2J5XA

Structure of the small g protein arf6 in complex with gtpgammas
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
NKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ADP-RIBOSYLATION FACTOR 6
publication title The Structural Gdp-GTP Cycle of Human Arf6.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j5xA00
1RW4A 1Z6XA 1DBSA 2WMOB 3B13B 3KFVA 1IOZA 4RFSB 1NSFA 3B8HA 4IOLA 1G7RA 4JL6A 1HQCA 3PG5A 1XTRA 4LHYA 2G3YA 1VYUA 4XVRA 2QSZA 2IF2A 2ZQ5A 4ARZB 4DLYA 4EJSB 4C2TA 5BYJA 1S96A 2V1UA 1KAGA 4PO9A 3R20A 4AD8A 2JIZA 4D26A 1A82A 4OQLA 2J1LA 5FPKA 1V43A 1U81A 5BXQC 1RRCA 4P33A 4EUNA 4RZXA 3UANA 3CPHA 3CX7A 3WBJA 2Q9CA 4BFSA 2FFHA 1ZCAA 4GOKA 5C18A 2IYUA 3DOEA 4M1TA 4NP6A 2IYRA 1C4OA 4IFEA 1O87A 4C0QC 3RWOA 1BYIA 4POAA 4Q7MB 1I4LD 2PZFA 2DHRA 4QGFA 2X1VA 4A92A 4AG6A 2ZRLA 4BLPA 4QKQA 3KJEA 4HLCA 3NDPA 1PLLA 3U3JA 2AK2A 3MMPA 3BH0A 4B74A 1AKEA 1JAHA 2ORWA 1NLYA 2ZUCA 1Q3HA 4BFVA 3L0IB 4YMTA 2CLSA 3IBGA 1TU4A 1A1VA 4M0LA 1IJEA 2FNAA 2GF9A 2VHUA 3VU9A 3ZYCA 1DO0A 2UVQA 1OH7A 1TUEA 4NCJA 5BN3A 2QZ4A 3QBTA 4KVAA 4TL7A 3QPWA 1Z2CA 2Q3HA 2AFIE 3IEVA 1Z47A 1IN6A 4D4JA 2OXCA 2J0QA 4J0QA 3X2SA 4LRWA 1XJ0A 4LJ9A 2QG6A 3SS8A 2YNMA 5LB4A 3KQUA 1P5ZB 4BLSA 3EA0A 4TMZA 4F7WA 2EVWX 4E5UA 3A1TA 3QKRA 3QXSA 3SYNA 1F48A 5DN6A 4ESVA 3AF3A 2J5XA 4NH0A 1NVUQ 3I3SR 3LBNA 3GEEA 4EPRA 5AUOB 4B43A 5KHOC 3W34A 4Z1MA 3X1XA 2OCYC 2OHFA 1FUUA 2ZS9A 4MDFA 1XJCA 5JFGA 5LB2A 1P75A 1ZYUA 4LPKA 2VQSA 2EQBA 2YHSA 4QOSA 4TN1A 1GWNA 3P4YA 1ZNWA 3W6OA 4LV8B 3T06B 2ZSDA 5L3SA 3QXJA 4GT1A 4ZDKA 4A2QA 3BFVA 4IVPA 2VP0A 4HB0A 5EP3A 1CJMA 2HLDA 4UNSA 4B2LA 2CDNA 4LI0A 2Q21A 1WP9A 3C8UA 4QJ5A 4BLQA 2C5LA 3FFAA 5EE3A 3GCGA 2ZAOA 2IA5A 2VP5A 3B2EA 2CEAA 5FBVB 1RPZA 1WF3A 4C4PA 3QVVA 1E4YA 3WP1B 4RD3A 1YRAA 1Z2AA 3BIFA 4QM6A 4DUGA 1Z63A 4XWAA 2HF9A 3AQ4A 2ONJA 5EP1A 4MKGA 2ZRIA 1KI3A 4DLZA 1D6JA 3FE2A 2C77A 1AJEA 1M7BA 3MD0A 3CX6A 5CB6A 3HYTA 3T1OA 1W0KA 2WWYA 1J2JA 4M9XA 3R9XA 1JJ7A 1E9FA 2JLZA 2WWXA 4G1UC 1G64A 4EPWA 1KI7A 2OE2A 3VU9B 4PQFA 4Q9JA 3EZ6A 3RDPA 3TSZA 2JJ8A 1J70A 3ZIAD 2RGEA 2QY9A 5EUQB 5FPHA 2F9LA 1D8TA 3P32A 1NI3A 1E9AA 3ZJYA 2CHQA 2WJJA 3Q5EA 4OI1A 2HF8A 1T8TA 2N42A 2VTKA 1JNYA 3KUCA 2XZOA 1TQ2A 2QTVB 2P0EA 1H8HD 4XSHA 3AUYA 3CRQA 2A5DA 3CPJB 3I92A 2QUZA 3PITA 3WY9A 3PIRA 2O0HA 3T12A 1U9IC 2QAJA 3LBIA 1ZMXA 2J41A 5GVSA 3DZDA 3OEED 2OT3B 3QKRB 2HEIA 1N0VC 1Q21A 1VDZA 2XSZD 1IJFA 4LV5B 3P26A 2HJGA 2ORVA 2WBLC 1EX6A 5SZKB 1NY5A 1OH5A 3LA6A 1KO8A 1N5IA 5FI1B 3K8YA 5FBWB 1RIFA 4NYJR 1DAMA 2FPLA 1GOTA 1HURA 5H1YA 3TR5A 1S1CA 3SQXA 1OHHD 4DIEA 4FWIB 1Q1QA 3UMRA 3SR0A 4DVGA 5L3SB 5JEEA 4O25A 3U3RA 1VG0B 2QRNA 5B30A 2WWHA 4RCYA 1E2IA 2CK3D 3NHAA 4JLJA 4Q19A 2OSBA 4PC7A 4RD2A 4HYYA 1F5NA 3HPQA 1US8A 2D74A 2WJGA 1XU4A 4XTCS 4QJ3A 1XEWY 2I1VB 3RS2A 4OI2A 5FOWA 1IY1A 2ZIAA 1NLZA 2XTZA 1MO3A 3BH7A 4MH0R 5TB5A 1JR3A 3I72A 2O52A 4CT4B 2BKUA 3A4LA 3R8CA 1IONA 3LD9A 4BLRA 2EYQA 3BFKA 3PEVA 1KZ7B 1S8FA 4DCTA 3CO5A 2X8AA 1M8PA 4N0DA 1XPUA 2XEXA 4NHOA 1E1RD 3QG5A 4LYFA 4TSFA 1QBKC 3NBYC 5CYPA 2B92A 4LPSA 4HB4A 2BEKA 3OHMA 5FOUA 1GITA 3NKVA 1WBDA 3TW8B 1G8GA 1IXRC 3QF7A 1TF5A 2ZETA 2X2FA 1CRPA 2BJWA 4GOXA 2CE7A 3WNCA 1GL7A 1OV4A 1P2TA 3WHKA 3U60B 1Z28A 1ZP6A 3Q9LA 4L8GA 5DSZA 4Q1CA 2YYZA 3FYHA 4ZKEA 4NCHA 3VR6A 2J7PA 3LV8A 4XD7A 3CUEF 4GP6A 521PA 3OEHD 3CLVA 1ZM4A 4OKSA 3GLHE 3FKQA 3TGPA 1RYFA 5KPJA 3M1IA 1D2MA 4KV9A 1KKMA 2NOAA 2E87A 4A1FA 4BPBA 4UXJA 4M22A 1CR2A 2REXB 1P3JA 4V0MA 1LF0A 3U2QA 1MABB 2Z5FA 4JBXA 1QHNA 2QQ0A 4D0LB 3LBHA 4XVQA 3FTQA 3LW8A 4GOJA 2DFTA 3SJAA 3U7GA 3EZ7A 2QROA 4H9GA 2W83A 3T1VA 2OG2A 3K0CA 3DKPA 4F38A 3VKWA 1RRPA 4ASUD 3AM1A 4TQ9A 4AC9A 4BECA 2Q9BA 5EXSA 3IEUA 3AVQA 4NMMA 2WWFA 1QVAA 4QNMA 2CLCX 4PC6A 2IYSA 4DSNA 4WA7A 3HP1A 3PEUA 2WOJA 3TW4A 1G3QA 1LNZA 1Y63A 4I1SA 3SZRA 4LOAA 4FW9A 4V0OA 4G5OA 1DO2A 3QKUA 4CEIA 2JJ2D 1K6MA 2GTPA 2I4IA 2ZAMA 4B33A 3EX7C 2NG1A 3MRSA 1P2UA 5JMTA 3RHFA 2MSCB 1S0UA 3L8YA 1US8B 1GILA 3X1WA 1MH1A 1G8FA 1BKDR 2GKSA 3BFXA 4TYWA 5KDDA 2Z4RA 1XX6A 1L2TA 4QFMA 1MO5A 4IJMA 3SJZA 2O5VA 4KCGA 3CF0A 4ABYA 2FWRA 4KYIB 4DLVA 5KYKA 3ADCA 1D9ZA 1DAKA 2JJ1A 2D4HA 2ODWA 1DVRA 1G41A 2FMXA 3HPRA 2CE2X 3SJCA 1XJQA 2FPMA 2BM1A 1OXTA 2G0NA 4AKIA 1QZXA 4GNKA 1OLOA 3ZS8A 5IF9A 1J90A 1NG9A 2YOHA 3W8NA 4PC2A 4EIWA 2D06A 2GVZC 3CRW1 2ZU6A 2AK3A 2REBA 3RRMA 5JECA 1E2GA 2BCGY 1XFAA 5P21A 4QGHA 3HWSA 1CR1A 2I3BA 3F8TA 4GPTA 3CX8A 1FTNA 1K8RA 4JSTA 4M1WA 5JCPA 5JLJA 4ZDIA 1XD8A 4ZI3A 5G53C 1SVSA 4HAWA 3EAQA 2PLRA 3IBYA 3LY5A 1WBBA 3U6BA 5JJLA 4V0NA 2WWIA 3LQQA 4JLNA 4HSEA 3PUXA 2PEZA 2A7QA 3KB1A 2F3TA 4LJ4A 1W46A 4LY6A 4EPXA 2NO7A 4L9SA 4FCWA 4IVRA 1C1YA 1IXZA 2FU5C 2OAQ1 4GSYA 1ZRHA 2PX0A 2JLUA 4URWR 3U7EB 1G8YA 1DARA 1GSIA 3ZZUA 1T3LA 2V55B 1CP2A 2LKCA 3GJXC 3LW7A 1N2CE 3T5GA 1A7JA 2B8WA 1UADA 1TTTA 2HDNB 5DE3A 3WRXC 1GZSA 2ZEJA 1YR9A 3FMIA 2Q6TA 2J0SA 3UXMA 1E2KA 1VKJA 4CEIB 1P2VA 1P6XA 1KAOA 1KY3A 2ODNA 3D8BA 3I62A 1XD2B 2TMKA 1Z06A 1G3RA 3X1DA 1GNRA 1DE0A 4MA4A 1E96A 4NCIA 1Q3TA 2PEYA 4C0KA 121PA 2ECKA 4R7ZA 3U3KA 1N6RA 3THOA 3W6NA 2ERXA 2J45A 4BE7B 3OFND 3CNLA 1W7AA 4DLRA 3OF5A 4A8JC 3H1TA 4HB2A 4TYYA 2BEJA 4M9ZA 4V03A 4EJSC 3GLGE 1E9BA 1KGDA 1QHSA 1XD9A 2VSXA 1II9A 1RFLA 5FTLA 3V4FA 5EXXA 3VKGA 3U7HB 2NTYC 2QRZA 5K8UA 3D7MA 4PX9A 5IK2D 1YJ5A 2ZRGA 2VP9A 4TWZA 1XTJA 3RC8A 3CNNA 1R2QA 3H4MA 2WSSD 4Q1FA 5JJKA 3NWJA 1ESNA 1Z22A 2A2ZA 5DI3B 1W44A 2RCNA 2RH5A 3A1WA 1NBMA 1R7RA 1Z6TA 4IRUB 1AGRA 4IKEA 2CVFA 2GRJA 3H84A 3I8XA 1M6NA 2HV8A 4NKRA 4D6PA 4C2UA 1SXJA 4UXIA 2QE7A 5DYGA 1XMJA 4DJTA 5BN5A 3HU3A 4JKIA 1SQ5A 4DLUA 3T15A 4Q9KA 1EFHA 1GNPA 3GD7A 3QXHA 3UKDA 1IY0A 1O3YA 2Y8EA 1EGAA 1Z0AA 1PLKA 3B78A 1DOAA 5DIFA 3TIFA 1U8ZA 4Z8XA 3EW9A 4PPFA 4S35A 3EWAA 3H0KA 2R8RA 4BFZA 1SZPA 2IWRA 2DFKB 1YZLA 2QBYA 4YC7A 5E7MA 1OF1A 5DGXA 2FGJA 3OEEA 2PBRA 2QP3A 3FKSD 3OIYA 3EPHA 5G40A 3MSXA 3THYA 3EIEA 2CVHA 4DDTA 1YZGA 4ZPXA 3CH5A 2QORA 4O2LA 4P4SA 2LKDA 3IUYA 1FNNA 4LJ6A 4MQBA 2BWJA 2IHBA 2BCJQ 3PV0A 3KQLA 4HAUA 1E2NA 1KO5A 2AHOA 5CITA 1LW7A 1VIYA 1UDWA 1E99A 2QPTA 4HUTA 3CH4B 3AV0B 1Z8FA 1G18A 2GK7A 1NMXA 3B5JA 1YKSA 3CZQA 2EFHB 3A58B 3HYRA 4IDPA 2ZS7A 2O8DA 3B1XA 3RWMB 5AJYA 4U00A 5J5CA 4JBWA 421PA 4GDFA 5FL7D 4B73A 2VIIA 1IM2A 2PMKA 4JVNA 3GLIE 4BFUA 2VP4A 1QHXA 4KFSA 3TQFA 1L7VC 4C3ZA 3DM9B 3AVVA 1IAQA 2B21A 3SYLA 2EYUA 1ZBDA 4D2IA 2GJKA 4RZUA 2QAGB 1LS1A 2YWGA 1A4RA 2ZU0C 1LF5A 5JHHB 1Q22A 4X8HA 3EG5A 1NKTA 1ZM9A 2Z0MA 4LYHA 1CS4C 1Q57A 2A5GA 2MMGA 3LAWA 2ZUBA 1KZGB 4TTPA 1NVVR 2ZJAA 3T1TA 1SXJB 2JEOA 3BERA 1W36D 4JZKA 2RGNC 1U2RA 2VF7A 3SI7A 2IS1A 2V6JA 2KBEA 4JYCA 4TTQA 4M21A 3ZDQA 1IN5A 3HR7A 1J99A 1UKZA 1G1MA 3GLIA 1IY2A 2C99A 4DSOA 1E9EA 2ZUDA 2CNWA 4PHGA 4DB2A 4PPGA 3IQXA 3MWYW 1M74A 3QEOA 3RSOA 5HZKA 2A30A 2CJWB 4P32A 4TYQA 4FMCF 4C7OA 5AJXA 3QEJA 4DRZA 3B85A 2WJHA 1VHLA 4OQNA 1T5IA 4UNQA 5L8VA 4D4MA 2O8CB 3SJBA 1CU1A 2B6HA 5HR5A 3THYB 4WOPA 2I1QA 4HZIA 2WZQA 4FINA 1GKIA 2QA5A 2W0SA 5CIQA 1GP2A 3EARA 3S1AB 1J7KA 4P4SB 221PA 3R7WA 2A3RA 5CK5A 1Z0FA 4D82A 2MSDB 3PUYA 4RFVA 1ZC3A 4GRAA 2ZE8A 1DAIA 4I1VA 4Z8YA 1S3GA 3QY0A 1N0UA 2ZI5A 2W6ID 3LXXA 5EQTA 2XX3A 2ZSFA 3C4JA 1E2QA 4PSKA 3SBEA 1XTSA 1U0JA 1ZJ6A 3LX5A 1NG1A 4YMWA 2QPAA 2MSEB 1Z29A 2JGNA 1DADA 4HUQA 4KYUA 1YQTA 1RYHA 4E22A 4LHZA 4RVCA 5KSYA 3OESA 2QENA 5JZVA 2EWWA 3RS0A 4X8OA 3MWJA 1ZNYA 4LCBA 2C9CA 2JASA 2R6GA 3ZZ0A 4Q00A 3DL0A 3KFXA 5K8TA 1JI0A 2CCJA 1OXSC 2GNOA 5IT5A 3BXZA 1E2FA 3AKYA 3CPEA 5KO2A 4Q4JA 1MKYA 2ZYVX 3O8DA 1KKLA 1QHIA 3SU8A 1DTSA 4HZUB 4LC1A 1W47A 1NVXQ 5HKKD 2KSQA 1PLJA 1AN0A 1U90A 2F1JA 1ZU5A 2O0KA 4RD6A 5HE9A 4F4CA 4Z54A 2ONKA 3L43A 1OIXA 3BRWD 4WVFA 3FHOA 3PEWA 1UBEA 4AYXA 5M04A 3TSOA 4G5QA 1ZAKA 1XWIA 1KJYA 5AJWA 1KO1A 3A1SA 3LO5A 2ZREA 3D6TB 3LVRE 1ANKA 2PCJA 4OK6A 1SVOA 2DWOA 2V1XA 3KJGA 1FFHA 3B6EA 3ETLA 3LH5A 4M1MA 2R6AA 1DAEA 4KI0A 4C7OB 4PO8A 2P5SA 4UNNA 2BOVA 2XOKD 3QPVA 2ZI7A 1OFUX 4ACAA 4N1AA 1XMIA 1W36C 2YOFA 5JCZA 5JBQA 3KKQA 4QBHA 5TMPA 2OM2A 4CEHA 2BBSA 2BBOA 3ASZA 4EQ6A 3GFPA 2F1HA 4QNRA 1XBTA 3NTUA 1FZQA 1JAIA 2IK8A 2QMEA 1ZNXA 4ZKDA 1E3MA 1AZTA 1E0AA 1R6BX 1JR6A 2RGCA 3QENA 4ERNA 1E2HA 2ZYTX 3QKTA 3A36A 3EIHA 2H16A 2QM8A 5JHGB 4HAVA 4PAOA 2GK6A 1U8AA 1UM8A 3KXIA 3W90A 4G0NA 4IW3B 4D0GA 3PVSA 2WAXA 5GVRA 1MV5A 1N3BA 4C0JA 5IRCD 3RABA 2NZJA 4HUQB 2ZRKA 5AJZA 2EWVA 2DPXA 2OBMA 5KSPA 5C1BA 3RAPR 2FH5B 4PZYA 1JBKA 3RYTC 2HJVA 1E94E 2F9MA 2IYWA 1PJRA 4KXFB 3FWYA 3VKHA 4YXWA 4KSCA 3ADDA 4YQFA 4RKFA 1G19A 4OK5A 5CK4A 3W3ZB 3GJ4A 3OE7D 3OFNA 5TDHA 2WICA 5AUQA 1XPRA 4Q4JB 4TL6A 1EFCA 5DHAA 4OHZA 4GFDA 4BZXA 4TMVA 3U7FB 2RKOA 3BD9A 4PANA 1L8QA 3GFOA 2LCFA 4MITA 4AWXA 4A9AA 2DCUA 4RY2A 1YVDA 1LB1B 5C4GB 4KJZA 2YJTD 1NP6A 1A5TA 2W58A 1SHKA 4NTZA 4Q4HB 4B6EA 4DCNA 4L15A 1D9XA 5FTJA 4B47A 1WQ1R 3CKLA 3AUXA 2FF7A 1KSGA 3TR0A 3BGWA 2JAQA 1W5TA 2O0JA 1KNXA 2CMKA 4XWOA 1BIFA 2X2EA 1P4SA 2YVUA 4F93B 1SHZA 4Q1AA 1UDXA 1BO6A 2VBCA 2OLJA 2O8EA 1ZW6A 1BOFA 1M1YE 1OYWA 4HDCA 2F1IA 2H18A 2FN4A 3GQBA 3IGFA 4JVLA 4MRRA 5JRZA 4CEHB 4PR0A 4EQ6B 3B7GA 4LBVA 1P60A 4TT3D 3L2OB 2AWNA 2Z43A 4I1OA 3OAAA 4UNRA 4KFTA 1XTIA 2GHIA 4LYAA 4HATA 4OHWA 4GL2A 1P7CA 2C98A 1CJTC 2ZE6A 4K8OA 4M1SA 2R62A 5LPNA 1F6BA 2WKQA 2BMEA 3MAAC 4FMCB 4GBMA 4JS0A 3FKSA 2IUUA 5A0FA 5DHFA 3ZH9B 5CJPA 1QDEA 2ZR7A 1Z5ZA 2NO9A 5K8IA 1T3HA 4Y0VA 3AVOA 1WCV1 5F98A 2C95A 2CL7X 2JDIA 1KK2A 1G3UA 3OZXA 4IDOA 4TLCA 1AM4D 2OZEA 1E2PA 2QTFA 3PXGA 2REOA 2YWHA 3LLUA 4ZI2A 4G01B 4Q01A 2OBLA 5HCNA 1P61B 2VLIA 2D62A 2QMOA 1HE1C 4US1R 1GRRA 2B7CA 2WWWA 1TQ6A 1OXXK 1G4AE 2FSIA 2UKDA 2WSMA 3LVQE 1L4YA 4MKIA 2QM7A 5EE5B 3UWOA 4NYIQ 4II7A 4BZPA 3NG1A 5F9FA 4A6PA 2BMJA 2KB0A 2O8FA 1XNJA 3U4QA 1DEKA 1Z6GA 4HLDA 4QHTA 1KDOA 3JVUA 5E3HA 4URZR 4EDHA 5JSZA 1IN7A 4MRNA 4OQFA 4PHTA 1VCOA 4PO1A 1LV7A 1T8UA 2XTNA 5CLQA 5G3YA 1X8JA 1F60A 1KDRA 3AF2A 1BS1A 2GAOA 2VSOA 1PUIA 1W0JA 3LLMA 2H1LA 1I4TD 3BAFA 4Q9LA 3B1VA 1ELOA 4CVNA 2WV9A 3EZ2A 4BRUA 1XXHE 2P2LA 1E6CA 1S4QA 4BUJA 3PUZA 2WKPA 1M2OB 3O8BA 4DKXA 1Z07A 1JB1A 2WKRA 2DFNA 3AVPA 1OE0A 3EZ9A 4ZCMA 1RC8A 1HH4A 2ZXUA 2VP6A 3ZVMA 1E9RA 1AZSC 1N5LA 2CL6X 4LJ7A 4NCKA 1TEXA 4Q1DA 4C9BA 1ONBA 2RMKA 3FOZA 3ZZTA 1X8KA 2FZLA 2AN9A 1JALA 3CWZA 1GVNB 4LJ5A 4TMWA 2IXGA 4TTRA 3K70B 3A6PC 1E1QD 1UJ2A 3KJIA 1S9HA 4NYMQ 2OLKA 1Z0KA 2GBLC 2GEUA 3GJ0A 3Q8XB 4CEJA 1LVGA 1JQLB 1KYIA 2ZI4A 4NZYA 4V0LA 4XOIA 2QN6A 5C2JB 5TVKA 3P4XA 1Z3IX 2ZE7A 4BEBA 1N5JA 3UATA 3ZGXA 2ZYUX 3VNUA 2V4ZA 4Q02A 5BN4A 2G77B 2ZR0A 4D4LA 1W2HA 3FFBA 3SHFA 1JQJC 1EK0A 2V8OA 3KQKA 5G3ZA 4RD4A 4OBEA 4V02A 4WAUA 3U3MA 4DDWA 2CLDX 2RGBA 2FEOA 2VSFA 4US0R 4WXRA 3DPUA 5LDDC 2AKYA 1E0KA 3DMNA 3Q85A 4HI0E 4MKHA 4RZ2A 3WYAA 4AURA 4FWTA 4RKEA 2O8FB 3U4QB 4ZDJA 4NU0A 2X19A 3VR3A 1IHUA 5EJEA 3IHWA 5JSZB 3NDBB 4HLUC 3WNBA 2P3SA 2ZVQX 3ECCA 3Q3JB 4E09A 1NMZA 1OIWA 2OV2A 2ZRFA 2OO7A 5CIWA 1QF9A 3DOFA 1MRNA 5LBIA 4IDHA 2CHVA 2VH5R 2PL3A 4LHWA 2DYKA 2ZI9A 3GEHA 2N1BA 2QAGC 1NL3A 5DISB 2IYVA 2BBWA 4EAQA 4DB4A 2IS2A 2KJQA 2WPDD 1Q12A 2RGGA 2QL6A 2C04A 2W2TA 3C7KA 4DSUA 1Z6AA 1MT0A 1KO4A 3MG9A 4ZIRA 1N6PA 3LWNA 5TXGA 3WMEA 4OQMA 3KKOA 1KIMA 1COWA 1CJKC 1IN4A 1Z6YA 3QQ5A 4KODA 4WIAA 3FMPB 4DCSA 2VHQA 1KMHA 1ZD9A 1KK1A 4HAYA 3I5YA 4R98A 3SBDA 2W2XA 4KBGA 3B9PA 2ZM5A 2RB4A 4ESHA 1NSTA 4KHZA 4O0MA 5D3QA 5KNBA 2RGXA 4PHHA 3DO6A 2KE5A 3GLHA 2BDTA 2EW1A 4RSGA 1M7GA 2FSHA 4TLDA 5F9HA 3VX3A 4CEJB 5SZJA 1HE8B 4KAXA 4MUBA 1AK2A 1LY1A 1YZQA 3REFA 2KI5A 3TAUA 3GJ3A 1NRJB 1WXQA 3TLXA 3W3AA 4LV6A 1KDPA 1K5GA 2GEVA 3CNOA 4PTLA 5EE1A 4B34A 3HJNA 4TYNA 4OHVA 1UBCA 1FMLA 1Q44A 3TVTA 4Q21A 3UMSA 4NONA 2ZR9A 4OYHA 1W4BA 5EP2A 3B82A 5AJVB 1WB9A 1ESMA 3MJHA 2RGDA 3F3YA 3QPUA 2A5FA 4PFSA 1KI8A 5DH9A 2ZITA 2XITA 4HDOB 4KVGA 4MDEA 2XNSA 2IYQA 5F3WB 4GP7A 4ZCLA 1YR7A 3OE7A 4QBIA 4D81A 4PZZA 3D3QA 5BWMA 4FMDF 4LJAA 4HAZA 1HEIA 3WHLA 4HDQB 2IEZA 4M1YA 1Q1EA 1EFRD 2AWOA 4QHYA 4RD1A 5B58C 4IDNA 3HU2A 4LK2A 1XZQA 3CR7A 3KXLA 4A6XA 4PC3A 4OJQA 1G3IA 2IL1A 4ZIRB 4KLZA 5A5GA 1JPNA 3HU1A 1W4RA 3C16C 1N6HA 1MRSA 2BJVA 4TLAA 3GLFE 1ZM2A 2JA1A 2W0MA 2OCPA 3BJIC 2HCBA 3RRYA 5KNDA 4L4UA 3CWQA 3RS7A 1B0UA 1TQDA 2AKAB 2AX4A 1KSHA 4Q9IA 5FBQB 5AUNB 4C0SA 1WE2A 4LGMA 3KJHA 5JWHA 2ZRDA 2UZ3A 2G1KA 2AD1A 2CCGA 3P1JA 3GLHB 2H7VA 3LRPA 4MGIR 4QGGA 1KHTA 3X1YA 3K09C 2GCOA 4YMUA 1DAGA 2ZJ5A 3MLEA 3KX2A 4GMXA 3KB2A 5LD2B 2QT0A 3BK7A 2GZAA 3SFVA 3VMFA 2GXUA 3C14C 8OHMA 4DSTA 5FR2A 4GZMA 3ADBA 3P20A 1IQPA 3K0FA 3DKVA 3AP2A 4WZ6A 3AVTA 4B32A 1GNQA 4E07A 2W6JD 4L16A 3RNLA 1OH6A 1ZNZA 2YOGA 3A4NA 4TYPA 3RRNA 821PA 1N0WA 3QBVA 1P9RA 5TY0A 2ATVA 1FNMA 4L5BA 2IHYA 1SVKA 4N0EA 2ZRNA 2XXAA 3DM5A 3BB3A 3SEAA 1ZVQA 1Q1BA 2PMDA 2YINC 2GXQA 5FOTA 1SKQA 4AIIA 3I61A 3TK1A 2NQ2C 2F6RA 4HAXA 2GZHA 1VTKA 3CF2A 4KFRA 4G5RA 5JS8A 1ODFA 2HXSA 2VHJA 2P6UA 1CR0A 4MYUA 3WYFA 3RC3A 1XDBA 4DHEA 1L4UA 1SVLA 3U44A 3TSWA 1QG2A 3AGPA 3VHLB 2G6BA 4IFBA 5H70A 3TRFA 3RSLA 4Q5IA 1G291 3ZIAA 3KUDA 721PA 2J7KA 5HZHA 1YZKA 1CJUC 1JJVA 1KY2A 2L0XA 2FGKA 3GLGA 2ZE5A 2VHTA 2D2EA 4Q1EA 3TAHA 1ZUIA 1SKYE 1H8HA 2ZYWX 3BB1A 4HB3A 5FBRB 1G7SA 3U3OA 4DWJA 1TAGA 3W8RA 5JWOA 4OHYA 4DCUA 5DN6D 5HCIA 3VTKA 1FTSA 1CF4A 2HXYA 1TEVA 3TH5A 3UMFA 4URVR 3DDCA 1YZUA 4Q4AA 1HA3A 4AK9A 4Z1MD 2OCAA 1X86B 3KQNA 2J0UA 1TPZA 1EXMA 4QRHA 2XJ4A 3QF4A 4JJZA 2XSZA 4AKHA 4KBFA 3O8CA 3PFIA 2IUSA 5CYOA 1NN5A 4XIGS 3M4YA 3PQCA 1GIAA 2IF0A 4H1VA 4MGZR 3PR1A 2VYFA 4JYBA 2GILA 4D80A 4PQYA 2VF8A 5HPYB 2HLDD 3NH9A 2F43A 4JLKA 1OHHA 4JT4A 4U5XA 3TJZA 4B6FA 4BRWA 2O8BA 2ANCA 2PZGA 4Q7LA 1RRFA 1U8YA 4TQUS 3AH8A 2CK3A 3UIEA 3VR5A 3C5HA 4BLOA 1N6IA 3NH6A 4DLXA 1I2DA 3R8FA 1B23P 1W4CA 1DS6A 3B1YA 3LQRA 1NJFA 1U94A 2ZSEA 3BOSA 4QJ4A 2YV5A 1XCPA 3ZQJA 2YC4C 2HCJB 3L8ZA 5ANRB 1XPOA 1LTQA 1GAJA 1HTWA 2GA8A 1E2LA 1RKBA 5L3VA 1ZIPA 3L0SA 3LXRA 5FTKA 3ICEA 4R9UC 1P9NA 4AYWA 1AS2A 1LS6A 1XEFA 2ZPTX 5DLQC 3VR1A 2BVNA 5EP4A 2E9SA 1E1RA 1GRNA 4FD2A 2ASEA 2J9RA 4OI0A 4P3YA 2FZ4A 3U44B 3GJ6A 3ZLJA 4LHXA 2FFBA 3ASYA 1GUAA 4BQSA 3VQTA 1XMSA 5EE9A 5H68A 4IVQA 1NY6A 1TADA 1TF2A 3Q5DA 2VP2A 3GMTA 2WJIA 2J46A 3EXAA 1VCMA 1HQYE 2F3RA 2ZJZA 4LBYA 1PUJA 1UEIA 3OEHA 1AQYA 2VPPA 4A0RA 4TZ6A 4Q4AB 2Q3MA 2QBYB 4YLGA 4NCNA 2J0UB 4Q9HA 2EFEB 5EE0A 1IN8A 4FMDB 4QGAA 2QI9C 1CULC 3SN6A 1S9DA 2G0TA 4NBSA 3V4RA 3L0OA 1KJZA 1PZNA 2R6FA 3Q7PA 4FXPA 2ZRBA 4A4DA 3WMFA 2ZRMA 3FB4A 4FI3C 4RD0A 5KUTA 4ASUA 1CJVC 1OB2A 1IBRA 2NO0A 3BS4A 2F43B 2FDCA 5JI3E 3PUVA 2O8DB 4P4TA 4JLAA 4IEIA 3LFUA 4A8JA 4DEXA 1G17A 1KSJA 3TUIC 3U61B 1Q20A 2PJZA 2IBMA 3QNUA 5C4MA 4XVUA 3QOFA 4EJSA 4MGYR 5FUXA 3T61A 2JJ2A 4YMVA 2J59A 3IQWA 4BFXA 4BZQA 5J4YA 3AKDA 2VRWA 4M2LA 3CF6R 4LX0A 2AXPA 3NVAA 4U02A 3T5DA 4BWYA 1ZU4A 4V0KA 4E03A 1TF7A 2JLRA 4KO8A 1QRAA 1E2MA 2AD5A 2KWIA 2XAUA 4JVMA 2C9YA 2ZROA 3ZVNA 4RCZA 2VA8A 4TSFD 2PT5A 3K70C 4QXAA 4DLSA 4EFLA 3IO5A 4JLPA 5J40A 2C2HA 4JL8A 4L9WA 2ATXA 2FJUA 1EESA 4NYJQ 1HY3A 1ZM3A 2IWHA 3K1JA 4W9MC 3IDQA 4FMBB 3R9IA 2J3EA 4EPYA 2QQEA 4RZ3A 2J7PD 2A78A 2BBTA 1ZINA 1II0A 2GCPA 4XD7D 5B2ZA 4MRSA 3GLIB 5J4LA 2BM0A 3ND8A 5FTMA 3SQWA 1FOEB 4EFMA 4LWZA 3EIQA 2VEDA 4JLBA 4B35A 2FSGA 2CBZA 5J47A 4F91B 4TL9A 2ZSBA 1KNQA 1E9DA 1E9CA 2NO6A 3QKSA 1NLFA 3LDAA 1CKEA 2ZRAA 3W5IA 3I8SA 1OKKD 4IOMA 3G82C 1SVWA 4Q47A 1EFRA 4CDGA 1NMYA 4WZBE 4WW0A 3T34A 1GL9B 2Z4SA 3QIAA 4A0FA 3R7WB 3A37A 3NC0C 5FOSA 5FOXA 4BFWA 4ILEA 4AYTA 1Z08A 4JKYA 3A1UA 4B2IA 3DZ8A 1VG9B 3VR2A 2YC2C 5FFMA 3K0SA 3KTAA 2MMCA 1EFTA 4A8JB 5KDLA 1R4AA 1T0HB 5JS7A 1R5OA 1KO7A 4XSGA 5AWFC 4D4KA 2Q3FA 1JECA 2C03A 2SHKA 3QE0A 4LZZA 5JWRA 2WM9B 3NEYA 4K81B 4YDSA 3SFZA 3TUJC 4XWKA 1XEXA 1Z0IA 2JJ1D 4W5HA 3SNHA 4HEJA 4A0GA 3FPAA 3LNCA 1X1RA 1HT2E 3UPUA 1JXMA 2H57A 3MJRA 2ZRPA 2X77A 3V9PA 2HYDA 2IYXA 3KZ1E 4QBGB 3AP1A 4D25A 4JLDA 4N3NA 2QGNA 3E70C 1QHGA 1LFDB 4EPTA 2WJYA 1TU3A 2AR7A 1EX7A 1MO4A 4Q48A 2W6JA 1GFIA 4PXAA 3CR8A 5H8WA 2ZJ8A 2RGNA 4CIDA 1D5CA 1PVOA 2IX3A 1UFQA 3L82B 1R8QA 2F7SA 5IK2A 2VL7A 4URUR 1YZNA 1EFUA 3NHBA 1P9WA 4XJXA 1N6LA 2QEQA 3RS4A 4ZCIA 2WSSA 1AS3A 2ODBA 4M53A 3FMFA 4A0HA 1TUIA 4DDVA 2IYTA 3BB4A 2E1RA 1D2NA 1R5NA 4IXNA 3RVBA 1G8HA 3AP3A 5CM9C 1DG3A 1AQUA 3ADKA 4PPNA 3TVDA 1VECA 2JLVA 1FX0A 1CLUA 3Q72A 3QKSB 4FCTA 3A8TA 1E0SA 1OT3A 5FBLB 3QJYA 5KDOA 3RS5A 2HT6A 1BYUA 3NBZC 5GJWC 1R10A 4DIDA 2V3CC 5EUMA 4WZAE 4MRPA 1A2BA 2W00A 3I73A 1F3OA 4MYHA 3AF1A 4C0BA 3ZD7A 4B3BA 2PJRA 2FFAA 621PA 2XB2A 2DY1A 3TE6A 1G7TA 1KI6A 2G88A 4I99A 2BMFA 3KTAB 3UK6A 1KI2A 1ETUA 2XZPA 3K0CC 4QG7A 2IXEA 5GJBA 5HTKA 2YKGA 1UBFA 4M1OA 5KPDA 3VR4A 1TL7C 4HLQB 3G5UA 1H8ED 1XEXB 3BWDD 1XRJA 3L0PA 5FTNA 1WRBA 3NXSA 1G3MA 4S2EA 5AUPB 4R2HA 3SDZA 4IHQA 4O2RA 1SGWA 1OSNA 3CONA 1AKYA 4UXHA 2JLYA 3GJ5A 4LHVA 4C30A 1CRQA 2OUKA 4B71A 1C9KA 3K53A 3K9GA 4R2IA 3EASA 3AEZA 1KOFA 5FPYA 1YRBA 3JVVA 5FUWA 5FL7A 5DO9A 4GZLA 1X8LA 1M34E 3B9QA 3D31A 2GJ9A 1NN0A 2BIFA 3FMOB 5LD2C 4BGDA 1S3SA 1E98A 4TQAA 1NBMD 2IC5A 1G5PA 3BE4A 2CCKA 1OIVA 4FIDA 1W48A 2R6CA 3IILA 5FOVA 1S1MA 4NL4H 1YE8A 4B48A 4DEYA 3AKCA 3MCAA 3W9YA 1SXJD 3DVLA 2QE7D 1R0XA 3K0EA 4JBYA 4B76A 2IW3A 2D7CA 4AI6A 3WXMA 4WBSA 1SVIA 1FPMA 1Z0JA 1R0YA 3E1SA 4RJLA 5AR1A 3F5FA 2KBFA 4F92B 1YR6A 1T5LA 2IT1A 2P5TB 4M9SA 3TQCA 1FX0B 3C41J 3EPKA 2ZS8A 3I4LA 2NO1A 2OXRA 2O8EB 4B3GA 3T35A 1GG2A 1OFIA 1TQ4A 5DNYB 4ITRC 1MO6A 4W5WA 3W6PA 1MOZA 1OB5A 1VG1A 1ZUNB 3P27A 2IYLD 4PZLA 5FL3A 3SE0A 3OIWA 5FI0B 1GM5A 2Z6VA 3IIKA 1T3SA 1E4VA 4DLTA 3KXKA 3RANA 4LUCA 1NIPA 2DBYA 4M1KA 1MABA 3WP0A 1G9XA 1F2TA 1KI6B 1KMQA 2NZ8A 2OESA 1JR3E 3J81k 2GCNA 3IHLA 3QXXA 4BFTA 1TNDA 5E4FA 4MGKR 2GVDC 4FCVA 4TZ0A 5GJVC 2QT1A 3RRZA 4CT5A 1G5RA 1H65A 1JPJA 4OQXA 4PAQA 3O47A 4US2R 1M7HA 1E2EA 4URYR 3E2IA 1HUQA 2A9KA 3CBQA 3QVUA 3EWSA 4MRVA 3BBPA 4M4SA 1XXHA 4BASA 4Z51A 1P72A 2AFHE 5SZIA 2ZTSA 1UKEA 3UG6A 3GPLA 1DG1G 4QHSA 1OW3B 2JLSA 1KI1A 4B75A 1OXUA 3RLFA 4I1UA 2W6IA 2C96A 3AF0A 3U5ZB 1E79D 5AK0A 3ICQB 2LWIA 1HT1E 1JEDA 1DAHA 2EU8A 2BC9A 1T91A 4R71A 1VPLA 1G20E 3HR8A 2UZIR 4URXR 1EG7A 2OBNA 4B2PA 3OIUA 2P65A 2C9OA 4V0ME 4DDUA 1YHNA 4OHXA 4DZZA 3K9LA 4ZDWA 6Q21A 1UKVY 1XEWX 1DPFA 2OCBA 4OL0A 4IEEA 5FPSA 1FUKA 5ELXA 3MUFA 1CXZA 2FV8A 4JLMA 1OFTA 4I81A 1N6OA 4EPVA 2GETA 2ZI3A 3ZD6A 5KTYA 4MYTA 5HKKA 1W49A 2P6RA 1A2KC 2ZVPX 4CF7A 5CM8B 1W36B 2CNWD 3KL4A 4TLEA 3PJRA 5EZ6B 1FP6A 3QXCA 4M9QA 1FQKA 2P6NA 1BMFD 3TNFA 4A2PA 1IXSB 1KJWA 1ZM7A 4Y0AA 2RHDA 2FG5A 1VCIA 4MYCA 2NMVA 2R9VA 4C0HA 1S2MA 1SXJC 2AXNA 1R0WA 1OJLA 3DMDA 4JIMA 3QG1A 2GXAA 2C78A 5IDVA 2QGZA 2FFQA 1F2TB 1TMKA 1G7CA 2XOKA 3THWA 4X8LA 2WOOA 4PQRA 3FHTA 1Z83A 3PENA 1CEEA 1OKKA 4PPQA 2GESA 3PCRB 2H5EA 5EXTA 5F2EA 1PV4A 2A5JA 1R0ZA 4P0TA 3UG7A 3VFDA 3KDSE 1N25A 4LBZA 1HYQA 1XXHB 1RZ3A 2CL0X 2OAP1 1NVVQ 3EA5A 1VCNA 1WMSA 2A5YB 2D3WA 3N5CA 3TUZC 3GFTA 4Q18A 3SOPA 4XH9B 2RGAA 3AVWA 3MFYA 4Q03A 1UF9A 2XNDD 1XD2A 4LYJA 2WMNB 5EZ5A 2WHXA 1FL9A 4DT1A 3GP8A 2GJSA 4JSYA 3C15C 4P31A 3K9NA 4GI7A 2K5UA 5EXPA 5FPTA 2OILA 1N5KA 4JMPA 4PSVA 5UKDA 2H8KA 3AB3A 3EZFA 1T9HA 2ZRJA 1F2UA 3CRMA 2XB4A 3B60A 1KTVA 3BH6A 3FVQA 2GJ8A 2ERYA 4CYMA 4F4JA 3O8RA 1XCGB 4UNPA 4ON9A 1XZPA 3CRVA 3QSYA 4GMDA 5SZHB 4PSAA 5FUYA 1U9IA 3GJ8A 2N46A 1W5SA 1UPTA 4W5JA 2GXSA 2BV3A 1R8SA 3I5XA 1E2DA 3RS3A 3B1WA 1HV8A 5IHPA 2QP4A 4QL3A 4UJ5A 4IXMA 5CDFE 2ZJOA 3SC3A 1JEEA 1CBUA 2V7QD 4ZO4A 4O3MA 1ZD8A 4MKFA 4B3CA 1I2MA 3ZQ6A 1WDTA 3CM0A 2JATA 2HUPA 4NPHA 5BW8A 5DI3A 1CIPA 1XTQA 4A2WA 2QU8A 1GL6A 3EC1A 3EPLA 1Y3AA 4UKDA 2IEYA 4QBFA 4YMSA 1FQJA 4B3FX 1VG8A 5KSZA 1W1WA 2CXXA 3EPJA 2YWEA 3MGCA 4TMKA 2F55A 2JLXA 4AY2A 1NN3A 1KMHB 1T4GA 2NPIA 2PLFA 1E69A 4TMXA 1P62B 1ZCBA 2H92A 4DC9A 1I4DD 1OYYA 3VX4A 3THWB 1W2GA 2DR3A 4JLOA 2FE4A 1XP8A 3CIOA 2JIZD 2PCLA 1QVRA 2GBLA 4IOJA 3VHXA 4BFYA 5C46F 4NYIR 4MUAA 5E95A 1FMJA 1N6NA 4I4LA 4Q7JB 2ZRHA 1N6KA 3I1FA 4TT3A 1CR4A 2GDJA 5TARA 5CDFA 3AVYA 1GDDA 4JLVA 1G6OA 2B8TA 4CW7A 4C0LA 1YR8A 4LSGA 1P2SA 3V00A 2Q0HA 2EFDB 4EFNA 1KK3A 1U0HC 5L3RA 1K5DA 4A82A 5KOYA 3NIBA 3KQHA 4JT2A 1ZD1A 3GLFA 1NF3A 4LDJA 4BEJA 4Q66C 3C5CA 4TMTA 4ACBA 4DT1B 1NBME 4QM7A 1V5WA 3AF4A 3CZPA 3KKNA 4OJKA 4DXAA 3PEYA 2WAYA 1R5BA 2J87A 2DWPA 1MR3F 2Q9AA 4YXWD 5J4KA 2ZANA 3ZS9A 2VHCA 1SXJE 1WA5A 1XTKA 1F2UB 1XF9A 3G0HA 3H86A 4B44A 1E0JA 2ZJ2A 3Q7QA 4IOKA 5E7JA 5L3QA 1H8EA 2FOLA 1U0LA 4LC0A 5FR1A 3DEFA 5KSOA 2XZLA 4HLUA 2NGRA 1NVWQ 3FDIA 3QI2A 2R44A 4PAMA 1RRGA 2EFGA 2HYIC 2F1RA 4EKDA 5DYIA 4H1UA 5K8LA 3AVUA 4AG5A 1QHHA 2QAGA 1KSFX 1RJ9A 2FSFA 2ODEA 4NYMR 5CJ2A 1NIJA 3N2EA 1II8A 2B7BA 1Z0DA 5DI9A 1T6NA 2ZI6A 3DHWC 4ZV4A 4TL8A 1P73A 4YDHB 4D0NA 2WWGA 2ZJYA 2ZRCA 2DFLA 5B64A 1VIAA 2ZSAA 3SHWA 2XGJA 2YZ2A 5JJIA 4A36A 2OEPA 3N2IA 3N70A 2QP9X 1G8PA 1GRQA 5BYKA 2W2VA 2WIAA 1KK0A 4FN5A 1X6VA 3CRRA 5KNCA 3JZAA 2XTMA 4IDQA 2V9PA 2WJVA 2R6DA 3IKJA 1EWQA 1NN1A 2GWHA 4DCVA 3OAAD 1YZTA 4UQOA 2C8VA 2Z83A 1YU9A 5D3MA 1OH8A 2GCOB 1RE0A 3WNDA 1X1SA 4K46A 2JCSA 1AA9A 2CJWA 1GKUB 4DBLC 2IYYA 3THXA 2HT1A 3FHCB 1ZUHA 1AS0A 2ORIA 3M6AA 4KU4A 2O8CA 1G16A 2V54A 3K70D 3A4MA 3K0AA 4CRWB 4C0AC 4WXPA 4UJ3A 3B1ZA 2ANBA 3BC1A 3K0FB 4LJYA 4LBWA 3REGA 2WVJA 2EFCB 4X8MA 3UWKA 3GJ7A 4XTRA 1SVMA 3ND9A 3S1AA 4DUGD 5CLLA 3GLFB 1U98A 5JRJA 1E1QA 2JDID 3GEIA 1Q0UA 5GADl 2H17A 2V6IA 1TX4B 1D2EA 2R65A 3MWLA 2XXAB 1W0KD 2OFXA 2BMDA 1G5TA 5L3QB 4CZ2A 4PHFA 3PUWA 2G9NA 1J8YF 2IYZA 3MWKA 3VAAA 2FA9A 2IXFA 2FX3A 3HDTA 4NDZA 3T1QA 4F4IA 3AKEA 1E79A 1KI9A 2NPFA 4QC2A 4TLBA 1CTQA 1QHHB 1QHYA 3ZVLA 1DAFA 4NE2A 1RJ9B 1XCMA 1ZIOA 5KU1A 3WYGA 1U99A 4Q1BA 1G4UR 3GLGB 1II8B 3IPXA 1E2JA 5J4HA 3AVXA 4B3XA 5CB8A 1E32A 1UBGA 1W0JD 4G5GA 4HZUA 2VO1A 3NBFA 1XMVA 1VYTA 1G6HA 1UKYA 3K9HA 3WBKA 1DELA 2PH1A 1QG4A 2DB3A 3OIVA 1FW6A 1NJGA 3U6KA 4A15A 3TKLA 3QF4B 5A4JA 1RVDA 2GF0A 2P67A 1KI4A 1W4AA 1AIPA 2WPDA 3E5HA 2DWQA 2QNRA 4M8NE 2BHRA 2RAPA 5E7IA 1XB2A 1E9SA 5BQ5A 3I32A 3NC1C 3K09A 5D3MB 1BMFA 1X3SA 2WIBA 3JZMA 3LX8A 3M0EA 2XJ9A 4G3XA 3THXB 4RFSA 2O8BB 2RHMA 4PC1A 5FUVA 4Q7KA 5JI2E 1G21E 1OXVA 2FEMA 1SKYB 3EC2A 1GKYA 3K0AB 3IPYA 1VYVA 4JL5A 5J4VA 3TBKA 3CB4A 4ARZA 4OI4A 5TV2A 1T0JB 2QPOA 2QMHA 3FGNA 1JR3D 5B57C 4Q4LA 4AKEA 5HE8A 2OFWA 4AKGA 5FH9A 2GZDA 4KFUA 2NIPA 1GTVA 2GJAA 2OFOA 3F0TA 2D7DA 1AGPA 3WMGA 1J8MF 4JVSB 2R2AA 3IIMA 4KSBA 1UAAA 2IS4A 3CW2A 3IIJA 2GEDA 1VMAA 2XNDA 2QMUA 1SULA 4KLNA 4DLWA 1VHTA 2PZEA 3AGQA 4CGZA 2JLQA 3TMKA 1FP7A 4YONB 4B3DA 4KITB 4LJ8A 2WTUA 3BORA 5G41A 5GJCA 3SYKA 2QSYA 3X1ZA 3ONWA 1NNEA 2JLWA 4JJKA 2GAAA 2IUTA 1ZC4A 2FPKA 2AL7A 4W7SA 2G1JA 2IS6A 4U7DA 2PT7A 2J0VA 2D2FA 1OPXA 1EWRA 2ZJBA 2G83A 4P4UA 1BH2A 2BKEA 3NBXX 4OK3A 3VNVA 2QTHA 2V7QA 4G5SA 4Q4HA 1COWD 2YWFA 3KKPA 3WRYC 1UEJA 1KDTA 3IO3A 3QUSA 3KKMA 3W5JA 1NKSA 4BLTA 3ZVRA 5JEDA 3R9WA 1JXOA 1Q1ZA 3A1VA 3H2YA 1OFHA 2CHGA 2PX3A 3NEJA
chains in the Genus database with same CATH superfamily
1Z6XA 2WMOB 3KFVA 4MWEA 1HETA 1NXTA 1YE5A 3I2FA 4N3BA 1NSFA 4QGSA 1QQBA 1AB6A 1S8OA 1F38A 1BXZA 1GSAA 4XVHA 1TA4A 3BTUA 4CM4A 5KNBD 4L5IA 3NTRA 4IX1A 2Z2ZA 4IOLA 2YQ4A 4O08A 1ZMTA 1BXGB 4KP7A 4IXDA 2AZ4A 2G3YA 2GB4A 4EL0A 2IF2A 4YQZA 4ARZB 5IBCA 2NXJA 2D1RA 4NBRA 2H1CA 4V3CA 1U7DA 2QYHA 2VAXA 3ER6A 3KP1A 4Z86A 2PLNA 4EG4A 2V1UA 4MNTA 3VJMA 2JIZA 4GGMX 1P8AA 1X15A 2NWQA 1EK5A 4IIHA 1A82A 1NBIA 3ILVA 5CCDA 2IVFA 4OQLA 1L7QA 3LUFA 1DBPA 4DLNA 4JC5A 1LXCA 3H9EO 2N9UA 2IITA 5C32A 1KFBB 3VR6H 2IIVA 1PJCA 3SM3A 4RZXA 4ER7A 3CPHA 1M2HA 1VFNA 3I9JA 2Q9CA 3H5AA 4MQFB 5K8VA 2FFHA 2NZUG 1G55A 4GOKA 2IYUA 4M1TA 4NP6A 2LBPA 3IEIA 5AIBA 2MR6A 2WZBA 3V8RA 5IUJC 3FBTA 4C7XA 1V4BA 3K32A 3AI3A 4BNZA 4QGFA 2X1VA 4XQGA 1Q0HA 3AX6A 4ZEOA 3SHQA 4AG6A 3DT9A 5EKXA 4QKQA 3LHIA 4HLCA 3NLLA 4CR7A 2EKBA 1MW8X 1LC3A 5TQ2B 3LHSA 1U0EA 1NLYA 1QFZA 1TQ8A 2BFCA 2CXNA 2ZYHA 3UJCA 1DQRA 3WYBA 1N75A 4OLHA 1X1CA 1TU4A 4Y1GA 1A1VA 1U2PA 5DT9A 1OH7A 1DO0A 4N9QA 4NCJA 3VJRA 4UAUA 3QBTA 2H07A 1NLMA 3TG8A 5KOHB 4PCAA 3NHFA 5JFTA 5D3KA 1TECE 1Z47A 3GBSA 3CTMA 1WZEA 1XJWA 4J0QA 2J0QA 3V2GA 3OJFA 4LRWA 3PFWO 1XJ0A 2D5CA 4LJ9A 5DBGA 1BRTA 2YNMA 4S0XA 4F8YA 3KYBA 2FHPA 5A6VA 1NVMB 4OJTA 1TJ4A 1WULS 2Z1MA 4LXIA 4YRBA 1OAKA 1G9SA 1K7XB 2ZYRA 4XGQA 3A1TA 3QKRA 3ENQA 4RABA 3QXSA 4ND3A 5JASA 1GPH1 1NNLA 5ULLA 2XA2A 3AF3A 3E2MA 1C7QA 1T4DA 4D8VA 1P17A 4BFLA 5BNZA 4N7JA 5AW8A 3GEEA 4EPRA 4BMYA 1AUQA 2JHAA 1YRYE 4HDAA 4G1CA 1M2OA 1VXRA 4PV7A 4UTOA 3WP1B 5IX8A 5K0ZA 4MS3B 1RCTE 5ABPA 2OCYC 4QDXA 4RETA 2OHFA 2JC3A 2ZS9A 3S4YA 2QX9A 4MDFA 1PBNA 1P75A 1Z6PA 4Y1FA 3U13A 4H7EA 4TMFA 3F3KA 1E7MA 4ZOBA 3VSDA 1ZNWA 4C6TB 4NPCA 1Z16A 5CT6A 3T06B 1U1CA 2JI9A 2O7QA 2ZSDA 4XJVA 3SC4A 2HHHB 2AT1A 3T4EA 1LX7A 3BFVA 1A4XA 4QTUB 4HB0A 5EP3A 4E5SA 2AOXA 2HLDA 3OTOB 1OAAA 3QJ5A 1DP4A 4JSRA 4LDAA 4BLQA 4QJ5A 2C5LA 5EE3A 1SWVA 1SOVA 4TKZA 5IHXA 2HTFA 2I3AA 2PZBA 1UQUA 1KXJA 1QX3A 4W8HA 1ECCA 1RYZA 1RQGA 1GCAA 2JFQA 2KHZA 5FBVB 2V0CA 1ZGAA 1E4YA 1GTL1 2G71A 3QVVA 1Z2AA 4A27A 1EX1A 3RVDA 4BTVA 4UM9B 1YCDA 2VK2A 4XWAA 4Q3OA 4DJ5X 2O2YA 3D3EA 2VSQA 2WUFA 2PX4A 2H1VA 3OX3A 4I14A 5JADA 1S7GA 4C6RA 5IT4A 2AFVA 3PQ6A 3JVEA 2VNSA 2R86A 2A6PA 3RJZA 3KZOA 3D6UA 5E2BA 3L77A 4DCPA 2F8SA 4OG2A 2C77A 1RJGA 3FIUA 4YRPA 3MD0A 5LOVF 3CX6A 3TD2A 5FWNA 4NR0A 1J2JA 2WKSA 4IJ6A 5AVKA 4OSPA 1Y6FA 2C8JA 1E9FA 1SUAA 1Q19A 3WGHA 5BMVB 2XYHA 2G7MC 2WUEA 2OE2A 3TSZA 1XZGA 2OV4A 1CVRA 2RGEA 5FPHA 2EWMA 3FDFA 2WT9A 4W9NC 2Y4OA 2CLHB 2F9LA 2BFFA 3TDNA 4HVTA 4JJ7A 3ENWA 5F4ZA 2WJJA 5J1TB 4OI1A 2VTKA 1JNYA 3KUCA 3NJ8A 4K1XA 3SOZA 2QTVB 2ID4A 3F4BA 4W1SA 3I0ZA 7AT1A 5TT0A 3LCCA 1J4AA 3F46A 4IIVA 2A5DA 3L4EA 5AW5A 3I92A 2QUZA 3PITA 3IEPA 3KWJA 4OHCA 4G24A 5DGCA 3UW3A 2O0HA 3WY9A 3H11B 5BRJA 4EY4A 2OD9A 2Q2VA 2YICA 3LBIA 4L3VA 4Y6PA 3JQEA 3BCRA 3OEED 2XXBA 4H4CA 3GVCA 3BIXA 1FTQA 1N0VC 1Q21A 3VKVA 1CT9A 1N3YA 3IQEA 4KC0A 1BE6A 1PNVA 1Y89A 2AW5A 4M98A 4NVRA 5DBOA 4LV5B 4Y2HA 3UGQA 2HJGA 2ORVA 1Z3CA 2WBLC 3Q9SA 4EY8A 5HQTA 1DIHA 3NAGA 4IIJF 1LA2A 5EJFA 3WL7A 1GA6A 5AD1A 1KO8A 1R1DA 4P0QB 1F2DA 3BZWA 5FI1B 1H3NA 3K8YA 3ESAA 4NYJR 1DAMA 2FPLA 3TR5A 2FPGA 1EFDN 4YO8A 1QO7A 3E9QA 3SQXA 1OHHD 4S24A 1B0ZA 1KJNA 4CT0A 3IOMA 1J6UA 1Q1QA 3AHFA 4PS1A 1E3EA 2FUG1 4XR9A 3SR0A 4FC7A 3UMRA 3GJYA 4TLLB 3VDQA 1UBUS 5L3SB 2JFHA 1DIGA 3QNMA 4O25A 3ZC3A 1VG0B 2QRNA 2WY2D 3Q1LA 4EKGA 2CK3D 3HC7A 3EIOA 1PR6A 3C2QA 3NIWA 1AQNA 2OSBA 2VWGA 4H7JA 4BGEA 3PQ8A 4EGFA 1APBA 2WJGA 1A9QA 1XU4A 1D1SA 2B25A 4YAIA 5EZYB 2I1VB 4LX8A 2BE9A 1OBFO 1IY1A 2EJTA 3G23A 2XTZA 3BH7A 4MH0R 2XV1A 5HMMA 1JR3A 2R6JA 5JNUA 3I72A 4EJMA 5F2OA 1XZMA 2HMTA 5B3KA 2GERA 1RWKA 5CBKA 4JB0A 1IONA 3T5TA 4H4DA 4YUYA 2VUTA 4DCTA 1Y3DE 2HA2A 2X8AA 5EKDA 4E5PA 1CIJA 3PSHA 1L5QA 3W7AA 2XEXA 4NHOA 5SYNA 4EG3A 5CYPA 5F7ZA 3NBYC 5CX1B 5AXBA 5ALDA 5I7WA 4X95A 1GITA 3DC7A 3NKVA 5H81A 2Y67A 2SKCA 2DLCX 1G8GA 2H65A 1Z0ZA 1ZL0A 1YL6A 3LQ4A 2ZETA 1CRPA 2X2FA 2OZVA 3OTQA 1PRYA 3QYAA 1XZNA 2IOFA 1P2TA 4HQLA 5CHYA 3WHKA 1H5UA 1Z28A 2OMKA 4PLVA 4NBVA 4HNUA 2OHVA 1E6UA 1I5RA 3LV8A 4XD7A 3CLHA 4YALA 3COYA 2PH7A 1JAXA 1UAYA 3OEHD 4GP6A 3ZCUA 4FBGA 2Q8NA 1AUXA 3LSTA 2IHZA 2NQ8A 4J16A 4AZ0B 4I5FA 1LLQA 2GGSA 2VDNB 3M1IA 3RJTA 4EG6A 2D0OB 1KKMA 5EHIA 4G4GA 3GO4A 4UXJA 4R8RA 1BQEA 1CR2A 8ADHA 1P3JA 3GLSA 3U2QA 3O8QA 2Z5FA 4P5PA 1QHNA 4MCIA 3C1TA 3LBHA 4PYMA 5JO9A 2HQBA 3FTQA 3EK2A 3B53X 3EZ7A 2QROA 4IIGA 5FNVB 3T1VA 1V8OA 5JMWA 4Y2RA 2UZAA 1ZGZA 1RRPA 5AOVA 5K0JA 3OKFA 4TKLA 2RI0A 4AC9A 4BECA 1T1IA 4CFZA 2C2GA 2MDTA 2O3JA 2NZVG 2OXFA 2CLCX 3K9WA 5B1YA 2IYSA 1D4OA 3KUXA 4PONA 3KQQA 5LC1A 5LQCA 4CEHA 4WA7A 1UXGA 1U2GA 2WOJA 3OF3A 4N5LA 4C29A 4EKIA 1LNZA 1IZ8A 3H83A 1B76A 3U1VA 3EXHB 3DHNA 4G5OA 3QKUA 1DLIA 2GTPA 2CDRA 2I4IA 1R9JA 2HJWA 3CYFA 3QUCA 2HPAA 1S0UA 3CUKA 2COKA 1GILA 4JAVC 3JRNA 4UOQA 2R00C 3SR4A 1BXRA 1QKIA 1CUIA 4V0SA 3BXXA 5GM1A 2ZB8A 1L7NA 3O1JC 4B83A 4OHFA 1T4CB 4AF8A 2O5VA 3MWFA 4DA6A 4KCGA 3BTVA 1J8QA 2AN4A 2DBRA 2FWRA 3LGAA 3FYSA 4KYIB 5LMCA 3ADCA 3A4TA 4YCNA 5HTOA 1DAKA 2GVNA 3H4VA 1B8NA 2NAFA 3I12A 2W2LD 3PPWA 1K7FB 4F3TA 3HPRA 4LMBA 3B3AA 3SJCA 1CQIB 1X80A 1RADA 2G0NA 3RODA 1SHTX 4F3CA 2E1PA 4BO2A 5I4KA 3EJWA 2TMGA 4EW1A 2FP4B 1LPSA 1GV1A 2AFHB 2Z95A 1NG9A 4PC2A 3RYIA 2IHNA 3IUNA 5JDIC 2XYPA 2EKPA 2QJOA 2XUKA 2ZU6A 1E20A 1WDLA 3DBHA 1BCSA 2REBA 3V4ZA 4BB6A 5JECA 2HCTA 1JA0A 1JAYA 1IY8A 2BCGY 5P21A 2Z98A 1RZUA 3HWSA 4G86A 4IDBA 1NZFA 2DWCA 1K08A 1FTNA 1GQQA 4JSTA 5FLKA 4ZCPA 1GNLA 4C4OA 4ZI3A 5G53C 4B4WA 3S5JA 2D1FA 5LJIA 3DCJA 4DCOA 1STOA 2DFPA 5K6TA 3PA8A 2X41A 5T64A 2JRCA 1LBTA 2K7FA 3JWEA 2ZZNA 2IFTA 2WWIA 2HRBA 1E4EB 5KMGA 1TO1E 2QW1A 1K63A 5DBHX 3M82A 5A4DA 2PEZA 2A7QA 2F3TA 4LJ4A 1DRJA 3NCTA 2QD3A 4EPXA 3IV6A 2NO7A 2YZMA 4KXQA 4L9SA 3H6GA 1XC7A 1C1YA 1IXZA 4GSYA 4J1TA 5G2OA 3R7SA 3TOSA 3WQHA 1ZRHA 4J43A 2JLUA 4URWR 3AM4A 2HSWA 5C3UA 4ZVRA 4CF3A 2QYTA 1NU8A 4INZA 1UWVA 4BNHA 1QIIA 5TVGA 3G5TA 3JQAB 1XZBA 3Q6NA 3WRXC 4KMRA 3DF7A 4FILA 4UHFA 5EJAA 4HP8A 4I3HA 1QG6A 3UEOA 1R88A 2XCRB 3ZDDA 2UVPA 2EKLA 3DMGA 2Q6TA 4NBTA 5TPZA 3UXMA 1P2VA 1E3IA 1KAOA 4DJAA 5IWCA 4GLFA 4HFJA 1G3RA 2HMVA 5EPOA 2X9NA 2VSNA 4MA4A 3VBCA 1QFMA 2PEYA 3EUAA 1JU3A 2ECKA 2HNAA 2NSLA 5ECYA 1TGYA 3RFFA 2V4MA 3U3KA 1N6RA 4HDSA 4DV7B 4PLYA 1W4LA 4TSKA 4J03A 3W6NA 2GN4A 4MPTA 2EBFX 3ZY6A 3PX2A 5DVZA 1R8XA 1GCOA 2PE5A 4NF2A 5GIPE 5EESA 2C5HA 5HS4A 4M9ZA 4XPIB 1C1HA 1OV6A 1QHSA 1XD9A 4DPMA 3GLGE 1UC4B 2VSXA 5CGQB 2I91A 5EXXA 1MTZA 4ONEA 4YRMA 3VKGA 4I0WB 1P0FA 2W6PA 1TYAE 2UAGA 4CG0A 5KNDD 2NLOA 1VLHA 3A6LA 4PX9A 1M8KA 2ZRGA 5LZ9A 4KZKA 1FS5A 4TWZA 1X7HA 3X2EA 1PGNA 3AJRA 3E8XA 3H4MA 2WSSD 4HEHA 1Q50A 2BFDA 3FBWA 4Q1FA 3P8ZA 3HJAA 3RTEA 1T5OA 1Y42X 4XGNA 4CMGA 4DDMA 5DI3B 1W44A 2RH5A 5GZ3A 5IPFA 3GWGA 2AEFA 1CY4A 4IRUB 5KTNA 4IKEA 1QGAA 5THQA 1AKNA 3G5LA 3I8XA 3ZHTA 1JTEA 3ZNNA 4PRZA 4NNOA 3R4CA 4NKRA 4ZK6A 3ORYA 5C8YB 4PLZA 4C2UA 4G26A 2GYUA 2GPTA 3WYEA 1GCGA 1JSRA 2D13A 4JLSA 1RQ7A 4JKIA 1DU4A 1LLCA 3U4MA 4NV3A 3KB8A 5HRCA 4M83A 2HJRA 1EFHA 2WG0A 3FHLA 3NMUF 3A6EA 2ENWA 3GXOA 2PSHA 4OP1A 1HLGA 4YY3B 1J5PA 1L5RA 2WU1A 2BR3A 1YDWA 2J67A 3N8GA 4A1OA 1W4ZA 3B78A 3GB9A 2YJGA 5DIFA 3D3KA 5LBTA 3LTNC 1XGKA 3GZ4A 5KREA 2Q5OA 4D5EA 2VWQA 5T57A 4LRTB 1CUHA 4U2DA 4QZVA 4PNPA 4S35A 4B85A 1ZL2A 4DQUA 2BFBA 2PRIA 4EHLA 3I09A 4L7VA 1BX3A 2R8RA 1OASA 1SZPA 2E4VA 3I34X 1CS0B 1P0IA 2DECA 2PWYA 4KL8S 5E7MA 5KYTA 3OIYA 3FKSD 1VMIA 4KK4A 1GNVA 3UMVA 3MSXA 3THYA 1HQKA 3EIEA 3K1AA 5D2CA 3RT7A 3LECA 1JIVA 2FZCA 4ZPXA 4O2BB 4OREX 3KOWA 1U2DA 1W2WB 2JGRA 3DWIA 3DFZA 1PQ4A 4FZJA 5EMMA 1LI7A 3VR4D 3KQLA 4BMZA 4HV4A 5I7AA 1DTWA 2Z6UA 4DNOA 3ROXA 1UDWA 4HUTA 1L5OA 2VUIB 4ZVVA 4K7JA 1AD2A 1Z8FA 1NMXA 1I10A 2GK7A 5IAKA 1NMSA 3AIIA 1BWPA 2CEKA 2W2QA 3GLVA 2AJDA 5C31A 2PPVA 3OF2A 3SJUA 3FTPA 1PW7A 1K97A 2RJNA 4CHGA 5CAEA 1RBYA 4E1BA 2YVKA 3HCFA 2QZJA 4I2VA 1TMGE 1IM2A 1CY0A 1F12A 2PMKA 3GGSA 3OBBA 4JVNA 4BFUA 4ZGGA 3GLIE 3TQFA 2PTHA 1KQOA 1L7VC 5LA6F 2I65A 4X41A 3C3BA 3DMFA 3AVVA 1IAQA 5HJEA 3BMNA 1KRWA 2V7BA 1BE1A 5KNLA 1OYOA 4CMEA 4ZYZA 5DYYA 2Q5FA 1TEHA 1O6CA 3MCTA 2ASVA 4CMIA 1R6UA 3OQBA 4M88A 3OCCA 4RM3A 3RE1A 5JHHB 2WNIA 1BROA 3PXUA 4N18A 2OXEA 4YRKA 3E1KA 3E0XA 3ETGA 1SCJA 1NKTA 2J3JA 2XGSA 4B4DA 2C2BA 4JVOA 4IGFA 1YQDA 1O95C 4C1BA 2L18A 2MMGA 2ZUBA 2R68A 4RNDB 4D97A 1QDUA 3A2MA 4KDCA 3F2VA 1Q84A 4FUQA 1B00A 3R24A 5DN9A 1A8IA 1BKYA 3A2KA 1SXJB 1Y5RA 2JEOA 2HLNA 1F4VA 3WWDA 2BDEA 2IS1A 2V9ZA 4WADA 3TQHA 3W8DA 2G9ZA 3IP9A 1IN5A 2IP2A 3LP6A 1J99A 1G1MA 3JWIA 3GLIA 1UXIA 3UK0A 1KTIA 4OIMA 5BWCA 1E9EA 1VPWA 1RHUA 1U5BB 1K6JA 3HRIA 4PPGA 3IAFA 1GFZA 4PXYA 1T2DA 1UWLA 1M74A 4KQIA 2Q4BA 4JEMA 2CJWB 4P32A 3WICA 5LKRA 5BSVA 4F0JA 1VPTA 2PQ6A 2WJHA 3EODA 1U1IA 4KXMA 4UNQA 3AJAA 1H94A 4EY6A 1MGPA 1YK1A 3QYPA 4IMPA 1CU1A 1PFWA 1YQWA 2B6HA 2HHLA 1GZ4A 2HJHA 2OTCA 1PG0A 2XKJE 3DMYA 3DAYA 3PCXA 4HZIA 4NQZA 5LQRA 2Y0DA 2VYND 2P68A 1TYEB 3EARA 2AQKA 3EHDA 3UPTA 3VOSA 1RAFA 3LPNA 3OUTA 4N3AA 4Q0MA 1V96A 3HB7A 3IPCA 4M0EA 3UB4A 4JBLA 4AU1A 4D82A 3PUYA 2A1IA 1ZC3A 3IVRA 3CEPB 3Q8KA 3TZCA 2ZE8A 3CZ4A 3EQ9A 3P9IA 4EI9A 5I7OA 4UZFA 4Z8YA 1EJ2A 5J2TB 3U7QA 2OCGA 3LXXA 3KYCA 3E84A 2XX3A 1FDVA 4BMCA 4GWGA 1AUPA 2HHCA 2ZSFA 3GEGA 4Q3CA 3IMFA 2PZ8A 1EX9A 4B3TB 1E18A 1RBZA 5CDHA 2FKNA 4XRGA 2QPAA 3AXTA 5CFQA 2DXIA 1Z29A 4HUQA 4ME6A 4F56A 4PE5B 2V65A 1OXMA 2G80A 4LHZA 4RVCA 1CZRA 4YUAA 5KSYA 5MDHA 2W6CX 3OO1A 2QYOA 2HFJA 3NGXA 2EWWA 3RPEA 4IM7A 4EW2A 2R6GA 2WFZA 1X1QA 1Y5MA 4Q00A 1VJTA 1Q7EA 1USWA 4LOIA 1BVUA 2EEPA 1ORVA 2O4UX 5IT5A 2QTZA 2OZKA 2PL5A 4WASA 3OUZA 4JEUA 4RANA 3FUWA 4QYTA 3ZU4A 4BO0A 3O8DA 2P9TA 2CY0A 2WM2A 3GROA 4YJFA 5BR8B 2OG1A 1OYVA 3W5HA 1B42A 3RVMA 2ZWIA 1AN0A 2O0KA 2Z3WA 3ICOA 4UVEA 3RC1A 3SHVA 1W93A 4R4JA 5MN4A 1GYPA 3BRWD 4QUEA 1JDSA 3WWZA 5B6JA 4F60A 5M04A 4AY3A 1EUZA 4G5QA 3OA0A 5AJWA 3CNBA 1KJYA 1Y4SA 1EE9A 2C54A 3HKBB 1T0BA 3OIDA 4IXWA 1YS2X 3HJRA 1A71A 1HE4A 3G2OA 4G4SO 4R0NA 4K28A 1SVOA 5H16A 1F7VA 5LM3A 1SC6A 1AKUA 2Q50A 2RI1A 4C4YA 1IQ0A 1GG9A 3MWEA 5J63A 1RQPA 2BY4A 3EDYA 3KOYA 5TPWB 5HJ7A 1ZK4A 1ZWKA 2ZI7A 1OFUX 1B2LA 3DC2A 1OXBB 4G9EA 3RUFA 4ENVA 4ZALA 1Z7YA 4H7IA 3ACBA 4L6CA 1VRCA 3TRDA 4FP9A 3AJEA 3K73O 1MAHA 1GTMA 3EG9B 1JAIA 4YJ2A 2BGLA 5GOZA 1ZNXA 3HHPA 3ZI7A 3L02A 4GUDA 5AXAA 1R6BX 3QFRA 1JR6A 3LU1A 1JV2B 3F96A 4KGXA 4ERNA 4R9VA 1C0PA 4F04A 3WK5A 1PYOA 5EY5B 5H3CA 5HIJA 1WNFA 2C88A 4Q4DA 4P1ZA 1WPQA 1UM8A 3KXIA 1V8ZA 4I6GA 4V2IA 1BN7A 2IXAA 5HEKA 4P98A 2BD0A 3GOHA 3PVSA 3TE7A 4D0GA 5DGDA 3E9RA 1N3BA 4C0JA 4HQKA 3GDFA 4OX9B 2NZJA 4X6LA 2HMUA 3IAS1 3O4VA 4X60A 4E0BA 2Z3ZA 5K01A 1UK6A 1QYVA 2P3OA 2P9GA 5KSPA 2M1ZA 1XZJA 2FH5B 4AWAA 2EW2A 5AVTA 3V8BA 1PWHA 3BK1A 3HO6A 4UD6A 5H82A 1R6XA 2ZBQA 5KTRA 1THGA 1SY7A 4YXWA 3ZE7A 4DBZA 4DV0B 3KZMA 3FPSA 1RQXA 3DDNA 3BXGA 4YP7A 3VNBA 1T0UA 4EJ2A 1T2FA 1VQ1A 2WICA 5AUQA 1O0SA 4ZZ1A 1EJ6A 2RAVA 5EWMA 2I4MA 1FVOA 4XDZA 4YCJA 4AZTA 3L7MA 5FDFA 1V9CA 4FJ2A 4OQEA 2INGX 4NMLA 3ST7A 2WWTA 3JWJA 3HN2A 5HBGA 4U7JA 1YDGA 3WGGA 1Y8RA 3UC9A 4AWXA 4BEVA 3HH8A 3QFCA 4NFSA 4REMA 3VISA 1TZBA 3EVNA 4KJZA 2YJTD 2C2OA 3OZDA 3ANLA 4X0EA 1RTKA 3WKAA 3M9WA 5IH7A 5JARA 5LMNB 2JFNA 1H2FA 2DH6A 4NTZA 1J56A 3FX2A 4B6EA 4L15A 1D9XA 1R64A 4B47A 2JGIA 1WQ1R 3FNFA 3V4OA 3AUXA 2FF7A 5AO9A 4D45A 5C52B 4TXHA 5LN1A 3BGWA 2JAQA 1ODIA 2B61A 3OCUA 2QAIA 2PDAA 1UJMA 4XQEA 4RE6A 4BNLA 2V7PA 4FR5A 1L4MA 1GZ3A 1UDXA 2GBIA 3VZBA 3LCMA 3DVRX 3RV3A 4EVIA 4UFPA 1BOFA 2F1IA 2H18A 5KKCA 3A11A 1ZRSA 2FN4A 3FNGA 3PS9A 4XJSA 5JRZA 4CEHB 4ENUA 1FYWA 3M49A 1HORA 3EOZA 4EQ6B 1FJHA 1HFJA 3B7GA 2WG2A 4LYDA 1TO6A 2F8TA 2LR0A 5LMUB 3PQ2A 5DJ5A 3L2OB 5CYFA 2PMWB 1XTIA 3CUTA 3I9V1 4LYAA 1WMEA 1M0TA 4REQB 2ZZMA 2C98A 1FY2A 3ET5A 5AOBA 5JNTA 3DW1X 3OU2A 2R62A 4RQAA 2V6MA 5LPNA 3G8CA 3AF5A 2UUPA 4JP2A 1JLLA 3QA9A 4N39A 4LA4A 1QO9A 3ZH9B 1EDBA 3GQVA 2ZR7A 3VVCA 4FU0A 2OP0A 4YT5A 3FTNA 3OZAA 4JIGA 2FSVA 2OY0A 4NESA 1WCV1 3OCWA 5LNK1 2Z5GA 1Z0UA 2HOQA 2C95A 3ZX5A 2JHGA 1KK2A 5B3AA 1G3UA 3OZXA 3PXGA 1MNAA 2JK1A 2QTFA 2REOA 3UYLA 3WYNA 2FEKA 1MX3A 3NTOA 3QVWA 5GY7A 4JBGA 1TD9A 1V5FA 3ANNA 1TFRA 4I5DA 4BJ3A 1A9TA 4XYEA 1P61B 3T5PA 2D62A 3KELA 2QMOA 5GONA 4PGGA 4FFDA 2YIJA 4XKJA 2OYRA 1GRRA 1I1NA 3SJ7A 1OXXK 1MIOA 3B38A 5KNDH 1ST3A 2FYTA 3SXUB 3F49S 3BHMA 1L4YA 4Z2AA 3B1JA 1WMBA 3RJMA 3UWOA 5ALMA 3NG1A 3A27A 3KVNA 4J4BA 2KB0A 4D5GA 1AMUA 5JYDA 1KL7A 2R66A 1KP3A 3ICPA 1PWEA 4QHTA 5HJ5A 3K6RA 5JSZA 1V3VA 4URZR 1QU2A 1ZW1A 4JY7A 3V34A 1C80A 1Y6RA 2JAWA 1ODCA 1Q95A 2Q1WA 3DTVB 1HMPA 4FYHA 1U9YA 4PHTA 3UGKA 3N0TA 1UBHS 2XTNA 2YFYA 1RAIA 3K5PA 1IXKA 4HY3A 4LYEA 1KDRA 1RTTA 3AF2A 4QXQA 5G3YA 1BS1A 2VSOA 2ZT6A 3FCAA 4FMPA 4UCXA 3W9SA 5CDGA 6GPBA 1R5JA 4G2NA 1RKVA 3Q4GA 3MPOA 4N5MA 1HO3A 2H9AA 3J80A 7ADHA 2JI8A 1T8RA 1T1RA 3S8EA 5TRTA 1J1ZA 2CUKA 3O8BA 1Z07A 1JB1A 2DFNA 2H3EA 5FA8A 1J8DA 1JEQB 2FR8C 5CDSA 1TM5E 1W29A 5KAMA 3GP5A 2AOWA 2VP6A 1Z82A 2AG0A 1V4NA 1AZSC 4E70A 2GNAA 2GX6A 2AZMA 5A02A 2FN9A 1OXKB 5TR9A 3TXYA 4G0ZA 3GYBA 3LX4A 2RMKA 2VOJA 2R0QC 1X8KA 3SM9A 1JX6A 2XGOA 1TM2A 3MBIA 3AINA 2YDXA 5A3RA 1PQWA 2NAPA 3HEMA 4TTRA 1EYZA 5EWLB 4ABTA 3G02A 4J1TC 5K09A 1UJ2A 4F9FA 5KHAA 3O3MB 2ONZA 3EGCA 5CFNA 3GJ0A 3Q8XB 1U5CA 4BU0A 3MNFA 4U2EA 3REOA 3I64A 3IURA 3R0IA 1KYIA 1B8OA 2GTHA 4V0LA 3WLSA 2CKDA 5C2JB 2F8MA 3P4XA 1Z3IX 2ZTUA 3KAQA 1XA0A 1XRQA 3I30X 4LSWA 4TVSA 4WUVA 3UATA 4RGBA 1T3GA 1CQWA 1OU4A 4ARUA 3VNUA 3IT2A 3U3DA 1DFGA 4PLHA 4XGKA 3R2JA 1QRRA 2V98A 3A4VA 5L3ZA 3JASA 3WHPA 1KZ1A 1DIRA 1J23A 1TM3E 1XRRA 2JZNA 3KOXA 4FHZA 4MVJG 3FFBA 1OBHA 1JQJC 1QC5A 2X0DA 3SHFA 4CPDA 4QNNA 2R97A 1EKXA 4UULA 1BS2A 2OPHA 2E4ZA 3TD9A 1V26A 4DM7A 2W6ZA 1U8XX 1DQZA 3BD7A 4GXRA 3FSRA 4OBEA 5G3ZA 4V02A 3U3MA 1F8YA 1RBQA 1RWVA 2QVLA 4OLBA 3DPUA 2YQ5A 4OOFA 5G02A 1Y80A 4R0MA 1JS1X 1SQ6A 4AURA 1UMDA 4DR4B 4C7KA 2X19A 3FLAA 4FFSA 5ALJA 1CDOA 3GFSA 5HILA 3RVLA 2AF4C 3JR7A 2BGRA 1PJ3A 2O50A 2HWWA 5EJEA 3HCAA 2HGSA 5KEIA 5F5XA 2WK1A 5E7QA 4E09A 4E4RA 3SYRA 5AVYA 1CD5A 5CIWA 1QF9A 2ISQA 3ITKA 1U0TA 4AP9A 2ZXFA 1QRTA 1YL5A 3UWPA 1I1QB 4C78A 1NVEA 2J33A 3C7AA 3ZE8A 5KCZA 1NL3A 2FZ5A 4LY9A 5LXTA 3PNQA 4D3YA 1KEUA 1ONNA 4R41A 1QR2A 2C04A 3C7KA 3F67A 3UVEA 4CKEB 4DSUA 2OKGA 2V97A 3LPLA 1MT0A 3V3KA 1YNOA 1CHNA 4FBLA 4MQMA 1R9MA 4ARVA 4QTTB 4M0PA 4ZIRA 2OZLA 4WINA 4OQMA 3KKOA 1UZAA 3IBCA 1D2GA 1NXXA 2VAMA 3LVBA 4DLLA 2FEXA 3H9BA 1IPFA 2MTBA 3P2MA 4UUBA 4CUKA 3JATA 1E7WA 4RHUA 4AJJA 1X92A 2YHIA 4HK4A 3S7TA 2W2KB 4C14A 3I5YA 4DZTA 2BI4A 2W2XA 1MW9X 2QF7A 4HRAA 4CLOA 1A88A 4ESHA 1IBLB 1NQ5A 1AKQA 4C03A 4X90A 2BGTA 2R8YA 3GLHA 3H9CA 5C7LO 2VH1A 3DXYA 1NUUA 3PTLA 3PRJA 5E3IA 3WBFA 3ZXYA 4EYGA 5JH7F 5SZJA 1E8MA 2LCIA 1HE8B 2O07A 2XUIA 5BSEA 5HKBA 3PK0A 4MUBA 2NYAA 2Y4NA 3R9KA 4P35A 2ZBVA 1OUMA 2AN1A 3REFA 2ZLBA 1WXQA 1EM8B 3NHZA 1LI5A 3G9ZA 2IXTA 1H3FA 4RL4A 1K5GA 1NASA 1MQAA 1ZESA 2I6UA 2PZLA 1CJSA 4OHVA 4CJXA 1KZ4A 5BN4B 3SIXA 4DY4A 3CKKA 3U26A 1Q44A 2J3DA 1L7MA 3NP9A 4ZT2A 1U2DC 2XQFA 4RSRA 4B8YA 3N0WA 2GFHA 2G70A 2KX7A 2PFGA 3A4IA 1JLMA 4UDNA 3LMKA 3COJA 1EM6A 4I4TA 2WSBA 1VKNA 2E5WA 5TQJA 5BV1A 3JQCA 4NG4A 4ZOCA 2EQAA 1SD2A 2DOKA 2A5FA 1YDMA 4A2CA 4BNXA 1EWKA 2NZWA 3LPCA 2WU8A 2B35A 3D7RA 3ZD9A 2F17A 1KJJA 1KETA 1Y4ZA 2BTOA 4HDOB 4L76A 4XUCA 3I1JA 1A97A 3E15A 3SDBA 1F9AA 4BEWA 2IYQA 2IDJA 3GZJA 4CKCA 1Q0LA 1OD6A 4ZCLA 3GDOA 1ML4A 1IRXA 1G20B 1ZQ1A 3KE8A 3UFBA 3V8PA 5I8WA 4HAZA 2I4TA 1HEIA 4WNIA 5TS3A 3VZCA 2CNBA 2IEZA 4BKUA 3NBAA 4EAAA 1Z35A 3FYCA 4CMEC 3IAUA 2AWOA 1XCLA 4QHYA 1ZI6A 2Y1KA 3CXRA 3KSMA 4IDNA 4XEUA 4BATA 1N9ZA 4PZEA 2QUAA 3E27A 1O7JA 3OJLA 3ZQUA 5CG1A 4D43A 2ZBUA 3SBOA 3SVLA 4OJQA 1G3IA 3THSA 5A5GA 3DLHA 3I01M 3IL2A 1TPYA 1W4RA 2QRMA 4EHKA 1JGTA 1MRSA 4TLAA 4XPZA 3GLFE 2O2EA 4I6EA 3ZKWB 6AT1A 3GA0A 3R3SA 4P7KA 5HRAA 1QNFA 3CWQA 3IULA 1R00A 1GNTA 3VPDA 1NOIA 1KP2A 5DTIA 4ZFNA 1KSHA 1JHMA 4MP6A 2MCFA 5JR3A 4RTKA 1WE2A 3KJHA 5JWHA 1NW8A 4ZAWA 1YCFA 3GRCA 1ZEJA 4WXEA 2AD1A 4CM8A 4RTJA 3H5VA 1PEDA 5JVDA 1XRSB 5DM2A 3EFEA 2DKOA 3EXIA 1DNPA 3MK31 2H7VA 1N8KA 3LRPA 4H1TA 3W5VA 1SXQA 3A06A 4PSCA 4YMUA 1BCRB 1DAGA 3CEHA 3NORA 2QQFA 3O5AA 2ZJ5A 3EY4A 3E4CA 1X9IA 2WA1A 1GLNA 3KB2A 4ODIA 1R15A 3FMGA 4LFBB 2R25B 5AQ1A 3VMFA 1XRMA 3QX3A 1QQ6A 5BORA 1O95D 4GZMA 3EULA 3K0FA 3AP2A 5JXJA 3DDOA 4CKWB 4E07A 4QDTA 3ULKA 4G5XA 3MOSA 4FEGA 3C1AA 2GZSA 3KSUA 3RYCB 1CUSA 1N2CA 5KAPA 4B4KA 3N2GA 7MDHA 3LOQA 1RS0A 4OQ4A 1EWYA 1HYEA 2IHYA 4LOLA 2Y0PA 4BYGA 1QUEA 2ZRNA 1VSUA 2H2IA 3SEAA 8MHTA 3JYNA 4G0PA 4ALLA 1Q1BA 2PMDA 4I66A 4RAQA 1EK2A 5FOTA 3REQB 1WMAA 3TK1A 2I33A 2RD2A 3GT3A 4KFRA 2PGNA 4G5RA 5JS8A 1ODFA 3QMVA 2IEGA 2VHJA 5JCXA 2IBSA 1V1MB 4W1PA 4C4ZA 4MYUA 4ZD6A 1O94A 2JCVA 2LVBA 1AHHA 2HSGA 3B6IA 3WQSB 3WYFA 4KREA 1XDBA 1SVLA 2ISCA 2ON6A 4MWBA 2YUIA 2PMCA 3TSWA 4L6IA 1TK3A 1V5IA 1TCCA 4IFBA 3ZIAA 3CA8A 3H1EA 4MKZA 2J7KA 3QYJA 2NNLD 4WDQA 3A7DA 2FKAA 3DBOB 1SXGA 4PAWA 2YNMD 3RUIA 2VHTA 4MUGA 2ZYWX 1SKYE 1H8HA 2R7MA 3HKCB 2GEFA 3QE2A 4QOIA 1P7WA 3UT6A 1TAGA 3W8RA 2NVUB 4BNVA 3DE5X 3OH8A 5BUQA 4ZWNA 4Y9DA 1SD1A 2B69A 2ZUUA 2M6RA 3AEXA 4HEA6 2QUBA 2VYVD 4I8IA 4IJKA 4QYSA 1PR2A 2PLAA 2BM9A 4NS4A 3PDIB 3TH5A 4URVR 3ABRB 3HVIA 1LBHA 2PQMA 1HA3A 2G28A 4ZVTA 4IUCS 2OCAA 4KH0A 3WGUA 2IV3A 4Z9YA 3TNDA 4KWTA 1U3FA 1GAWA 2XJ4A 4AT1A 1RWNA 2CNLA 3C3PA 3O8CA 1MDBA 1OFGA 4AKHA 2OXTA 3PFIA 1SUPA 3K71B 2IUSA 2TMDA 1X1DA 1VSBA 3PQCA 4DKJA 2C94A 1YRLA 2DE0X 2IF0A 4H1VA 5CNKA 4MGZR 4QDUA 5I3ZA 3CSSA 3ZBTA 2K4MA 3PPYA 1PL7A 3GFQA 2GNPA 2NADA 3PWKA 3QVXA 2IZ1A 5HPYB 2HLDD 3VNQA 4JT4A 4U5XA 3TJZA 3ZHBA 4XWTA 4OPMA 5DX8A 3VNAA 2ANCA 3DBRB 2GM9A 5SV2A 1MMFB 4RHFA 3SX0A 3IHKA 3ZLTA 1BD3A 4ITVA 5IZCC 2QLFA 3AH8A 3ZWVA 3UIEA 1K98A 2IH2A 1WKBA 2J09A 4DLXA 2W5UA 2RIRA 2HZ7A 1I2DA 1H1TA 1B23P 1W4CA 3B1YA 2PUVA 3PUIA 5E6SB 5C5DA 1NJFA 1U94A 4AUEA 3IJPA