4EFMA

Crystal structure of h-ras g12v in complex with gppnhp (state 1)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the state 1 conformations of the GTP-bound H-Ras protein and its oncogenic G12V and Q61L mutants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4efmA00
1S4QA 1J8YF 4LCBA 4RFSB 4O2RA 4ERNA 2HXSA 3TW8B 4CEIA 4G3XA 1G3IA 1JEEA 1X1RA 3WY9A 1YZKA 421PA 2Q3FA 1NVVQ 3ONWA 1R6BX 3I61A 1MO4A 2EWWA 1DEKA 1IAQA 1TMKA 2NO7A 3DL0A 1XXHB 2DR3A 3KL4A 4KYIB 4A0GA 4BZXA 2Q9AA 4A6PA 2H17A 4IVRA 1DARA 1T5LA 3AF3A 1VIAA 4EPYA 2QUZA 2EFGA 5EZ5A 4LHWA 1ZD8A 1J90A 1GNRA 1MT0A 5HZKA 1H8ED 2QORA 4G5QA 3TBKA 3DOEA 2HCBA 3D3QA 5KSPA 3A4NA 1G18A 2ZYWX 2PX0A 1KSGA 4IRUB 1ZM7A 1F2TA 2BBSA 4LBWA 4LGMA 821PA 2HEIA 4QC2A 2F1JA 2WMOB 4TT3A 2Q9BA 2OILA 4Q66C 1YZGA 3N5CA 2PZGA 4UJ3A 5DYGA 5EXTA 3SI7A 3U7HB 2ZJBA 2CNWD 3EA5A 4WBSA 4PZZA 4AKEA 4EKDA 2H5EA 1UBEA 2F9MA 3JZMA 1IN6A 1M34E 1G9XA 4FW9A 4V0ME 2YV5A 2IYRA 1LTQA 2IUSA 3RS4A 3P20A 1W0JA 4PTLA 4M4SA 2DY1A 2WSMA 3HU2A 4B76A 5EXXA 1JR3E 3FWYA 2W2VA 1NVUQ 1G6OA 4B48A 2ZRDA 1HURA 1KMHB 3VX3A 4PC7A 2CK3A 1VCNA 1N6LA 1G5PA 1C4OA 5G3YA 3L0OA 3FKSA 1XPOA 3KB1A 3FMIA 1Z8FA 4LHVA 3WYGA 1PVOA 5FL3A 2F1RA 4M1YA 3UWOA 4IDHA 1U2RA 2R62A 3ND9A 1F2UB 3WRXC 2JA1A 4EJSA 4W9MC 3CPEA 4LPSA 4BQSA 4E5UA 3PCRB 1N5KA 2YWHA 1E98A 2NOAA 1OXUA 2W00A 5GJWC 1NIPA 3S1AB 2YVUA 3MCAA 2V9PA 3Q85A 3VU9A 3UMFA 1LB1B 2RGEA 3UG6A 4XD7D 1U99A 3ZIAD 2NZ8A 1JAIA 3BWDD 4HLQB 4B2LA 2DCUA 2QQEA 3C16C 3OEED 2FFQA 2G88A 2LKCA 2ZSFA 2AR7A 4LV8B 4OK3A 1VCIA 1CR1A 2A3RA 4OHYA 2HUPA 1GUAA 1A1VA 3CWZA 3AF4A 2MSEB 1W7AA 3EC1A 4NCKA 2CE2X 4NONA 3TE6A 1A4RA 1BH2A 2QAGC 3W5IA 4C0SA 5GVSA 1XPRA 1UADA 2FZLA 5FI0B 3UG7A 3SNHA 2FJUA 2YWEA 4D82A 1YE8A 4FXPA 4MGZR 5LB2A 5JJKA 1HTWA 1OIWA 4DSOA 1DG3A 1M74A 2WV9A 4B32A 2ZE5A 5JSZA 1EFHA 4QRHA 3R9XA 1XP8A 2QE7D 3SZRA 1SXJB 4BLQA 4C0LA 1KO5A 1XEWY 3BB3A 5K8LA 3WHKA 4B35A 2YHSA 2A2ZA 1O3YA 2W83A 2QY9A 2GZAA 3QKSB 3DM9B 4TLEA 3K0EA 2CDNA 5IT5A 3NIBA 1U9IA 5FTJA 4WZ6A 3OEEA 2IUTA 4ARZA 5AUOB 1YZTA 4YMVA 3TK1A 1TF2A 3ETLA 1Z22A 3NHAA 5TARA 5L3QB 4RD1A 1Q21A 3M1IA 3KJIA 1E6CA 1VYTA 4Q9HA 4DBLC 4DSNA 2BKEA 1AGRA 2Z0MA 3TQFA 2BM0A 3LX5A 3KUCA 2A5YB 4KI0A 5EP1A 4B2PA 5LD2C 1P61B 1XD9A 3A58B 4PHGA 3PEUA 2V6IA 4F4CA 4URZR 2IYLD 2XTZA 4QHTA 1G16A 3IDQA 4GMXA 4A8JB 3AVVA 1JR3A 2IYQA 4Z1MD 1OJLA 1TADA 1WE2A 3T12A 3D8BA 3WYFA 4F91B 3K0AB 2HYDA 3CX6A 1E79D 2GA8A 1QZXA 3B13B 3FYHA 3HJNA 3PUVA 4AYXA 3R20A 1LVGA 2AKYA 2VP2A 2FPKA 3UKDA 5FBLB 1X3SA 1VG9B 2JJ1A 2HXYA 4PAQA 3U3KA 4OL0A 2PX3A 2LKDA 4PXAA 4E22A 2QP4A 2XSZD 4G0NA 1G8GA 4KSBA 5TY0A 4DEYA 3THXA 4TYYA 3GLHA 4A1FA 2ZYVX 2GAAA 3FDIA 5FTKA 5KNDA 2PJZA 2Q9CA 3QG5A 2LWIA 3QEJA 1WF3A 1Q22A 4RVCA 2O8CB 4HB0A 5KU1A 2DHRA 2R6CA 3N2IA 3C5HA 2GCPA 3FKQA 4M9SA 3NWJA 2JGNA 5HCIA 1AIPA 2R44A 1YZNA 2QG6A 3QVVA 4NKRA 4TSFD 2QU8A 3UXMA 4LUCA 1OXXK 4BFXA 3QPUA 4L9SA 5JS8A 2TMKA 4PSVA 4D0NA 3CKLA 1Q3TA 4A2PA 1NNEA 2GJSA 2VL7A 2ZRGA 4I99A 2ZRMA 2IXGA 1W4AA 3RWOA 1DPFA 4Q4AA 1SGWA 1IONA 3BXZA 4DT1A 3KZ1E 5FBQB 4DDTA 2VP4A 4FINA 5TXGA 2GCOB 3KJHA 1ZNWA 1Z07A 1I2MA 4ZV4A 3CNNA 4ZIRB 1CKEA 1GL6A 2ZYTX 2XNSA 1R0WA 4QJ5A 3ZVNA 1TF5A 2HDNB 1CJVC 3LBHA 1E2GA 2CJWA 3ZDQA 4B74A 4JYBA 1II0A 3IIJA 5B57C 3QKRB 1NG9A 2WIAA 1VG8A 3QI2A 1T8UA 2REOA 4Z51A 5FTLA 1S3SA 4Y0VA 2PT7A 3BK7A 3LXRA 5DYIA 5FUYA 3IBGA 4UXHA 1YZQA 1U0HC 1AZSC 2ZVQX 1VKJA 5HCNA 3H2YA 2PZEA 2ODBA 4NHOA 5FOTA 3ZS9A 2H7VA 5G3ZA 4WIAA 2IYYA 1N6NA 1WP9A 3IGFA 3F3YA 3AUXA 2QP9X 2V6JA 4WW0A 3HR8A 4M1SA 3EIEA 2FPMA 1TAGA 2FEMA 2HT1A 3NBFA 3QE0A 4UNNA 4A8JA 4ZDIA 3ZLJA 1MO3A 4XWOA 4WA7A 2BIFA 2JLXA 4DCUA 3R9WA 1KYIA 5DI3A 3UWKA 3IPXA 3AUYA 4M53A 4M1KA 1T91A 4PX9A 1CU1A 3IQXA 1U8AA 3U44B 3RANA 2YOFA 3SBEA 4R9UC 2FMXA 4KCGA 3QBVA 1VCMA 1JBKA 1JJVA 3AEZA 1E2MA 1V43A 1R2QA 4P4UA 4TLDA 3EZFA 3ZZTA 1KIMA 2HJGA 3TNFA 4TMXA 1FZQA 2DFTA 3A8TA 3AF0A 1KJYA 4HYYA 4JIMA 1KOFA 1E94E 1I4DD 1FX0B 1MR3F 3TVDA 2R6GA 1IY1A 2CLDX 2MMGA 4BLPA 2GEDA 1ZVQA 5CITA 5KNBA 3FMOB 2X2FA 2EYQA 5E7JA 1RKBA 4W5HA 4Q19A 4KXFB 2BJVA 2ORWA 4ARZB 1NF3A 1XD8A 2AD5A 2KB0A 3D31A 3RC3A 1N3BA 721PA 1II8A 3RRYA 2ZJ5A 4YXWD 1W36C 2FFHA 4YDSA 1ZNYA 3WMGA 3CIOA 2EU8A 4GFDA 1UM8A 5CIWA 2GETA 2WPDD 1EXMA 3JZAA 5TV2A 4LY6A 3DZ8A 1OE0A 2NIPA 1S96A 2WSSA 4Q9LA 2AN9A 4QJ3A 2GF0A 1LW7A 2H8KA 4LJ7A 4ESHA 1Z6YA 1H8HD 4LZZA 4XTCS 2VSOA 3CH5A 4JVSB 3BERA 5DHFA 4DKXA 4I1VA 2O5VA 3AV0B 4P4SB 3MJHA 4XVUA 1SXJD 5JMTA 2REBA 4JYCA 2FDCA 3TGPA 5JS7A 1SKYE 2SHKA 2F1HA 3LNCA 2O8BB 4CT5A 3P26A 2AXPA 1JR6A 3L0SA 1XZQA 4CT4B 3NBYC 2ZSEA 2J45A 2OFXA 2I4IA 1WXQA 1E32A 3LBIA 2IL1A 3NHBA 1UFQA 3FB4A 3RS3A 2A78A 4JLAA 2P65A 3B7GA 4C0BA 3U4QA 5SZKB 2JLUA 3IUYA 1GKYA 2QNRA 5GJCA 4HLDA 1SVSA 2J0UA 2WICA 4OHVA 3K1JA 4CEJB 1HV8A 1DO0A 4U5XA 4RKFA 3FE2A 3WYAA 1NKSA 4US2R 5F98A 3BH7A 5EJEA 5FOXA 1E2QA 1ZNZA 3GJ3A 1BMFD 4HAXA 2WMNB 2F7SA 1TEVA 3PV0A 1NLFA 2VA8A 2QAGA 3SYNA 3T1VA 3KB2A 3AVTA 1E69A 5JLJA 3MWJA 3AVOA 1XJCA 2GZHA 1T4GA 5J5CA 2D2EA 3X1XA 3AP2A 4D0GA 1GRQA 2YINC 2OM2A 2Q3HA 3QKUA 4F4IA 4QBHA 3EPHA 2XGJA 5FL7A 1QF9A 1AM4D 1RZ3A 1CJKC 2XX3A 2ZS9A 5F9HA 4YMWA 4XVRA 4TYQA 2N46A 3LXXA 4FN5A 2ONJA 1GKUB 2GXUA 2OXCA 1RJ9B 1VYUA 3LO5A 2ZSAA 1KI9A 1XEXA 2DPXA 3KQUA 3B1XA 8OHMA 2XZOA 1L8QA 1U9IC 5JI2E 3L43A 2QTHA 3T1OA 1PUIA 4FIDA 1TTTA 4A6XA 2HV8A 3L8YA 4MYUA 3GLIE 4NCJA 2JLWA 1IXRC 1S8FA 2FSFA 3CF6R 1NSFA 1XEFA 2AL7A 2BWJA 2YYZA 4D80A 3ZD7A 2FU5C 4NYJQ 4NDZA 1W36D 1LS1A 1F6BA 4LV5B 4MGIR 5F3WB 1W4BA 1YR6A 2FNAA 2JIZA 1YRBA 3SYLA 5JHHB 4ZKEA 3RRZA 3SJZA 3QPWA 2MMCA 1OB5A 1G7RA 2GHIA 2QA5A 2VBCA 4URUR 3RDPA 3Q5DA 3W8NA 3OZXA 2QQ0A 4MGKR 1UBFA 1QVRA 1Z83A 4LJ5A 3WXMA 4CGZA 5EP4A 2BC9A 4DUGD 3SS8A 2FA9A 4IKEA 3W3ZB 3TSOA 1XXHE 2IYTA 3K70C 2VSXA 3QKTA 1QG2A 3LA6A 1DBSA 2IK8A 3QY0A 1MABA 3QENA 4FMCF 1F5NA 4HUQA 4U7DA 1VG0B 2DFKB 4YLGA 3UPUA 4OQXA 3VKWA 1XFAA 2CHGA 4HB3A 4I81A 4S2EA 3I62A 2PL3A 1TPZA 2UKDA 1J2JA 4Q5IA 1LY1A 4MA4A 2C99A 2NZJA 2HLDD 4QHSA 3GJXC 4FMBB 1F2UA 3RVBA 1XRJA 5DE3A 1NN0A 3RHFA 3CZPA 2QMEA 1E9RA 1OH6A 2VF8A 3E2IA 3MD0A 4M8NE 2CEAA 4QFMA 4A15A 1JJ7A 3LLUA 3MRSA 2WM9B 4ZO4A 3VQTA 4B3XA 3FTQA 4MRNA 3H4MA 4NYIQ 5LD2B 1A82A 3P4YA 1R0ZA 1XMIA 2RGNA 2ZI6A 4TQ9A 3OEHD 1ZM4A 2VQSA 4PQYA 2QENA 1IN7A 1Z0DA 4Q1CA 3SHWA 2AX4A 2IS4A 2VF7A 1SHZA 3X1YA 4BGDA 4NYMR 2F3RA 2NPFA 4FWIB 1J99A 1RRPA 4CZ2A 3W6PA 1D6JA 4DIEA 2VH5R 2ZUCA 1SULA 3K70B 3R8FA 3TQCA 3THXB 4HZIA 4D4JA 3VKHA 4P31A 2P2LA 2C03A 4GBMA 4NP6A 4EFMA 2BOVA 3NBZC 2R6AA 4K46A 4PPNA 3WNBA 3QXXA 2ZJ2A 4PQRA 1M7HA 3PITA 4XOIA 3FFAA 1AK2A 5D3QA 2EWVA 1MABB 3T34A 3P1JA 4JMPA 2A9KA 2ZE7A 2OUKA 4KBFA 4ZDWA 1GTVA 2VP5A 4UNRA 1AS0A 1E2PA 1HQCA 3ZGXA 2DFNA 3CX7A 1CULC 4B33A 1SQ5A 1ZP6A 2H57A 2RH5A 5AJYA 1G8PA 1PJRA 4FI3C 4EPVA 2YOHA 1T0JB 4DCTA 1T3LA 3U3MA 4XIGS 1YR9A 2PBRA 2KE5A 3F8TA 4C30A 4B3BA 2V54A 1IM2A 3IO3A 3RAPR 5BW8A 2JJ2A 5AJWA 2ZRAA 1NMYA 1NL3A 3AP1A 2IXEA 3KKOA 4JLBA 2CCKA 3BD9A 4LSGA 4BE7B 2CVFA 1F48A 3B6EA 3O47A 2XXAB 4D26A 2A7QA 1OH8A 1NN5A 1COWD 1ZM9A 4GNKA 3EPKA 1PZNA 2ZRJA 4WXPA 2GCNA 2PMDA 2V7QA 4GRAA 4Q18A 3HP1A 3X1ZA 1EGAA 1CJMA 1HQYE 2G6BA 4TL7A 2WJYA 2O8DB 3AF1A 1UBGA 5CDFE 1ELOA 2KSQA 5CB6A 3FOZA 5H8WA 4LPKA 1ODFA 2QN6A 2QTVB 5BN4A 3L0PA 4RD4A 5FOVA 2ZYUX 3THOA 4RD2A 1IJEA 4AK9A 4XVQA 4I1UA 5FBVB 1LV7A 2YZ2A 2ZJ8A 3GEHA 4XSGA 2OCYC 4I4LA 1Z29A 3HPRA 3W6NA 1OH7A 1WDTA 4AKGA 4YXWA 3AVPA 3QJYA 5E7IA 2WZQA 2PCLA 2X1VA 2C04A 1P2TA 3CF2A 2DFLA 3I72A 4Q1FA 3SFZA 2IS2A 1VG1A 1BOFA 1G3QA 3QF7A 1X8LA 4ZCMA 3B1VA 4ZKDA 4A0RA 5BN3A 1N6HA 3I32A 2H92A 1JR3D 2ZR7A 1KDTA 1E3MA 2ERXA 1P2UA 1NIJA 4YMUA 3VU9B 2ZRKA 4HB2A 2W0MA 1EX6A 4RFSA 2WAYA 2OAP1 4QHYA 1MH1A 1R8QA 5K8TA 4QGAA 3AKYA 4DZZA 3O8BA 2JEOA 3QOFA 1ZJ6A 3LLMA 2OAQ1 1XXHA 1OSNA 2W2XA 3CUEF 3NC1C 4BZQA 4ZDJA 2B8TA 2FOLA 3BB4A 1AS2A 2BDTA 2KBFA 4Q4JA 4PZLA 5JI3E 1G291 4KFSA 1N6KA 5FTNA 2JLRA 4X8OA 2GXQA 1KI4A 2D7DA 1CLUA 3BRWD 4KJZA 4NZYA 2XXAA 5JEEA 3MWYW 2WJGA 5JJIA 2ZRNA 2OCAA 2ZROA 3U6BA 4JVLA 5A5GA 3LH5A 5TVKA 1FTSA 4TL6A 2WBLC 1MOZA 4AC9A 1WBDA 5LBIA 4LRWA 3KKNA 1FNMA 1NY5A 4C0JA 4AURA 4V02A 3C41J 1K8RA 3ZQJA 4URVR 1EG7A 3OAAA 3QQ5A 2J87A 1ZM3A 4NTZA 3OIVA 1RYHA 2IUUA 1DAGA 1D8TA 4P0TA 4BEBA 4DVGA 3SQXA 4IXMA 3KKMA 5DI3B 3IIKA 1UKZA 2CCGA 1KTVA 2NQ2C 2OBLA 2CNWA 2JLYA 1Z2AA 4OQLA 3WBKA 2P6UA 1F60A 2EFEB 1XMVA 4A9AA 1J7KA 3RABA 3RS5A 1DAIA 3AF2A 3UMRA 1GILA 1QHIA 5E3HA 2JLZA 1E1QD 4BZPA 2GKSA 1F3OA 4JLPA 4RD6A 1G4AE 1GL9B 4DIDA 4B75A 5KSOA 2XAUA 1C1YA 4HZUA 5FOUA 3LW8A 1G6HA 1W0KD 2AHOA 1W2HA 4OI4A 3KQLA 4TTQA 4UNPA 3SYKA 3SN6A 2BHRA 2IXFA 3AVXA 1GKIA 4IOMA 3EZ7A 3EAQA 3N70A 4HI0E 5JRJA 4JL6A 1NSTA 3BBPA 1QG4A 5FBWB 1IY0A 2BVNA 1NVWQ 2BKUA 3K0AA 5FPHA 4Q01A 2XOKA 2QI9C 2VHQA 1E2HA 3KKPA 4KO8A 1G19A 1IQPA 1CF4A 1E9FA 3U3OA 3ZH9B 1YZUA 1KSHA 3A1SA 1GDDA 4MDEA 2W6IA 1E79A 1XCGB 3H0KA 4II7A 4NH0A 4O3MA 2HT6A 1KDRA 1KMQA 4OI1A 3SE0A 4B44A 4UXJA 1W49A 4ZCLA 1ZCBA 4IDQA 4PFSA 5LDDC 4D4LA 3IKJA 4JKIA 5G40A 2WWWA 2XSZA 4BRUA 1E4VA 1E9CA 1G3UA 2ZR9A 2F6RA 3AH8A 2QE7A 2QMHA 2B7BA 3U44A 1LF5A 1KK1A 3EW9A 5C18A 1QHGA 1EK0A 1NVVR 2C96A 3B82A 2ONKA 4TQAA 2IC5A 4Q48A 2QMUA 5B58C 4BECA 4HLCA 1TQ4A 5JCPA 3IQWA 3U7GA 2W2TA 1C9KA 4EFNA 4KV9A 2AD1A 4JLDA 1PLJA 2NMVA 1GRNA 4KAXA 3R7WA 5ELXA 3K9GA 2PZFA 3DKPA 5BYJA 3AVWA 4QNMA 3CB4A 3EARA 2G1JA 3KXLA 5HKKD 2JIZD 3Q8XB 5SZJA 4G5OA 1E1QA 1IN8A 4HAUA 1GG2A 2JLSA 1XEXB 1G7SA 1DADA 2XZPA 1S2MA 4WZAE 4HDQB 4TYWA 3KJGA 1NMXA 1DG1G 4IW3B 1KO8A 4G5GA 3VR4A 4NYMQ 3LQRA 1DAHA 4TSFA 4L15A 1KSFX 2FH5B 2J7PA 2I1QA 4BPBA 4U00A 1GNQA 3VFDA 1SVMA 4C0HA 4D0LB 3CBQA 3LVRE 1U98A 4JL5A 5B30A 1KJZA 4TTRA 1I4LD 5KDOA 4KITB 2QL6A 2XTNA 1W4CA 2JJ2D 3I8XA 4EPRA 3KJEA 4JLOA 4PO1A 5GVRA 1CR0A 1YHNA 4Q1AA 3OAAD 3NKVA 5CJPA 5BWMA 3WNDA 2PJRA 4CDGA 2HF8A 1CIPA 4QJ4A 1JXMA 2BMFA 2ZIAA 4BFSA 2O8EB 1MKYA 2HJVA 4DLXA 1J8MF 4Z1MA 4Q7KA 1YR7A 2A30A 1SVWA 3C5CA 4LJ4A 2A5DA 2JDID 2QMOA 4M1TA 4TMWA 2IHBA 3NEJA 3Q7QA 2BJWA 4KFUA 4X8MA 4URXR 1BMFA 1Z06A 5J4YA 1KI3A 3ZZ0A 1IBRA 2YC4C 2WOOA 2RGAA 3ADKA 3U2QA 3T5GA 2QM7A 2GDJA 3K53A 3QUSA 1E2NA 2RCNA 2XEXA 4LV6A 2YWGA 4D81A 2NO6A 2ZUBA 5CDFA 2FE4A 2CL6X 3GCGA 4LHZA 1G64A 1Z0FA 3ICQB 4DSTA 2WSSD 4H9GA 3GLFB 3V4FA 4C3ZA 5L8VA 2V8OA 4QM6A 4LJYA 1JPNA 4A4DA 1E1RA 3U61B 1VPLA 6Q21A 3TH5A 1WBBA 3ZVLA 2NO9A 5LPNA 1HT1E 3H1TA 4OHZA 3I5YA 5EE3A 1U0JA 1W5SA 1XNJA 1N5JA 1TL7C 3RNLA 3VR2A 2GBLC 3TIFA 4FMDB 1Z5ZA 4R2IA 4DHEA 1KI1A 2ODWA 1OXVA 3E5HA 5IF9A 4IVPA 4PC3A 1QBKC 4R2HA 2ZJYA 3NXSA 1ZYUA 4M21A 3BGWA 2BCJQ 3CRMA 2J7KA 2OEPA 4Q7MB 4A2QA 2QGZA 2RGXA 2EYUA 121PA 2BMEA 2EVWX 2JDIA 2VYFA 4GZLA 4LHXA 4MGYR 4TTPA 3T1TA 1PUJA 1KY2A 1CJTC 2CHQA 3QF4B 4F92B 1TQDA 4QG7A 2FEOA 3CH4B 2XB4A 4RZUA 4OBEA 2HLDA 4Q7JB 4W5WA 2O0HA 5IK2A 4LC0A 1AKYA 3QEOA 4DEXA 2GEVA 1LS6A 2ZM5A 4FWTA 1T3HA 4YC7A 1VHLA 2R6FA 2XJ4A 1HYQA 2A5FA 2GESA 1DOAA 1TQ2A 5HTKA 4BLOA 3KKQA 1AZTA 2X8AA 3AGPA 1NN1A 3QXJA 1OHHD 2VHTA 2EFHB 2EFDB 1RE0A 3LY5A 3EZ2A 2B8WA 3THWA 4WVFA 1BO6A 1RVDA 5LB4A 4P32A 3B9PA 3P4XA 1IN4A 2P5TB 2CCJA 4Q4AB 4EDHA 4EQ6A 4IOLA 4MYTA 2ZE8A 1KZGB 1OIVA 1R5OA 3PIRA 4LBVA 4V0KA 1QVAA 3HU3A 3NDBB 5KPDA 3I5XA 4C4PA 5H68A 4TZ0A 2YC2C 3IEUA 1Q57A 2P6RA 1GWNA 5P21A 1RFLA 5J4VA 2PLRA 4O2LA 2H1LA 1ESMA 1AN0A 1FOEB 4B3GA 4EPXA 1VTKA 5DN6D 2O8CA 3PEYA 3OE7D 4JJZA 2O8FA 2EQBA 4JVMA 1KNQA 2Z4RA 3MLEA 3DHWC 2VIIA 3K09C 3OF5A 4LX0A 2QSYA 1OFIA 2D62A 3RSLA 2ATVA 3PUXA 4LI0A 3PFIA 5KPJA 1QHNA 3SQWA 1E2JA 3C15C 5B2ZA 1DTSA 3DVLA 5BYKA 2VEDA 2BM1A 3U6KA 1A2BA 1AS3A 1JAHA 2G1KA 2IYVA 2ZTSA 2WTUA 1Y63A 1XTJA 4Y0AA 1W44A 4KVGA 4HAVA 2BEJA 5CLQA 4HB4A 1EX7A 4TT3D 2Z5FA 1UPTA 2R2AA 3TAHA 5C2JB 1MRNA 1OXTA 3H84A 1FX0A 1NKTA 2CMKA 4RCYA 2ZPTX 1Z0IA 3EASA 3DEFA 4L4UA 2EFCB 3L2OB 221PA 5CIQA 1VDZA 4AG6A 1S0UA 1P9NA 1CXZA 4BLRA 4LJAA 3IO5A 5L3QA 4DC9A 1ZC3A 3GJ0A 4G5RA 4IEIA 2CXXA 1DAEA 2QPTA 3T06B 1FMLA 2I3BA 4DWJA 4MH0R 4LJ9A 4LWZA 4PQFA 1WMSA 3I73A 2WJJA 4ABYA 3LWNA 4AYTA 3KQNA 1RYFA 1YU9A 1Z6TA 4HAYA 3CLVA 2BBTA 3THWB 4B3CA 2ZXUA 4URWR 2RHMA 2ANCA 1XTIA 4RSGA 4H1VA 4J0QA 2GVDC 4N1AA 5DI9A 2VHJA 1GVNB 4B34A 1GM5A 5BQ5A 3CNLA 1OKKA 4Z8YA 5FFMA 1HEIA 3O8CA 1IOZA 1KAOA 4QL3A 1N6PA 2NGRA 2IF2A 1AGPA 3O8DA 4Q4HA 5HR5A 3WP0A 2WAXA 2DWOA 2FN4A 3BFKA 3MFYA 5JCZA 4LYHA 5CK5A 2ZI3A 2O0KA 2NO1A 1P4SA 1ANKA 1HE1C 3CF0A 4Q02A 3DMDA 2Q21A 4JLJA 3W34A 2ASEA 1CTQA 3ASZA 4LC1A 2O8BA 5B64A 2DBYA 5JWHA 1W5TA 4JSYA 4K81B 2QT1A 2B7CA 3NH9A 3GJ6A 4W5JA 1US8B 4IDNA 1KMHA 3I3SR 5JHGB 1FPMA 4WAUA 3GLFE 4D25A 2ZITA 4A82A 2F9LA 2MSDB 1CRQA 2ZJOA 4V0OA 1T0HB 2Z83A 4Z54A 2VSFA 2FPLA 1D2EA 1SKQA 4MRRA 3QPVA 1N25A 3W5JA 1P62B 2J59A 1XCMA 1JEDA 3REGA 4GL2A 1OYWA 2ZAOA 3AP3A 4BFTA 1HA3A 1Z0KA 1COWA 3ECCA 1Q20A 1TNDA 2QGNA 1W36B 1E0SA 1P2VA 3IILA 1XDBA 3GJ8A 4DLVA 1H8HA 1G21E 4N0DA 4PSAA 3SJBA 4Q1BA 1XMJA 3OESA 3MJRA 3FMPB 3F5FA 2J1LA 4QXAA 2ZETA 3PUZA 1VYVA 1YKSA 4PZYA 3TRFA 1XMSA 1E9BA 1ETUA 4AD8A 4B71A 1SVIA 4TLAA 1R0YA 1RPZA 1KI6B 2G0TA 5KTYA 1FL9A 1M2OB 2WWXA 1U81A 2X2EA 4PC1A 4H1UA 1YJ5A 2BMDA 2WJHA 3EIHA 3K9HA 4DLUA 3W8RA 5IK2D 3GPLA 2GILA 1FFHA 4NPHA 2ZAMA 1YRAA 1OLOA 5DISB 2G9NA 5FUWA 3GD7A 2QTFA 2ZQ5A 2IWHA 2AK3A 1P6XA 3CONA 1UF9A 5D3MB 3RWMB 1GOTA 4FCWA 1QHYA 2Z6VA 3NC0C 2IA5A 1BKDR 4B3DA 4DB2A 3L0IB 2IYZA 4KU4A 4JSTA 3CO5A 3K0SA 4KHZA 2CBZA 2FGJA 3GLIA 2D74A 2A5JA 2J41A 2ZJAA 4ESVA 3C7KA 4JL8A 5AJVB 3KQHA 3PENA 3ZQ6A 1D2MA 3VR6A 3SFVA 3SC3A 4NYIR 2WPDA 4EFLA 2D06A 1N0UA 2ZSDA 3DO6A 2WWIA 4TL8A 2GJKA 3B1YA 3AGQA 3RYTC 5DHAA 4RJLA 1ZCAA 1DO2A 1KKMA 4PANA 5EXPA 3GFOA 2GTPA 2VRWA 1W4RA 2F3TA 3AKCA 4KSCA 4CW7A 4ZI3A 1CP2A 3G0HA 2W0SA 5KSYA 2ZEJA 1W46A 4JZKA 1CBUA 4HUTA 3RRMA 2YKGA 5EP2A 4QNRA 4EUNA 2R6DA 1G20E 5F2EA 1F2TB 4P33A 4DLYA 2J46A 1Z6GA 3GFTA 1YQTA 1VHTA 1WA5A 4NBSA 2ECKA 4KLNA 1M7GA 4P4TA 1CJUC 2ZRBA 2BEKA 4Q4HB 4LK2A 3GEEA 3PQCA 1AA9A 3LW7A 2ZR0A 4TLCA 1D9ZA 3BS4A 4Q9JA 2GK6A 4IOJA 3LDAA 2ZRLA 2JASA 2IYWA 1ZC4A 2QRNA 2B6HA 4QBFA 4CEHB 1N0VC 2RHDA 3W6OA 2WKRA 4V0LA 2IX3A 2Q0HA 1E2EA 2R65A 5E95A 3MSXA 3VR5A 4A36A 3K09A 5E4FA 2GEUA 1NJFA 3GLGB 2DWPA 2RB4A 3CZQA 2QPOA 4IFBA 1UDXA 4M9ZA 3VX4A 4TZ6A 3VHXA 2PCJA 1SVKA 2GCOA 2FFBA 4TN1A 1E99A 4BFYA 4D6PA 2JATA 4YQFA 4AI6A 5EXSA 1G5TA 2AFIE 1Q1EA 4ZIRA 3T15A 1KO1A 4L9WA 2DB3A 5DLQC 4GP6A 3WMFA 1ZIPA 1XF9A 1KHTA 3OEHA 3WRYC 4B6EA 4HLUA 1FTNA 1P73A 2JJ1D 3EZ6A 4HAZA 5AR1A 3G5UA 3EG5A 2AXNA 1TUIA 1DAFA 2IWRA 2R9VA 1QRAA 2IF0A 4FCVA 2G3YA 3CRVA 2GXSA 3FHCB 2J0SA 1KO4A 2AK2A 2KI5A 1ZBDA 2E87A 3TMKA 2VP9A 5FOWA 1Z63A 4X8LA 3PEWA 2OO7A 1ZM2A 4GMDA 4JS0A 3B8HA 4N0EA 2UZIR 5E7MA 1XJQA 4KFTA 4BFVA 4XSHA 5CLLA 1IXSB 4O0MA 1SXJA 2JLQA 4C0AC 4TYNA 1KZ7B 2RGCA 4DB4A 5KYKA 3B1WA 2ZRIA 2ZRCA 2ERYA 1SXJC 2XOKD 3D7MA 4F7WA 4KODA 3QXHA 4DXAA 4DCVA 4R71A 2C5LA 1S9HA 2FZ4A 3TAUA 5L3VA 1LNZA 2VPPA 4ACBA 2C9YA 1P5ZB 4YMSA 2B92A 2ZANA 3NG1A 3SOPA 1HT2E 4ZPXA 1ESNA 3GLFA 5K8UA 4Z8XA 5EZ6B 4US1R 2AWNA 3SR0A 1MRSA 2W6ID 3G82C 2Q3MA 4DSUA 4GOKA 4C0KA 3QXCA 4YONB 3T5DA 4GOXA 4HLUC 4TLBA 2HCJB 3AB3A 1VMAA 1D5CA 1G4UR 1J70A 4GI7A 3DZDA 4N3NA 5C4GB 4L16A 1U8YA 3REFA 4EJSC 4CVNA 3SDZA 1JXOA 2PH1A 4LJ8A 1R4AA 4QGFA 1E0JA 1RJ9A 1WQ1R 3SHFA 3FPAA 1WRBA 2XZLA 3DKVA 3T35A 2REXB 3CM0A 2OCPA 2CL0X 2QPAA 4IXNA 4M0LA 2OV2A 5BXQC 3QBTA 4PPGA 2NG1A 4WZBE 1CEEA 4DDUA 3I92A 1E9SA 5EP3A 2D2FA 1VECA 4A0FA 1Z3IX 2QT0A 4AWXA 2ZVPX 2WWGA 1HH4A 4NE2A 4OK5A 4LDJA 3BB1A 1AQUA 4X8HA 1XTKA 1G8YA 4GPTA 2J5XA 4Q1EA 1T6NA 2QROA 3BH6A 1PLKA 4I1OA 4IEEA 3QIAA 2JLVA 4AKIA 2BBOA 2WWYA 4PO8A 4XH9B 3EIQA 5FBRB 4ACAA 1PLLA 2FGKA 1TUEA 1W2GA 1UKVY 1Q1BA 2ORIA 3PR1A 4AKHA 1KKLA 1KDOA 4QGHA 1UJ2A 5A0FA 1T3SA 4A0HA 1TU3A 4FMDF 1Z2CA 1T8TA 3BOSA 4WXRA 3V4RA 5FUVA 4YDHB 4US0R 1FW6A 3HPQA 3DDCA 3ASYA 4DDWA 3EWSA 3KTAB 2GWHA 1WB9A 2ZE6A 1G7TA 3RC8A 4V0NA 4DLWA 5J4LA 3NBXX 1GAJA 1GFIA 1UEIA 1GIAA 5L3RA 2VP0A 2BV3A 4JT2A 5DH9A 5KSZA 4HATA 2ZI9A 4C2TA 1GRRA 1N6RA 5SZHB 1GZSA 1II8B 3W90A 3BFXA 4BASA 1QHXA 5JZVA 2IHYA 1KNXA 4OJQA 1ZW6A 1ZD1A 4EAQA 2VO1A 4CEIB 1A7JA 4ITRC 3AKEA 4XJXA 4F38A 1ZUNB 5F9FA 3WBJA 621PA 3WHLA 2P5SA 1QHHA 2XNDD 4JLMA 4PHTA 4BLTA 4W7SA 3THYA 1II9A 2OESA 2FF7A 2G0NA 2HYIC 2CK3D 3NEYA 1MV5A 4DRZA 1ZU4A 4BFWA 2FFAA 4B2IA 4C7OB 1FQKA 1OYYA 1V5WA 3NDPA 4MITA 4RD0A 1E2FA 4CRWB 1N5LA 4UNSA 1XBTA 1P72A 5CJ2A 2ZRHA 4ON9A 3EPJA 1E2LA 2K5UA 3KDSE 4B3FX 5KNCA 3A37A 3KQKA 2VHUA 1RRCA 1KI6A 1FP6A 4AY2A 2ZSBA 2C8VA 2QBYB 5G53C 1G3RA 2W58A 3LD9A 4CIDA 2XB2A 1M6NA 1IHUA 2C78A 4OQNA 4OJKA 4NCIA 4ZI2A 4UQOA 1Q0UA 2IYXA 1OW3B 1NP6A 2EW1A 2WKPA 1JQLB 1E1RD 4HEJA 4KFRA 5KDLA 2FSHA 3K70D 1K5GA 1ZNXA 4HUQB 4QKQA 5GADl 1L4UA 3A36A 3K0FB 4BFZA 5L3SB 3BFVA 3UIEA 1N5IA 1NBME 3HU1A 4GOJA 1S1MA 3GLGE 4DLSA 1PV4A 1SKYB 3VR1A 5GJVC 2J0QA 3SU8A 4HSEA 4EPTA 2OT3B 4G01B 1XPUA 1BYUA 1CRPA 3LAWA 3W3AA 5J47A 4PC2A 3THYB 4P3YA 3ZD6A 2O0JA 1D2NA 3B2EA 5C1BA 2MSCB 3B9QA 3OFNA 2B21A 3GJ5A 2OSBA 1OFTA 2IEZA 2NTYC 1O87A 3DMNA 3K0CC 2PT5A 2CJWB 1E2DA 2IS1A 3QXSA 4R98A 2D3WA 2OLJA 2GZDA 4DUGA 2FSIA 1MO5A 5DIFA 3BE4A 2O8FB 4NCHA 3IPYA 3IHWA 5AJXA 5CM8B 3QF4A 4CEHA 5DN6A 1CS4C 1K5DA 3OE7A 1ZMXA 3IHLA 3PG5A 4QGGA 1P9WA 2QBYA 4MDFA 1LF0A 3B78A 4M9XA 4V0MA 4RKEA 2C9OA 1EFRA 1W48A 1OT3A 4DCNA 2FX3A 2KJQA 1IY2A 4G5SA 4BRWA 1XJ0A 4OI0A 5TB5A 1TU4A 1E0AA 2IBMA 5FI1B 4AIIA 3MAAC 2QP3A 5EQTA 5KHOC 3VNUA 1ZUHA 1NBMD 3RS2A 1OFHA 3CNOA 2ZRPA 4MQBA 2Z4SA 1UKEA 1E2KA 3A1TA 3PUWA 4FCTA 4TL9A 4PHFA 1M1YE 4NCNA 3K0CA 1FNNA 1N0WA 1P60A 2OZEA 2PEYA 3UK6A 1X86B 3MUFA 3GJ7A 1Q12A 1OHHA 1Q44A 2GJ9A 4OHXA 2PEZA 5JBQA 1GP2A 2J3EA 2QRZA 1R8SA 3PUYA 4MKHA 3HR7A 2ZI7A 3M0EA 3FHOA 4PPQA 1E2IA 5JFGA 3JVUA 2J9RA 1EFTA 1W47A 3F0TA 3SBDA 4PAOA 4ASUA 1U94A 2CVHA 1EFCA 3OIYA 2E9SA 3VHLB 1EWQA 2CLSA 2OG2A 3MWLA 4Q4JB 4LJ6A 1M8PA 2BMJA 1OXSC 4CYMA 3LBNA 3O8RA 5FPTA 4TQUS 2WHXA 4KLZA 4GP7A 2W6JA 3GLHB 3FVQA 2N1BA 4LYJA 4XTRA 3AVUA 1IN5A 4IVQA 1SHKA 2ODEA 1GITA 2NO0A 3EA0A 1JPJA 4Q7LA 5JSZB 4UKDA 3TKLA 3V00A 3L82B 1D9XA 2RGDA 3I8SA 4S35A 3R8CA 4A2WA 2ZU0C 1G41A 2C95A 4PSKA 4JVNA 1G7CA 1HE8B 1ZU5A 4OQFA 2GXAA 1S3GA 5D3MA 4Q21A 1TX4B 3MG9A 2J0UB 1OKKD 2QAGB 4PC6A 3EX7C 1ZRHA 2QZ4A 3B60A 2X19A 4M1WA 3UMSA 3X1WA 2DYKA 1NN3A 4EPWA 1Q1QA 1S1CA 2XTMA 5CYOA 5L3SA 3SJCA 1ZIOA 3VNVA 3HYRA 2FWRA 1NJGA 2ZI5A 1W0JD 4M2LA 3N2EA 4LOAA 5C46F 1R0XA 5IRCD 3U60B 2F55A 1UKYA 4FD2A 4F93B 3K9NA 3KFXA 4HDOB 1GNPA 2ZI4A 3CRQA 1R5BA 3P32A 4GZMA 3UANA 1L2TA 2WWFA 4HAWA 1NG1A 3BC1A 1R5NA 4V03A 1K6MA 1QDEA 1KSJA 4GT1A 1OB2A 4IJMA 1Z08A 1XD2A 3A1VA 5FL7D 4AG5A 2RGNC 1HY3A 5ANRB 1X1SA 1TQ6A 2WVJA 3QKRA 1VCOA 2WJVA 3UATA 4EJSB 3GQBA 3R9IA 2WJIA 3AKDA 3Q9LA 1XD2B 4RD3A 4RZ2A 2F1IA 2F43B 3FMFA 4B43A 2P0EA 2E1RA 4IFEA 2RMKA 1G8HA 2ZS7A 1H65A 3A1WA 2QM8A 3M6AA 2ODNA 3GP8A 2RAPA 3M4YA 1P75A 4LBYA 2V3CC 1KK0A 4OK6A 2YNMA 1XTQA 4TMVA 4JJKA 2OHFA 5FPKA 1KY3A 1B0UA 4ZDKA 5DO9A 3ND8A 1RW4A 3U3RA 3ZS8A 3C14C 2D4HA 3VMFA 2J7PD 2GK7A 1EESA 3FFBA 2GVZC 2V55B 3KX2A 1NI3A 2UVQA 3SEAA 3TSZA 4L5BA 2UZ3A 4U02A 3WMEA 4OI2A 1KI7A 1N6IA 4MKGA 4OHWA 4URYR 4Q9IA 3PXGA 4RZ3A 4EIWA 1JECA 3HDTA 3Q7PA 2X77A 2GBLA 2CE7A 1NY6A 2ATXA 2BCGY 3B1ZA 4IDOA 1ZUIA 1BS1A 4M1OA 4TMKA 1X6VA 2H18A 3TVTA 3R7WB 4OQMA 2RKOA 1G8FA 3LVQE 2D7CA 3BH0A 2J0VA 1Q1ZA 3EXAA 3OIWA 2VP6A 1FUUA 1SZPA 2RGBA 4TMTA 3RLFA 2OBMA 1OIXA 5JEDA 3GJ4A 4NMMA 3U5ZB 4RFVA 1G17A 2FV8A 3W9YA 4NU0A 2KWIA 4OKSA 5SZIA 4YMTA 3BJIC 1G3MA 4Q47A 2Y8EA 521PA 3SJAA 2DWQA 5HKKA 5FR1A 2YWFA 1E9DA 5KOYA 5IDVA 2C77A 1U90A 1KGDA 4UJ5A 2OCBA 4DCSA 2VLIA 2ZS8A 2ZRFA 4MRPA 5GJBA 4MYCA 3IIMA 1AJEA 4MRVA 1ZAKA 2OLKA 3RRNA 1NVXQ 3CWQA 4LHYA 1FQJA 4LYFA 4C0QC 4JBWA 1XWIA 5KUTA 1L4YA 2JAQA 1UAAA 3A6PC 4C2UA 1YVDA 1JALA 3MWKA 2PMKA 3LFUA 1B23P 5C4MA 1UDWA 1BIFA 1E0KA 3VKGA 4M22A 3E70C 3WNCA 2O52A 1VIYA 5J40A 2H16A 1A5TA 1KAGA 1E9EA 1SVLA 4NYJR 3K0FA 4MUBA 2WOJA 3OIUA 5HZHA 3AVQA 1M7BA 4PPFA 1E96A 3QG1A 3ADCA 4JKYA 1GSIA 4WOPA 4OYHA 2GF9A 1OFUX 4TMZA 3WP1B 3VTKA 5EE5B 3J81k 3LV8A 1OH5A 3KUDA 4QBIA 5EUQB 4L8GA 1Z6XA 3H86A 1AKEA 2C9CA 3ADBA 3CRW1 3ZYCA 4ZCIA 3JVVA 2RGGA 1RC8A 4MKFA 5AUPB 5J4HA 2AWOA 5FTMA 1XTRA 5AJZA 2V4ZA 3V9PA 1P7CA 4KVAA 2G77B 4CF7A 2Q6TA 5JWRA 3CPHA 1A2KC 3TW4A 2ZU6A 2WWHA 3X2SA 1NMZA 3FHTA 5JECA 5KO2A 2OFWA 3PVSA 5FPYA 1CR4A 1OV4A 2KBEA 4FMCB 1Z0AA 1DS6A 1S9DA 4Q03A 4BFUA 2CL7X 4M9QA 1ONBA 1OPXA 2QAJA 4UXIA 4MUAA 4IDPA 4K8OA 2YOGA 2XITA 4C7OA 3TSWA 2GJAA 3CR8A 4PO9A 4B47A 3Q5EA 5J4KA 2A5GA 1RRFA 3P27A 4DLZA 3TUZC 2O8DA 3OHMA 4BLSA 1YZLA 1G5RA 3NTUA 4P4SA 4O25A 2OBNA 2P3SA 5FOSA 5DNYB 1UEJA 2N42A 1KK3A 2VTKA 3QKSA 5BN5A 1DE0A 4QOSA 1DELA 2O8EA 3B85A 1EFUA 4MKIA 1KJWA 3ZZUA 3KXIA 2GRJA 1HUQA 3U4QB 1IJFA 4E03A 1XZPA 1RRGA 4LBZA 5HE9A 5FUXA 4A92A 3PEVA 3BORA 3PJRA 1EWRA 4CEJA 2AFHE 4ASUD 3I4LA 1CR2A 4B73A 5AUQA 1NBMA 4HZUB 3DM5A 1XB2A 3ZVMA 2C98A 2V1UA 4NL4H 5M04A 4XD7A 3NVAA 3ZIAA 3X1DA 5JWOA 4A8JC 1QHSA 3KTAA 4R7ZA 2IW3A 1KO7A 5H70A 3S1AA 4E09A 4RY2A 2LCFA 1NLYA 3TUIC 1I4TD 2YJTD 2IS6A 3FGNA 4G1UC 5UKDA 4GDFA 2GNOA 1Z6AA 1QHHB 3NH6A 4HDCA 3LRPA 2P67A 3EPLA 3AVYA 1U8ZA 2CHVA 1JQJC 5DGXA 1SVOA 2PLFA 2ORVA 3EZ9A 4Q1DA 3GMTA 3U3JA 3QNUA 5EE0A 2F43A 1R7RA 2IEYA 3GEIA 1KI8A 3B5JA 4QBGB 1JI0A 4UNQA 3RS7A 1DAKA 5H1YA 4E07A 3IEVA 5A4JA 3CR7A 3T1QA 1SXJE 4PHHA 2W6JD 1Z28A 3K9LA 4Q00A 4JBYA 4POAA 3AM1A 3ZVRA 5HPYB 3ICEA 4LYAA 1I2DA 3AQ4A 3ADDA 2R8RA 1TEXA 3A1UA 3TJZA 3L8ZA 2V1XA 4PAMA 1ZINA 2WKQA 4MRSA 3A4LA 5EE1A 1P9RA 2G83A 4JT4A 4DLTA 3VR3A 2V7QD 1E9AA 4IHQA 5CB8A 5AWFC 5TDHA 3RSOA 1NRJB 3Q3JB 1Z0JA 1X8KA 2C2HA 3TR0A 5EUMA 1XU4A 1US8A 1KDPA 3HWSA 4GSYA 3TLXA 2OXRA 3HYTA 2ZREA 4BUJA 4C9BA 1XCPA 1TF7A 4ILEA 3GLHE 3CRRA 3T61A 1P2SA 1U0LA 5FR2A 4RCZA 1FUKA 1NLZA 1RIFA 1W1WA 4D2IA 3C8UA 1XTSA 3KXKA 2NPIA 5FH9A 4BEJA 3QSYA 3Q72A 1Y3AA 3MMPA 1JNYA 3EWAA 4RZXA 4BWYA 3U7FB 2QEQA 2OFOA 1W0KA 5CK4A 2VHCA 5KDDA 1AQYA 1R10A 3C4JA 3DOFA 4JLKA 5CYPA 1MO6A 5JRZA 4PR0A 3EC2A 3OFND 1OF1A 1KI2A 3BIFA 3IBYA 4I1SA 3GFPA 2P6NA 1ZD9A 2BBWA 4TWZA 3RS0A 4EQ6B 4D4MA 2HF9A 2ZJZA 5AK0A 5HE8A 3CPJB 2FG5A 5IHPA 4DDVA 4XWKA 4AYWA 4DLRA 5FPSA 1P3JA 4F4JA 2ANBA 5JJLA 1DVRA 3MGCA 1XX6A 5CM9C 5K8IA 1JB1A 3QVUA 1X8JA 2QSZA 5G41A 3TUJC 3BAFA 3A4MA 3LX8A 3I1FA 1WCV1 4DJTA 2ZUDA 2IYUA 1FMJA 5EE9A 3LQQA 3CW2A 4KYUA 2IT1A 4KBGA 1YR8A 2JJ8A 1EFRD 1DAMA 2WIBA 1FP7A 2AKAB 4JBXA 4MYHA 2Z43A 5AUNB 4Q4LA 3K8YA 3D6TB 3DPUA 4XWAA 3TR5A 3FKSD 3ZJYA 2JCSA 3CX8A 1G1MA 4B6FA 4DT1B 4TYPA 3GLIB 1Q3HA 1T5IA 1LFDB 5TMPA 4Q9KA 1E4YA 2I1VB 4JLVA 1N6OA 1N2CE 1XEWX 3KFVA 5DSZA 1T9HA 3VAAA 1GL7A 2FSGA 1Z47A 2CLCX 1KK2A 3U7EB 4QM7A 2XNDA 4M1MA 4D4KA 1BYIA 1UBCA 4JLNA 2XJ9A 2GJ8A 1IXZA 1L7VC 3GLGA 3E1SA 2OE2A 4IOKA 2IYSA 2GAOA 2L0XA 1H8EA
chains in the Genus database with same CATH superfamily
4LCBA 1M0SA 3R09A 1Z3CA 2HXSA 3C48A 4G3XA 4WLFA 1G3IA 1JEEA 1OZ0A 3WY9A 2A8YA 3KJXA 4LWOA 2A9VA 1JEAA 3ONWA 2IBSA 1R6BX 5HBGA 1Y82A 1MO4A 3I61A 2N47A 4C4RA 1IAQA 1RI1A 1WMBA 1VRVA 1TMKA 2OHOA 2NO7A 2SECE 3BTSA 3DL0A 4Z3DA 3P0JA 1XXHB 1WETA 2DR3A 4JI7B 3FWNA 4A0GA 4JK3A 4UEKA 2XDQB 3RYFB 4ZK6A 4RMJA 4JITA 2QUZA 4LHWA 3TQHA 2O2ZA 4PYNA 1J90A 3WNVA 3H2JA 3WZLA 4YUWA 1LEHA 3FOFC 5K3CA 2IEGA 3HADA 4OIMA 3BA1A 4XWWA 4WLVA 3Q8MA 2PX0A 1EK2A 4PN3A 1QZTA 1ZM7A 5EYPB 3MRTA 4XFDA 2EKQA 2MR5A 1E4EA 3MLBA 2OYCA 1WD5A 821PA 5G1PA 2DBRA 4HH1A 4XRRA 2GD2A 1EVYA 3NHUA 5EXTA 1YZGA 3N5CA 2PZGA 2EJWA 3LUGA 3MZ0A 3DJFA 1RQPA 2CNWD 4Q34A 1GL3A 2IXAA 2R5FA 4O1HA 4PZZA 4RA6A 3C4VA 1YI0A 5D1HA 2Q6OA 4LFBB 5FUBA 4V0ME 2YV5A 3LT4A 1HZZA 1NZJA 1X13A 2IYRA 1H85A 1E89A 1MQAA 1W1UA 5BMVF 3HU2A 3O2SB 1PG0A 3ANTA 2QZJA 3FWYA 1DDGA 1WOMA 4PCLA 1G6OA 2IHNA 3K5HA 3FBWA 3MPUA 4UCWA 3GGOA 2ZRDA 5K8CA 3BWVA 5BW5A 4C01A 4PC7A 2YTZA 3GC6A 1PS0A 1VCNA 3RBVA 3ROKA 1SG6A 3E81A 3K71B 1G5PA 3NOXA 4JJGA 4ITUA 3WQSB 3FUCA 3UQZA 1XPOA 3ELUA 3FMIA 4KQWA 3GUVA 1QMGA 5HRCA 4YQYA 5K6RA 1Y3BE 4BRZA 2B4QA 4MWGA 3HP7A 1V95A 2HJWA 4E5UA 4GD3Q 2YWHA 1NLUA 1Q91A 1E98A 1R37A 1Y1LA 2XOEA 2NOAA 1OXUA 4OB6A 1C0IA 2ACWA 5COBA 5GJWC 1WVMA 4FYVA 5AVTA 1A4XA 3EEIA 1YS2X 1Y6JA 2YVUA 3MCAA 1C9EA 3UMFA 4EMSA 4YR9A 1DB3A 2RGEA 2ZYAA 4JC5A 3ZIAD 4Q7QA 3NU1A 3ZTTA 1JAIA 4HLQB 2F62A 5A3SA 2QQEA 1COZA 3OEED 3HZRA 2G88A 2LKCA 4ZXFA 3H8WA 2AOTA 3GEGA 2AR7A 5KSWB 3T7RA 1VCIA 2C42A 1CR1A 4PIMA 2SICE 4JC0A 2ZTUA 2BEVA 2W8BB 2O23A 3FFXA 4LSWA 3RVQA 4BEWA 1A1VA 3CWZA 3AF4A 3EC1A 4NCKA 4UZEA 1TPYA 4C7KA 3IHTA 1A4RA 1BH2A 1U0NA 1UDBA 1E18A 2QAGC 3NEPX 3QLUC 1UADA 4LNUB 4MS1B 1MGPA 5CB4F 2CZQA 2GARA 3CB2A 4GM4A 4JJ7A 3SNHA 1IE3A 2FJUA 2W2LD 1VE1A 3EVCA 3FBTA 2PFKA 1X94A 3LWZA 5CA1B 4MGZR 1OIWA 2RHRA 2Z8YM 3DD1A 3QI7A 2FSVA 3F8SA 2LCQA 4KQJA 4YV7A 3JD0A 1DBWA 4QRHA 8ATCA 1XP8A 2QE7D 3SZRA 1SXJB 4EVQA 4C0LA 2P2NA 1IN1A 4B35A 2YHSA 2W83A 3S70A 3K4HA 5JRDS 3HA7A 2GZAA 5DEOA 1MO2A 3PPXA 3ZHTA 2G28A 2OPHA 4XX1A 5EJFA 3TBHA 3NIBA 5FTJA 1WU8A 3ORYA 3Q7IA 5IC6A 1DLIA 1QWSA 3VPDA 3JCZA 1GZHB 2JI6A 2ZAYA 3L4BA 1EQ2A 1V1RA 3ETLA 1Z22A 1XYVA 3IEPA 2WLTA 1Y3IA 1A2OA 2UYQA 3D7KA 2E1PA 3OFVA 4RD1A 4DIBA 2AR0A 4B7AA 4OU4A 4QBKA 4YEDA 3PPVA 2OY0A 3KJIA 5CVCA 4PF1A 1VYTA 4DSNA 5BV8A 2I4NA 2PNJA 2BM0A 3KUCA 3TLBA 2B9EA 3V4PB 4S1PA 1TLFA 4B2PA 5LYJF 4B5KA 1G63A 1OZHA 3T4XA 3T95A 4PHGA 3PEUA 3MB5A 2EZTA 4F4CA 3VSEA 2XTZA 2FXVA 2O6HA 1L7AA 1QONA 2DXIA 1MJFA 1JR3A 4FFOA 1E5TA 3P2KA 3RH0A 1MOQA 1SBNE 1TMGE 1UMKA 4Z1MD 3JAKA 1P4HA 5IJ9A 1W1IA 5MHTA 1PRYA 2DZDA 3D8BA 1XVTA 3T12A 1HXHA 3LFTA 1W35A 3CX6A 1SD2A 1MNQA 1MENA 2GFQA 3DEHA 1EK5A 1IHYA 4QLBA 2VP2A 2FPKA 4BEVA 4CKEB 4EL5A 1JU4A 1IC6A 2XDQA 1KAHA 1HYBA 1E7YA 3MINB 3TEFA 3U3KA 1BE6A 2GCGA 2IP4A 2PX3A 5BQOA 5DRTA 1KOLA 1OVMA 1CY0A 4JZYA 3KZNA 4ND8B 1F4VA 4G0NA 5C31A 1BVYF 1ZVMA 3O38A 2A9FA 5TY0A 1N4AA 4KRFA 1CUCA 2ZYVX 2ZTMA 4RDIA 3DZBA 4K8RB 5FTKA 2XI4A 2OCGA 3QEJA 3VDNB 1MDFA 4PONA 4KAJA 2A9OA 2RHGB 4R8MA 3NT2A 5FJIA 1CUDA 4RWEA 3TZEA 3ZWOA 8LDHA 5K0ZA 5THXA 1D2AA 1EFKA 3BMOB 3AIOA 3NWJA 4M9SA 3DXYA 5A5DA 3ET5A 1AIPA 2R44A 3QVVA 2QG6A 3M6IA 1PG5A 4LQDA 4TSFD 4FYKA 4LWQA 1HE4A 4LUCA 4BFXA 2DM6A 3PFFA 2BI4A 3RBZA 3JR7A 4PSVA 5LYJA 2C5EA 1XQXA 1Y81A 3FRIA 4A2PA 3I83A 3V7UA 2VL7A 2SCUA 2ZRGA 4Y2TA 2ZRMA 1O8BA 2FLVA 2IXGA 3OD5A 1M2VB 1QR6A 1U1FA 3SQLA 1I94B 1XKTA 1DPFA 4Q4AA 4E5PA 4EELA 2E4YA 2ZT7A 2VP4A 4FINA 3LQ1A 4F72A 5TXGA 3KJHA 2QVXX 3IAM6 1WCIB 3F2VA 3KKLA 3CNNA 3SHVA 3H2HA 1GL6A 5AM2A 9LDTA 5SYNA 4OAQA 1P91A 4BVEA 2OECA 1DZ3A 1TF5A 2HDNB 1RI2A 1K3TA 2EEZA 1L7NA 3L84A 4HRVA 3ZDQA 2QOEA 5JSQA 4D9JA 3PNPA 1II0A 4IH4A 4JYBA 2BKXA 3KPVA 1ZBQA 2WIAA 4U1RA 1S3SA 5BR1A 5DYIA 2CXTA 2G6TA 4KDEA 1Z5VA 1XZEA 1A71A 3IUMA 2JVKA 3IERA 4L7QA 5TPWB 4DM4A 1AZSC 1VKJA 5HXAA 4R1NA 1Y3FE 4N7MA 1H3NA 2H7VA 3EGDB 5G3ZA 5J2TF 1DC6A 2IYYA 1N6NA 3TRIA 3IGFA 4BFCA 5JNTA 1OZFA 1P1IA 1ENYA 4QZVA 2V6JA 1KVUA 5HFJA 1NRXA 2FPMA 3EIEA 5T6BA 4CKBB 3F9RA 4Y18A 1FBTA 2F00A 4QUEA 4ZDIA 1EAMA 3FVVA 2VF4X 2RB5A 3ZLJA 1E5QA 3KHTA 3ONDA 2VCYA 3DZCA 1BFKA 3KU1A 4JWKA 4WA7A 2C4WA 3LP5A 2JLXA 1JHPA 1G1AA 2Q2WA 3R9WA 3EYAA 4OP1A 1C81A 5DULA 5LZ5A 5F7OA 4M1KA 1T91A 3L04A 3I4CA 1L5GB 4JYPA 4TWAA 1KC1A 2NXEA 2PKWA 4OHKA 4IQ4A 5ETJA 5EPOA 1VCMA 1JBKA 5TE9A 1XP5A 3OCJA 3DBVO 4P7JA 3IJEB 4IMIB 4BNVA 3ZZTA 4B6QA 2R5NA 1MIOA 4FOOA 3TNFA 4X0EA 2OO5A 3A8TA 4HYYA 1KJYA 4JIMA 3TM4A 3HUDA 2DWUA 1GQSA 3E3NA 3K6SB 1I4DD 1WB4A 4ND2A 5DTQA 1FX0B 1MR3F 2C7GA 2P6OA 3OIGA 4MW9A 5J1SB 2FKAA 5CLJA 3HXPA 5JATA 1JN0A 3HNOA 4AMGA 5BPHA 4FGLA 1RKBA 1RWOA 4W5HA 1SN7A 4LRYA 1Y3DE 4GOLD 3UXHA 1EWTA 2JGDA 2KB0A 3D31A 3RC3A 1N3BA 1GVHA 5CB4B 3WQRA 3ZWAA 4R1TA 2J3JA 2AW3A 4YDSA 4GPEA 1H66A 5FFNA 2RHJA 3WMGA 1AY0A 2EU8A 4GFDA 5CIWA 5B7QA 5HUQA 2VZ8A 1SQ6A 3N5KA 3KALA 1QQ6A 4H6VA 1K7FB 3DZ8A 1S96A 1NFFA 3E5NA 3FSJX 3QX8A 1U9YA 1IH8A 4LYDA 4RULA 1EDEA 1ULHA 2H8KA 2XCIA 4LJ7A 4ZAVA 1XJ5A 3N0VA 1H8HD 4BU0A 4PN7A 1XZDA 2VSOA 3I6ZA 1RBZA 2GH1A 1N2IA 3BERA 1H9AA 1QS0B 5EHQA 5DHFA 2FMKA 4I1VA 3QOWA 1PK9A 2O5VA 1TM5E 1RABA 2E4WA 3G1TA 1NI4B 4TLLB 4YMIA 3WRVA 5TEWA 1E6MA 3KR9A 1SKYE 2JGAA 4E15A 4EHLA 3LNCA 4L6AA 2VFAA 2FQYA 4FU0A 4MPJA 4PU0A 4CT5A 2AXPA 4YQZA 2Q5FA 3AUJB 1J0DA 3NBYC 1FUYB 2ZSEA 2J45A 3M6XA 3LBIA 5B55A 2DFVA 2XUQA 3HN2A 3ILSA 4C0BA 2HHCA 5DWDA 1WIWA 2P2GA 3U4QA 2WQ7A 1J9GA 3M70A 3AR3A 3AONB 7ABPA 1GKYA 4YAWA 4HLDA 3FCEA 1JQ3A 3OLZA 4JFRA 4XDYA 1HV8A 1DO0A 3KCQA 4QPNA 4Q16A 4BAUA 1NKSA 3H3JA 5F98A 3BH7A 3O6VA 4X54A 2FQXA 3BTVA 5CW2A 4R2LA 3PHJA 3ZJUA 3IVCA 3B48A 1QBGA 2F7SA 3PV0A 1FSFA 2R87A 4FZJA 4K88A 5HZMA 5ICEA 1WPQA 1FFAA 5IM4A 2IZOA 2P8JA 1WUTA 3G2LA 4AQDA 1E69A 3K7EA 2ZP1A 3AVOA 4HOYA 4EW2A 4F2WA 4KREA 3TTXA 4UAGA 2H4YA 4JI3B 3U62A 1UXGA 2GZHA 3TBFA 4XR4A 4BMVA 4NU8X 3X1XA 3OF2A 4X66B 2OM2A 2Q3HA 2HCTA 4EB0A 1DFHA 3JSAA 1QF9A 3HEAA 2R25B 5EY5B 4POOA 5LMNB 4XVRA 3ZBPA 3RSHA 4X3PA 4FN5A 2FWPA 1S89A 4NZPA 1H4SA 1CUJA 2Y27A 4LXHA 3UGQA 3LO5A 2ZSAA 1KI9A 2CNNA 1YCFA 4ZVUA 1FUEA 1ORVA 2XUGA 4BVBA 2XZOA 1SO8A 3HJAA 3I34X 4CM3A 1MD9A 2V6GA 4TT8A 2GPJA 1DEOA 4BWFB 2IQ5A 1PUIA 4OXQA 2HHLA 3KOYA 2HV8A 1QUFA 2JLWA 4NCJA 4QTUB 2K6GA 1IXRC 3HJGA 3T3MB 3VZPA 2EDAA 5JZMA 4JR1A 4D6XA 1XEFA 3ORQA 4TRRA 3HY6A 5ISMA 1VB3A 2IQIA 3JRWA 1OAKA 4RGBA 5HGJA 3R7SA 3SC6A 4I5IA 4NDZA 4LVNA 4C1NA 5L4LA 1QVVA 4W9RA 3OSZA 2XY4A 1ADBA 3PEEA 4OGWA 3RE1A 1M8GA 5F3WB 3SYLA 3LNTA 1HNWB 3QXGA 4ZKEA 3SJZA 3OT5A 3IP3A 1B8OA 3WK5A 4M9UA 2VBCA 2YRFA 1J97A 3HKDA 3Q5DA 3RDPA 2VCHA 4EKIA 1IRIA 2PYZA 3K15A 4BCCA 3IQHX 1U6JA 2IITA 3TPZA 4FYWA 3NUZA 1C3EA 5EP4A 3UGTA 4AS2A 3DXFA 4MW0A 4EGQA 1XXHE 2GZ2A 1YFKA 4NENB 1DEHA 2Q6VA 1EJ6A 3K70C 2C84A 2VSXA 5M7EA 1N2CA 2IK8A 3QY0A 3DF9A 3PRJA 1X92A 1VG0B 2BLLA 2DFKB 3PC8C 4XIJA 5JLAA 2BGLA 3VVMA 5EQFA 4MW5A 2BKLA 5EL0A 2XB6A 2E4XA 1LTKA 1TPZA 3I52A 3EK2A 3FNIA 5D6OA 3V1MA 2O19A 4KX5A 4FEAA 1WDKA 1GR1A 2HDHA 2PQ2A 4UD2A 3R76A 3RVBA 3G6KA 1XRJA 2DUWA 3WSTA 4EG5A 3MOGA 1E9RA 1XDWA 2D1RA 4MVJG 6GPBA 1ZCZA 1GGVA 1YASA 5JS1A 4S1TA 4QFMA 2IY9A 4LCJA 3MRSA 5G0WA 2C00A 2EW8A 3D0QA 4ABTA 4KK3A 4L02A 1LW6E 1GPLA 3AL2A 4HXEB 3BXHA 5E9JA 3TPFA 1E4EB 4P58A 2H8GA 4NYIQ 3LC0A 2YMMA 2Q3EA 3U4MA 4OXXA 2AE1A 1FXUA 3HCEA 4C4OA 2ZOSA 3EVGA 3AETB 4O4LB 2OMKA 1OA1A 1OWOA 2VQSA 4Y6QA 1Z6ZA 3JXEA 1OVGA 1CE8A 1I6MA 2XDYA 1R12A 2ZKIA 4RZIA 4YK7A 4I55F 4MVWA 1UFRA 4Q1CA 3QYPA 1N8NA 3WWDA 2VF7A 5TQ0B 3IULA 1SHZA 4O2AF 3RIYA 1FQOA 1HDEA 4PLGA 3J80A 2NPFA 3SFTA 5KCZA 2OQ2A 3H83A 4JXKA 5K6AA 1J99A 1K08A 4AP5A 3B3JA 4CMHA 3OMWA 4DXDA 1ECLA 3W6PA 4DIEA 2DKNA 4HDNA 3F7NA 1YBFA 4GHWA 1IHOA 1Z82A 4G1FA 4RPJA 1T8RA 4G0MA 4P31A 4AN0A 2BY4A 2HADA 4GBMA 4NP6A 3ND7A 3KU4A 2D4AA 2BOVA 1KGSA 2X41A 4QXPA 4JHXA 4AO7A 5T4FA 3WNBA 3QXXA 4ZZ3A 4U2CA 1RHMA 2M6SA 1Y33E 4PQRA 1KEZA 1M67A 3V8BA 1O94D 5A5VA 4N48A 3NYRA 5JROA 3PITA 5DTRA 2BTQA 3BIWA 1BE0A 3IEKA 3LVFO 1ULBA 1LLCA 1RJWA 1HEUA 1XQ9A 2EX0A 2LDBA 3G8BA 5HIKA 4RTKA 2OUKA 4L8LA 5HIIA 2VP5A 3COYA 2YYYA 5WRFA 3BULA 5TF4A 3ZGXA 3CX7A 5FF9A 4ZEOA 3TLZA 4DMKA 1SQ5A 3BSYA 1ZP6A 2VDMB 4MRMB 3USES 5L9AA 5KI6A 5D6NA 5AJYA 3CX4A 1T6XA 4NX2A 5GZ6A 1IY9A 2VAWA 4EYEA 4EMBA 1PEDA 2FY8A 1JIKA 4C30A 3F8TA 3JQAB 4GH5A 1IM2A 4BKPA 3RAPR 4RTSA 1PJ4A 2XUIA 5AJWA 1NMYA 3AP1A 4FP9A 1OOEA 4JLBA 4N8DA 3DLAA 1CZUA 1UKBA 1F48A 4MQ4A 2QPLA 3SZOA 4BX3A 4OX9Y 1JFSA 5HKAA 1V1JA 2DH6A 1ZX1A 1N1DA 3W6ZA 1U5BA 4FFBA 1ZM9A 2DC1A 3WHPA 1UWVA 3IEXA 3FSGA 1T2DA 5ILQA 2ZRJA 4H0NA 1W52X 4WXPA 3FD8A 2G09A 3L7IA 3ABOB 4GRAA 5AIAA 2IZ6A 3ZI0A 2GASA 3FDFA 3X1ZA 1HQYE 4LOKA 3DMTA 4RYDA 2QVGA 1EM6A 1NULA 2H54A 1X1QA 2ZTVA 3VPFA 4FYIA 5B2FA 4EHNA 3FSRA 1B0ZA 1CQXA 1HTBA 3FUUA 4HQ0A 3V8EA 5CDFE 1ABBA 4HEHA 3PRHA 1M1UA 4OJMX 5CB6A 2XRYA 4TOIA 1ODFA 3ZDDA 4F5DA 4PG6A 3P45A 3VJMA 2XVAA 1EUCB 3UWMA 4F6RB 1Z36A 1KQGA 2ZYUX 4HVAA 4OGFA 4EM6A 1IJEA 2OD2A 1ZI6A 3FZEA 1OBHA 4G24A 3M5WA 4XVQA 2AH5A 2JIOA 4RA9B 4FUTA 4NK4A 4OHPA 1SIBE 2X0NA 3HPRA 2JCGA 3H5WA 4H31A 4AKGA 5HOEA 5E7IA 4H17A 2WZQA 4Q3CA 4CM5A 2VDRB 4EQZA 1PIWA 2X1VA 3CF2A 4NR0A 4Q1FA 2DFLA 4F1JA 2PRKA 3SFZA 3NHMA 4L08A 4NY1A 3RJMA 4G0VA 3H9UA 1BOFA 2ZYRA 1G3QA 3V4LA 4EW6A 4DQUA 5HOQA 1GYRA 1OUMA 4P5PA 4ZCMA 3KO8A 2J9FB 3HKCB 2IPMA 3JRNA 3H1PA 4TV9A 4XGQA 4CL0A 1ONPA 2BMWA 4DA6A 1EXDA 3VAZA 5HDBB 4D8XA 1YS1X 5HKOA 1YRLA 5IX8A 3FYUB 2ID7A 5TDHA 3JD3A 2E82A 1P2UA 1NIJA 3VU9B 4BNGA 2ENWA 4XARA 1E3JA 1K86A 4W5QA 1EX6A 2Q07A 4ND1A 4XI9A 1ZMRA 2JLVA 4MAMA 4QHYA 1ZA2A 1NRIA 1NXOA 2H48A 3OE5A 1PNRA 2QZ9A 1IFXA 4NZ9A 2VKQA 4ISBA 4UHDA 3STVA 1ZJ6A 4ZYZA 1AKRA 1F1JA 2ST1A 3NC1C 3OCZA 2PY6A 5FWXB 1DUIA 1SUBA 3BB4A 1AS2A 3DAGA 4WEOA 2GHTA 2H7YA 5K20A 4MVJA 1QV7A 4RQTA 2XKKA 5JI3E 4YVFA 4A6DA 1VBFA 4L0DA 4W1SA 4K9RA 1YZHA 1OQAA 4FDUA 4BUZA 5CAEA 1RAHA 1TUBA 1KI4A 3PE4A 2B61A 3BRWD 4O63O 4UTVA 5KJCA 2OBYA 3T5PA 2WQZA 2ZRNA 3O3NB 1CUAA 4GX1A 4OSPA 3KAKA 2YJZA 5DT2A 3V4ZA 1Q92A 3S99A 1UM9A 4KPFC 1FEZA 4JVLA 4OUDA 3RC7A 4D8VA 2CD7A 4OHCA 5K0FA 2WBLC 3NV9A 2F4VB 3DEZA 3W4JA 2Q27A 3HZHA 1SXIA 2W6PA 1ISHA 1BMQA 1SBZA 2WZCA 3RTDA 2JGLA 2OVBA 4AJPA 4CG3A 5M34A 1GTMA 4TTAA 1ZSYA 3JARB 1BCRB 4QVIA 3RT9A 4CI9A 1H2WA 3P9ZA 1EGQA 5K09A 3A6ZA 4FK8A 3VKFA 2ZM6B 4HG2A 4IXMA 3KKMA 2AF4C 5DI3B 4QJBA 3UKOA 4TTSA 3BKXA 2OBLA 5AK4A 1TUGA 3EVTA 4XPZA 4L85A 2PH5A 5ECGC 4HWTA 2PT9A 3UTDA 1Z2AA 4P83A 2HQBA 1DWUA 3NHWA 1F60A 1WMEA 1CFJA 1XMVA 3UMRA 3AF2A 4Y3UA 4HL6A 4F5EA 5I7OA 1GILA 5HZGA 1SHTX 1VZ2A 5E3HA 2JLZA 1JIQA 2HB6A 4BZPA 1EINA 1X7DA 3I6MA 4I50B 4JLPA 1J23A 2Q5LA 2XGOA 4UUOA 2V0GA 2WUGA 4NULA 3K20A 2E89A 2VUHB 3NB0A 4KWTA 3GXBA 4AWAA 4MVJP 3LLSA 2P41A 2Y4NA 4OI4A 4MI1A 1UZUA 2VDWA 1T4MA 3SYKA 1GXSB 2BHRA 4G0ZA 4KMOA 2RIPA 2PLNA 2UYHA 2ZYGA 4NMXB 3TKAA 3HJTA 5DCLA 1G8MA 4ETIA 3W7BA 1WHSB 3R6WA 4M60A 5ABPA 3AUTA 2FP3A 3N70A 4HI0E 4X64B 1PR6A 2J0EA 4JL6A 4RV4A 9ATCA 4BLWA 2W48A 1IK6A 1VYHA 1IY0A 1JH8A 5FBWB 1NNSA 3K0AA 2X76A 3CCCA 1MCZA 1YB1A 2VHQA 1TB4A 3FUXA 1E2HA 3KKPA 3LPAA 4TKLA 4YS6A 3PUHA 1P6UA 4B8WA 3QH4A 4DWWA 1CF4A 1SKAA 5ES4B 4F0JA 1GZ3A 1DXOA 2JI4A 1YAHA 3QHPA 4DUPA 1RYBA 1LPOA 3OTIA 4B4OA 4MYDA 1R3DA 1XCGB 4BO9A 2X5KO 1P81A 3PJDA 5C80A 5K3DA 5THKA 2YN2A 1QPGA 1C80A 3LHIA 3N28A 4PFSA 4E5SA 5HGXA 4D4LA 3CZMA 3H7AA 3IKJA 4JKIA 3RQIA 4ZPJA 4FDMA 3NTVA 2PWBA 4HUJA 4DL9A 2NSDA 5G40A 5HUHA 2VHYA 2ISSD 2AS0A 4PLCA 3EHDA 2F6RA 3AH8A 1N2GA 3GOHA 3QLJA 4MUNA 4UPVA 4ZVKA 2OP0A 2ZB4A 5AW0A 4DV0B 2B7BA 3AJ9A 4I5EA 3U5TA 4NZZA 1LF5A 2BZ1A 3CLKA 2Q8PA 3EW9A 2DP4E 1A4IA 1EK0A 4YP1A 4FGUA 2C96A 1EVQA 2ONKA 3IC5A 1AB6A 1RQXA 2AZMA 5FNVF 3U7GA 4OVKA 2Q6KA 3ZDBA 3E82A 3I9V6 3Q40A 2B37A 3ULKA 1BHO1 2OXFA 4KV9A 4MEJA 4YAGA 4PQEA 3M1LA 2A94A 4KAXA 2WNIA 1NVEA 2PZFA 3ZDRA 3DKPA 3EODA 5C8DA 3GU3A 4CKWA 2EAUA 4IO0A 5A2GA 3TKYA 3PTLA 2ECQA 3NHZA 3KXLA 2G4VA 2DBVO 2TECE 3ON5A 3WB1A 3RSZA 3E7PA 3KETA 1N8TA 2GBPA 2RG7A 4JOCA 1YJAA 2EG5A 5ICSA 2AJTA 1EZ4A 1KEUA 1S2MA 2C3YA 4OA8A 1S2DA 4CKEA 3L7BA 4G5GA 3NFYA 2JGIA 2VDOB 3LQRA 2QX7A 1QOPB 4NYMQ 3ZDYB 4D42A 1XVAA 2IYPA 5K9ZA 2J7PA 4Y1RB 3ACBA 4HGPA 4AJJA 1P19A 4PG4A 4N6GA 3K8ZA 1C9MA 4FXOA 4I4NA 1E58A 4GSLA 4LWPA 1C7EA 4YRIA 4HPJB 5B30A 4JUIA 3OZFA 3H5TA 3K9CA 1I4LD 2QS9A 2FFRA 4OSEA 4KITB 4Y6SA 2QL6A 1PAUA 1W4CA 4NOLA 1JHRA 2Y1WA 4OHUA 4JLOA 4RK1A 4ZAGA 5HYVA 3BIJA 5JMWA 1SUDA 4QTXA 4QDZA 1P45A 4ZP1A 3R0ZA 2AHRA 1VMEA 3W5IA 5HNKA 5BWMA 3LOPA 1PQYA 1KKUA 2GB4A 4M0EA 1DIAA 2BMFA 2RJ3A 4BFSA 2WFAA 1K1EA 5IASA 1MKYA 2C83A 2HJVA 3H3FA 5C8YA 2H4XA 4C78A 5LU8A 2QKYA 1EG2A 3O4VA 4BVAA 3C5CA 1H9CA 2XODA 2IDMA 4LJ4A 4TMWA 1CNMA 5L3SB 5AJHA 1BMFA 3ANYB 1KI3A 1U31A 2ZIGA 4PE5B 2YC4C 3U2QA 2RGAA 4MQEA 4DMCA 2N9UA 3T5GA 1FJGB 2QM7A 4FHCA 1D1PA 4J16C 5LLSA 3I23A 2W2MA 5KHLB 4D81A 2MJLA 4GR9A 1MIHA 5AKYA 3OJLA 4ZI7F 5IJWA 1G64A 2HSJA 4O4HF 2WSSD 2GN9A 3W5CA 1VHWA 1JJIA 5KKAA 1ORTA 5HJ5A 3V4FA 4YCLA 1FSSA 3GLFB 4DV7B 2G8LA 1JPNA 3E2MA 3NJRA 1QB8A 5T6MA 4E7OA 3FB1A 4RTJA 3FPJA 3TH5A 2Z09A 3EBLA 3LRTA 2C94A 2NO9A 1HT1E 3I9LA 3H1TA 3PDIB 4G1MB 4JC8A 1NGSA 4X24A 3WJ7A 3D59A 1N57A 4RH0A 1QGZA 1ODJA 2OB1A 1XQWA 2PTHA 1M8KA 3C39A 3LXUX 4QVKA 4IP0A 3GVXA 4BP9A 2XBMA 3U4GA 3O4GA 3B36A 4IJQA 4BO1A 4NXMB 1KWKA 3LRXA 1JSRA 2G0AA 2X3FA 3JQ8A 3VR2A 4CHTA 5U1PA 3PTAA 1Z5ZA 2XMDA 2G9ZA 3D81A 4BNMA 1MB0A 4UVEA 3GRAA 1N3IA 4EYKA 4OXNA 3E5HA 3CV3A 4FSXA 1KH3A 3S8YA 4IVPA 4LI3X 2VJYA 4RJKA 5IMSA 1QBKC 3IVMA 2ZJYA 2E49A 3WLMA 4AMVA 3NXSA 1ZYUA 1QC5B 4EW1A 2M98A 3LZ6A 3A3PA 3RR2A 5CFPA 1C7QA 1MXFA 4KWIA 4AUEA 2BMEA 4TTPA 2VYFA 4GZLA 3D4PA 3T1TA 3COZA 3R40A 4TV8A 3ZE6A 1KY2A 1CJTC 1TZ2A 4EHAA 4IILA 1UJNA 1BU8A 3N2GA 3R74A 2V7EA 4QG7A 3VBCA 3VA7A 3CH4B 4GECA 2XB4A 1EXVA 1GFWA 5AW7A 1I2AA 2HLDA 2O0HA 5ERGB 3RK0A 3VISA 2M1XA 3QEOA 2GEVA 2QRLA 3NGXA 3ZV7A 4DEXA 2ZM5A 1JL3A 3CC8A 2BFMA 2DLNA 3R0JA 2HFKA 4YCBA 4YC7A 3VZCA 1OTHA 3QJ5A 1TQ2A 2W70A 3BTOA 4BLOA 1J00A 4P7BA 1AZTA 1C8KA 3VYSB 3RNOA 4BB0A 1OHHD 5LQNA 1NJ8A 4OH7A 4B83A 2EFHB 1RE0A 2WYVA 3DO8A 2B8WA 2I6UA 2C5FA 4CM4B 4J0FA 1JFTA 2WHPA 2Q29A 1NJSA 2GPBA 3DFUA 2JIQA 3L7YA 2V7WA 4G56A 3B9PA 5IBCA 5KWEA 3OM8A 2CDAA 2J3LA 1V41E 4Q4AB 1K4MA 1NPTO 3CINA 3STXA 3ZDEA 4J1TA 3KSUA 1KZGB 3WK7A 3PIRA 1YOVA 3HU3A 1N77A 2A9RA 3KVRA 3I5XA 4C4PA 2YC2C 4L3VA 3DFZA 2WILA 4ME6A 4B7CA 5B1YA 1FYEA 5HILA 5J2UF 4M6WB 5J4VA 4IR7A 4AJLA 3R3HA 2P2CA 5LFAA 2DUJA 3L1UA 3OA0A 4GLJA 1GA4A 1UUFA 2NO4A 3RJTA 2NXJA 1JMVA 3PC6A 4BN0A 3PEYA 2O8CA 2WM3A 4FYPA 4TVSA 1RM5A 2DH5A 5C7LO 2J9ZB 2JFQA 4NJEB 4JVMA 3HGMA 3U17A 1SC6A 4S04A 2XKAA 4A27A 2HPHA 1Z2NX 2HZ7A 3LECA 4OP2A 5I8ZA 5J58A 3O0DA 4FNMA 4ZK2A 4LX0A 2OKCA 2X22A 1RHUA 5DTIA 5DHRA 3PUXA 3EGXA 3OH8A 5TQ0A 4K0RA 1GQOA 1LBIA 2FSPA 3AHCA 1U2ZA 3DC7A 1SRRA 3SQWA 3ZNNA 3U6KA 5F2NA 2VEDA 2BM1A 4KE7A 3ZDCA 1O7JA 1N2JA 1AS3A 2ZTSA 2D2XA 4WTOA 2WTUA 4TTTS 3LSYA 1XTJA 1Z9BA 1QG6A 3PTZA 4Y0AA 5DWQA 1J2YA 1YULA 4RVOA 3CVOA 3RVRA 2W6NA 3EULA 4EENA 4DV5B 4G9BA 4HB4A 4MB2A 3FOEC 3ND6A 1XNGA 2P9EA 5EJ2A 2FMHA 2P3LA 4GKKB 2AN3A 2R2AA 3WIDA 3BD7A 3ZJ4A 2PSEA 2JLAA 5GIOE 3AY0A 1FX0A 5DYWA 2CMKA 2JAHA 1HFEL 2ZPTX 4HYTA 1MEJA 5FI5A 3D3NA 1SCQA 4L4UA 3M6UA 3L2OB 5DTMA 3SLKA 2AGVA 4PYQA 1K4YA 221PA 4RTOA 5CIQA 3L02A 4JJFA 2HHHB 1TZKA 1P3Y1 4DC9A 1IB0A 1ZC3A 3OOJA 2C59A 2CXXA 1JIXA 1U80A 4IPTA 3S81A 2C5HA 3MJCA 4H6WA 4MUJA 2DT8A 1ADYA 1FRZA 1WMSA 4E30A 4BKOA 1WUKS 1OBVA 2CVPA 4BHTA 4RTMA 1ISIA 2ONYA 2YMQA 1XI2A 1NATA 3QE3A 3LWNA 4R1UA 1RYFA 1YU9A 4F4DA 4L72A 4COKA 1VP9A 4B3CA 4YV0A 1I3NA 1RAFA 2GAJA 2Z5VA 1B3RA 8AT1A 2BGTA 3D6HA 1WM1A 2RAUA 3IR5A 2Z2JA 1TIKA 3PYLA 5FKJA 4N1AA 5IDWA 3DBHB 4IRMA 4LGYA 1GVNB 3THRA 4F2HA 2WWRA 2AFHA 3LQYA 1GA6A 2AV6A 4JWTA 3VOSA 4BVKA 4G1VA 3SIRA 1X1AA 4Z8YA 5FFMA 2FWMX 1JWLA 4COOA 1KAOA 1ZH0A 4QL3A 2ATCA 3B6IA 4Y6OA 3BHNA 3ROEA 4D56A 4OHMA 3NETA 4HLNA 4YRTA 5HR5A 2FN4A 1IEWA 1N9ZA 3Q9SA 4EFDA 2WV7A 3QU2A 2E0IA 1P4RA 3BYZA 4KO4S 5JCZA 2OGZA 3WGKA 1K7EB 2V45A 4UVGA 5CEEA 2E4ZA 5JZBA 2C3MA 2O0KA 2KYRA 5B36A 1RCFA 2YHAA 5BUCA 2VNAA 5L4NA 2IW1A 1X1EA 1UFVA 2ZDGA 4DPMA 4MUHA 4JLJA 3W34A 4EJFA 1CUFA 4TMYA 4MRAA 2O8BA 2A9PA 1TKRA 1UOOA 5B64A 2DBYA 4KDCA 2WTMA 4K81B 3NH9A 4U9IS 3GZNA 2FX5A 1GNSA 1YFZA 2ZIFA 1XYGA 2XUHA 3BMOA 4F11A 3RAGA 3VDMA 5NLLA 1N4DA 2WYHA 5H02A 4Q7EA 5JHGB 5GONF 3HBLA 3QOXA 4WAUA 4QDUA 3PFCA 1YBMA 4D97A 3I39X 5I7UA 1CRQA 4WFKA 3NEAA 5H9VA 2VSFA 2RSLA 2SCUB 4MRRA 1GRVA 3VXKA 3O8OA 1XQ6A 3GARA 5TT1A 4AT1A 4C4AA 4RACA 2X4IA 1FMCA 4JX9A 3ANNA 1Q0SA 3REGA 1OYWA 2ZAOA 4K6KA 2FK8A 4AN4A 4CQMA 4DMUB 1HA3A 2G9QA 4EAAA 1IUNA 4TV9F 3ECCA 1IAVA 1ST2A 3GJYA 1V0JA 3S5JA 3IP1A 1TNDA 1U7WA 1XMPA 3TLCA 5TGDA 2YIDA 3O03A 1IZ0A 4RLQA 4QDJA 4YJ3B 1FP4B 4YRDA 4CM4A 3UBTA 1H8HA 1G21E 3GVPA 4N0DA 4TPKA 5TS2A 3SSAA 4Q1BA 5CU7A 3SJBA 4G67A 3SR3A 3B7WA 3LIIA 4CT0A 1AUXA 1J7JA 1DPGA 1H4TA 3LUHA 3EMDA 4DG9A 5IXJA 4AY5A 2OPBA 4MSUA 5FLYA 4GKBA 1JKJA 1XMSA 4MUEA 4PSDA 4QWWA 4UBOA 3EG9B 1PTKA 1E9BA 3LT2A 3WGOA 4AD8A 1G8AA 4B71A 4RHEA 1U8CB 4TLAA 1ZG3A 4AULA 3VO1A 5I6DA 3D8SA 3ML1A 5KTYA 3ZXYA 2WWXA 3A9CA 2V5AA 4PS0A 5BN4B 3LK6A 2XUPA 3IPRA 4FFWA 3W5SA 2IYFA 5IBQA 5ALTA 2IV2X 1K06A 2O9JA 2Z3ZA 4QVGA 3SQNA 5DISB 3UMYA 4J07A 4MMXB 2O7SA 1TM3E 2FR8A 4B85A 1H69A 2QTFA 2ZAIA 1FPQA 3HWRA 3CONA 3H5RA 4H2DA 5CT9A 5D3MB 3WYCA 1P4AA 1O9BA 3ZQ4A 3IVXA 1QHYA 2Z6VA 2H1IA 3OT1A 1EFVB 3N74A 3L0IB 1GTJ1 5F35A 3NNDA 1C8BA 4M8SA 5A03A 1TTQB 4BTEA 5CNMA 3F5DA 3OQIB 3DDHA 3GOQA 2PFSA 3ZH2A 4W82A 5JNSA 2ZJAA 4LSZA 4JIGA 5GPBA 5AJVB 3ED1A 4NMWA 3ZQ6A 1KFJB 3AOEC 3SC3A 5B6IA 3HM2A 2D06A 2FZCA 1OFUA 1V26A 4TV9B 2AXEA 3VDQA 3VKVA 1ZL0A 1E3DA 3FETA 3ZHRA 3AGQA 3JQGB 5DHAA 4OHBA 1GPH1 1ZCAA 3H8VA 3HBFA 4PANA 2Y77A 5HSGA 4HXGA 1R66A 1W4RA 2M1ZA 2ZUVA 4AQYB 1KPGA 2UZ1A 4WY8A 1IOWA 1CQZA 2YRXA 3AHHA 1CRLA 3L6OO 4QFCA 4R9SA 3RUEA 2FEAA 3Q7TA 4MX8A 3T52A 4ZI3A