1EEXB 3CBQA 2WY2D 1YR1A 3OEED 2ZRNA 4ND8A 1Q5PA 4WZBB 4FHCA 4KSCA 3D4LA 3BD9A 4IV0A 3KOUA 1P9NA 2ZPUA 4EY4A 5KYGA 5KJEA 2IYSA 1AQLA 1GD1O 4AN4A 5I9NA 3CZMA 5KNDA 3O0TA 3ON5A 4XASA 3AJDA 3AT1A 1XL1A 3OPXA 2IVFA 2PGNA 3D1VA 3IHKA 4B3IA 4JB8A 2LW7A 3MGGA 3ETNA 2ZS7A 2WB2A 2G80A 3B9BA 4I4NA 2FHSA 2B3TA 3NU1A 4FQ8A 4H77A 4P3XA 2RAVA 4GLBA 1HG0A 1OT5A 2P9QA 4C07A 1CF4A 1ZMTA 2P4SA 1UBSB 1A27A 3NHAA 3JQGA 1WZUA 4KX5A 2RGYA 3PTAA 1G8YA 1Z2EA 2C4UA 3PNLA 4TTIA 3EW7A 3IKVA 3I0ZA 3IUJA 1HZJA 5EFZA 3T3HA 3W5JA 4YP0A 4C0LA 3PWTA 1UKAA 1Y3DE 2GDZA 1UWLA 3ANSA 3PVSA 4OQDA 2A1TS 5AVZA 3ZZ1A 4QDUA 2QTRA 5CAEB 1IN5A 4RO0A 3LHKA 4OMCA 1VI5A 3K32A 4TRMA 5JTTA 4IXNA 4YCSA 1H2AS 2Q7DA 1YHYA 1E7RA 4LF4B 3U2QA 4FK8A 2JJ1D 3CGWA 1X9IA 1TF5A 3E1SA 5JMPA 2QUHA 3ZNOA 4BLVA 4B3JA 3HN7A 2WICA 1KI9A 1X7YB 3X44A 4LHWA 3HBNA 4OXNA 1PWXA 3VKGA 5DSZA 4LMRA 1OBVA 3C85A 2LCIA 3QBTA 4TM7A 1L0BA 1PL0A 1P61B 4DFDA 3R3SA 3OF5A 4KB5A 1MO4A 1JHVA 1CUWA 3LT0A 1UBRS 4CHTA 2UYQA 3H1AA 1SNYA 2VATA 1HE5A 4ZEMA 1YZTA 2R96A 1EVQA 1CEXA 2ZRQA 3DPIA 3Q3CA 3Q41A 1JFFB 4GW3A 4QVKA 1IN4A 1KETA 1Y1TA 2J4DA 5AK6A 4B31A 5BY2A 2VZLA 4FZ3A 3ZY2A 2BEWA 5HQ3B 1JUDA 5CG2A 3CUKA 1KO4A 3X1XA 3FKSD 1DKUA 4FHFA 2IOFK 5AVOA 4HWTA 1T4BA 2PRIA 4P7BA 5CD9A 1GCUA 4YUAA 3DBOB 1Y1RA 3WIOA 1ORVA 4XQ9A 1A4UA 2PO5A 4TV8F 1N7HA 1G20A 3DXXA 1KFKB 4CIWA 4N8DA 3PXAA 4PFQA 5B5SA 2OZKA 2ZIXB 1I94B 1KP9A 3RYHA 4WESA 3G6WA 4A8HA 5HRCA 3AJ8A 3PUVA 3G79A 3FNRA 4RHUA 1PSDA 3TRHA 1JW9B 1WW2A 4A0GA 3IP9A 3FDFA 2E82A 3FFBA 3O82A 1J5XA 4WCFB 4GKBA 1G5HA 1UBHS 4L9SA 2HJWA 2XGMA 3FDJA 3NOXA 3OJXA 1C9DB 1SHZA 2YMQA 4L9WA 3TXAA 3W2FA 1DAEA 4XWYA 4P8RA 2IYQA 2QLBA 4G5SA 4GUAA 3VHXA 1RYZA 3LWDA 5A9TA 1SC3A 3T35A 4G67A 4ILKA 2AOTA 5DM2A 2GTHA 4KV9A 1XJWA 4URVR 5IK2A 4Q9LA 1ORWA 3F4LA 1WEHA 1H8HA 2PU5A 2YHUA 4BTEA 4NYJR 2BLLA 4HYTA 4LPSA 4J0KA 3UGQA 1EFUA 2F9FA 2JLRA 1X3LA 3F0TA 3GDGA 2V59A 1DMRA 3FTNA 3LCUA 5ALFA 1MGPA 4LYEA 1DRKA 4GNKA 3FTDA 1NUSA 4IJWA 4Q9IA 4XPIA 3JQ7A 1UQTA 1MC4A 4QUAA 1X1CA 1L7OA 3WK7A 3GZNB 1EYZA 1MIHA 4UUNA 1BXRB 4DTIA 1QQBA 2WIFA 3KV1A 4MYRA 1P4GA 2QX8A 1L5GB 3GLRA 4DGQA 4I9NA 2C2XA 1OIWA 1K6MA 3M5DA 1R9GA 3JWGA 4DCGA 4OBXA 4IIUA 1DS6A 1GEGA 4WWHA 3T4EA 1N5JA 4HFMA 3KLOA 1HYBA 5K3BA 1OBHA 1T1GA 2WB4A 4OHXA 4JLOA 1R0WA 2JFVA 1C4WA 3O6VA 2CEAA 3D0QA 2CV2A 1TYCA 3T54A 2FZ4A 2BYTA 1SRQA 1W34A 2IZ1A 2JG3A 4BWVA 1JA0A 3SLRA 3KPJA 3AI2A 1RVDA 4ZQGA 1MEJA 2EARA 1BZYA 2RGGA 4LQ4A 4WERA 5F3DA 1VDZA 1U1EA 1QOPB 1YCFA 2ENUA 3LUJA 3R5HA 4ETWA 3B3AA 5LMUB 1HRKA 2PWBA 3RAEC 1OZHA 1YS2X 3VTAA 2AKAB 4EHDA 5LBTA 3WGGA 5EJ5A 3GAFA 1GA1A 1KI2A 2NQ8A 2YVQA 4M1WA 1RC8A 3I5MA 3M6WA 4RANA 4EHBA 3M6AA 2C8LA 1JS1X 2BFMA 5SY9A 5SZJA 1QVAA 4G25A 4G8DA 2OO7A 1P0QA 4XH9B 2ANCA 4B3MB 1YJCA 2IS6A 3GGGA 3PF9A 2IU3A 1LLQA 1QFJA 2X58A 4GC9A 4J0EA 4Q9JA 5K9ZA 1LK5A 4CKBA 4QRDA 2HLDD 5E0KB 2NU7A 3DDNA 1FVOA 2E4XA 5HG0A 4B45A 2QX7A 1UPBA 5FUYA 5BV8A 3COZA 1H4VB 2QKYA 2YWXA 2AR9A 3NHRA 4NABA 3DKIA 5BYAA 5DDIP 3OQPA 3HYSA 2PV7A 4QDOA 4LJ6A 4WLFA 2TMGA 3G0GA 4OHMA 3WQHA 2CJXA 5KQSA 1ABBA 4AUEA 4C3UA 1V39A 2XE6A 1CUYA 2O54A 2JFOA 4Q00A 4QHYA 3TB6A 2O5EA 3UHAA 1HV8A 3DF9A 5T4FA 4DN6A 3W0LB 2PLFA 1BIFA 4XD7A 4XUGB 4MWBA 5GJWC 4BZZA 5EVJA 1N5RA 2OC9A 4KE8A 4NE9A 3ZD6A 2GBPA 2OBXA 3ZCTA 5BMVA 3IQZA 1SKQA 3RVMA 4CDGA 5ILOA 1TDJA 2IK8A 2JGAA 1E94E 2NPIA 1U3GA 1W8DA 4A4DA 1OZ0A 2Z1NA 1O96B 3WK6A 1UZLA 3K0BA 5KOYA 3AUJB 4W5WA 3OO1A 1YBHA 3E53A 2H2IA 5LNK6 5G4LA 2QV7A 3QI2A 4ZWNA 5I9TA 4QGGA 1OLOA 4BKPA 4TL8A 1TB4A 3TIFA 4MUGA 2O3UA 4WD3A 1IEWA 3OQBA 4U7PB 4FONA 3RRNA 7REQA 3H2SA 4CEJA 3P4YA 4HXYA 4HLQB 1GQRA 4PCAA 4V2UA 1UBLS 1I7SB 4U7TB 3Q3JB 1Z29A 4BUZA 2P9JA 3MWEA 2BMWA 1M2FA 4R16A 2OV4A 3D6MA 4I5FA 1X92A 3UYKA 4D44A 2XBMA 3GROA 2FH5B 4D1YA 1NLMA 1UKYA 1L7VC 3EBOA 1JWLA 3S27A 3HM9A 1GYQA 3KZ1E 4HQOA 1ULAA 2DJIA 3L5OA 4BVBA 2C82A 3H3JA 4CUZA 3CPHA 1OSNA 5CLIA 5EHQA 2VSYA 4HADA 1SIWA 4MLPA 2F59A 4JBHA 4BNUA 3O3CA 1M6VA 3U4GA 1FU8A 2VXOA 2XSZD 3WWDA 1H3EA 5B2FA 2ZUSA 2V3WA 3GH3A 1CR1A 1IAQA 3KSRA 3PNBA 3R6GA 1PVVA 2OL4A 5ERYA 4RZUA 3U4CA 4Q4AA 3NBAA 3WGNA 1SCKA 4YMSA 4FPXA 1N6NA 4JVOA 4LDRA 4YIKA 1FUIA 2XODA 3FDXA 4NDNE 3DNFA 3H18A 1ISPA 4MGYR 1BO6A 1AKTA 2GEVA 4HS9A 4DSAA 4C7OA 1JDVA 1JIVA 4GOLD 2IH2A 2FQWA 3PCXA 1ATIA 1CUFA 2Y2UA 3OEYA 4M0PA 2NADA 4R1SA 2F8SA 1J00A 4KVFA 2OZEA 3I28A 2B25A 2JEYA 1NR5A 3NRJA 4GX2A 5DSXA 4ZDWA 3EVTA 4Y0NA 4Z4CA 2A30A 4BTVA 2H7YA 3WNVA 3ZDYB 5DHUA 3DMYA 3TGLA 4BMYA 4EHKA 3ZDCA 3IKJA 1C30B 3KC2A 3VU9B 5KPJA 1H9BA 4K05A 1KK3A 1XCLA 2QD1A 1NSTA 5BWCA 4R2LA 1HT0A 4MVCA 2MTBA 3P4XA 2FETA 5JAHA 2YINC 1TI7A 3M2PA 2WTMA 3ILYA 3X0DA 2RHHA 4RM3A 3ZCUA 1G2QA 1RPTA 2WG1A 5ITZB 1ZOOA 3D3WA 3M81A 1BWQA 2E4YA 4MROA 1AF7A 4UEKA 4FSHA 4WFJA 1T2UA 4RPIA 3VR3D 1BE1A 3C7AA 4QZVA 1WY7A 1R8QA 2WDPA 4WL0A 3WRXA 4DDWA 1NC3A 5JC1A 4UEJA 3DDUA 5FPTA 4YRZA 2DERA 3K7EA 3WQRA 4NV3A 3ZJ4A 1JH8A 3AUFA 1O54A 2Y77A 4I3GA 1IJEA 2ZSIA 1OIXA 3NOVA 1DC8A 2QW1A 3JTEA 4N3GA 2ZSAA 5JHHB 1VMKA 2F2TA 2C4KA 3ONVA 4ON9A 4YECA 1UKEA 1A0OA 3BEOA 2X0FA 3ZNPA 3QWHA 1PEYA 1T6YA 1IFXA 1I7LA 5ESDA 2D8AA 1RYYA 1GKIA 2AMVA 3WTBA 2X7XA 1J1IA 2Q3EA 3IILA 4PPNA 1JAIA 3OX2A 4P4LA 1W85A 5DGIA 1F0YA 4MW5A 3QPVA 4CQMA 3PC8A 1H1LB 2YXEA 5B1HA 2Y0DA 3NHLA 2HOQA 3IL2A 4ZEOA 2F3UA 3IQIX 3V8BA 5KVVA 1M0TA 1TJPB 3UXHA 1GL6A 3C7DB 2NUAA 3JRWA 1XN4A 3VPSA 3E7DA 1VHJA 3HB7A 4JJAA 3QVOA 4EP1A 1ZDMA 4I6EA 1Z6QA 4FNGA 1Z5UA 4IO1A 4KGVA 1QGED 4JLWA 2GBCA 1MDFA 4HNAB 2HCRA 2QTVB 3IP3A 1Y1SA 5LN1A 2VCHA 1DDOA 2CL6X 4JP3A 3U5ZB 4XQGA 1X80B 3AERA 3B20A 3NBFA 4WE3A 3IJPA 4CLDA 3DE7X 1TK3A 1WPGA 4D9GA 3BL5A 4ACAA 1ZZEA 1BE0A 1YQGA 1P3Y1 1EFDN 2HCFA 1JLLA 1XTPA 2VDOB 1Z5VA 4JNCA 4DE5A 1ML3A 1UZAA 3K5PA 4PLVA 1U3CA 3MWFA 4FSXA 4UE3S 4NZOA 1KYTA 3FYDA 1FFXB 2WFAA 5DLEA 3KJEA 1T2EA 1U0RA 2BD0A 5FBZA 3CNHA 3R41A 4QOHA 1E5LA 4DWVA 3PK0A 1OD6A 4PVCA 1AV6A 4EY5A 1N2SA 1PQUA 3JQBA 2IY9A 4HI0E 1GRCA 1DXQA 1U1IA 3I64A 4WZAE 3NUGA 2VUHB 2BSQA 2A0UA 4QO8A 3LCVB 1GSOA 1SVUA 1XD9A 1ZUD1 4C7OB 1X2EA 4L8YA 3QJGA 1XMXA 2JLAA 1SOMA 1F3OA 2YZKA 1CE8A 3ZGYA 4BVGA 3VZSA 5REQA 1LPMA 3DZGA 5BRAA 2X0RA 1C50A 1KI7A 1YOVB 1OR8A 1PJLA 2Q49A 3FAKA 2J9RA 3R7LA 3AWDA 3LFTA 3V6MA 3KX2A 1WB5A 1JQ5A 3KQNA 4O1MA 1P29A 3MCAA 3U7RA 3QFFA 1RTTA 2DFPA 5CGZA 3WL4A 1IMJA 4BASA 1TM3E 2WUWE 1HLDA 3PYLA 1XG5A 4LMBA 2CJWB 8MHTA 3BDIA 5TJ9A 2R6R1 2GM3A 3QW2A 5AXCA 2XMZA 1KZ1A 4R7ZA 1O95D 4M7RA 1F0PA 3DGFC 2QG9A 2X8AA 4N3BA 4NS4A 4RLSA 1WBBA 3K94A 4GPD1 1V47A 2BGLA 3CS3A 2XRZA 1GFZA 3IO5A 1QRSA 4OLFA 3WJAA 1IZZA 1JT9A 2Q3BA 3QMWA 1UOEA 1W87A 4GVLA 1TYDE 3UGKA 1B73A 2FEKA 2VYCA 4E2WA 1U28C 3EARA 3R0JA 3L6CA 1OXUA 2PMWB 3Q7PA 1JB1A 3OQ6A 3RS5A 3LI2A 3QU4A 4KQMA 4DLYA 5EKSA 2IYUA 3MSXA 2ZYAA 1ONOA 3QWFA 3TJZA 1UKZA 1SKYB 2IEAA 4UTPA 4CXMA 1XPUA 1D8TA 2IP4A 2FF5A 4C0SA 4R0MA 4HDMB 2I87A 3K6KA 1I3LA 4JLDA 4B7AA 2YWDA 1R16A 2O3JA 3FPSA 3WSWA 1P4HA 2AL7A 1I0IA 4IDFA 4PONA 1EBBA 3LZDA 1QPBA 5DWQA 2OHVA 1J4AA 1G8SA 3PFFA 5AT1A 2VAVA 4HGPA 3X43A 4QWMA 1Z6PA 3FHOA 3V2GA 4LZAA 1ADCA 1N9GA 3FYUA 3G5UA 3BBLA 4UC0A 1RLMA 4RYLA 4Q3KA 4YAJA 5E6RA 2OB2A 5ETJA 1XMOB 1CY8A 1G3UA 3EA4A 2EWVA 1U6KA 2X3YA 4BMNA 4EHIA 4FQ7A 4X1OA 2P90A 4P1ZA 1VDMA 4GRDA 1XFDA 5FKJA 4DV3B 1XXHE 3LBAA 4DG8A 1UINA 1AZSC 4CF6A 1B2RA 3P9YA 4WNAA 2B1JA 3QG1A 5DP2A 5KVAA 3NBUA 4Z4QA 4Z5XA 2JLCA 4KHZA 4ZV4A 4Q4JA 4Q1AA 5ER6A 5A5FA 3SYLA 1TLLA 2PNFA 3DR5A 5F98A 2WQ6A 2BFFB 3AM4A 2EHDA 3KQMA 4M49A 4OQQA 1Y1LA 5KC9A 4GE3A 4IM7A 3Q85A 5AKEA 5KIAA 1RMQA 2MYNA 2X8JA 3TLZA 5JMWA 3H84A 2PA3A 1M67A 1QYIA 4HCJA 3BJZA 3DW1X 4UDYX 3BXOA 1MENA 1HTBA 4S1TA 4CKWA 3FBGA 4RHCA 2C4VA 5AI0A 1UBMS 4ZC1A 2G0NA 1XZIA 4NH4A 1BNCA 1RJEA 2Q21A 2DHEA 1WOYA 1Z25A 4RD0A 4G85A 4BEWA 2YMPA 1EX1A 3V8RA 3I3SR 4WBNA 4ZT5A 1GAXA 4LGVA 2IT1A 2H2FA 3EXFA 1GRNA 1Y3HA 2WWRA 1KORA 2FWNA 4HWSA 4Q9KA 4GWGA 2DXIA 3AK4A 1Z5NA 2ODWA 1YR8A 3ZU2A 1ATZA 2ZIZA 4WDQA 1DJMA 2CB9A 3GFQA 1BOOA 1YHZA 3RVKA 2DKFA 2GPWA 2JGLA 1C80A 1HFJA 2ZJZA 1U0FA 4KN9S 1TOAA 5AVXA 3E4CA 3EWAA 4NBUA 4JLKA 5IDQA 3ER8A 2J31A 4CQLA 1G4HA 1W36D 4Y2XA 4M0FA 5LDDC 1CS0A 3UB4A 2G1JA 4JJ8A 1JQKA 3OPYB 1YB4A 3K0KA 4IUYA 4ZI7A 2JAPA 2NVWA 1BH6A 4PV7A 2GX6A 5JQWA 4FFRA 4EA6A 2WV9A 2OE2A 1A8HA 2ZPTX 4FFLA 2E55A 3TLXA 1Z82A 4G4JA 2VUIB 4NG5A 3NT4A 2UZ3A 2HNBA 5DCWA 4NIMA 3DZFA 1T9AA 4UNSA 2QTTA 3UJCA 3IUMA 5JAMA 3DT9A 1CUJA 1US8A 4RQTA 2QMQA 2X2FA 3DXYA 3HZZA 1AV7A 2ZCJA 3D4NA 2XQVA 3CT6A 3SIRA 4O8ZA 1EINA 5DT9A 3WKBA 4X20B 4OI2A 1Q50A 3I1JA 1ZI8A 4CU5A 4MI3A 5HM8A 2H1LA 3D3NA 1N5LA 1JPJA 4Q1FA 2UZ1A 4HDQB 1UPFA 1CZLA 1JJVA 3I2HA 4B73A 1XA0A 1ZLYA 1CZUA 1Z7GA 3ND8A 1R4MA 2ERYA 3U48A 2GJ9A 2QAGB 1KYIA 2Z1DA 3ANNA 4BPRA 4N0QA 3OURA 3AVUA 1QIKA 5AKJA 3ZHBA 4O5AA 1J21A 4LY6A 1MO6A 3HR7A 1RCUA 1AK9A 3C98A 5E95A 4BNNA 5JLAA 2XUDA 3E58A 3T61A 1ZH6A 1ZX1A 4LNUA 4Y98A 5F4ZA 2ZUUA 4AVYA 3VISA 3R3YA 1XCBA 1R10A 3LLUA 2R6FA 3QLVC 2O2XA 3HKBB 2IW3A 3R5TA 3QE0A 4UM5A 1CIVA 1UODA 3LLCA 2XGJA 1AB5A 4G56A 2Y3IA 3NALA 5IP5A 2IF2A 2NACA 1P1RA 5C1OA 3RF6A 4DCCA 2AR0A 3QKRB 4W1PA 4ECAA 1EFRD 4ENUA 5JZMA 5LA6A 4LFCB 3RNOA 4AD8A 1BCSB 1A7JA 5AHXA 4CTMA 4ZZ1A 1H4QA 2IYNA 1DPGA 4MP6A 5IBRA 1AGYA 4QJ3A 2PSDA 4QM6A 1WCIB 3LKBA 5HKBA 4BIMA 1I3MA 1E9FA 3HU5A 5A03A 2RONA 4CM4A 5CFQA 4PNEA 2FUNB 1R66A 1R8SA 2A5LA 2VOEA 4GPTA 1OH6A 3R7WB 3RJTA 4TOIA 1CP3A 1PYOA 1N0VC 4OM7A 3TTYA 3NIDB 1HZZA 2HSEA 3WGQA 1YCHA 1XXHA 1R6XA 4YUYA 1TUBA 3NC4A 1NMZA 2GEBA 2H5JA 2NYUA 3O31A 1BEZA 4K1LA 5FPKA 3FZNA 1EWVA 2WD7A 4WGFA 3VR4D 3QE9Y 1IXYA 2V0GA 1P1JA 1TD9A 2JGFA 1NI4B 2GXQA 2PUHA 2Z56A 3TOZA 4RMHA 3EAFA 1R0KA 2QSJA 1N5KA 4O2BF 2JCSA 4M1KA 3UOGA 3QOXA 1NKSA 6LDHA 3UXYA 3QVUA 1EUDA 1T10A 4Z2YA 3VTKA 1JLRA 4BJ1A 4Y1RA 2ZYRA 2FSHA 1L3BA 4ZO9A 3MC1A 3VHRA 2CDCA 4BO8A 1OGYA 1WVGA 1CQIB 3KU4A 4IMIB 1A96A 1KMIY 4RVGA 2NZXA 4EVQA 2BM1A 4ZOLA 5DI9A 3K1AB 4DSZA 4EO7A 1JV2B 3O84A 3NAZA 3L93A 3O90A 3TGWA 4HNHA 3WLEA 3DYIA 1N7IA 1KKUA 3A3YA 1RJ9A 5JQGB 1M1YB 4A03A 5JZSA 1KQFA 3KQUA 1P2VA 2GDJA 2WKWA 4MUIA 3B3JA 3CE9A 4FUQA 2GEFA 2H57A 3IGFA 2ZIWB 2D62A 4IW3B 4B3FX 3GJ3A 2D1YA 5JYEA 2ZRJA 2VDKB 2XNJA 3CNLA 3V48A 3F71A 1NPYA 3QELB 2C9CA 3KOZA 1U5AA 1W2WB 4G86A 1WW3A 1XPRA 1MH1A 4PG8A 1WU7A 1QIHA 4LWOA 4NCBA 1AHHA 1BE6A 4I7EA 4NTZA 4F6RA 1M1ZA 3GLHB 3AV3A 4XDZA 3SF0A 1UXGA 1L9XA 3DGEC 4QUHA 4GSYA 1BEUB 1TC2A 2BM9A 1TMGE 1Q57A 2GN4A 2IUSA 3ZUGA 5J23A 3AKZA 4WCDA 4CDNA 4YJKA 4MB6A 3PPXA 3CBGA 1GKYA 1YE3A 2C77A 4E7PA 1PZFA 3VKFA 2ZZMA 1PDOA 1T6XA 2C5EA 2JH8A 5J5CA 2C0QA 4XRRA 4DKJA 4I8XA 3NHYA 1HDEA 4KREA 1KKLA 1RR6A 5LLSA 2I2CA 4LYJA 4HGZA 5FR1A 4V0RA 3CRVA 3QGMA 1TUIA 2WWWA 4JL5A 3ZU4A 5M2QA 2QQ5A 1TK2A 3O0DA 4OKSA 4BJHB 4I55A 3ZN2A 1JSZA 3QF4A 3QXCA 1P60A 3BIXA 3HH8A 4OU5A 4DIOA 3U4MA 3CR8A 2PXHA 3A3KA 4A0RA 2PUJA 1KH3A 1JVSA 1M1UA 1M8FA 2Q4DA 3LD9A 4UDNA 1TCVA 4R8SA 3AF0A 5CYOA 4E2XA 2ZR8A 2E85A 2LTAA 1OI7A 3L77A 2F43A 3C2QA 4F93B 5K4GA 1GZ4A 1N3IA 3A6HA 1W88B 2GXUA 2EX1A 1DQNA 3RSZA 1NQUA 1J2RA 1LF5A 1QJ4A 3BXEA 4M6WB 1F2DA 4Z1MD 5IC4A 4F3NA 2BJHA 1USWA 2CXXA 2H2GA 3O7WA 2GNAA 4Q9HA 4WZZA 2Y9PB 4EQ6A 4RKWA 5EWJB 5CA0B 1S89A 4LISA 4MKGA 5BV7A 1XQYA 1NVUQ 4IILA 3VH4A 2FPXA 1MUUA 1HL7A 1EEHA 1GQQA 1ZJ4A 3C5EA 3MXOA 3VQTA 5EZ5A 2AG1A 1EXDA 3QJYA 4GKJB 1KRXA 1SBQA 1EGAA 4RZIA 4GBGA 2A88A 2YFKA 4YDRA 3AETB 1ZNZA 3R0QA 3TD6A 5IYZA 5J2TB 2B83A 4ZMSA 5C5IA 4H08A 1RADA 3ETDA 2F1JA 3EPPA 4MI6A 2GLUA 4WW0A 3ZQJA 4RV4A 3ITKA 3N9IA 4X1KB 4TV8A 1ZNWA 2O1EA 2NLOA 3PRHA 5IVHA 3TW8B 2PX6A 3CQ9A 3C6YA 2JEOA 3W2TA 3L0YA 1Y37A 4O4JF 2WE8A 4BNWA 1VIAA 3WGHA 2VYVA 2ZJBA 1SAYA 2BM8A 1FLVA 1X42A 2KE5A 2XECA 1X3SA 3A1UA 4N3CA 4O4HA 2FUG6 3BUSA 3VO1A 1KKMA 1RWMA 1U8EA 2WF7A 4J90A 4JEHA 4Q1DA 1YR2A 3P0RA 3VHLB 1L7QA 4D4MA 4V1CA 4TKUB 2H2WA 2O8FB 1W7AA 1NQVA 1ZM2A 3G5MA 2XNKA 3LVRE 4G9GA 4BZXA 3A37A 3IUBA 3OU6A 4BKMA 1YWGO 2IP1A 3IBGA 1FRQA 1F9EA 2C3UA 3ZE6A 5DTRA 2WSSA 3ZH9B 3ZX5A 4DDHA 4UDOA 3EEOA 1TAUA 3FAZA 2VT6A 2EZ4A 4FFSA 1H23A 3V8EA 2ATXA 4CL0A 4KHPB 1NVVQ 2I4OA 1ENYA 3OBIA 4BFTA 3IKTA 2GAFA 1NMQA 1U2DA 3ND7A 1GCIA 1PQ4A 1F14A 1PO7A 3LOPA 1BMTA 1JBKA 4HUJA 2KS6A 4LXIA 1KSFX 3OZUA 3PHLA 4S3MA 1V2HE 1VL5A 1YH3A 3NRCA 1DRWA 4X5OA 3V4PB 1F4VA 4X85A 2XCUA 1K3FA 4A2QA 3IBYA 2Z5GA 3GWGA 4MA0A 1A97A 2YWGA 5DTJA 2OCAA 4OAPA 4RVSA 2CSXA 3WIEA 3NTUA 4JT2A 1YMUA 2FLKA 2NAFA 1I5OA 1KP2A 2NZYA 2J32A 5IAOA 3OM0A 1DJPA 2R1VB 1CEQA 2HRZA 3E0XA 1PBTA 3GMDA 3HU3A 3E3LA 1O95C 4N82A 4QUDA 3ZCRA 4PGFA 2JAUA 2AS0A 3HRIA 5HNKA 1ENPA 4LJ9A 1O5OA 2BELA 2HGZA 2ZEJA 3AXTA 1ZUIA 2RK6A 2B37A 1E32A 1SO8A 1Z4MA 4N0MA 4OGFA 4N39A 2BKLA 3HUEA 4MMZB 1X8XA 2QG4A 3RTDA 4YCMA 3A3OA 1CUBA 1NFRA 1Y8RA 4GF5A 1I6MA 3OT4A 1EWRA 1GYPA 4DMMA 1Z8FA 2X4DA 1GTL1 2ZWIA 3HR8A 3CNNA 4BO5A 2JGJA 5L6LB 2A5YB 1JG4A 1VSUA 3KQQA 2XZOA 3DLHA 3GAZA 4LAFA 1WSAA 3BA6A 4PSVA 4KQ9A 1RKBA 2NO6A 5CGQB 3KZMA 4JBIA 2J7PA 2QX4A 1S2LA 2ZJ7A 3JWHA 1FDUA 3QNUA 2YQZA 3N0WA 3QEJA 3Q3IA 4JYCA 4O4IB 1U80A 2PKQP 3OP1A 2RB4A 5K8VA 1TJ5A 4WOKA 1QKKA 2W4IA 3LE8A 5JFTA 1RQ7A 1ZSNA 3KD2A 4TXNA 4RVDA 4FDUA 4WXMA 4C14A 2LE0A 1P1HA 2XVMA 1KFBB 3FYHA 3G8DA 3IMCA 3P0EA 2WHEA 2Z3WA 4TKZA 4D9CA 2GCOB 1TU4A 3PE3A 2SECE 2OXCA 3AILA 1CVLA 2XWSA 3QKSA 4LSGA 4CIBA 3K6SA 1GZHB 1UANA 5DTIA 4AJNA 3NBZC 4HY3A 3EFBA 1OYYA 3BB4A 2INGX 1X39A 2DETA 3C1OA 1S2NA 3WKDA 3ZDBA 2ZB8A 1XZGA 1FDOA 3A1VA 3BRWD 3OOWA 3ZIAD 2E5LB 3H0KA 4YMWA 1KTIA 4HZIA 2PSSA 3TL3A 1VBMA 2ISQA 3ZHVA 2ADMA 4Z51A 1ZWLA 3LMKA 4ZAYA 4F3YA 2O2JA 3V7YA 4CN9A 3CSDA 1Y3IA 3M89A 3W9YA 2FPSA 4MLZA 5CBPA 2LPMA 2JLUA 2QD5A 2Y1FA 3KYCB 1TJ4A 3RASA 2VXCA 4QGAA 2QJTA 3SYTA 4BVAA 4PF1A 3T7AA 2E6UX 3EGCA 4HV4A 4CLOB 4ZIRB 4K9MA 4KQ6A 2C42A 2HDHA 2O2IA 4WXRA 4A82A 3WLOA 4ED9A 4C30A 2RCYA 2HPVA 1SD2A 2VH2A 2W70A 1QX3A 2WT8A 2H1VA 4MUHA 3A8TA 4CE6A 3L05A 3EXHC 3N39C 4GYWA 4MULA 1PFGA 4HQFA 4X3PA 4YRKA 5F64A 4D4GA 1JZTA 1YA6A 1U3FA 3OP4A 1DMSA 2W2LA 3TQFA 1E69A 4PSAA 1G18A 1XMVA 2JGEA 2QUKA 3EULA 1Z3CA 3AINA 3H5TA 4RV9A 2NV6A 1J7KA 3ZDDA 4ZU6X 1KAGA 3HE3A 2HHAA 3P9RA 3OZIA 1GT91 1WTCA 4KR9A 3S6JA 4HT3B 4Z4IA 1DKNA 2WRZA 4YMIA 1OFHA 3VZDA 1Z2NX 1ZGHA 4EUFA 5LP6C 1JFLA 2PKXA 2VQ3A 2ZJ0A 4GXRA 2FX5A 3ZE0B 2GUGA 3TTUA 2OG2A 3G9ZA 5JXIA 4RCVA 4ZZ0A 1H0SA 4P92A 1W36C 1TQHA 1SC9A 3TLBA 5CA1F 5JH7B 1FOEB 1HGXA 3FPCA 2W5UA 3K09A 3MD9A 4HN2A 3SR0A 3N87A 4BEJA 5TGDA 5LQJA 1DWOA 2EFYA 2H00A 1YQWA 2CJFA 2C2GA 2OZLB 2XDAA 3KPVA 3G0CA 4M54A 4BMZA 5E6SA 3HK2A 1YJBA 3HSKA 5FWNA 2QLTA 4QEKA 4OQLA 3QLTA 4OGLA 3IR7A 2UZIR 3SBDA 1OFTA 5KYYA 1RZRA 2ZYWX 2PWZA 2WSIA 1AD2A 5JT1A 4NJEB 3LC7O 2ZR7A 4IHJF 2IA5A 3ZY3A 1YMQA 3VVBA 1YZNA 1YOBA 7MDHA 1VTKA 5DV9A 1I10A 4KQHA 3U9LA 2A9OA 3O83A 3ZU5A 4M8NE 2B7CA 3SQNA 4YJDA 1DTWB 2BFCA 3M6UA 4UXIA 1X6VA 4IIJA 5IUKC 4POOA 1YKGA 2D2IA 2AXNA 4EG0A 2VTDA 1ULZA 3D6VA 3BPSA 3MRSA 1YQDA 3EWNA 3MINA 1JR3E 1IZYA 1PT8A 2ZPAA 4N01A 4LG1A 3TLGB 4EMBA 1KI8A 2KYRA 2FN3A 3AEUB 3SKYA 4QYIB 3GRYA 4FZ5A 1DLJA 2IXTA 4PZYA 5IC5A 4AUKA 3CLVA 1GUAA 2X22A 2QROA 5DB4A 3VGJA 3Q8XB 5BN4A 1RKVA 3DMDA 2QB5A 2R6HA 3AVPA 2YZNA 3LW8A 3VR4H 4A9AA 4E5MA 4F84A 1NZJA 6CHYA 2X8LA 5FOUA 4CMHA 3QLJA 3VYUB 1ZN7A 1QPZA 1EX9A 1T5BA 2BGNA 4II7A 4BO0A 5K8IA 1H3NA 2ILVA 4JNKA 1GZ7A 2IUTA 2OGTA 2VSOA 1XA3A 3RFUA 1UUFA 3AWIA 2EQ5A 4TMZA 3U44B 3DMHA 1KS9A 1KYWA 2C83A 1YZKA 2FQXA 3FLBA 1HOTA 1AOXA 2I4TA 4KYVA 2VG8A 3FUCA 4I1IA 4NX2A 1OTHA 3FCXA 2CDNA 4H35A 1P44A 3G2OA 1CUIA 5K3OA 5TV2A 4Q4HA 1A9OA 3E8XA 4M9UA 4UUBA 3NIWA 3SR3A 2XUFA 4DLVA 3M3PA 5A2GA 2NYVA 1EZ1A 3EZ9A 2QPTA 3TZHA 2I3BA 3A10A 3CONA 4XX1A 1KIAA 1LFDB 1EX7A 3NORA 2PSHA 1ZM4A 1XELA 1T4CB 3NV7A 2A35A 4WBSA 1R9JA 1H22A 1CUGA 4LRWA 3SHWA 4UNRA 2JIMA 2RHMA 3OCZA 2ODPA 5JSYA 5GONB 4BNMA 1EWKA 5ALXA 4B3RB 2H4XA 5BSWA 1ZITA 2AMLA 2I2DA 4R6XA 5KTPA 2J5QA 1P33A 2DWOA 3TM5A 1U0EA 2ATEA 2PX4A 1E6MA 2F1KA 1DADA 1RQGA 4MW6A 3KQWA 3GJ6A 4BQSA 1PT5A 2FPIB 3AONB 3ZXUB 1THGA 1YBFA 1E6WA 2X9QA 3EIXA 3MTBA 1E92A 4HB4A 4ZO7A 1K7EB 4X8HA 4DSOA 4DQUA 4ZYWA 3M49A 4OH7A 1KK2A 4LJ5A 1NVMB 3DKRA 5IM5A 4YUWA 4B6JA 4IINA 1GZ6A 4HPXB 3U4QA 1JDTA 4PFJA 1NXPA 1BH2A 1JEEA 1RI3A 2EX0A 3LKZA 3QVGB 4I50A 2G8NA 1EE9A 3U39A 5IZCC 1NU6A 3NX4A 2HMSA 3TEFA 1UJ5A 1YS7A 1B1CA 1OMOA 4HP8A 4UCWA 4OU4A 3FCCA 4D5GA 2VDJA 4PX5A 3Q2KA 4U7JA 1SN7A 4ZJZA 2HJRA 1UQRA 4OHFA 1W93A 1Q11A 3NAQA 1G6Q1 3TIIA 2JBAA 5IK2D 5J2UA 3DBLB 5FF9A 3WL5A 1T6BY 1IOVA 3PR1A 1H8HD 4IDNA 2IY8A 3QVTA 1BKYA 1OWNA 2B36A 4QUBA 4LXQA 2H1RA 2PSFA 4IS2A 4MCAA 1RLUA 2NU6B 4FCWA 3LG2A 5EYPA 4NONA 1NXOA 5C37A 3I5XA 4PWYA 2PMDA 3IX7A 1L3CA 3T8YA 1B6GA 4UBMA 2WUDA 4V03A 3RO7A 3ZDQA 4UE6A 4ZK6A 2HDWA 3PE4A 3E5HA 4NU6A 2WIJA 4ZT3A 4PQYA 4F1JA 3WXMA 3SQDA 1DBRA 4CGYA 5BRJA 4NARA 5EHZA 4BUJA 3W8DA 1HTTA 5F5LA 4OKNA 2XBLA 1A9TA 1J2JA 1B26A 3L1JA 2CMGA 1T5SA 2RJ3A 5I01A 2C2ZA 1IDOA 5BRNA 4G81A 4NQRA 3OUTA 1YVUA 2O50A 2VKTA 3G5LA 3I2YX 1OREA 2CLDX 4ZPJA 3A4TA 3ND6A 2ZBGA 4QQFA 3W8EA 5IZ4A 1M33A 1FYFA 1F9AA 4JLAA 4RS3A 1P3DA 1ZNXA 4L0MA 3A4LA 3UEOA 1R9NA 3RLIA 4EG3A 3HJAA 3D7RA 4TKMA 3VO2A 1JAXA 5B57C 2K7FA 4KQWA 1F1JA 3LUAA 1JR3A 2YV2A 3ODGA 1FUUA 4HGQA 2VXYA 1YRAA 3F4KA 2OWDA 5EZYB 3GD7A 1CEYA 1TA9A 1HF3A 1PGNA 1FC0A 2PD3A 3L7MA 1E4EB 1Q6ZA 4PU0A 4WI1A 1OROA 3M1YA 1RXIA 1J8QA 1HDCA 4R1TA 5DGTA 5K7SA 3ENNA 2ACVA 4H7IA 2QRVB 3HXPA 1IM5A 2IDZA 1VB5A 2W6ZA 5AHRA 2C7GA 4I5GA 4B3GA 2I9KA 5DBGA 1DLIA 3TR6A 4YR9A 2II6A 1W2GA 2PNJA 1I3NA 1DKMA 1IHOA 3HDGA 4XFJA 3MIZA 2C3YA 5EI5A 3RUIA 3V8PA 5H81A 4ZICA 2W2XA 5D3ZA 5CITA 3K15A 1H65A 1Q19A 2Z8YM 1NX9A 4TQUS 1JQAA 2G9VA 5DLPA 3TUZC 3ENZA 3HA2A 1NF9A 1AZWA 1FP7A 4D96A 3LY8A 3ELBA 1E1RD 4KMMA 3UAXA 1FYXA 4CEHA 1PR4A 4HFNA 1T1RA 4YRNA 5DN9A 4N9WA 1AMOA 2BFDA 2VYNA 1QYRA 1XEXA 3SF8A 2J4CA 4G0PA 2ID7A 4KBFA 1MIOB 4BTLA 3ZI4A 1GG9A 1RWWA 2WZQA 1XJ0A 3CIOA 3TIGA 2SKCA 4AKEA 4WK4B 2VJMB 3QOFA 2XE7A 4U6QA 4P98A 1DAGA 2O2GA 4QFDA 4KYIB 5JS6A 1RZ3A 1VJ0A 3IHLA 1O4VA 4JT4A 4PLHA 1QGUB 4PYKA 1MV8A 3TXYA 5LQUA 1VSBA 1D2MA 4O6VA 2CD9A 1U3UA 2P1ZA 4L4ZA 3IAFA 1N2CE 3PQ6A 3U0BA 1T2FA 3DVAB 2VZ0A 1P0MA 4S1OA 1TRKA 4G84A 3ZW9A 3PJFA 4JLVA 2VSFA 5KSZA 1ZL0A 3P0HA 1BHO1 1RM3A 3D9QX 2R4UA 3MAGA 4QPCA 2H4WA 2EATA 4N3NA 4D0NA 4LJYA 4NLLA 2BHTA 2Y4NA 1J5PA 3B6MA 1KR5A 1PL7A 1UAGA 1EE1A 1ZJJA 2VTEA 3DKVA 3EXHB 4ODIA 2ZRFA 5EUCA 1RXEA 4ZOQI 1N0IA 1MJGA 2EP5A 4H1UA 1YGYA 1HYEA 2VPPA 3W1EA 3AUKA 3Q3VA 1PJZA 4MSUA 1W5AA 4Y6OA 1TVKA 2FX2A 3RSSA 2R44A 1T1IA 1V16B 4J7UA 4L3WA 3JV7A 4M1OA 5G0VA 2UVQA 1KWGA 4QXMA 4L5JA 1H0RA 4WY8A 5TPWA 5K5EA 4KMOA 1RWPA 2W6OA 1H1DA 1UC8A 4NJOA 4FJ0A 1SUIA 2BZ0A 4RV5A 4LCEA 4MPTA 5E0OA 3KHSA 2Z6VA 1R15A 1IQUA 2VNHA 4ZI5A 3DE3X 5A02A 1RWNA 1HFKA 1W36B 4DQ0A 5EUBA 5C8DA 1ADBA 3LCCA 3V8MA 2Z3ZA 4P4NA 2XTZA 4YMGA 5EIXA 1U9YA 2YCBA 4RQUA 3R3XA 1EFHA 1SCDA 4RJTA 1RRKA 1ODCA 3IEKA 4EKNB 3VNVA 3F8TA 1V8ZA 3ITDA 2WU0A 4LHZA 4JENA 1I7NA 1ISMA 1Z2DA 3KQSA 3NS7A 3CVYA 4AZ3B 3PQ3A 4M1SA 1FTGA 4ENWA 3PQ5A 4XFKA 3W2EA 4Q9NA 2QMHA 1YUBA 2ENWA 3RTEA 4EARA 3OQJA 3C3MA 4UHJA 3KQLA 2Z6QA 2DHQA 1UMCA 2HMWA 4OAOA 5JWOA 3SS9X 1DC3A 1WXEA 1ZVJA 2PYZA 2Q1YA 3E4DA 4H0NA 4UPVA 1SFRA 1J0AA 4UXHA 5K3FB 5AW9A 4CTKA 3WB1A 1P4JA 4OQNA 3NTOA 2NWQA 3ESXA 3A2NA 1G8PA 2E9SA 5EKUA 1A50B 3LPCA 3QH4A 5FHQA 3SE0A 3IERA 1WKVA 1M9NA 1QF9A 1FLNA 1RZVA 2J6HA 3A32A 4AQ7A 2IS1A 4QBKA 1Z18A 2YJ4A 3AR5A 5IXSA 1MABA 4X24A 4NFLA 2PUEA 3FVVA 2JEZA 5TR9A 4L5IA 1TFRA 4US1R 2CJPA 1RRPA 1SBYA 1ZA1A 2R6JA 1VE6A 2WLSA 5B2EA 3U7EB 1K3UB 2CVQA 3VSEA 4QU9A 1QGAA 2WFZA 5EP3A 3RVOA 3PWKA 4QT0A 4AJ2A 4IOKA 4JU9A 3PT5A 4GC5A 4H1VA 1B8NA 5IH7A 1LDEA 1E3IA 1VJCA 3L40A 3R0XA 1C7QA 4GPZA 3BE6A 2BKUA 4K86A 4UBNA 4PPFA 1K66A 1II0A 2XMGA 4UTXA 1S3FA 3BXZA 5D1HA 1A8PA 2JFHA 2J41A 4RW0A 2R7NA 3EOBI 1GSAA 1T3TA 3T5DA 1W75A 2JF0A 1LX6A 3OC6A 1ARZA 1EFPB 3FW1A 4KZPA 3NH6A 1PFKA 1L5SA 1DQPA 1DX9A 2I8CA 2OYSA 3C3AA 4OI4A 4Z8XA 4C7MA 2GM4A 3CEPB 2I3ZA 3FE2A 1ZGAA 4CQMD 1DGQA 1FX0B 3RPEA 4KQFA 3G0IA 4KSBA 3I92A 5IG2A 3EJWA 5E2IA 1LQ2A 2IUYA 2B5WA 5IN4A 4CM3A 2CLKB 2DQYA 2BT4A 5HIIA 3WISA 3FA2A 2FW6A 3CRZA 2BF4A 3T4UA 4BP8A 2QE6A 4BLWA 5FI1B 5KYKA 3RYIA 1Z0JA 1E1YA 4F4UA 4YJFA 4DWJA 5CURA 4V24A 3QLUC 4PHTA 4GPEA 4JGIA 5B12A 2BKXA 2XUIA 1UDXA 3IMGA 1U4NA 3OJOA 4B6EA 2IHUA 5EXXA 5KYXB 1OFGA 1VJTA 1Y42X 2A9RA 2CZGA 4O2BA 3OPQA 4XDGA 4I3FA 3V80A 5ESXA 3H04A 3SCZA 3WOVA 2RKOA 1G21A 5KJCA 3SY8A 1ZCZA 5CJJA 2Q1TA 1N2CA 2XMBA 3A06A 5IBCA 1VBFA 2RH9B 2SKDA 4RBNA 4F9FA 2JAHA 4D56A 1O77A 2AQ8A 3SX2A 4B3SB 3FUTA 2AJCA 4KN6A 5K3CA 3HYNA 1M73E 2XBUA 4V39A 1LLFA 5JG7A 3K6RA 3G7UA 4C6RA 4RKEA 2QMZA 1FF9A 1YB7A 2XYPA 4FNOA 4MLCA 5HEKA 3CEMA 3M83A 5H1YA 1Z6GA 5B4UA 4RFLA 2VT3A 3A1WA 4MKRA 4B6SA 5AW6A 2QRNA 3EVGA 1DB3A 1LQUA 1DG1G 1MFZA 1Y3CE 3TZEA 3D02A 4IF6A 3MJCA 4RXUA 2QI9F 3DDSA 3RC1A 4D4LA 5B64A 5J4LA 1BVUA 4UQLA 3FOWA 4R7GA 3H6GA 2DZDA 1A76A 5DCUA 2YIDA 3IDZA 2VJNA 1Z33A 1BKDR 3LXRA 5LBIA 3BL8A 1VOTA 2DR0A 3EQ2A 4F6LA 3GRZA 5AVUA 4S0XA 3RNLA 1R6TA 2WHYA 3E23A 5KU1A 4CLRB 3ZGVA 1XWIA 5FO0A 1XV5A 1Z36A 1D2RA 3FCSB 5DNWA 5BW5A 3QX9A 1MAUA 5EJIA 4MW4A 1V1MA 4WOJA 4EG1A 1L9KA 4OHBA 5BQOA 3KUUA 2AK2A 1AB6A 2R68A 1MPTA 4MRPA 3CVVA 1O4WA 1H8EA 3AV0B 4MYSA 2CCKA 2GJ8A 3WLPA 1SOWA 1T9ZA 2LR0A 4AO6A 3AG6A 4FX5A 1PGQA 3QWIA 1TA4A 5AK0A 4RLFA 3CVOA 3LKVA 4TTTS 4XWTA 5EXEA 5T4HA 3SJ7A 2VQSA 4R2IA 4RELA 4ZCIA 4X65B 1BD4A 2RB5A 3AY3A 1MNAA 2D2EA 3ZE8A 3MFYA 5EAIA 4CYMA 3REQB 1Q2UA 3D3QA 3EQ6A 4FNAA 4YONB 5FHRA 4ALIA 1LBIA 4Q21A 5MGBA 4NU8X 2W8BA 1WQ3A 1UOPA 3KVVA 4TRJA 4C4AA 2CK3A 4J7AA 4PGGA 4V3BA 1VMAA 2X77A 2J3MA 3GPBA 1GUBA 2FFJA 3LT5A 2H08A 4P35A 3T5GA 2JPDA 1NF2A 2YUTA 3BA1A 2ZYTX 2REQB 3AQ4A 2VHCA 3O38A 4ARCA 1HSOA 4UE2A 3FJ1A 4CEIB 1Q0QA 5D5QA 1OXTA 2PY6A 3M9LA 1QYWA 3PITA 3QUBA 2YVKA 4FD3A 4HEHA 4WK2B 3STUA 2F3SA 4FXOA 3ZHYA 5L53A 4HLDA 1WV1A 2LD4A 3EEQA 4CG0A 4CG3A 4BE7B 3ZDXB 1PX0A 1WF6A 3GUVA 2HSJA 3ROPA 1Y4AE 1RXCA 2Q6OA 2ZI9A 4PZ0A 3BGWA 3I1FA 1Y4ZA 1FW8A 4WY2A 1ODSA 2FMIA 3ASYA 3D4PA 4DABA 5IDXA 3CKLA 3ECCA 1IN6A 1T2AA 5FOSA 4RK7A 1LGYA 2ZRLA 1QM5A 2XMSA 1JEYA 1N36B 3GFRA 1OBOA 4RMJA 5A4MS 5LWQA 3UZUA 2BFPA 5E1OA 5IN5A 5BOSB 5AWFC 2IHBA 3DOHA 4HVLA 5JJ5A 3THXB 2CBZA 3GYGA 1KY2A 4M37A 4GX1A 2ID9A 1RAHA 2PGAA 5EY5B 5KSOA 2PR2A 2D2XA 2HHCA 3Q3GE 4G5FA 2V03A 4IDPA 3TLKA 1UFRA 2DFNA 2AF4C 3GRKA 2WUFA 2YJ3A 4WN9B 3I53A 5AVTA 4QNRA 1ZC4A 4Q7MB 2V0NA 4ESVA 2REBA 1CUHA 3CT4A 2O3RA 3PS9A 2NM0A 2LV8A 4LV6A 5F1KA 3UHJA 3L8FA 3QTTA 3ZTYA 2VRCA 1M2VB 2MYTA 2NUBA 1PWEA 4OOFA 4YN3A 2ZU6A 4NJMA 2N1BA 3JATA 3NW9A 1RU3A 5EHXA 5I8PA 2CXRA 2G5TA 2WTEA 3N0TA 3DBRA 4X92A 5J43A 1ECGA 1P81A 4D9NA 1T5OA 2F1HA 2PVCA 1QH1A 4N1AA 5C46F 4H1TA 3U1TA 4A36A 1TM2A 5AVQA 4WFKA 4I4TB 3BDAA 2J3QA 2YW2A 3FDZB 1DBSA 1MORA 5MN6A 1YVDA 2XKBA 2BGWA 2JKVA 3RH0A 1RRFA 2H85A 3VH1A 1W4LA 4ZDKA 1MLDA 1KEVA 2NVUB 1H2XA 5I45A 4YX9A 3CZ4A 3CVWA 3QI7A 1AC5A 1DEHA 3P52A 5FL3A 3PXDA 3ZS8A 3KZXA 3MFQA 2VJDA 3I9V6 5BVHB 3FB1A 3IRVA 3FNFA 3H2IA 3T15A 5C80A 4KXQA 4NOMA 3LSYA 2PO7A 4UM9D 3FCAA 5CRIA 2IPMA 5C1BA 4HNVA 2CXUA 3C14C 5K6RA 2PHZA 3FOEC 3COYA 4J9UE 5BQPA 2PBLA 5C8YF 1C3OA 3A6ZA 1MOPA 3W6OA 4C0XA 2JKYA 3N1UA 3GNLA 4BQEA 3FNGA 1E0SA 2RE8A 1J70A 5LZ2A 4YAEA 1QAQA 3GN1A 5FQNA 2B8WA 2MINB 1F8XA 3KCQA 1QWSA 1CHDA 4Q15A 2G28A 4R9VA 4X64B 3ZBPA 2O7QA 4QYXA 4YEDA 3H5OA 5LNK1 1N34B 2OM6A 2N1MA 5DNDA 4ZT4A 2CLHB 3G1UA 2PT6A 1UCFA 2QNIA 4W1RA 4DA7A 4TVOA 3HMKA 4KO2S 2C8JA 4URFA 3WO0A 3G0DA 1UAYA 4INPA 3TAUA 3DR3A 4ZZIA 5BWOA 3VI4B 1ISGA 1R0RE 3I6ZA 1RWBA 521PA 3DMTA 2DPLA 4REOA 4UAUA 2GYUA 4A0HA 4BC1A 1JDPA 1RJWA 1K6JA 4BCCA 4BGUA 5HMMA 4N8EA 4QU5A 1PJAA 5EFOA 1UK7A 2WMYA 1WDWB 4KFUA 5LD2C 1QUFA 3KB2A 2IYAA 3FHJA 1T8RA 1AS0A 5JNVA 2IYTA 3A6KA 4M1TA 1UMKA 2CXNA 1LPNA 1BTOA 1BXGB 3LBNA 3TYXA 4D4HA 1CB0A 1BRTA 4HDRB 3PDWA 1G6OA 1FFDA 1NR1A 4I6JA 5K0GA 5AI8A 3H9JA 1JLSA 1MG5A 3IEUA 2XQJA 2FRXA 3DT8A 4P0QB 3HCCA 1A9ZA 3KALA 4E46A 3D4BA 4X8OA 4DIKA 1V37A 1Q15A 3JARB 3QV2A 4OCZA 5FPYA 1OWMA 3G89A 3IQDB 4L07A 1XCMA 2PGOA 2R9VA 4PX9A 1GSHA 4EG4A 1FRFS 1CUUA 3WLRA 3OMXA 1JDBB 1BA3A 1MG0A 1N6HA 3DEIA 3NTQA 3PHGA 3JX9A 4YP5A 2XGGA 4M0LA 4L5YA 1FW6A 1I2DA 1GZDA 2PBFA 5A1JA 4C43A 4ACBA 1WMBA 1FSFA 1UL1X 2FHPA 4A0FA 4HAZA 1VL1A 1GXSB 1WD5A 2VHWA 2DM6A 3OD1A 1YR6A 2CLFB 1HOXA 3DB1A 3PQ7A 2X4IA 4ASUA 1VFPA 3GUZA 1QOQB 1ZHHA 4ENPA 4X6XA 5I7EA 1KSJA 1DQZA 2ZJ2A 1GA6A 3DVRX 3N2YA 3P2OA 5CM2Z 1C1XA 1E2PA 4RZXA 1ICEA 9MHTA 5JVDB 4DLUA 1VHWA 2PTGA 4KWEA 4BZWA 5K0LA 2XITA 5LC1A 3L84A 4UBIA 4RSGA 3UAVA 1E9EA 2WTNA 3JYPA 2RGUA 4HWRA 4MKXA 1UJ6A 4N49A 5AO9A 4EJ2A 1H2WA 1PDVA 3AJEA 4LXUA 3GJ0A 2HMTA 2IV2X 5CA1A 4MVYA 2RHJA 3K6JA 3RS3A 3O1HB 1EK0A 3WWPA 1UM9B 4ZA2A 4M0DA 4AP9A 2O2DA 4EPWA 3FLAA 4IHKA 4UHEA 4ER6A 2CXSA 3P32A 2B61A 2JLQA 5TF4A 1ZD1A 1QJCA 1GG5A 2Y8EA 3KSUA 4QJIA 4MKFA 4WK6A 3EPLA 1RLJA 3NKVA 4R8VA 1KJQA 3V7FA 1SKAA 3T3PB 3WGVA 3NAMA 3RAFC 3DUFB 3QU5A 3QW4B 1YBVA 4IP0A 4YJGB 4EUNA 4AX8A 1AKUA 4R8RA 3GZJA 4C7KA 5B6JA 5K51A 4EUKA 3E03A 2FEWB 3T0FA 3ZWXA 5FYDA 4AG3A 4FOSA 1XRSB 2D1RA 3X2SA 2JFPA 3SQLA 2PZKA 1AGPA 1VCIA 3D54D 4A26A 4DNOA 2QA5A 1GDDA 1WP9A 4EWLA 1TCAA 4YV7A 2BMAA 4M1ZA 4JEMA 1EXMA 3ZCQA 3HZHA 1Z45A 1NJ6A 1AS3A 3DCIA 4G41A 1JF8A 3ZCSA 1ONSA 5SICE 2JIQA 5IXJA 4BHTA 2XXAB 2WWTA 4KXVA 4QREA 3ZZTA 2ZCUA 1NW3A 2OESA 3U4IA 3SSAA 3DBVO 3IEIA 5GVSA 4G3XA 4PYRA 1S01A 1E2FA 4ETIA 4FYYA 2CVPA 2OHJA 4P3KA 4DQKA 2W43A 2P6MA 5LCXA 3WRXC 1IC6A 1RQXA 4R9SA 1QYCA 4QU0A 2CBXA 3OIWA 2ATIA 4JZKA 4O08A 1R6DA 3NGMA 4LJAA 3VBCA 4PAWA 3UWPA 2VIIA 3WSVA 1AUXA 3LUPA 4UNQA 3PKZA 3SVLA 3CX6A 1ZK4A 3HFJA 1V11A 1JAHA 1MX9A 1XCOA 2YYAA 2AG8A 2C7VA 2IDJA 3CKKA 3KSBC 3ASUA 5K0JA 3O21A 3L7KA 4AY6A 2JGNA 3WFZA 5LOVF 3R9WA 1I7PA 5C2JB 1G17A 2BFAA 1EA7A 4WEOA 4E09A 3F4BA 1CLUA 4FSDA 3W7AA 1WXIA 5B7GA 3PC8C 5JCPA 2ATCA 1RYDA 1O87A 3K0HA 1TCBA 1Z39A 1NWHA 3QTBA 3OT1B 4GQIA 5KQPA 5LXTB 1QFSA 1T9GR 5ARDA 4QOFA 2FWBA 1DT5A 2VPTA 2ZWVA 3QXGA 5TNXA 2ZQYA 1RLOA 1L7AA 1VYVA 4O59O 4YLYA 1VLJA 2PEYA 1GSIA 1AXGA 1DE0A 2O48X 3FMIA 1U5BB 3FXAA 4GSLA 4Q01A 4QC2A 4V0SA 3VRHA 4U1RA 2Z5VA 2AZMA 1LBHA 3O2JA 2WINI 1XMJA 3KR2A 2FE1A 4GE0A 4O4LF 3CUEF 3N3BC 2GD2A 1SEVA 3QVMA 3LVQE 1E1NA 1DU4A 2V7WA 3ISJA 4O1HA 1P5JA 3EB9A 1BFUA 1DC5A 3RYHB 3S68A 5SY4A 3WADA 2VYVD 4IIYA 4Z3OA 1M0WA 1BDMA 1EZ4A 5JBIA 1G5IA 2AZTA 5K20A 1OQAA 3ESBA 4FHZA 4D92A 4FZVA 4WKOA 3V4LA 5KSWB 3B9PA 1UFOA 3K31A 1ST3A 5EC8A 3A6PC 3WDMA 1GFWA 4JQZA 1F7VA 4PZPA 3FDIA 1B7GO 1E59A 2P1DA 3ZY6A 4EW3A 2QF7A 2O8CB 4Y2YA 4GGMX 1TL7C 3PD1A 3I3OA 3QJ5A 3QU2A 2ZSHA 1QNFA 1I9CA 2AQIA 4EKEA 5CDYA 2P77A 5L9AA 2DYKA 4E11A 4XWWA 1SCUB 4TL7A 4CF7A 3EIWA 3WNQA 1KO1A 2IC5A 4KQXA 3RIMA 5IKPA 3N8GA 4XSVA 2NGRA 2YRFA 3DEZA 1EVZA 3TRIA 3OPMA 1VL6A 3GXBA 3U49A 1JAZA 4AKTA 4O4JB 3T7EA 1FVHA 1AF4A 3BMNA 3H3FA 4XVQA 4CCYB 1DARA 4KXFB 4MVJI 2G63A 5TS2A 5E9AA 5J59A 1XCGB 4FOOA 1WVMA 3DEKA 3H1BA 1AN0A 5CCDA 3S1LA 2HGSA 2DOKA 4H60A 4ZCPA 4UVIA 3LPDA 3DHWC 2QIPA 4OHYA 1J22A 1P8AA 1G3IA 2H2AA 1LJLA 1E1MA 2N0SA 1ZS9A 4I4CA 3OZ7A 5HIKA 1K7YA 1RJDA 2V9CA 2XA9A 4AZ0A 2EIHA 2XMRA 3EDRA 4QJ5A 3E2PA 3N2KB 3EF3A 4X93A 2M98A 3GH1A 3N28A 1KZHA 1MQ8B 1X2BA 2XH8A 4JJFA 4R41A 2X3UA 3ZDFA 4BQIA 4ENTA 3AEQB 4KQGA 1JLHA 3LF2A 4F2WA 4UOEA 4IH9A 5DOZA 3S3TA 1KE1A 1DBQA 4DCUA 3MIIA 1TEZA 2X0KA 5CVDA 1H85A 3N5CA 5E1DA 2EP7A 4ESOA 1AHIA 2ST1A 3FPGA 3MMXA 3KETA 1XVLA 2LIPA 2RGCA 3VNQA 1GPNA 2BDUA 4NE2A 1JLKA 4ENQA 1RQNA 5KOJB 3GD5A 3RC8A 2XZPA 3QUTA 4ZYVA 3BFKA 2OXRA 1EFVB 3BSSA 2JIRA 4M1EA 1FUEA 1SQGA 1IN8A 4UATA 4QUEA 2G4CA 3QPWA 4FI3F 3WHLA 1GGVA 2IELA 4B40A 2J7PD 1A9YA 2O20A 3R4CA 2G88A 3AVVA 2JFBA 2ZRDA 3QVWA 1QVWA 1J06A 2XA1A 4FUTA 5ULLA 2B4YA 2WIBA 2HK8A 2C5SA 1SUFA 2ZSDA 5JDIA 2SBTA 1I2ZA 5LQCA 3OTQA 3PYMA 2WWIA 1WTAA 4L2IA 3VOTA 5T41A 4DA0A 3RHZA 2ZI6A 1G5PA 3FYUC 3R8FA 3CLHA 1AVTA 4KLAA 1OPRA 4REQA 5J63A 2HRRA 4AY4A 4LA4A 4DR2B 1RC1A 3I4LA 4V38A 1PVOA 5EVCA 3CZAA 4DMKA 5KTSA 3MJHA 4HQNA 4XCXA 2ONKA 3WGTA 2OD7A 3AEKA 2WZBA 4R1PA 4RIGA 3GGPA 5T57A 1JEQA 3U31A 7YASA 5KTYA 2PUBA 4QFCA 1XGKA 1K3TA 1WKBA 1Y6RA 4ZOBA 5LZ8A 4RPHA 5FQOA 3U13A 2R0QC 2VS1A 1GNPA 1NF3A 5LD2B 1YC2A 2BOVA 3UUEA 4EUEA 4PAOA 2PM8A 2FI1A 3BORA 3PHBE 1OVGA 5ALUA 3NC1C 2G72A 3TOCA 1OAOA 2IIQA 5IAAA 2JRLA 2WYOA 4J8PA 2IYFA 1RBYA 2QDXA 2XUHA 3HVKA 3IFSA 2R8EA 1VGQA 1KMNA 5DOVA 5L8VA 2CT8A 1NUAA 3PXXA 2GPJA 4HK4A 4C0QC 5BMVB 1JA9A 4A8JB 1E4OA 4DJFC 2C4WA 1THTA 2Q0SA 4TWIA 3TQOA 4I9GA 3KE9A 3KZNA 3CV3A 1PK8A 4QYWA 2Q9BA 1O6GA 1NN0A 1WA5A 3E2MA 2RGAA 4B3DA 3I6MA 1TQ4A 2W2LD 2NUTA 3ZK9A 4PC1A 3WMFA 3RBZA 1KI6B 3N0XA 3MBIA 4D9IA 2ZK7A 4XIFA 3WWOA 4Z9AA 7REQB 1C41A 1EDOA 1QTRA 3HR4A 4HD8A 2EDAA 3PA8A 1GQFA 2IXEA 1AJEA 2J30A 1CD5A 1IHPA 2UZ0A 3DZDA 3MWEB 4FYIA 5CNMA 1C9KA 1SH7A 2VF2A 1ZSYA 3LQKA 1U04A 4HB2A 2BMFA 2O3SA 3RFTA 1T8PA 3SP1A 3LPNA 3AVWA 2H0RA 4LYDA 4C7BA 3AUUA 2A92A 3U7QA 4RTSA 3PE6A 4U9UA 2V1UA 3BIWA 4NHOA 2Q6KA 1RMYA 2C94A 2D7CA 5K3DA 3IJ5A 1ACMA 1X7ZA 2JD1A 4B32A 4JA2A 5F2NA 5HZGA 4KZKA 2IY7A 3E6AA 3FSJX 4MIYA 4QBHA 1QH0A 2HLPA 4V02A 2O5CA 1CBUA 3GA7A 4BXOB 2XE8A 1CZNA 3GO4A 1M6VB 4D80A 1N5OX 2JAWA 1SXJE 4YRFA 3HKDA 3PUJA 3TSZA 4RMIA 1IPFA 2ETXA 1F6BA 5F77A 1QYVA 3L6RA 2WQ7A 1RZRD 1JXOA 1V3VA 1QG0A 3P27A 3GLIE 5A7HA 4F12A 2VYFA 1WMFA 5LYJB 2BI8A 2AJ8A 5ALVA 1EQAA 3BXPA 4FCTA 1ZL2A 5KKCA 1EBFA 1FFHA 4G0NA 5EZ6B 3UHPA 5NLLA 3SXUA 3FZQA 1NBAA 1E7MA 1Z7WA 4XB6B 2V5UA 4D3XA 4JYAB 3T5AA 1KZ7B 1REQB 1ZD4A 4A5SA 2Z4TA 1FTWA 4NNJA 4B85A 3GRPA 1WZCA 1QTIA 1C1DA 3C3XA 3HDQA 3L7DA 4LOHA 3B60A 3G59A 4R40A 1GNTA 4NBTA 2IZ0A 3I30X 3EVAA 4B5LA 2AB0A 3ZY5A 3N2GB 5ITSA 3IUQA 4ZYXA 4IDQA 4CMCA 3GLVA 3NDJA 1X8KA 4GYJA 2WR8A 4EGQA 3ZOZA 1NRXA 5B4TA 4JR2A 4Q4CA 4N0PA 3K1ZA 5JXGA 1PBNA 5E7IA 2QNRA 4IHJB 2MJLA 5HTKA 1TCCA 1EDDA 2A0YA 4RHFA 4OG2A 3UMMA 1WBJB 1QO7A 5G0TA 3OY7A 4EYKA 3WKEA 1S9HA 4KGXA 1NVBA 1PNTA 3SFVA 3UTDA 2BUBA 4IDHA 1P2FA 1Y8CA 3GLGB 3E7PA 1SOVA 3WRYA 2MYPA 4G5YA 3ZVKA 4RJIA 4A92A 2MMCA 1Y89A 1Z8NA 4DMHA 1V6SA 2OUIA 3C8MA 3NHFA 2Q1UA 2IOFA 5AJXA 2DUNA 4PZAA 1G8GA 3KKZA 1IY9A 3U26A 4RDXA 4HAUA 1PUJA 3OZFA 2XOXA 3WX0A 2ERCA 2JFUA 3NNSA 3I42A 4MQBA 3V1NA 3GLQA 4WLOA 4QGBA 5DX0A 1W1UA 1IDN1 4II2A 1DKPA 2IWRA 4EZEA 2RH8A 4I46A 5H5JA 1EVEA 5C4GB 4O3MA 3H2YA 2DPXA 5K8TA 1K89A 1N32B 1JSXA 5HP4A 4NV1A 3IB3A 1HZZC 1QHXA 3H19A 3OLZA 4FC7A 4IVPA 2WZDA 3ZWWA 5FWXB 3IUPA 1S96A 5C0OE 3WNDA 1HYGA 1TZMA 3MGCA 1RRMA 3DEAA 2ZAIA 4TTPA 1WPQA 2WHPA 2EJCA 4UEWA 1TQ2A 4GZMA 3HDVA 2J9FA 3T1HB 4N7BA 1XZ8A 4LYFA 4ZC8A 3OX3A 3EA0A 3OC0A 4JLSA 2PQ2A 5AD1A 4ZV9A 4BZPA 2A9JA 3AERB 5FB3A 1U3DA 1NMEA 4N47A 4OX9Y 4O2AF 3DZ8A 2IZOA 1T3LA 2YL2A 3EDQA 4PINA 4YRLA 5EXSA 5JXWA 2F3PA 2NXCA 3MELA 4Y30A 5LU9A 3CVJA 3IMFA 5KTMA 4L78A 2PS0A 1SVKA 3KJXA 1C0KA 4IRUB 3DONA 5F33A 3SI7A 1X86B 3AG5A 2VSNA 4Y2PA 5L4NA 1XZCA 1QAMA 1XD2A 1UXIA 2I7VA 1F7UA 1NSFA 3JYOA 1GGEA 1KK1A 3BTVA 4YFVA 3JR7A 2X8WA 5JNRA 2ZJ4A 2OMKA 2RHRA 1AURA 4B8WA 1YA8A 1ZJWA 4MUMA 4R9RA 4DJ5X 3SD7A 3BQMB 1RPNA 1XZJA 1NUPA 4HZUB 3QFSA 4PS0A 4RXTA 3DEJA 4AT1A 5LJIA 2HZBA 4YH1A 3NIGB 4DYVA 2R1ZA 4D46A 2BFEB 1X1SA 4R1MA 5BSVA 1Z73A 4EG7A 3D8BA 1M74A 4LE0A 4F1KA 2PBZA 4P82A 5EQTA 4BBZA 1U3WA 1KZ4A 4HUQA 2Q5JA 3ZWPA 2CUZA 1PKXA 2WZCA 3ZJTA 2CGEA 3AESA 1Z56C 2BFWA 4RFVA 5EL0A 1XMIA 3D2LA 2JIOA 3G85A 4PSUA 2M32A 1X7WA 2GERA 3ST7A 1SQSA 1J9EA 1POXA 1SXJA 16PKA 1KXJA 2J5XA 2XTNA 2WD9A 4G0XA 1PF7E 1ZW1A 1G8FA 2H9AA 4EECA 1EXNA 2AXEA 4ZTZB 1SXHA 1ZM9A 8ADHA 3ZBQA 4O5OA 4BLSA 5CH8A 1M1NB 1LF0A 2HQRA 2QTMA 3PICA 3UAOA 3DE0X 5F23A 3GLIA 1YD7A 1RABA 4TYNA 1PEDA 3OIUA 2O6HA 4DPLA 4Z1OA 1YVRA 3FTFA 3O3NB 4PRLA 2IHNA 4C7XA 4TT3A 4W7SA 2REXB 5TRTA 5ALYA 3ZG6A 1GUYA 1N25A 5H02A 3J81A 1M66A 2O57A 2V9ZA 3T7IA 2IHTA 2OAP1 3JQ8A 5J5VA 3SHTA 4DY4A 4Z49A 2J3DA 4RPJA 3LLVA 3KYJB 4X1IA 4ZHQF 4IGEA 2CFCA 2PZJA 2Z08A 4GBMA 5AI5A 3AM1A 5DYTA 3DZCA 1OX4B 2WJVA 1GNLA 3QBJA 1P2UA 2DJ5A 1BSVA 1E6LA 3WIDA 2FSSA 3Q6NA 1F2TA 4UJ3A 5F1PA 3CX7A 1V1RB 3PI7A 1MTOA 4IICA 2JAQA 4E6EA 5AKZA 5HE8A 4BCDA 2HKIA 2AZDA 2AEFA 5A3SA 4IQ4A 3RHTA 1S8OA 5GOZA 3NP7A 5C1IA 5K45A 1DBIA 2C9MA 1H42A 4HH3C 1S3SA 1L5OA 4W6ZA 2C4HA 2W22A 1PNQA 5B6IA 2ZS8A 1N9GB 3AHJA 3LPLA 4YLEA 3WVNA 3UKDA 3L43A 3IVXA 3R0VA 1K27A 2ZI4A 4IUCS 1DEXA 2FWRA 2R6ZA 2VF7A 4OJYA 1QCZA 2EERA 1SVNA 4JJ7A 3DVQX 2IU6A 2OGUA 2PCLA 3PR2B 4CMKA 1ADYA 4YRJA 1GADO 3GFFA 3OQIB 1AMNA 2VYND 5DT2A 4G1UC 5BYBA 4GXNA 4WNAB 4V0KA 1EZZA 2WI8A 2I1VB 1GLNA 2ZWMA 4PO3X 4MITA 5JLJA 2FF7A 1RC0A 1RVV1 2O1WA 4JLUA 2IWHA 4CWAA 2QBYA 3MJDA 1VSQA 4HDAA 3LY7A 5CYGA 3QX7A 1KJWA 4Q4JB 2OBNA 1A1SA 1Z2OX 3QEBZ 3DMNA 1TE2A 5DM1A 3EASA 5CFNA 4DM4A 2QT1A 3GMSA 1LU9A 3QUAA 4FKZA 4MAAA 3GFVA 4RPKA 4H59A 4DDKA 1OHHA 1H2RS 3F5DA 4OXYA 4H18A 5DGDA 4DBZA 2XNDD 5IJZA 1TADA 3PJEA 4R1UA 1U2DC 3L7CA 1CR6A 3HB5X 3O4VA 3HVIA 2WJ4A 5JAZA 4FWBA 4DIUA 2ZRPA 5BSEA 3AP2A 1BMDA 2OGZA 1E2LA 4P7GA 3ELYA 2VDWA 1LW6E 5IAKA 1INLA 2V7EA 1JWAB 3B7PA 3CPSA 3LSTA 4RK6A 4ARAA 5ADHA 5ALTA 2NU8B 1FYEA 5EINA 1PR6A 2ZI5A 3KJFA 3N7TA 3E9MA 4HAIA 2Q3DA 3KYDB 4B8ZA 4B1FA 1XJQA 1U02A 2FOLA 3DO5A 3M2TA 2R8OA 3PSAA 4EABA 1GQYA 2R7KA 2YX1A 3BAFA 1XDZA 2IU0A 3UUWA 2E1RA 3RRYA 2HNKA 5ALJA 4DLXA 2W48A 5KTNA 4Q6WA 4RA6A 3L1HA 3TG2A 2GK3A 4W5NA 2WMNB 2HFKA 3BF8A 1GPYA 2FR8C 4XWKA 2V7UA 3VM6A 4CQLB 1UM8A 3MWDB 4JP1A 2HQ1A 4PBRA 1U7ZA 2WYIA 5FNVA 1Q0PA 1EWQA 4ZO4A 1QRAA 1SWVA 2HA6A 2XMCA 4B7XA 1UIMA 2X15A 2KBEA 4RLHA 1I1QB 1NAIA 1CY0A 3H5AA 3GJSA 4TYYA 1OJ7A 4EYSA 1NBMD 1FBTA 2Q8PA 2EP8A 1FA9A 1GGFA 3BWYA 4FT4A 4R05A 3AHCA 4UNNA 5LZ7A 1TMYA 3GNSA 3CRW1 1EFCA 1OU0A 5B1IA 3U5TA 4W5TA 4UM9B 1SZJG 2A6PA 1Z0UA 1US8B 2RJNA 1TJYA 2MSKA 3WLIA 3K9GA 2PGDA 2IODA 2ZB7A 4YI5A 5C8YA 2R87A 4E03A 3C6KA 5EE5B 1ZK0A 2GF9A 3UG6A 2GSWA 3T7KA 4R2WA 1CZRA 4ZVRA 5GPBA 2NVBA 4FE4A 4X3CA 4F4IA 1PVDA 1XIVA 4MVJF 5CCEA 1G38A 3ADDA 3IHWA 3RUDA 2M6LA 1U90A 3I61A 1W4RA 4KDCA 1J9ZA 2BKAA 2ADOA 1EGHA 3D5QA 2XWBF 1XNRB 3RRMA 2Q5LA 3P2YA 1RYBA 5AM5A 2ZSKA 3W34A 8GPBA 1JL3A 1R4MB 2WAMA 3QKUA 3FWKA 3HVHA 3KL2A 4EHNA 2C61A 2Q3CA 3HS3A 3AKDA 3Q0EA 4ECEA 3BN3A 2EFEB 3HQ4O 4PSDA 5GZ3A 1EUZA 3INRA 1CF9A 1ZUWA 4LNUB 5EP4A 1DFGA 3IE0A 1NJFA 3B51X 1YDGA 3KOYA 1XKTA 2ODBA 4JUBA 5AVKA 2LWIA 1IJFA 1CUAA 3HUFA 2ZRCA 3O2QB 4I4IA 3W2IA 3X1ZA 4C22A 1I14A 1U2SA 1XYGA 4WAUA 3EY4A 3KFVA 3VGPA 3B6JA 1FP6A 5JI2E 3B89A 1JI0A 4Y2SA 2NTNA 4BQRA 1F06A 4Z4EA 2RARA 3T5TA 1F12A 4FFDA 4H7FA 2NO4A 2HJGA 4MRMA 5A4DA 1DG3A 5DMHA 3UM9A 1TTPB 3IUEA 1O3YA 1O9BA 1UXHA 2X7HA 4ICIA 3SG0A 1YZYA 1PJCA 2LDXA 3R5XA 3SZOA 1JU9A 4MQEB 1YJXA 4RD2A 4B48A 5J1SB 4BKQA 3UMVA 2XGSA 1ZK2A 3GELA 2D0OB 4EVIA 5H59A 2A94A 4Q3CA 2ODQA 3ROFA 3KEGA 3WYNA 5AVWA 3URMA 3KWJA 1V7QA 2B92A 1K9SA 4N0EA 1KDZA 4ER5A 5T67A 4X97A 2I1LA 5A3RA 3E9NA 4GDFA 1LVHA 2V7TA 3H1GA 3A9VA 3UCEA 5IT0A 3TQHA 3F9RA 2OGSA 4F9GA 3QITA 4IXTA 4O2LA 1JHXA 3QPAA 3ZWYA 2WOOA 4G5HA 1K6EA 5L3RA 3SHOA 2EG5A 1FNSA 2XB9A 3AHFA 4KK4A 3U7FB 4A15A 2YXDA 1JKIA 3FMPB 1C81A 1R2QA 5KAMA 1JJIA 4Y1RB 1E2MA 3IMEA 3RG2A 1B3BA 2J0EA 4OK3A 3T6KA 3Q7SA 3DBHB 2VTVA 5CVJA 2VDRB 5JEDA 2BBWA 3X1DA 5HGJA 3LLMA 4AKSA 2I3AA 3NTVA 4C87A 3TH5A 3JU3A 3CR3C 1WY5A 1P7CA 4ZOLB 5U9CA 1N6KA 5HRUA 4HQ0A 3NIFB 3HVRA 4DHWA 1DDGA 1FRZA 5BURA 3DXZA 2RHGB 3JPWA 4QXOA 4YJ3B 1YTLA 4UPEA 4Q3EA 3TB4A 1BDBA 2IX3A 3I45A 2I7DA 3IODA 3RTBA 4FGJA 2CJYA 3AEYA 4S2EA 1I4EB 2IOYA 3MPOA 4YNBA 1VI2A 5D3MB 4JR0A 2HLHA 4LOLA 2Q4OA 4GT1A 4Y1GA 3SHVA 3WQSB 2ASEA 1FX1A 4KE9A 2YJGA 5L45A 1GPWB 3P9NA 4RXMA 5TQ0B 4KDEA 2ZJAA 4QPJC 3HXTA 5HF9A 2WF5A 2J3KA 5ANRB 5EGSA 4GWLA 5HIJA 2JLWA 2GFHA 5G1NA 3U37A 1VHTA 2C8KA 4WINA 1SCNE 2BISA 2UXBB 1OXBB 3JS5A 3FJOA 5CX1A 1OLSA 1WXWA 3B1ZA 3H4MA 4RK0A 4Q47A 5JROA 3MMPA 3KDAA 5FLYA 2ZRMA 3VZQA 4DEYA 5IKMA 2ZUEA 3RIHA 2Y1KA 4B6GA 2HCBA 5IDYA 1KEKA 5M04A 1JFTA 2Y2VA 1IOLA 3CW8X 3FHCB 1AUVA 4JYPA 2P3OA 4DLAA 3S1SA 1I8TA 2GH1A 2P8SA 1H8ED 1N5IA 1VP3A 3QF4B 2BHLA 3F7TA 1E3QA 5C52B 2PXCA 1T4DA 3GJZA 1PG2A 3LXMA 3IAEA 3O74A 3RS0A 3PPIA 2CVFA 4J0FA 4MMXB 1MJFA 3SC4A 3GHHA 4P6VF 4PC6A 4EO9A 4DW8A 5CLQA 3LT1A 2R2AA 1RAEA 1D2HA 1QONA 2VJQA 1Q12A 4Q05A 4RQAA 1IOZA 3NNDA 3K4QA 1P5FA 4OJKA 4Z0PA 4J9VA 2C7PA 3CG0A 3FGOA 1TLTA 3CZQA 2LVBA