4EFMA

Crystal structure of h-ras g12v in complex with gppnhp (state 1)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title Crystal structures of the state 1 conformations of the GTP-bound H-Ras protein and its oncogenic G12V and Q61L mutants
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4efmA00
2GZHA 2WICA 1UF9A 3MJHA 3TVTA 1T0HB 1YR7A 4D0GA 3F0TA 3ZZUA 2VEDA 2P65A 3GP8A 3LW8A 2IC5A 1NVWQ 1E98A 3ADKA 3UATA 3BOSA 3UMFA 4DXAA 1JXOA 2GXAA 2R6GA 1FUUA 1E9EA 2O8FB 2WM9B 2F7SA 3BE4A 5KDOA 4BFXA 4JIMA 3VAAA 3AGQA 5FOWA 4DLWA 3W34A 2SHKA 1UPTA 2IWHA 1A2KC 1KI8A 4AYTA 1E99A 2YWEA 4A6PA 4TZ0A 3WMEA 4CZ2A 2EFCB 3WRXC 3AVWA 2BOVA 4PC6A 1QHYA 2XEXA 5HTKA 1CJVC 4EJSA 2YC4C 4TYPA 1W36B 2G6BA 3FMPB 4LHYA 3K0FB 2K5UA 2ZRIA 5EE0A 2GJ9A 2D7CA 1NBMA 2KB0A 1V43A 1AJEA 3RS0A 4LHWA 1VCMA 2P67A 1Z2CA 1US8B 1XU4A 2Q9CA 5LD2C 3THYB 1VCIA 2P5SA 1N5LA 5KDLA 3EZ9A 2BM1A 2O0KA 2XOKD 1P7CA 4UJ3A 2JLQA 2MMCA 3QKRA 3C5CA 4Q4JB 4CYMA 2QMHA 3KJHA 2JJ1A 1YR9A 1GP2A 1G7RA 2BMFA 1E9SA 2C9YA 3QQ5A 5AJZA 3LVRE 4IKEA 3CF6R 3A1TA 3EWAA 4KFSA 4ZCLA 3PJRA 1Q3TA 2MMGA 4LYFA 3OF5A 3KQLA 4M1TA 2D2EA 4KBGA 1DO2A 5J4LA 4C2UA 1Z08A 1CEEA 1E79A 3AVTA 1E1RA 1KI6B 2IXFA 2J5XA 2PT5A 2BJWA 3BWDD 4LYHA 3AKEA 2W6JD 4KJZA 1UDWA 2QM8A 3M6AA 2JLUA 4V0NA 5IRCD 4IDPA 1XDBA 2AX4A 4TQUS 4LWZA 3A1UA 2QMEA 4KODA 2AD1A 3HU3A 1S3GA 3KFVA 4TYNA 2O8FA 4BEJA 2ZRCA 3F3YA 3H86A 1VIAA 3VTKA 4TLEA 1VECA 3ICEA 3GD7A 1VDZA 1KO1A 2LWIA 2A5FA 4DEYA 3A6PC 4F93B 2XZOA 4GP7A 1SGWA 1RRFA 4WVFA 4Q9KA 2OBNA 1NJFA 4AG6A 1OFHA 4BQSA 5KTYA 1W48A 3K0FA 3QEOA 4FWIB 4UNSA 3QJYA 5LD2B 4FMBB 2AXPA 1N6OA 5F98A 3RS5A 3FHTA 2W0MA 3THOA 5JS7A 5EJEA 2QT1A 1KJYA 1US8A 2AN9A 3K70D 4K8OA 1RIFA 1J8MF 3GJ3A 3THYA 5C1BA 5EZ6B 2OCBA 2RGDA 2IWRA 1ETUA 1HH4A 2DHRA 5HKKD 1P2VA 1R4AA 2OCPA 2QI9C 2WKRA 3AQ4A 4M53A 4Q4JA 2B92A 5CK5A 1H8EA 5DNYB 2WSSA 3DEFA 4TTQA 5KDDA 1GSIA 2PCJA 4MKHA 5EP4A 2J1LA 1EFHA 2ZRLA 2QTVB 4JVNA 4OJKA 3EZFA 1R5NA 1R8QA 3AUXA 2VP0A 4A2PA 3CPJB 3IPYA 4D2IA 1UKZA 1VPLA 1K8RA 2ZI3A 3QIAA 2NPFA 3Q9LA 4IXMA 1AA9A 1U8AA 4AYWA 1MT0A 1KI6A 1T3SA 4X8MA 1II9A 4BZQA 2TMKA 2KBFA 3K9HA 2EWWA 2JJ2A 1T3HA 3CH4B 4V0MA 3P20A 2C98A 5F9HA 1E1QD 3ADDA 1DVRA 1E2EA 3K0CC 2OV2A 4URWR 5IK2D 2ZRBA 2PT7A 1OT3A 3ZVRA 1NVUQ 4LJ7A 1E2DA 2VHTA 2NG1A 3KFXA 3A1SA 4HI0E 4CIDA 1RRPA 3WP1B 3IIJA 3WRYC 4RZXA 1OFTA 4B3DA 3CBQA 2D74A 4G5RA 5TY0A 1DE0A 1FNNA 4WW0A 4AKIA 1P6XA 4R71A 1NNEA 2F3TA 3DDCA 5DLQC 2N1BA 2RB4A 5DE3A 3HPRA 1CR4A 3VR2A 4KCGA 2AXNA 4A8JC 2FNAA 4NDZA 4B74A 3AVOA 1R8SA 2QAJA 2ZRNA 5TB5A 2EWVA 1G5RA 1CR1A 1CLUA 1JR3A 4LV6A 1MO3A 4P31A 2CL7X 1IY0A 2F1JA 3BJIC 2EW1A 1RYFA 4Q1EA 5FPYA 1ZIOA 2REBA 4I1UA 4NZYA 1XFAA 4Q18A 4DDUA 1E2QA 1P75A 4HZIA 1ZUIA 5L8VA 3U4QB 1XEXA 4B6EA 2DWPA 2YZ2A 2AKYA 2GK6A 1E9RA 3OE7D 4BZXA 2PZEA 4N0DA 4YXWD 3U7HB 4I1VA 2GESA 2JGNA 4LX0A 4KHZA 1ZVQA 4IDOA 2W0SA 1MABA 1E2MA 3T12A 3ZJYA 2VHUA 2JATA 5BXQC 2ZRFA 4L5BA 1AIPA 4BFSA 1GRNA 1KO4A 2XNDA 3BFKA 2YHSA 2VP9A 5DGXA 4DBLC 2CHGA 4OQXA 1XCPA 2ZQ5A 2AKAB 3IEUA 2NPIA 4KFUA 1BYIA 4OHWA 3BB1A 1Z28A 2QP4A 2QSZA 1YR6A 2OUKA 1UKYA 4QBFA 1UADA 3ZYCA 3TGPA 2WJYA 3EXAA 4A8JB 2WZQA 4LHVA 2OHFA 3E5HA 5F2EA 4P33A 5KUTA 3TUIC 1II0A 2HEIA 3CNNA 1DG1G 3CZPA 1HTWA 3NDPA 4RCYA 2G1KA 1HURA 1Z0DA 3T61A 3L0IB 5CDFA 1SVSA 1HA3A 1ZIPA 4XJXA 3EAQA 1TUIA 1N3BA 4U00A 4LJ6A 3E2IA 2HF8A 3GLIE 4PAOA 1A1VA 2ZI5A 1M7GA 2BWJA 2ZI4A 3L2OB 5GJWC 3UG6A 2A5YB 4KYIB 3MWJA 3IIMA 3K1JA 2GTPA 3QXXA 1Y63A 1SVMA 4C0LA 1L4YA 3EZ2A 3SBDA 4QNMA 4MRRA 3I1FA 1Z6YA 1SVLA 2HLDA 2OBLA 3U4QA 3T1QA 221PA 2YNMA 4LYJA 3BGWA 2QMOA 2QN6A 3PVSA 2J45A 4XSHA 2GXQA 4JLJA 5B2ZA 1VG9B 3QKSB 2RKOA 2IK8A 1VIYA 2CEAA 3QPVA 2BMEA 3KTAB 4ESHA 1KK1A 1QHNA 2QGZA 3M0EA 1IQPA 1YR8A 3TUZC 1R0YA 2IXEA 2F1RA 3UPUA 2BEJA 4GL2A 2ZUDA 3ZZTA 3Q85A 1KK3A 621PA 2QPAA 1Z0JA 3WHKA 3K0CA 3MLEA 3TBKA 1F5NA 3PEUA 1OHHD 1DEKA 1Z47A 2FF7A 2ZSAA 2X2EA 3B82A 3ND8A 4QGAA 5EZ5A 2J0UB 2X8AA 2GJAA 2J7KA 1W0JA 4TWZA 3CUEF 4V02A 2VHQA 3IDQA 1D2MA 4O0MA 5FUVA 3GLHB 1TQDA 4UXJA 1XTJA 2QNRA 1RC8A 4B6FA 2XOKA 2JAQA 4NHOA 4CDGA 1AK2A 3BH6A 1TEXA 3K0AB 3WBJA 3FFAA 5J4VA 2QP3A 5FTNA 3O8DA 3EPLA 1YHNA 3QE0A 3VHXA 4NYIQ 4XWAA 3C41J 4NL4H 2X1VA 4PZZA 4GZLA 4YDSA 3SC3A 3U61B 1DBSA 1EG7A 1CRQA 4BUJA 4ERNA 1G7TA 2QRZA 1H65A 3NEYA 1FP6A 2OSBA 3K9GA 1G8PA 3UK6A 4BEBA 2J0SA 2VSFA 1Z6XA 4LJ9A 4LOAA 1WF3A 2B8TA 1HT2E 1E2JA 4NCKA 4OQNA 4M1MA 3LA6A 2NO6A 1HQCA 2HUPA 2NO0A 4A15A 3IEVA 1CF4A 1UFQA 1L2TA 1KSHA 3P32A 4ESVA 2ZPTX 3GFOA 4Q48A 4TN1A 4JT4A 1OH8A 3QKSA 2IF2A 2V1XA 4XH9B 3FHOA 1S1MA 3L8YA 4TLAA 1PUIA 2H57A 1D2NA 2WWWA 3WYGA 3I72A 1ZP6A 3AVVA 3AGPA 4QGFA 3CPEA 1XF9A 2F9LA 3KJEA 2QQEA 4RD3A 1UDXA 1NBMD 2PEZA 1OFIA 3PUZA 4FW9A 3TR0A 4D80A 2P3SA 1P61B 4FXPA 3EWSA 2BVNA 4HLDA 4O2LA 5TXGA 3EIQA 4MGZR 1SVOA 4ILEA 3ND9A 2J0UA 5B57C 4DT1B 4OK6A 2OCYC 4QFMA 2VSXA 1G4AE 2QG6A 1E9AA 2ZS8A 4XSGA 1E2HA 1P2TA 4LYAA 5EQTA 1SVIA 3GLHA 4EIWA 3KZ1E 3RVBA 3PG5A 1WP9A 1KSGA 1W4CA 3TK1A 5KSYA 1ZAKA 1G3IA 1COWD 4M9ZA 5CK4A 1P62B 2CNWD 3VR3A 3LXRA 5HKKA 1U94A 2WWGA 5FBRB 3W6PA 5B30A 3W9YA 4AURA 5KYKA 3K0AA 1U99A 3LWNA 1UEIA 2UZ3A 5G3ZA 4TYQA 5G41A 1ZNWA 1NG1A 1SZPA 2CXXA 2VBCA 1Z6TA 2WBLC 2GBLC 3RLFA 3BB4A 3TSOA 1C4OA 4TL6A 4PC2A 3FTQA 1E79D 4TL9A 3U2QA 1VG1A 1E1RD 3VFDA 2Q3HA 3SR0A 3CF0A 3RS7A 3AM1A 3NHAA 2WJHA 4FMDF 4Q9HA 3OIUA 1PLKA 3EC1A 5FBWB 4R98A 5HZHA 1R0XA 1KKLA 1Z06A 4BE7B 4RSGA 4X8OA 5LB4A 1CULC 1E1QA 4IDHA 4PAQA 3U3KA 4HB0A 3ADBA 4Q1CA 4IVRA 5IK2A 1ZD1A 2FOLA 4ACAA 4Q7KA 4C4PA 3VNVA 1EFTA 3ZD7A 1ZM4A 2PZFA 5FUWA 1GITA 1Q1BA 1RRCA 1NVVQ 2MSCB 3DZ8A 3NBYC 1C9KA 2EYUA 1TPZA 2VP4A 3B1YA 3NC0C 4DUGD 2G3YA 2XSZD 4IW3B 4DT1A 1Q1EA 4DCTA 3AV0B 2FG5A 5BN5A 4JL5A 1WB9A 1GIAA 1LTQA 1E2IA 2HJGA 1M34E 2ZJAA 2BV3A 4V0KA 3QUSA 3U7GA 1T4GA 5D3MB 3W6NA 4JLMA 4TMXA 1XBTA 3BH0A 1G41A 3IPXA 2F9MA 2IYQA 2VP6A 3M4YA 4LPSA 2CL6X 3BBPA 4UJ5A 1NL3A 1BIFA 1KJZA 3L0OA 4GOJA 2FU5C 3OE7A 5DSZA 4F91B 4CEIB 3PEYA 1SHZA 4YXWA 5C4GB 3TQCA 1R10A 2V6JA 1I2MA 2VQSA 3Q7PA 4F38A 2AR7A 1E2LA 2IHYA 1JNYA 1DAMA 4C30A 4GPTA 3FVQA 2J3EA 2PZGA 3T5DA 4PHTA 421PA 4US1R 2E87A 3T35A 1G20E 3B1VA 5FL7D 1E2KA 3MMPA 1YZKA 1ZD8A 1Q20A 2IUTA 4KYUA 1CJTC 2WKPA 1S9DA 3FMIA 4MH0R 1SXJD 1XEWX 4E22A 1JJ7A 1KO7A 3THXB 1KOFA 4TMTA 1R5OA 4POAA 4DCNA 3EZ6A 4UQOA 3I92A 2A30A 5KNBA 2CBZA 4Q1AA 1NBME 3WXMA 4TSFD 3ZVNA 1HQYE 1KMQA 1G4UR 1Z8FA 3QEJA 4DLYA 1U0JA 1ZC4A 4G5GA 3H2YA 1FMJA 1X8LA 1KZGB 5HCNA 3BK7A 1LF0A 2ZI6A 1P72A 5E7IA 4PZLA 4IEEA 1II8B 1S2MA 4JS0A 2G77B 2CCGA 3CO5A 4BFVA 1ZBDA 4DSTA 4QKQA 4ZV4A 4W5JA 4US2R 1ZMXA 3SI7A 5JECA 2XAUA 2O5VA 5G53C 2ANBA 4L9SA 2FV8A 3DPUA 3KKQA 3P4XA 2F1HA 3AKCA 2BMJA 3B9PA 4A0RA 2PJRA 5C46F 3DM9B 4HDOB 2QSYA 2GBLA 2VTKA 2XTMA 1UKEA 2GCNA 2FWRA 2ODNA 2DB3A 1Z5ZA 4NU0A 4BASA 4MGIR 2PX0A 1P9WA 1F60A 3R9WA 2ZS9A 2OBMA 3IQXA 4AKGA 1Z2AA 3KXIA 4B3XA 4HDCA 3AVXA 2BIFA 2N46A 3PUXA 1DOAA 1O3YA 3WYAA 3X1XA 1MRSA 2ZR0A 2W00A 3NG1A 3ZD6A 2QROA 1IM2A 3GJ6A 1W5SA 1J8YF 2BDTA 2FFBA 1LF5A 4PO1A 1JALA 2G0TA 2XNSA 1SULA 1YRAA 2ZVPX 1OHHA 1W49A 3PV0A 4XVRA 4FMCB 1RRGA 3VQTA 1E0AA 3VU9B 5EXXA 4YMSA 5JLJA 3SZRA 4IFBA 2VHJA 1P5ZB 4OHVA 4GMDA 2FSIA 4Y0AA 2ZI7A 4I99A 3ZQJA 1NVXQ 1Q57A 3TAHA 3VHLB 3I62A 1JJVA 2Z4SA 2FH5B 1E32A 1G9XA 3HR7A 1OH7A 3ECCA 4H1UA 1ESMA 3CZQA 2ZVQX 4RY2A 5FI0B 1G8YA 3ZDQA 2R8RA 1NIJA 3H0KA 1GNRA 3WHLA 4TYWA 1NN5A 1YZGA 1G16A 1LVGA 2OXRA 5JWHA 1O87A 3T1TA 6Q21A 1II8A 4BZPA 2FFQA 2YWGA 4HZUB 2KBEA 1J99A 4Z1MA 1KTVA 1D9XA 5DI3B 2CL0X 1TQ6A 2H5EA 1W1WA 1W2GA 3QI2A 2RGXA 4WAUA 4JZKA 3CH5A 2VO1A 3AP3A 3ZZ0A 5KO2A 1ZCAA 1EFUA 2GEUA 5M04A 2IYUA 5FBQB 2HLDD 3R8CA 4CF7A 1KO8A 2CLDX 1JECA 1E2FA 1JI0A 5FFMA 5JCPA 4Q47A 4B47A 1OE0A 1BH2A 3D3QA 2GAAA 2H17A 1OJLA 3LW7A 4WA7A 4HB3A 1OV4A 2ZRKA 1ZW6A 3KX2A 2DBYA 3U3RA 1QHSA 2DCUA 4D81A 1RW4A 2OLKA 4WZAE 5DHFA 1SXJC 1FW6A 1TF5A 4V0ME 2ATVA 2QZ4A 5FPKA 5JZVA 4MKFA 3Q3JB 4G5QA 5CM9C 1W0JD 1KK2A 1P4SA 1XZQA 2C9OA 2CLCX 2GEVA 3BFXA 3GFPA 4M2LA 2OE2A 3VU9A 3EASA 1XD8A 4JVMA 2BKUA 5JS8A 3JVUA 4IHQA 2B8WA 3LY5A 2B6HA 3QVUA 2QA5A 3L82B 2A5JA 2QMUA 1GL6A 1JB1A 1NLFA 3K09C 2VH5R 4LJYA 4DB2A 1COWA 2CNWA 2Q6TA 1AQYA 2OEPA 2REOA 1JR3E 3CR8A 1HE1C 5JJKA 1GAJA 2NQ2C 2WOJA 1BO6A 3BXZA 2WAXA 4JSTA 3PUWA 3GLFE 4YQFA 1E4VA 2CE7A 1XJCA 4HZUA 5AJYA 1OXSC 5KSPA 5DN6D 2ZETA 3NTUA 5DI3A 3WMFA 3FOZA 2ZRAA 3UKDA 2ONJA 1S4QA 4WZBE 3SHFA 2BBWA 3GCGA 3C15C 1DADA 2IYYA 4A82A 2I4IA 1LFDB 1SXJB 5FTMA 5HPYB 1QVRA 2J41A 4KVAA 2ZEJA 2NZJA 5CYPA 1Z29A 4M9SA 4Q02A 5CYOA 2Q21A 1W4RA 4P4TA 5H68A 1M74A 1NSFA 3GJ5A 3BORA 1UAAA 4QGHA 4IOMA 1JEEA 1XCMA 1KKMA 2Q3FA 3U5ZB 1QHXA 4H9GA 4F7WA 2HT6A 2VP5A 1P60A 4BECA 1E9BA 1IAQA 2FEMA 3VR1A 3V4FA 1KDOA 2WJGA 4DUGA 3C16C 2XJ9A 4HAUA 3GEHA 2XSZA 4IOJA 5J4KA 2GJ8A 4P4UA 1X6VA 1Z0FA 2HCBA 2Q3MA 1G8HA 1Q1QA 5K8TA 3GLFB 4LC0A 2V55B 4F92B 3AVQA 4KXFB 2R62A 1Q21A 4LI0A 3JZMA 2OG2A 1JR6A 5CDFE 1QVAA 4LY6A 1A7JA 5D3QA 1KI1A 1XEXB 3MWLA 5P21A 3SYLA 3PUYA 1M2OB 1GM5A 2VLIA 2W58A 3EG5A 1ZC3A 1TTTA 3B60A 4AK9A 2ZANA 1BOFA 5BN4A 2IBMA 1VCOA 1QRAA 3KB2A 3KDSE 1UJ2A 4UKDA 4DSUA 3WNCA 3Q5EA 2NIPA 1MABB 5JJLA 3P27A 5FUYA 2QPTA 5BYKA 2WWYA 2NMVA 1PLLA 4MRNA 2XZPA 4PR0A 4WOPA 4PANA 3SHWA 4W5WA 4FWTA 2R65A 5DISB 4TMZA 5SZIA 1XMVA 3O47A 5FL7A 1G6HA 1SVWA 4TMWA 2QAGB 4DRZA 3ONWA 2ODEA 2EFGA 3LLMA 1FPMA 821PA 4P0TA 2QQ0A 5BQ5A 2RGGA 5FBVB 3MWYW 5CB8A 2FEOA 4QHTA 1SXJA 3CX7A 3U7FB 3KJGA 2QTFA 4OHXA 2CHQA 1Z0AA 4NYJR 1ZCBA 2IUUA 4IDNA 1ZYUA 2ONKA 5GJCA 2QRNA 3RWMB 1DARA 5AUQA 4IRUB 4DDWA 1YZLA 2GK7A 1QG2A 1NSTA 3NH9A 5KSZA 3LAWA 4TSFA 2J59A 4C0BA 3RC8A 4CT4B 2D62A 3PQCA 4D4KA 4QBGB 1NN0A 1G3UA 1RJ9B 3QXSA 5C4MA 2JLWA 3QKUA 3WBKA 2O8CB 2QPOA 4LSGA 2RGEA 1PZNA 1CTQA 2NTYC 2GJSA 2CE2X 2ZSFA 2VA8A 2PLFA 3K09A 4PQYA 1JPJA 1SKQA 2C03A 2E9SA 4FCVA 3W5JA 2OLJA 4TTRA 2GF9A 3GLFA 2CCJA 2HJVA 1DAGA 3OZXA 3SE0A 3UWKA 2PH1A 1CXZA 1EFCA 1ZINA 1JPNA 2CCKA 2ZYTX 4ZO4A 4BRWA 3TSZA 1OXVA 2JLXA 4P32A 4UNPA 4C0AC 3BRWD 5B64A 1Q12A 4M9QA 4D0NA 1ZM9A 2BCJQ 2ZROA 1QDEA 2W2TA 2WOOA 3LV8A 2P5TB 4ZDIA 5F3WB 3R9IA 1YJ5A 4E5UA 1G3RA 2ZUBA 4B48A 2FMXA 4MA4A 3SEAA 4JBWA 5BW8A 2G0NA 1KO5A 1Z22A 2YC2C 3TRFA 1UKVY 4FINA 4URVR 3N5CA 1IN6A 1GVNB 1E9CA 2J87A 2QY9A 4G5SA 3JVVA 2P2LA 2EVWX 4QBIA 2G9NA 4CT5A 5HR5A 4OHYA 2C99A 5EXTA 3NIBA 4EPTA 1OIXA 1F3OA 4GZMA 4ZDKA 2QAGA 2NZ8A 1KSJA 3T1VA 1NF3A 4PPNA 4NBSA 2H92A 3HU2A 3U6KA 1KY2A 2O0HA 4QJ5A 1S9HA 3FKSD 4YMWA 3DHWC 3Q5DA 3EIEA 3PEWA 3RRZA 3BERA 4F4IA 4AYXA 1YRBA 3GPLA 2QORA 4YMVA 1FNMA 3DOEA 4JLPA 1ZRHA 4FIDA 3KKNA 4UXIA 1F48A 2Z4RA 4HAYA 4DKXA 1M6NA 3AF3A 3QBTA 5FH9A 4DJTA 1GRQA 3GLHE 1RJ9A 3I8XA 4IJMA 4L8GA 2O8CA 2D2FA 1VMAA 5IT5A 5GVRA 3V4RA 1IXSB 4B73A 2XB2A 1N6RA 1TMKA 1MOZA 2PLRA 3P1JA 1MRNA 3NHBA 1W7AA 1AS3A 2ANCA 3HPQA 1R7RA 3AF4A 3SFVA 4LJ4A 4BLSA 3KQNA 3QF4B 3EZ7A 3KKMA 4A36A 3LFUA 3QXJA 2ATXA 4RKFA 4NCHA 3JZAA 4M21A 2XGJA 4JLAA 2IYWA 3EPKA 4CVNA 1WRBA 3MRSA 1ZM2A 3CRRA 4Q9JA 4EFNA 3TW8B 1U81A 4O3MA 1R0WA 3NBFA 4UNNA 4GOXA 5J47A 1U98A 1TAGA 4HLUC 3PFIA 1IJFA 1XTKA 4OHZA 1Z83A 3LH5A 1FQKA 3CLVA 1Q44A 4W5HA 3H84A 2ZTSA 5LB2A 1NLYA 4LRWA 2E1RA 5FTLA 4MYHA 1KDRA 4PSAA 4B2IA 4DIDA 1OXTA 2YWHA 3ASYA 4TMKA 1T91A 1T5IA 1TQ4A 5ANRB 3W6OA 2IS2A 5DI9A 2JEOA 5K8UA 4EFMA 1KI3A 2C2HA 4BLOA 1AGPA 1VCNA 2VIIA 2GXUA 4AY2A 2LKCA 4C0QC 3TKLA 1FOEB 3FWYA 1OH5A 1KI9A 5F9FA 2QGNA 2XJ4A 4D82A 2EFDB 3UMSA 5LDDC 3A4LA 4Q9IA 1WA5A 4I81A 3REFA 3SN6A 1S96A 1XXHB 2ZUCA 3U6BA 1UBFA 2ZE5A 4PQFA 3L8ZA 1IONA 5BYJA 4B35A 1E6CA 1OIWA 2UVQA 1TUEA 4LJ8A 3X2SA 5DH9A 4D6PA 2GEDA 3PEVA 5LBIA 1CJKC 3GEEA 1M8PA 2P6UA 1S0UA 4RFSB 1YVDA 2VF7A 2IW3A 1OXUA 3KKPA 4Z1MD 1YU9A 1FTSA 5CLQA 1CRPA 3SDZA 5AUNB 1YZTA 1MH1A 2I3BA 4Q21A 1Q3HA 5DN6A 3FMFA 3QF4A 4XOIA 5CITA 3NBXX 2Z0MA 3DOFA 2O0JA 3GLGB 2ZM5A 1G19A 2BKEA 1SHKA 3PCRB 3ZIAD 4F4JA 3OIWA 1D2EA 1XJ0A 2J0VA 3SS8A 3SOPA 4DSNA 4ZKEA 3TMKA 1XZPA 2GKSA 2WMNB 2ZU0C 5CIWA 5DYIA 5E95A 1UEJA 1DO0A 4Q19A 1YZQA 2DR3A 3B8HA 3UMRA 1GRRA 1QHGA 2HCJB 1U9IC 3NWJA 4JYCA 2I1VB 4QG7A 4QJ3A 4QNRA 5CIQA 4HLQB 4ZPXA 2CMKA 3LD9A 3WP0A 1S8FA 1KI2A 1U0LA 4G5OA 2YOHA 1TL7C 4A2QA 5FI1B 3C4JA 2REXB 1E0JA 3GJ8A 2QE7D 3MAAC 1VKJA 2IXGA 3D31A 1XX6A 1GOTA 2JASA 2FSFA 2PEYA 1OW3B 1CR2A 4PO9A 2N42A 2J9RA 4LK2A 3NC1C 5SZJA 3B78A 1Z0KA 4B3BA 1FZQA 3QXHA 1KGDA 4TLDA 3PIRA 1TF7A 1IBRA 4G01B 1XXHA 4JLBA 2BC9A 3RYTC 3TSWA 1XPUA 2IYTA 3ADCA 2OO7A 3FMOB 4TZ6A 2RGCA 2ZRMA 1N6IA 1G8FA 4B3GA 2JLVA 2RGBA 4DLSA 2WWFA 3SYNA 2F55A 3TVDA 3CRVA 4AI6A 3UG7A 1Z6AA 4RFSA 4OK5A 1P2UA 1BMFA 4M1SA 1X3SA 3F5FA 5AJVB 3V9PA 2EFHB 4A0GA 2R2AA 1YZNA 4NP6A 1VYVA 4JL6A 1ONBA 1HV8A 3G0HA 4HLUA 5BWMA 4LHZA 2HYDA 3X1ZA 2VPPA 4FI3C 3GLGA 3T5GA 4ON9A 3TW4A 1NJGA 1MO5A 5A4JA 2GVDC 2FJUA 3B13B 1YZUA 4V0LA 3E1SA 3R7WB 3LXXA 3VKHA 1EK0A 1KY3A 2AFIE 4B43A 3RRMA 4QXAA 4PSVA 2IEZA 3R9XA 1W2HA 2ZSEA 3KQKA 1AS2A 2CK3D 5JSZB 3KJIA 3RSOA 1LB1B 3CKLA 1G5PA 4C7OB 3CWQA 521PA 4LUCA 1KMHB 1U8ZA 2BJVA 1TU3A 4LBZA 4RVCA 3HJNA 4XWKA 3SQXA 2IT1A 2KI5A 1ZM3A 1QHHB 2Q0HA 2F3RA 4TQAA 1IN4A 1GKIA 2CJWB 4PPFA 3B2EA 4IXNA 3X1WA 3REGA 1KI7A 5A5GA 4JVLA 3ZH9B 4B2LA 1S3SA 3ZS9A 1Z6GA 1E4YA 3QENA 3G82C 3TE6A 5CJPA 3LLUA 2ORVA 3VKWA 1HT1E 1OYYA 1VTKA 4B3FX 1DAFA 3AVPA 4H1VA 1NI3A 2ZYVX 4PO8A 1GL7A 2YVUA 4QHSA 5FR2A 3ZGXA 2PL3A 1T0JB 4B3CA 5HE8A 1KNXA 1R2QA 4PC3A 3RSLA 2FGKA 4RKEA 3EA5A 3T34A 2AWOA 3GFTA 3B5JA 5CB6A 1JBKA 3IBGA 1HE8B 4IFEA 4TLBA 4AKEA 3I8SA 2QU8A 4D26A 3J81k 4NCIA 4Q7JB 4L4UA 1FTNA 4MDEA 1DELA 3AKYA 2LKDA 4JKIA 4QGGA 5EE5B 4RZ3A 3DKPA 1W46A 2XX3A 4Z8XA 1NRJB 4D4MA 5FUXA 4B32A 3HYTA 1XMIA 1U9IA 4GP6A 1CBUA 2JJ8A 2ZJOA 3LX8A 2BHRA 4Q5IA 5FOSA 4EFLA 3N70A 2JLSA 3A4NA 5UKDA 5L3QB 4NYMR 3R7WA 1T8UA 1H8HD 3FKSA 1E2GA 3IKJA 1DAKA 4LBVA 2W2VA 3B1XA 4QOSA 1GDDA 2WKQA 4OK3A 4C0KA 3OESA 4D25A 1B0UA 5CM8B 2GRJA 2NGRA 4BWYA 2WWHA 3H1TA 5KSOA 5JSZA 4HAVA 4R9UC 4OI0A 4C7OA 3N2EA 2NO7A 1KMHA 5EXSA 1CP2A 1YE8A 1XPRA 1TU4A 2HT1A 5J40A 2VSOA 2JIZA 2AFHE 1IY2A 1QHHA 4B34A 2R6DA 5JEEA 3KQUA 3CF2A 4I1OA 1Y3AA 4LBWA 3BS4A 2CJWA 4MYCA 4UXHA 721PA 3ZVMA 2GHIA 1GUAA 2GJKA 3QG5A 1BYUA 1A4RA 1FMLA 2Z83A 5EUMA 4E03A 2DPXA 1A2BA 1MO4A 1OSNA 1QBKC 3TJZA 4YC7A 2FPLA 3LVQE 3VR5A 3GEIA 3CX8A 3VR4A 3W3ZB 5IF9A 1G5TA 4GI7A 5FTKA 1XMSA 4LDJA 1RPZA 2KSQA 2OAQ1 1AGRA 4DLZA 1T8TA 3RWOA 3CRW1 2FE4A 1EGAA 1E69A 4FCTA 2DFNA 4BLTA 3WNBA 3PXGA 3N2IA 2L0XA 3RANA 4WZ6A 3EPJA 121PA 1VHTA 1SKYB 1KAOA 3BFVA 4K46A 2OT3B 4CEHB 2QM7A 2AD5A 2ORIA 2OZEA 2YJTD 3I32A 4U7DA 1DG3A 3AH8A 2OESA 4EQ6B 2A3RA 5AJWA 2Y8EA 3QNUA 1OKKD 2GAOA 2GVZC 4MITA 1LS1A 2V9PA 1G18A 4M4SA 3MFYA 4R2IA 4M0LA 1Z07A 2V3CC 2BM0A 5L3QA 4KLNA 3QBVA 1Q1ZA 4M9XA 5FR1A 1GNQA 3RDPA 4RD1A 3RABA 5KNDA 2EYQA 1N6NA 2Q9AA 2OFWA 4DLXA 2ZJBA 4KFRA 4TQ9A 4DC9A 4GMXA 2W6ID 1WDTA 2RGAA 4MUAA 1KJWA 4YDHB 1JQLB 3OFND 4KU4A 4TT3D 2J7PD 2FPKA 3ZS8A 1GILA 5TARA 1X8KA 1U2RA 2GWHA 3RNLA 5GJVC 4QJ4A 1F2UB 4IOKA 4EKDA 1KNQA 5C2JB 1OH6A 1NP6A 1OXXK 4M1KA 5DHAA 1TQ2A 2C78A 3IQWA 4HUQA 2A78A 4MRSA 4JVSB 2WPDD 1W4BA 4G0NA 1XD2B 1GKUB 2MSEB 4JLNA 4OI1A 5JI3E 1MR3F 4NCJA 5EP2A 3EARA 2WAYA 3ZIAA 4DCVA 5JRJA 1N5KA 3Q7QA 3CRMA 2Z6VA 4JBXA 5JHHB 3VNUA 1G17A 2IS4A 4ASUD 2ECKA 4BLRA 4FMCF 4QL3A 2D7DA 1KIMA 3LNCA 3IBYA 4W7SA 2IYSA 1VHLA 3K8YA 4LJAA 4Q03A 5G3YA 2FSGA 4WBSA 1TX4B 2A7QA 5FPHA 2WJJA 5FOXA 5JMTA 4DZZA 2C96A 1R5BA 4PZYA 2WWIA 4CEHA 2A5GA 1EX6A 4PTLA 1SXJE 2ZAOA 4MUBA 4PPQA 3RAPR 4A2WA 1JAIA 4EQ6A 1CJMA 2QE7A 2IHBA 2DWOA 2RH5A 5E4FA 2R6FA 4CEJA 1ZNXA 3U3MA 2BBOA 3Q8XB 5IHPA 3HWSA 3U60B 1R6BX 1S1CA 3DMNA 5TDHA 3MWKA 4L16A 2YKGA 1XNJA 4CEIA 1AKEA 4BFZA 2FPMA 4M1YA 4QRHA 4CRWB 2GDJA 1B23P 3EIHA 4JLDA 2BBSA 5AR1A 1X1SA 2KJQA 1NMXA 1TADA 1G64A 1G6OA 2WVJA 3LO5A 1XPOA 1BS1A 1EESA 4NYJQ 1OYWA 2FGJA 1XD9A 2W83A 5JWRA 4A4DA 3CR7A 2P0EA 2IYLD 2ORWA 3TNFA 5JI2E 2ZJ8A 1ZM7A 4KO8A 4BFUA 2DFKB 4DSOA 4PX9A 1GL9B 3EA0A 4URYR 3G5UA 3IGFA 2HF9A 4KV9A 1F2UA 1N5IA 5J4HA 3R8FA 4NMMA 4RCZA 4N1AA 2YYZA 5BN3A 3DVLA 3LQRA 3THWA 3K53A 2DY1A 3W90A 2IS1A 1IJEA 2FZLA 3B7GA 1N0WA 2V4ZA 4C2TA 4N0EA 2VF8A 4TLCA 4YMUA 1M1YE 4NKRA 3H4MA 4WXRA 4AIIA 1XD2A 4JLKA 1DPFA 1NN1A 4BGDA 1X1RA 2RHDA 2DWQA 2Q9BA 2OAP1 1IN8A 1J70A 4KLZA 1WQ1R 2QL6A 3LQQA 2ERYA 2G88A 2QAGC 4BRUA 4C0JA 4M22A 2IS6A 3BIFA 3DKVA 3CIOA 3HU1A 4LGMA 3LDAA 4PXAA 5FL3A 4DVGA 1W47A 4TL7A 1I2DA 1W0KD 5AJXA 3C8UA 5TVKA 3AVYA 4CGZA 2CK3A 3SBEA 2C95A 2FN4A 2ZSBA 3A37A 3NKVA 1K5DA 1QZXA 3QY0A 3QPUA 1X86B 1AN0A 2KWIA 2OILA 2EQBA 2JDID 2RHMA 3IIKA 4ZI2A 1WBBA 3D6TB 1NIPA 1NKSA 4EPRA 4LJ5A 4C3ZA 1IXRC 3M1IA 2H8KA 4ACBA 4OQFA 3DMDA 4PC7A 1NY5A 1RVDA 4Q66C 3PUVA 3OEEA 4FCWA 4EPYA 3X1DA 4NPHA 1E94E 2IYVA 2FZ4A 2GF0A 2WMOB 4DLVA 2O8EB 1J7KA 5L3RA 3SJZA 4DLTA 1LNZA 2O52A 1EWRA 1K6MA 3AF2A 1BMFD 3W3AA 4XD7D 4NE2A 4Q00A 1G7SA 2R6AA 1E2NA 4RD0A 1GZSA 2IYXA 1XWIA 3TIFA 4B75A 1R0ZA 4JLVA 1W5TA 3RC3A 3UXMA 4XWOA 1Q0UA 1ZNZA 4ZIRB 2YINC 3HYRA 3BD9A 3W8RA 4TTPA 2PJZA 5EE9A 4J0QA 2ZYWX 3BB3A 2C9CA 4DB4A 3VMFA 5TMPA 5J4YA 3A1WA 2WV9A 1DAIA 1FQJA 2WSMA 1SVKA 1LS6A 1U8YA 3OIVA 1GG2A 3F8TA 2QBYB 3B9QA 3TQFA 4RD2A 1I4LD 3B85A 1EX7A 3KUDA 2C77A 4IDQA 3WMGA 4A9AA 1CKEA 4Y0VA 1H8HA 2ZSDA 3AEZA 3D7MA 5FOTA 4R2HA 1DAEA 4OBEA 4ZKDA 4QC2A 1QF9A 3PENA 3C5HA 4MRVA 3OAAD 5CJ2A 3BC1A 3C7KA 1AS0A 1XTSA 1VG8A 1OB2A 1W4AA 5E3HA 4HAWA 4MDFA 3W8NA 1J90A 1RE0A 4II7A 2ZRHA 4MKIA 5JBQA 1UBGA 5C18A 4TYYA 1XEFA 2C04A 4B71A 1E9DA 3DZDA 4L9WA 3RS2A 1G21E 3SJCA 2ZU6A 5H1YA 2O8EA 5JEDA 2GZAA 4HB2A 1AZTA 4M1OA 4GFDA 1XJQA 3AUYA 5FPTA 4GSYA 4RZ2A 4OL0A 2ZREA 2QEQA 3VX4A 1RZ3A 2VRWA 5EXPA 4G3XA 1XTIA 3FKQA 2VP2A 4LBYA 1RKBA 1WMSA 4Q1BA 5EUQB 4ZIRA 3S1AB 2ZR9A 1D6JA 1HYQA 4A0HA 2F43B 2RAPA 4PFSA 4ARZB 1AZSC 3QG1A 4V0OA 3O8RA 3K9NA 2H16A 3NXSA 1ZUNB 3FDIA 4BLPA 1CIPA 1OKKA 4A0FA 1J2JA 3IUYA 1KHTA 4D4JA 3IHWA 5KU1A 2QBYA 1EWQA 4XTRA 1U90A 2WTUA 2HXSA 1EFRD 1OIVA 5EP3A 2EFEB 1ANKA 1HEIA 2NO9A 4AD8A 5KOYA 1AKYA 5SZKB 3EPHA 1N6PA 3CPHA 1G7CA 2V7QD 3KXKA 1JXMA 1C1YA 2W6IA 1WCV1 2GXSA 3I4LA 3PR1A 1MO6A 3LBHA 3OFNA 1OF1A 3RRNA 4TT3A 2J7PA 2JIZD 3WYFA 5K8IA 1XEWY 1XXHE 1RYHA 5GVSA 1NMYA 1ELOA 2IEYA 4HEJA 2CHVA 2QT0A 5L3VA 2Z5FA 4RD4A 4DDTA 1XRJA 4PHFA 1P2SA 1VG0B 3P4YA 3K70C 1UBCA 3TR5A 3OEHD 5JFGA 1Z63A 3KKOA 4JBYA 2ZE7A 1UM8A 4LPKA 3NH6A 4JYBA 2WPDA 4JL8A 3FGNA 1L8QA 2CDNA 1F2TB 1VYUA 1DAHA 2RGNC 2WJIA 2WHXA 2V54A 2ASEA 1WBDA 3FB4A 2C5LA 4ZDWA 2DYKA 3SU8A 4ASUA 2OFOA 5AWFC 4IVQA 4KI0A 1FL9A 1QG4A 4BLQA 3EX7C 1GTVA 2V6IA 5H8WA 2P6NA 3GLGE 2D3WA 3HR8A 2OM2A 4NTZA 4A6XA 4LCBA 5HE9A 3VX3A 4QM6A 2NOAA 1E3MA 3RHFA 2IUSA 3RS3A 3X1YA 2XTNA 3AB3A 3S1AA 1G8GA 5ELXA 4ARZA 2F43A 2B7BA 1N2CE 4AKHA 2ZRDA 4LC1A 4O25A 3O8CA 1N25A 4QHYA 4MKGA 2RMKA 4FN5A 2HYIC 1PLJA 3GJ0A 1XB2A 4DHEA 2H1LA 2ZS7A 1TNDA 1GNPA 4JKYA 4G1UC 2RCNA 3NEJA 4ZI3A 3IHLA 5EE1A 4OYHA 1EXMA 4PC1A 1ZU5A 2X2FA 2XXAB 1KK0A 2PCLA 1F6BA 3ZVLA 1Z3IX 1XTQA 1MV5A 3WY9A 5FOUA 5FOVA 1FUKA 4HB4A 4Q4HB 2LCFA 4DLRA 1TF2A 3CM0A 1T5LA 1IXZA 4M8NE 2XTZA 4X8LA 3K70B 3PITA 1G1MA 5EE3A 4EUNA 5CLLA 3B1WA 1V5WA 4ABYA 3GLIB 4A8JA 3CONA 4Q01A 2ZRJA 3MJRA 3GJXC 3KXLA 2ZRPA 3BH7A 4RFVA 4HUTA 4W9MC 4RD6A 3CNLA 4BFWA 4DEXA 4ZCMA 1HUQA 2IA5A 2ODBA 3EC2A 5AUPB 2OFXA 3FPAA 2ODWA 1KDTA 5DO9A 4HAZA 3ASZA 1LV7A 1F2TA 4MYTA 3KUCA 4URZR 5JRZA 1L4UA 4Z8YA 1HY3A 2QENA 5DIFA 3AF0A 1G3MA 2FX3A 4LZZA 3AVUA 1A82A 4JJKA 1I4DD 4BFTA 4KFTA 2OXCA 1P9NA 3I73A 3QOFA 1NLZA 4I4LA 3FFBA 1ZNYA 2P6RA 2GA8A 2HV8A 2GILA 3ZLJA 2W6JA 4K81B 4WIAA 2NO1A 1W0KA 2BCGY 5K8LA 4OI2A 5KPJA 1NN3A 1D9ZA 3SJBA 4MGKR 5KPDA 3MUFA 1A5TA 4S35A 2JDIA 2GCOB 4RJLA 5DYGA 2G83A 5AUOB 4LHXA 1G291 4FMDB 5FBLB 1NMZA 1IHUA 2AK3A 3KTAA 4KVGA 3OIYA 4IVPA 2I1QA 3TH5A 1N0VC 4GOKA 1ZD9A 1FX0B 1WXQA 2ZITA 4AG5A 1D8TA 1E2PA 3CW2A 3MGCA 2J0QA 1K5GA 4Q4LA 3A4MA 4NYMQ 4Q4AB 2O8BB 2CLSA 4A1FA 3VR6A 2XXAA 3LBNA 3RS4A 3UANA 2ZR7A 4URUR 1N6KA 3NBZC 4Q4HA 3B1ZA 4GNKA 1N0UA 1FFHA 4X8HA 4XD7A 4O2RA 2GCPA 1IY1A 3V00A 4YONB 1OLOA 3QVVA 1PV4A 3R20A 4B2PA 2GZDA 1XCGB 2ZJ5A 3QSYA 1E0KA 2JJ1D 4D0LB 3AF1A 2IL1A 3BAFA 2WJVA 3O8BA 2YOGA 3GLIA 4D4LA 5KNCA 2RGNA 4P4SB 3TUJC 2ZIAA 4PQRA 3A58B 1LW7A 4OJQA 3I61A 4FD2A 5JJIA 2JLYA 4JSYA 3LBIA 4OI4A 3K0EA 4I1SA 2WIAA 2ERXA 3K9LA 1WE2A 4TL8A 1DS6A 4JJZA 4Z54A 2XZLA 4HSEA 3FHCB 3GQBA 3MG9A 4UNQA 2R6CA 3ETLA 5LPNA 1XMJA 4OQLA 1YKSA 2CVFA 4Z51A 5GADl 3I5YA 2JLZA 1AM4D 4PAMA 2AHOA 3L0SA 2ZJZA 2BMDA 3OHMA 2HDNB 4M1WA 4AWXA 4UNRA 3EW9A 4KAXA 4URXR 4JLOA 5SZHB 4ZCIA 1AQUA 2B7CA 3GJ7A 3OAAA 4S2EA 2V1UA 2ZE8A 3GJ4A 1OB5A 4MGYR 5E7MA 2HXYA 2QP9X 1CJUC 4NCNA 4NH0A 1JEDA 4L15A 2GCOA 5GJBA 5IDVA 3MCAA 3UIEA 3IILA 2AL7A 1N5JA 1CU1A 4XTCS 2IX3A 1KAGA 4NYIR 4V03A 3OEED 4NONA 5HCIA 1T9HA 5A0FA 4DWJA 3U7EB 1CR0A 3SNHA 2D06A 1W36D 3CX6A 1FX0A 2J46A 1YQTA 4PHHA 3KB1A 4GRAA 4HATA 1GKYA 5G40A 4B44A 1KYIA 4Q4AA 3L0PA 2O8BA 4JT2A 5JCZA 3SJAA 2O8DB 5KHOC 3NDBB 1QHIA 5JWOA 1SQ5A 1X8JA 4KITB 4U02A 4KSBA 3B6EA 4GBMA 4OKSA 1BKDR 1T3LA 1IN7A 2FA9A 2PBRA 4PHGA 3ZQ6A 2JCSA 2WIBA 1H8ED 1ESNA 2WSSD 3NVAA 1ZJ6A 3UWOA 1MKYA 3U44B 4P4SA 1TEVA 1Q22A 4EPVA 2R44A 4A92A 5FTJA 1JQJC 2R9VA 1E0SA 3DL0A 2MSDB 1UBEA 3DM5A 1NKTA 1GWNA 2YOFA 4Q9LA 4XVQA 2PMDA 2C8VA 1SKYE 2UZIR 4US0R 4Q1DA 1D5CA 1U0HC 2WWXA 3SYKA 4MRPA 5JHGB 1EFRA 3TLXA 2V8OA 1N6LA 1NY6A 3D8BA 2JJ2D 5J5CA 2DFLA 2XITA 3AP1A 3CB4A 4OQMA 5TV2A 2V7QA 4EJSC 2AK2A 3KL4A 1T6NA 5L3SB 2W2XA 3T06B 1IOZA 3C14C 5B58C 2PX3A 2A5DA 2FFHA 2F6RA 4HDQB 1KZ7B 3T1OA 3KQHA 3CWZA 4PPGA 2ZXUA 2IF0A 4RZUA 2BBTA 2GETA 4XVUA 4TMVA 1DTSA 4ITRC 1FP7A 4HUQB 1ODFA 1P3JA 2B21A 1I4TD 1XP8A 1LY1A 2A9KA 1PJRA 3U3OA 3OEHA 4Q7MB 4MQBA 5EP1A 1IN5A 2O8DA 3QPWA 4C9BA 1JR3D 1VYTA 4F4CA 3A1VA 4LV5B 2GNOA 3MSXA 4IEIA 4MYUA 8OHMA 3AKDA 3TAUA 1OFUX 2EU8A 2VL7A 2G1JA 4U5XA 4C0SA 4DDVA 3HP1A 3P26A 3FYHA 4EPXA 2VYFA 4KSCA 3ICQB 1KDPA 5HZKA 3U3JA 5D3MA 3U44A 3SFZA 3T15A 3WNDA 3VKGA 1CS4C 2JA1A 4P3YA 1G3QA 1GFIA 4Q1FA 4R7ZA 3MD0A 4C0HA 1JAHA 2H18A 4CW7A 4DIEA 1PUJA 1W44A 2QUZA 4CEJB 1PVOA 4EAQA 2YWFA 2XB4A 3QXCA 2ZI9A 4HLCA 2FDCA 1NVVR 1N6HA 2PMKA 1M7BA 5E7JA 4HYYA 2FFAA 2H7VA 2ZRGA 2FSHA 3E70C 4BFYA 2YV5A 2IYZA 2ZJ2A 4DCUA 2XNDD 3CRQA 3FE2A 2D4HA 4EJSB 2F1IA 1ZU4A 2Z43A 4PSKA 4E09A 2X77A 4ZDJA 3A36A 4YMTA 3CNOA 4IOLA 4N3NA 2X19A 4GDFA 2UKDA 1W36C 2DFTA 4EPWA 4HAXA 4XIGS 1RFLA 5L3SA 4BPBA 1Z0IA 3LRPA 4B76A 3THXA 3IO3A 1M7HA 1E9FA 3THWB 3I3SR 3K0SA 1NG9A 3QKRB 2A2ZA 4Q7LA 4YLGA 3SQWA 1P9RA 3GMTA 4B33A 2ZJYA 4GT1A 5FPSA 1KSFX 3I5XA 3QF7A 3Q72A 3AP2A 2ZE6A 3HDTA 2VHCA 1ZUHA 1XTRA 3LX5A 3W5IA 2AWNA 2CVHA 1L7VC 4DLUA 4AC9A 3A8TA 4EDHA 4LV8B 4DCSA 4WXPA 1OPXA 2JLRA 2ZAMA 3DO6A 2ZYUX 2KE5A 4QM7A 1E96A 1P73A 2OCAA 4E07A 3IO5A 3QKTA 4JMPA 2IYRA 5H70A 2BEKA 4QBHA 5AK0A 3L43A 2QTHA 4KBFA 3RRYA 1KI4A
chains in the Genus database with same CATH superfamily
4TTVA 1YSCA 2Y0PA 1ULTA 2EW2A 3AI1A 1VL8A 3O94A 1S2IA 1C7QA 1VKZA 4NX2A 1SRRA 3ADKA 3VZDA 3DE7X 2O57A 4ZAWA 5THQA 3UMFA 1JU3A 2WF6A 4PCLA 2R6GA 1IIBA 3IAEA 1XA0A 1Q5PA 2F7SA 3OWOA 2XVXA 4M7RA 4RLHA 4RZSA 1C4XA 4WSOA 5FOWA 3COWA 3FOWA 4Y2TA 2MR5A 4M54A 4DQVA 1IPHA 5ECYA 2CJXA 4IUCS 1B2RA 1UDCA 2HF7A 3L1KA 3ZD9A 4CKWB 4MAAA 3WRXC 4JEIA 3OPYA 1O7JA 3ZG6A 2BP7B 1QHYA 3LXMA 4PC6A 4MHSA 4PZ0A 4BJ1A 3H87A 3I83A 2G6BA 3WISA 4LHYA 3DZGA 4WKBA 5FLYA 4CV2A 4A0QA 3TI9A 2VJKA 4HDRB 1B1CA 1NBMA 4UAGA 3TDNA 1J6UA 5JAMA 2C54A 1LC3A 1L5OA 3DDHA 5JSZB 3RS0A 1AXGA 3CUKA 3DL2A 3KZOA 1AVTA 3IUPA 4MP3A 1YQUA 1V5IA 2JGDA 3O1JC 3C2QA 1N7JA 1X87A 3MIIA 2FPOA 3UH1A 3TRHA 2I1LA 1XVIA 3EZ9A 2O0KA 4MS4B 4JI1B 3PL1A 4EL5A 3H5AA 4QNNA 3L0ZA 1B76A 1XRLA 2HPVA 1GLGA 3LT4A 1VIVA 3D3KA 2AHRA 2JJMA 2J3JA 1E9SA 2Y2UA 4L2IB 3ZHYA 1TGVA 4M49A 5HUHA 3DMYA 4Y2PA 1T6YA 2NYAA 5AJZA 4KWHA 4ZVNA 1IY9A 2IHKA 3E61A 3NORA 3RUHA 4TTIA 2EKQA 3EGWA 4LYFA 4BHTA 3AR4A 4KBGA 3GA0A 3E3LA 3HS3A 1DO2A 5J4LA 4UVGA 2GYUA 1PYGA 3FXAA 3MK31 1EZ4A 3IXLA 4ZC1A 1XI2A 2LGJA 5EUBA 5A05A 3S3TA 3X0DA 4W8HA 3IESA 2IXFA 4NZMA 1Q92A 1SK8A 5LCXA 1L7EA 5DWDA 2QZ9A 3TS1A 1I9GA 3PCXA 2BJWA 2HA6A 2AEFA 2YBDA 4LYHA 1NUPA 3AKEA 3EGOA 4KJZA 1UDWA 2JLUA 5GZ1A 3F67A 5IRCD 1ZMOA 4W5QA 1Y3DE 5IDWA 3ZDBA 4FBMA 3BMNA 4LCEA 4HDNB 4TQUS 2PYDA 3ANYB 3ZZMA 4YCNA 1GQRA 2QMEA 3AJDA 3OX4A 2HRZA 4JBGA 1OV6A 1R8XA 3KDAA 4KODA 4RGVA 1S3GA 1X42A 3PDIB 3HCNA 2ZRCA 1I1OA 3F3YA 2P9QA 1FDUA 3H86A 4I50B 1VIAA 4N7BA 4BAGA 1ZQ9A 1VDZA 1I6KA 4KKVA 5AI6A 1SZCA 3BBLA 1GTL1 4MUHA 1UJCA 3B6MA 4AG6A 4WLVA 1ZPDA 5A2GA 1CIJA 1QORA 1RD4A 5CB4F 1TJPB 1ZMBA 4FWIB 4UNSA 4A6DA 1I0IA 1RBMA 1D2RA 3L1HA 3MS7A 3UMMA 3JQPA 4PYQA 5F98A 3DV9A 3Q41A 1JA1A 2W0MA 4GWKA 4I9FA 3I3OA 3THOA 4U7FA 4BNDA 5EJEA 2Y4NA 4AJKA 3GF4A 2G4CA 3PT5A 3I9FA 3RUAA 3LXUX 4J4TA 4KMRA 3WTCA 1INLA 1US8A 3MWFA 1EVYA 3K70D 1XWFA 3PVZA 1XPJA 3EQ9A 3T3PB 1J8MF 3K30A 3GJ3A 3SQDA 7ABPA 1L9KA 1HH4A 1TYZA 3ZXXA 1XKQA 3ZHSA 1R4AA 2QI9C 4UHCA 3AQ4A 4M53A 4Q4JA 2B92A 1ZEJA 3DEFA 4UTVA 4MKHA 2G76A 5EP4A 2QR2A 3W9SA 1RJDA 1TQHA 2Q6KA 3BWXA 1PEYA 1HYEA 3MQ2A 3B5IA 3RCBA 2P8JA 1W52X 1YJQA 2QIPA 1P1FA 1R5NA 3BCUA 1JEQA 3AUXA 3QNWA 1NQXA 3M49A 4NJMA 2VP0A 1FSPA 1VMKA 1C3EA 1KARA 3JWHA 5K8CA 1UXIA 4N9WA 3X1MA 5CLFA 9MHTA 3QLUC 1C4KA 3U1VA 5EKUA 3ZWNA 1MTZA 1R6DA 5K0CA 3WBFA 4AYWA 1QIHA 1OBFO 3EF0A 4MVJM 4AAYA 1G2PA 3NALA 4Z0NA 4CMHA 5BSFA 2LR0A 2TMKA 3G68A 3RK1A 5LQCA 1YAJA 1YGYA 2WMDA 3M4JA 1T4MA 3OWHA 4RNDB 1NVMB 1TC2A 2FZCA 2BFDB 2Y1OA 4CG0A 3CH4B 1D2AA 3DW3X 1Y3FE 1UT5A 2FG6C 3G2NA 2C98A 3HSSA 5I7OA 1KWKA 4M0CA 2C7OA 1CS0B 1AUXA 1E2EA 3ZGLA 4EEXA 3FCYA 3K31A 2ZRBA 1IPFA 3JQEA 2ZYDA 4OLJA 4XX0B 2PT7A 3VPXA 4A91A 1NNUA 3KFXA 2HBRA 3RC9A 4DNFA 1NWCA 1YIAA 4HI0E 4MWSA 4TZKA 3WP1B 3B1JA 3WRYC 3LDGA 4RZXA 3ER8A 4B3DA 3CBQA 3WGZA 3EUFA 4Z9XA 4AKIA 3I05A 1Y5IA 1P6XA 1P0IA 1RQXA 2BR5A 2O2DA 1OWMA 2GSDA 2QXYA 1BHO1 4MVJH 2OUIA 1TW2A 1R4ZA 2N1BA 2RB4A 4F9EA 4WBNA 1XLVA 2O6HA 1RKXA 1J0DA 2EC5A 2PPVA 3HPRA 2EJUA 1MXFA 1OYVA 3ILYA 4Q9DA 4XQ9A 4A8JC 4LWPA 3AVOA 4G2NA 4YCMA 2ZRNA 2LPMA 3DP9A 1PE0A 2J85A 1B0ZA 4IDAA 5TB5A 1G5RA 2P27A 4H6VA 5LLTA 2R8YA 2I55A 3C8HA 1TJNA 4UM9D 1ZQ1A 3ZCVA 2CUKA 4NABA 3FNRA 2E85A 3BJIC 3LC7O 4JP3A 1RYFA 5FPYA 4EO4A 4YT4A 1KBQA 4I5FA 1WXIA 2VDRB 2KPOA 3T9BA 2F64A 2ZYHA 4G4SO 2NVWA 4K9DA 5CVVA 3BMOB 3DT8A 4Q18A 4TLLB 3Q1LA 1T5HX 1N9GA 3FVWA 3KZKA 2OB1A 5AKKA 1OWOA 1PQWA 1JV2B 2APJA 3U4QB 4B6EA 5K6AC 2YZ2A 3S55A 5LM3A 4KNYA 3TLZA 3DFUA 3OE7D 3DXYA 2PZEA 4LVUA 4AZ0B 1GDHA 2C4MA 2FW9A 4ZQGA 1QGAA 4CHGA 4YXWD 3U7HB 1SCAA 4BQRA 4KHZA 1XU7A 3BF8A 3EXIB 3IRVA 1T1JA 3L8CA 4RM3A 2Q4RA 3WHPA 1SG6A 3T12A 1WXGA 4HX2A 1NQOA 2JATA 2ZRFA 4L5BA 1AIPA 1AGYA 2MYPA 1GYRA 1F8FA 1GRNA 2XUIA 4GI1A 3RODA 5LMCA 1FLNA 1VJ0A 2D8MA 3HWRA 3L4BC 3QBDA 2ZQ5A 3VDMA 2HXGA 4P7KA 2VVTA 1JILA 3C4QA 3BJEA 2FLVA 4X6LA 3GJYA 1PZXA 3DSRA 3IJPA 4EYOA 2D0PB 2UZAA 3CY6A 4S1NA 4DBLE 3SVLA 4ARIA 1YR6A 3DV0B 1M2GA 3GCDA 3HDQA 4TZTA 2PLWA 5EJAA 3A2LA 1LSUA 1U8TA 2VJLA 4V1CI 1QO0D 2Q27A 3G6WA 1RACA 3C7TA 3WOVA 1X7ZB 2X0FA 2P9BA 1G2OA 1ABBA 2P9JA 2WZQA 1XT6A 1P44A 2XUAA 5JNWA 3DWEX 4FGJA 3TUIC 1II0A 4PYJA 1MPTA 4JXXA 1JG6A 2H29A 3AY7A 3NDPA 2C83A 4JI0B 3PQEA 2HIHA 3QA9A 4PVCA 2NO5A 4XJXA 1I51A 1RXVA 1N3BA 2Q3EA 2Z98A 2NQTA 4KRYA 5EKSA 1PZFA 2BHSA 2C5BA 1GL3A 1EWYA 2JF0A 2PNFA 2UZ0A 4XR4A 2D1TA 2ZI5A 2EIXA 3GRPA 3LUFA 2IU3A 4CMIA 4Z4FA 1IXYA 3DDZX 1FY2A 3UV7A 4MIKA 4O2AB 2VTBB 1IEVA 4KYIB 3KXPA 3HACA 4MPDA 5EUCA 2ZTUA 3KZMA 3O0TA 1WOYA 3QXXA 4MMYB 1QRRA 4H27A 3A6HA 1SVMA 5E8JA 3W8FA 3KELA 3EZ2A 1JLMA 4J9UE 4C0LA 2OV4A 3I1FA 4MRRA 1T4CB 5IM4F 2X0IA 1WPRA 2DOKA 3ZDRA 4ZCPA 2HQ1A 1PL0A 3WQRA 1MFPA 1UODA 3BGWA 9ATCA 3PVSA 3GDWA 5B2ZA 4CMGA 2BR4A 1NUTA 1VG9B 3UCFA 2FK7A 3VPDA 4BC1A 2O5EA 1E3EA 1KK1A 3OIGA 1WX1A 2H7CA 3DXXA 1LTKA 1M8FA 2VFAA 2BTQA 4IGKA 2H2WA 5M29A 2BEJA 4LFBB 1S89A 2QDXA 2WVAA 3N7TA 2O4CA 1UIMA 3Q85A 3L9WA 3LLSA 3OA0A 2HK9A 2QPAA 3MCWA 3ETDA 2OHJA 3ONVA 1Q7EA 3K0CA 4J49A 4RUKA 4B4DA 1MEJA 1DEKA 1LDNA 1P7YA 1Z47A 2X2EA 2FY8A 4QUKA 4RQTA 1D4FA 1ESZA 3EOBI 2EEPA 3EH2A 3AR2A 3R24A 4EYQA 4DM3A 1MV8A 2C2GA 3WL8A 5JVDA 3WLLA 1TZJA 4IMPA 4EUKA 2B8JA 1WULS 4JEHA 1LWNA 5BR1A 1HWYA 4H0FA 4JLPA 4V2IA 3M89A 1I6MA 4C22A 1P5JA 1YOBA 1XTJA 3ZGVA 4PGGA 1WSBA 1LTHR 4HBGA 4B6FA 2XOKA 2F4VB 5KTSA 4KO3S 5EXEA 3KJZA 1Y3BE 2GN4A 3TZCA 1AK2A 3UT5A 3A4IA 5C8YB 2QMYA 1ZMRA 3KB8A 3BH6A 3OX3A 1TEXA 1E64A 2C0QA 4OTZA 3WBJA 5FTNA 2I9KA 5JS6A 3I76A 4NL4H 4I4NA 5B1HA 4MTCA 2OORC 4GZLA 3ZDZB 1EG7A 1QYRA 1KF0A 3EVCA 5HFNA 3EPPA 4DE5A 1PR6A 2OGSA 3VDQA 1K4YA 1G6KA 2IFTA 3O4FA 2XRFA 4GWLA 3BTVA 4RABA 1FP6A 1VM6A 2W4QA 3K9GA 5HVNA 1AKQA 1SHLA 2VSFA 1IWPB 2QQGA 3ME5A 4LJ9A 2WY2D 1D8AA 1AQ6A 4TRRA 3EDRA 4RK5A 3HABA 2OQRA 2B8TA 1QK3A 5F76A 3ZWBA 1Z35A 4NCKA 4M1MA 3LA6A 1L6RA 5HIIA 2TRSB 3CUTA 2W6QA 1DXYA 3G5LA 3WR5A 4M6WB 5KTMA 1CF4A 1KSHA 5C9ZA 5JSKA 1HR0B 1XWWA 3E1GA 2AJDA 3HGMA 4TTTS 4CCWA 2B4AA 2GM5A 2XIQA 4ZJPA 1CERA 1MX3A 2VRCD 3QKSA 2VTDA 2B36A 4P3PA 4FFLA 5IVHA 4TLAA 1QE3A 1RWKA 2Q4DA 1PUIA 2H57A 2HMUA 3H13A 3I6IA 2QVGA 4LY3A 3ZY4A 4R2KA 3AGPA 2FR8C 5A5FA 4ITVA 4E4TA 1UBRS 4RKRA 1E92A 5F51A 1UDXA 3TR0A 2PEZA 4P1ZA 3PUZA 3PQ8A 4FW9A 2IEIA 2ZWIA 2WYVA 4P5EA 4FXPA 1F8UA 2D54A 3EWSA 1ADYA 1R0CA 3H5LA 2CLHB 1HFKA 5JYEA 5B57C 3EQ2A 3AHEA 1E9AA 2ZS8A 3W0LB 1E2HA 2CV1A 1KMIY 4UBJA 1DNPA 1MH9A 3GLHA 2VZ8A 5EQTA 5BN5B 2B2NA 3PG5A 3RVBA 4G6ZA 1CNFA 1I3CA 1B00A 1ZAKA 2KX7A 1M10A 4MB6A 4C7KA 1ECJA 1QIGA 1COWD 4JJ8A 5FLXA 3DMHA 5CK4A 3MZ0A 1A8HA 1ULAA 2CNWD 3VR3A 4QATA 4WE3A 4WJKB 2XCIA 3ZX4A 1ATZA 5FBRB 4G9EA 5D84A 3A2MA 4WCFC 1U99A 5IPFA 3L8DA 2VN8A 4FT4A 4TYQA 4AUNA 1U7UA 1JJIA 1E5QA 1NP7A 1SZPA 1NQUA 4LMPA 3VZRA 5FA5A 2VBCA 1Z6TA 2PY6A 2VQFB 3HBNA 3RLFA 3GDFA 3BB4A 4LSWA 4EI2A 1K7CA 1EZZA 3UPDA 4PC2A 5D8DA 4TL9A 1E1RD 2WV7A 1O9HA 3DFIA 3JYNA 3AM1A 1CUSA 2GFIA 3QFFA 1PW7A 2C2MA 2WJHA 3NHAA 3PC2A 3ZWPA 2C4WA 2QSJA 3K2BA 3HUFA 1LPSA 1RSZA 1OAOA 2PU7A 3V4LA 4DFDA 1NR1A 2HRQA 3FNGA 4RVFA 5F1OA 5F78A 5MFZA 1SPBS 2L17A 2W6PA 1W4ZA 4TV8A 5FLEX 1PQPA 4NFYA 2DBRA 1JSRA 1SKMA 5LB4A 3NHKA 4YTEA 3U3KA 4KPEC 1TT5B 1NT2A 4CCAA 5DM4A 1YQ9A 1NE7A 3DPIA 2JFBA 3VNVA 4RK1A 1ZM4A 2X8JB 3RAFC 2PZFA 3AX6A 4IMRA 2P9ZA 5FUWA 2B8NA 1ZRSA 3BGVA 2H8GA 3ETGA 4PLFA 2IYAA 4X3CA 2QX6A 1TIBA 1NVVQ 1ZSYA 2D1FA 3ZWXA 3TEFA 2XR1A 2D1YA 4OXRA 4R41A 5KNLA 4XJTA 3T5MA 5AOBA 4TUYF 2WJZB 3NC0C 3TN7A 4AMYA 3O84A 3Q5GA 4IRMA 4EG8A 4IW3B 3GROA 4UEQA 3KD2A 1CK4A 4W9NC 4D8WA 3WAGA 1QF7A 1Q1EA 2B1IA 2JCYA 4RMNA 5EJIA 3FPEA 4DCTA 4E5NA 4ROTA 3SVTA 4OFWA 1ECBA 5I7SA 1IK4A 5TQJA 1XHLA 3RSGA 3H42B 1VXOA 1M34E 1OTYA 2X9NA 3U7GA 1N4DA 5KTPA 2JI4A 1MP0A 1IDOA 1CUGA 3ESQA 3MS2A 4R9SA 5D3MB 3SU8A 4XASA 3PGXA 3SOZA 1N92A 3BH0A 3N2KA 1PL6A 1EPUA 2W4MA 2H9AA 2F67A 3IPXA 4FFPA 5E2AA 4B1FA 4LPSA 4L8WB 1YD7A 1DC4A 3P4UA 1NL3A 3H2HA 3VHQA 5C51B 5IBCA 3WS7A 4IH1A 1HPLA 1VLMA 3E9ZA 3H6GA 3T3HA 4ZI7A 5C4GB 3TPZA 4NS4A 1R10A 2F8MA 2JGJA 2VQSA 1I2MA 5BYAA 1OLUA 3P94A 1E2LA 1UK7A 4GMDA 4DMRA 1RYNA 4C30A 4MW6A 3HVIA 5HFJA 2C8JA 2ONYA 2XD9A 2ZM6B 4L0QA 4Z7JA 3T35A 1PT5A 5A2QA 1VB5A 5IVKA 3PQ5A 5ICMA 3ZOKA 3A9WA 3E9CA 1O8CA 4UU8A 1U2GA 3I09A 2H7YA 2IUTA 2XLCA 4KYUA 1CJTC 2PZ8A 1S9DA 4LZAA 3IRUA 4GF5A 4MH0R 4IV0A 5I8ZA 1PT6A 5JAQA 4B81A 4ER5A 5IF3A 5AVOA 2NNLD 1X74A 1QK4A 3ESYA 3JPYA 1R5OA 4N5NA 4MKRA 5EG5A 4CM5A 4UDXX 1P9LA 1Y8RA 3EZ6A 2WAMA 3P19A 3QVMA 4YVFA 1LJLA 3RLIA 2X22A 3O03A 3O2JA 4CI9A 4ZT5A 1NBME 5J2UF 1ZRNA 2INGX 1WG8A 1DT5A 2X9VA 4M8SA 4OHFA 3ZVNA 2A7XA 1E1DA 3QEJA 2N0SA 4MEAA 1IK6A 5B1DA 1DZIA 3S2IA 1AZWA 4GC5A 3JV7A 3BK7A 5K0GA 2PHZA 4M0KA 5K6TA 3HCFA 3T8YA 4BFVA 1KFBB 4Y9RA 4UTPA 1PDWA 4ZV4A 4WKNA 3R3XA 2JFVA 4W5JA 2R6R1 3GC6A 4N54A 3BF7A 4UZSA 3BKWA 3CZ4A 1X7XB 3EIUA 3OBIA 4L75A 3W1VA 2ZJ0A 4AB1A 5JECA 1D4AA 1QOQB 2XAUA 3SSOA 1MAUA 5JH7B 2B78A 2ANBA 3L8FA 3FUXA 4L9SA 5ABPA 3KKQA 1ZGGA 2CJFA 2WM2A 4GX5A 2F1HA 1AKUA 4UMEA 3IEKA 3IR7A 3OKFA 4A0RA 5C46F 3PKZA 2VTKA 2WYHA 3FGPA 2FOXA 5TQ2A 1MGOA 4M7PA 1LPNA 2GK4A 4IIBA 1YUBA 4QXPA 4NU0A 2JANA 4ZV9A 2PX0A 1S7CA 3R9WA 1TYBE 1WSWA 2ZS9A 3O73A 4FD3A 1WUIS 2PMWB 4BDTA 3PGKA 3E05A 2JB9A 4QXMA 4B3SB 1GAEO 2P2GA 2CXHA 2RBEA 2VWHA 3IURA 2IV7A 4E30A 3WYAA 4BO0A 3IB3A 1UOQA 3LCMA 5KX5B 5BNIA 2QROA 1JTVA 2I67A 1DLIA 3Q2OA 1IY8A 1TVMA 2BDTA 1KZ1A 1LF5A 4WFKA 5LU8A 3DD5A 2G0TA 1LC0A 4PV7A 1SULA 2AOVA 1OZGA 3RTAA 3NQ41 1KOGA 2AKEA 3PU6A 4G65A 3P9PA 5A0VA 2NW6A 4FMCB 4NZZA 4TSRA 1N78A 1RRGA 3DEAA 4I0WB 5CDGA 2JGDB 6ADHA 1P5ZB 3ANLA 2I29A 1MX1A 3HVRA 4BVBA 1WXDA 5AM5A 1NUQA 2FSIA 2P9FA 3QSGA 4I99A 1DX6A 5I47A 3VHLB 1C0IA 4WMLA 3JQ7B 4G07A 2Z4SA 2FH5B 3HR7A 3DKIA 1OFGA 3KP1A 1OX6A 1OT5A 4RY2A 2WHPB 1FVOA 1DDGA 1KH2A 1RM3A 4Y1FA 5FI0B 3ZDQA 1TVCA 2FR1A 1GNRA 3WHLA 1IH8A 1OXKB 1VPDA 1Y9EA 4JC5A 1YZGA 4NBWA 2NZ2A 2WKSA 4U3JA 3MHPA 4LZPA 5JWHA 4XAQA 3IPCA 3IULA 5D5HA 4FR0A 3VTZA 1MC8A 3E5RA 1WDKA 2OAGA 2XVYA 1V6SA 4OHCA 1J99A 4BDSA 4EA7A 2VT7A 4Z1MA 4OSOA 3UJBA 3VH2A 3DZKA 5DI3B 4IXWA 5AXBA 4MQ5A 3FGZA 2H5EA 1KE2A 1UC8A 4B6PA 2Y1GA 1TC1A 1A1SA 1WHSA 1DUVG 3S7TA 3ZZ0A 4DR5B 1ZCAA 3H2BA 4R0VA 1PT8A 4XQ0A 4Z7QB 3SCZA 3TLBA 5CFQA 2CLDX 3DWFA 4CF7A 1S8NA 1NC1A 4LGVA 4G8BA 5E4TA 1AF4A 1PFYA 4Q47A 4YJ2A 2ECPA 1BH2A 2EATA 3RIEA 4WA7A 4CF3A 4Z4IA 1OV4A 3W5HA 4ZO8A 1NYQA 4LOKA 1WW2A 5LN1A 4LQLA 4PLPA 4EMUA 3GPBA 1V3UA 1XZHA 2ZKLA 2HZ7A 2OLKA 3WWPA 3GWGA 1GHTA 1QHFA 4PZEA 1FW6A 1TF5A 2JIPA 3SXUA 5DX1A 1H9BA 3T3MB 1BDMA 4GVLA 1XMXA 4MKFA 4RTLA 3H1GA 2PRZA 3BL5A 1Z8HA 4P92A 4KPUA 1W0JD 1E6LA 4GVPA 2V7TA 4Q12A 3RYFA 1CY7A 4MUNA 1P4SA 2CLCX 1AUOA 2C3MA 2IDJA 2J3IA 4HEHA 5JD4A 1P1KA 2BY4A 2OE2A 4TXMA 1Y6FA 4XGKA 3EASA 2B69A 4RJ2A 1R0KA 1P3Y1 1XD8A 4UVIA 4C4AA 3QWFA 4ARBA 2JPDA 2PANA 4J0DA 4MV3A 1XUOA 3QRWA 1EVIA 1PNQA 3CVVA 4PWZA 4KRGA 4F11A 1DINA 4WFJA 3K09C 4DB2A 2AFHA 3I6BA 4OXQA 1K92A 5DBEX 1AQYA 3NP7A 1I0LA 3SIWA 4B7AA 3OZUA 1ZZGA 2ZR8A 3ET4A 4DIUA 4FHGA 4O29A 1NXOA 2O1SA 3RKRA 4BX8A 1V4NA 3BMQA 4DTIA 3GLFE 1QB7A 5HMLA 3EH1A 1RZUA 2OXFA 2ZIFA 5CA0B 4H3SA 1XJCA 3HMQA 3J7AC 5TPWA 2OCKA 4NU5A 4PWYA 3O4HA 1SA0B 3Q40A 1ODLA 3NTUA 4WCDA 4CKCB 3VYWA 4R8RA 2BHNA 5DBOA 5CB4B 4DV1B 2B30A 1UMCB 1WCYA 4IHJF 3A9CA 3FZYA 4I2VA 3UKDA 3CVOA 4TWBA 3P52A 3FDFA 1QH9A 2BBWA 2PT6A 3GCGA 3GPDG 2P8SA 1NYLA 2FSVA 1P0FA 1A97A 2GI4A 2I4IA 4XOUA 3S4YA 2A0KA 1JLRA 3USES 1SXJB 1AXRA 1XLWA 1U2DA 2ZG6A 2CBXA 2J41A 3KZCA 4G86A 1QYVA 1FDRA 1Z4OA 3G88A 4UZEA 4ZA2A 3D3JA 4H3VA 1JG1A 3U4CA 3IALA 2B4QA 2OB2A 1NULA 2K2QB 2PXCA 5DHPA 3QU2A 5KC8A 1ZI6A 1M74A 1UFOA 1NSFA 3DBHA 3ROXA 1RYEA 4IOMA 2Z2XA 1KAEA 2XDAA 2R4TA 1JEEA 2Y92A 4R83A 2Q3FA 2Z5GA 4MW9A 5HJEA 5ITVA 4E4YA 3O8NA 5H02A 2CUZA 3EXHA 2WJ3A 1YVUA 3AF5A 2WJGA 3D4OA 1CB7A 3NDJA 1C0EA 3ZVLA 3F1LA 4DUGA 1M1ZA 3ZE2B 3IQIX 3O75A 2P4HX 2XSZA 4GW3A 5F52A 2GJ8A 4P4UA 1IB0A 2ROQA 4XD2A 2HCBA 2X76A 2IHUA 1Q1QA 4CQMA 4CTKA 3U19A 3GLFB 4CU2A 4NHEA 4HNVA 1GN9A 4D42A 3ZJVA 3HNOA 3HCRA 4LI0A 1QRUA 1L4EA 5JY6A 5I01A 2B94A 2GO7A 2BGLA 4PLYA 2J3LA 4BNVA 2WHQA 1MJ5A 1CQPA 3MWLA 5D3QA 5EMKA 3SYLA 3ZDXB 1QS0A 2VP3A 4LFCB 3AHFA 2DKOA 10MHA 3I53A 2YFQA 1FA9A 2ZANA 4AK9A 2O14A 1JKXA 1XROA 4JBHA 1S6YA 1Y5RA 1E66A 3E03A 4HXYA 5EWMB 1L7AA 3GV0A 2PO5A 5K0NA 5TF4A 3T9FA 5BW5A 1QMPA 1T2EA 3P27A 3MBIA 4DMMA 4YV2A 4G4IA 2FUG6 2QPTA 5BYKA 3QUCA 2IUFA 4ZAXA 5BSTA 2IOHA 3CC8A 3ELBA 3HZRA 1AD2A 1C7JA 5SZIA 4EA8A 2FFJA 5ALKA 1IZYA 3TRJA 4ALLA 3ZDDA 1XMVA 1QB8A 1SVWA 4TMWA 2QAGB 4KTTE 5LC1A 3ONWA 3TZKA 4TKMA 5ARBA 5ITSA 4CI0B 1FPMA 821PA 2IP2A 5BQ5A 2RGGA 4R1NA 2A35A 3MWYW 2FEOA 4QHTA 5T5QA 2Z6UA 3CX7A 1ZKDA 2YXDA 5GINE 4EZBA 2HU8A 3T7JA 1H66A 5EHNA 3RS8A 1I8TA 1GTZA 1Y8QA 1FS4A 1N77A 4Z3OA 2LE0A 1WZIA 1W59A 2OQ2A 4W5NA 2YQ5A 4OJTA 5CGQB 5CNMA 1C4WA 4RETA 1CWUA 2FRVA 2OZLB 3HXKA 3PRKE 4TXHA 3DNFA 1M5RA 2JVJA 4X44A 2OP1A 4C0BA 3KJFA 5AHOA 2D62A 3TNYA 3A6ZA 4QBGB 1RJ9B 3QXSA 3PDUA 5JBIA 3NNDA 2JLWA 2IEGA 2WRZA 1TM7E 4Y2JA 1XN4A 1T1GA 1B74A 4JP1A 1AX9A 4XIYA 4UU1A 2GJSA 3N76A 1GZ4A 1TCAA 2P9CA 1YV9A 2PLFA 2QL7A 1SKQA 4WINA 1N2SA 5LMUB 3STXA 1G8MA 4J43A 4MA0A 4G63A 3JYHA 3OZXA 4BRWA 4ZO4A 1EFCA 1ZINA 2ZYTX 1EQUA 1ZL0A 3AUAA 4YS6A 2VF2A 3UJ9A 1OXVA 1O6GA 2JLXA 2DX7A 1APBA 1J07A 3X43A 4C0AC 4ZICA 1NXSA 1BEZA 3OF3A 1WEHA 2BCJQ 3W5BA 3KAPA 1QDEA 5LBTA 5F3WB 4CM7A 2HBQA 2UXCB 1K88A 4PZUA 3HRIA 1KEPA 3MAJA 5BW8A 4MR7A 1KO5A 3CSDA 5EMNA 1BWRA 4AZVA 3DNMA 4URVR 2HK6A 1IN6A 4C6HA 1QP4A 2Q1WA 4H35A 3K32A 2J87A 1GEGA 4WXHA 4XLTA 3RIXA 2HPAA 2KQUA 2YZ7A 3P0FA 4R7TA 4JNKA 2G9NA 1UBUS 1GGHA 3M9XA 3PPVA 5CNIA 3IHTA 1QRTA 4S24A 4DG8A 2RK4A 4OHYA 2C4VA 4U8HA 1BNCA 4Q93A 5IWCA 2C7BA 2MTBA 2O0MA 4GZMA 3ROMA 3C8DA 2C5FA 3WIEA 2VJMA 2VBIA 5A3VA 3T1VA 1NF3A 1SD2A 2BFAA 2H92A 2O0HA 4NLLA 1N2ZA 1PR2A 1RAGA 2Q62A 4YO7A 1QR6A 3CMMA 1NMEA 3AY3A 1C9EA 3CLTC 3DHWC 3ZD8A 1WUYA 2HLNA 1IHDA 3EIEA 3Q5DA 3DHYA 3RRZA 2ZOSA 4AYXA 2QI9F 2PIAA 3RSCA 5CT8A 2XOXA 2F17A 3RVLA 4HDSA 4UXIA 1SCJA 4LI3X 3BD8A 1ODSA 1B3RA 1RRKA 4L4YA 4Q24A 5D1HA 5ECGC 3KIPA 4DKXA 5J58A 2PFKA 1SCUA 3QBTA 1F0YA 3EYAA 4EFDA 4IBOA 3Q12A 3GLHE 5LL6P 4L50A 1NR7A 2G28A 1VMAA 1LQTA 1TYAE 5GVRA 3VH3A 4L78A 4WK2B 4KIJA 4P8RA 4LOLA 4LIPD 2XB2A 4RHYA 1KPGA 1N6RA 3MJFA 3P1JA 5DSXA 2GLTA 1W7AA 1YBFA 5E6SB 1R7RA 5F7XA 2IVZA 3EDOA 3ICCA 1WXHA 3STTA 2GPWA 3LFUA 1UXGA 3A7EA 4NDAA 4RACA 3I9NA 4C5AA 4RKFA 2QSUA 1DCKA 5FO0A 1WHTA 2IYWA 3MRSA 5HJ2A 1ZM2A 2I34A 1LBSA 3CRRA 3OTWA 4UUPA 1R0WA 2A9OA 3Q4GA 2DUMA 3W5DA 4GOXA 3RRBA 1Y4ZA 3Q3VA 5EXDA 4LF8B 4XQEA 3CSUA 4GQIA 4HLUC 2A33A 4RV9A 5IKOA 1F38A 3P2YA 5FWYA 4MIYA 4A1OA 1NDHA 4PXYA 1EXVA 1HZZA 1ONPA 2QJWA 3KETA 1Q44A 1OA1A 4G8JA 3H84A 4W5HA 2ZTSA 1NLYA 3T7SA 1GPLA 1N5MA 2HM7A 3KWFA 3MELA 4B2IA 1K9SA 3N8HA 4L4SA 3H9UA 5C31A 5EGSA 1KY5A 3UUWA 1C9NA 4GR4A 4EHLA 1T91A 1TQ4A 4JI3B 3TLJA 1X1CA 1L4HA 3GEMA 3TDKA 3MRXA 5HQ3A 4FS8A 4NMLA 3NNNA 5EMHA 3WK5A 2W8BB 3WI7A 4P3XA 3JPWA 1BU8A 3TTUA 2R6HA 4C0QC 1RQLA 4GXQA 1OH5A 3TOZA 4O4IF 2RG7A 5F9FA 1D2CA 2XJ4A 3H99A 4QE3A 2QRGA 3UMSA 3VI3B 4D82A 3VJMA 4MHTA 1T9AA 1P4HA 3A4LA 4MEJA 2X6TA 4X1KB 3ULKA 4CR8A 4I81A 3CJTA 4EF6A 1FFCA 1S96A 3FPLA 2XMSA 5JT1A 4B2YA 4JI2B 2AZ4A 1KJNA 3L7YA 3U6BA 1C8LA 1FVFA 2QRMA 4HKTA 4P2BA 3VHRA 1JHVA 2B4RO 2UVQA 2NNWB 1TUEA 1T8RA 4UBIA 2CXQA 4GYKA 5DH9A 3UWDA 2GEDA 2OBFA 3HUTA 5LBIA 1NJSA 2HADA 5K6RA 4L4RA 1K0FA 1S0UA 2G63A 1A96A 5TEVA 1H2YA 1YVDA 2Q0QA 3JQAD 4J03A 4OUKX 2H1SA 1OXUA 3KKPA 3OX2A 1A0OA 1YU9A 3DHEA 3WO1A 4YAUA 5HRAA 4KW7A 4E5DA 1CRPA 1BE8A 1YZTA 2AOUB 4EZEA 4Q21A 5LXTB 3IB6A 2DGDA 4P82A 1YTUA 2WU1A 1F0KA 4XOIA 2VDQB 1ULUA 1RWQA 4Y1EA 3GLGB 4LMAA 4DCJA 1NDQA 3KSZO 2ZM5A 3PCRB 3TW8A 4N0MA 3RUPA 5L53A 4MS1B 4J3FA 3OIWA 3ONDA 1XJ0A 2J0VA 1Y4UA 2AJ8A 3DT6A 1AHNA 2WMNB 2ZU0C 5E95A 5KJ1A 5JADA 4UNIA 2XUGA 3U81A 3IDSA 3UMRA 2HCJB 4XUEA 4PY2A 3GLUA 4LJSA 4QG7A 4QNRA 3SXJA 4H7DA 2EZ8A 3HADA 1O94A 3O4RA 4Q3KA 5CIQA 3R9XB 5BV7A 2BJHA 2Z09A 1S8FA 1KI2A 1U0LA 2YOHA 1QIEA 2Q7DA 1WU7A 4A2QA 4LXGA 4KLRA 4GOLD 1YR1A 4OKSA 3DMGA 4HBZA 4QAQA 3S70A 1W88B 4AJNA 2RHWA 1XX6A 4IR7A 4UHDA 4U7WA 5DBIA 1KH3A 1CUHA 4Z9FA 1QKJA 2N42A 1V25A 3IDZA 3QU4A 5JMWA 3NC1C 3WSWA 2W11A 1Z7BA 5DVZA 4TM7A 1MLDA 1ULBA 3PIRA 2ZJ4A 1SQGA 1F20A 3A6FA 5J23A 1UZLA 1GVHA 2OHXA 4JLBA 4YT8A 2BC9A 7REQA 4GLOA 4RAQA 2VK8A 4JBNA 1Z73A 2DH6A 1WSAA 2QW0X 1DKLA 1A2OA 1WUTA 2OO7A 3GXOA 3PC3A 5JSHA 5JXIA 3GG2A 4MWDA 1SOVA 5CCBA 2VPWA 3PGLA 4DLSA 4PO3X 3A28A 2YS6A 3RVSA 5KREA 5GWXA 1WS6A 2Z2YA 3WK7A 2V8BA 3KG2A 2A1TS 4FZRA 4KWCA 2AN5A 4M1SA 2PDAA 4PM4A 5CP8A 3V9PA 1FNCA 2X5KO 2JAHA 5G1PA 3SR4A 3PC6A 4FFBB 4XRRA 4NP6A 3L5KA 2GRAA 5EIBD 3HCPA 1NM5A 3UAVA 4JL6A 1TVKB 5LZ7A 3O8OA 2FPIA 4NWIA 4ZMSA 4D8YA 3IEMA 1YBAA 3RBZA 3OCUA 5HRCA 5GIOE 4XIFA 1KGSA 4JSRA 1T8SA 1Z12A 1MNQA 3V8EA 5KYUB 2HTEA 4CTJA 2Y1CA 2PUBA 4H0CA 2IELA 3IT0A 3TW4A 1NJGA 5L9AA 1MO5A 2C3PA 3S2GA 1YUNA 2FJUA 4OAQA 3STYA 1B8VA 4V0LA 3MBOA 1XG5A 1F06A 1E3WA 2QN9A 3R7WB 1M2JA 3EBOA 3LXXA 1Y8RB 3PD0A 3UK7A 1NF9A 1VKHA 5LWQA 4QXAA 1GN8A 3OUUA 3DEJA 2GHQA 5ERGB 1EZ1A 3OJOA 4EF4A 2WZDA 2AA3A 2CK3D 4U2FA 4K86A 1X1AA 2DBQA 2XYRA 1Y9JA 4JYMA 3KEMA 3KJIA 4MUJA 3RSOA 5HKBA 3CKLA 4OXIA 4C7OB 521PA 1KMHB 2F3UA 3R7SA 4B7ZA 4RVCA 4YREA 5C5EA 4R1OA 3IAM6 3HJNA 2AVNA 4PE5B 4XWKA 3AZQA 1M75A 1I1NA 1HXHA 3SQXA 2GZ1A 1QHHB 5FUQA 2F3RA 2XMGA 3A32A 1GKIA 3TXXA 3V80A 3IA7A 1QTRA 4PPFA 3GEGA 4MWEA 4PYOA 4IXNA 1GPYA 1KI7A 3Q9UA 4UFPA 3KJNA 3DFMA 4BCDA 3ABQB 3D6AA 5CA1A 5HHTA 4CDRA 5FIUA 1W94A 1LA2A 4NK4A 4O4LF 4IIFA 3VKWA 3ANSA 4R1PA 3MGBA 2ZYIA 3QLJA 4KOAA 4RK7A 3OE5A 4W6ZA 1UWVA 2ZYVX 1FXSA 4H1VA 1GL7A 4QHSA 3SF0A 3TJMA 4AZ0A 5KJ6A 2YCLA 3MUNA 2O0LA 3QPVA 1R2QA 3RSLA 3T34A 3L1VA 3GFTA 3B5JA 2VDVE 3C6QA 4FYKA 4IFEA 2XQIA 5IBPA 5J1TB 2OFFA 1VGQA 4D26A 5CFRA 4KBYA 3E82A 4G1CA 2OZPA 2ZUFA 1XTUA 1G9SA 4G0YA