4EFMA

Crystal structure of h-ras g12v in complex with gppnhp (state 1)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Crystal structures of the state 1 conformations of the GTP-bound H-Ras protein and its oncogenic G12V and Q61L mutants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4efmA00
2RGXA 1TEVA 4M1WA 1G3RA 2QQEA 2DR3A 2RB4A 5B64A 3VX4A 4LRWA 1M7GA 1RRPA 5FBLB 4TL9A 1VIYA 3ZVLA 2HJGA 1IBRA 2Q9BA 2ZVQX 3A58B 3W6NA 4W5WA 1UBCA 2FE4A 2WTUA 3MLEA 1OKKA 2VQSA 1R8QA 2OXCA 2C9OA 2E9SA 4NU0A 3AM1A 2C03A 4AC9A 5EP2A 2FPKA 1C1YA 5KHOC 2WMNB 4US1R 1Z47A 2F1IA 3C16C 2HLDA 1AGRA 3GPLA 4UQOA 1O87A 4HUQA 1SZPA 1XZPA 3C5CA 4M2LA 2NO6A 4C0AC 1OV4A 1J70A 3EIHA 1YR7A 2FFHA 3BFVA 4PC1A 4O2LA 4XH9B 2WWXA 2XTNA 4LJ8A 1JALA 2PZGA 4UJ3A 4CF7A 1GDDA 1VIAA 4DSUA 3Q3JB 5HCNA 4DCTA 3GJ0A 1BMFD 2D2FA 4JL5A 1ZNXA 4Q7KA 3B85A 2AR7A 4L9WA 3ASZA 3CB4A 3TKLA 1LVGA 1MO6A 3KJHA 4JL8A 1N0VC 2CHGA 2HXYA 1YZNA 2OFOA 2D3WA 5JEEA 4NCNA 4B3DA 2E1RA 2KB0A 3OEED 4QJ4A 4X8MA 4S35A 4DT1B 3GFTA 4JKIA 1FFHA 1SVOA 2QGNA 3L8YA 1XJQA 1KNQA 4KU4A 4KODA 1OLOA 2GBLC 1KZGB 4OQNA 1F2TB 1E2HA 2GTPA 2H57A 2QBYB 1KI3A 1Z6AA 4IEIA 1AGPA 3SR0A 4RFSB 3SZRA 4LK2A 4TL7A 1KI2A 3KJIA 1SGWA 5HCIA 5TV2A 4A92A 4EKDA 3CWZA 4UNRA 3T15A 2R65A 2VHTA 4NCKA 4Q66C 2XZPA 2KE5A 1UKVY 1Z3IX 2CK3D 5KPDA 3IO3A 3W9YA 1XTIA 3U44B 2BMEA 1S3GA 2WKRA 2EYUA 4A8JC 4F91B 5L3VA 5DE3A 4BWYA 2ZUDA 4OJQA 2F3TA 5HTKA 3M4YA 3EPKA 5CB8A 1TU3A 1JR6A 3GCGA 3T1QA 2RGBA 4U00A 3QXHA 2QBYA 4QM6A 1XMVA 2IEYA 3PV0A 5AUQA 3W5JA 4DLWA 4RFSA 1KI4A 5HZKA 2IUUA 1Q1QA 1HA3A 4R2HA 1DTSA 1YHNA 4BZXA 1JQLB 1MV5A 2B7BA 2QPOA 4HAXA 1G64A 1KK3A 3EZ6A 1XNJA 4AURA 3SHWA 4DSNA 2RAPA 1KOFA 1WP9A 1JAIA 1BYUA 1R7RA 2GJ8A 3GFOA 3H86A 1AN0A 3VR2A 1NBME 2ZI4A 2XITA 1WMSA 2IYUA 2XAUA 3Q9LA 1K6MA 1G5PA 1YZTA 4QFMA 2QSYA 3KB2A 3I8SA 5LD2B 3QF7A 4BFZA 4QGGA 3IDQA 3IBYA 3SQXA 4PZZA 4LPSA 2ZRGA 1CIPA 5LBIA 1U0LA 2XJ4A 1DAFA 4BZPA 4HUTA 3QBVA 1DARA 4LV6A 1LB1B 3P26A 4TYYA 2XGJA 4G5OA 1EWRA 1A5TA 2IYRA 2JDID 4B33A 3PR1A 2ZI3A 4XJXA 2F9LA 4HLUA 4IRUB 3EX7C 3A4LA 3TH5A 2ZR7A 1ZC3A 1ZM2A 2G3YA 2ZJAA 3B7GA 2HJVA 2GZDA 2YZ2A 4C7OB 2DFTA 2QL6A 4B32A 4PPQA 4H1UA 2V1UA 2C9CA 5IDVA 3MCAA 3DOFA 4QL3A 1E0JA 3IIMA 4Q9HA 3QBTA 1S3SA 4JYCA 3DKPA 5L3QA 2EVWX 2IA5A 3SU8A 1HUQA 2LKDA 3NIBA 1E99A 1M1YE 4B73A 4QXAA 2VHCA 2QGZA 1NN0A 3LQQA 4DDUA 2PJZA 1GG2A 2D06A 1DO0A 3ADDA 3RS4A 4US2R 4LJ7A 4WXRA 4OHZA 4C7OA 1M2OB 2DWQA 2IS1A 1ELOA 1XP8A 2G6BA 1AQYA 1UBGA 3K0EA 5DH9A 2ZI6A 4EDHA 3CX8A 4PC3A 3KQHA 1JJ7A 1GNQA 1BKDR 4HEJA 2FPMA 3LDAA 1ZM3A 4EQ6B 1IONA 3TVDA 3CF2A 4XVUA 1PLLA 3OF5A 3AGPA 1Q1BA 3RC3A 4OI0A 1ZM4A 2PMKA 2CHVA 5AUPB 2VBCA 1KDPA 1F3OA 1AM4D 5JECA 3GLIB 2YC4C 2OAQ1 1YZGA 2GK6A 3PITA 4JVLA 5CYPA 4CT4B 2OV2A 4KFUA 3RRMA 3WBKA 1M8PA 3DL0A 1W0KD 2GNOA 2IXEA 4DEYA 3CX7A 4B44A 3I5YA 1YE8A 3ZLJA 5CLLA 2ZYWX 1SXJB 1ETUA 1SULA 2WOJA 1E9FA 2A2ZA 4LCBA 2NZ8A 2OAP1 3SDZA 1HV8A 4HZUA 1Q1EA 3TW8B 2ZE7A 1EFRD 3EA5A 3MWYW 1OPXA 1Z0DA 1YRAA 4Q1FA 4G5QA 2OCYC 5EZ5A 3TAUA 3GLIA 2TMKA 1KJZA 1ZCBA 1FX0B 4ZCMA 4TMTA 4DKXA 4DRZA 4DBLC 3WMGA 5KSPA 2WOOA 1TEXA 4LHXA 2EFEB 4XTRA 3SI7A 2CJWA 1Z0JA 5J4YA 1SXJA 1GRRA 4W9MC 2YVUA 4C0JA 5EXXA 1CS4C 1BO6A 2OCAA 5CK5A 3CPHA 2J7PD 1Y63A 3DMDA 5FI1B 3SJZA 1P7CA 1W5SA 1OF1A 4FCWA 2V7QA 1T8TA 4M21A 3VHXA 1OH5A 3EC2A 4IFEA 1P3JA 5JRJA 2UZ3A 4UXJA 2CEAA 2ZRDA 3IUYA 3RLFA 4D0NA 2W6JD 5FBVB 3D31A 4CYMA 4A2QA 5E95A 2P0EA 4LBWA 1P9NA 3JVUA 4MGZR 2WWHA 3DDCA 1F60A 1I4LD 4NYIR 1W7AA 3BD9A 4ABYA 4I81A 3IEVA 3DOEA 1ZNZA 4ZKEA 1AS2A 1PLJA 1U99A 3VMFA 1LFDB 3I8XA 4LC1A 2QROA 4NYJQ 4HDOB 1S0UA 3PVSA 4PHGA 1RVDA 2R6DA 5KU1A 2GJKA 2P3SA 1G8PA 1Z0FA 1W36D 1KAOA 5HZHA 2ERXA 1NVVR 1MRNA 4IOLA 5L3SB 2IYTA 4ZDIA 1E4VA 4A2WA 1UFQA 2A5FA 2PEZA 4PPNA 1LV7A 5D3MB 2GILA 2P6UA 3U7EB 1U8ZA 2WIAA 3CNLA 4HAVA 4EPWA 2XB4A 3NVAA 1JR3D 1ZC4A 2JEOA 2R9VA 2UZIR 2HDNB 4GBMA 3RDPA 2CCJA 4BLQA 2AFIE 5IHPA 3B1WA 3K09C 5FTMA 2KJQA 2MSDB 2VTKA 5J40A 2IS2A 4Q4JB 3QKSA 1GTVA 2GCPA 1YR8A 2WSSD 2XOKD 4FMCB 1GAJA 1P72A 4ILEA 4M8NE 1L4YA 2VA8A 4C0HA 3I61A 3QXCA 4RD0A 4RVCA 5JHGB 3Q5DA 4AYXA 3THWB 3ZZ0A 2ZI7A 3K9LA 2NGRA 1Z8FA 4ZIRB 3A37A 4Y0VA 4II7A 4JKYA 4TTRA 5FOSA 3SYKA 4EUNA 2ATVA 2GAOA 2QRNA 3EW9A 3REGA 1KI1A 4BASA 1UKZA 4RD4A 1WBDA 2GJAA 1G16A 4KFSA 4Q4JA 4LHWA 4FWTA 2FFQA 5ANRB 2QMOA 4CGZA 4A0FA 1AKEA 2YWFA 3BFKA 3L0PA 4PSAA 4Q5IA 2YOHA 1FP7A 1ZD9A 1Q20A 4FW9A 2J0UA 4Q1BA 1E3MA 3GLGB 2FX3A 3SJCA 2C04A 4KYUA 2ONJA 3THWA 4PO8A 2G1JA 4D25A 4OHVA 3FPAA 3HPRA 2HUPA 4OK6A 4MUAA 3T61A 1Z63A 3X2SA 4ZIRA 2NPFA 4C2TA 1DAEA 2AK3A 1KK0A 5JS8A 1VCIA 5JFGA 1YVDA 2I4IA 4EJSA 3NDPA 4B48A 2GKSA 5DGXA 2AX4A 4LBZA 3M0EA 3W3AA 1TQ6A 4KLNA 1Z6TA 4P31A 2F9MA 4V0MA 1K5DA 5DN6D 2IYLD 3FYHA 4RKEA 2DPXA 4TWZA 1E9RA 1OFIA 2Z6VA 5TDHA 1S8FA 5IRCD 5A5GA 3EZ9A 2PCJA 1NIJA 1VYTA 2JCSA 3VR1A 2ZIAA 1RYFA 4L8GA 5E7IA 4Q9IA 2V6JA 3EPJA 5FUYA 1XTQA 2BHRA 1WXQA 2BMJA 1L8QA 2C98A 2VO1A 2IXFA 1E2JA 3L0IB 4JLMA 5K8UA 1FUUA 2JJ2D 3TIFA 4C3ZA 1SVLA 1FNMA 2QE7A 2ZU6A 5CYOA 5J4KA 3CM0A 1KDOA 1CEEA 5DO9A 1NLYA 2C78A 3AB3A 3HJNA 4CEJB 3DHWC 2OBLA 3T5DA 2NOAA 5D3QA 1QRAA 2DWPA 3RRZA 3UG7A 5HKKD 1CRQA 5FR1A 1VKJA 4PZYA 2O8CB 4KXFB 2J87A 2VSXA 4PQFA 4DXAA 2R2AA 1W2HA 1X1SA 3GD7A 2FNAA 2X77A 4QJ3A 4JLOA 1P2SA 2DFKB 2RH5A 5KTYA 5FTKA 2VH5R 2Q3FA 1XFAA 3PENA 3PIRA 4HLCA 4B3XA 1Q22A 2HV8A 1JBKA 1NKSA 2ZRMA 5C4GB 2L0XA 3ND8A 4XWOA 1KGDA 2XTMA 4FN5A 1R0YA 1GOTA 3D7MA 4W7SA 3FGNA 1T0HB 4PPGA 3WYFA 4DUGD 3OHMA 4A15A 3W90A 2OG2A 4GZMA 2O0HA 3CF6R 2O8CA 4G5GA 3QQ5A 4DSOA 4A0RA 3LH5A 1UBFA 4URYR 3HU2A 3OE7D 1QHSA 1CJKC 3W5IA 4BLOA 5DISB 1BYIA 4BLTA 3ZD6A 4PSKA 2AWOA 3LA6A 3SFZA 4R71A 1TMKA 4K8OA 2GK7A 3NBZC 1YZQA 3ICQB 5DHAA 2YV5A 2XTZA 3RHFA 1MABA 1ZW6A 1D2MA 5FL7D 3VR5A 3AVWA 1W46A 1OXXK 1XF9A 5J4LA 3KB1A 3ZQJA 5AJWA 2IHBA 4LYJA 2N46A 4XWKA 3Q7QA 4D2IA 1P9RA 1W48A 1W44A 3WY9A 2JA1A 2FJUA 1W36C 1T3LA 3EARA 1W5TA 1EGAA 2AD1A 3AKCA 2V8OA 3X1ZA 1OFTA 2EWWA 2IS6A 2J41A 2XZLA 3SFVA 4PQYA 4YDSA 1N0UA 3ZD7A 2YYZA 2WVJA 2H16A 1U81A 2BBWA 2OBMA 4B3FX 5J47A 2VSOA 3TMKA 1FZQA 2SHKA 4Q18A 2RGEA 2WJIA 5C2JB 3K9GA 3VQTA 1FP6A 3KUDA 1H8HD 3CNNA 2O8EA 2NPIA 3LW8A 4AKIA 2ZRBA 1E1RD 4NP6A 1R4AA 3ASYA 1XMJA 3I92A 1E96A 3TJZA 2D62A 4C0LA 3PUXA 3F0TA 1N6OA 1DAIA 2JIZA 4HB3A 2VL7A 2W2TA 2GF9A 3MJHA 5P21A 1OHHA 2CL6X 1KO8A 4ON9A 1MO4A 1CTQA 2ODEA 2OXRA 1F6BA 1ONBA 4JLNA 1QHHA 5JJKA 2QP3A 4BFTA 1U9IC 1ZNWA 4PC6A 4YONB 4CIDA 2C8VA 2NMVA 4B3BA 2F6RA 4Z8XA 2V1XA 2GCOA 3DM5A 1W0JD 1HT2E 3BH0A 3PQCA 4JBWA 1XBTA 2G1KA 1Z22A 4YC7A 1N5KA 3M1IA 4YMSA 3U3JA 5K8TA 1FW6A 3AVVA 4IVPA 1Z06A 1FQKA 3F3YA 2BCJQ 3QPWA 2DFNA 3AKEA 2A30A 1N0WA 5FUVA 1OIVA 2BDTA 5J5CA 3RS2A 4NH0A 4MKIA 4V0LA 2WMOB 2I3BA 1T6NA 1PJRA 2BWJA 2QN6A 4V02A 1OJLA 5E7MA 1DEKA 3K0SA 5JHHB 5DNYB 1XD8A 2CHQA 2Z5FA 4QBGB 3I72A 4TMZA 3UK6A 1P75A 1ZD8A 2CLCX 2WJYA 3I32A 4TT3A 2GZAA 1NBMA 4P4TA 4L9SA 3SE0A 2E87A 2OT3B 1SKQA 3EZFA 3L43A 5CB6A 2ZJBA 1TX4B 3CPEA 3DVLA 5E3HA 2X19A 5CLQA 2IYXA 4Z54A 4JSTA 4FCVA 1QG4A 1GNPA 1IHUA 2WJVA 3P27A 1II8B 1XMIA 3QEOA 1XJ0A 5KSYA 4JLAA 1KJWA 3AP3A 4JT2A 5TMPA 3VR3A 1VCMA 1Z0KA 3BXZA 3WRXC 3AF4A 4DSTA 2H17A 3MMPA 4JYBA 3EIEA 2FOLA 2G9NA 4KLZA 1SHZA 2WPDA 1VPLA 3BORA 2J9RA 4PANA 1Q1ZA 2NO7A 2OFWA 3MGCA 821PA 3V4RA 3HP1A 4DLVA 1AIPA 3SYNA 5KDOA 5FL3A 3LX5A 4RD3A 1GUAA 1ZP6A 2QAJA 3QSYA 4LWZA 3K0AA 1E79D 1Z0IA 2QPAA 3OFND 1II8A 4LHYA 4LJ4A 3TBKA 1VG0B 5FUWA 5F9FA 5JJLA 1GVNB 1JI0A 2BIFA 3EPLA 1BOFA 2QP9X 3B1YA 4PPFA 4Q1DA 4M9ZA 5JLJA 4HUQB 1Z07A 3CRW1 3K9NA 4PAOA 4D0LB 4XD7D 3GQBA 4IVQA 1IQPA 1ZBDA 2FH5B 4P4UA 1BH2A 5FBRB 3WBJA 1II9A 2YOGA 3UMFA 1CU1A 4FMCF 3L2OB 1II0A 3TUIC 4RJLA 4URUR 1E2DA 3RS3A 4F4CA 1AK2A 4ZDJA 1KNXA 2IYQA 3I1FA 1WE2A 1OIWA 3LLMA 3E70C 1ZM7A 4D26A 1LF5A 2ANBA 1KDRA 3A6PC 3AVYA 1RPZA 4NONA 5AUNB 2ZYTX 4KAXA 3FB4A 4S2EA 1CR2A 2R6AA 3U3RA 4WAUA 4KVGA 4HLDA 4OI1A 3ZDQA 3O8BA 2A78A 2VEDA 4I99A 2IF2A 2J3EA 2CCKA 4C0KA 3VNVA 2FWRA 3IQWA 4TYQA 4BECA 2P5TB 4QM7A 3DMNA 4EFMA 4HAYA 4JT4A 1GL6A 4KFRA 3WNDA 3TNFA 5BN5A 1V43A 1A2BA 4JMPA 3Q85A 4YXWA 4OBEA 1P62B 3CRVA 5FOVA 3BFXA 4OQXA 2JJ1D 1G17A 2EU8A 2FSFA 2YWGA 2DB3A 4K46A 1EFTA 2Q0HA 5GJVC 1KI9A 3R9XA 1ZM9A 4NYMQ 1H8ED 3CZPA 2EQBA 1T3SA 4GSYA 5LD2C 2YWEA 4HDCA 4RKFA 3TSZA 1Y3AA 1EK0A 4RZ2A 4BEBA 1KZ7B 2VP2A 4ACBA 4LHVA 1FQJA 3T35A 1XJCA 3U3MA 2Z4RA 4B35A 3R7WA 5F2EA 1TQ2A 3BB4A 2H18A 3AVOA 3F8TA 4P32A 3QE0A 2W6ID 4LZZA 1ZIOA 4JSYA 4FINA 5LPNA 3X1WA 5SZKB 5DYIA 1NVXQ 3W3ZB 3A4NA 4GOJA 2O0KA 4BE7B 1HY3A 4DJTA 2PT5A 2PLRA 4WBSA 2X8AA 2XSZD 4IDOA 1ZYUA 4LYFA 1SVSA 3OZXA 3DZ8A 2YINC 2WIBA 3AP2A 1W4AA 1VYUA 4FMBB 2QY9A 3AEZA 5FBWB 3ZGXA 4NTZA 4CEIB 3QJYA 1S9DA 4E5UA 4UXHA 1E9CA 2GRJA 3IGFA 1D6JA 1G6OA 3MWLA 3PFIA 2V54A 2F55A 4PSVA 3T5GA 4DDTA 4ITRC 1QHYA 1GIAA 1HEIA 4XSHA 4YDHB 2ZUCA 3P4XA 2R8RA 1U98A 4GRAA 2ZJYA 2OCBA 3MRSA 3OEHA 1FOEB 2ANCA 3NXSA 4IOJA 3UATA 5KO2A 1J99A 2C5LA 4ARZB 2WWIA 2J0VA 1B23P 5KUTA 2FDCA 1C9KA 4IW3B 4UXIA 2ERYA 4DLUA 3LBIA 4DB4A 4C0SA 4KITB 4A2PA 1HTWA 2VHUA 4CEIA 1E2PA 3F5FA 4DLTA 4M9QA 4WA7A 3A1WA 4NHOA 4EFNA 3K70D 1P61B 4EPVA 3GLFE 1Q3TA 3U7GA 3NHAA 3GLHE 3UPUA 1EFUA 1C4OA 4LSGA 4CEHB 1SQ5A 3K1JA 4C2UA 1X8JA 1XXHE 1EFHA 5L3QB 2NQ2C 4ZDKA 1W4CA 3ND9A 1OXTA 5DI3A 1NMZA 4I1SA 2IXGA 3ADBA 4JJKA 3KQLA 3NH9A 4ARZA 3OESA 1JPJA 1DOAA 1RRFA 2XNDD 3RRYA 2PZFA 4N0EA 1R5OA 2CLSA 1TPZA 4YMWA 5B2ZA 2IC5A 3O8CA 5EJEA 1SXJC 2IK8A 1NG9A 2I1VB 3B78A 4D0GA 4BUJA 3AP1A 4MDEA 4V0OA 5G3ZA 5EP3A 4GFDA 3D8BA 4TLEA 2V9PA 3SQWA 4CEHA 4E03A 1KKLA 4HSEA 3VR4A 2CLDX 3CRMA 1QHNA 1D8TA 4TZ6A 4NBSA 2ZE5A 1W49A 2G88A 3UANA 2GWHA 2MSEB 3CR7A 1P5ZB 2CNWD 6Q21A 4GI7A 3WYGA 1JR3E 1N6HA 3MG9A 1NL3A 2JGNA 1XPOA 1QG2A 1OIXA 2XX3A 2DWOA 2WWGA 1TADA 3U4QB 1XDBA 2OLKA 4PR0A 5KSOA 3BGWA 3QIAA 3A36A 5C18A 2GBLA 5BQ5A 3BAFA 1Q12A 3HR7A 1U0HC 2QMUA 3RRNA 2AWNA 4E07A 1OSNA 1VG9B 3OAAA 4OHWA 2GXAA 4QGAA 2PX3A 4BPBA 3RABA 1I2DA 1RJ9A 2MMGA 2QUZA 2AXPA 3IPXA 2F1RA 4HDQB 5AJVB 4HB2A 3TQCA 2JLYA 1E2GA 4DHEA 4KHZA 2ZYVX 4HZUB 2QAGB 4OHXA 2WHXA 1NY6A 3RWMB 3RSLA 2EW1A 3FMIA 4JS0A 4IDPA 1GILA 1EWQA 4KSCA 1DELA 1PLKA 3EWSA 4ESHA 3U4QA 3U60B 3CPJB 4V0KA 4EIWA 5IT5A 1CJTC 2ZYUX 3GJXC 4DLZA 2O8FA 1XU4A 1N2CE 4P33A 2AKAB 2CJWB 4F93B 1Z5ZA 2RGNC 3CRRA 4KSBA 4D4KA 2QAGA 1A2KC 3QKUA 1KI6B 1RRGA 2ZROA 3HU1A 1N3BA 3KKMA 3QXJA 1GP2A 4MKGA 2IUSA 4B6FA 3LLUA 1XTJA 4V03A 1W2GA 1OB5A 3WMEA 4Q4HA 1N6RA 1SVMA 5B30A 3SN6A 3RSOA 4XOIA 3X1DA 4M1OA 1DVRA 4Q7MB 2H5EA 4ACAA 4P0TA 5IK2A 3C8UA 4LC0A 1R5NA 3QF4A 1D5CA 3WMFA 2GCNA 2X2EA 4TYPA 4TLDA 2O8BA 4IXNA 4QGFA 4XVRA 1R0XA 4DC9A 3VU9A 1CJVC 2QG6A 2OO7A 2ZQ5A 4J0QA 4JBYA 3T1VA 1CJUC 4UJ5A 2N42A 4B2IA 1ZUHA 4BLSA 4TQUS 1KI6A 2FN4A 3MJRA 3MSXA 4LUCA 4TSFD 4AWXA 5JBQA 1HURA 3HU3A 2OHFA 3WYAA 5C1BA 1E2MA 4JLVA 4AKHA 5BYKA 2VRWA 4F38A 4R2IA 3QKRB 2R6FA 2OE2A 2FG5A 2WV9A 1XWIA 2JLVA 4ZKDA 3CH4B 1E1QA 5BWMA 1F5NA 3GJ7A 3IIKA 4MA4A 2H1LA 5KNCA 1L4UA 1COWD 3KQKA 5JCPA 1CR1A 3KX2A 1MO3A 1SHKA 4PQRA 4DZZA 5SZJA 1JB1A 3LWNA 1IY2A 4HYYA 3UMRA 3C4JA 4Q00A 1W1WA 1VHLA 3LNCA 4QC2A 2IUTA 3C41J 3BJIC 2ZR9A 2ODBA 3B5JA 4OI4A 2QQ0A 2WICA 5AJXA 3WNCA 2GZHA 1GL7A 4DVGA 4HLQB 4DEXA 4O3MA 5C4MA 3NEYA 2CE7A 2HXSA 2DBYA 2W83A 1UJ2A 2XB2A 1VCOA 3QKRA 4YMVA 1EESA 1WBBA 1T5IA 2IL1A 3QKSB 4YMTA 2YWHA 3AVUA 2O0JA 1ESMA 4GP6A 2BEJA 1PUIA 4NCIA 2D4HA 4CZ2A 1YZUA 3WP0A 3D3QA 3QVUA 3AH8A 5CK4A 3BBPA 4IDHA 5KDLA 1SVWA 2NO0A 5FBQB 2WSMA 3LVRE 4ASUD 2VYFA 4Q21A 3MD0A 2V3CC 4B3CA 1XCMA 3K70C 1ZU5A 3LV8A 3ADCA 4QHYA 2ZPTX 3BOSA 3TRFA 4HZIA 5CM8B 4ZV4A 1VCNA 3LX8A 2GEVA 2OM2A 5BW8A 4HAUA 1G41A 1KTVA 5AK0A 3VAAA 1WRBA 4GOXA 4URVR 2J0UB 5EE9A 3TUZC 4CRWB 5CDFA 2HCJB 3GJ3A 2W0SA 3TVTA 1ZMXA 1QVRA 1E9BA 2QA5A 4D80A 5TVKA 4OK5A 3O8RA 1NRJB 3QENA 4LY6A 3FHTA 4EJSB 3JZMA 2BBOA 2PH1A 1OKKD 1BMFA 4GT1A 3V00A 4UNQA 3B9QA 3KJGA 3CF0A 1WCV1 2RCNA 3I73A 1YU9A 4MGYR 1KO1A 4AK9A 2ODWA 4B47A 2FEMA 2HLDD 3U3KA 5TB5A 3OEEA 4Q48A 1CLUA 1DAHA 1GL9B 1MH1A 1OXUA 2NG1A 4GZLA 4JZKA 1EXMA 4QNRA 5HE9A 4KO8A 1K5GA 2HCBA 4AKEA 2W2XA 3W34A 4LBYA 2BOVA 1NVWQ 1FUKA 4FI3C 4US0R 2BM1A 3MUFA 4H1VA 1R6BX 1LW7A 2UKDA 3K9HA 2BEKA 4NE2A 4NYIQ 2QORA 4IJMA 3VHLB 3NDBB 121PA 2WAYA 3AF0A 1S1CA 2RGGA 3Q7PA 1IY0A 4M53A 5FPHA 2AKYA 3BH7A 3LY5A 3QXSA 3IILA 4Q19A 3LBNA 2CK3A 2IT1A 1KSFX 4URZR 1MOZA 1R5BA 5GADl 2PZEA 1R10A 1NVVQ 4QGHA 5EXTA 2B6HA 2ZRAA 3MWKA 1U90A 4WVFA 4EPRA 2VP4A 4U5XA 2IHYA 5KDDA 1R0ZA 4QBHA 3K0CC 4JIMA 2ZRLA 2ZJ5A 1DPFA 3B6EA 1E69A 3EZ7A 4Q02A 3HPQA 1G21E 4LJ9A 3U7FB 1GKIA 1DAKA 1M74A 1X3SA 3IHWA 3PCRB 5BN4A 3N70A 1X1RA 1NMXA 4DLYA 1GZSA 4OL0A 1CR0A 2Q3MA 5HE8A 4Q9KA 3C14C 4LYAA 4DIEA 2WKQA 3ZVMA 1P6XA 1QZXA 2ZI9A 1GNRA 3P4YA 4KCGA 5EUQB 3GLIE 4JVMA 1KKMA 1TQ4A 1J90A 4Y0AA 1ZCAA 3BK7A 4Z1MA 2OUKA 1S96A 2IEZA 2YKGA 3BB3A 1BS1A 1RFLA 3R8FA 1Z2CA 2BVNA 4XSGA 3NH6A 1P2UA 5GJCA 2WZQA 1SXJE 2ZSEA 3K09A 4NPHA 5G41A 5EP4A 1OB2A 1G7TA 4A4DA 2HF8A 4MKFA 1MABB 2FSGA 4JLBA 3THYA 4OHYA 2JDIA 3ECCA 3P32A 1G8YA 4EPYA 2B8TA 3UIEA 2O8DA 2W00A 3ZQ6A 5BXQC 1ZRHA 2NZJA 2VPPA 1XEXA 5AR1A 1NLZA 4MYCA 2NIPA 4FXPA 4KBFA 2QTVB 1RC8A 4C30A 2A7QA 3W6OA 4B6EA 5JI2E 4O0MA 4A0GA 3ZVRA 5G40A 1OH7A 4B2LA 4G0NA 2BMDA 2X1VA 3PEYA 3ZJYA 1TAGA 4IDQA 3EC1A 5FR2A 1ODFA 4MYTA 2GAAA 3TQFA 1B0UA 4IEEA 4MQBA 1TF7A 2GVZC 1XTKA 2ODNA 4G01B 4TLCA 1R2QA 1NJGA 2RGDA 5FTLA 3REFA 4CT5A 2ZR0A 4DWJA 3AKYA 4CDGA 2CL0X 4D4MA 5DHFA 2O8EB 4HAWA 2GETA 3GJ6A 3UG6A 3A1UA 2QP4A 4FIDA 1G5TA 1S1MA 4KYIB 3SS8A 1P60A 2KI5A 1IN6A 1FTSA 1JXMA 3KQUA 2G0TA 2GF0A 5G53C 3ZZUA 5LB2A 1E0KA 1UAAA 1KO5A 2Q9AA 4JLKA 2XNSA 3B9PA 2XEXA 3PEUA 1QHHB 4LDJA 3VFDA 2QT1A 2QMHA 1A1VA 1T5LA 4G5SA 3N2IA 1LF0A 4LX0A 1I2MA 3EIQA 4BFWA 1VYVA 4JVNA 4NKRA 1P2TA 3CWQA 2GCOB 2C95A 2ZAMA 1G6HA 1QBKC 1RYHA 1XD2B 3U2QA 2FGJA 1VMAA 2ZRCA 3LFUA 1W0KA 2JAQA 4UNNA 4I1OA 1HQYE 4IXMA 1DG3A 4Z51A 2BBSA 3CW2A 5J4VA 4MRNA 2DYKA 2RHMA 3NKVA 4XTCS 1EFRA 1IN5A 2GJ9A 5KNDA 2IYYA 4D4LA 1CRPA 3PUZA 2ZS8A 4L16A 4ZCLA 1GSIA 1GRNA 3FDIA 4IVRA 1Z08A 5JCZA 1QVAA 1CP2A 2FZ4A 1IOZA 4X8LA 1XD2A 1IXZA 1J8YF 3H0KA 1E98A 1DG1G 4QOSA 4Q4AA 5FPKA 3NWJA 4DCUA 1U8YA 1EX6A 1NVUQ 2FSIA 5FUXA 5H68A 3VX3A 4URWR 1IN7A 1N6IA 2GESA 1G8GA 2FSHA 1L2TA 3W8NA 1XPRA 2OLJA 1SKYB 2J7PA 1YZKA 2WJJA 4PXAA 4OQLA 3WHLA 1D2NA 3I4LA 4MKHA 4NCHA 3FKSA 4AG5A 5CJ2A 4G5RA 5ELXA 5F9HA 3M6AA 1XEWY 1YQTA 2NTYC 5EQTA 3U3OA 3TE6A 2JLRA 3ONWA 3U61B 2W6JA 4V0ME 4BFVA 4Q9LA 4LV5B 3H84A 1N5JA 4U7DA 2XXAA 3GLHA 1SXJD 4PHFA 3GLGE 3VR6A 3K0AB 2BJWA 3ZS8A 3CO5A 1E6CA 3IHLA 3Q8XB 3CZQA 1Z2AA 3A4MA 4MRVA 1HQCA 2FV8A 5M04A 2V7QD 2ZS9A 3UWKA 3E1SA 4OK3A 3ETLA 4R98A 1XTRA 1US8B 4L5BA 3FMOB 2MMCA 3LVQE 1ZINA 4N0DA 2AK2A 4QHSA 3SBDA 4TMXA 2PMDA 2FZLA 3A1SA 4FMDB 2EFHB 3SEAA 4BFYA 2ZRFA 2LKCA 2WWWA 3KKQA 4PAMA 3H1TA 2ZRHA 5FTJA 2J0QA 1V5WA 2VF7A 2ZRNA 3B8HA 3LO5A 4IHQA 3TR5A 1X86B 1TUIA 1XEWX 2OBNA 1G19A 2VP9A 4MGIR 2CE2X 4D82A 5BN3A 5KNBA 2GXSA 1NY5A 5TXGA 2VP5A 1QHGA 4Q47A 4MYUA 1JR3A 1NMYA 2C99A 1E0AA 1US8A 1CULC 3I3SR 2CXXA 1UKYA 2OESA 4QBIA 2JASA 3OIUA 1YJ5A 4A0HA 1R8SA 1JPNA 4HB0A 2WSSA 2KSQA 2ZSFA 4RZUA 4DCNA 2AXNA 2XOKA 2W0MA 3EZ2A 4HB4A 621PA 2B92A 5DIFA 4IKEA 5JSZA 2JLUA 4G3XA 1WQ1R 2W58A 2ZEJA 3RC8A 2C2HA 2AL7A 5E7JA 4TYNA 4O25A 4AYWA 4PO1A 3UKDA 2CMKA 3BC1A 4AIIA 4RSGA 3TUJC 4M4SA 5KSZA 1FL9A 2EFDB 1F2UB 3DEFA 1U9IA 4I1UA 1XTSA 4DLXA 721PA 4RD2A 4PC7A 5J4HA 2H8KA 2JLXA 3E2IA 4E22A 3R7WB 5BYJA 2J7KA 4LJ5A 1TF5A 4QHTA 1AJEA 4UNSA 2VIIA 1ESNA 1KSGA 3U6KA 1R0WA 4ZI3A 2KWIA 4G1UC 5JRZA 4NL4H 1F48A 1G9XA 5KYKA 2GEUA 3HR8A 2J5XA 1KK2A 2AN9A 4HLUC 3J81k 2VP6A 3SNHA 1KJYA 2FFBA 5FPTA 4BFSA 4DCSA 3KDSE 2QRZA 5CITA 1KSJA 2Q3HA 1F2UA 3RS5A 3FHCB 4EFLA 5K8IA 3WHKA 2I1QA 2ZI5A 3IBGA 3UMSA 1N25A 3A1TA 2ONKA 3ICEA 1KMHB 4DB2A 1HE1C 2FF7A 2P67A 3N5CA 2V4ZA 3IQXA 3QKTA 3QXXA 1CKEA 4LPKA 3B2EA 3TW4A 4NDZA 2ZRIA 1ZIPA 1MKYA 1ZAKA 1GWNA 2AHOA 1XMSA 2Z4SA 1EFCA 2C77A 1CBUA 4TMKA 5DN6A 3NEJA 2IW3A 1UF9A 4ZDWA 1JQJC 1G1MA 4GOKA 2ZVPX 4MRRA 2QPTA 4B71A 4UNPA 1PUJA 1XPUA 1XCPA 2F43B 2ZM5A 4WZ6A 4L15A 5L3RA 4TLAA 2BKEA 4XVQA 4TN1A 4Q9JA 1KMHA 2JJ2A 3FMPB 4BQSA 1KAGA 3GJ4A 2Z83A 1UPTA 1D9ZA 3CLVA 4FWIB 5FPYA 4RZ3A 2DFLA 5GJBA 4QG7A 2IBMA 3KTAB 4PZLA 5JZVA 2IWRA 4F4IA 4ESVA 4RFVA 5HKKA 4F4JA 1A7JA 4DT1A 1VG8A 4TL8A 2WBLC 1KY2A 4CVNA 2ECKA 5DI3B 2REBA 2F43A 4RZXA 1T4GA 4K81B 1L7VC 1RE0A 1NP6A 1I4TD 1G3IA 4LYHA 1KI8A 4A36A 2JLWA 1F2TA 2F1JA 3QI2A 2ZSDA 4QKQA 3ZZTA 5F3WB 4TTPA 5JJIA 1LY1A 2QE7D 4IDNA 1SVIA 3B1ZA 3ZYCA 1QDEA 2YHSA 3AVXA 3KTAA 1E2FA 1E9DA 4MITA 5AWFC 1MRSA 4DUGA 1M34E 1Z0AA 2QAGC 2ZTSA 4QNMA 2CL7X 3TR0A 4AG6A 2PX0A 1EG7A 4IOMA 1Z29A 5JWOA 3U44A 4XIGS 4ZCIA 3QPUA 1DS6A 2PJRA 1G7CA 5EUMA 3OE7A 3GJ8A 1RRCA 5EXSA 3R9IA 4JLPA 1EX7A 3ZVNA 1NLFA 4Q01A 4Z1MD 1NN5A 2D7DA 1ZD1A 3FOZA 2VSFA 5H70A 1XD9A 2J45A 3W8RA 2CCGA 4JLDA 2X2FA 2A5GA 1G5RA 1ZJ6A 3BB1A 1UDWA 3L0OA 3BE4A 1QHIA 3AUYA 4XWAA 2HT6A 5FL7A 1RJ9B 1RKBA 1SKYE 2AD5A 2ORIA 3HWSA 2B7CA 1CR4A 2QNRA 3N2EA 3QNUA 2ASEA 4A82A 5JEDA 1HYQA 2WWFA 4PTLA 4AY2A 4LJAA 1YRBA 1P2VA 3IPYA 2F1HA 3NBXX 2ZITA 4A8JB 2JATA 4BFUA 1IJFA 3PG5A 4OI2A 1UM8A 4QJ5A 1CJMA 1G3QA 3V4FA 2O8FB 2OFXA 1AZSC 4MGKR 3VTKA 3VKHA 3RS7A 1PV4A 1MR3F 2UVQA 3KKOA 1OH6A 3B13B 3L8ZA 3Q72A 3CIOA 2P65A 1TUEA 2FA9A 1TL7C 2J0SA 2QSZA 1G3MA 2O5VA 3PUVA 3QG1A 1TQDA 4PO9A 2BCGY 4BRWA 4OJKA 3AGQA 1GKUB 1VHTA 2WKPA 4LJYA 4PX9A 1HE8B 1FTNA 4O2RA 1H8HA 1G4UR 1JECA 5FTNA 4B34A 2PBRA 3DM9B 4KJZA 4A8JA 2KBEA 2CVHA 1E1RA 4Q4HB 3ZS9A 3KFVA 2BC9A 3T1TA 1N6LA 4KI0A 2JLZA 3KXKA 1GRQA 1VDZA 1WDTA 1IY1A 2P5SA 3SBEA 2WWYA 3AKDA 3QF4B 2ZE6A 1KIMA 3RS0A 4B74A 4ERNA 1JXOA 2O8BB 4NYJR 1N5LA 3VU9B 3LW7A 521PA 4MRPA 1AKYA 1T0JB 4EPXA 1IXRC 4M9SA 3G5UA 3KZ1E 4HATA 3X1YA 1NIPA 3SYLA 4GL2A 1TNDA 5K8LA 1E4YA 5EZ6B 1VECA 1OW3B 1W0JA 1NF3A 1NNEA 1E2IA 2ZJ8A 1KY3A 1Z28A 3FMFA 3C7KA 4LV8B 4TMVA 3EPHA 4IFBA 4RY2A 3HDTA 2IF0A 4Q1AA 4TL6A 2JIZD 1J2JA 3IKJA 5IF9A 1E94E 1P9WA 4EQ6A 1TF2A 1OHHD 1YKSA 3H2YA 3TAHA 4DDVA 1H65A 3GEIA 1OXVA 1T3HA 4Q4LA 2HYDA 3NG1A 4N3NA 4B75A 1ZNYA 3LQRA 2H92A 2VLIA 3OIWA 2PLFA 3LD9A 5AUOB 1IN4A 3MWJA 1RW4A 3AVPA 3O8DA 2ZXUA 3LXRA 2GEDA 5GJWC 3SC3A 1XRJA 4A1FA 3AUXA 3KQNA 4KBGA 1OXSC 2QZ4A 2A3RA 1D9XA 3IEUA 4M22A 3FVQA 2ZS7A 2RGCA 1LNZA 4P4SB 5DSZA 5B57C 8OHMA 5CIWA 1E0SA 5E4FA 1IXSB 1Q44A 5HR5A 1NN3A 1K8RA 4Q1EA 4RD6A 3LRPA 4B76A 2NO9A 2ZSBA 3BS4A 3DO6A 3CONA 1VG1A 4OQFA 2HT1A 2FGKA 1XX6A 4M9XA 4OKSA 4L4UA 4ZO4A 5CJPA 3ZIAA 4EJSC 2GDJA 2H7VA 3PJRA 4I1VA 2JLQA 3FKSD 4TT3D 2J46A 1YR9A 1FX0A 1NBMD 4FMDF 1X8LA 4HI0E 1VTKA 2BJVA 1NI3A 2V55B 3QEJA 5H1YA 4P4SA 1G4AE 1G18A 2PT7A 3AVQA 4YMUA 1DBSA 4AKGA 3OFNA 1D2EA 1E79A 2Q6TA 4QRHA 3KKNA 1E2LA 4WOPA 3NHBA 1HT1E 1ZU4A 4XD7A 3FFAA 2ZSAA 3OIVA 4A6PA 1W4RA 4NZYA 3TGPA 4MUBA 4WW0A 1T91A 5FPSA 1OYWA 4LGMA 2WPDD 4JJZA 2G77B 4AD8A 3WRYC 2YOFA 2C9YA 2F7SA 2W2VA 4N1AA 3AVTA 3C15C 4KFTA 1KO4A 3CKLA 2ZRPA 1E2QA 1PVOA 2ZJ2A 3RAPR 3SHFA 2YJTD 3T06B 1I4DD 3O47A 5CIQA 3AQ4A 4TMWA 2RGNA 2VHJA 4BLPA 1JNYA 3BERA 3U6BA 3BH6A 1YZLA 1KMQA 4Q7JB 1FMLA 1WA5A 1Q57A 2QMEA 3NC1C 4M0LA 3GFPA 1UBEA 2D2EA 3B1VA 3THOA 1AA9A 4H9GA 1DE0A 1P73A 3E5HA 5AJYA 5HPYB 2EFGA 4WXPA 2IYSA 5L3SA 4BGDA 1E9AA 2JJ1A 2Y8EA 2YNMA 2VP0A 3FFBA 1LS1A 4E09A 2ZJZA 4BEJA 5A0FA 2OZEA 2MSCB 4TQAA 5D3MA 1CXZA 3VNUA 1UEJA 2D7CA 3I62A 2RKOA 1H8EA 3B60A 4I4LA 2QU8A 2DCUA 3MAAC 3T12A 3RVBA 1QF9A 4URXR 3EA0A 1FPMA 5JWHA 421PA 1GITA 2GJSA 3WXMA 1DO2A 4GPTA 1UKEA 3SOPA 2OSBA 2W6IA 1J7KA 2IYVA 4QBFA 5EXPA 1AS3A 4YXWD 1KDTA 3IIJA 2ATXA 1AZTA 5SZIA 4EAQA 4Q7LA 3GMTA 4M1TA 2B8WA 1YR6A 4B43A 5C46F 1Z6GA 1NJFA 2QT0A 2ORWA 1IM2A 2XSZA 2VHQA 3OIYA 4YQFA 5JMTA 3MFYA 2A5JA 1G7SA 4RCZA 4MDFA 3GJ5A 1G20E 2GA8A 4WZBE 4W5HA 2R62A 1OFUX 3RNLA 2XJ9A 3KKPA 3T34A 2AFHE 5JS7A 3EAQA 2QM8A 3WP1B 1E2EA 4LJ6A 3K70B 2EYQA 1DAGA 5L8VA 4MRSA 1G8FA 3ZH9B 3T1OA 3FWYA 3U7HB 3PEVA 3SJAA 3B82A 3NBYC 2HEIA 3GLGA 3THYB 2NO1A 2J59A 1AS0A 3TSOA 3CRQA 2A5DA 3NC0C 1Z83A 2YC2C 3BIFA 1HH4A 3VKGA 3NBFA 3R9WA 2O8DB 5LB4A 1LS6A 2FPLA 4GMDA 1XEXB 3L0SA 4CW7A 3TSWA 221PA 2VF8A 4D81A 4P3YA 1ZVQA 1XZQA 5DYGA 3P1JA 4FD2A 2G83A 1KSHA 1ZUIA 4C9BA 2GXQA 2BM0A 1W47A 2DY1A 2JJ8A 3KXLA 3LXXA 4MYHA 4AI6A 3K8YA 1U0JA 2A5YB 2HYIC 4TLBA 4Q1CA 4GMXA 1KK1A 4X8HA 3OEHD 4GP7A 1OFHA 5JI3E 3X1XA 4DLRA 5JWRA 1NG1A 1M7HA 2ZE8A 2XNDA 1M7BA 3BWDD 2V6IA 4M1KA 1Q3HA 2F3RA 5FFMA 1XCGB 3LAWA 2EWVA 2CVFA 2Q21A 1A4RA 3KXIA 3CX6A 2P6NA 2D74A 1JJVA 3QOFA 2ORVA 5GVSA 4PAQA 4CEJA 3QPVA 4POAA 2RMKA 1G3UA 2PEYA 3EXAA 4JL6A 2QTHA 3ADKA 2FFAA 3KL4A 5FI0B 5G3YA 2ZJOA 2K5UA 5FOTA 1NSFA 1E32A 1KI7A 2PL3A 4HAZA 4X8OA 2CNWA 3QY0A 4F7WA 3H4MA 3PUYA 4NMMA 2Z43A 1IJEA 1N5IA 3AF1A 1E2KA 4D4JA 1KYIA 1E2NA 1JEEA 2KBFA 2G0NA 2BKUA 1GM5A 4U02A 2JLSA 3QVVA 2IWHA 2GXUA 3KJEA 3AF2A 3FHOA 4C0QC 1FNNA 3CH5A 3G82C 4BLRA 4RCYA 3AV0B 2R44A 2WM9B 3DPUA 1MO5A 1TTTA 5DLQC 1E9SA 4B2PA 2IS4A 2ZRJA 2RGAA 4C0BA 2R6GA 4OQMA 5EE1A 4LHZA 3QG5A 4IOKA 4ZI2A 1N6KA 2O52A 1J8MF 3K0FB 3R20A 3A8TA 5TY0A 1N6NA 3GEEA 1DADA 5SZHB 4EPTA 2ZREA 2J1LA 1DAMA 3JZAA 1RZ3A 1JEDA 5EE0A 2P2LA 3VKWA 2Z0MA 1NKTA 2OEPA 3IO5A 3K0CA 4TZ0A 4Q4AB 3THXB 3OAAD 2N1BA 5EE3A 5LDDC 4PHTA 4Q03A 4Z8YA 4LBVA 4LOAA 5UKDA 3CNOA 4BFXA 5CDFE 3EASA 1P4SA 3DKVA 2OILA 1S2MA 1UEIA 1W4BA 1SVKA 1T8UA 3JVVA 4AYTA 4BZQA 1KO7A 3K0FA 1QHXA 4OYHA 3QUSA 1TU4A 3CUEF 4M1SA 4TQ9A 3UWOA 2A9KA 5FH9A 4F92B 1ZUNB 3KFXA 2REOA 3AF3A 3RANA 5KPJA 4M1MA 1OE0A 4LI0A 5FOUA 3W6PA 2ZU0C 5F98A 2OCPA 3THXA 4DCVA 1IN8A 4NCJA 1A82A 1M6NA 3PUWA 2WJGA 3GLFB 1G291 2XXAB 4DIDA 2WJHA 3EWAA 1IAQA 3GLHB 2ZANA 5FOXA 3P20A 1Q0UA 1NSTA 5A4JA 5EE5B 1XB2A 1XEFA 1GKYA 4WZAE 4C4PA 1XXHB 3RYTC 4MH0R 1RIFA 2QTFA 3LBHA 4M1YA 2Q9CA 4TSFA 5GVRA 3I5XA 5H8WA 1OYYA 2FU5C 1LTQA 3GEHA 1N6PA 2HF9A 1ANKA 1S9HA 3K53A 2ZETA 5FOWA 1T9HA 3D6TB 3PXGA 1CF4A 2ZAOA 1G8HA 1U8AA 3BRWD 1Q21A 4UKDA 4GDFA 1W36B 5IK2D 2QEQA 1X6VA 1AQUA 1Z6YA 3FE2A 3C5HA 3GLFA 1COWA 3V9PA 1Z6XA 5AJZA 4DDWA 1BIFA 3SJBA 1G7RA 2ZUBA 2P6RA 2BBTA 2BV3A 1XXHA 2FMXA 2IYWA 3Q5EA 1WB9A 3HYRA 3R8CA 3KUCA 3B1XA 4KV9A 5KOYA 2B21A 3EG5A 2GVDC 1GFIA 4FCTA 2DHRA 4KVAA 2XZOA 1OH8A 1PZNA 2RHDA 2CBZA 2FEOA 3RWOA 2QENA 2ZRKA 4R9UC 3CR8A 5EP1A 2REXB 1MT0A 2EFCB 2PCLA 4NYMR 1E1QD 2LCFA 4JVSB 5TARA 3DZDA 4D6PA 3S1AB 1FMJA 1S4QA 4PFSA 1U94A 4WIAA 4A6XA 1UDXA 2GHIA 3NTUA 4RD1A 5JSZB 4W5JA 2C96A 3U5ZB 2R6CA 2CDNA 3FKQA 3L82B 3TLXA 2IYZA 4JBXA 2QM7A 4TTQA 3ZIAD 4DLSA 1X8KA 1E9EA 1KHTA 5B58C 4YLGA 4ASUA 2QI9C 3A1VA 4B3GA 4PHHA 3CBQA 2IX3A 4PC2A 3G0HA 1JAHA 3GP8A 2BMFA 2WAXA 2LWIA 3WNBA 1UADA 4V0NA 5DI9A 3PEWA 3FTQA 3S1AA 3TK1A 4GNKA 1OT3A 3HYTA 1O3YA 4R7ZA 4TYWA 3UXMA 4A9AA 4ZPXA 1NN1A 4BRUA 1WF3A 4JLJA 1U2RA 5CM9C
chains in the Genus database with same CATH superfamily
4AZ0A 1FRFS 2PKXA 1NURA 4MQMA 5KIAA 2QQEA 1SN7A 3LHSA 5EFOA 5HJ5A 4CDMA 1SIOA 5BYAA 2A9VA 4YJFB 1L5YA 3CNQS 4FX2A 4K2AA 1RR6A 4RS4A 2HJGA 1DWOA 2Q9BA 2ZVQX 3BBLA 2Q62A 4W5WA 2WT9A 3D8RA 9LDBA 2E9SA 3BXFA 2QQFA 4C29A 2ZM6B 1Q15A 2OZPA 2PKQP 4AC9A 1LJUA 2J5BA 4RVGA 4CF6A 1HDOA 5KHOC 3HVHA 2G5CA 3IAS1 1IMOA 2ZT6A 3OPNA 3D9QX 4FYXA 4ZMSA 1PBTA 1T34A 1Y5RA 2W42A 2BSQA 2UZ1B 1OV4A 4M8LA 3T0FA 3AM3A 4MVJI 4E5SA 1T9BA 4JJ8A 1KEVA 1AHHA 4EGAA 4NK5A 4Q9DA 3GLUA 4HNAB 3TW6A 3WL6A 5K0EA 5JYCA 1ISGA 3LRTA 3T3MB 1ZJZA 3Q3JB 1HRKA 2AN3A 5HCNA 2I4NA 4ZVPA 1BMFD 1G60A 1MG5A 2ZSJA 1OUMA 2HU5A 1RT9A 4JL5A 3QVTA 3ZBTA 3IULA 3ASZA 2D8AA 1XG5A 2MHCA 3H97A 1AB6A 1N0VC 1VOTA 1XRLA 2Q6VA 3H9BA 2FFJA 5AVTA 3VMMA 4F85A 2B20A 2D3WA 5JEEA 2I4MA 4B3DA 4XGIA 1I9CA 2LNDA 2GMWA 4X8MA 3GFTA 4RGYA 3RSGA 5EJ7A 1OZGA 4DMUB 3KKLA 3M9XA 3ZGNA 3UT6A 1M83A 4KODA 3U56A 2EJVA 3OURA 1TK9A 1WCIA 1WWKA 1KZGB 3TRJA 1YRLA 3N74A 5BVHA 5LP1A 1DJLA 1A72A 2C2GA 2H57A 4KDCA 5A4FS 2QBYB 2FZEA 1AGPA 1L3IA 3SR0A 1Z18A 4L4RA 4Q3BA 4QWWA 5D8DA 1PKXA 4P2BA 3VNBA 1VMDA 1KI2A 4PIMA 1J06A 1Q7CA 1GZ5A 1SM4A 4EKDA 3MS4A 4INAA 2IH2A 1T3TA 2HFKA 2VHTA 2C4UA 3FMGA 4Q66C 2KE5A 2WB4A 4F97A 5KPDA 2A9QA 1WVIA 2BMEA 1U8FO 2C7QA 3IP8A 2JCVA 4LKRA 5DE3A 2FEWB 2JGDA 5BSRA 2ZUDA 4OJQA 5HTKA 3EPKA 3M4YA 2OMKA 4N7BA 2V8BA 4W6ZA 2D5IA 3D64A 2ZFUA 4U00A 4L0MA 1NT2A 2AV6A 3LG2A 3QWHA 1KVQA 4M6WA 3U31A 2ZOSA 3N6RA 3VOAA 1PRYA 2XWQA 5C35A 3WYCA 5AUQA 2CXNA 1DKPA 4EA8A 5ITVA 3BXXA 5KOJA 3PWTA 1K4KA 2C9MA 1DQNA 3G2KA 3FYSA 1YHNA 4RHFA 3DP7A 5CGZA 4FDLA 2IUFA 3PF9A 3QWIA 4G5YA 5LQDA 5DFAA 3GFGA 3NBQA 1QMGA 1Q6ZA 3SHWA 2BCEA 2RAPA 2X2PA 1JAIA 4NJEA 1YJBA 4CKEB 4BO2A 4RTNA 4RK4A 2EF0A 3GFOA 1VFNA 3OLVA 1FYDA 2AEMA 3VR2A 2ZI4A 1I2ZA 1WMSA 2IYUA 1E66A 2XAUA 1MN6A 1FJ2A 1K6MA 4BUZA 5K99A 4KOAA 3STUA 4QFMA 5AVKA 3I9V1 2OXEA 2QSYA 4D6YA 3I9LA 2H00A 2ISQA 1Z7BA 4RDCA 5CT5A 3IJ5A 3TXAA 4LF9B 5JUWA 4LPSA 3ESQA 2XJ4A 4IIEA 3O74A 3IT3A 4X6XA 2WABA 1DAFA 1XRSB 3BHIA 4WASA 3QBVA 5EPUA 5BW6B 3Q3CA 4HUTA 4XLZA 4TYYA 1K6IA 1Y1KE 1S89A 4Z0TA 4IX9A 2R8ZA 3JSAA 4RMGA 3GA5A 4OTZA 3LUDA 1GQFA 1JVBA 2YJNA 2Q27A 5HRUA 1JF8A 1RCUA 1TJ3A 4FFLA 3BXPA 3T52A 3TH5A 1C3OB 3IUPA 3OCZA 3V7FA 3PR2B 4UTZA 1ES9A 2G3YA 4BC1A 1WSAA 2HJVA 2P9FA 2C61A 2YFQA 1OPRA 3JQ8B 5LJLA 1KFEB 1FU8A 1Z4KA 1LEHA 2W4MA 4Q34A 1XN1A 4XEHA 4B32A 5IXSA 3WQQA 2C9CA 3D6VA 4ZXPA 4BBJA 3H7AA 3ET5A 4XOUA 5ADHA 3MCAA 1ISFA 3DOFA 2IKQA 3KD2A 1FP2A 2AG5A 4U2CA 5A6SB 5AOVA 2D5LA 4JI1B 5HRCA 2IA5A 3SU8A 3WFIA 1E99A 3KHUA 1M1YE 4TMYA 1ODIA 1KJIA 2FB9A 3DA8A 1J24A 4QXAA 4UBOA 1O6GA 5J2TF 2XNHA 4DDUA 2PJZA 1N5RA 3R3XA 4HN9A 1PX2A 1UCFA 3BM5A 1DO0A 4JJ4A 1JQ5A 1P80A 4OBXA 2FX2A 2YVLA 3T38A 5FWYB 2DWQA 1I6WA 4E51A 1U0TA 2YHAA 2P4UA 3A28A 5DH9A 1KRXA 1BC5A 3VJMA 3L41A 2VHWA 1G8MA 5IF3A 3KQHA 5IM4A 2C5BA 3H4TA 1QGED 3ORHA 1UJ4A 3BGIA 4HEJA 2ZTMA 2JFOA 1PFUA 1S8OA 2YJ5A 4X66B 3ZWQA 1EM8A 4MVJH 3MA0A 4CLDA 3FTDA 3TOXA 2QTTA 4L22A 3OF5A 3SJUA 4CM9D 5B4VA 4OI0A 4S05A 2AOUA 2H31A 1Z62A 2IIQA 3GJZA 3B6KA 1KDPA 5HUHA 3M3PA 4BO6A 4FEYA 3OOJA 1KS2A 1ADCA 4NATA 3IA2A 3NGXA 2QSUA 2OAQ1 2EZTA 4TKVA 2O7VA 3T7JA 1EWYA 4CDGA 3UJNA 1KRHA 5CBPA 3WGKA 1CY0A 1W0KD 2GNOA 3S5UA 1IHPA 3R7FA 1SXIA 4DEYA 5BVGA 4KWIA 5LP6F 2I6UA 3WLIA 3E53A 5D6NA 4ZV9A 3DEAA 3VA7A 2O8EB 4ADSG 2BFEB 1SB9A 2WOJA 4NS4A 4OL9A 4CFYA 3AL2A 2WSBA 3GH1A 1NDHA 4N18A 4L7QA 2VTVA 1XROA 3TW8B 4CUKA 4NWIA 1A9OA 3ILYA 4K9QA 4R2WA 4TVBA 5KNDD 3EA5A 4OO3A 3MWYW 3UEOA 1OPXA 2GRUA 3E1GA 1YRAA 1UBUS 1YH3A 2DJIA 4QAQA 1N5DA 4G5QA 4IIJF 3FCSB 4QRDA 1U0EA 4R7TA 2OCYC 5EZ5A 3GLIA 3GUZA 4ZREA 1XI2A 2DUNA 5AVRA 1AHPA 3L9XA 2EFEB 2FPWA 3D3EA 3A6FA 3SI7A 1C30A 4J7XA 1Z0JA 4Y2VA 4HFJA 4DY6A 3VDRA 1WVGA 1ST3A 1QH8B 2OZVA 3H99A 4JFRA 2PU5A 1EDBA 4OPMA 3RSCA 4C0JA 7GPBA 5F2OA 3S70A 2B35A 2OCAA 1HYEA 4FPXA 1YV9A 1C1XB 5FI1B 2JIOA 5JMOA 1QYWA 3QKIA 4OHMA 5CLHA 2V7QA 1T8TA 3H2GA 3VHXA 3OKAA 4BX2A 3OTQA 5IBRA 4EENA 4LDQA 2XQGA 3JALB 1EVYA 4IH9A 1JVSA 5AM2A 1T2FA 2CEAA 3H05A 1UK6A 1IXYA 4QLAA 2AYYA 3VDQA 3GRZA 2AI1A 3KYDA 4RVOA 1N36B 3JVIA 2P0EA 1P9NA 3JVUA 2CUTA 2ZIXA 1U4SA 4G2NA 1I1OA 1F60A 3AIIA 1VL1A 4HC4A 3TBFA 1HFKA 1TJ4A 3B38A 3HH8A 3CXUA 4ZKEA 5IN5A 3WWDA 4BE9A 1PLJA 1TCAA 3VO8A 4OH1A 1LFDB 3HDQA 1GCGA 2PX2A 1UFVA 4HDOB 1LWOA 2O1EA 5LU8A 1TC2A 1RVDA 2M6KA 4AUNA 5LBUA 1TECE 5KU1A 2GJKA 1C3JA 2HA3A 4ENPA 1DOHA 1Z0FA 3WOVA 2PUHA 2BZGA 1JL3A 2DWCA 1MRNA 4IOLA 5D3KA 2C0PA 3ZJ5A 1E4VA 2DZDA 5JSFA 4IGFA 3BMQB 3PYLA 2A5FA 4RPKA 5BN1A 1KAMA 3CA8A 2W8BB 4QUEA 4UFPA 3UBTA 3VR4H 1TE2A 4UOEA 1DQPA 1E7MA 4EPWA 3NVAA 3O8OB 1H05A 1AQNA 4AJ4A 3RDPA 4BLQA 3B1FA 1PDOA 2O8NA 3WK5A 3MJCA 1YWGO 3AFHA 1HEUA 2HWUA 3OJLA 4ERXA 5I51A 3P97A 5JZMA 5B4TA 5CVEA 4CM1A 1M8FA 5EIBD 5D84A 3RARA 1P72A 1BZYA 3I61A 2JKVA 3VGPA 4RVCA 2HSGA 4RORA 1SUEA 3QVSA 2BE7A 4YY3B 4HR7A 3FG9A 3DOOA 4YRZA 4RESA 2DPHA 3SYTA 5HUQA 1EE9A 2ZBEA 1FFYA 4ZIRB 2OHGA 2GYVA 1DJOA 3R8XA 5FOSA 4B3JA 4EUNA 1XDDA 2ATVA 3FY4A 4REQB 5IULC 3UICA 1FUIA 3REGA 1KPIA 1E1NA 2OCLA 3E48A 4QLBA 3V55A 2BM9A 4RD4A 2FR8A 3ORFA 4Y2YA 2V0GA 1P1BA 4KFSA 3ILHA 1GAEO 4Y2GA 3G2QA 1C8VB 1A50B 2H4HA 4BV8A 4LHWA 1AN9A 2FFQA 3B7WA 3I01M 4M7WA 5A4KA 3JQEA 5BWOA 2EW8A 1V8ZA 3L0PA 4P3KA 1ZD9A 4E31A 3MHPA 4Y9RA 3VBCA 4QDJA 4MWCA 4Q1BA 1M6HA 3HCWA 1N33B 1Y98A 3THWA 2XCRB 3PC8A 3BWEA 4PO8A 3UPDA 4DG8A 5DP1A 3AIMA 3RTEA 5DM70 2OV4A 3VZDA 4WBNB 1VCIA 4IQGA 1Y1PA 2I4IA 4GLFA 5J2UB 2VAVA 4B48A 3G2PA 3JSXA 3RHTA 4BP9A 2YBDA 2BFDB 1UBOS 2VUTA 3M0EA 3PEFA 4IIDA 3QFCA 5LSAA 3WIVA 3M4JA 4ZT5A 2BH2A 2P27A 1B4DA 3JWPA 1K5DA 5DN6D 1N2HA 1V7PC 2ATCA 2O2ZA 3FYHA 3HJHA 4DL9A 4TWZA 1E9RA 1OFIA 3GI1A 1PIWA 3CC8A 1B14A 2R66A 3DT9A 2NUTB 4UAUA 4EW2A 4PIPA 1B0AA 3GFBA 2J9FA 4Z4HA 1WHTA 2Y2VA 2N47A 5I5EA 3FNRA 3EZ9A 2PCJA 2FFRA 2B61A 3GP3A 4YR9A 3VR1A 2ZDHA 5E7IA 1CERA 4Q9IA 3EPJA 4BJ6A 3AESA 4XCVA 2BHRA 1WXQA 2VO1A 3VC3A 4BQPA 3C6BA 3W8EA 1E2JA 1FUUA 1TAQA 3HSYA 1ZD2P 2PGAA 3PSHA 2ZU6A 5LUBA 3FYUC 4MB2A 3RF6A 1H23A 5J4KA 4FNOA 4NQZA 1HEYA 2R60A 3AB3A 3HJNA 2P5UA 3BMCA 3DZCA 3I53A 4GLOA 4A5OA 4EELA 3DHWC 2OBLA 3S55A 2NOAA 3KQWA 3WLTA 5CHYA 1M6VB 2BMAA 4XQCA 2CY0A 3QX8A 4LXUA 1KERA 1A9QA 1CRQA 1FCJA 1FUYB 5FR1A 3RBXA 5KNCH 3IXMA 2ACEA 2J87A 2VF2A 3DOCA 3GFVA 4PQFA 3U80A 1GJRA 1QIHA 1X1SA 3GD7A 3NCTA 1PW7A 4JLOA 4QJ3A 1NFFA 1V11A 5JCJA 5KQRA 3K71B 3COYA 1ZK3A 1Y82A 3EVCA 5KTYA 5FTKA 1KBQA 1JEQB 1RWQA 2VJYA 3BPSA 1XFAA 3LWZA 2PXCA 5F9MA 3PIRA 4HLCA 5G1OA 1J33A 2RHRA 2I65A 3LQ1A 4MQEB 1KDVA 1JU9A 1OVGA 5C4GB 2X5KO 4GQIA 4LJLA 2IXBA 4XWOA 3N0VA 4Z99A 1JA0A 3P2IA 1BMDA 1R0YA 2QPLA 4PLWA 3FGNA 2ZZMA 3WYFA 4DUGD 1HE3A 2H5JA 2MCFA 5AW3A 2XCSB 2JAWA 7AT1A 2Y0PA 4GZMA 3BDVA 2O8CA 4U3JA 4G5GA 3QQ5A 3CEJA 3PB3A 5JD6A 2VBIA 5DCUA 4K6HA 1NW4A 1QHSA 2VVTA 3M70A 4K5QA 1Q7TA 2BI8A 3W5IA 3QLVA 2J6IA 1H2HA 1BYIA 1LBQA 4LOLA 5DISB 3Q41A 1Z4LA 2AWOA 1IEXA 3LA6A 2B8NA 2RH9B 4R9RA 3SFZA 3WBBA 4ARAA 2VDWB 4CNBA 3IMKA 4JGGA 4Z53A 4GBGA 4K8OA 2GK7A 4D4GA 3NBZC 1T2AA 3H11B 4CG3A 2W2NA 1GFZA 1YZQA 3GELA 3TDMA 5EVJA 4D9BA 1W34A 2FCAA 4MQUA 2GEKA 2Q5LA 4XR4A 2P9EA 1ZW6A 3G9XA 5LZ5A 2CNOA 2ZXEA 5FL7D 5LYJF 1NFQA 1W87A 4WWHA 3U4CA 2AE2A 4YCJA 3GGGA 1CY4A 2OBXA 4D82A 4RH3A 1Y9DA 3K6JA 2QU7A 2AE1A 4H7HA 3RT9A 1KVRA 3PE4A 1L5OA 2N46A 1ISJA 3G2MA 1K5PA 3WNQA 4H31A 4D2IA 1W48A 3EXEA 1ZIXA 4J0DA 3WY9A 4QELA 3WGVA 2FJUA 2VJPA 3TL2A 3HA2A 4DGSA 1KS9A 1IK4A 2Q5CA 3L8EA 3IKVA 4OX9B 3AKCA 1T6BY 2V8OA 4QYWA 2G06A 3E4DA 3N87A 4TTJA 3TD2A 1HQDA 2IS6A 2WKSA 3WZ2A 2OOKA 3SFVA 4PQYA 2FP4A 2YIJA 5A62A 1FVHA 2JEZA 2ZDGA 3F71A 5FF9A 2Q41A 2BHNA 2YYZA 2CN1A 1P1HA 3MTBA 4PYOA 2OBMA 1JYFA 2DHQA 3GB9A 4JJIA 2GAFA 1FEZA 1EGVB 4RA6A 2IY8A 3UV6A 2HGSA 4XPZA 2WJIA 3E9YA 1TYDE 1JFFA 2WAOA 1EWVA 4KMRA 3T4UA 4X7MA 2Z5GA 2GTHA 2MSLA 1DXOA 2PX8A 1H8HD 3KUDA 3HY3A 3NAZA 4QOIA 4RLFA 1KTIA 1HL7A 1RRVA 2PXXA 4PNEA 2O8EA 2P2YA 3BD8A 1R4AA 1ZMOA 2ZBDA 3ASYA 3OWXA 2EARA 5EIBC 2G7MC 4OQPA 3D3KA 3R3JA 1AK1A 1YHZA 1QB7A 2NZWA 3MYYA 4NBLA 4P3PA 3MJHA 2GF9A 5DIZA 3WJ1A 4Z49A 3INRA 2Q8QA 3E23A 1CTQA 2PZKA 2ODEA 5CCDA 1R0KA 4ZN6A 1ZEMA 1ONBA 1JEYA 3IT0A 4RJ2A 1L3CA 3H4VA 1YONA 4BFTA 1PR6A 1U9IC 2W43A 3AU9A 1U8XX 4YONB 3RSHA 4O4HB 2C8VA 2NMVA 2WA2A 3ZHCA 1MIHA 2V1XA 4FHEA 3R3ZA 4JBWA 1KU6A 4JWKA 1EYZA 4QQNA 4YMSA 1JSRA 5D1NA 3AY3A 4EI7A 5J2TA 1KJJA 3UJPA 5DTQA 5JFOA 2NXEA 3ROGA 3RVSA 3UJ7A 1FFEA 3FVVA 4DM3A 1Z06A 4N49A 2X8WA 4GX0A 3CVUA 3BICA 2A30A 3IESA 4MEAA 1SPXA 5CH8A 5ITZB 1TO1E 3NX4A 3G23A 5C51B 3MOSA 1M2FA 3HXOA 1T2NA 3ZU4A 2UZ0A 1WNTA 4GI5A 1RIIA 3NYRA 1DEKA 5DNYB 3KYJB 1XD8A 4L78A 2ST1A 5CJJA 1QZZA 4YVFA 4MUYA 4WOJA 1P75A 4GYKA 4M98A 3DXFA 2BE9A 3HMKA 3I2YX 4YIHA 4URFA 1EVIA 2E87A 4KE7A 3GP5A 3L43A 5D1HA 2I6QA 1I5OA 1H6DA 2X19A 2IYXA 3F8WA 4J94A 2J07A 3KKEA 1GUBA 4JSTA 3AEQA 4FCVA 4LX8A 5ENDA 4YRGA 1U2SA 4N9QA 4P8RA 1KPHA 3AHJA 3CUKA 1A9YA 1GNPA 1AKWA 1JHMA 2AJCA 3P27A 3ZHTA 4PBRA 3ZIDA 4TV8A 3WWEA 1DKUA 2GN2A 3UA4A 4CCSA 2G28A 3MYRA 5CDSA 2H1OA 1UPFA 1QF7A 3BCHA 4MULA 4JT2A 5U4QA 4NE7A 3JQAD 3NBAA 1AUPA 3WRXC 3MMPA 4H3HB 1NAIA 3NIDB 1L7MA 4RNCA 3L05A 2PRJA 3TQRA 2WZDA 4PXSA 1KU0A 2PV0A 2QD1A 2VOJA 5EQJB 4PANA 2F62A 4UMDA 2B69A 4DABA 821PA 3HP1A 5ILOA 4JOBA 4QULA 1X1DA 3PXUA 5I3CA 1NNSA 5IZCC 2INGX 3FLBA 5I9TA 1YMQA 3BKXA 4UAJA 4X3CA 4LWZA 1IBMB 1QCYA 2QPAA 4F5ZA 2OBYA 1I4OA 2OHOA 4GS5A 5FUWA 2OD9A 2B9EA 2IFTA 2ILTA 2BIFA 1YB7A 1J0BA 1CIVA 2BFAA 4Q1DA 5JJLA 5AT1A 3HI6A 5DU2A 5BW5A 1Z6QA 4RL6A 2IZ7A 4D0LB 3ONEA 3OU2A 1Y5IA 3GQBA 4XD7D 2H6EA 4JP8A 3ZHXA 4TXJA 4A8PA 2IHZA 3KZVA 3O03A 4NV0A 2DH6A 1BH2A 4P4UA 4NOKA 5FBRB 1II9A 3S6JA 1K9SA 3V8VA 1A4IA 3NWOA 1II0A 1RBMA 1WUIS 1OY1A 3B7PA 2NU8B 1AQIA 3RS3A 4D46A 4C4AA 2Q4OA 4CL0A 1JFTA 4N82A 3K5PA 5IJ0A 5CNMA 3C3AA 3WBFA 3P94A 4PPYA 1OIWA 4K1LA 4YI5A 1VJ0A 4BXOA 1ZSNA 3FMVA 3BEDA 3AVYA 1RPZA 4NONA 3I23A 3NKFA 3AY7A 3QEKA 3TFQA 4KAXA 1PJLA 3FB4A 4S2EA 1CR2A 4QQFA 1Q5PA 3FR7A 2GSWA 4KVGA 4WAUA 4NEGA 3C8MA 3ZDQA 2I6GA 4I99A 3I9OA 4Z3OA 1Y3HA 4Q6WA 1WABA 1RMTA 1V1MB 3A7DA 4TYQA 2YH2A 4RDHA 3UMJA 3PGA1 3Q8WA 4PZAA 1AY0A 2LP4Y 3X2EA 3AEXA 5E4TA 4DR4B 1R50A 2RIRA 4DG9A 4J1NA 2HW8A 4MWBA 5L40A 2QYOA 4LNUB 4OQXA 1XMOB 4CIAA 4PLGA 4PRZA 3U37A 3TLMA 5J2UF 2DB3A 1J0XO 1TVKA 1VPEA 3TCNA 2HA0A 1JDNA 1Q92A 2CDRA 5GJVC 5DT9A 3R9XA 1ZM9A 4F0JA 3CZPA 1D1QA 1M1NB 3GRUA 1O58A 4K9PA 4AN0A 2NSLA 3KG2A 4U6QA 2B25A 3TSZA 1Y3AA 4ZCTA 5CAEA 4BEBA 1ABBA 3P45A 5JVDA 1ULBA 3ANLA 5HJ7A 1D2AA 4JVOA 3KR1A 1S6YA 3AWDA 3IOMA 4YJDA 2WYOA 5EGNA 3ZWBA 5C81A 1OZ0A 2ZIUB 3ZD7A 3EMVA 4NIMA 3TJMA 4YJ3F 2PSJA 4FZJA 4LEIA 4PYJA 4Y2XA 1YIDA 4Z4FA 1SG0A 2DEUA 3RU3A 3JATA 4EFDA 1Z0UA 2APJA 1Y89A 1VXRA 4PM4A 4GVPA 4WBSA 5IASA 3MMXA 2X8AA 4IDOA 1KIAA 4RVHA 3PHBE 3V2IA 4LYFA 1H6CA 1VB3A 3OZXA 2ONCA 2BFCB 2E5FA 3AP2A 1N2OA 4QASA 4U7TB 4OJNA 1VYUA 3T3OA 2QY9A 1W1UA 2WD9A 3TVYA 3PE6A 5CIYA 3ZGXA 4NTZA 3CVVA 3HKCA 3KR2A 3PNOA 3QJYA 3MLAA 4EFKA 1E9CA 1MB3A 2BR5A 2GRJA 4FFBA 4DXHA 3O31A 4OMDA 3VC1A 1DL5A 3MIIA 1BSVA 3IDSA 4PSVA 3NS7A 1WO8A 1GIAA 1HEIA 2C4MA 4EGCB 5IW8A 1KZHA 5AHXA 3JASB 3W1VA 5IJZA 5DHTA 2ANCA 4RVDA 4IOJA 4N8DA 1C7JA 3KQQA 2AJDA 2C5LA 4UPDA 1E5TA 2A3NA 1C9KA 3RODA 4YQZA 1DXQA 5K0GA 1GCAA 2ERYA 2NVUA 2XBUA 3NM6B 4PWZA 5DV9A 5BR1A 3F5MA 1M1XB 3CH7A 5EKTA 5AJHA 3F6PA 2QRKA 2ZIFA 3PQ2A 4I8XA 4L85A 4NHOA 1FNSA 1RQ2A 1ACLA 1M2HA 1NTOA 5ALIA 1JDZA 3DXZA 4OHPA 3U7GA 4BJ3A 1SG6A 4BQNA 1C4OA 4WESB 4CEHB 1SQ5A 3K1JA 2WSIA 4HYEA 4I6GA 1G8SA 2YIVX 4Q0MA 1XXHE 1EFHA 3N2YA 4XUDA 5A3JA 4HGYA 2PKQO 4MICA 5DWDA 3NH9A 3PJDA 1RCFA 1RRFA 4MXDA 4E1VA 1ODCA 4IIGA 3HCPA 5CCXA 3L18A 1DIOB 2PVPA 1RQPA 1TPZA 1Z6ZA 5B2ZA 2IC5A 3EVGA 2EC5A 3ENVA 2PH7A 3NATA 5D2CA 1SXJC 3EVAA 2V9CA 3LLVA 4G2TA 4I9NA 5JAPA 5JNUA 4D0GA 1P4GA 5AVSA 3D8BA 5E38A 1LJ8A 3LVFO 3NBKA 4QDZA 1PZEA 5JAQA 1QHNA 2TSYB 4KDRA 1ZJ5A 1D8TA 3KZKA 4NBSA 2ZE5A 4U6NA 4E5YA 5C1DA 5DJ5A 3ML1A 1SU4A 2OZKA 1XJWA 2PS1A 1S7GA 4LC9A 1DV2A 2MSEB 4GI7A 1NL3A 1XPOA 4IHJF 3WIDA 3H1EA 3FNBA 3ISTA 1STOA 3EFOB 1M2GA 1YVEI 2JI4A 1P6UA 2CXQA 3G88A 2GBLA 5C18A 2C7RA 3HR7A 4FX5A 2QMUA 1QIIA 4GQBA 6LDHA 3C5VA 5TQVA 3OZRA 1XA0A 1JMKC 1RLJA 4BPBA 1ZO8A 5CDHA 2MMGA 1PGOA 2QUZA 2ROQA 4QFCA 3TQCA 1RAFA 3ACCA 1QK4A 4XR9A 5TNXA 3H1GA 1CR6A 2ZYVX 4HZUB 3RWMB 5EIAA 1S01A 3M33A 2PUEA 2R8BA 3W5HA 4BWFB 5KVCA 1JR4A 3D6UA 4WLOA 2YZ7A 2FPPB 3EBLA 3M6IA 1R3UA 2OGZA 3JYQA 3SHOA 3FSEA 1CJTC 3OOYA 5IAOA 2FI1A 4B46A 5BV7A 2K7ZA 5AVWA 4DRXB 3FVRA 4YJ2A 4BVAA 3FWKA 5DXFA 1XOIA 1MENA 2Z9CA 4DE5A 2NZXA 3DDZX 4KQEA 3ET4A 4MV1A 4C6RA 1HDCA 4D4KA 2QAGA 1KI6B 2VPTA 4RHUA 3ZNNA 1WAMA 2PT9A 4UZEA 4WINA 4DIBA 3S5JA 5IC5A 3LLUA 3GMSA 4V03A 3DBRA 3KR9A 2BEWA 4ZZ0A 3HO1A 3MJ4A 2QG9A 2BEUA 1T5TA 3PFNA 3O95A 3PRYA 1ZNQO 4EBBA 4Q7MB 3GRRA 4Y7CA 1U1EA 3ADOA 4NARA 4ACAA 1Z34A 4NAVA 4P0TA 3D0KA 5IK2A 2E5LB 1R5NA 1FS6A 4X20A 5IAGA 4AY3A 3DF7A 1C2TA 5FQOA 4TLDA 2O8BA 2JZOA 4QGFA 1CLEA 4XVRA 3QVOA 3N2KB 5ALXA 5KVQA 2PGDA 1CJVC 1VJ1A 1ETHA 2MYNA 3E3NA 5U9CA 5AW0A 4XWWA 5EN4A 5F1YA 2VI5A 4BLSA 3ZXYA 3MJRA 3VTAA 2VZ8A 1VI5A 4LUCA 5DX8A 4YUYA 3L8DA 2IYAA 4TTVA 2GBGA 3HU3A 5C8XA 3WYAA 1E2MA 2CUKA 1TZ2A 2X4IA 4F11A 4ECEA 3MQ2A 4R1SA 1WULS 2V98A 2Q7OE 4MS3A 4OP3A 2R6FA 4LDAA 3BE8A 1E63A 2KYRA 5T8KA 1P9OA 3M6FA 3MELA 3G8CA 3IIKA 3EFEA 4QYSA 5IUNC 1Q0TA 1L4UA 1COWD 3ZDRA 2H1WA 3QUQA 4P54A 1CR1A 1MO3A 2FPGA 3V48A 4XSVA 4LYDA 3MWDA 3ZK9A 4CMJA 4F7DA 2JLXA 4HYYA 1WG8A 3C4JA 3UMRA 4C5BA 1VHLA 3LNCA 3D5QA 3T9EA 4XFJA 4HOYA 4FE7A 3FPKA 4RK7A 2OCKA 1YFJA 5BUZA 5AJXA 4MQ6A 3WNCA 3IAAA 2D1TA 4K8RB 1L8LA 3ZTYA 1S8NA 1VCOA 1RBQA 4YMVA 5IN4A 2DUMA 3EUFA 2JEYA 4Z86A 1WBBA 1EUQA 1T5IA 2IL1A 5B3JA 2YWHA 3LY7A 3PPWA 1ESMA 1PUIA 3EW7A 4NCIA 2D4HA 2Q2VA 3EGVA 1PSWA 1YZUA 1Q77A 3WP0A 3X43A 4CUZA 4YT8A 1QP0A 2II6A 3A0RB 5LYYA 2J3LA 5KQPA 3QVUA 4BNHA 5HIJA 4L4ZA 2X7XA 2IZ6A 4PV7A 3KOUA 1NI5A 1DXYA 3ZGOA 5DLDA 4Z4CA 5BV2P 2CKDA 4HWGA 3FTCA 2R1TB 5DB4A 3TQTA 4B3CA 4EYKA 2Z6UA 2H2GA 4HWOA 2NU7B 3I52A 3P4UA 5ALQA 4QHYA 3X1KA 3V7UA 4OBWA 2YWBA 3S3TA 2HJSA 4Q37A 1D6MA 1O96A 4CCWA 3NAGA 4INJA 1C3VA 1BRMA 1SCQA 2H2IA 4P81A 5CM8B 2REQA 2JHFA 4NULA 3T9BA 3DLIA 4S12A 1WRBA 4URVR 3TUZC 1X7ZA 4CRWB 1AUQA 1QO7A 1Z6PA 2V74B 5HF9A 2W93A 3WLRA 1J0CA 4G1MB 3I2KA 4AIRA 1KAEA 4WJZA 3TD6A 3TL6A 3BF8A 3RAGA 5TQJA 2QA5A 4JN6B 4L57A 4UHFA 5TVKA 5BOVA 4OUDB 3PDIB 4KN5A 4EJSB 2C9ZA 3CCCA 3U0VA 4D8VA 4JXZA 1QWSA 1T4CB 4O0LA 1SNYA 3V00A 2LW7A 3MB5A 3OJOA 4H18A 4LTNA 4UNQA 5F33A 3B9QA 3KJGA 4D0SA 2AEJA 2G71A 3CF0A 1WCV1 3CGGA 4NNOA 3T9DA 4P2GA 2ZJ0A 4JJGA 5IMSA 4B9AA 2PUBA 1JYEA 4ZGWA 2HSDA 5CDGA 5JD5A 1Z45A 4D41A 2RBKA 2B2XA 5TB5A 5B64A 2YN0A 1CLUA 2IHKA 3BFJA 4HQKA 1JX6A 4JZKA 4QNRA 3NHKA 3A1DA 3GGOA 4KO8A 4WKCA 5EKXA 4MCJA 2CV1A 4ZU3A 3VYSB 5ERXA 1DEHA 1G63A 2HCBA 4PF1A 1XVIA 3ZZMA 2W2XA 2W7TA 1SZCA 2RHGB 3SEQA 4OHFA 1F1JA 3I5UA 4E5PA 5HVNA 2H06A 2XMDA 4FI3C 3SFTA 4OFXA 4US0R 4YCBA 2RHBA 3DL7A 3FBWA 4NE2A 3IB3A 2BEKA 4KNVA 4D4HA 2B5WA 1JIUA 3DS8A 1RJDA 2C4TA 2WAYA 3CQ9A 1IK6A 3W6UA 3NDBB 2RGGA 4ZQGA 5D5PA 3W06A 3EOAI 2CYBA 3KVYA 3QP9A 5CCEA 1I3OA 3ZHQA 3M7IA 2PS3A 3QXSA 1L7BA 2ZCUA 3IILA 3AR8A 4R8VA 1CX9B 2VNHA 3DVSX 1I0IA 2JFHA 5EWJB 4UCXA 4EZIA 5A7HA 3IPCA 3CLRD 2AR0A 3PFGA 4O1IA 4OSEA 3MWKA 4ZANA 1DEOA 2VP4A 4LY3A 4MP8A 4U5XA 5CT6A 3SJ7A 1R0ZA 3UCFA 4JIMA 2O7RA 3OLYA 3DE1X 3ROPA 3SEZA 4MCAA 1MAHA 2VQEB 5K0SA 4Q02A 1GKLA 3BA1A 3QLJA 1P2FA 3UCEA 4LJ9A 3U7FB 1QXSA 1X3SA 1UQRA 4ENVA 4YQYA 3L4EA 4BNZA 3PCRB 3PDJA 4QUAA 3H1FA 3UWDA 4P35A 1X1RA 5BN4A 2VUSA 5KQLA 2UYOA 1GZSA 4QSHA 4DLYA 3RYCA 4RIHA 3FUWA 5JXWA 2BN4A 1ZK0A 2HAEA 2HMTA 4FFWA 4Q9KA 5B1HA 3C14C 9MHTA 1FTGA 4GDMA 3LC0A 3M6MD 2WKQA 4DIEA 4B4VA 1QZXA 1XZ8A 1GNRA 2XA1A 4E88A 3ZVMA 2WZCA 4LRTB 3IS3A 2EX0A 2WWRA 1BX0A 1KKMA 1TQ4A 1VLQA 2PPVA 4ZOLF 2FW7A 4G24A 3K7EA 1TUGA 3P2KA 2ZWAA 5JARA 3BB3A 1CY1A 3OZFA 3DUFA 4JBLA 2NM0A 3COSA 3N7UA 4WECA 4F1JA 4UM9B 4RL4A 1L7RA 1TAUA 2WZQA 3VNAA 2ZSEA 3K09A 4GUAA 4PEVA 1YOVB 2P91A 3I1IA 1PQPA 3PD1A 2HHCA 2IZ0A 2JGRA 3CMCO 4G23A 2WDPA 3UPTA 4FYYA 2I67A 4G5FA 4UUQA 4LXYA 4RJKA 5AJUA 3ZBQA 2JDIA 1JKJB 4PRYA 2VP3A 3L8CA 1G8YA 1I1HA 2B8TA 3UIEA 2R0QC 4CLRA 2O8DA 3IKTA 1NR5A 1WZUA 2W00A 1V48A 1ZR4A 3UJDA 1ZRHA 3G59A 1ARZA 2VPPA 1PHPA 1EDOA 1QWOA 2YRXA 3VR2D 3AI1A 1V9SA 1T4MA 4IL5A 1O95D 4WGGA 4CKBB 4JNKA 3Q8LA 3W6OA 4E5KA 3RJTA 2V6FA 3WK4A 4WL0A 3PVZA 3IJEB 1UOOA 2OL4A 3FNFA 7MDHA 3G6KA 1BHJA 4IS2A 1J00A 1JWBB 1S2LA 3M89A 3CZ9A 4IGEA 5LA6A 2QUJA 1TAGA 3W4KA 1JHUA 1E7WA 5E9WA 3EC1A 1Y7PA 2A88A 3LNTA 4ZOCA 1ZGZA 1ODFA 4UAVA 4WERA 1T9CA 1Q2XA 2GAAA 4K0RA 3TQFA 2AIRA 1RADA 1IL0A 4MQBA 1XTKA 5M3BA 3LE8A 3QVGA 2DBRA 3K0BA 2XOXA 1MF7A 1I3NA 4WJKB 1ZWLA 1DWUA 4XARA 4DWJA 1I36A 3DZJA 1HDXA 2FMHA 4HAWA 2YXLA 1ORIA 1ZONA 2GETA 2WZBA 4XM2A 4FIDA 1SZJG 1G5TA 4KYIB 4NQRA 3RVDA 1P60A 4BDTA 1OXMA 3GVPA 3OSZA 1FTSA 1NF2A 1JXMA 1H6AA 4P1ZA 3KQUA 1CZNA 3A6ZA 3GNQA 4JUFA 2RARA 3ETEA 2C4KA 4NAUA 2XNSA 3K9QO 1CB7A 4WNYA 4X54A 2QN1A 1QHHB 4LDJA 5C8YF 5LZ9A 1YB4A 3ZK8A 5CB4A 4FBGA 3JAMA 2JFNA 2ZTUA 5KVVA 3MHTA 1PS9A 4ZHQB 2P68A 3DEYX 1RDFA 2JGFA 1I2MA 3DTVB 4X00A 4RKRA 4L9AA 2MOKA 4EVQA 1SKMA 2C95A 3DLAA 1QBKC 2XYRA 3CJRA 4I55A 3BFPA 1KF0A 1PTJC 3HDJA 4DMHA 3DLBA 2ZRCA 3KVVA 4R9NA 3FOCA 3HMQA 3K35A 3ZWMA 4CLEA 3EXG2 4I1OA 3S2IA 1XALA 2PUCA 1EXNA 4RF5A 1NUSA 3RTBA 2YS6A 3NRJA 4Z51A 2BBSA 4M9UA 1Y48E 4Q24A 4I3FA 4MR7A 2VHZA 4EG0A 2ZXFA 4CL3A 5JG7A 2J9XB 4UUAA 5AK3A 2DXIA 2I76A 1L4EA 2V3WA 2YW2A 1EFRA 1ZWKA 1GZ4A 3WQBA 2I7VA 3ZEIA 1USUA 4J91A 1CRPA 1U7ZA 3OLCX 3QE4A 4GR9A 4R41A 4BO5A 1Q83A 1U9CA 3EVNA 4LOJA 2Q4EA 5JCZA 2FZ4A 3PNKA 1QPGA 3IP5A 3K5IA 4UHBA 5REQB 3KALA 1Z5UA 4NBKA 3EJWA 1E98A 1GPMA 2OLEA 4Q4AA 4WACA 3RYHB 5FX2A 2AKEA 4WNAB 4EYQA 1WB6A 1F4VA 1NVUQ 1U8YA 1W75A 1ZH6A 3NTQA 1T6XA 3EMKA 5AH0A 5FUXA 4EB0A 5THKA 2W6NA 4YAEA 4F71A 4FGJA 2WPNA 2GESA 1KL7A 3SE7A