4EFMA

Crystal structure of h-ras g12v in complex with gppnhp (state 1)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the state 1 conformations of the GTP-bound H-Ras protein and its oncogenic G12V and Q61L mutants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 62
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4efmA00
1XEXA 3M1IA 1G9XA 4C2UA 3I5XA 4KJZA 5G53C 1BO6A 1X8KA 2XNDA 4Q21A 3VX4A 5FTMA 1W1WA 4TQAA 4UQOA 3GLGB 4IOJA 1IXSB 4MYTA 721PA 1XJCA 3HYTA 5P21A 2OO7A 2QMUA 4D25A 2D06A 1FTNA 3A1VA 4LBVA 5EE9A 4AI6A 4J0QA 4LWZA 3LW8A 3GFOA 2ZS9A 4NH0A 3MJHA 4HUTA 4Q9LA 1SVKA 2QM8A 1NLZA 5FPSA 3O8RA 3K70C 2D7CA 3A37A 3O8BA 4L9WA 4ZDJA 4V0OA 3OEHD 1GVNB 4ON9A 4Q9IA 1YQTA 1F2UB 4RKFA 3SZRA 3JZMA 3PUWA 2OLJA 3QNUA 5AK0A 2CLDX 1ZIPA 2W6IA 1E2LA 1OXVA 5FR1A 1PV4A 4FWTA 2BMFA 4ZKEA 2Z4SA 1FP6A 4NMMA 1G8FA 4BLRA 1D8TA 1KK1A 3EA0A 3BD9A 4ZO4A 3U3RA 4TQ9A 2E9SA 1S1MA 3AKYA 3K8YA 1AGPA 1NJGA 3LWNA 1US8A 5JS8A 621PA 3THXA 3IIJA 2XTNA 1JECA 2XXAA 1UKYA 4DJTA 1ODFA 3BRWD 1XJQA 4G3XA 1EFRA 1WB9A 2W2TA 3IEVA 1FX0B 5CIWA 5AUNB 3I5YA 2GK7A 4FMCF 4ASUD 3CWQA 3A58B 4US2R 1GNQA 1OJLA 3CX6A 1ZCAA 3B7GA 2BIFA 4ARZB 2OLKA 4JVMA 1D2MA 1W4BA 3RNLA 2G9NA 2J3EA 3FMPB 5C4GB 2ERXA 2ZJYA 4UXJA 3EIEA 2H5EA 4RJLA 2UZ3A 2IEYA 1AS2A 4MQBA 2LKDA 1OXTA 3R7WB 2FSIA 4LGMA 3ZS8A 1RRCA 3IHLA 1BOFA 3KKOA 4KBGA 2UVQA 4TQUS 3DDCA 5JRZA 1ZNXA 4XVRA 4JVLA 2ZYUX 3GJ5A 5JCZA 4RSGA 2RHMA 3E70C 4IFBA 1ZM4A 3LBIA 1QVAA 4YONB 3TLXA 4HAWA 2QAGC 2CL0X 2NOAA 5EZ6B 4F4IA 2QSYA 1U0LA 2X77A 2BMEA 2Q3FA 3DOFA 3SOPA 3VX3A 3TAHA 5A5GA 1I4LD 1XNJA 4F38A 1Q21A 1COWD 4HSEA 1E1RD 4NP6A 4O2LA 3PXGA 5HZKA 5FBRB 1F2TB 2IS6A 5CJPA 4A1FA 1XEFA 5B64A 2FEOA 4TYPA 4PHTA 2J9RA 5FFMA 3A1SA 2YHSA 4EPWA 3B13B 4HLDA 2JJ8A 1SHKA 3ONWA 2A5YB 4IOKA 3W34A 4WOPA 1XWIA 3QXXA 4W5HA 4B6FA 4GZMA 4RKEA 1K8RA 2AL7A 2YJTD 3GEIA 1XCMA 3K09C 2CE2X 4DLRA 4DB2A 3QF4B 3QVVA 1T4GA 2V4ZA 2L0XA 1QZXA 1W47A 1Z06A 1Z8FA 2EFDB 1HA3A 2V7QD 1DELA 2VL7A 3R9WA 4LHYA 3ASYA 3PEUA 3ND8A 2JJ1A 1ZD9A 3W9YA 2W2VA 5A0FA 3K70D 1T0HB 5J40A 4A92A 1KSFX 4CIDA 1FPMA 1Z83A 4M9XA 3EASA 4AWXA 2NO7A 1E1QA 4X8MA 3KKMA 1VG8A 4HAZA 4LJ4A 1KK0A 4LHZA 4Q4JB 4WA7A 3AVPA 2F3TA 1E2FA 3L2OB 3SQWA 3KJGA 4B3GA 5CDFE 3BGWA 1SVMA 3H86A 4CEJA 2C04A 2K5UA 1I2MA 2Z83A 5IK2A 4YDSA 4IHQA 1N6RA 5DHFA 2BV3A 2HF8A 3ZZTA 4QHSA 2WOJA 1N3BA 1VYVA 1M6NA 2HV8A 4HATA 3GQBA 4PQYA 5EUQB 2GHIA 3TQCA 2GNOA 2ONKA 4KVGA 3SU8A 2CHGA 4QBHA 2QRZA 2V1UA 3ADDA 3MRSA 5FPYA 4RCZA 3KDSE 4EPTA 4Q4HA 2QORA 2WKQA 5CYPA 1YRBA 2A5FA 1HYQA 2FH5B 4FIDA 1IXRC 3SJBA 1ELOA 4G1UC 5FBQB 3JVVA 3OAAD 1E9DA 4WVFA 4ABYA 3UG6A 2N1BA 2IUSA 2YV5A 4KODA 4CEHB 4L9SA 3ZVLA 2ZJ8A 3HR8A 4AKEA 3SE0A 1VG9B 2OCYC 4TSFD 1RFLA 1TEXA 5EP3A 3SFZA 1DAMA 4QGHA 1IN5A 3RRZA 2QBYA 3FGNA 5LPNA 4QKQA 1DPFA 3RVBA 2V1XA 4KO8A 3CZPA 3W3AA 1E0SA 5TB5A 2IS2A 3OHMA 2IT1A 4O0MA 3DOEA 4NCKA 1GRNA 1HE1C 5KYKA 1PLJA 2IF0A 2REBA 4L16A 5JJLA 5HKKA 3PUVA 2ZUCA 4NL4H 1UDXA 5GADl 3KJIA 3THWB 2CVFA 3ZD7A 2ZRDA 3CR7A 4D80A 4YMTA 4E09A 3TBKA 3QKSA 5FBVB 4UXHA 4Y0VA 1NBMA 4MRSA 5K8TA 1E99A 3AVXA 4WZ6A 3EPLA 2FV8A 2WJJA 4E07A 1A1VA 1W5SA 1Z2CA 2F43A 1QG4A 4XWOA 2ZM5A 2C9OA 4TYNA 4OK5A 4RFSA 3KB1A 4JYBA 1DEKA 1NSFA 1AQYA 2ZAMA 2FFHA 3PEVA 4LPSA 4FCTA 1P4SA 3FHOA 2FSFA 4UKDA 1XCPA 2QM7A 3DPUA 3AF3A 1OYWA 5DE3A 5LB4A 1C1YA 1OXUA 1U81A 1Z08A 2NGRA 3NWJA 2VA8A 4FN5A 3RS3A 5K8UA 3B1XA 2NIPA 2VP9A 4R9UC 3QPUA 4IVRA 4M1TA 3RS7A 2RGXA 5AUOB 1VCMA 2JJ1D 2FU5C 1VG1A 1K6MA 2F7SA 3LD9A 4G5OA 3VR1A 4ZCIA 4DZZA 1E6CA 5FL7D 3NC1C 1P2VA 1AA9A 1S8FA 1NN1A 3L43A 4V0LA 2PZGA 4BPBA 2OBMA 2XTZA 1RZ3A 2GJAA 1M2OB 2WSSA 2VYFA 1ZUNB 2A78A 1FTSA 4TMZA 1KGDA 1G3MA 3CR8A 1TF2A 3CIOA 3LXXA 4FMDB 4BZQA 3HPRA 4DT1A 5AJXA 1YJ5A 1GSIA 1HTWA 5JHHB 3REFA 2XNSA 1E9EA 2C95A 3CH5A 3WP0A 3K70B 4O2RA 3T1VA 4DDWA 2R44A 3BBPA 3UWOA 2CVHA 3UANA 5FPKA 5KOYA 5L3RA 3LQRA 1DG1G 4YLGA 4M9QA 1TAGA 4D4MA 1W36B 4B6EA 4JVNA 1YVDA 4TL7A 5SZIA 1XD2B 4B34A 2WVJA 2GCOA 3PEWA 3TSOA 3D7MA 4XH9B 1KMHA 4FINA 3ZZ0A 3ETLA 2AK3A 4JLDA 2J46A 4DEYA 4M1YA 3UKDA 1OB5A 1R4AA 4PZLA 1DAIA 1KSJA 1TU4A 3LDAA 1SXJC 2HUPA 2CHQA 4Q5IA 4QJ5A 4WAUA 3SDZA 1R0WA 4HDQB 3D3QA 4M0LA 3KFVA 1KI9A 2ZI5A 3THWA 1VYUA 5FPHA 3TNFA 1OKKD 4RCYA 3K53A 3ZVNA 2ZRMA 3ZQ6A 1CR1A 1I4DD 1JQJC 1WP9A 2J7PD 2NPFA 3W3ZB 1CEEA 3NTUA 3QI2A 3TAUA 1TF7A 3U4QB 2JLUA 5FR2A 3NVAA 2IUTA 3B6EA 3THOA 1I2DA 4EUNA 5G40A 2QAGA 2HCBA 4PO8A 3FKSA 4LHXA 2OUKA 3L8ZA 4AKHA 5KDOA 2RGNA 4IXMA 4P4TA 3UXMA 1G8GA 2Q3HA 3U5ZB 2EU8A 3CRMA 4BFXA 5CM9C 3TUIC 4N3NA 2ZRJA 4DIDA 4LBZA 4IDHA 2G3YA 4OL0A 2GJSA 3SNHA 4BQSA 3RS0A 1GTVA 1W0JA 2JLVA 3MD0A 3AV0B 3TSWA 4A8JB 1CJMA 1KY2A 1J8MF 1SXJA 2ZS7A 2ATVA 2ODBA 1P2TA 5J4VA 1YHNA 2MMCA 2ORIA 3RWOA 1QHYA 2X1VA 3P4XA 4BZXA 3GJXC 4WZAE 5LDDC 1ZIOA 1N6HA 3PEYA 1NL3A 1YE8A 2ZRLA 3T12A 3RHFA 2I4IA 4DHEA 2J0QA 5F9FA 5FOUA 3L0IB 1SVIA 4BRWA 2QZ4A 1IBRA 1COWA 4WXRA 1N6KA 3VTKA 1Z5ZA 1I4TD 3RS2A 2XZOA 3SS8A 3MWKA 4R2HA 4CGZA 1MKYA 5CM8B 2ZE7A 2QE7A 4B32A 2GDJA 4RD3A 3K0EA 4AYWA 1E69A 3U3OA 2G1KA 4D82A 2OM2A 4GPTA 1AKYA 2VF8A 3I3SR 2G0NA 4KBFA 1LB1B 2X8AA 2ZR7A 3QXCA 4GSYA 3KJHA 2EFHB 5AWFC 3S1AA 3VR6A 1LNZA 4DXAA 3I4LA 2QMOA 2XNDD 1RKBA 1JR3D 2FPKA 4B76A 3VMFA 1T8TA 4YMSA 3QIAA 1K5DA 2WSSD 2YZ2A 4M8NE 4IEEA 2O8CA 2BOVA 4C7OB 3P27A 3Q7QA 2OFXA 4LRWA 2ZRBA 3FMFA 5BW8A 4C30A 2R6FA 4HAXA 4ZI3A 2QENA 3I73A 2B8TA 4BEJA 2EFCB 2PJRA 5B58C 2QRNA 2ZQ5A 4CEHA 3VFDA 2IA5A 3HPQA 4HAUA 1RC8A 1KO8A 4Z51A 3KQLA 3LBNA 4V03A 1G3UA 4C4PA 2DCUA 2BBWA 4BECA 2AFHE 5FTKA 1XX6A 2CDNA 5HCIA 2W0SA 4EJSA 5D3MA 1GRQA 1G18A 3WY9A 2FFBA 1L4UA 2V55B 2JCSA 3L0OA 2J0VA 1KJZA 2PL3A 3QG5A 1Q3HA 3GLGA 4JL5A 5KSPA 2QAGB 4KFUA 2QPOA 2D74A 3MGCA 1CXZA 2O8DA 5GJVC 1E79A 1C4OA 1OE0A 4Q1CA 4Y0AA 5DSZA 1W0KA 3HU1A 5HTKA 1RRFA 3NEYA 4BGDA 1P9NA 4KI0A 2YOFA 1WF3A 4FCVA 1ZVQA 2WKRA 3E2IA 3AVQA 1A2KC 4KFRA 4PANA 1Z07A 4BFUA 4U7DA 2ZJ5A 1XMIA 1S9HA 1Q1ZA 3A1TA 3AVYA 1ZUIA 5IK2D 2VLIA 1G21E 3OEHA 3B5JA 2EVWX 5CK5A 2RMKA 3DM9B 4HAVA 4Q1BA 3G82C 4LV6A 4I1OA 2R6AA 4Q4HB 4HB3A 4TT3A 2AWNA 2KBFA 5CITA 3F8TA 5JSZA 4TSFA 4A0HA 2WWGA 1HV8A 1TEVA 1UPTA 4WXPA 2Y8EA 3NDBB 1IN4A 3CB4A 4Q19A 4US0R 4XTCS 1QHHB 3Q3JB 1EFCA 4Q4LA 3R8CA 2KE5A 2J0UA 2CJWA 4LYAA 1TADA 4CDGA 2NPIA 2F1JA 5KTYA 4PC2A 4OQNA 3T5GA 5HCNA 3EX7C 1U90A 1Z47A 1VKJA 3PUYA 4NYMR 4UNQA 4AYXA 3EZ2A 1ZM2A 5TDHA 1W44A 3IKJA 4JKYA 3RRMA 3WMFA 3EZ7A 1LF0A 3PCRB 4A8JA 4NYMQ 1P75A 2VHCA 4JLJA 2Q9CA 3VR2A 5AUPB 1UBCA 2Q6TA 1GNRA 4URZR 3JZAA 1PZNA 3CRQA 3THYA 3B8HA 4F91B 1NG1A 1UEJA 3VNUA 2OE2A 3SJZA 5DNYB 2WWXA 2V6JA 2ANBA 4HB0A 2F9MA 4JLOA 3EIHA 1Q1EA 1YU9A 3P20A 4PPNA 1MRNA 1LS6A 3MAAC 4UJ3A 1B23P 5CIQA 4TTRA 2IYQA 3CPHA 1R8SA 3KXLA 1ZU4A 4RFVA 3SJCA 1UKEA 3AUXA 2D2EA 4JSTA 4Q66C 2OAP1 1MV5A 4V0NA 3GLIA 3EPHA 4DCVA 1Z28A 2IYTA 1A7JA 1T91A 1OT3A 3QXHA 1W4AA 4IOLA 5EJEA 4L5BA 1KSHA 2YC4C 2HJGA 4X8OA 4JLKA 1DAFA 2CMKA 5J5CA 4KCGA 2NO0A 3VR4A 2AXPA 4TLCA 4A8JC 1Q0UA 1E1RA 1R0ZA 1J90A 2ZREA 2FSGA 2DFNA 1G16A 1DTSA 1YZNA 2OZEA 2J5XA 4HB2A 5KSZA 3WBKA 1UEIA 4CYMA 1FP7A 1KI4A 1QHIA 2XJ4A 3BS4A 3RAPR 3U7FB 2QQ0A 2JLRA 4CT4B 2GAAA 4DLXA 2PH1A 4OQLA 3M4YA 2C03A 4QC2A 2VF7A 3NBXX 4KITB 1JI0A 3FVQA 4IOMA 5G3ZA 3DKPA 2ECKA 5EQTA 2JIZD 1SKYE 2DYKA 2GEDA 1ZNWA 4YMVA 3AGQA 2IWHA 1JB1A 3VU9B 3KKNA 2JAQA 5KDLA 4KVAA 1U0HC 5L3SA 1GRRA 3BH0A 1KIMA 4X8LA 1E2KA 2IYWA 5DH9A 1DAEA 5CB8A 1OW3B 3FPAA 4LCBA 1HURA 3GJ3A 3RSLA 1D5CA 2XZPA 3CO5A 2AK2A 3SEAA 2IYSA 3SYNA 5H68A 4R2IA 3C14C 4M21A 4M1WA 5KNBA 5FTJA 2J1LA 2B7BA 3BC1A 4OYHA 1OF1A 2LWIA 4QM6A 4EQ6A 4DSUA 3CX8A 1OB2A 3P26A 3C41J 2BMJA 4I1UA 5C46F 3EW9A 3CRVA 4C0KA 1D9XA 2QROA 4D4KA 3OFND 2OCBA 5JS7A 3UMRA 2Z43A 1N5IA 1RVDA 4DLSA 4LHWA 1QVRA 3WYFA 5DGXA 5KNCA 1FX0A 2PLRA 5BYKA 4QNRA 4N0DA 1XF9A 2RB4A 2ZR9A 1T0JB 2ODNA 2CBZA 1FL9A 1QRAA 2PCJA 3K0AB 1DADA 1VTKA 1BMFA 4OK6A 4AKGA 1L8QA 3VAAA 3WRYC 1XPRA 2TMKA 1TQ2A 3ADCA 4TTQA 5F98A 4I81A 1GKUB 2Q9AA 1G1MA 3QQ5A 5FUXA 5IRCD 4MUAA 4XD7A 3LY5A 1GKYA 2R8RA 4RZUA 4GP7A 4IVPA 2ZU0C 1UKVY 2FX3A 1KJWA 2KWIA 2CK3D 4KLZA 5FOXA 5EXPA 4BZPA 5IHPA 3GPLA 3IEUA 4EIWA 4D26A 4EFLA 3AQ4A 1AQUA 3WNCA 2FA9A 4A0FA 3IDQA 5BXQC 2IL1A 2XGJA 1E2JA 2GKSA 4IJMA 4URUR 5TV2A 3TH5A 2G1JA 3P1JA 2A9KA 2DFKB 2QTVB 1M7HA 4RZ3A 2X2FA 1WA5A 4ZKDA 2IHYA 1FQJA 1YZLA 2QP3A 3T61A 2FJUA 4M53A 5FL3A 4BFZA 2CL6X 4Z8YA 3AF0A 1XPOA 1G20E 1G5TA 4YXWD 5J4YA 4EDHA 1JEEA 3KQHA 4PTLA 5TVKA 4Q4AB 4Q18A 1E9AA 3QBTA 3UG7A 3ZVMA 3GCGA 3MMPA 1U9IC 2ZSAA 5HE9A 2PT5A 4B75A 4C0LA 1NLYA 2CE7A 2OEPA 2YWHA 1ZM7A 2BCJQ 4P32A 1FUKA 3B1VA 4BLSA 5FOSA 2P6NA 4MGZR 2RGBA 5ELXA 2QL6A 3AUYA 1XTRA 4JIMA 2ZETA 1AM4D 5FOTA 3QXSA 2O8CB 1D2EA 3LLMA 4DSNA 2ZRAA 1EK0A 4Q4AA 1VYTA 5EXSA 4HEJA 4HLUA 1HQYE 2CNWA 1DO0A 3LLUA 3A36A 1D9ZA 1E2DA 3TVDA 1KAGA 5C18A 5KSOA 2GETA 1N5KA 3NBFA 3CWZA 2H17A 1E4YA 1EWQA 1GG2A 3KQKA 3SC3A 1AZSC 1QF9A 4AK9A 1G64A 2ZVPX 2ZVQX 3RS5A 4CEIB 1S96A 5M04A 2CJWB 4PHHA 2I1QA 4MA4A 1H8HA 5EXXA 4EPRA 1XZPA 2ZRNA 2VH5R 1EGAA 2A30A 2FZ4A 4P33A 2H16A 2FFQA 4LDJA 5L3QA 4PPQA 2GVZC 4IRUB 3SBEA 3C7KA 2ZXUA 3E5HA 4KHZA 2O8BA 1M8PA 2C9CA 2BEJA 3GLFA 2J7PA 2QA5A 4G5GA 4IVQA 1OFHA 1XTJA 2WJGA 2JJ2D 1CP2A 4Q7LA 4B71A 4C0JA 4PQRA 5FH9A 1T3SA 3KXKA 3U3KA 3V00A 1KNQA 4ACAA 2AKYA 1VDZA 4MKFA 6Q21A 4ILEA 1KO5A 2J7KA 2QGZA 1XBTA 3FKSD 3LBHA 1S1CA 1ZAKA 3U3MA 1II8B 2PT7A 2W58A 4IXNA 4BFVA 4V0MA 1NBME 3C5CA 4OI2A 5F2EA 2RHDA 4LJ7A 3AKDA 3PQCA 3MWYW 3N2EA 3LO5A 5AUQA 3TGPA 1JPNA 3CF2A 1DAGA 2GEUA 4NE2A 4ZDIA 4M22A 3ICEA 1Q1QA 4TYWA 3DZ8A 1RJ9B 2PMKA 3MJRA 3RANA 1JXMA 1G5PA 2FEMA 3QEJA 1G6OA 3NBZC 5G3YA 4EFMA 4PX9A 2PLFA 1G291 4GBMA 4FWIB 5E3HA 2WM9B 4Q01A 1F2UA 1HUQA 3I1FA 4XD7D 3X2SA 3AVTA 2BVNA 4QGAA 3U3JA 5EE0A 3FHTA 4HUQB 4H9GA 5CYOA 1XTKA 1X8LA 4OQMA 3ZS9A 2R2AA 1HH4A 4W9MC 1E9BA 8OHMA 5JCPA 4PPFA 4DDTA 5J4KA 2JA1A 1TQDA 3C4JA 4II7A 1KAOA 3OIYA 3WRXC 1GZSA 4GZLA 1TUIA 2WTUA 3KXIA 1XXHE 1AN0A 3AP3A 3H2YA 4QNMA 4DBLC 4XWKA 1KHTA 3U6BA 4X8HA 1T5LA 5HKKD 1E9FA 3D31A 4A4DA 1NI3A 2W6JA 3BB4A 2WAYA 1NIPA 4LOAA 4URXR 1U0JA 3AM1A 3ICQB 4MRNA 3MWJA 2QP9X 4HLCA 1UFQA 5ANRB 5TMPA 4HZUB 2XOKD 3C16C 4IDQA 3W8NA 4JS0A 5L8VA 4OHVA 1NBMD 5CJ2A 3EIQA 1WXQA 5HE8A 1XEWX 1NY5A 4CF7A 3THXB 2Q21A 4CZ2A 1PUJA 1FNNA 4UJ5A 3IO3A 2ZJBA 3GLIE 2IS4A 3NDPA 5D3MB 2GBLC 3ZJYA 2DHRA 3CPJB 3QEOA 3CRW1 2CXXA 1XFAA 5FI1B 1UKZA 3TKLA 4C0BA 5F3WB 1V43A 1KZGB 3DL0A 3KJEA 4Z1MD 1AIPA 1Q12A 1EX7A 4QRHA 1W36C 1DAHA 2EQBA 4PAQA 1L2TA 4HYYA 4Q02A 1P2UA 4US1R 1VG0B 2A2ZA 1XD9A 1Z0DA 2V8OA 5CDFA 3LRPA 2ZE8A 4Q1EA 2KBEA 3VKWA 3WNDA 4DDVA 2IW3A 2ZJZA 2BKUA 2ZSEA 3OIUA 3KL4A 2ZRIA 2JDID 2P5TB 4DDUA 1CR4A 4RD1A 2ZTSA 4OQXA 4DLUA 2D7DA 3TW8B 1KZ7B 2YYZA 4MUBA 1KDOA 4ZCMA 3BJIC 3BH6A 5C4MA 4FMCB 3VU9A 2JJ2A 3SBDA 2GZAA 1DAKA 3E1SA 4F93B 1VIYA 2FMXA 3K0CC 4CW7A 3KUCA 4MDFA 5H1YA 2RGCA 4DCNA 2FPMA 2CCJA 2VSXA 3EXAA 5C2JB 2KJQA 2PX0A 1UADA 3EZ6A 1SHZA 2R6GA 1F2TA 1NKSA 3R20A 1CTQA 2REXB 4JT4A 5FUWA 3CF6R 4WZBE 1R2QA 4B74A 1RYFA 2HT1A 2VPPA 3AEZA 1EFTA 1H8ED 1RRPA 4LC1A 4LJYA 3KKPA 1NVXQ 3QBVA 3F0TA 1U98A 3GLHE 2V54A 2B92A 1Q3TA 3SR0A 4A15A 4MKGA 4ITRC 4TYQA 3QG1A 2B6HA 2C5LA 4A2WA 3REGA 4AIIA 4FMDF 5J4HA 4Q00A 1E79D 5FTNA 5L3VA 4MRRA 2P3SA 2H8KA 5B30A 4KYIB 3EG5A 4N1AA 3GFTA 4H1VA 1Z29A 3P32A 3R7WA 3K09A 3V4FA 3FTQA 4LBYA 3IIKA 3EWAA 5JJIA 1JJ7A 1YZGA 1GM5A 2MSCB 3OEED 2ASEA 5E7MA 3T15A 4NYIQ 5DIFA 3B9PA 3L82B 5H8WA 4NCHA 2J0SA 2NO6A 1P2SA 5GJBA 3BORA 2DB3A 4A9AA 4WW0A 3BH7A 4FXPA 5IF9A 2VSFA 4RD2A 4OHYA 1YKSA 2BM0A 2OG2A 5HZHA 4C7OA 3AB3A 2WWYA 1KI6A 2W00A 2CLCX 1OIWA 4D0LB 2B8WA 2Z5FA 5DI3B 2XOKA 2R62A 3PUXA 3OE7A 5GJCA 1DG3A 2ZRKA 2KI5A 5H70A 2J87A 2ZSBA 5AR1A 1S4QA 3B9QA 2XXAB 4XSGA 1IQPA 4FD2A 1KI7A 2IUUA 2Q0HA 4DLYA 4A0RA 2VHQA 2VEDA 4DSOA 4HLQB 2BHRA 5D3QA 3A6PC 4DLTA 2F3RA 2HXSA 2D3WA 1SVOA 4Z1MA 4ZIRA 2C99A 3MLEA 4JBYA 3BXZA 1LW7A 2GK6A 3QF4A 2XX3A 4L8GA 4Q1AA 1KMQA 3CW2A 5GVRA 3D8BA 1ANKA 3DEFA 2FF7A 5EP1A 3R8FA 1IJEA 1ONBA 1TL7C 1EG7A 2O52A 5EP2A 4PAMA 5FOWA 1CULC 2W2XA 1XDBA 1LVGA 1UF9A 1FMJA 1CR2A 1N2CE 4MGIR 2ZIAA 3UK6A 1RYHA 4TLDA 2CNWD 2EW1A 3TVTA 3A1UA 2OILA 5K8IA 3VHLB 3T1QA 1P73A 2H57A 1GL6A 1HY3A 4S35A 3WMEA 2ATXA 1XCGB 1N0WA 4L4UA 3N2IA 4HB4A 1R5OA 4UNRA 1KJYA 4JSYA 1P9WA 4A36A 1DARA 4MYCA 1N6PA 1E3MA 4Q9HA 1IY2A 2VP5A 3TJZA 3AVVA 1U8ZA 1W4RA 4PR0A 4V0KA 1XEWY 2ORWA 2QQEA 2VP2A 4E03A 4M2LA 3FMOB 1T3HA 4AKIA 2IYUA 3V4RA 2D2FA 3AF2A 2WWWA 3QY0A 4P3YA 2YWEA 3TUZC 2BEKA 1NY6A 3TRFA 2Q9BA 1ZP6A 1RIFA 5KNDA 5JRJA 1M34E 1GL7A 3M6AA 4DLWA 3DMNA 1NVUQ 1XTIA 3HU2A 5JECA 2XB2A 4MH0R 4KLNA 2OSBA 1JBKA 2ZYVX 1AS3A 3VHXA 5DLQC 2OAQ1 1MOZA 2RAPA 1N6OA 4RD0A 3LX8A 1WCV1 3PV0A 4B3CA 1N6IA 1QHGA 3GLHA 2OCAA 3EC2A 3NHBA 4BFSA 2ZI4A 4DKXA 4C9BA 2GXQA 4EJSC 1HE8B 1X8JA 3SYKA 4LHVA 4IDPA 3T35A 2DWPA 4LV8B 1TF5A 4PFSA 3IIMA 1KKLA 3QKSB 4M1OA 4NCIA 4QG7A 4R71A 1WBBA 2IS1A 1A5TA 2PMDA 3CPEA 5LBIA 4B73A 1JNYA 2CL7X 4OBEA 2EWVA 3B1YA 1M74A 3HJNA 5FBLB 1GP2A 2ZS8A 1N6LA 3WXMA 1SULA 2CCKA 2HLDD 1E0KA 1ETUA 1CBUA 1WMSA 3KKQA 3P4YA 5KHOC 3PVSA 5C1BA 3Q8XB 1CIPA 1N6NA 3OE7D 1KY3A 1X3SA 1ZYUA 4M1SA 1AK2A 4LUCA 3U60B 3GJ4A 3RC3A 5E7JA 1A82A 3PFIA 1BH2A 4AURA 3ZDQA 1KK3A 4BFYA 2FZLA 1HQCA 2MSDB 2YOHA 1N5LA 1MRSA 2GRJA 1LF5A 3R9XA 2EFEB 4YQFA 1OFUX 2AHOA 1SXJD 1J2JA 3A8TA 2ZI3A 3BK7A 4ESVA 5JWHA 3GMTA 1TTTA 2AKAB 2HYDA 4MYHA 2BJVA 5JFGA 2DPXA 1A4RA 4QL3A 5UKDA 4TL9A 5FUVA 3EWSA 4A2PA 1Z6GA 1GFIA 1XEXB 1N0UA 2KSQA 1PLLA 4B3BA 1UAAA 5GJWC 4BASA 2F1RA 1KI8A 2KB0A 2WJYA 3DMDA 2ZI7A 4QXAA 1G6HA 5L3SB 3NXSA 2BCGY 2QMEA 1EXMA 4HZIA 2O8EB 4B47A 1OIXA 1SXJE 3KFXA 4W5JA 2HXYA 3ZVRA 4D6PA 2P5SA 3QENA 4POAA 1KO4A 1DOAA 1XU4A 2ZJ2A 2NTYC 2FWRA 4KYUA 1E98A 4JYCA 3W6NA 2RGEA 4OKSA 2FOLA 1G41A 1G8PA 3MG9A 2AN9A 4QHYA 4DCTA 1JR3A 2ZYWX 4HLUC 3HP1A 2C9YA 2QI9C 3RLFA 2B7CA 4DVGA 3OIWA 3WP1B 1QHHA 3Q5EA 4Q47A 2FNAA 2WWFA 4G5QA 2D62A 1E2IA 2GCOB 2WOOA 3QKUA 1JPJA 1U8AA 1VHLA 3EZFA 4LJ9A 4WBSA 3WMGA 4QGGA 5FTLA 1T5IA 3EA5A 1VPLA 1J8YF 1G7TA 1OV4A 3AKCA 1RW4A 1IM2A 1R5BA 3GJ0A 1CU1A 4I1SA 1FW6A 3TMKA 2JDIA 1P72A 1OYYA 2GVDC 5JEDA 4GDFA 2MSEB 1XJ0A 1G8HA 2Z6VA 1P61B 4A6PA 1OXXK 2BDTA 1GWNA 4LJAA 4P4UA 4EPVA 2PEZA 4NZYA 1AKEA 1E2MA 2G77B 3S1AB 1NN5A 1EFUA 1W49A 4GNKA 4ZDKA 2QT1A 1ZU5A 4QJ4A 3PIRA 3TK1A 5JLJA 1H8HD 1YR6A 2HF9A 3NEJA 1EX6A 1W5TA 1CJTC 3IPYA 3ZD6A 2XJ9A 1G7CA 3RC8A 2F6RA 3K9LA 421PA 3NBYC 3SYLA 4B2IA 1B0UA 2WWIA 1W36D 1W0KD 3MWLA 4MRVA 3SN6A 2P6RA 2P65A 4NONA 4U00A 3EC1A 1Z6AA 4EAQA 2BBSA 1IJFA 1IY1A 1F6BA 4E5UA 5EXTA 5J4LA 2ZI9A 4G01B 4D4LA 3GLFB 2JLSA 4F7WA 2R6DA 3EARA 4B3FX 1E32A 1FQKA 4EKDA 4FW9A 2J45A 2IYVA 1KI3A 5CLLA 2H1LA 1F48A 1OLOA 2IXFA 1BS1A 3LFUA 3N70A 2VTKA 3NKVA 1Y63A 4GP6A 4JL6A 4JMPA 3I8XA 1IN6A 2GZDA 5F9HA 1UBEA 1IN8A 2WJIA 3CNLA 3W90A 3A1WA 3Q72A 2GF9A 2BBOA 3WYGA 4LK2A 1QHXA 2PZEA 2GXAA 2YKGA 2JLQA 3AGPA 4LYJA 4NU0A 3QKRB 4TMVA 1F60A 4CT5A 5SZKB 1OKKA 3I92A 2QSZA 3DHWC 3N5CA 4RD4A 5LD2C 4K81B 4IEIA 4LSGA 2VP4A 1JR6A 1NIJA 2C77A 2QPAA 1G8YA 2RH5A 2VHJA 4DWJA 1KDPA 2IXGA 3U7EB 1G7RA 1OXSC 1Q1BA 4OI1A 2WHXA 3LQQA 1GL9B 2CHVA 1R8QA 2RGDA 4KFSA 3ECCA 4EQ6B 3U44A 1EESA 4P0TA 3L0SA 1E0AA 1JJVA 2GBLA 5E4FA 5K8LA 1QG2A 1XB2A 2GZHA 4ZCLA 4KSCA 3FB4A 2FG5A 1N5JA 3TR0A 4UXIA 2NZJA 2VRWA 5JJKA 2QGNA 3CM0A 4XJXA 3IBGA 1KMHB 3T06B 1VCIA 2QY9A 1XRJA 1NF3A 3CH4B 1GNPA 3Q85A 2GXSA 3X1DA 1MO4A 4JLAA 2WJVA 1P3JA 1HEIA 1R0YA 2OCPA 4JVSB 1YR9A 4ZPXA 3IQWA 1G5RA 3PUZA 3I61A 2C8VA 3IPXA 5JMTA 3K1JA 2VO1A 2PEYA 4DLVA 1P9RA 4D0GA 2QU8A 1E96A 3MCAA 1U9IA 2PZFA 1VMAA 3GLGE 4MDEA 3NH9A 4TWZA 1ESNA 3NIBA 1R7RA 1NJFA 1CF4A 4D2IA 1XXHA 3B1ZA 4TMKA 2GILA 3BE4A 2GWHA 4DLZA 3T34A 5AJWA 2J41A 4BE7B 2ZAOA 2PX3A 3Q5DA 4MKHA 3K0CA 2UZIR 1EWRA 2ZUDA 1ZD1A 4HDOB 1T8UA 1E2EA 4Q7KA 3CKLA 3AP1A 3QKTA 2JIZA 4LJ6A 4ZI2A 1MABA 1GILA 3BFXA 1TMKA 4O25A 3I8SA 2BWJA 5L3QB 3H1TA 2AFIE 1E0JA 1JR3E 2JLXA 1IN7A 2V6IA 3CF0A 3QOFA 2O8BB 1HT2E 3H84A 3IHWA 2BBTA 2WMOB 3W6OA 2P67A 5LD2B 3KTAB 2A7QA 1ZD8A 1K5GA 3RSOA 1LFDB 1TQ6A 4PXAA 4DC9A 3LNCA 1DS6A 3T5DA 3CBQA 4QBFA 2VSOA 1P60A 1JAIA 3Q7PA 2VHTA 1E9RA 3FMIA 1KKMA 3UPUA 3WHLA 2W0MA 4EPYA 1W2HA 1SVLA 3ZQJA 3AVUA 1X1RA 1Z0FA 4PC1A 4ERNA 3UWKA 3R9IA 4BLPA 3J81k 3OFNA 4XOIA 1X1SA 2YINC 1UJ2A 4JKIA 1GUAA 3K0SA 4LJ5A 4WIAA 2WICA 3HDTA 3QJYA 2LKCA 3QF7A 2OBLA 3B2EA 4YMWA 3K9NA 2N42A 3TR5A 4DUGA 2HLDA 2O0JA 3ZIAA 4LZZA 1CJVC 2Q3MA 4BRUA 4B33A 3V9PA 2AD1A 4PC6A 3SHFA 4I1VA 1KI1A 1SQ5A 1ZJ6A 4ASUA 1OSNA 5JHGB 4LJ8A 1C9KA 1AZTA 2QE7D 2ZRFA 2DWQA 5FI0B 3GD7A 1OH8A 2WAXA 1E9CA 3T1OA 2VBCA 2HEIA 1E2NA 2FPLA 1ZNZA 5CK4A 4O3MA 2FN4A 3W8RA 1R10A 4P4SA 5EUMA 4YMUA 1EFHA 3BFVA 5B57C 5JI3E 1YZQA 3CNOA 4DCUA 1WBDA 3OZXA 2CK3A 1YZTA 3PJRA 4JLBA 4GMDA 2QP4A 4JLPA 2XZLA 1NP6A 3ASZA 2VP0A 4KXFB 2F9LA 4TT3D 1XPUA 4TLAA 2WWHA 4MYUA 1D6JA 1MT0A 1Q44A 5BYJA 4LI0A 2ZRGA 3IUYA 4EFNA 2JASA 2GA8A 1ZM9A 3B1WA 2JLWA 1S3GA 4BLOA 4QJ3A 4G5SA 1TX4B 4C3ZA 2G88A 3K9GA 3PENA 1VCNA 2IXEA 1RE0A 2QEQA 2E87A 2WPDA 1S9DA 2GESA 1CRQA 2F1HA 1KOFA 1W7AA 3K0FB 1NN3A 4QFMA 3QPVA 1YR7A 4DSTA 4XSHA 2AWOA 5GVSA 4DT1B 3BWDD 4U5XA 1QBKC 1II9A 3KQNA 3QSYA 4B44A 4DEXA 2H92A 2FE4A 2F1IA 3TE6A 4G0NA 2ZE6A 4QOSA 3ADBA 2ZR0A 1O87A 2HCJB 1J7KA 4NBSA 4OI4A 4JZKA 2BJWA 3GEEA 4PSVA 1WRBA 1KO1A 2XSZD 3RDPA 4NYIR 4MGKR 1VHTA 2E1RA 4LPKA 1NMXA 3LH5A 1LY1A 4AC9A 1KNXA 3QXJA 5CB6A 4ARZA 2N46A 221PA 1XMVA 5JWOA 4JT2A 2ZI6A 4CRWB 2R65A 3AH8A 2RKOA 4B35A 1G19A 4GFDA 5JWRA 3I62A 4B2LA 1ZBDA 1G3QA 1QHSA 4TLBA 4UNNA 4KFTA 1Y3AA 4BLTA 1SVSA 5FOVA 3G0HA 3LX5A 3AP2A 3VR5A 2JATA 1A2BA 2OFOA 3NC0C 1U2RA 3PG5A 2RGNC 1MO5A 4B2PA 1CKEA 1YZKA 2QG6A 2WSMA 4QHTA 3QKRA 4TN1A 1ZW6A 4ESHA 1BKDR 4GOKA 4QGFA 2EYQA 4JLMA 2P2LA 4P31A 3MFYA 4GMXA 4DB4A 2ZU6A 3ZYCA 1XTQA 1DVRA 3FFAA 1ZINA 1HT1E 2V3CC 4G5RA 1FFHA 2QTFA 3BIFA 1CJKC 2DFLA 2WZQA 2A3RA 3LAWA 4F4CA 2WKPA 3DVLA 2R6CA 2ODEA 4TMTA 5BN4A 5DN6D 3IO5A 1G4UR 1IXZA 1XTSA 2P6UA 5LB2A 1BYIA 3BB3A 4Q48A 4RD6A 3RRYA 4IDOA 1AJEA 2J59A 3A4MA 1CR0A 5EZ5A 2J0UB 3I72A 2AX4A 4UNSA 3RRNA 1L4YA 4V0ME 5TY0A 2ZRHA 3SHWA 2XEXA 4EJSB 5G41A 4DCSA 2VQSA 1OIVA 3OESA 1RPZA 2IYRA 5SZJA 1AS0A 3RWMB 2H18A 4PO9A 1OFTA 2GCPA 4ZDWA 5A4JA 3HWSA 2JLZA 1FNMA 4LYHA 2IHBA 1O3YA 5DISB 4HI0E 2DBYA 5KSYA 3RS4A 2ZRCA 1TUEA 4H1UA 3BB1A 1XXHB 3UATA 2O8FB 2ANCA 2FSHA 1UDWA 4AY2A 3DKVA 4I99A 4KAXA 3EPKA 1R0XA 2DWOA 1Z3IX 5DO9A 4A0GA 2CLSA 2IYYA 1G4AE 1WE2A 2V9PA 4IKEA 4Q7JB 4JLVA 5AJZA 4PQFA 1M7GA 4C0QC 1ZM3A 2IC5A 3GJ6A 3VKGA 4PSKA 1N25A 3HU3A 3MSXA 1XMSA 4XVQA 4HDCA 2A5JA 2WV9A 2QUZA 1Z63A 4NTZA 1G3IA 1SGWA 3Q9LA 3KB2A 3CRRA 5EE5B 4C0AC 1XMJA 4IDNA 4NKRA 2A5GA 2W6JD 1EFRD 1UBFA 4CEJB 4PZYA 2NMVA 1W4CA 1X6VA 2GJ8A 1PJRA 2O5VA 1US8B 3U44B 1Z0IA 1E9SA 3CX7A 4MRPA 2GEVA 1BMFD 4Q9KA 2C96A 1VCOA 4W7SA 1S2MA 2RCNA 1OH6A 3H0KA 4S2EA 1OFIA 3GLIB 4A6XA 4OHZA 2WIBA 1JALA 1XP8A 3M0EA 1KSGA 1NG9A 4BWYA 2IX3A 3FWYA 1W46A 1F3OA 1T9HA 521PA 1CLUA 2AXNA 1E94E 3CLVA 2MMGA 4AG5A 3UMSA 3LVQE 3W6PA 4TL6A 1CJUC 1IY0A 3EZ9A 1VECA 1Q22A 4KU4A 1IONA 2BC9A 3D6TB 3VR3A 2V7QA 1N0VC 2VP6A 1LV7A 2OV2A 4D0NA 3LVRE 3H4MA 2X2EA 1T3LA 2ORVA 4BEBA 3B82A 4K46A 2NG1A 1CS4C 3RYTC 3X1ZA 3KQUA 4A2QA 4TTPA 3A4NA 2FFAA 3EAQA 4TZ0A 1ZUHA 3AF1A 4OJQA 4XVUA 2GXUA 4LYFA 1OH5A 2ERYA 1NVVR 4OK3A 2RGGA 1JAHA 1KTVA 2CEAA 1ESMA 4B3XA 3KTAA 3GP8A 3EPJA 4PPGA 3LA6A 4B3DA 3TW4A 1BYUA 2G83A 3GLFE 4PZZA 4NCNA 1MABB 4PC3A 3VQTA 2QAJA 3O8DA 2OHFA 4HAYA 1ZC3A 3I32A 2ZANA 3UIEA 3VKHA 3BERA 2GF0A 3FOZA 1Q57A 1QDEA 1E2GA 2NO1A 5FPTA 5TXGA 3TIFA 1M1YE 3FYHA 1ZCBA 5J47A 1R6BX 5JSZB 2Z0MA 4PO1A 3FE2A 2YWFA 3DM5A 2OXRA 3WBJA 2NO9A 3ZZUA 4GT1A 3F5FA 2D4HA 3HYRA 2I3BA 1FOEB 3K9HA 3QPWA 3OIVA 2OBNA 2ZSFA 4URYR 1W2GA 2WIAA 1OH7A 2ZYTX 3A4LA 3X1WA 2X19A 4I4LA 1TQ4A 3CNNA 2CCGA 4PAOA 1PLKA 3W5JA 1U94A 1E1QD 4EPXA 1NSTA 1TPZA 3THYB 1AGRA 4PC7A 4LX0A 4RZ2A 4YDHB 2ZUBA 4TYYA 4TL8A 1R5NA 2QT0A 2GAOA 5HR5A 3C5HA 5FUYA 2GTPA 1NVWQ 4JBXA 2EWWA 4Z54A 3B60A 5DI9A 3AKEA 4B48A 1DO2A 3VNVA 1FZQA 2XB4A 2O0HA 4XTRA 2WBLC 2BKEA 4DRZA 2IEZA 2YOGA 1TNDA 4HUQA 4Z8XA 2PCLA 4DUGD 4JBWA 1JEDA 4BLQA 3ZIAD 2PBRA 4M1KA 1GKIA 2B21A 2BM1A 2YC2C 1NLFA 3O47A 1PUIA 2VHUA 3G5UA 3LV8A 4Q03A 1XD2A 821PA 1NVVQ 2H7VA 5EP4A 1XD8A 4B43A 4GL2A 2FDCA 3QE0A 1IAQA 2R9VA 5TARA 3LW7A 4CVNA 4L15A 4OI0A 1SXJB 2GCNA 2JGNA 1KI2A 5JBQA 4PHGA 1OHHA 1SVWA 4PSAA 3ADKA 2HYIC 2IWRA 3IGFA 4OHWA 3U61B 1PVOA 2IYXA 4GI7A 3FKQA 3TSZA 1MO3A 2WMNB 1JXOA 1P7CA 1GITA 4RVCA 3WHKA 2QPTA 3BAFA 3SJAA 2XSZA 5DYGA 4F92B 2I1VB 4RZXA 3B78A 5KPDA 4AYTA 1NKTA 1Z6TA 2ZEJA 5KO2A 3LXRA 5DI3A 2JLYA 3FFBA 1ZC4A 3DZDA 5FL7A 3JVUA 4E22A 4JJZA 3AVOA 4KV9A 3BOSA 3PITA 1G7SA 2OFWA 2DR3A 3MUFA 4XIGS 1KDRA 5E7IA 1CRPA 2YWGA 3F3YA 2PJZA 1GAJA 5HPYB 2F55A 1VIAA 4Q7MB 4AG6A 3ZGXA 2HJVA 1FUUA 1T6NA 1J70A 4JJKA 4FI3C 5EE3A 5KDDA 1SKYB 2GJ9A 1Z0AA 4U02A 5BQ5A 3ZLJA 3FDIA 2DFTA 5AJYA 3T1TA 2P0EA 5FBWB 3B85A 4ZV4A 3GEHA 2AR7A 2ZITA 3U6KA 1WQ1R 3GJ7A 1YRAA 3C15C 1H65A 1Z2AA 3GFPA 3NHAA 2FGKA 2QN6A 1DE0A 3CUEF 4K8OA 4GOXA 4KSBA 2HT6A 2RGAA 3NG1A 1E2HA 4XWAA 2GJKA 4LC0A 4RY2A 3WYAA 2ODWA 5BN3A 1E2QA 3U2QA 4HZUA 4MGYR 2BMDA 1ZMXA 3SFVA 1F5NA 1IHUA 3UMFA 1MH1A 4LY6A 1X86B 4BFWA 2OT3B 2IF2A 2A5DA 1Z6YA 2Z4RA 3C8UA 2XAUA 1TU3A 3AF4A 1D2NA 4Q1FA 5E95A 4YC7A 5KU1A 1G3RA 5SZHB 1BIFA 2YVUA 4AD8A 1YR8A 4C0SA 4URWR 4P4SB 3K0AA 1ZNYA 1MR3F 1GIAA 2IK8A 3W5IA 4JLNA 4URVR 4C0HA 3FHCB 5KUTA 2FGJA 2EFGA 2ZSDA 2ZROA 3IBYA 4FMBB 4M4SA 4NDZA 1Z22A 1RRGA 3KX2A 2C98A 3OAAA 2JEOA 4OJKA 4PHFA 3TQFA 4QM7A 3TUJC 1II0A 4LBWA 4M9SA 2ONJA 1Z0JA 3CZQA 4NCJA 4MITA 2W6ID 1NMYA 4IW3B 1JQLB 2XITA 1ZRHA 4NHOA 1NRJB 1LS1A 1W0JD 1OPXA 4Q9JA 4CEIA 3CONA 4RFSB 3HR7A 3X1YA 2HDNB 4R7ZA 5B2ZA 1FMLA 1L7VC 2REOA 4NPHA 1S0UA 2ZRPA 3SI7A 1G17A 3SQXA 1Z0KA 2C2HA 2WPDD 1S3SA 2LCFA 4GRAA 4BUJA 1II8A 1QHNA 4QBGB 3ZH9B 4C2TA 2NQ2C 3OF5A 4LV5B 1OHHD 4W5WA 4UNPA 2QMHA 2WJHA 2ZE5A 2ZJAA 2XTMA 4M1MA 5IDVA 4BFTA 4TMXA 4DIEA 4Q1DA 2UKDA 4NYJR 2EYUA 4FCWA 4V02A 3PR1A 1KO7A 1V5WA 1IOZA 3OEEA 4Q4JA 1P5ZB 2C78A 2QTHA 3U7HB 4NYJQ 1SKQA 4QBIA 4R98A 5KPJA 2IBMA 2YNMA 3GJ8A 2IYZA 2AD5A 1W48A 4TLEA 4YXWA 1UBGA 3WNBA 1M7BA 2ZPTX 3U7GA 3U4QA 1NN0A 2G6BA 5EE1A 3KUDA 3KZ1E 2OXCA 3GLHB 1KDTA 2W83A 4OHXA 4OQFA 1J99A 2NZ8A 2QBYB 4ZIRB 2G0TA 5CLQA 2O8FA 2F43B 2QNRA 2ZJOA 3BFKA 1NMZA 3QUSA 4JL8A 1MO6A 1NNEA 2SHKA 1LTQA 4D4JA 1KYIA 4A82A 3RABA 4F4JA 3NH6A 5JZVA 1GDDA 3IILA 4TMWA 3L0PA 3AVWA 4IFEA 1UM8A 1P6XA 5BWMA 1Q20A 4TZ6A 4N0EA 121PA 3DO6A 2IYLD 4D81A 3X1XA 5IT5A 3QVUA 1E4VA 1XZQA 2O0KA 1DBSA 5AJVB 2VIIA 4MKIA 4ACBA 3O8CA 5JEEA 1E2PA 1YZUA 5DYIA 3L8YA 3ND9A 1KK2A 2O8EA 2OESA 1KI6B 3K0FA 5JI2E 1H8EA 1WDTA 2O8DB 1P62B 1U99A 1Z6XA 4M9ZA 5BN5A 4GOJA 3IQXA 1GOTA 1RJ9A 5DHAA 5DN6A 1SZPA 1U8YA 2DY1A
chains in the Genus database with same CATH superfamily
3QVGA 4RACA 1A9PA 2WC1A 4N5MA 1SIWA 4C2UA 2HK9A 1YA4A 4KJZA 2M6KA 3F9IA 2GFHA 3TX6A 1QVWA 3TZBA 4Q21A 3VX4A 4PBTA 3GLGB 1F8YA 3DBLA 4DMGA 2P2CA 3V34A 4C7BA 5JCJA 3BGVA 3ZJ5A 1MDBA 1LSSA 1FC0A 2Y9MB 1U4SA 1FTNA 4O4JF 2XUKA 3QLTA 4IDDA 3H5NA 4J6EA 5EE9A 5FXMA 5BUQA 3BWEA 4GM4A 4GYKA 3N2KB 3KNZA 4NH0A 5F1OA 2WE7A 3MT7A 1GPJA 1NLZA 3M81A 5FPSA 1N9KA 4BGUA 4POOA 4XWOA 1C7ZA 1GUBA 2D7CA 2FI1A 3O8BA 3QA9A 4CKYA 3W2EA 2PVSA 1GVNB 4ARSA 4BN0A 2E4WA 2PDAA 4Q9IA 1F2UB 2O7QA 1C81A 4MUYA 4TV8F 1UCFA 4UNIA 1MQAA 3PUWA 1VIMA 2OLJA 4E33A 3QNUA 5AK0A 2CLDX 2VUUA 3KZCA 2W6IA 1UH5A 2EWMA 1OXVA 3HJTA 1H4TA 2BMFA 5GOTA 2Z4SA 1L7BA 2R5NA 4ZKEA 4BLRA 4G0ZA 3EG9A 3LUPA 2A3NA 3F46A 3BD9A 4WNIA 4ZO4A 4TQ9A 5KYTA 4G4IA 2ZYSA 1XELA 4IZ6A 3KD2A 3LWNA 1U2GA 1US8A 4JCOA 4U7WA 5JS8A 4ZREA 1JWBB 5AJTA 1JECA 4N5IX 4AROA 5K09A 3FOFC 1F14A 1SD2A 3O83A 1ODFA 1EFRA 4B6PA 4A27A 1WB9A 4MZDA 3T7RA 4CCWA 5TQJA 2CV2A 2VCHA 5F76A 3L4KA 2FCRA 1SEVA 2E4AA 3ILYA 5I9BA 3WLPA 1ZKDA 2FPOA 5FA8A 4C5BA 3SXUB 2HFKA 2AC4A 4FMCF 4EG7A 2HEGA 3CWQA 1GNQA 2BFAA 2A58A 4JP2A 3CX6A 2QLNA 3OM9A 3R8XA 3BD8A 3UH1A 4ARZB 3GXBA 4YFVA 4CODB 5C4GB 1DEAA 1TT7A 1FFGA 1QG0A 4QUEA 4RJLA 4I46A 4WDQA 2BSAA 2IEYA 1R4NB 1OGIA 3I1YA 4EHAA 3CZAA 3D4NA 3OOYA 4GHWA 4K9KA 3UGJA 1OXTA 1T5HX 3R7WB 4JBGA 4Z3KA 1YVEI 1ZMBA 3OZFA 3LCRA 4P86A 4UZFA 3ZEAA 1WXDA 4KBGA 2P4QA 4UTXA 5JRZA 1L1FA 4AMBA 2ZYUX 1ULHA 5JCZA 3L1VA 2RHMA 5JAIA 5DBGA 1JLMA 3LBIA 1QVAA 4FFLA 1W88A 2PZBA 4P3KA 4QWWA 3URMA 3R5HA 2XVYA 4HAWA 5KOJA 3GK3A 3ORFA 2NOAA 4IH4A 5FWYB 4AG3A 2PRYA 5IC6A 1OI3A 4EABA 3IV7A 4XB1A 3SOPA 3VX3A 5A5GA 5IJ0A 1PZEA 1I4LD 1XLWA 2FUNB 5CNIA 4BNDA 2ZT8A 1Q21A 4BDSA 5KMGA 1COWD 3J7TA 3FWPA 4M1ZA 1E1RD 2XQJA 1M3SA 3MFQA 4QQFA 1HQDA 5TS3A 3PXGA 3ST7A 1U31A 2IS6A 1GEGA 5CPBA 3TEMA 5I3ZA 3H2HA 3E3LA 4M87A 4WXHA 3F7OA 1Y48E 1NE2A 4B9EA 6CHYA 3A6LA 2J9RA 2Y6UA 3URKA 3A1SA 3AM3A 3HKBA 4AS3A 2B1JA 1HDZA 2QN7A 1AUOA 2JJ8A 3N58A 2R68A 4L5JA 4OQ4A 4I5IA 1FYWA 1YDHA 3O31A 4WOPA 3QXXA 2P90A 3RRFA 4JVOA 1YS2X 2PMCA 1NF9A 1WCIB 4D8YA 5EG5A 4DG8A 3LOUA 3I01A 2FR1A 3NC4A 2CE2X 5DWQA 2JVKA 3MSCA 3SZGA 4XX0B 1PGPA 3ZLBA 1XWWA 4CNQA 3E3MA 3NT4A 2QDKA 3CZRA 2V4ZA 1PU2A 4Q1BA 1TO2E 1Z8FA 2QRJA 3K15A 1HA3A 1RS0A 2ADMA 4KRGA 1GU7A 3VZBA 4CKXA 5EPUA 1GNTA 3L92A 3PC8C 3PEUA 1O7JA 2JJ1A 1G1AA 2C07A 1EI9A 2XTAA 4HGQA 1P3DA 4QXPA 2G5CA 5BSWA 1T0HB 1H6BA 1CVRA 3OX2A 4YV2A 5LVAA 3EGIA 4R69A 4QZVA 4DDMA 3IDOA 1Z83A 2DTEA 2OORA 1M1NB 3H99A 3KKMA 3BREA 2I0FA 4AF7A 2YJZA 1MZVA 1YK1A 1U7UA 1JA1A 4Q4JB 3LDGA 1ZW1A 5EC8A 1TGYA 2C5GA 4EF5A 1P1BA 3AHDA 1PG0A 4B3GA 1MG0A 3O8OA 5LP1A 3DZKA 1S02A 2C04A 5IK2A 4B7XA 2JIQA 3LBFA 3N0WA 5K0LA 1N6RA 2BV3A 2GLUA 4B4WA 2HMSA 4B85A 2LPMA 4PYOA 2FK8A 4OV6B 2GZRA 1M6NA 2Z1DA 3ZWVA 5AXBA 4BFLA 3DZIA 3MTJA 1I51A 5EUQB 2GHIA 3G8AA 3TQCA 3PX2A 5JH7B 1YAHA 2GNOA 4JI3B 4KVGA 3SU8A 5FFFA 1BXGB 3L7MA 5CHEA 1W96A 3UJHA 2FQXA 5HGJA 2QRZA 4CR8A 1H1LB 4G4JA 4XGIA 1XZGA 1ORDA 1D04A 4GOND 2PRZA 5B12A 1CC1S 3KSBC 4NENA 3ADDA 2A7XA 4A2CA 3PCTA 5FPYA 3KDSE 4V0RA 2PUTA 3RGWS 1VL8A 1WVMA 2A5FA 3ELWA 2FH5B 1ZICA 1IXRC 2PQ0A 3IQGX 4QULA 4L9RA 1FDVA 4BNHA 3JVVA 5LP6A 1J06A 2N3ZA 1ABEA 4BNZA 2PK3A 4D99A 3ZVLA 5JNVA 1XVAA 1DXOA 3GZNA 4GC5A 2GK4A 2YV2A 2QX8A 1XTTA 1SUEA 3LC2O 1F0PA 2OCXA 4NJOA 1IMOA 1TEXA 5EP3A 1M0SA 2CVOA 1D2GA 3SK0A 5LPNA 4QKQA 2O3UA 4KO8A 2VN8A 3W3AA 1AK1A 5TB5A 2VWQA 4NCKA 2OTCA 1PJ4A 3UJDA 1NUUA 4QYIB 2NADA 2REBA 3CLSC 2VBGA 3DXZA 5E4JA 2OV1A 2X5XA 1NMQA 2ZUCA 4Q34A 4NL4H 4X20A 5ALQA 5GADl 1XQWA 3FYUC 5BW6B 3QE3A 3THWB 4KQHA 1GYQA 2UXCB 3BN3A 3TBKA 2C9BA 5FBVB 2R8OA 4DA0A 2RG7A 4AZSA 3RSZA 2IJGX 4RETA 1WEKA 4K1XA 4LNUB 4RH1A 5E8JA 4PG8A 5LNK6 4MRSA 4GMFA 1P1HA 3LCJA 4BNMA 2WJJA 1WR8A 1GA6A 5FNVB 3VDNB 1CX9B 1W5SA 2FZ5A 1V11A 3QMVA 2Z95A 1F4PA 5KUTA 4DV2B 1NSFA 1HNXB 4J4TA 2ZAMA 3D1VA 1Y81A 2FFHA 3PEVA 1IYZA 4CWAA 1H2ZA 5LIRA 3ACDA 1ISGA 4KN8A 3B3QA 5AVUA 4J91A 2AYXA 5IBRA 2FSFA 4QODA 3PC6A 1XCPA 2QM7A 3HXKA 3TDMA 3AF3A 4BKRA 5DE3A 1TUGA 5LB4A 3KZMA 1OXUA 2R7KA 2WU1A 4PXSA 4HWTA 5IAKA 5LZ8A 4ALKA 4BWFB 1P1JA 3F6CA 2GA9A 4FPXA 4FN5A 2QWXA 4KO1S 2J3DA 3V3KA 1A5SB 3E2MA 3SZLA 5IYZF 1QR6A 4R9UC 2FPIA 4IVRA 3KSZO 3WTBA 3D8SA 4IDGA 4M1TA 4W7HA 3RVMA 1JRLA 1VCMA 2BFNA 2E18A 1AZLA 4DR3B 1ZO8A 4W99A 1IHOA 4G5OA 5DNAA 3SIWA 4ZCIA 4CMHA 4DNPA 3OZSA 1TM4E 1Z2NX 1PN3A 3Q2IA 3DZCA 2A6PA 1E60A 1VKNA 1W5FA 2PGDA 1Y6ZA 2XMBA 3X1JA 3O8LA 3L4BC 4BPBA 4W1QA 2ZOSA 5EQFA 1RZ3A 1T9GR 1ZL2A 1Q0HA 2YIDA 3CINA 2QZZA 2G5PA 2CXNA 3PNKA 4IQGA 2XNCA 5IJZA 2ZAIA 5TQ0B 1Z4OA 2OHVA 1DV1A 2JLAA 3UT5B 4TMZA 3WJ1A 3O1JC 3LXXA 2P2NA 4FMDB 3WRVA 3VYTB 5AJXA 3KOZA 4PNEA 5KCZA 4Y9SA 3REFA 4EHFA 1LK5A 3GMSA 3W04A 1ODLA 5E38A 3K9WA 4DYHA 2OVFA 3JD3A 3TRIA 3ZCTA 4RHYA 3UANA 2ILVA 2BH9A 1C1DA 2Y99A 5JAOA 1U3TA 5L3RA 2BFBA 1TAGA 3PI6A 4YRIA 4EW3A 1QMPA 3BHMA 4JVNA 4B6EA 5SZIA 1M72A 2CMDA 1SUWA 5CU7A 1T1EA 1U28A 3EGXA 3N8GA 1O08A 1QX4A 5T67A 1RD4A 3PEWA 1PIWA 3FJ1A 2VJKA 4IFIA 3HLTA 1TYZA 4GS5A 4L5CA 4MW9A 4MV8A 4FINA 4YMIA 3WYCA 4DEYA 4JLDA 4YYZA 2C1ZA 3DDWA 3UKDA 1IRXA 3II6X 4H1WA 3UBTA 4OH7A 4DR4B 3INRA 1AKRA 4L8YA 3DAGA 5A0VA 1P2FA 4CT0A 1FDSA 3WK9A 2BMVA 4M0LA 2TMYA 5H4HA 2GEBA 2SBTA 1BA3A 2Q5FA 3K53A 4M8LA 3ZQ6A 1CR1A 2J7PD 1I9CA 5JDIC 3NTUA 1XJWA 5FNVF 2NM0A 2E85A 4P5EA 1W52X 1LRLA 1EJ6A 4JA2A 4R7GA 2YJ6A 4K9MA 5FI5A 1O95A 3B6EA 4B6SA 1I2DA 4L0DA 2IPXA 4RBNA 3W5AA 5I7FA 2X5KO 1L7PA 2V6FA 4LHXA 3NASA 1YDMA 3GLQA 4IXMA 1G8GA 3BDIA 4AWAA 1TYDE 2EU8A 3CRMA 4B81A 3TUIC 4NIMA 2MDTA 2R25B 1FXWA 1Y1SA 3DXXA 4JI8B 4IDHA 4BQSA 1HTBA 4HGYA 4KAJA 2H9IA 2AYYA 4OL0A 3VZPA 4ERXA 5ABPA 4PX2A 2NSYA 3ZI7A 3MD0A 2AR9A 1YBHA 1CJMA 2B1RA 3EF1A 1VXRA 4F2HA 4P0PB 1Z25A 3LA8A 5JS2A 2EW2A 2ORIA 4E5NA 1U3CA 2IHNA 2Q46A 1HDGO 5DYTA 2X1VA 3NTQA 4RK6A 1NQTA 3O2QB 1YBAA 3CZ5A 4HR7A 5IT4A 4FQ5A 4ZYVA 2IP4A 1RHUA 4JB3A 5F9FA 1J0CA 2PTHA 3V2IA 1FFXB 5CM2Z 5FOUA 4MUNA 4BRWA 4FGWA 3PBKA 1IBRA 1U0EA 2JJQA 5DTJA 2J9FA 4WXRA 4DABA 4F06A 1Z5ZA 4XX1A 3RS2A 3ORSA 3T7KA 5KNDH 2DEUA 2XT0A 3JQBA 3BULA 4AM8A 1SD1A 3FZGA 5BQPA 1N5MA 3WZMA 4U2FA 3LGXA 4EYKA 4I4TA 3UQZA 4AYWA 4MS4B 1GQFA 10MHA 3OFKA 1K9VF 4RLHA 4LTMA 3ESXA 2X4LA 2ZBVA 4PW0A 5EJ2A 2G0NA 2HPHA 3BSSA 4YVFA 2ZR7A 4KDRA 2R85A 1JHXA 2BEVB 5AWFC 3WLTA 1GD1O 5FB3A 3FJYA 1LNZA 2O2CA 3I4LA 3O92A 2C3YA 4RXTA 1SY7A 4XEHA 5IAEA 3VMFA 5SYAA 3ETHA 4OA8A 3QIAA 2ZIZA 5G0UA 3L9WA 3PHGA 4M8NE 1VRCA 3NJRA 3P27A 1MMFB 2OFXA 3K6SA 4PZ9A 5J2TF 3QX3A 1KEPA 1Q74A 4TXNA 2YHIA 3I73A 2B8TA 3EBOA 4M0FA 1KXZA 2RCYA 1Z5WA 4CJXA 5B58C 5JNRA 1FFXA 2PSFA 1B8OA 2QRUA 2W37A 3LSYA 4CU2A 2FWIA 3FZQA 4ENQA 2ZUTA 1YA8A 3I2IA 4FCCA 4Z51A 2WNHA 2F8TA 2COUA 1JEQB 4V03A 4YRJA 2Y1DA 1GTJ1 3UAWA 1XX6A 2CDNA 2I7VA 1QKKA 2Z8YA 3PR2B 4KWHA 5D3MA 2L19A 2Y3IA 1G18A 4I5EA 3WGHA 4FGKA 3WY9A 2O5CA 3EXEB 4OIFA 2J0VA 3BMCA 3FA2A 2OY0A 4BNVA 3EZYA 2CXQA 3OFJA 1Q3HA 4PBRA 2QD4A 2X9NA 4Y2SA 3ROXA 1KP3A 1J25A 6ADHA 1C4OA 3N2GB 4UBLA 3R40A 2NV0A 4QELA 3SNKA 5JQGF 3P9XA 3I1IA 2V7GA 4UUOA 4P08A 2DUUA 1JJBA 2X2OA 4MJ3A 1RRFA 4NS1A 4UBNA 2NU6A 1NLUA 2YOFA 1WF3A 5EVJA 5A1JA 3E2IA 4MXDA 3SMQA 1NR7A 4PANA 5CFZA 5AVYA 4YY3B 4U7DA 5U1PA 5KYGA 1Q1ZA 4DJAA 4ZYTA 1Z12A 2P1ZA 3OKCA 5KEIA 5D2CA 3KVYA 2V9CA 2SCUA 1GPAA 2Q5EA 4BNKA 2ZIXB 5HQTA 5J43A 2R1TB 1TT5A 3JVDA 3IP6A 2RMKA 3DM9B 2QYTA 2JD1A 2P9TA 4GYYA 4KZKA 4QDZA 5IKOA 4YRNA 2E82A 2RKWA 4PHCA 4Q4HB 2F64A 5AI6A 4RGYA 4BCBA 3CC8A 4UM5A 2NVUA 1OLSB 4TSFA 1TOAA 3WMRA 2DQYA 4EI9A 1ZI6A 5IC4A 2MJLA 3ZE6A 2R84A 5DTMA 5BSVA 1V41E 2Y8EA 4BLUA 2QRPA 5T4EA 4Q19A 4AF6A 4B3RB 1ZIXA 4XTCS 1WZ2A 3Q41A 1QHHB 3FCEA 2FUCA 2OBFA 1P9LA 1CJCA 5F1PA 2IV7A 3ENZA 2RG1A 3CUYA 4PIPA 4FOLA 1EFCA 1T8SA 4Q4LA 5CGZA 5CFLA 5FQNA 2P6PA 4LHEA 1XU7A 3PHLA 4D41A 1JSZA 1EB9A 1ORTA 2GD1O 4CDGA 2NPIA 1EK1A 2F1JA 2FQQA 2VHVA 2VXYA 3BMQA 4OOEA 1G2OA 3WJ7A 1F7VA 4OQNA 1JE1A 3T5GA 2KLHA 1ZITA 3RARA 3C3MA 2R8PA 4JT8A 5B1YA 1Z47A 1VKJA 4COKA 4H18A 3H05A 4DXHA 2GYUA 5J2TB 1ZM2A 2C1EA 1KIAA 3COPA 4JYPA 4XR4A 5TDHA 3T38A 2DBQA 1Q6YA 1GGFA 3IX7A 1AE1A 3OOSA 4NBKA 2LP4Y 3N7TA 1AKUA 3TLZA 4GXRA 1VLVA 3WK6A 1NOJA 2EBFX 4GQIA 4NYMQ 1JIJA 3PWSA 3QGMA 3QVKA 3DEIA 4N76A 4NLLA 3IJPA 1GNRA 4J9UE 1DCFA 1WPXA 3B8HA 2DETA 1INLA 1ADGA 1IZ7A 3SJZA 1EDZA 4X84A 1T5DX 4HB0A 4JLOA 2F9MA 5CW1A 3U9SA 4KUGA 5KSOA 4JXJA 1NUPA 4DG5A 4NSNA 1VKHA 3UEOA 1LS6A 4UJ3A 3IPAA 4JJFA 5JG7A 1QYIA 1LNSA 3RW9A 4BKPA 1B23P 1TW2A 3C7DB 5I6DA 1QYRA 3CPHA 5DYYA 3H1FA 4G0XA 4ESEA 3SJCA 2D2EA 2I3GA 2OAP1 4KL8S 4O6VA 3SX0A 1JHQA 1H3NA 3GLIA 3C3PA 2V6MA 2JLBA 3ZBTA 5A9SA 5G1PA 1OT3A 1SCIA 1W4AA 3IOBA 4CG2A 2OZKA 3RT7A 3ZIUA 3I5AA 5IFKA 4CQMA 4QPPA 3G7SA 4DC1A 1PT7A 1TXGA 2YC4C 1XN1A 1RCFA 3BK1A 4X8OA 2ID8A 1X38A 3UW3A 1PSZA 4ARAA 3TG8A 2XYVA 3MRVA 4RH0A 4ZI7A 3OTIA 4NDNE 3VR4A 3P2IA 2HTFA 2R11A 2ZM6B 3L79A 3L40A 3OIFA 3B7WA 1E1RA 2PN1A 2Y1EA 4UBJA 3I39X 3EVBA 4KACA 4DGSA 3P9IA 1ZCFA 1J90A 1V8OA 3SQOA 1R27A 3ZY2A 4EG3A 2DFNA 5DM60 1G16A 1EH5A 1DTSA 1YZNA 1V7PC 2HA0A 1FE8A 1V95A 2J5XA 2OZEA 1GJRA 2ZKLA 1UEIA 3WBKA 5KSZA 3ZDBA 3EUWA 4URHA 1QHIA 1D4FA 2QRQA 2XJ4A 4XJVA 3QTTA 4CT4B 1GPH1 1G20A 1N7HA 2GAAA 3A28A 3VZQA 2XYGA 4C6HA 1UM9B 2Y71A 1GT6A 2C03A 2J6HA 1Q7BA 4QC2A 5D87A 3ABOB 2KMLA 1IWPB 1E89A 1GRVA 3JALB 1N1MA 2PMFA 3ZHSA 2O1WA 1WXHA 4G1VA 1UOEA 2PIAA 3CXRA 5EQTA 2JIZD 3EVAA 2DYKA 3NCTA 1ZNWA 4YMVA 2VDLB 3AGQA 1I6KA 1RADA 1SKMA 2JAQA 4KVAA 3VVBA 1GRRA 3VH2A 2R7NA 2OZLB 2QR3A 1AXEA 1D1SA 4I2VA 5HJ5A 3G13A 3PXAA 1TZMA 4GI3A 4J94A 3IA7A 4XYBA 3C97A 3AHEA 3B8EA 1BDIA 1RLUA 1WMFA 1AGXA 3SYNA 2IYSA 2OHGA 4QVIA 2ZTHA 3ODPA 3C14C 3FLBA 1LC3A 4I4NA 1U0NA 5DXFA 3QWFA 1BDHA 4KH1A 3N7UA 2OQ2A 3BC1A 1V2HE 2H7XA 2J3MA 1MXHA 2LWIA 3DONA 4GPZA 4ZU6X 4QM6A 4DSUA 1OB2A 2LIPA 2BMJA 3E9MA 5C46F 2P2DA 3PPYA 1BQ4A 1SG6A 1BDJA 1ZCZA 2B5OA 2WM2A 3BXGA 3U9TA 1WABA 3FTEA 4EJ0A 3TSAA 4BY9E 1CUVA 3KT3A 3HP7A 2JGKA 2P9EA 1UMDA 2VVTA 3QE4A 5J58A 4EY7A 3GEPA 2OA0A 3T0FA 3CF4A 2Z43A 3LPLA 2HWYA 4M0DA 3LUFA 1N5IA 3V46A 1O97D 2GPBA 2VYVD 4TV9F 4KPEC 4TWIA 3Q3GE 3WYFA 3T3DA 1T2UA 4KQKA 5DGXA 2Q3JA 3UOWA 2J31A 3FOCA 4QPDA 4AMZA 4BIMA 3HH8A 4N0DA 1J2RA 4LVUA 1N8KA 1XF9A 2RK3A 3AXTA 3HEAA 4U5QA 2CBZA 2WU0A 4XE5A 4BX0A 1FZTA 1S5PA 1QRAA 1DWUA 1SU7A 4BNNA 1WU7A 1DADA 2V3WA 1BMFA 3EZLA 5EWMB 3MINB 1MGPA 4M9RA 3WA7A 4WLNA 4LNHA 3WRYC 1NJSA 3O38A 3KSDO 4KR0A 3KIPA 4M7OA 1KQPA 1PFUA 2TMKA 4L57A 3LT4A 4NX2A 3TSYA 5A06A 1XPRA 3ADCA 1WUYA 3ZCPA 4D9NA 2PWZA 1NXPA 1EWYA 3A6EA 3PSAA 1GKUB 2CEKA 1G1MA 2JLCA 4ICIA 4R2MA 5AKXA 4TM8A 4OBBA 5E6UA 3JZIA 4IVPA 1WTCA 4OXXA 5ERYA 5FOXA 2C1XA 5AHKA 3VPCA 3WSTA 3AINA 4F7DA 1MO2A 3DAPA 1AUXA 3Q10A 5E4YA 3H75A 3UCFA 2FA9A 3OJ0A 4Z7NB 2JIDA 4IJMA 4URUR 5TV2A 1U7ZA 2RI6A 3JYOA 3K1AA 3P1JA 3U37A 5SYMA 4X9XA 1E8DA 2CXTA 2FMIA 2QUIA 3EH2A 5IVDA 3U19A 2X2FA 3LSTA 4C2BA 1ZGAA 4U9UA 3Q0TA 3A6HA 3HCEA 2HXGA 5K5EA 2H54A 2OK7A 3GW8A 2FJUA 3AY0A 1M8KA 1GV1A 4YGXB 5FL3A 5FDFA 1XPOA 1G20E 1G5TA 4YXWD 5J4YA 1YDWA 3UUGA 1JEEA 4PTLA 1VLMA 3LDFA 3UICA 3F9CA 3MT8A 3KLOA 1UKAA 3QBTA 2DWUA 3MMPA 1LLDA 4DW8A 1HDXA 1Z7YA 1QKJA 2PT5A 4FJ2A 1DC6A 2BCJQ 3ZPXA 1X74A 1P8AA 1CZNA 1VGRA 3H6GA 5DCUA 3HJHA 3UV7A 1FUKA 4QYTA 2WHQA 4O2BF 4MGZR 2IW1A 3IBTA 4JGGA 2CY0A 3B6ZA 1DBWA 2WTNA 3DVSX 3ETJA 2QL6A 3AUYA 5BR8B 4ZXFA 4RZIA 3CW8X 1NXTA 2BFFA 2ZYIA 1AM4D 5TF0A 1HKUA 3OZCA 2JVJA 5FOTA 3R7DA 3QXSA 1U0GA 5ES3A 3LLMA 3HN7A 2ZRAA 5F77A 2R8ZA 4Q4AA 4HPWA 1VYTA 2F9FA 4ZRMA 1I13A 4KMSA 3VISA 1HQYE 1L8LA 2FJPA 1DO0A 1PYOA 4G9GA 4KPGA 3RHTA 1KAGA 1DC5A 5C18A 3L4BA 2KQUA 1H0RA 3WMFA 5B6PA 4DYVA 1BX1A 1N5KA 2CLOB 3NBFA 1LFAA 1TLFA 4BMCA 3ANYB 3E7FA 3ZK9A 2BUBA 1EPUA 4Y9UA 2EV9A 3P9PA 3I9KA 2J08A 1QF9A 4O5AA 1VE5A 5TIIA 3FCUB 3DOUA 1LPPA 3RS5A 4AZTA 4JDPA 1S96A 1KHHA 3I6YA 5ER9A 3A6DA 3CN9A 4MA4A 4PVDA 1H8HA 4J2TA 1EUDB 3P5SA 3E22B 4EPRA 4E14A 1EGAA 2A30A 3KYIB 1W5BA 4LDJA 4P33A 4QUIA 4IP0A 1AN9A 4LOLA 1QOQB 2GVZC 1AV7A 3G8BA 1JILA 1S8OA 3BSFA 2ZXUA 5K3CA 2YFKA 4KHZA 2ZIEA 4M8IA 1M8PA 5CURA 3T41A 5C80A 4EUEA 4MMYB 2A1IA 3DZHA 4QDJA 1Z18A 3OBIA 4AZ3A 1PK9A 4G5GA 1RYEA 3KETA 4IVQA 1V8ZA 2E4XA 3GAMA 5FH9A 2Z1MA 4YTEA 5CLGA 2BSQA 1T3SA 3U3KA 3DKRA 2J7KA 1GXSB 1F8FA 1DLJA 3IUJA 1PT9A 5FJIA 5AHOA 3GT7A 1O94D 2TECE 4AQ7A 2CVQA 4M98A 4C08A 3ZHRA 3PQ4A 3V2HA 5IMBA 1F12A 2H0RA 3W2IA 3O7WA 3AETA 3L1KA 4L07A 2FHSA 2W58A 1HG0A 3FTCA 5EWLB 4TTAA 3BFJA 5ESWA 4BFVA 3AFHA 1NBME 3C5CA 3FUCA 3IE1A 1Y1LA 3OCUA 3PQCA 4FFVA 3UC5A 3MWYW 3FCOA 4KGVA 2PL9A 5EIBC 2WAOA 1HOXA 4UMEA 2BE7A 2FFRA 5AUQA 1USKA 2GEUA 3KQVA 4ZODA 3AESA 4P98A 3ICEA 4IKPA 4MI9A 3ZWNA 5HR5A 1SUSA 2B5WA 1I4OA 1C9JA 1JXMA 1J00A 2FPPB 2FZWA 2FEMA 3ZCRA 4RVDA 2HKIA 1LUAA 2VTEA 4JFAA 4PX9A 1G291 2PRIA 4GBMA 4RMIA 4DR5B 2Z57A 1BW9A 3EXFB 5F1KA 2PZKA 1YIOA 4Q01A 1IUNA 1F2UA 1ZD4A 4XD7D 1QS0B 3OO0A 3AVTA 3U3JA 2KYRA 5D84A 4B1FA 3S1SA 1BE0A 4HKTA 1SUBA 2PSHA 4PSCA 1L5SA 2GN9A 4PS1A 1U1FA 1X8LA 1XTKA 2YN2A 4Y6LA 3ELUA 5JS1A 4OJTA 2CXOA 2DLCX 4J90A 3ZS9A 1V4NA 4ITVA 2R2AA 1HH4A 3AUSA 3QUQA 1B6RA 4FONA 1R9JA 4PPFA 3OZWA 3L0CA 1MA0A 2QRVB 5HCIA 4BB5A 5HZMA 2RK4A 1G5IA 3GQVA 3OIYA 1UDRA 4O8CA 5AM0A 1VHQA 2PBLA 3DTVA 1QYWA 3KXIA 2WTUA 1AN0A 2QLBA 4XWKA 1K08A 5J2UA 4FOOA 1FPQA 5HKKD 2G9RA 3CX4A 3G0GA 3BB4A 3OD5A 3O9VA 5JNSA 4K26A 5CCXA 4KHPB 3UUFA 2FR0A 3GHHA 1U0JA 4LE1A 4MRNA 3MWJA 4HTAA 1Q19A 3LT1A 1YQXA 3O21A 4HLCA 1EHYA 3BMNA 5FJJA 2VSYA 4DCJA 5JPCA 3L7DA 4Y2RA 2Z3ZA 4CF6A 3EVCA 3IPRA 2AJCA 5BV2P 1NY5A 3ND7A 1JU4A 1FTYA 4QX6A 1H4VB 4L4SA 2ZJBA 3OQ1A 3CKYA 3IDSA 4KLAA 2FPWA 3ZJYA 4KH0A 3CPJB 4CETA 2IU3A 2CXXA 3FI9A 2ZBFA 1QJ4A 2CFCA 3LCCA 3OPMA 3TKLA 4AO8A 4C0BA 5LMZA 5F3WB 3L1JA 1RWBA 4J8PA 3ZD8A 1M1XB 3TINA 1B26A 1KJ9A 4KR7A 5T8KC 1USIA 2IH4A 1WKVA 1DAHA 3C3JA 3JD0A 3LK6A 5I9NA 1GGMA 1VA4A 2NNWB 3UMVA 1RBZA 3GLKA 4HYYA 4NBUA 4Q02A 4TVSA 4HNUA 3R75A 3JAMA 2A2ZA 3VXKA 1Z0DA 2O2ZA 2V8OA 3NR2A 2UAGA 2IVFA 3VNAA 2KBEA 3VKWA 1G6KA 2WD7A 1O9BA 2IW3A 4RY9A 5TF4A 4DDVA 3AR2A 3VBCA 4KXQA 5AIAA 3TG2A 5CB4B 5IDXA 3KL4A 1W5AA 2CL5A 1MOSA 4IX1A 1CR4A 3WB9A 4JT9A 1A8UA 3HYCA 2CDAA 3L6DA 3W9SA 2DFPA 5KX5A 3F2VA 2YYZA 3LMKA 4B8YA 1C80A 1KDOA 3ED1A 4ZCMA 1N36B 3G02A 3BH6A 3T5MA 2IDKA 5LQRA 3GFGA 2H2FA 2GN0A 3PKJA 1LI4A 2GEJA 2GZAA 5ESXA 2V5VA 2F1KA 1BHQ1 3E1SA 4NZNA 4PYKA 1T2EA 1NUSA 3HA2A 4TRRA 4D6YA 3DMPA 2HAEA 3LTNC 4TPKA 1T5TA 5F5LA 1OX5A 1CVIA 2B3TA 2XVZA 3MZ0A 4FFOA 3RCBA 1I0IA 3KUCA 4RY0A 3NUZA 5H1YA 3K8OE 2FPMA 3RK0A 2G7ZA 4FFBA 3WDKA 4J07A 1ESZA 2KJQA 3EZ6A 1F2TA 2VT2A 1I6MA 3AY6A 3YASA 2UYOA 1WS6A 4JT4A 3W1EA 2WJZB 1EE1A 3CF6R 3FWKA 3N05A 4X7BA 4ZO9A 3X1KA 2HT1A 3AEZA 3ML1A 3NWOA 1Q0TA 3PUIA 4N3GA 2CFTA 2A84A 1H8ED 4UAUA 1RRPA 1KYXA 2AF3C 2FPXA 3JYQA 3KKPA 2P68A 4Z9FA 4ER6A 1AD2A 4D1YA 3F0TA 1U98A 1WXIA 4G8JA 2OKCA 1Q3TA 5H3HA 1U1CA 5A4DA 1T8RA 1U8FO 5ERGB 3WWEA 5AQ1A 2NTJA 2HJRA 2MYTA 3QG1A 3U3DA 2C5LA 4DMFA 2G1PA 4DGQA 4FMDF 4MP8A 4YR7A 3A9WA 1E79D 2XWPA 1GGNA 2DBRA 3CNQS 4JUIA 5M34A 4MRRA 2P3SA 1NQAO 4FYXA 1MJGA 4R8VA 3EDOA 2N9UA 2VHZA 2OGUA 5LDGA 4N1AA 3BXOA 4F97A 2NU7A 3P32A 3V4FA 1M5TA 1O6CA 4C2AA 1XKTA 2BMAA 2DE0X 1EX9A 3WAKA 5DT2A 5E8RA 4QLBA 4MLDA 3ESRA 2AR0A 3TVYA 4YDRA 4BV9A 5H8WA 4NCHA 1T6BY 3LK7A 2NO6A 4GZ3A 4C07A 3E8SA 4TOIA 3I6QA 2REQB 3HI4A 4GRIA 4M7WA 5CA0B 4A9AA 5IJ0B 2WIFA 3P9NA 3G85A 1Y3DE 1A50B 1NXXA 4FXPA 5ALHA 5DNVA 2CLFB 2VSFA 5IF9A 2AJTA 1MNQA 2IEBA 3HFSA 4OO3A 1JQEA 1ZSVA 3N53A 1QX3A 4UCXA 2AFHA 3WKEA 4CLRB 1N5RA 1YI8A 1S8AA 2HA3A 5JH7A 4ZZ0A 1RHKA 4DTIA 1PW5A 1Q15A 2W00A 4EEKA 1BD3A 3ETNA 4D0LB 1PWYE 3SF0A 5JQWA 2Z5FA 5JSUA 1K7SN 3MIIA 3L05A 4IIXA 5BORA 2XMDA 2Q3CA 2QJTA 2KI5A 2IELA 4UDYX 3NNNA 2ZSBA 3KUXA 4O4HF 3L6BA 3MERA 3UV3A 1G59A 2XXAB 1OBVA 3FSEA 1IQPA 1KI7A 3M8KA 2Q0HA 5CFOA 1YNSA 4Y2YA 1SR8A 5EHZA 4DSOA 2HWKA 1POXA 1T8PA 3HLKA 2OWEA 2BHRA 1GXSA 2Y66A 4W8GA 4AFNA 4QOHA 4DLTA 2F3RA 4U2GA 4DZRA 4P0QB 1Y7LA 2FN3A 2I7CA 4TLLB 4YPOA 2K2QB 3ZLVA 3N59A 1H1LA 1WOYA 3DE1X 3DYIA 4D0SA 5A03A 1L7EA 4FSXA 3DHVA 2UYGA 3MLEA 1HNZB 3I05A 4ZHQF 2EZ4A 2ZT7A 3QF4A 5DTIA 1JIUA 1JLSA 2EQAA 1K6JA 4GZ5A 4WMLA 1NQXA 1AQJA 3CW2A 5GVRA 4WJLA 1JHOA 3DEFA 2AOXA 2Q1YA 4GGOA 2NZYA 4ZVOA 5EP1A 3RHSA 3R8FA 3MUNA 1TL7C 4N6OA 4HYEA 1Z36A 3ESAA 2W2XA 1QYDA 1LVGA 3KP1A 5TEVA 1JMVA 1ONNA 2GN1A 3MS4A 3UK6A 1DKRA 1Y6RA 1G4HA 1VXOA 4E2ZA 1ZQ1A 3SQMA 1HTTA 3T1QA 4PS0A 2QXUA 4S1WA 1L4KA 4G89A 2O2SA 3UJCA 5EHGA 4IXTA 3CLTD 4QOEA 2O4CA 1LVHA 5JNUA 5IAGA 2HC9A 5DM1A 1CQIB 1LBHA 3N2IA 3JQGA 4NV3A 4X54A 1M8FA 4UNRA 1Z4IA 2GFIA 1HSOA 3L46A 5AK5A 4A36A 4INAA 4MVJP 4WFQA 2R4UA 4D9BA 1QGED 1E3MA 1UDBA 4LMBA 3PYLA 2R87A 1U8ZA 2G5GX 1ZDMA 2VNJA 5H82A 3HZZA 1J23A 5GONB 4E03A 4AKIA 3EA4A 4F21A 3U39A 5K0EA 2A33A 3AF2A 2EATA 5JFOA 3E22A 4CLEA 3ETCA 4IIJA 2Q9BA 2HLPA 1I3NA 1L1RA 3P0JA 1GL7A 4RVOA 1ZVKA 3PD0A 1ZPDA 3M6AA 4P3OA 2YJGA 4O1HA 3IBSA 1T3GA 1NVUQ 1EVIA 3ESZA 5JECA 2P9CA 1A2QA 4ENRA 4MH0R 4XWTA 3C7TA 1N78A 1PK8A 4I4TF 1AKQA 2G04A 2OAQ1 3L0ZA 3MCTA 4FGLA 4Q82A 3NP9A 4RD0A 1O8CA 3LX8A 3WWYA 4QYWA 4E6PA 3ET5A 4IJKA 2JCVA 4UPVA 3ZWWA 3NTVA 3GGOA 4DKXA 2H06A 3EVNA 4MUMA 2ZIWB 3T3MB 1P77A 3PA6A 3EYWA 1X8JA 4EJSC 1K7YA 3SYKA 2GNPA 2HU2A 4HNAB 4IDPA 1DBVO 2V97A 1NFQA 3IIMA 4M1OA 2KM1A 3QKSB 4K6KA 3C48A 4QG7A 3DLPX 3NB0A 4MGHA 5IDYA 3I2FA 4KFCA 3IAS1 3IHKA 2GPJA 4K6OA 3UUWA 1YJAA 2QN1A 2WYWA 2C2KA 3ROFA 1JNYA 4B73A 3EEFA 2XBLA 5I4KA 3R0JA 1AQNA 2X1HA 3B1YA 1GQQA 1M74A 1T1GA 4TMYA 1QZTA 4YS6A 3RVOA 3GNTA 4TV8B 2VJDA 3OO1A 1C0PA 1CY4A 1R6UA 3VZSA 1W2WB 1XI2A 5F51A 2PR7A 4CKCA 4UFPA 4YUZA 4MOWA 3MTDA 3ZHOA 1CBUA 4S1VA 1YVRA 2BUCA 3BCUA 4GLLA 2G08A 1J5XA 2BGTA 4PXYA 4YACA 5GGYA 3IAAA 2CNBA 3Q3EA 3S2IA 5BR4A 5KX5B 2BEUA 4HN9A 5AM1A 3WE7A 4DV1B 2QLMA 2P40A 1KY3A 1X3SA 4ARVA 4M1SA 1ZGZA 3T3OA 4UFOA 2ZPUA 4KPFC 1EINA 5LQCA 3GJ4A 1GGHA 2W43A 1XMQB 5EKDA 4MVJD 4DXDA 1BH2A 4AURA 4EBBA 5JNTA 3AR3A 2FZLA 1HQCA 2QS9A 1IM5A