4EFMA

Crystal structure of h-ras g12v in complex with gppnhp (state 1)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Crystal structures of the state 1 conformations of the GTP-bound H-Ras protein and its oncogenic G12V and Q61L mutants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4efmA00
5KUTA 4TZ0A 1TUIA 1XB2A 1QHHA 2VRWA 5FOWA 4UNRA 2WWHA 5KU1A 1GKIA 3A36A 3PFIA 1Z6TA 3KQNA 1TTTA 1V43A 3L8ZA 3EXAA 3JZMA 1X6VA 2W58A 2YKGA 1W36D 4IDPA 3T15A 3NWJA 1YZQA 2IXEA 1M8PA 1KI6B 1KJWA 1XFAA 2AKAB 2B8WA 4BZQA 2HJGA 5FL7A 4B75A 4EPVA 1ZU5A 2J87A 2C03A 1ZNWA 4OQFA 3ICEA 1BMFA 1ODFA 4MKGA 1YZNA 1EESA 3H2YA 2VHCA 3FWYA 1AZTA 2YNMA 3CPEA 2AXNA 3LV8A 4V0NA 3ADKA 5EUQB 4B3FX 3QKSA 5KSZA 2ZJBA 3QXHA 2QMHA 4H9GA 3OFNA 2WVJA 2AN9A 4Q4AA 3RS7A 1C1YA 4URXR 3B9PA 2XSZA 4Z51A 3KTAA 2IEYA 3I1FA 4HB4A 4UQOA 1ANKA 5JJKA 1XTRA 5CYOA 4FINA 2F1HA 3SHWA 4C4PA 3B6EA 4IDNA 2FJUA 3NBFA 3UMRA 5KHOC 2O8DB 3H1TA 4URWR 1YJ5A 4JJZA 2QRZA 2ZETA 4Q4HA 4TMTA 5E4FA 4LUCA 2VP5A 5JHHB 2OEPA 4JBYA 2GJSA 3C8UA 4CW7A 4QJ5A 1OXUA 2VHJA 2FEMA 5GADl 2PCJA 2ZSDA 1Z0DA 4IOLA 3Q9LA 1S3SA 4LV5B 1E9FA 2KB0A 1W2HA 3HP1A 1T0JB 1P75A 2DWOA 1II9A 1E2PA 3OAAD 3IIMA 1XF9A 2WAYA 4NU0A 3VX3A 1UADA 2BDTA 1Q3TA 2C9CA 3G0HA 3LX5A 4ZDWA 3UPUA 4AYTA 2RB4A 1CR0A 3CF0A 2ZM5A 2QTVB 1NLYA 3B1XA 3DZ8A 5LB2A 3UMFA 4CEJA 2IA5A 1DE0A 3PJRA 4TQ9A 3RS4A 2ZJ5A 4GOXA 4A15A 5DYIA 1F2UB 3LNCA 5J4LA 2O8EB 2F7SA 1KI6A 1W46A 1E1RD 5EE5B 4ESHA 2VP0A 5DYGA 3IHLA 5E7MA 2P0EA 5EXTA 3UKDA 4Q00A 1HY3A 4JLAA 2FEOA 3TGPA 5HE9A 5UKDA 1AGPA 1PZNA 1X8KA 5EP4A 4NH0A 4PSAA 4Z1MA 1UM8A 3HPQA 4MITA 4BPBA 3RC3A 2W83A 3WYAA 2IYUA 2ZJAA 1Z47A 4DLUA 4D4JA 1D2EA 3PEYA 3TIFA 2J7KA 4LV8B 5SZHB 4PQYA 3T5GA 5HKKA 3LLUA 1GRNA 1U9IA 1NY6A 2F55A 5JJLA 4R2HA 2NTYC 4PTLA 5AUPB 1GFIA 2O8DA 1L4YA 4B34A 4G5QA 2ASEA 4DDUA 2EFGA 4WIAA 4TQAA 2K5UA 2JATA 4DDTA 1AJEA 1XTIA 4TTRA 1JJVA 1G3UA 1ESMA 4O2RA 2VSOA 3CONA 2IYVA 1Z07A 1WXQA 3SC3A 1G4UR 3KFXA 6Q21A 2RCNA 1E2EA 1VIAA 2OZEA 4R98A 2FG5A 2ZI4A 4QFMA 1G41A 2QT1A 1TF7A 3MWYW 5EE1A 3GLIE 5B2ZA 3ETLA 1SVWA 2Q6TA 5JFGA 2Z6VA 5AJXA 2BCJQ 1OT3A 4KJZA 3RLFA 3BIFA 3Q7QA 3CF6R 2IWRA 3P26A 4ZDIA 5CK4A 5LDDC 3T1TA 1Z6XA 3PQCA 1YU9A 1P2UA 5HE8A 5DISB 4X8HA 5A4JA 4NCIA 4E07A 1E0JA 3F5FA 2ZS8A 3Q5DA 4M1MA 4RFSB 2ZYTX 1A4RA 2IUSA 4B3DA 2O8EA 1KO7A 4CZ2A 2NG1A 1GRRA 2OESA 3CO5A 4MA4A 3SJCA 2ZROA 3P27A 2ZI3A 4RJLA 1DARA 5K8IA 3GLFB 1NJFA 3ZZTA 1G6OA 1QZXA 1XMSA 4KV9A 1Z22A 2RGGA 1P9NA 2ZE7A 2R6GA 2BM0A 1T8TA 4XJXA 4ARZB 4DSOA 2CHVA 4OK5A 3ZVRA 2CNWA 3N2EA 2GETA 1Z8FA 2WIBA 4LJ4A 3BFVA 1N2CE 1T9HA 5AUQA 1XCPA 2GESA 4MUAA 4AKHA 4BFUA 4GDFA 1WBDA 4FD2A 5CB6A 1JI0A 3SQWA 2GTPA 1P7CA 1QDEA 3Q85A 4LJYA 4TSFD 5CIWA 1KHTA 2H17A 3GD7A 2JAQA 2D74A 3REGA 5GJVC 4FCWA 4V02A 4M1YA 1XCMA 2W6JA 3K1JA 2IBMA 4FMDB 1U0JA 2QM8A 3L0IB 1GNQA 1KI4A 1AM4D 4LPSA 5J4YA 2DFTA 2O0KA 2FA9A 3FMFA 2FZLA 5EQTA 1E99A 2W2VA 4XWOA 3QKRB 1OFHA 4Q9JA 4W9MC 1WQ1R 2VBCA 2ZSBA 3IBGA 2ORWA 2BC9A 5FTKA 1RRPA 3T34A 4B71A 3GCGA 2RGXA 3WNBA 2BEJA 2PT7A 1HA3A 1XXHE 3GJ4A 4PC2A 4NYMR 1CJKC 5G3ZA 2Q0HA 4I4LA 4DCTA 1A1VA 4RFSA 2J0SA 1R7RA 3JZAA 2H1LA 4B3BA 2MMCA 3GFOA 4TLAA 4YMTA 2AHOA 2NO1A 3QOFA 2VTKA 1OFUX 1D9XA 1GNPA 2W2XA 5FPYA 1JR3A 3MUFA 1N5LA 3B1WA 3HU2A 4RZUA 3GLFA 4GOKA 2D62A 3CZPA 5D3QA 5SZKB 3FOZA 3HYRA 3ZH9B 1LB1B 1LW7A 2Q9CA 1MO4A 2ZANA 3R9XA 4A0RA 1S0UA 3LVRE 4JKYA 4BLTA 4JLNA 4RZXA 4FW9A 2G88A 3VU9B 5BN3A 2KI5A 3OIYA 4ILEA 4ARZA 4B6FA 2ONJA 3LQRA 3ZS8A 1T3LA 2B92A 1ZAKA 4D0LB 2CCKA 2GXAA 4M1WA 2X1VA 2IYZA 4KYUA 1YQTA 3A1TA 1E2MA 1Z0JA 2E87A 1XBTA 5JWRA 1EWQA 2QI9C 4A2QA 5DN6D 3R9WA 2O0HA 5EP2A 3ZDQA 5E7JA 2C9YA 1KI1A 3HWSA 4EIWA 2F1IA 2VSFA 1ZINA 2BJVA 2QROA 2F1RA 1DEKA 1BO6A 1SKQA 2AWOA 1ZNZA 2NZJA 2QAGA 1GWNA 4IEEA 4KHZA 5DI9A 4BFTA 5BXQC 4MDEA 4OI4A 4PHFA 3AVXA 4DLYA 1OFTA 4NP6A 3BH0A 4XH9B 2KJQA 2CCGA 4L5BA 4OBEA 4B2IA 2J5XA 4Q7KA 3RRYA 4B47A 4MH0R 3TLXA 2ZU6A 1N6NA 2HT6A 2JLSA 1FTNA 3K8YA 3QKRA 4V03A 2H57A 2JGNA 3AP1A 2ANCA 1KK1A 3EASA 3EC2A 4D26A 3L8YA 2DFKB 3MWJA 3SYLA 2XNDA 1M6NA 4FCVA 4PO9A 2DY1A 1KK3A 1JNYA 2QAJA 1G6HA 2NOAA 3FB4A 3QJYA 3VR2A 2X19A 1G3MA 2FE4A 3NHAA 4JT2A 3PVSA 2QY9A 2ZSEA 4MKFA 1G291 5DGXA 2R8RA 4DSNA 1CRQA 3UK6A 4K81B 5C4GB 4GI7A 1E2HA 3IIKA 1T3SA 2IYTA 2RAPA 2XXAB 2XGJA 2F6RA 5JSZB 3FVQA 1DG1G 1GL9B 3T1OA 4UNSA 3CIOA 3VU9A 3NKVA 4QHSA 2AFIE 4S2EA 3OE7D 1XMVA 2DB3A 4BLPA 3IKJA 4A2WA 3KUCA 3NDBB 3THYB 2I4IA 4JLBA 5F9FA 2LKCA 4PQRA 1U81A 5EXPA 2VYFA 5GJCA 3R7WB 5FBVB 1W36C 2QRNA 2IT1A 4C9BA 2O8CB 2GK7A 3QXSA 3ZIAD 2J7PA 1G7SA 5IK2A 1W47A 3UWKA 4FMCF 3WYFA 5J4KA 2VL7A 2GZDA 1AGRA 3X1XA 1ZC3A 2ZU0C 1KNQA 4JLPA 1OW3B 4HUQB 3VKHA 2OE2A 3I73A 4TQUS 4GMXA 3I92A 1F6BA 4ASUD 4JL8A 1XD8A 5KYKA 4TMXA 3DEFA 3RC8A 4XSHA 2GVDC 1R0WA 2ZYVX 2FPKA 2RH5A 2OSBA 3FKSA 2ZIAA 1M2OB 4M53A 5G53C 2ZRDA 4DLSA 5DHFA 5DHAA 2YYZA 2OBLA 1P61B 4AIIA 4RCZA 2G6BA 2DFLA 2VF8A 5JHGB 1R4AA 4WVFA 1G1MA 1RRCA 1N5IA 5EXSA 2JLWA 1DAKA 2E1RA 1PLJA 4XVRA 1OH7A 1D8TA 3MWKA 3NDPA 3QXJA 1FMLA 4M1KA 1XJCA 5JEDA 4LC1A 2OO7A 2FDCA 1DAHA 3BGWA 3W6PA 1COWA 3ZJYA 4LPKA 2PEYA 3I4LA 3MFYA 4GZMA 3RRZA 1TEVA 1G3RA 3IUYA 1KNXA 2ERYA 4F7WA 2XXAA 5JSZA 4O0MA 2Q3MA 2BV3A 4QGGA 3ONWA 1HUQA 4ZCMA 3FTQA 3BH6A 1AZSC 3NHBA 4H1UA 2PMKA 4YQFA 1E6CA 1W49A 3EC1A 3CUEF 4I1VA 4POAA 3THYA 3KKOA 5BN4A 3L2OB 4LYJA 4AG5A 1VKJA 3R7WA 1IN4A 5EP3A 2ZRIA 1Q57A 2V1UA 1Z0IA 2QE7A 2O8CA 3K0EA 2VIIA 3U3RA 3HU3A 2F43A 3LBNA 3SEAA 1T5IA 4EJSC 1TL7C 1NKTA 1CS4C 5K8LA 2IYLD 5BW8A 5A5GA 4NCKA 3PCRB 4HUQA 3AM1A 1NI3A 4YXWA 1YR7A 3LO5A 2GXSA 3UG6A 4AI6A 3T12A 5J4HA 5D3MB 3ZYCA 2QPTA 1KJZA 1C9KA 4XVQA 4HAYA 1XP8A 3VHXA 2ZUBA 4A0FA 3AF4A 1ZU4A 1E0SA 1JXMA 2CLSA 1ZYUA 2B8TA 2GAOA 2DWQA 2QTHA 2XZLA 4A8JC 2VP4A 5LB4A 3OIVA 4EPXA 4NMMA 2QU8A 2ZRHA 3UWOA 3JVVA 1BYIA 3WBKA 2HDNB 1LV7A 2ODWA 2IYXA 2C78A 1XTSA 3OIUA 2ZRJA 4UXIA 2ZR9A 4BGDA 2JIZA 4L4UA 5KPJA 1E2KA 3BFKA 4Q9KA 2WWXA 2GEDA 1SXJB 2ZSAA 2UZIR 3GJ5A 1AS0A 3WBJA 2C99A 2R6CA 2Z5FA 3AKYA 4ZCIA 3I3SR 2P67A 4YDHB 4RD4A 3PUYA 4DDVA 2ZXUA 2XOKD 1G18A 2O8FB 2JLZA 2ODNA 2QQ0A 2WMNB 3HJNA 2QMOA 3RRNA 2W2TA 2AD1A 3I8SA 3ZVMA 1D9ZA 3IQXA 3WMFA 3M6AA 1LVGA 4UJ3A 1QF9A 4P4TA 1TADA 1OHHA 2YWEA 1S4QA 4A0GA 4OQXA 1GAJA 1G7RA 4EFNA 1W0JA 2QMUA 1U2RA 2WWWA 2YC2C 1Z83A 4NYJQ 1ZC4A 3K0AB 4HLCA 4F4JA 4FN5A 4R2IA 4TL6A 5CJPA 2VP2A 3GLGE 1K8RA 1HT2E 2HCBA 4PANA 5D3MA 5C4MA 2WOJA 3UATA 1BMFD 2ZRKA 4P31A 2DHRA 3EPKA 2OT3B 1KSFX 3PEWA 4RD0A 3W8NA 3ZVNA 3GLHB 2CE2X 1J8YF 2L0XA 3B9QA 1NVXQ 3ZQJA 2CVFA 2OAQ1 3AGPA 3OFND 5FR2A 2VSXA 4G01B 1ZVQA 2XSZD 3AVWA 1YR6A 3DPUA 2P5SA 2ZPTX 1VG8A 2BJWA 3WY9A 3W90A 3ZLJA 2EQBA 4OQLA 1CR2A 2C77A 1NKSA 1OV4A 3CB4A 3C5CA 4GP7A 4D6PA 3CX6A 4NCNA 3GJ8A 1SKYB 1P73A 1QHHB 3WP1B 3ADCA 5JRJA 3X1YA 2BMJA 2KSQA 3FGNA 1G8GA 2AKYA 4GMDA 4HAUA 4M8NE 2VP9A 4IKEA 4B44A 4BLQA 3NC0C 3L0OA 5AJZA 2ZAOA 5HPYB 1AA9A 5JZVA 2AWNA 5F3WB 5HZKA 2DCUA 1HH4A 1W4CA 1RW4A 2BMEA 1IBRA 4DWJA 3A37A 2GZAA 1MT0A 3AF3A 2O8FA 5AJWA 1YKSA 5FPKA 1IQPA 4MYTA 2VPPA 1RE0A 1NN0A 3QF4B 4MRSA 5A0FA 2PZFA 4AK9A 3VNUA 1GOTA 3C15C 1QHSA 4EFMA 3B8HA 2IS2A 221PA 3BORA 4Z8XA 4BUJA 3LDAA 3T06B 4KYIB 4Q1AA 2RMKA 2MSDB 4DCSA 1KDRA 3MCAA 2GF9A 1HYQA 3CH4B 4HLUC 5JECA 4S35A 2J1LA 3K9NA 4Q1FA 4RKFA 3T61A 2F9MA 4WA7A 1MO6A 3K0AA 4Q9LA 1LS6A 1UDXA 4O3MA 4E09A 3RHFA 1KI7A 4WAUA 3I61A 2ZYWX 4EPYA 3EWAA 2JJ2D 2H5EA 2GK6A 1OLOA 2A7QA 3RS3A 5EZ5A 3L43A 1G5PA 2D3WA 2QPAA 3O8BA 721PA 1IAQA 4DEYA 3GLHA 4L8GA 2GF0A 4LYFA 4URUR 3BE4A 3WHLA 4UJ5A 2JLXA 5EUMA 1KO4A 4BWYA 3DMNA 1K5GA 2GA8A 4V0MA 4ESVA 4MYCA 4ZI3A 4FCTA 3CWQA 5HKKD 3MMPA 4OHXA 4OI1A 3SN6A 2GBLA 2C95A 3QY0A 4RD1A 1L7VC 3AKEA 5GVSA 2Z4SA 2V7QD 5IRCD 2X77A 3SDZA 4DLRA 2GCOA 4CEJB 4U5XA 2R2AA 1RKBA 1OIXA 5FPHA 3MSXA 2WBLC 1JR3E 1DG3A 1KO5A 4U7DA 4PZZA 1KI8A 2XTMA 1CULC 3VR4A 4ZI2A 2FPLA 1RZ3A 1E96A 3GJ3A 1Z6YA 2NMVA 1F48A 3QF4A 2ZREA 4Q4JB 2PBRA 2IWHA 3D7MA 2ZSFA 4BE7B 1NNEA 1XJQA 2RHDA 1NVWQ 2ZRGA 5G40A 4NZYA 4Q5IA 2R62A 2FNAA 4QC2A 2I1VB 3LAWA 5KO2A 2CL0X 2HV8A 3HR7A 1N6KA 5DNYB 3O47A 3BBPA 3CRRA 4R9UC 3CW2A 2GDJA 4BZPA 4FIDA 1Z2CA 4BLSA 2Q3FA 3KKMA 2QSYA 3DVLA 1NG9A 2WHXA 1KY3A 1NN5A 1QVAA 4ABYA 2I1QA 2PEZA 4BFVA 5CDFA 3TKLA 3LVQE 2XZOA 2IYSA 1ZCAA 2G0TA 4HDOB 4E22A 1XWIA 1LTQA 4CYMA 3A4LA 2Z83A 3EG5A 2Z0MA 3OZXA 2H7VA 1E4YA 3K0CA 4E03A 3U7HB 4QRHA 1E9DA 5FPTA 3ND8A 2IC5A 5FOXA 5JEEA 2OM2A 5CLLA 2CNWD 3TMKA 1ZNXA 3CNOA 2V6IA 1I4TD 2CK3A 3NBXX 4TYYA 1JQJC 1XEWY 4C3ZA 4Q7JB 4DLWA 5JI3E 3AQ4A 2FFHA 5JCPA 4N0EA 4HLQB 1H8HD 1FTSA 1NBMA 1Z5ZA 2OUKA 1EK0A 2A9KA 1R5NA 3K09C 1X8LA 3WRYC 1XTKA 1XEWX 3FDIA 1U0HC 5CITA 3ADBA 4ZIRB 1R6BX 1T3HA 1ZM2A 1CJVC 2ZAMA 1KI3A 1UEJA 4Q7LA 1YE8A 2WWFA 1CTQA 821PA 1HQCA 4Q4JA 1Z6GA 1IOZA 5ANRB 1TUEA 3NH9A 3U6KA 1SZPA 4NCJA 4UNNA 1ESNA 1NJGA 1S1MA 3VR3A 3LA6A 2BKEA 3TQCA 1N6OA 2J41A 2ANBA 2ERXA 1N5JA 2NPFA 1K5DA 4O25A 4KODA 4Q19A 3SYKA 3PITA 1XTJA 1RC8A 2O8BB 1JR3D 4DKXA 4O2LA 2OXRA 3OEHA 3SHFA 2QEQA 2XZPA 4TMVA 4QKQA 3KKNA 1LS1A 4RD2A 2DPXA 2IXFA 5B57C 4Q1BA 3RAPR 2RGNA 1MO3A 4UKDA 4PHHA 3CM0A 2A3RA 2B6HA 4TLDA 4IFBA 1VCNA 1RRGA 2YOFA 3ICQB 4ZO4A 1SXJC 4TTQA 3QSYA 4IRUB 3NVAA 3VMFA 4Q1DA 1Q44A 2PJZA 3RS0A 4Q9HA 1QVRA 3J81k 2CMKA 1D2NA 4N3NA 5CB8A 5CIQA 5TDHA 2BVNA 4IFEA 3F0TA 2QG6A 2FH5B 1G8HA 5CJ2A 2FWRA 1XPUA 2N1BA 2ZYUX 4Z54A 1XJ0A 5JI2E 4IJMA 1G5RA 1ZD8A 2VH5R 2X2FA 3N5CA 2P3SA 4K8OA 3RSOA 2ATVA 2HXYA 5KSYA 5KPDA 3V4RA 1DBSA 3M1IA 1S1CA 3BC1A 4LJAA 1Z0FA 4Q7MB 3TH5A 3EW9A 5L3SB 4QNRA 4ZIRA 3AVOA 2BEKA 1W7AA 2BBTA 3HU1A 2OFOA 1C4OA 4Q4LA 4UXHA 1VYUA 5FH9A 2SHKA 1Q22A 3AF1A 5J5CA 4A4DA 1ZM4A 2XITA 4B2LA 4A9AA 2W00A 1H65A 4BFYA 1SVLA 5EP1A 2OFWA 3W3ZB 1SVMA 1KSHA 2XNDD 2MSCB 1OH8A 4C2TA 2LKDA 2PMDA 4JVLA 1KAGA 1SQ5A 1W44A 1KDTA 2R6DA 3PR1A 2DBYA 2OLKA 3L0SA 1E2JA 2C2HA 5BN5A 1JALA 1TMKA 5KNDA 3BFXA 1U98A 1KY2A 1AIPA 1E1QA 1EFHA 4G5SA 3SJBA 4XOIA 2QA5A 2O8BA 4P33A 1E69A 3PUZA 1YRBA 1GKUB 1CLUA 4DBLC 1P9RA 1PLLA 3P4XA 3UXMA 3QBVA 1NSFA 2QAGB 2ZJOA 2NIPA 4Q1EA 2AL7A 2EU8A 4F38A 3B82A 1T0HB 3LW8A 2CL7X 2FSGA 1NMZA 2GRJA 4P4SB 5FTNA 2NGRA 4DSTA 3OAAA 2C96A 2ZE8A 1NLFA 3U61B 2AK2A 2J7PD 2WJHA 3DHWC 4M1TA 4MGYR 5IK2D 5FOTA 1VYVA 1FQKA 3KQLA 1VYTA 3KX2A 1L4UA 1OE0A 4DHEA 1T91A 4B3XA 2H18A 3ZD7A 3LXRA 2BKUA 2V1XA 1OIVA 2IYWA 5L3SA 1E1RA 3LQQA 2OCBA 2QENA 1Q20A 2V55B 3FKSD 4PC3A 1IN5A 2CE7A 1FP6A 1NVUQ 3X2SA 1U0LA 1VHTA 2J9RA 1GL6A 1WE2A 2X8AA 1W4AA 5G3YA 2FFAA 3R8FA 3NBZC 3W3AA 1CXZA 4OHVA 4LBYA 2OLJA 1IY2A 3S1AA 4WOPA 1MO5A 3FYHA 5KNCA 1SVIA 3CR8A 4B2PA 1KZ7B 3VTKA 3U5ZB 4LBWA 1RFLA 2OCPA 3C41J 1Y63A 4MGKR 1FOEB 1COWD 2FSFA 3GJ0A 2O5VA 2XJ4A 4XWAA 1VPLA 4MRRA 1PVOA 1US8B 1YZUA 2G9NA 4LDJA 5AK0A 5C1BA 2BBSA 4RY2A 4XTRA 1MH1A 4IOKA 2BIFA 2KBEA 2Q9BA 4B3GA 2WSSA 3EPLA 4P4SA 1DAIA 4HAXA 3QQ5A 4TT3A 3B78A 3NC1C 4BRUA 4QXAA 2QE7D 4JYCA 2JLVA 2RGAA 5BYJA 1TQDA 1B0UA 5DI3B 2LWIA 1R2QA 1NRJB 2QP4A 1NY5A 3C14C 3SZRA 5JLJA 4I81A 5CLQA 5L3QB 2JEOA 2PX3A 4YXWD 4AG6A 1SXJE 3TNFA 4CF7A 1KJYA 1E94E 1XCGB 3EZ6A 3ZS9A 2RGCA 4YMSA 1OSNA 1XX6A 1FP7A 3QF7A 4JVMA 3CRW1 4KAXA 3LRPA 2J59A 4OL0A 2XTNA 4CVNA 3U7EB 4BECA 1OKKD 2XB2A 1P5ZB 2V6JA 4XD7A 3MGCA 3QE0A 3UG7A 2QZ4A 2HEIA 2WJIA 4YDSA 2B7CA 3SJZA 1J2JA 1U9IC 5KNBA 3QENA 3GLIB 2DR3A 4PC1A 4B6EA 4P0TA 4KXFB 4Y0AA 2RGNC 4F91B 2OHFA 2JIZD 4QM6A 1AKEA 3DM5A 4IHQA 4DB4A 2YJTD 4LI0A 4FMDF 2HLDA 1EWRA 5EJEA 1ZW6A 4V0KA 4GL2A 3PUXA 1CJMA 1F60A 1UAAA 1ZM7A 3Q7PA 1KK2A 3KQUA 1OXSC 2F43B 1ZJ6A 2FFQA 2QM7A 1OXVA 1US8A 2NQ2C 2ONKA 4I1UA 4IOJA 4M0LA 4NPHA 1J90A 4OYHA 2ZE5A 5L3RA 4DIDA 1KOFA 2J3EA 4KFTA 4M9XA 3I5YA 2AXPA 1Z0AA 2XNSA 3VQTA 4QBGB 3X1ZA 4QJ4A 1E2FA 4OKSA 3TUZC 1VHLA 1JECA 2QORA 3CPJB 4KFSA 3TAUA 4E5UA 1G5TA 2YOGA 2ZRCA 2GCPA 4DVGA 2CLDX 5TB5A 1Q3HA 1ZBDA 2GAAA 3B85A 3ADDA 1OHHD 3AEZA 1E2GA 2BMDA 3Q3JB 3MAAC 4A6XA 4PAQA 2A2ZA 1W0JD 3AVVA 1BIFA 2QUZA 2C9OA 5DI3A 1QRAA 1DAEA 2WJGA 1CR4A 1NL3A 5H68A 3F8TA 5TVKA 3RABA 1BKDR 4B43A 4URVR 5L3QA 1WBBA 1KK0A 1PV4A 1FZQA 2D2EA 1IN8A 3EIHA 4Q1CA 1QHYA 4HYYA 4WBSA 4V0OA 4FXPA 2BBOA 4JZKA 1B23P 2B21A 1AS2A 2AX4A 2QP3A 1NN1A 2YHSA 4D80A 2Y8EA 3CZQA 4MQBA 1E32A 1VTKA 1RJ9B 1A2KC 3QG5A 1DELA 4RCYA 2B7BA 1YHNA 2JLRA 3RWMB 3CRVA 5AJVB 1P3JA 1P60A 3FKQA 3HPRA 3GLIA 3U3JA 1OYYA 621PA 4BASA 1NIJA 1DS6A 2EWWA 1J99A 4DT1B 5IF9A 2QNRA 1XXHB 2ZITA 4LRWA 1X1SA 3TQFA 4OI2A 1Z28A 1SXJD 5FUVA 3ZQ6A 3EARA 4QHTA 4DCNA 1N5KA 4QBIA 5FBRB 3FFBA 5AWFC 2D7DA 1S2MA 3QIAA 4LC0A 1AS3A 4RZ3A 4IDHA 4D4KA 2F3TA 2JDID 4FMBB 4HAZA 4KBFA 5CDFE 3QEOA 1L2TA 4W5JA 2RGDA 3THOA 1NP6A 1M34E 5KDOA 1JEDA 1XD2B 3NTUA 2OXCA 4AKGA 4M1SA 3VR6A 4M9QA 3ND9A 4BEJA 1II0A 2HJVA 1DTSA 2P5TB 3C7KA 3U3OA 4A2PA 1ELOA 4U02A 2ZQ5A 2NO0A 2NO6A 4DCUA 4TYWA 1GILA 5M04A 4Q02A 2QP9X 4IDOA 1NLZA 2IL1A 3TVTA 3EZ7A 1N6RA 2A5DA 2IYQA 3BB1A 3TW8B 1JJ7A 1ZM3A 1WMSA 4JLMA 1NMXA 3CRMA 1CIPA 4Z8YA 5JMTA 4C0AC 1SVOA 1E9CA 3SFZA 2GVZC 3QNUA 2EFCB 1UBGA 4KSCA 1GDDA 2GXQA 4QGHA 1Q21A 3NXSA 4Q66C 2H8KA 4KITB 1RJ9A 2H92A 4MYUA 2ZE6A 1I4DD 1KAOA 1N0UA 2JJ1A 2UVQA 5DH9A 1LFDB 1VDZA 5BWMA 3BH7A 1HURA 4CDGA 3U2QA 4JLJA 3K70B 2WJJA 4MRPA 5TV2A 1N3BA 1XPOA 5IDVA 4DT1A 5FBWB 1IY1A 1XXHA 2QAGC 2ORVA 2J46A 2QSZA 1OJLA 3QKTA 1JEEA 5JWHA 3V00A 4QBFA 1M74A 3LW7A 4CRWB 1TNDA 3D6TB 4PSKA 4NE2A 4C0LA 1P2VA 1R10A 3W5IA 1R0XA 1CBUA 3GJ7A 4B35A 1DO0A 4KO8A 4Q18A 3VHLB 4EPTA 4CGZA 3TUIC 2JASA 3AV0B 3F3YA 3CRQA 3U3MA 1SULA 2IS4A 2X2EA 4G5RA 2JA1A 4OQMA 1XD2A 5IHPA 3D31A 4I1OA 3L0PA 3AVTA 3SQXA 4AKIA 4HB3A 1W0KA 5FL7D 4BRWA 2PX0A 3EZ9A 4QG7A 4HZUB 4X8OA 2HUPA 2BCGY 2IHYA 2YWFA 1VG1A 3ASYA 1XRJA 4EPWA 2CBZA 1H8EA 2WZQA 3CWZA 3VFDA 1ZIOA 4PPGA 2ZRPA 5FUYA 4PR0A 1W48A 4K46A 1V5WA 5G41A 1KKLA 5FUWA 1F3OA 2ZR0A 4PHGA 4L9WA 3M0EA 1OXTA 1EFCA 4JSYA 2CXXA 4JT4A 1SVSA 4LWZA 1P2SA 4W7SA 2WWGA 3MJRA 1QBKC 1F2TB 4ZCLA 1KI2A 3SNHA 4LSGA 1E3MA 1DO2A 1R5BA 3B1YA 1HEIA 2ZI6A 2WJYA 1Z6AA 2GCOB 3IPYA 1MKYA 4KI0A 3WP0A 2FV8A 4HB2A 3VNVA 2BHRA 1WDTA 4NCHA 2F1JA 1UFQA 5FFMA 4M2LA 1DPFA 2XEXA 3NIBA 1NVVQ 3A1UA 2ODBA 3AKCA 3PIRA 2TMKA 4NYJR 4F92B 5JRZA 2OILA 3SBEA 1OB2A 2BM1A 1F5NA 1VCIA 3KKPA 2V9PA 2WJVA 4PX9A 2KWIA 1BYUA 4B73A 3AVQA 2FFBA 2ZI7A 5DE3A 2E9SA 2RGEA 3REFA 1DADA 2ZRFA 1IM2A 5F9HA 1JAHA 4Q01A 3SBDA 4GPTA 4LBZA 3IHWA 1YZTA 2A30A 3IIJA 4NYIQ 1XNJA 1CU1A 1LF5A 4CT4B 2VHUA 1R0YA 4C30A 4DJTA 4LOAA 1HT1E 4F93B 3FPAA 3U7GA 4N1AA 1ZP6A 4HZUA 3OEEA 4NDZA 2LCFA 2W0MA 4Z1MD 4YMWA 1IJEA 4TL7A 3CPHA 3VKGA 2VEDA 1XZPA 4OHWA 4YLGA 2OFXA 4G3XA 3SU8A 1ZM9A 4JLDA 5H70A 4AYWA 2V3CC 1P62B 1W1WA 3PUVA 4WW0A 5JWOA 3T1QA 5B30A 1AN0A 4L9SA 4ZKDA 2N42A 4TZ6A 3CX7A 3C4JA 1NVVR 2GWHA 2WOOA 2VHQA 3AH8A 5JS8A 1E9BA 1F2TA 4QJ3A 1AQUA 2REBA 3LY5A 1ZIPA 1R8QA 1RYHA 3OEHD 4JJKA 5FL3A 4OJKA 5KSPA 3EWSA 1OH6A 1N6PA 4U00A 4PXAA 1P2TA 1GITA 2QPOA 1L8QA 4BLRA 3DKPA 2HF8A 1G16A 1YZGA 2D2FA 1AKYA 1HQYE 1YZKA 2XAUA 2NO7A 3AF2A 4A36A 3IO5A 3SOPA 4AYXA 3GLFE 4MKIA 4WXPA 1EX7A 4LJ7A 4KCGA 4QGAA 3LXXA 4WXRA 1UKEA 2P6NA 5E7IA 1TQ4A 3E2IA 2XTZA 3VX4A 1EXMA 1U8ZA 1SVKA 2C5LA 1EFRA 2FSIA 1G8PA 4V0LA 4JVSB 1OB5A 4KLZA 1CJUC 4BFSA 3B1VA 1Z08A 5K8TA 2ZR7A 4XWKA 3IDQA 1ZCBA 3RS2A 1GM5A 2A5JA 1A82A 1HTWA 1TF2A 1KIMA 4KSBA 2YWGA 1DAFA 1KKMA 1YR8A 3ASZA 3N2IA 1AK2A 3B1ZA 1G3QA 1U99A 2ZJYA 1CKEA 1P72A 3GFTA 3GMTA 3LBHA 3UMSA 1M7BA 2ZRNA 3BD9A 1Z3IX 2ATXA 2QGZA 4NTZA 4G1UC 2ZI9A 5L3VA 3THWB 3IEUA 4UNQA 1ZUIA 4PO8A 2GCNA 4ACBA 1A2BA 4QHYA 2GEUA 1O3YA 4B74A 4LHXA 3O8RA 4D82A 3A6PC 2YVUA 1FMJA 4ITRC 3KQKA 2REOA 2XX3A 1RIFA 4NHOA 2W6IA 3KB2A 3NEYA 3A58B 521PA 2CHGA 1T8UA 1J7KA 4UXJA 1E1QD 4PC7A 1EX6A 1DAMA 5DLQC 4B33A 3KQHA 3G82C 2HYIC 2Z4RA 3CX8A 4HUTA 2AFHE 3Q72A 3GLGB 5IT5A 1R0ZA 1KSJA 4C2UA 4US1R 2HF9A 3RWOA 3FHOA 3IPXA 2W6JD 4M22A 3TK1A 1W36B 3N70A 4DLVA 2PLFA 4X8MA 1EGAA 2VQSA 3WRXC 3BK7A 3KL4A 3LX8A 3U3KA 5TARA 1XZQA 3U4QB 3R9IA 4URZR 3QVVA 2KE5A 3ZD6A 2UKDA 4IXNA 4JKIA 3I62A 1P9WA 2IW3A 2FGKA 4TYPA 3HR8A 3LLMA 3T1VA 1KSGA 1E2LA 2ZTSA 2ZVQX 1IY0A 4MGIR 2OBNA 3PG5A 4BFZA 4YC7A 4DB2A 4TLEA 421PA 4Q03A 1N6IA 2ZUDA 4A6PA 2CJWB 1EFUA 1VG0B 2J0VA 2WKPA 2Z43A 3BOSA 4JL6A 4JIMA 2AR7A 3X1DA 3AUYA 3EIEA 2JJ2A 3K53A 1UF9A 5H8WA 1EFTA 3THWA 5F2EA 2Q3HA 2QMEA 1N6LA 4TL9A 2IYYA 1M7GA 1Z06A 2BBWA 3DM9B 5H1YA 3VKWA 3X1WA 1ZNYA 5DO9A 3KJIA 2VA8A 3KUDA 1D2MA 1R8SA 4TN1A 1DOAA 2IEZA 4DUGA 1I2MA 3B2EA 4XVUA 2P6RA 1FPMA 1FW6A 1IN6A 2WPDA 3H0KA 5C18A 4X8LA 5EE3A 4TYQA 1JR6A 3TE6A 3E1SA 4HZIA 3E70C 3TRFA 3I72A 4G5OA 1Q12A 2VF7A 3NH6A 5CYPA 5SZIA 5F98A 3W9YA 2G83A 1E79A 4F4CA 3UIEA 2V7QA 4ERNA 2RGBA 5BYKA 4GOJA 3K70C 1WCV1 3GLGA 4LY6A 3BB4A 4HB0A 1I4LD 3PV0A 1G64A 3HYTA 2QTFA 5FBQB 2F9LA 1OFIA 1G7CA 4LHYA 2ZVPX 4MYHA 4ON9A 4NONA 1LNZA 2FX3A 4LZZA 5KSOA 1IXZA 2CLCX 1YVDA 2FOLA 2WSSD 5BQ5A 2OCYC 2ZRBA 4MRVA 4XIGS 4OHZA 3WXMA 4AKEA 2WAXA 1G8YA 4URYR 4LHZA 1JPNA 4TT3D 3SR0A 2H16A 4HSEA 4EJSB 3K9HA 3U4QA 5K8UA 3H86A 3EAQA 2OBMA 1CR1A 1FUUA 3BWDD 2VP6A 2P2LA 3PENA 3RSLA 2FGJA 4OK3A 3H84A 1GUAA 3LBIA 3IILA 3TSOA 2ZUCA 4IVPA 1X86B 2R9VA 3S1AB 1XMIA 1Z2AA 2V54A 2ZRLA 1GIAA 1F2UA 2IS1A 4GNKA 3FMPB 1HV8A 3MRSA 3DKVA 4D0NA 4RD3A 4A8JB 2CJWA 2NZ8A 4ZPXA 4MRNA 3EZFA 3DOFA 4YMUA 1XPRA 5EE9A 3Q5EA 5FI1B 3AGQA 2IK8A 1CP2A 3G5UA 2I3BA 2QQEA 4RFVA 5DSZA 1QHIA 4DLXA 1MRSA 1ZUHA 2YWHA 1FNMA 4C7OB 1UBFA 3L82B 4NYMQ 4XD7D 3RVBA 3KJEA 1E2DA 4PZYA 2GBLC 2NPIA 2ORIA 4RVCA 5KDLA 1U94A 3P32A 1N0VC 4TLBA 5TY0A 3DDCA 1OH5A 2FMXA 3WNCA 1NIPA 3MJHA 4DC9A 1FNNA 2DFNA 3EZ2A 3WYGA 3B7GA 4GBMA 1MABB 1GRQA 2ZI5A 1WP9A 4NKRA 3SFVA 3QXXA 1A7JA 3FE2A 4YMVA 2REXB 2YOHA 2HLDD 4M9ZA 1XEFA 4QM7A 3TAHA 4GT1A 3DMDA 3UANA 3AUXA 3PUWA 2V4ZA 1U90A 5CK5A 3MWLA 3QUSA 3PXGA 4JMPA 3W8RA 1H8HA 4TMWA 1XTQA 4LJ6A 3A1VA 2IUTA 4ZDJA 1OYWA 3KXKA 2G1JA 3KDSE 4C0KA 2NO9A 4DEXA 1UKYA 3BB3A 4Y0VA 3CR7A 1TU4A 2MSEB 1IXSB 1VG9B 3TUJC 3SYNA 3RDPA 2ZRAA 5FTMA 5HZHA 1MRNA 3QPVA 2WV9A 1XD9A 1G8FA 2WICA 2CDNA 4PHTA 2IHBA 3A4NA 1M7HA 3C5HA 4FMCB 3O8DA 5HTKA 4EJSA 1E9EA 1NSTA 4BQSA 1G20E 5FI0B 1U8YA 3WMEA 1I2DA 5J47A 3O8CA 2IXGA 2QGNA 5LD2B 4EAQA 4CIDA 4KVAA 1FQJA 1KMHB 4J0QA 4M21A 4C0BA 5KTYA 3RNLA 3ZGXA 3BAFA 1W4RA 2CL6X 3U6BA 1O87A 4MUBA 5FUXA 4OQNA 1NMYA 3FFAA 3K0CC 4W5WA 4B3CA 4A8JA 1YZLA 4TLCA 1E0KA 5JBQA 2BWJA 1RYFA 3IBYA 3OESA 4PQFA 4TWZA 3AB3A 4ACAA 4PFSA 2C8VA 3JVUA 4KFUA 3GEIA 4C7OA 2Q9AA 1VECA 2EFEB 1RVDA 5KOYA 2HCJB 2CHQA 3QBTA 5KDDA 5EZ6B 4B76A 1E9SA 3DOEA 4R7ZA 4PO1A 4I99A 3P1JA 1GTVA 4Q48A 4LHVA 1JAIA 3U60B 2VO1A 1MABA 1QG2A 3IGFA 1T6NA 5HCNA 4C0HA 2QT0A 3OHMA 4FWTA 3AVYA 2QBYB 2XB4A 1UKZA 2ZS9A 2XJ9A 1S96A 1T4GA 4Q9IA 3SE0A 4CT5A 2G77B 2PT5A 2GILA 5B64A 1YR9A 5E3HA 1PUJA 2ECKA 3DO6A 1E9AA 1QHNA 4D4MA 1VCOA 5HCIA 1UBEA 2JJ8A 4OJQA 1QG4A 1T5LA 5FTJA 1G17A 4CEHB 1Q0UA 3EPJA 1Z29A 3T5DA 4JBWA 4OI0A 4ZDKA 3A8TA 2PJRA 3ZVLA 2EWVA 1K6MA 3KFVA 3OF5A 4G0NA 1FFHA 1TAGA 2UZ3A 3PEVA 1X3SA 4AURA 4BZXA 1OF1A 4IEIA 121PA 3GPLA 1CRPA 1SHKA 2CVHA 4P3YA 1G4AE 1KMQA 4D4LA 4HLDA 3LWNA 4JVNA 4DZZA 3QKUA 4F4IA 4D25A 1ETUA 3T35A 3FHCB 2D4HA 1KMHA 4D2IA 1NF3A 4H1VA 3I8XA 5C46F 1EG7A 3CKLA 2N46A 1PLKA 1W2GA 2YC4C 2RKOA 4PPFA 3WHKA 3U7FB 3THXB 1ZD1A 1G7TA 1KI9A 4C0JA 5JCZA 4MGZR 1IXRC 3D8BA 4JYBA 3ECCA 2GZHA 4DLTA 1II8B 2OAP1 4ZV4A 3SI7A 1DAGA 4WZ6A 4TSFA 2WSMA 3A1WA 1GL7A 2JJ1D 4EKDA 2GHIA 2JLUA 2WIAA 4OHYA 2C04A 1N6HA 4M4SA 2FU5C 3EPHA 3AP2A 3GLHE 4WZBE 2AK3A 4LJ8A 4JLVA 1BS1A 5FTLA 3NEJA 4YONB 4QBHA 1XU4A 3GJXC 2ZRMA 4LCBA 2QBYA 2ZJ8A 2GKSA 4PZLA 3FHTA 1NG1A 1GG2A 1FUKA 1ZD9A 3LH5A 1N25A 4KFRA 3CBQA 5AUNB 2ODEA 1J8MF 4V0ME 4PPNA 3BJIC 2GXUA 4D81A 4AY2A 4BFWA 2Q21A 4KU4A 2F3RA 2IUUA 4US0R 3W6OA 4CEHA 5B58C 2G1KA 3K0FB 1SKYE 3KB1A 4BLOA 1CEEA 3I5XA 1R5OA 1W0KD 4N0DA 4QNMA 4IVQA 4HLUA 2CEAA 2QL6A 2ZEJA 3DL0A 5EE0A 1W5SA 2VLIA 3KXIA 3QPWA 4L16A 3A1SA 1KO8A 1OPXA 2BOVA 4RKEA 1H8ED 2WKQA 3E5HA 4EUNA 4TL8A 4EQ6B 4DLZA 1KTVA 2O0JA 3BXZA 3K9GA 2GJAA 4LYAA 1VIYA 1S9HA 1LF0A 2GJKA 4DIEA 3KZ1E 3GQBA 3THXA 5J4VA 5TXGA 4US2R 4OK6A 3CLVA 5FOVA 4P4UA 2D06A 3GEHA 1OXXK 2GNOA 1W4BA 1S9DA 4A92A 1UJ2A 3TVDA 2YZ2A 1XEXB 3U44B 3LFUA 3ZZUA 5CM9C 1II8A 1KDPA 5DN6A 2WKRA 1CF4A 4R71A 2OG2A 3QXCA 3W5JA 3BRWD 1BOFA 1IONA 2GJ8A 4GZLA 4A82A 1PJRA 1IHUA 2G3YA 4FI3C 1Z63A 3GJ6A 5SZJA 2PZEA 1N0WA 5HR5A 4XSGA 4TMZA 2JLYA 1S3GA 3CF2A 2A5GA 5GJWC 4AWXA 3K70D 4QOSA 1TEXA 4PAMA 3R20A 4LYHA 4A0HA 3B60A 1LY1A 3EX7C 1GP2A 2GEVA 4HAVA 1X8JA 3OIWA 1QHGA 2A5YB 3QVUA 2WM9B 4M1OA 4EFLA 3C16C 3CNNA 2ZS7A 4PSVA 3NBYC 5FOUA 2EFHB 2HT1A 4C0QC 3QG1A 3VR5A 1FL9A 1D5CA 3AP3A 1M1YE 2PCLA 3M4YA 3K0FA 1QHXA 4NL4H 1UKVY 1MV5A 3DZDA 3RRMA 1NBME 1DVRA 4W5HA 5CM8B 3TJZA 1E98A 3AKDA 1JQLB 3RANA 1E2QA 2FSHA 1RPZA 1HE1C 2P65A 3OEED 1Y3AA 4NBSA 1OKKA 4CEIB 4GSYA 3CNLA 1TQ2A 3TR5A 2R6AA 3AF0A 2FZ4A 3TSWA 4IW3B 5FPSA 4EQ6A 3TSZA 2A78A 4DRZA 4RSGA 3SS8A 2WTUA 4JBXA 1XMJA 3OE7A 3Q8XB 2PL3A 2CCJA 5EXXA 3B13B 1NN3A 2VHTA 1HE8B 1AQYA 3V4FA 3PEUA 3IEVA 1XEXA 3U44A 1U8AA 1GVNB 3KJGA 1J70A 1S8FA 3ZIAA 2R44A 1GNRA 1Q1QA 3R8CA 4EPRA 1FX0B 1UPTA 4LK2A 2J0QA 4HAWA 3VAAA 4II7A 1Q1EA 4HDQB 5FBLB 3B5JA 4C0SA 2A5FA 1TPZA 2YINC 3BERA 4ASUA 2P6UA 2IF2A 1G19A 3A4MA 1ONBA 4JLKA 1E0AA 4I1SA 4IXMA 3GEEA 1Q1BA 4AC9A 2QN6A 3K09A 1EFRD 1MOZA 2GJ9A 3AVPA 2EW1A 3QPUA 2JLQA 4JS0A 1P6XA 4PAOA 5JJIA 5LPNA 4RD6A 1UEIA 4IDQA 2DWPA 1WRBA 3P4YA 4LV6A 3VR1A 4TYNA 3FMOB 1GZSA 5LD2C 4Q21A 2AD5A 2ZJZA 2ZJ2A 3KXLA 4FWIB 3TW4A 1IN7A 5E95A 3KJHA 3MD0A 4G5GA 4D0GA 3I32A 1A5TA 3W6NA 3ZZ0A 1UDWA 1Z0KA 4B48A 1CJTC 4AD8A 4MDFA 1KDOA 5DIFA 4MKHA 4EDHA 3FMIA 3GFPA 1WF3A 1MR3F 4KLNA 3EA5A 1IJFA 2DYKA 2HXSA 2J45A 4PPQA 4WZAE 4TTPA 2RHMA 4B32A 4CEIA 2IS6A 2V8OA 3RS5A 4BEBA 1E9RA 2BMFA 3P20A 3QEJA 3AVUA 4M9SA 1PUIA 1JBKA 5AUOB 2W6ID 4DXAA 5JS7A 2CK3D 2W0SA 2O52A 2WMOB 4JL5A 5J40A 3GP8A 4RZ2A 3EA0A 5TMPA 1X1RA 2R6FA 5C2JB 4KVGA 2WWYA 5AJYA 1WB9A 1BH2A 2J0UB 1G9XA 1ZMXA 3K9LA 2HYDA 4L15A 1YRAA 1KO1A 4UNPA 5L8VA 2PZGA 4XTCS 1G21E 1SXJA 1KYIA 4IVRA 3WNDA 4HDCA 4A1FA 4LX0A 1NBMD 2EVWX 8OHMA 3EIQA 3HDTA 1FX0A 5P21A 2PLRA 1UBCA 2JDIA 1VMAA 1E2NA 2FN4A 1SGWA 2G0NA 1G3IA 4ZKEA 2EYUA 3MG9A 4DCVA 4HI0E 4GRAA 1ZUNB 1TF5A 1VCMA 4KBGA 3TR0A 2C98A 1Q1ZA 2JCSA 2KBFA 1E4VA 1WA5A 4GFDA 4DDWA 3WMGA 5GJBA 3QKSB 5FR1A 3QI2A 5GVRA 4Q4AB 1JXOA 4TMKA 1E2IA 1OIWA 2IX3A 3MLEA 3BS4A 2IYRA 3KTAB 1D6JA 4GP6A 4JLOA 3V9PA 3D3QA 1GKYA 3IQWA 4HEJA 5AR1A 4HATA 2IF0A 4JSTA 5FOSA 1KGDA 4LBVA 3TBKA 4QGFA 4BFXA 3H4MA 2YV5A 4Q4HB 1JPJA 2D7CA 4DSUA 2OCAA 1ZRHA 4Q47A 3K0SA 1TU3A 3RYTC 1SHZA 4LJ5A 2FF7A 3KKQA 3W34A 1KZGB 2FPMA 3IO3A 4DUGD 4QL3A 1W5TA 4IOMA 1TX4B 1TQ6A 2WPDD 1GSIA 3LD9A 3NG1A 2PH1A 2WWIA 1P4SA 2EFDB 2XOKA 5ELXA 5LBIA 4LHWA 1JB1A 2R65A 3SJAA 4NYIR 3CH5A 2MMGA 4LJ9A 4PC6A 1E79D 2J0UA 1XDBA 4LGMA 4P32A 1RRFA 2OV2A 2EYQA
chains in the Genus database with same CATH superfamily
3QVMA 5FOWA 1XB2A 1ESCA 1VJCA 4F06A 3RUHA 3T5CA 2WWHA 1AA6A 4KMOA 1BROA 4RMJA 3PFIA 1Z6TA 4ZFNA 1TTTA 2L19A 4E7OA 4PXSA 2W58A 5AW5A 3NWJA 1ARZA 1YZQA 1Y9ZA 2IXEA 4JVOA 4ZVKA 3TDNA 4D9NA 4W1PA 1U3UA 2H51A 2WSBA 1ZU5A 1B93A 2IHZA 2O3TA 3O5AA 4OQFA 4MKGA 4RYDA 3NT2A 3GGOA 3GRAA 3NPMA 5GZ1A 2YNMA 2PWYA 3CPEA 3LV8A 3ADKA 3ZWBA 5JQGF 5EUQB 1Q2UA 3QKSA 4ENRA 4H9GA 1R6AA 2P35A 2YMQA 3OFNA 2R1TB 1SOVA 4Q4AA 3VOTA 4G85A 3RS8A 2NO4A 1ZGCA 4ZMSA 3P96A 1AZLA 1B16A 3KTAA 4PRKA 4IEFB 3RTAA 4E2ZA 1ILEA 5JJKA 3C6KA 4QWWA 5CYOA 2GPAA 4XYEA 2CVPA 5CVCA 1SKMA 1YL6A 3DFMA 3LLCA 4Y6OA 2CSXA 1TD1A 3KEFA 2CXUA 3AJAA 4IQ4A 3UMRA 5KHOC 3QITA 4AECA 3UWDA 3GBVA 5F5LA 1KMNA 4W99A 1SZJG 1E1YA 1J9ZA 3KJQA 3JARA 3OLXA 2FR0A 2C3OA 3BWMA 4MW2A 5JR3A 4KG7A 3EFBA 2XA1A 3MCUA 5CVDA 1B8UA 4FD3A 4X1IB 3QUAA 1Y8ZA 5DMHA 1EVIA 5C1PA 1OXUA 4ITUA 5GADl 2JL1A 5FJJA 4IOLA 1ZGZA 1P0CA 2O50A 1E9FA 3FCSB 3HBLA 3VNRA 4HDKB 4BOYA 1SXPA 4UBJA 4BKOA 2WD7A 4EHIA 3EB9A 3HWWA 1XF9A 3VX3A 3EGDA 3H65A 1H0KA 1SN7A 1Q3TA 1DLJA 3LX5A 3UPUA 1BA2A 4AYTA 2RB4A 3KEMA 5CTJA 1UC8A 2QTVB 1NLYA 1Z6ZA 5LB2A 3UMFA 1E3DA 5F73A 4UMEA 1DE0A 5CYFA 4J91A 2PZMA 1PGOA 3RS4A 2ASVA 2GRUA 3ILHA 2YJGA 5DYIA 3OZDA 4JUBA 2EWMA 2F7SA 2ZVJA 1GPMA 2ZGVA 5EZYA 3DQQA 2VP0A 1VJDA 4MEBA 1I5RA 1JSZA 4OHCA 2P0EA 5EXTA 1DJOA 3GFSA 5A3QA 4QULA 5KEIA 4Q00A 3ZOKA 2HWXA 2XWQA 3KC2A 3ROTA 4BN4A 1HY3A 2FEOA 2VJCA 1WVIA 2Z98A 3ENQA 3LQYA 4GEGA 4JY7A 3H19A 1X8KA 2IZ1A 2Y27A 4JUAA 5UKDA 1UM8A 2OCXA 3DWFA 3VHQA 4Z6KA 1BQEA 3GVHA 4FOPA 4YJ2F 1NXWA 3VDQA 3WADA 2IYUA 2EBHX 3G0GA 2ZJAA 1Z47A 2ZP1A 4E88A 3H5NA 2BHSA 2Q6LA 3PXXA 4G1CA 5KNCD 2X3YA 2XOXA 4IY1A 1A8HA 1T1SA 3PEYA 2J7KA 3L6OO 4EVQA 1Z12A 4KOAA 3LLUA 5ALNA 1AHNA 3WYEA 1U9IA 2LR0A 2PBFA 4KE7A 1NY6A 2B94A 2JS7A 3EHEA 4OMCA 1E5TA 2NTYC 3Q6IA 1GFIA 3JD0A 5JD5A 5JNUA 1C1XB 2P9JA 4FW8A 3TIXB 3WHIA 3CCFA 1JA9A 2VRNA 3FVTA 5BRJA 1RC0A 5L4LA 2UUBB 3INNA 1JJVA 1VI2A 1G3UA 3MBIA 3OC0A 4FFDA 3CONA 4H7PA 1WSDA 4Q9DA 5HGXA 2I7CA 1E3TA 3P9QA 1BFKA 1CY1A 3HB1A 2RCNA 3P9NA 2AVNA 2I9PA 1VIAA 2OZEA 4QPZA 3ANNA 4R98A 5K45A 4G81A 3SQNA 4JYZA 5AW1A 2QT1A 1RC1A 1ENPA 4BVHA 3LBYA 2C5FA 1SVWA 1F7UA 2Z6VA 5AJXA 5IVPA 3AUTA 4BV2A 2IEAA 3GGCA 4NMWA 3CF6R 2VT6A 3F3MA 2IWRA 3P26A 4ZDIA 4Z7QB 4ZOLB 1V1JA 2X0EA 3OQVA 1D0SA 2IOFA 4CM9D 1GTZA 1CUYA 1PS0A 4BCCA 3GRZA 4ZYWA 2ZYTX 1A4RA 1K6XA 3AILA 2IQ5A 2C0QA 2O8EA 1KVSA 2AG5A 3O90A 3QQPA 1Q50A 5I9MA 1E1KA 4EW3A 4MR9B 3H9BA 5L3QA 1QO0A 4B5KA 2OESA 4Z1OA 4MA4A 5DWQA 4FHFA 1XAIA 3ZTWA 5COAA 5SY4A 1V7CA 1A2OA 3IOCA 3GLFB 3AF6A 2CMDA 2A88A 3ZZTA 4N01A 4NU8X 4I14A 2ZSJA 4KV9A 3GT3A 3PXEA 4XWGA 1M2VA 5DTIA 3UAGA 2RGGA 2P40A 3WIEA 2ZE7A 1PJZA 1K3UB 1T8TA 4ARZB 4C2BA 3OZIA 2GGSA 3OJLA 1SUSA 1T3ZA 1RYDA 3PTZA 3NHSA 1LDEA 1AGNA 1I1OA 1Z8FA 2OGSA 2MSLA 1A9QA 1N2CE 2AC2A 2AMLA 3OCXA 4A73A 1H2RS 1H6AA 2F4VB 2HJHA 4PYNA 3VJRA 3TD6A 4UUPA 4N8SA 4ALJA 5GIOE 1IWBB 4FD2A 3UB2A 4K9RA 4AT1A 5CB6A 3BTUA 1VSUA 3L0YA 3C3XA 2DTEA 5AQEA 4BNDB 3NBQA 1T13A 4BP1A 2JAQA 2D74A 4MLDA 4V02A 3DV0A 4WKOA 1ABBA 1T2FA 1BWQA 3G0DA 2IBMA 3TLBA 2QLFA 4ZI7F 3SXUA 1XLTC 4N5LA 1YS2X 2I7DA 3ZHZA 2XXBA 1HI9A 4PNZA 1ZK0A 4QDXA 3L0IB 1MPTA 3JAKA 2R85A 4J0JA 2DF8A 4PGMA 2DFTA 3T7SA 2FA9A 4BBPA 2FZLA 3PSHA 5L4SA 3LE8A 3PLAE 2PL5A 1W5AA 1BWPA 1V96A 1YDGA 1NR1A 2P91A 4O4IF 1ZJ4A 2VI5A 1GUBA 4PLYA 4EVIA 4B71A 3GCGA 1QV7A 4WNAA 1NP7A 1NGSA 2RGXA 4PZ0A 3WNBA 4F45A 2PT7A 5KYNA 1E59A 4PC2A 5AKLA 3SLRA 3UA3A 1CJKC 1XTVA 4BWFB 3G2IA 1ECJA 1XNGA 1V6CA 4RORA 2GX6A 1A1VA 2J0SA 2O2SA 2VZ9A 2V7GA 3KB6A 1MJGM 4B3BA 3EH1A 4L8VA 1HKUA 2FHSA 2FFJA 2FJPA 3QOFA 1U2TA 1Z7YA 2QL5A 1B8NA 5I51A 4Y9SA 1JR3A 5HM8A 3B1WA 5AI8A 3MRTA 2ODPA 3C0KA 1JU9A 1TYBE 3AM3A 2QVLA 3L7OA 1IU9A 2FZKA 2Q7XA 3UA4A 1LB1B 2GM5A 5PGMA 4E33A 3ILVA 5CVVA 1S0UA 2A0XA 1Q0HA 1EHCA 2VYVD 4JKYA 1O97D 5B4TA 1CEQA 4UHFA 3BXXA 3OIYA 4QAQA 5KKAA 2VBFA 3OCCA 3ROQA 2R8ZA 4GQIA 5BRAA 1HLFA 4DTIA 2CV0A 4M0UA 4A0SA 2B92A 2GAJA 4DV3B 2C2MA 3EAGA 2CCKA 4E70A 1FDWA 2X1VA 2IYZA 3L1IA 1RRVA 3OO1A 3QLJA 2O4UX 4LFBB 4RA6A 3A1TA 2RC6A 4JR0A 1Z62A 4RHEA 3ESZA 3U7IA 4D5GA 5TIIA 2YWRA 3G2HA 3VSAA 1Y5LA 1UPCA 4FCCA 4R05A 2VSQA 3HA7A 5JD4A 5E7JA 1OI2A 1Z2NX 1YFZA 4V1CB 2EF1A 1KI1A 4U2FA 1XQVA 4IO0A 4EIWA 2ECPA 2HADA 5BV1A 3GARA 3TLCA 2VSFA 1JMYA 2LP4Y 2F1RA 1BO6A 1BFDA 1FNCA 1SKQA 1ZNZA 4KHZA 5DI9A 4PZCA 3RJTA 1XEAA 4F96A 1DDIA 4PHFA 5IBRA 2ZSIA 3P2MA 3WOHA 3NALA 3BH0A 4XH9B 1LNSA 3QOXA 4B2IA 2X6RA 4DLYA 2NUAB 4YMGA 5JNRA 3P9YA 4Y7CA 3K2EA 5JRDS 3ZWWA 4HG2A 2MT9A 4X6UA 1C1DA 1BJKA 2WHRA 4MAAA 4QQKA 2WY2D 4ZK2A 3KKKA 2HCRA 2JLSA 2VR1A 3K8YA 4CHTA 3JV7A 3A4YA 1HK7A 2BFPA 4NENA 4HH0A 3EC2A 2DFKB 3CF4G 5DBIA 3RBZA 2HB6A 1F17A 4HXGA 4Z0NA 9MHTA 3S2SA 1T9GR 4YUYA 1RABA 2PZBA 2AG6A 3HADA 1KK3A 3K96A 4UD6A 3WA6A 1Z5WA 1BXGB 1NI5A 5CAEB 2HSWA 1XCBA 3RIEA 2QAJA 3PRKE 3GQBB 4OXQA 4TTVA 1G6HA 4GR4A 5CNMA 1L3CA 4Z5XA 1JDSA 3NEAA 2Z3VA 3PS9A 3R6TA 4LDRA 3HJRA 1QR2A 4C4RA 5A9SA 3DDZX 1RPNA 1Y8QA 3SOZA 3ZV4A 5E1DA 2QUJA 3O4RA 3UXYA 2IKQA 2Y05A 2Y0EA 3DHYA 5KYVA 3LT5A 1X1BA 1CRQA 4DSNA 4A3SA 2W71A 2FSUA 4GI7A 1C7EA 5EJAA 3AHHA 3G3EA 3MEQA 1DQZA 4YRAA 3NHKA 4NS4A 3IIKA 4Z86A 4AZSA 2ZJ4A 1VE6A 3CZAA 4KPUB 4KXUA 4MPPA 3VYVA 4D92A 1ZNQO 4O02B 3P9XA 4UNSA 3LT2A 3VU9A 5FWYA 2JI9A 4D7AA 3GNTA 1NW6A 3C6ZA 3NBMA 2C2XA 1XMVA 4N40A 4BX0A 1P1FA 3JWJA 4UU8A 5H0IA 3KUCA 3KWFA 3C3AA 4JLBA 2LKCA 3CSUA 4N4AA 5BN4B 3UK2A 9ATCA 3OLWA 1YQQA 4K6HA 4HQFA 2WINI 1U81A 3BRQA 3DE6X 3M4XA 1F4VA 1Z0UA 2D2VA 2VOEA 1RI3A 4K9PA 1M67A 4DL9A 4U1RA 1WVMA 1E9VA 3O4FA 1RCTE 4ZRMA 1CW2B 2O8CB 1TW3A 1YRWA 5IG2A 5IK2A 1GU7A 4IZ6A 3AESB 2M6RA 3AEUB 5HM6A 2ARKA 4A26A 4F11A 4DR7B 3ROXA 4M0PA 4EYQA 3X1XA 3ZQUA 2G1PA 5GOZA 4PAGA 4NRDA 1OC2A 1KNQA 1L7XA 2XMCA 3VKHA 3D8RA 3F6CA 4CTNA 3AKZA 5ELXA 2OE2A 3LY7A 3I73A 1YACA 3FNHA 3I28A 1F6BA 2DLDA 3I92A 3WLLA 2WU4A 3LX4A 2PKQO 2VJDA 1B6TA 2OD9A 2Z1MA 3AEYA 3E53A 5DNWA 3RC8A 4X63A 1I3MA 4J7AA 1MQ8B 1OWNA 1MENA 1KFBB 5A5GA 2FPKA 4QTXA 2OSBA 4ZVPA 2IV3A 3ZWOA 3HXTA 3SYTA 5DHFA 3HI4A 4OX9Y 1X1EA 3O2SB 5E7QA 1FUYB 1P61B 1T4CB 1PE0A 2QNBA 3PEEA 4X7RA 4AIIA 4IJ6A 1AKQA 3PB3A 3VVCA 1JPUA 3A9WA 4B3IA 3PDUA 2VUSA 3N6VA 4GOMD 4IQGA 1DFIA 5JHGB 4RANA 1R4AA 3LUKA 1G1MA 2J3JA 2FZCA 2JLWA 2FE1A 1D2GA 1L5ZA 2IZ7A 1NVEA 3JQ7B 1CDZA 2QVCA 3EEQA 4EOGA 5CD1A 3QP9A 2PS9A 3NHPA 1F7VA 3JYPA 5A1JA 2BUAA 2FPGA 2HPHA 1R37A 1V8PA 2QD5A 2XB9A 4HP8A 2IOHA 1MF7A 3CEAA 4Y2YA 3DTVD 2HSEA 3QXJA 3UAXA 3P94A 5C31A 4HH3C 2J30A 3KUUA 1SQSA 1FMFA 1XJCA 2OO7A 5DN9A 2XCOA 1R9MA 3TI9A 4B8ZA 2C4UA 1R9NA 2MU1A 4IJWA 4KZKA 4UPDA 2BDEA 2WF9A 5BMVA 3VZDA 4MA5A 3MUNA 2YXBA 3IDOA 1A72A 2WFMA 3PTLA 2F2TA 4RLHA 4LMRA 4WINA 2NTVA 2XXAA 2JH9A 4UZSA 4P5DA 4EVSA 5AKJA 5L6LB 1AMNA 4ZCMA 3FTQA 4G1FA 5A4DA 3BH6A 3NHBA 2FRXA 4U7PB 4C4XA 1T0BA 4POAA 3EGOA 5KJCA 2WE8A 3MWDB 1JF8A 4ZTBA 4ZANA 3L2OB 4MTLA 3L7LA 1MDFA 1VKJA 1NXOA 3RODA 1IN4A 2BMVA 3Q9NA 5B1YA 3PF9A 5EP3A 2GERA 5D01A 1Q57A 4I4NA 4M7RA 4OGWA 2HBQA 2QVZX 4OFZA 3JATB 4ZWNA 1KH2A 2E7ZA 3FETA 2Y92A 1TL7C 1NKTA 2QUHA 4C7JA 2PH3A 1JAZA 1T5OA 3WL7A 1HDEA 4EHBA 4PZ9A 3K1YA 1VE9A 1I9CA 2G36A 1YR7A 4MR7A 4J07A 5HQ3B 1C9KA 2ADOA 1XP8A 3R0ZA 2F17A 1DWPA 2W2LD 4AZVA 4E30A 3AF4A 2A5LA 4O2AB 3MFQA 4LEIA 5KSWB 3NQ41 3T3EA 1YXMA 1CY6A 4U6SA 4DDKA 2JCVA 1E2BA 1FDUA 3R3ZA 1EQ2A 1TVCA 5FI3A 1XAHA 1E92A 5F5XA 1ZHOA 2ZRHA 4UQLA 3UWOA 1HM5A 1SUDA 3TOXA 2IP1A 3UUEA 1AVTA 1GGHA 1YS9A 2ZT8A 4I1IA 5EEHA 3VVBA 1SUFA 4OP1A 5F9MA 3ITEA 5IW8A 1XTSA 1CY0A 1X7HA 1I94B 5KAMA 1J1UA 2FI1A 2OQVA 4BGDA 2QE6A 3ACBA 4PQGA 2QRUA 5B1EA 2GPSA 4KQFA 4Y6QA 2OB2A 4Q9KA 1PS9A 2HXGA 3DXFA 4L7VA 1KP2A 3NBKA 1P6UA 3SKVA 1AS0A 3NS7A 5I5GA 5CDSA 2ZIVB 2C99A 2R6CA 3AEXA 4Y2PA 3ANMA 5L3ZA 3MCZA 3OQNA 1ODTC 3A27A 3QTLA 4DG5A 4G0UA 1QPBA 1TEHA 3X2FA 4YDHB 2QXTA 4FEYA 2DPGA 2ZXUA 2HV9A 4MW6A 2FK7A 1L5VA 2PV0A 2XOKD 1BE8A 3WQRA 4YUVA 4U4AA 3QLUA 4D6YA 4EGCB 2JLZA 2O8FB 3MJFA 2X9QA 1GNSA 3UEOA 3RRNA 4LXTA 2B20A 5AXDA 5BRNA 4HGQA 4LSZA 3OTQA 3MD9A 3Q3EA 2AG8A 2YH2A 3OLQA 4CNBA 1D9ZA 1U02A 2B0JA 4UJ3A 3R40A 3T3GA 4ZREA 1KZ1A 4CG0A 2ZT5A 3L3BA 3RBAA 1OHHA 4S1WA 4XDZA 1RI1A 4AJ1A 3TZ6A 1GAJA 1G7RA 4FYHA 4ZEMA 3OETA 2FEKA 1MAVA 1RXIA 1U2RA 1Z15A 2WWWA 1C9MA 2YC2C 1B73A 1IK6A 2EGUA 1QH8A 4F4JA 4ZVQA 4C5AA 2D7JA 3COSA 3L7DA 4XEHA 1D03A 1WUHS 4U3JA 4WL0A 2OZVA 4Y2HA 3PJGA 1LQUA 4BVFA 3ND7A 4PANA 3TXAA 2FSVA 1PWYE 3S3TA 3QYAA 3SJ7A 2WOJA 2ZBEA 3UATA 1K7SN 3DC2A 3M6UA 1V5IA 1U9CA 2DHRA 3H6GA 5AIAA 1KSFX 1RJGA 5IWCA 4RD0A 3K2BA 4DA8A 4X44A 4AS2A 5J58A 4MS1B 1DV1A 3B9QA 1SKUA 4BMVA 4IIEA 3BWYA 1TM1E 4CKEA 3FDJA 5LP6B 3R24A 4KXNA 3IS3A 1QGYA 1Z4LA 1YK1A 4QUBA 4DC1A 3OIGA 5KTOA 2HO5A 5EHIA 3N28A 3DLBA 2B5WA 2ZPTX 1M6VA 1JHPA 1I3KA 1AHIA 1EFPB 3C3MA 2YHBA 1RLMA 2P4SA 5JDCC 4UOZA 4MA0A 1VLVA 1OV4A 3C5CA 4X61A 3CX6A 2R8EA 3K0HA 4IF6A 1P73A 1QHHB 3FUTA 4RTLA 3N0XA 1ZEMA 4ER7A 4EKGA 4LTMA 2G9UA 3FGNA 4HVAA 3X1YA 4A5OA 3PE4A 4GMDA 3EHDA 4WFKA 3AY6A 1TCUA 5FEMA 2Q4OA 5HPYB 1QH1A 2V6BA 2OV8A 3ZN2A 2AWNA 3UW3A 1JRLA 1C7JA 1HH4A 1I0IA 1K06A 1UJNA 4DJFC 1IBRA 3AHIA 3H5LA 4E7PA 1MEOA 1NPDA 2WNSA 3RJZA 1YKSA 4D9HA 5FPKA 2Q1TA 3F98A 3STXA 3VU3A 2PZFA 4LRXA 4C76A 3VNUA 3C15C 4KGZA 3E1GA 3D3KA 4BUJA 1AO3A 1TB4A 2X5XA 3JXEA 2H7XA 5LBTA 1YQ9A 7ADHA 4H18A 2UXCB 5A4KA 4WCVA 1DIHA 3R5TA 3M3DA 3WL4A 1KDRA 2GF9A 3ZY2A 1OA1A 3CLUC 3F6YA 1AKNA 2JGDA 5JECA 3V7WA 3WIBA 3K9NA 2BHLA 5TMDA 1GZDA 4W4TA 1JW9B 3ETDA 2DUJA 2UUAB 1RXEA 1NSYA 2B37A 4DC0A 2E3JA 2QN2A 1Z74A 4DNOA 1PV1A 4JAVC 1NVKA 1UZLA 3C1AA 2XADA 3OLCX 4G4JA 3ZBQA 4M6WB 2QRHA 2ZR8A 4KXLA 2GK6A 1QFZA 4MMXB 4RH0A 3RS3A 4CMHA 3TMAA 3LT1A 1YUBA 1IAQA 1HMYA 2MSNA 2O1XA 4HS4A 4PIVA 4LN1A 4WBNA 3HSYA 2O5RA 4WNIA 1I32A 1KQGA 5JH7B 3SC2B 4EDFA 1H3NA 2Z2YA 1X80A 4UCXA 1WABA 2VWPA 4O2BA 3FCAA 2O59A 3MRXA 3DMNA 1K5GA 5HF8A 1NLUA 2O4CA 5FLEX 4XWYA 3SC4A 4MYCA 1U0EA 2J9XB 4ESVA 4N3GA 3CWQA 4DJ5X 2WJZB 1D6MA 3MMPA 4RL6A 1ESDA 4KQCA 5KYXA 4EHKA 2GBLA 3QY0A 4WHMA 1ZIDA 4OU4A 5CFQA 3MELA 1M1YB 2IEIA 3ZY3A 5EJ6A 1CYEA 1E3LA 2LVBA 2X77A 5EPEA 5AT1A 1TU0A 2CXOA 3HABA 4CM4B 4MO2A 3LSTA 3R8XA 2GN4A 1PRYA 3UK1A 4MIOA 2DT8A 5H9VA 3WAJA 3AG6A 2M6SA 3H13A 3MSXA 3S4YA 2WBLC 4YAJA 1DG3A 4MQMA 5HMLA 2VATA 4U7DA 2PUHA 4EB6A 4DQKA 5LMCA 1RZRD 2FCAA 5EQJB 4EP1A 5KOJB 3VR4A 4EF4A 1UIRA 1N5DA 1RXUA 1YBMA 2VS1A 2JFUA 3S6JA 3AL0C 1SG6A 5C8VA 4S24A 5HBGA 4Q4JB 3DBHA 2PBRA 4QECA 3S7TA 3D7MA 3UOWA 5IC4A 2ADFA 3RC3A 3SHTA 4BE7B 2QOEA 3PXCX 1NNEA 2RHDA 1RAHA 3G2MA 2NQ8A 4Q5IA 4UEQA 2BE7A 2Y1LA 5EPOA 4JYMA 5IAAA 1R0KA 2GNAA 3TGLA 4IH9A 2X58A 2WF8A 3ROEA 2QTZA 1HR0B 1H2AS 3BBPA 1E77A 5EOVA 3CRRA 4B0OA 5DLDA 2JGIA 1TIBA 1GFSA 2GDJA 3L49A 4BZPA 5C3MA 3K8OE 2Q4TA 1QKIA 4ZZ3A 3GAMA 1K63A 3RFVA 1WF6A 3AQIA 2KHZA 4FVTA 2WHXA 2BPOA 3Q8WA 4IUBS 2B1QA 1TTQB 5CDFA 3TKLA 2XZOA 2VRCA 1MO2A 2A0FA 1XWIA 4OHKA 4OO3A 3SR3A 4CYMA 1U9YA 3A4LA 3EG5A 5ILOA 3KZCA 3OZXA 2A84A 2AUTA 2GLTA 2JI6A 3R5KA 1ZHFA 4R31A 5HJ5A 4QLAA 1GQYA 1N0IA 3KL2A 3OWOA 1DBPA 5FPTA 2IC5A 1EDOA 4JP8A 3P9CA 5JEEA 4NZPA 1SK8A 2VG8A 2HU8A 1AKRA 1ZNXA 3PFCA 1P17A 3CNOA 4LDAA 2XCIA 4PICA 3FR8A 2C83A 4AAYA 4D4HA 3G17A 4GO1A 4E14A 1JQJC 1PD0A 2M1XA 5KKCA 3BWBA 4Q7JB 3RYHA 4AJHA 3EMDA 3KJFA 4LZPA 3PC8A 2I2FA 2LBPA 3LA8A 4RS4A 1VLQA 4KAAA 3N6XA 3CUUA 2RG1A 3ZIUA 2FFHA 5D8DA 1FX1A 2GHQA 2X1HA 4BP8A 5K01A 1A9TA 1P29A 5LNK6 2A9KA 4OKIA 3K09C 3RTEA 1K7FB 2GB4A 5L45A 3NC4A 4HXFB 5EYPB 1XTKA 1UT6A 2ZULA 3JQFC 1FXWF 2WHEA 3BSFA 3C5VA 3ECSA 1A69A 1JQ3A 3Q8MA 5ADUS 5C1IA 2BW0A 3I04M 3HBAA 1D2AA 3GYGA 5DOZA 1A7UA 2JAUA 5H83A 1YE8A 3FLBA 1LWNA 4LYYA 1J24A 1FMTA 5ITZA 1XQ9A 2G9QA 821PA 4CWAA 5AJHA 5JV5A 1Q15A 1Z6GA 2ZBQA 1IOZA 5ANRB 5TQ2A 3C3JA 1P2BA 1SZPA 1GG5A 1UP4A 3TZBA 2B5OA 1S1MA 1NJGA 5FP0A 2A94A 1HFEL 3U37A 3E15A 3F5QA 3VR3A 1N6OA 4FFSA 3DDHA 1UMDA 3E9MA 5IUKC 2UZ1A 4MUHA 4EW2A 3CJRA 2CLMB 1JHAA 2H5JA 2VAXA 4G67A 2V4UA 5BN5B 4E6EA 4NZOA 2ZTHA 1KH3A 2J3IA 1E0DA 2A33A 1FA9A 1XTJA 4G1EB 1JWBB 4XFJA 1AN9A 5EXDA 4CQMA 4KVFA 2AYZA 2OQRA 1QJCA 1U1IA 1Z4QA 4NR0A 4DKXA 3C3BA 2OXRA 1D1QA 5JAHA 3H17A 5HOQA 3IFSA 3KKNA 1LS1A 4I6EA 2YZNA 4RD2A 2DPXA 3TTTA 2IXFA 1P4JA 1LDNA 1QTIA 1MO3A 1RKVA 2Q5LA 3G85A 3M6VA 1K08A 3QY9A 3V4OA 4R83A 2PVPA 4L95C 5KNCH 2CVZA 1H9CA 3QNMA 3TKYA 3NKLA 3EOAI 3OG9A 4K9SA 1SXJC 3MILA 4TTQA 4TXLA 4TLMB 3OCUA 1SBNE 3ER9A 3NVAA 2HRRA 1GEEA 3NEPX 5AW7A 3VMFA 2FPOA 1PYGA 2BHNA 4KC0A 4Q93A 2NZ2A 3ELWA 2FG6C 3RS0A 3K5IA 1QVRA 3WFZA 3CUVA 1D2NA 4N3NA 4RZQA 4YRSA 1JEQB 1N3LA 1ZW1A 4IFEA 2QG6A 2FH5B 2E4AA 3MYYA 5EZYF 1W9HA 4JB2A 3A3YA 2ZYUX 2Y9PB 4AVYA 4DANA 4W8HA 4Z54A 3KHKA 5L51A 3RU3A 1Z35A 1SA0A 3ND6A 1TW2A 2JIRA 4WN9A 5EG5A 4EUSA 2FR1A 5CHYA 1OH7A 1PNRA 1GGKA 3LRTA 2I87A 4MW9A 3V2UA 4EYKA 2X7HA 4F97A 3NHZA 3TH5A 4GM0A 4QNRA 3QUTA 5JSFA 3LF2A 1GQQA 2XI4A 4AJNA 1YVUA 1RIIA 1ZVJA 2CKMA 1U3CA 2BEKA 2H59A 4HNHA 2OFOA 1RM3A 4PAWA 4KXQA 1EQAA 1VYUA 2C82A 3V1LA 4HVLA 5CNJA 1I7SB 3RG2A 1S3FA 5L4NA 2JZOA 3IEIA 4MKZA 1SVLA 5HUQA 5EP1A 3HB7A 4XUEA 1SVMA 3NPAA 5IN5A 2BP7B 3DS8A 4ZVTA 4C2TA 2JHGA 5G1PA 1Q14A 1KAGA 5EMNA 4EO7A 1DQSA 1T1IA 5F2KA 1ZGGA 3FYSA 4ZT5A 5KB3A 4K05A 1YJCA 4D80A 4F2PA 1TK3A 3L0SA 4K5QA 4Z7NB 5AFSA 1EFLA 1U2GA 1JALA 4E15A 3BFXA 1U98A 3IUQA 1YS6A 1KY2A 4FBGA 1E1QA 3WWDA 1KTIA 3ABQB 4XOIA 1IZ9A 2O8BA 1LK5A 1ZQ9A 2WK1A 3G8YA 4CMKA 2EBFX 3G2JA 1M2NA 2R1UA 3V4VB 4DBLC 1FF9A 2O5CA 2G8LA 1TC1A 1KPHA 3F9IA 4CT0A 3UXMA 1LBTA 1XHFA 5HUHA 3LCUA 1K2WA 3QBVA 2ZJOA 3ORRA 2CLFB 2OTCA 2PUVA 2AL7A 5B6JA 1ST3A 3RJ9A 3CNBA 3LW8A 2X5JO 2FSGA 1BGWA 2QTGA 3D59A 3Q3IA 1HETA 1EH5A 1R15A 4J0GA 2HNBA 1O9HA 2R3SA 4XYMA 5FTNA 5HMMA 3WK4A 5CFRA 2I7VA 3GFGA 4L2IA 5JNSA 1K7CA 4QTTB 2QY6A 2IXTA 2C96A 3EBOA 2BZ1A 1R5JA 4LZAA 5A3VA 5J5VA 4IDBA 4WNCA 5HKBA 3WS7A 3R23A 2WJHA 4HDNB 2EFJA 4ETWA 1LVHA 1VYVA 3HBJA 3OM0A 4JNKA 5FOTA 3GVIA 5IC5A 3UGJA 2JIBA 4L8LA 1OCEA 2I65A 2OCIA 4DHEA 1S2NA 4MUYA 3GJZA 3W8EA 1BGXT 2H18A 3ZD7A 3FDZB 1V6AA 2WHPA 3LL7A 1FNDA 5LIPA 3DO5A 2H1CA 3VO2A 1CD5A 4OBWA 2ID7A 1LX6A 2QENA 3CLUD 3FAZA 4ALKA 1IK4A 4TT8A 2GF2A 4OAOA 3JQAA 4DG8A 2XRYA 3MYRA 2PGLA 1WCXA 3A6EA 2W90A 2J9RA 4LF6B 1ULZA 2EP5A 2J3LA 5G3YA 4NHEA 4PG5A 1E6LA 1U28C 1YASA 3AWDA 4U6QA 1ORTA 5BVHB 3INTA 4MW4A 4QYSA 1QMPA 5FJIA 5GMOA 2OLJA 4BAZA 5I01A 1ZVVA 1RXCA 5EIBD 5KNCA 3Q6NA 4CCYA 3W7VA 2QN7A 1FU8A 1XUOA 4G0XA 2GMWA 4CU5A 3E3LA 3VTKA 1HORA 2IJGX 3Q2IA 4AMYA 2BGMA 2CLHB 4LBWA 3N59A 4PU0A 3ZQ4A 4AWBA 1Y63A 5AW6A 2Y68A 1S2OA 2GA9A 2R6HA 1TVMA 1ZH6A 3GJ0A 4UDNA 3RC7A 2XJ4A 1XZHA 4WOJA 1L7NA 1NFQA 1US8B 3EY4A 4R1MA 2G9NA 2MINB 5I7EA 4PWYA 5C1BA 2BBSA 3L79A 1UINA 3GZJA 3IUBA 2I3DA 2VVTA 1MH1A 4RWEA 2JZNA 2BIFA 1N92A 3LZDA 2VYNA 4EM6A 1OTYA 3CH6A 1HRDA 2OO5C 3O95A 2PPLA 1A5SB 4R68A 4B7AA 1F1BA 4AQ7A 4B3GA 1KE2A 2XB6A 3EPLA 2ZBUA 3LQKA 4P4SA 4R8VA 3E7PA 1KYQA 5BUQA 3DT8A 5DSTA 5AIBA 4DCPA 3WLKX 2WF5A 4I5GA 1Z9BA 1T9GS 2PH5A 2VDQB 3L77A 3VDRA 2JLVA 2RGAA 1O94A 1SBQA 5BYJA 1I36A 4XASA 1R2QA 3RRXA 4P0QB 3U4IA 4GMHA 1J2YA 3H97A 1Q1GA 4CMIA 1Z2PX 3BAZA 2I7XA 2RBKA 4UUAA 4UUMA 1LH0A 3E3OA 3SZRA 2PX3A 3VZPA 1TVKA 4AG6A 4YXWD 4QZVA 5L3QB 1TUBA 2PQ2A 3AJ9A 3OTHA 4FNMA 5DVZA 2A0YA 1E94E 5EXEA 3DPSA 4FYXA 4YRDA 1MAUA 1A5AB 1S8NA 5JXWA 1JFTA 3ZS9A 1E20A 1XX6A 3AI7A 4OL0A 4CVNA 2XTNA 4QEKA 4EUFA 4HQKA 3TLEA 3KOOA 2RE8A 1T0PA 1JBEA 5IEJA 1P5ZB 3HCBA 2GPYA 2Q3JA 8ATCA 3CW9A 2YR0A 3KAPA 2HEIA 3AW8A 4YDSA 2B7CA 5JMWA 1Y6FA 3GLIB 2BKLA 2DR3A 3ETHA 2HGSA 4PC1A 4XQCA 1GFZA 4ZO6A 4BYGA 3OZTA 1NKVA 4AN4A 3JASA 4KXFB 2IP4A 2VJBA 5MHTA 2RGNC 3EXEA 4WFIA 2NLOA 4FLEA 3KOYA 3DE2X 4I8XA 3F6PA 2JIZD 4TMYA 5DM1A 4P8RA 4D9GA 3DM5A 1RBYA 2VLBA 3JRWA 4FMDF 4F9FA 3GXBA 1J97A 1ULTA 3JQCA 3WZMA 4GL2A 2CVQA 2V8BA 4RF3A 4UTOA 5ICFA 5TE9A 1ZM7A 1E1MA 1CVIA 1KK2A 1NVFA 5CP8A 3VKFA 1ZJ6A 3S8YA 2HX1A 4NPHA 4TWJA 4WZ6A 1H93A 2Q5OA 2YV3A 5L3RA 3RAGA 4DIDA 4RTQA 2B7LA 3KOXA 4HYQA 2O3SA 4TKVB 2E37A 2PMBA 3OLZA 2XNSA 10MHA 3X1ZA 4JASB 3WB0A 1WPGA 2W6CX 3PDCA 3WGMA 5KMGB 3FPCA 1VHLA 2QORA 2EAUA 2YOGA 3W2TA 2X5OA 4QT0A 3WLRA 4DVGA 5LFAA 4QUAA 2PSEA 2R6ZA 2I80A 3M81A 4QVGA 4CV1A 1ZBDA 2GAAA 3UV6A 3V7FA 1RQPA 2ACEA 3DZGA 4KW7A 3PHHA 1E2GA 1Q11A 3HYLA 2Z8XA 2ZOSA 2JB9A 2OOKA 2W5UA 1YB1A 3QU9A 1BIFA 4AZWA 5A03A 5K4HA 3C3WA 1QRAA 3OOSA 1VIMA 1ZRNA 3JD2A 4DV1B 3BSYA 5H68A 1HYHA 4GMGA 5TVKA 4G07A 1DKRA 2RHJA 1KK0A 1FZQA 5EWLA 3M1LA 4FGJA 5ERGB 8GPBA 5DHTA 3CWCA 3VYRB 5B55A 4JZKA 4P1ZA 5K6RA 1B23P 2B21A 2YHSA 5B5SA 2G4VA 3CZQA 3UJNA 3EGXA 1RJ9B 2O0MA 3E81A 3QG5A 1MZPA 5EIHA 4DIKA 3NATA 3GUVA 2JLRA 3WJ2A 4JJ8A 4F6RB 4QU0A 621PA 3SHVA 2IEGA 1K68A 1YU6A 4OHPA 4MGEA 4DT1B 1ODJA 2DULA 1XA4A 3PEFA 4EBBA 1CNFA 5LMNB 2IW1A 1D6SA 2HL6A 4D9MA 3ICWA 1HNXB 4QFDA 4EKYA 4OI2A 5JSYA 3R7LA 3UFXB 1SXJD 1DGQA 5FUVA 4BVGA 2WJ3A 4QHTA 1V39A 4AXBA 5AWFC 4JP2A 4GPD1 3FFBA 1CUJA 1S2MA 1VBNA 4YRCA 2XUPA 3I2IA 4INJA 3T3OA 4D4KA 4TKUB 4QDUA 1GUZA 2VDJA 4FTWA 1JLLA 3UAYA 4NFLA 2RGDA 3HVJA 1M34E 4AF6A 4WERA 4UEOA 3QFHA 3TDKA 2OXCA 2XCUA 1AGYA 1AD2A 1M2GA 3FYUB 4BU1A 4CKXA 2XKKA 1XROA 2YV2A 3ZCQA 2YX1A 1AY0A 4BEJA 2HJVA 1HQDA 1DTSA 3U3OA 4GBGA 2G07A 4URHA 3LKVA 1PS8A 2ZQ5A 2H4JA 3BHIA 3CUKA 4AFNA 2ZUUA 2NO0A 5EIOA 2NO6A 1H5NA 4DCUA 2Y1FA 2YYSA 3PQDA 4ESEA 4TYWA 2LCQA 3ME5A 3QPBA 2DR0A 1GILA 4F3CA 4OL9A 1QRDA 2RB5A 3FBGA 3VRHA 4MQFA 3IEKA 4IDOA 3TOVA 3KHSA 2A9PA 4ZRNA 5BMVF 2WUEA 1N6RA 3PNSA 1HE3A 1Q7RA 2IYQA 4RFLA 4U2EA 2XBMA 2W2OA 3DT6A 3NETA 4IILA 4JLMA 2G5CA 4OQEA 4B6PA 5BSWA 1OTHA 3AHCA 4MWCA 4JNCA 4C0AC 2GVZC 5AVSA 3HC7A 5JC1A 1O8BA 6PFKA 2DUMA 5JANA 2NU8B 3GUUA 1JKJA 2GXQA 4QGHA 3EYWA 3NXSA 1MT3A 1PZXA 1V11B 3RT9A 1Z7EA 3GIWA 4KITB 2H92A 3FKJA 2EKQA 2I6UA 2ZE6A 1ONOA 3B70A 4RMGA 1Y3DE 4M89A 4YUWA 2Q6IA 1VDZA 3DMTC 4OJYA 4XAQA 5FYQA 3BX1A 5TSDA 2AC4A 4CDGA 4YNBA 3TW6A 2JBAB 4C87A 2M98A 1N3BA 2HLNA 4O8CA 1DINA 5IDVA 1XPOA 1WCYA 1I13A 1XXHA 4MIYA 2OBYA 3UICA 2ORVA