2J5XA

Structure of the small g protein arf6 in complex with gtpgammas
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
NKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Gdp-GTP Cycle of Human Arf6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-RIBOSYLATION FACTOR 6
total genus 55
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2j5xA00
4KFTA 4U00A 2VSXA 4ZPXA 4RCYA 3NWJA 5BW8A 3B9QA 3P26A 4ZKEA 1F3OA 2FFAA 3LA6A 4B6FA 1W4RA 2LKDA 1KI3A 3LQRA 4D4KA 4XWKA 3AF4A 1Q1QA 3IO3A 4UJ5A 2O8BA 5JECA 2H7VA 2NQ2C 3GFOA 4TSFD 4C0LA 3NDPA 3KKPA 4TMKA 2R65A 4MKFA 3A4MA 2ERXA 1Y63A 4HLUA 1Z0AA 4LZZA 1GILA 4XD7A 3R8FA 1NKSA 1F2UB 3Q5DA 4KLZA 5KYKA 3FMFA 1WP9A 1W36D 3LNCA 1E3MA 1GRQA 3UMFA 2V55B 4DJTA 4E22A 3GLFA 5JMTA 4DDWA 3FB4A 3AEZA 2JLQA 4A8JA 3CH5A 5J4HA 1SVMA 1E2HA 1LW7A 1NNEA 4CT4B 4ZCMA 3VFDA 2GXUA 4Q9IA 1KJYA 2HXYA 1QVRA 5EZ6B 1T0JB 1M1YE 2J5XA 2WJJA 3QKSB 3KJIA 4KHZA 4LWZA 4DB2A 2HJGA 1JAHA 2RGXA 3GLGE 1ZNYA 2GJAA 3IPYA 5D3QA 4Q4JA 4PANA 1NSFA 3QVUA 1SULA 4GRAA 2IYRA 4JLAA 5L3RA 2HEIA 2C77A 2YZ2A 3HU1A 1A1VA 2RGAA 4Y0VA 2NZ8A 3DM9B 1RRFA 4PZZA 3DZDA 1KI6A 5LB2A 1HURA 3EZFA 3KJEA 3BH7A 5CDFE 2J0SA 1BS1A 3RS7A 3WNDA 3I3SR 4TQUS 4M9QA 2MSDB 3HYRA 3GCGA 1GKUB 2WJGA 3SR0A 2ZI9A 2PZEA 3C5CA 2VL7A 1HE1C 2QROA 5TV2A 5SZJA 2XNDD 4JLPA 4S35A 3Q8XB 4A8JB 3A1TA 2ERYA 2BMEA 2GK7A 3TR5A 1HT1E 2R6DA 2EFHB 1F2TA 3AF0A 3THYA 3VR2A 3BC1A 4V03A 4LBVA 1HUQA 2G1JA 4HB4A 4WBSA 4ASUA 4QM6A 3DM5A 2CEAA 1OHHD 1J8MF 4FWIB 5JCZA 4TZ0A 3TGPA 5GJVC 3TW8B 3X1ZA 3CNLA 3BFXA 2J0QA 3O8BA 4YMTA 3BWDD 3BB1A 1Z29A 3CX8A 3QXCA 4QGGA 1WE2A 1XD2B 1XBTA 3T1QA 4QJ3A 2NO7A 4NMMA 3WMEA 4O3MA 3WYGA 3VQTA 1ZM4A 5A5GA 4F91B 2DCUA 2QPOA 3QVVA 2NTYC 5KSOA 2WPDA 4IOMA 4OI2A 2ZRGA 4QHYA 4C0QC 4QBGB 4IOLA 2NZJA 4ZDWA 4MYCA 4H1VA 521PA 1FX0B 3MGCA 3QPWA 3R9IA 2JIZD 1VHTA 2P5SA 3KFXA 2OESA 4JJKA 3LRPA 3QXJA 2REBA 4JT4A 1CULC 2CLDX 2ZI4A 4RFVA 4M1MA 1FOEB 2G1KA 1D2EA 2KSQA 3DZ8A 3BAFA 3IO5A 1KDPA 5C18A 4UXHA 4BASA 3R7WB 5M04A 3ZZUA 1EWRA 1P2TA 1YVDA 4JZKA 1VECA 1KGDA 3L0IB 4HUQB 5IK2A 1S1CA 1JBKA 3EW9A 4NCIA 3Q5EA 1IN7A 4EAQA 1ODFA 1QVAA 2A2ZA 1CS4C 4V0NA 3IDQA 4QHTA 1HEIA 3EPLA 3B1WA 3QKTA 4MDFA 2BOVA 2Z0MA 2A78A 3TH5A 2ZRHA 4HAUA 2GTPA 2H8KA 4QBFA 2QP4A 4B2PA 4QNRA 4EUNA 5EP2A 3TIFA 3RABA 4URUR 2QORA 5DYIA 5DYGA 1VMAA 1MKYA 1K5GA 4DLRA 2GKSA 1CJMA 4Q1BA 2VHQA 3KQHA 1E0AA 5AWFC 2J0UB 5JWRA 4ARZB 2OM2A 3TW4A 4DSTA 1G17A 4DHEA 1GNQA 2FEOA 1U2RA 3UMRA 1S0UA 1AS3A 5CM9C 3WYFA 5FUWA 5JI2E 2QEQA 2ZSAA 2ZE6A 3HR7A 4LJAA 2DB3A 1E2QA 3L0SA 4TN1A 2ZRNA 3TUJC 2CLCX 4GMXA 4RD2A 5AJXA 4LPKA 1D9XA 2JJ1A 4L5BA 3B13B 1AJEA 4M1KA 4A8JC 1L8QA 2CNWA 3OIWA 3QG5A 3FGNA 3W6OA 4F93B 2NO6A 4OHZA 1ZU4A 1RC8A 2YC2C 1KI7A 2MSCB 4RFSB 3FTQA 2C8VA 5G41A 2WKPA 1CR1A 4B3BA 1Q22A 1E0KA 1ZC3A 3DDCA 2QBYA 4B47A 1OXTA 2OILA 4AKGA 1VG8A 3IPXA 1TTTA 3Q85A 1VG9B 1OFHA 3A1WA 5FOWA 1WBDA 4WA7A 4KYIB 3RHFA 5AUOB 4HB3A 4PO9A 1XFAA 2AXPA 5KHOC 1CLUA 5EZ5A 2B7CA 5KNCA 2ATVA 1W4CA 4D81A 3E2IA 1GL7A 3B1XA 2A3RA 1VYTA 4NYJR 4EKDA 4XVQA 2ORWA 4ACBA 2JLRA 2N46A 4AYWA 3B8HA 2CLSA 3OIUA 1GG2A 4JIMA 5FR1A 4AG6A 1EGAA 1Z6AA 3GJXC 3TUIC 3TSZA 4LBYA 1E4VA 3KB2A 2JLWA 4FXPA 4M9SA 4QJ5A 1OFIA 4G5GA 4MH0R 2D2EA 4AKIA 3CBQA 2BKEA 2EFCB 4TLEA 2J7PA 4OQFA 1FNMA 2WWWA 2ZR0A 2KBEA 4DLYA 3QKUA 2JLXA 3WHLA 3AV0B 1ZD9A 2ZAMA 3ZVMA 4MITA 1Q3TA 4NCHA 5CLLA 1LV7A 2ZI3A 1W0JD 4FW9A 2ZJBA 3SJCA 3T5DA 3GPLA 4X8LA 4W5JA 1NLYA 2V8OA 2VP6A 2OT3B 2RH5A 3JVUA 1NIJA 3RRYA 3NH6A 4IKEA 2H5EA 1MABB 4KI0A 4BQSA 2V9PA 2IUTA 2JLUA 1T8UA 4A1FA 2OLJA 2FWRA 4XTRA 1YRBA 2GAAA 4II7A 2G9NA 3ZS8A 5GVRA 3SJAA 1N6KA 3B9PA 3REGA 3WP1B 1YHNA 1YU9A 4Q4HA 3AB3A 4OL0A 4TL9A 4EFMA 1PVOA 3MUFA 3DPUA 4KU4A 1TUIA 3TVDA 2R62A 2XITA 5F9FA 2ZRKA 1FUKA 2XSZA 2GILA 4M1SA 4NCJA 5J40A 1Z28A 3SOPA 1G3QA 2B21A 5JCPA 2QBYB 1J2JA 3EIEA 5B30A 3PFIA 2R6CA 3ZS9A 4HSEA 1IN6A 2PCLA 1OHHA 4RFSA 1GVNB 3B1YA 1LNZA 5JWOA 3AVXA 2FA9A 3D31A 4HZIA 1MRNA 2CL6X 2XTZA 3I1FA 4HAZA 3SBDA 3K70B 1JAIA 4KFRA 5DE3A 1P9WA 4ERNA 1SXJB 1RFLA 3CF2A 2H16A 2QM7A 4DDVA 4KVGA 2CHGA 4D6PA 1GNPA 3GLHA 3B7GA 1QRAA 1U0LA 3EWSA 4P4TA 2CBZA 5TY0A 4AYXA 2HLDD 1IAQA 1U98A 2JASA 3LLUA 2R8RA 2O0KA 3JZAA 2W2VA 4D25A 2YHSA 3T1OA 3K0SA 1XXHB 4DUGA 2WKRA 2ZU6A 4RSGA 1RJ9B 3ZVRA 5JLJA 1QG4A 3MJRA 1ZVQA 2YWEA 2A5GA 5KU1A 3TQFA 3AKYA 4M1TA 5TMPA 1HTWA 1WRBA 4LHZA 2ONJA 1Z83A 4B71A 2IS2A 1IM2A 5HKKD 1JJVA 3MWJA 2GVZC 2XEXA 3BH0A 3FE2A 5C1BA 1EESA 1H8ED 2YYZA 4JLJA 2GEVA 4TT3D 2G0TA 2J46A 2VP2A 1C9KA 3UIEA 1KKMA 5TDHA 4XVUA 2WVJA 1FP6A 1DELA 2P67A 2DWQA 2QPAA 3CW2A 3HU2A 3VKWA 4PC1A 1M6NA 2DBYA 4NP6A 3ZJYA 1ZMXA 4HB2A 2VP9A 3A1SA 1W36C 4OJQA 1UKVY 1YJ5A 1NL3A 4LK2A 1AQYA 3PQCA 1E9AA 4YXWD 2XTNA 1BMFA 4D4LA 4V0ME 3VKGA 1TF2A 3M1IA 5G3YA 4ESVA 1NBMA 4LYJA 5FL7A 2XZOA 2IK8A 1ONBA 3SYLA 5FL7D 4TSFA 4IJMA 2W6JD 5KNBA 1U0JA 4QJ4A 2ATXA 4CEIA 4LPSA 4C0HA 2PEZA 2P0EA 4WZAE 3UG7A 1E9DA 2D2FA 2Q21A 2ZRAA 4V0KA 3BXZA 1PUJA 5FPSA 1ZNWA 2PJZA 2FSIA 4E07A 4LYHA 1FW6A 1XPUA 3PUXA 1SGWA 3P4XA 2J59A 2OHFA 2QT1A 4RVCA 3X1DA 2MSEB 2A7QA 2F55A 1C4OA 1CKEA 1QHYA 1W4AA 2ZM5A 4FCWA 2QMEA 1I4TD 4B3XA 3PR1A 3AM1A 4PAOA 4IDOA 2Q3FA 4C7OB 2ZAOA 1F6BA 1HE8B 4RZ2A 1MO5A 2VTKA 1U8AA 2RMKA 2GBLC 5HKKA 2WKQA 4PHGA 1Q20A 3B78A 1YKSA 3KB1A 4D0GA 3OIYA 5BXQC 3CRW1 5BN5A 2VSFA 3SYKA 4DXAA 4RCZA 1NIPA 3A6PC 1LFDB 1P7CA 2BMJA 1M8PA 2FZ4A 5BYJA 5L3SB 3BS4A 2PX0A 4TLAA 3EWAA 1H65A 2KI5A 3CB4A 3LY5A 3ZIAD 4F7WA 4P33A 4DLWA 3GEIA 4POAA 5DSZA 1E79A 4TL7A 4I99A 4HATA 2F6RA 5UKDA 1W5SA 2D4HA 2ORIA 4LX0A 1KMQA 3U44A 2CJWA 4ILEA 3V4FA 3UPUA 3U7FB 1E9CA 4Q48A 2RGBA 1N6NA 3NHBA 2ZEJA 2JDIA 4AURA 4B35A 4M1OA 4Q4JB 3LXRA 1N5KA 1X6VA 2EU8A 2KBFA 4DIDA 3UWOA 2H92A 5GJCA 2VP0A 3TSOA 3LO5A 3EPKA 2C9OA 3P32A 4JYCA 4YONB 5FUXA 1UEJA 2FPKA 1BH2A 2WAXA 1AS2A 1IJEA 121PA 3LX5A 4LOAA 3ETLA 3UKDA 4A6XA 3K9LA 3P27A 1RRCA 4BFTA 1D6JA 4TYWA 5SZHB 2V6JA 3I5XA 2FGJA 4PTLA 1FX0A 2ZRFA 3W3AA 3WYAA 3U3KA 3AF2A 4EFNA 1KAGA 1SKQA 1LF5A 2CXXA 5FUVA 3AVQA 1OT3A 2J1LA 4PO8A 3CF0A 1HY3A 3ADBA 1RKBA 3FMPB 3F3YA 1ZD1A 2OBNA 2WAYA 3K9HA 3GLIB 1Z3IX 2A5DA 2A5YB 4LHXA 4B2IA 1AZSC 4TLBA 3I8XA 1AZTA 1G18A 2I3BA 2QRNA 5AK0A 4DEXA 3BK7A 1YR8A 3I61A 3Q7QA 2QA5A 4YLGA 4TYQA 3R8CA 3K0AA 4I4LA 1X1SA 4QFMA 1XJ0A 5K8LA 2QSYA 2EQBA 2IYZA 4G5QA 2QRZA 3EC2A 3CX6A 4Q66C 8OHMA 1XXHA 1XEFA 1ZD8A 2D06A 3CH4B 3SZRA 4AG5A 2C78A 4DWJA 3QUSA 4Q1DA 1Z0IA 2EVWX 4TMWA 3T12A 1OIVA 3AVOA 1CRQA 2CHVA 2VEDA 1TU3A 3WNBA 2VHTA 4OHVA 3K70C 3EIQA 2OV2A 1JQJC 5L3VA 1OLOA 1G4AE 3N2EA 3TJZA 2O8FA 1II8A 4HZUB 2PEYA 5FBVB 1FUUA 4J0QA 4QC2A 2ZJYA 3THOA 4JKIA 5CLQA 3CKLA 5G3ZA 5JJIA 4ZI2A 2GAOA 1EFTA 5E7IA 5B64A 4TMZA 3PJRA 1E2MA 4ITRC 4L4UA 1GOTA 1R6BX 3FFBA 2F3RA 1Z8FA 4ZO4A 4QBIA 3T34A 2EFGA 3LBHA 1DAIA 2WJHA 4Z8YA 3KJGA 4E03A 1P6XA 4G0NA 1KSGA 1P3JA 4JVSB 2IXEA 4IEEA 1K5DA 4PHFA 3FVQA 5EQTA 1JALA 1KY2A 4XWOA 1TX4B 2Z5FA 1GFIA 1NN0A 1XX6A 3ASYA 4X8MA 2HUPA 1U9IC 2D7CA 4G5SA 4L15A 4A0HA 4LRWA 2C96A 5CJ2A 3M4YA 1OFUX 1XJQA 3QKRA 3ZH9B 1NJGA 2ZS9A 4FIDA 4HAYA 3EZ9A 2VLIA 4I1VA 3I4LA 2XJ9A 4UJ3A 4ON9A 4DCNA 3EPJA 1Q21A 3H86A 4O2RA 4LY6A 4M21A 4MRPA 1IY0A 1OW3B 4P31A 2ECKA 4CRWB 5JRZA 4Y0AA 5FPHA 2J7KA 4HUTA 2AKAB 3TK1A 4Q4AA 2IYQA 4FINA 2QQ0A 4JS0A 4Z54A 4TL6A 4EJSB 4WIAA 5KTYA 2ZS7A 4NHOA 4XOIA 4ASUD 1T0HB 1XZQA 1QZXA 3THWB 1ZUIA 5EP1A 1XEXB 2FPMA 2ZRCA 4UNPA 4DSUA 2R6FA 1J8YF 1NLZA 2GCOA 3L8YA 1NG9A 1RRGA 2IYLD 1XTKA 2O8CB 5FR2A 1Z0KA 1P75A 2HYDA 4V0OA 4IXMA 4IRUB 2OSBA 4GBMA 4YDHB 4NONA 2AL7A 3OEHD 2AD5A 1VTKA 4BZQA 1E69A 1Q1EA 5AR1A 2QENA 2PT5A 5GJWC 5B58C 4DLZA 4FWTA 5FTNA 4BLRA 2F9LA 1VIAA 1QHIA 2V7QD 2EWWA 2GF0A 1ZBDA 3FWYA 1G5TA 2YV5A 4DLXA 2B7BA 4X8HA 4EJSA 2AX4A 4Q4AB 5FOUA 5JEDA 4GZLA 5BYKA 2FFHA 1VCOA 3CNOA 4MRVA 2R6GA 4TTPA 2O8BB 1DARA 1SVKA 4CEJB 3CLVA 2ZR9A 3WNCA 5DNYB 2ZITA 2QT0A 4DSNA 1HA3A 3DMDA 1I4DD 1DEKA 1G1MA 2W2XA 4RD6A 2IYXA 3SE0A 3U2QA 3EA0A 3FHCB 1EK0A 1PUIA 1TQDA 2WBLC 3W6PA 3ADDA 2XXAB 3NDBB 1P9NA 4Q7MB 2A30A 4GT1A 2QTVB 4WZ6A 1XCMA 3O8RA 3KTAA 3V4RA 4XD7D 5IHPA 1ESMA 1VIYA 1D2NA 2D74A 3AUXA 1E98A 1Q44A 3FDIA 1KTVA 1KI8A 1W5TA 2IHBA 1Z47A 2ZSEA 3AVUA 3NTUA 2WICA 3GFTA 4URXR 4R98A 1U94A 2KJQA 2YC4C 2Z4SA 2MMCA 4F38A 2ODEA 2KWIA 3A4LA 2GZDA 4M8NE 2VF8A 5SZIA 1NMYA 4JKYA 2F1IA 3FHTA 1N6IA 3QXSA 4BPBA 2IEZA 5EUMA 1Y3AA 4Q1CA 5EUQB 4PQRA 1KHTA 2GJKA 3GFPA 3IUYA 4PSAA 2IF0A 4XIGS 3T1TA 2RHMA 2WJYA 3D3QA 1XCPA 3NVAA 4OI0A 5DISB 1AM4D 1CRPA 3MCAA 3CO5A 2O52A 1I2MA 4BLOA 4ZKDA 3U3JA 2F43B 4DVGA 3H2YA 4NBSA 4CZ2A 2BDTA 3LFUA 1TQ4A 2TMKA 1PZNA 1TU4A 2HT6A 4R2IA 3PVSA 1S3GA 2QE7A 2LCFA 1LS6A 2PL3A 2PZFA 2GA8A 4TQ9A 3W3ZB 1ZUHA 1E9BA 3EZ6A 4A6PA 2W83A 2ZU0C 3IQWA 5IT5A 4MKGA 4LCBA 3AVPA 2WOOA 4C9BA 2WWXA 4GNKA 3BIFA 1R8QA 3KKMA 1W0KA 1L4YA 1KK1A 2DFLA 5EE1A 3EZ2A 1Z63A 2ZSFA 1NBME 2QPTA 3KKNA 1XD2A 4CGZA 621PA 4OHYA 2OCPA 4JLBA 1EWQA 4D4JA 3LW7A 2ZXUA 1XMIA 421PA 3K09A 2PBRA 2ZRDA 4PSVA 1E1QA 4XJXA 4LI0A 4RD0A 5KPDA 2I1QA 3OIVA 1WCV1 2BEKA 3QKRB 1BIFA 1P60A 1R8SA 2IUSA 2NPIA 3VNUA 4W5WA 4BFYA 2E9SA 2CCKA 2VP4A 1NP6A 1R0ZA 2QP9X 3RYTC 2WMNB 1CF4A 2D3WA 4LJYA 3K0CA 4TWZA 6Q21A 2ZRIA 4XSGA 4ZI3A 2FJUA 1T5IA 1E2NA 4WXRA 3OEEA 1GDDA 3GJ7A 4LV8B 3U5ZB 3WBKA 1KO1A 3GQBA 4H1UA 4MGZR 4QG7A 5B2ZA 1E9EA 1E9SA 1K8RA 1WA5A 3NBYC 2X1VA 2PH1A 3GLIE 4BRUA 4OQNA 4RJLA 5IDVA 4YMVA 3KX2A 2V4ZA 1XMJA 3QOFA 4TQAA 3TAUA 1KDOA 2DWPA 2RGNC 3FKSA 5KDDA 1II8B 4Q7LA 2O8FB 4PHTA 4EJSC 1U8ZA 4IXNA 2J45A 3R9XA 4NYJQ 5TB5A 2J7PD 2KB0A 2OCAA 4JT2A 1G291 1XTIA 1DAEA 3PV0A 2W6IA 1N3BA 1SVIA 2IYUA 1KSFX 4CT5A 2O0HA 4PC6A 5FBRB 4A15A 1JR3D 4QBHA 3TRFA 3GP8A 1OIWA 4UNQA 3KQKA 3A4NA 3GLFB 4KXFB 3ND8A 5F2EA 3F0TA 3ONWA 2V3CC 3ZVLA 1TPZA 4CEHB 4IDPA 4B34A 3BJIC 1N25A 3SJBA 3F5FA 1ZM9A 5DH9A 5HZHA 1Z2AA 2ZJZA 3MG9A 3BFVA 2XNSA 2Z43A 1XDBA 3VX3A 4CF7A 2QL6A 4TTRA 4N3NA 1R0YA 1RIFA 4HLUC 3EAQA 4EQ6A 3IIJA 2Q6TA 4CVNA 1G5RA 3QJYA 4GP6A 1FFHA 4Q01A 3TKLA 2A5FA 2OCYC 1G3UA 3N5CA 2LWIA 2ZI6A 3ADKA 1KI2A 1XCGB 1S96A 3P20A 1ANKA 3BORA 4JLKA 2P2LA 4Q03A 3BD9A 2ZUDA 4MRNA 3RC3A 5B57C 4P4SB 1JEDA 2FOLA 3UANA 4K8OA 3QY0A 1U8YA 2CCGA 4B48A 1JI0A 3HJNA 2J87A 1A5TA 1OYYA 4KLNA 5JEEA 4EPYA 4BGDA 4OJKA 4NZYA 1PLKA 4BFVA 5A4JA 4Q9KA 1COWA 1MO4A 3GMTA 5F3WB 2XOKA 2IBMA 1E2LA 1TF5A 1N5LA 3LBNA 4TMXA 3X1WA 1JXMA 2WIBA 3BGWA 1WF3A 3AP2A 4V0MA 1G8YA 3SJZA 4AKEA 4EPTA 3VKHA 3K8YA 4LV5B 2IW3A 1G3IA 4HLQB 1A2KC 3JVVA 1OB5A 4QGAA 2V7QA 4DLUA 1E96A 1EXMA 1N6HA 1DAMA 3B2EA 2H17A 2EYUA 1R0XA 3TNFA 3GJ8A 1T3LA 4L9WA 2WMOB 1US8A 4HAVA 1H8HD 3U44B 4EQ6B 1HT2E 3CRVA 3FHOA 2JLVA 3I92A 1E99A 3D7MA 3KZ1E 3OZXA 4JSYA 1X8LA 1KIMA 1KMHA 1XZPA 4A36A 4Z1MD 4FMBB 1LY1A 2NO0A 1P62B 1PLLA 2BJVA 4B73A 3QQ5A 2HT1A 4ESHA 3GLHE 1FMJA 1ZINA 1RJ9A 2CE7A 1UF9A 4JLDA 1E2PA 4MYTA 5IK2D 4HYYA 1T3SA 4BZXA 1ZUNB 1CR0A 1D2MA 4M53A 4D2IA 1WB9A 2NO9A 1BYIA 3I73A 3V00A 2IF2A 2IYWA 4IEIA 4F4IA 1JR6A 2O8EA 1UKEA 5EXTA 2AHOA 2AN9A 5IF9A 1H8HA 1NVVQ 5JS7A 2Y8EA 3NC0C 5EP4A 5KOYA 1NG1A 4ZDIA 4F4CA 3QPUA 2JIZA 1NVVR 5FBWB 2ZJ2A 4JL5A 3TSWA 2NGRA 3MRSA 4M1YA 2ZI7A 4OBEA 1W49A 4LJ9A 2RCNA 1UADA 4FN5A 3LXXA 1XP8A 5JRJA 3RWOA 2C9YA 3IBYA 1Q0UA 3ZZ0A 2WSSA 1K6MA 3N2IA 5FOXA 1Q1ZA 5HZKA 5C2JB 3EARA 3WXMA 4BRWA 3C15C 4Q4HB 3VMFA 1S3SA 2RGNA 3VR4A 4E5UA 2IS6A 1TUEA 3IEVA 1YZLA 3AF3A 3HPQA 2AD1A 2NO1A 3AH8A 4HAXA 3N70A 5KNDA 1NLFA 1A82A 3CF6R 4BLSA 1G7TA 4JLMA 1U81A 3C5HA 1YZGA 2ODNA 4PQFA 4B3FX 3DKPA 1D9ZA 2VHCA 4OHXA 1P4SA 4YMUA 2PJRA 1J99A 3AVYA 4IFBA 3BERA 5ELXA 3A36A 2XNDA 3I5YA 2OE2A 2FFQA 5KDOA 1VCMA 3VU9B 2C03A 2OUKA 1N6RA 5DIFA 1BO6A 2JEOA 1Z0JA 5FTKA 1DOAA 3JZMA 3RAPR 3SQWA 4AI6A 2H18A 3K53A 3IQXA 5E3HA 2XX3A 3ZZTA 1W2GA 2BBSA 1WDTA 3ICEA 4DSOA 4KYUA 4OK3A 2VPPA 4C2UA 3A58B 5FPTA 1QHNA 1J7KA 3REFA 2HYIC 2BM1A 2A5JA 3QE0A 3T35A 2ZYUX 3CR8A 1SVWA 4UNRA 2X77A 1F48A 2JLZA 1NMXA 2JLYA 3GJ5A 2BBOA 2FMXA 1XMVA 3NC1C 3TQCA 4DLVA 1KYIA 1JPJA 1T91A 3BRWD 3P1JA 2IUUA 1IN5A 1W1WA 2B8TA 1GSIA 1IXZA 4NYMR 3LX8A 4D0LB 5LB4A 1G7CA 1CR4A 2XOKD 1N6OA 2HCBA 2FZLA 4JJZA 1KK0A 4B74A 5H8WA 3TR0A 1U99A 5E7JA 2X2FA 3E5HA 1G20E 3EASA 4PX9A 3T5GA 4PAQA 1W36B 2C98A 2ZUCA 3K9NA 4BFZA 4P3YA 3L2OB 4DEYA 4DRZA 1A2BA 1S4QA 1EFRD 2G77B 1SHZA 2OAQ1 4US1R 2FV8A 2GRJA 4XH9B 5DHAA 3QBTA 3KFVA 3QENA 1SXJE 1XMSA 5TVKA 1OH8A 1GUAA 3CRQA 4BLQA 4B76A 1OXVA 1JECA 1GWNA 3BBPA 3O8CA 4G5RA 3SNHA 2JA1A 4WOPA 2F7SA 2FF7A 3PUWA 2VHUA 821PA 1ZAKA 1II0A 4MRSA 3MAAC 4JLNA 1IONA 5JBQA 2JAQA 4BUJA 1OKKD 1IJFA 4M9ZA 2JDID 1GIAA 1JR3A 1DG1G 2ZJ5A 3CZPA 3GJ6A 5CM8B 3GLGA 2ZSBA 3NBXX 2EYQA 3AKEA 2CMKA 4L9SA 2VYFA 1W0KD 2I4IA 1LB1B 4IDQA 1RVDA 4B3GA 4EIWA 3SU8A 2QMHA 3KXKA 1TEVA 3RVBA 1SXJC 3RWMB 1DO2A 3ZIAA 4DCUA 1CR2A 1E0JA 1E2EA 4LSGA 3QEOA 2FSFA 1EX6A 2B92A 1G8FA 2CHQA 4JBWA 1IXRC 4Q9JA 1VG1A 1QBKC 4AYTA 3GJ0A 5AJWA 2IXFA 1UBGA 4QXAA 4C4PA 4U7DA 4CYMA 4BEBA 1JPNA 1XEWX 1E9FA 1W4BA 2RGDA 4JMPA 4KCGA 2UVQA 3DHWC 3H84A 2C5LA 4QM7A 5CYOA 2PLFA 2ZE5A 5H68A 3PENA 4N1AA 1QHHB 2IEYA 1KK3A 3WMGA 1OV4A 5J47A 3KJHA 1OKKA 3TLXA 2RKOA 3U4QA 4FD2A 5DN6A 1GZSA 1V5WA 4DT1A 2ZPTX 4US0R 3THWA 3DOFA 2OBLA 3HP1A 4R9UC 2XB4A 1OH6A 2BM0A 2ZTSA 2Q3MA 1E32A 4NTZA 4P4SA 3LQQA 3X2SA 5AJZA 3RS5A 3K0EA 2O0JA 3CZQA 1IN8A 1NY5A 2OXCA 1E1QD 5FPKA 5JI3E 2RGEA 3NKVA 1QHXA 1XF9A 1YR9A 2BKUA 1OPXA 5FH9A 1IOZA 4EPXA 2OO7A 1J70A 4Q1FA 4A2QA 4C0KA 1R0WA 3NHAA 4JLOA 3L82B 1IY2A 3LLMA 1BMFD 1XTQA 3LW8A 5DLQC 1M7GA 1S8FA 4GOKA 1XNJA 2QP3A 2FX3A 3LVRE 2QM8A 4LBZA 5G40A 4Z51A 2QAJA 4PXAA 2I1VB 3ZGXA 1E1RD 1F2TB 1YRAA 1NVUQ 3BOSA 1M34E 2K5UA 3MSXA 3WHKA 2QE7D 1KNXA 1GAJA 4URZR 4XTCS 4W7SA 4DZZA 3CWQA 1E9RA 3W34A 2GJ8A 4UNNA 3HWSA 3C7KA 2IWRA 3AVTA 1EFHA 4DLTA 2GJ9A 4V0LA 4TT3A 1II9A 2BJWA 2WWFA 4QOSA 1Q57A 4FMCF 4MA4A 3VR1A 5GADl 4BEJA 5KO2A 1E2JA 3K0CC 1G8PA 2JCSA 3W9YA 4S2EA 4QKQA 1R7RA 1QF9A 2IL1A 3NIBA 5A0FA 2AFHE 2Q9CA 4C0BA 1WXQA 2GZAA 1L7VC 4NU0A 3H1TA 2QN6A 4L8GA 3C8UA 4DUGD 1E1RA 4O0MA 4URYR 2RHDA 4DC9A 2QAGB 3SFZA 1OH7A 1FP7A 2O8DA 2OXRA 2HLDA 3OEHA 3W90A 2GK6A 4HDQB 3M0EA 4MRRA 3U6BA 2ASEA 1Z6GA 4LJ5A 1XRJA 1G16A 4K46A 4PZYA 1C1YA 3B1ZA 5DI3B 5HPYB 4ZIRB 3NH9A 3X1XA 5JHHB 2F1JA 4RD4A 3UG6A 1B0UA 4LHWA 1KI9A 3I8SA 5D3MA 1NRJB 1VCNA 1QG2A 3DVLA 1G3MA 1Z08A 4RZUA 4DIEA 3WMFA 4PO1A 1SKYB 2N1BA 2P3SA 3U61B 4D4MA 5C4MA 4EDHA 1UEIA 4IOJA 5DN6D 3Q72A 2IS4A 2CL7X 1NMZA 4KBFA 1FZQA 3A37A 4YC7A 4GOJA 1M7BA 1OJLA 4Q18A 1UPTA 4CDGA 2VA8A 2WSSD 1KSJA 3SFVA 4M2LA 5AUPB 3IHLA 3L8ZA 1IN4A 2ZRBA 2CK3A 4PR0A 2QTFA 1LTQA 5JJKA 3S1AB 1M2OB 4D80A 1G3RA 1ETUA 4MUAA 1CJTC 3U3RA 5FPYA 4D26A 2QG6A 1BYUA 2OAP1 2ZVPX 3AQ4A 3LWNA 3QNUA 5D3MB 2QUZA 1AA9A 2W00A 4ZIRA 4HDCA 4EFLA 4XWAA 3K70D 5J4KA 2GXAA 2OFOA 5DI3A 5CB8A 2FE4A 1XXHE 4OK6A 4C0JA 1TADA 1MT0A 1P5ZB 1DAGA 1LVGA 4QGHA 3VR3A 2GESA 1NF3A 1ZW6A 1T8TA 4AIIA 2MMGA 1P2SA 2O8DB 4CIDA 5K8IA 1JB1A 4DDUA 3K0FB 2GNOA 2CL0X 5BWMA 4HB0A 4Q19A 1CJUC 1OXUA 1SHKA 2GXQA 2GF9A 4H9GA 5EP3A 4K81B 2ZREA 5C4GB 3R20A 4PC7A 2VF7A 4BECA 5HE9A 4Z1MA 1NSTA 5F9HA 4R7ZA 4D82A 3QXXA 3K0FA 3OFNA 4A0RA 3IKJA 1Z6YA 1W44A 2QI9C 4BFWA 3CONA 2V1XA 1X8JA 3RS2A 3T1VA 1G9XA 3H4MA 5JJLA 1F5NA 5L3QB 4MUBA 4UXIA 2WJVA 4LJ8A 3AGQA 3CNNA 2GETA 5AJYA 1ELOA 4NKRA 4EPRA 5JFGA 3DL0A 2C2HA 5AUQA 5J4LA 3CUEF 2FSGA 2P65A 2YKGA 2IXGA 2IA5A 5CIWA 4RY2A 4AWXA 4UKDA 1YR7A 2W58A 2ZRLA 2W0MA 3FKQA 1KI1A 3IGFA 4F4JA 5E7MA 3S1AA 4DCVA 2XXAA 5CDFA 2FEMA 4MYHA 5BQ5A 2RGGA 3VHXA 4C7OA 2WSMA 3UXMA 1AK2A 1EFCA 3I32A 5CITA 2G88A 2NMVA 1YZKA 4O25A 3GJ3A 3SEAA 3K09C 3TAHA 4OYHA 5JZVA 1IBRA 1XTJA 3WBJA 2QTHA 2ZUBA 1P73A 2YWHA 1WBBA 3OE7D 5CK4A 4TMVA 1ZM3A 3T15A 3AP1A 3Q7PA 2A9KA 1QDEA 3ZYCA 4FMDF 5FBQB 4Q1EA 2WWYA 3PEUA 1KDTA 3QPVA 4W5HA 1SKYE 3PEVA 3QF4A 4RD1A 5CB6A 4DCTA 3CM0A 1OIXA 3U4QB 3B85A 2ZSDA 1YZNA 2F1HA 3ASZA 2F43A 1QHHA 1G5PA 1ZCAA 4R2HA 1PV4A 4JVLA 3KXIA 1E2GA 3C4JA 1NVXQ 4OI4A 2WOJA 3HU3A 2BVNA 3MWKA 3A1UA 4JL8A 4MDEA 3OFND 2KE5A 4A9AA 2O8CA 1UBCA 1G41A 3QG1A 3WP0A 1S9DA 2GCOB 4UNSA 4YQFA 2IX3A 1CTQA 2QAGA 1MV5A 2P6UA 2EW1A 2ZI5A 4JVNA 1UKYA 2CVFA 1CBUA 2REOA 3QBVA 1YE8A 1GM5A 3T61A 4NE2A 1DAFA 2W6ID 3FMOB 2V1UA 1T3HA 2OZEA 1E79D 1NY6A 1UDXA 3VHLB 221PA 4FI3C 4PPFA 3I72A 4B2LA 1A4RA 1FL9A 1U9IA 4TZ6A 2SHKA 4C0AC 4B33A 1AKYA 2QMOA 4QL3A 3EX7C 1XB2A 2CDNA 3PEWA 3B5JA 1EG7A 4U5XA 4UQOA 4OKSA 1ZNZA 2XZLA 4B44A 3AUYA 2IYTA 4GOXA 3QIAA 1W2HA 2VQSA 1E2DA 3W6NA 5IRCD 1S1MA 3EC1A 5AJVB 4AC9A 1G7SA 5AUNB 2P5TB 3L0OA 1KKLA 1KSHA 2ZJ8A 1XPRA 3GEEA 1X3SA 2QY9A 4G3XA 3T06B 2F9MA 4RZ3A 3TBKA 2B6HA 4LYAA 1CIPA 3A1VA 1WQ1R 4GPTA 4BFSA 1RPZA 2ANBA 4OQXA 5C46F 1BOFA 1GKYA 3GD7A 1CJKC 2ZROA 2OLKA 1T9HA 1KAOA 1G8GA 2HJVA 1OH5A 3GJ4A 3FYHA 2ODBA 3D6TB 4MYUA 3WY9A 5FUYA 1UJ2A 2YOHA 5FI1B 4OQLA 2GHIA 1S2MA 1SVSA 2RGCA 2W6JA 2ZANA 2AK3A 3B6EA 4Q47A 4I1UA 4MKHA 3I62A 1VPLA 4URVR 1HQCA 2BBWA 2WV9A 3E70C 4LJ6A 2YOFA 2ZRMA 1YZTA 2NIPA 4A2WA 3B60A 2BMFA 2CCJA 1XTSA 1N2CE 5EXPA 5FFMA 2BEJA 1RZ3A 2EWVA 4GP7A 4NCKA 1TF7A 1VCIA 4F92B 1XD9A 1GRNA 3PUYA 3LBIA 3ZQ6A 2QZ4A 1XJCA 2FGKA 2GEDA 3VTKA 1D5CA 3GEHA 1OB2A 1PJRA 4P0TA 2ZQ5A 1MRSA 3BB3A 2DHRA 1NN1A 1FQJA 5JSZB 1N5JA 1W47A 5H70A 2C99A 2J0VA 2CK3D 2IT1A 3LDAA 2BC9A 3LV8A 2ZJOA 1OXSC 5EE0A 3GLIA 1DG3A 2WWIA 4RZXA 4IHQA 4HEJA 4LDJA 3RDPA 4QGFA 1Z0DA 4ZCLA 1UFQA 1EX7A 2VP5A 2YJTD 1MO6A 2PCJA 2BCGY 3C41J 4YMSA 4DKXA 3U7EB 2VRWA 1G19A 1TQ6A 1D8TA 1MR3F 4JSTA 4NYIR 4IDNA 4CW7A 2OCBA 2XB2A 1AGRA 3PUZA 1R10A 4PSKA 2BIFA 1E4YA 4KSCA 3CRRA 1XU4A 3ECCA 5E4FA 3VR6A 5LDDC 3KQUA 2ZRPA 1B23P 1DE0A 1KZ7B 5L3QA 2NPFA 1KK2A 3LAWA 1G4UR 2DY1A 4AD8A 1VHLA 1E2KA 1FTSA 1DAHA 3E1SA 1NBMD 2VIIA 1DPFA 2P6RA 1YQTA 5FTJA 1N6PA 5LD2C 4YXWA 3W8RA 3ZDQA 1TAGA 4DBLC 3ND9A 4MKIA 3RC8A 1DS6A 4DCSA 2BBTA 2PLRA 2DPXA 2ZS8A 3WRYC 1KO4A 1AS0A 2QGNA 3U7HB 2QAGC 4KO8A 2J41A 4OQMA 2XSZD 4KJZA 3B1VA 1FMLA 2AKYA 4NH0A 1TNDA 2ZIAA 3HDTA 1T5LA 1SZPA 2ZJAA 4Q9HA 4HZUA 1SQ5A 4TMTA 4LUCA 4KVAA 3EXAA 4KV9A 1ZP6A 3PUVA 3VX4A 4LC0A 3MD0A 1H8EA 2ZVQX 3SQXA 3W5IA 1CJVC 3Q3JB 1R5NA 4KSBA 5L3SA 5KPJA 1AIPA 3G0HA 1NN3A 3AF1A 4XVRA 4ZDKA 3VAAA 4M22A 3BFKA 4KBGA 4LV6A 1VYVA 4ARZA 1VDZA 2CE2X 4TL8A 1KJWA 1DAKA 2GWHA 4OI1A 3AVWA 4RKEA 3K0AB 2FG5A 1KMHB 3U60B 4HDOB 2DR3A 2BV3A 4RD3A 3RS0A 1G8HA 1NKTA 2D7DA 1OXXK 3OEED 2FDCA 3QEJA 2YNMA 1CU1A 2N42A 4BWYA 3ADCA 3P4YA 3QSYA 4GL2A 4Q02A 3K1JA 4HLDA 1RYFA 2QGZA 1UM8A 1E0SA 3MWLA 4ACAA 4G01B 4ZDJA 4AKHA 1KO8A 1NN5A 1G21E 3O8DA 1OSNA 3H0KA 1VYUA 1GKIA 1Z2CA 1ZIPA 3RSOA 1VG0B 3PITA 5GVSA 1IHUA 1P61B 2C04A 1JJ7A 2WTUA 4B3DA 5JWHA 3THXA 2X2EA 4M4SA 5EXSA 1FNNA 4C2TA 2XGJA 4FMCB 4FCVA 3EG5A 1S9HA 1O3YA 1GP2A 1XD8A 5DO9A 4FMDB 1WMSA 1P72A 4Q00A 4QRHA 5K8TA 3O47A 1ZM2A 5LBIA 2PZGA 5BN4A 1G6OA 1UDWA 2E1RA 1DADA 2EFDB 2RAPA 1XEWY 3WRXC 2FFBA 1JR3E 4BFUA 3KUDA 3TUZC 2ODWA 4Q9LA 2OFXA 4B3CA 2AWNA 4ABYA 2BCJQ 4PPGA 1UAAA 4MQBA 2XJ4A 3MFYA 3RANA 5SZKB 4IDHA 1R5BA 2CNWD 4U02A 3CR7A 1JQLB 4NL4H 3TMKA 2CJWB 3EA5A 2P6NA 2FU5C 3CWZA 4LHVA 2ZR7A 1U90A 1DBSA 2ANCA 2G6BA 4PQYA 3UWKA 4B75A 4WAUA 1RW4A 2PMKA 3CPEA 2O8EB 2R2AA 4JBYA 4TYPA 2G0NA 5ANRB 4DLSA 1CP2A 5KSZA 5P21A 2AXNA 1KZGB 2VSOA 4YMWA 2NG1A 1Q1BA 3GLFE 1E2IA 3OAAD 3AKDA 2HDNB 4L16A 2QMUA 2CVHA 2GJSA 2UZIR 3CX7A 1F60A 2GCPA 3IILA 1GL9B 4JL6A 1YR6A 1SVLA 4KFSA 1Q12A 1Q3HA 2ZE8A 3DO6A 2JJ2A 3IHWA 3R9WA 2Q3HA 3GLHB 4PFSA 3ZQJA 1SXJA 1ZM7A 2Z4RA 3NG1A 3QXHA 4A0GA 4EPWA 3NEYA 3DOEA 4R71A 4WVFA 1US8B 5EE3A 2GCNA 4FCTA 3KQNA 4IVPA 1EFRA 1UBFA 4GZMA 1XTRA 4NYMQ 3SHFA 1GL6A 2IYYA 3LVQE 3ZVNA 5GJBA 1N6LA 4P32A 5FOVA 1KO7A 3HYTA 2W2TA 1I4LD 2E87A 2GVDC 3OE7A 4DT1B 4JBXA 3FMIA 5DI9A 5JS8A 4A2PA 2IS1A 4AY2A 4CEIB 4PHHA 2Q9BA 3M6AA 4WW0A 4M9XA 4TLCA 4YDSA 1T4GA 2ZYVX 1ZYUA 3KDSE 1M74A 3RS3A 2JJ1D 2WIAA 1R4AA 1AKEA 2HV8A 1YZUA 3NXSA 1ZNXA 1GRRA 1W46A 5KSPA 2DWOA 2NOAA 4PC3A 3THXB 4EPVA 3NEJA 3QI2A 4RKFA 1KDRA 1N0VC 1ZJ6A 2WPDD 3EZ7A 5HCIA 4C0SA 1KOFA 3IEUA 4MGYR 2IYVA 4Q5IA 2XZPA 4C30A 1F2UA 2O5VA 4IFEA 2XTMA 4NCNA 5FOSA 3NBZC 3W8NA 5J4YA 2W0SA 1Z5ZA 2G3YA 2YVUA 5BN3A 1LF0A 2Q0HA 3PG5A 3ZD7A 4GMDA 5KUTA 4PZLA 2Q9AA 3U3OA 1IY1A 3DKVA 4BZPA 4LJ7A 1Z07A 1XWIA 1GNRA 4WXPA 2QQEA 5CK5A 4BFXA 2ZYTX 3Q9LA 1RYHA 4UXJA 5FTMA 1ZCBA 5H1YA 3GLGB 2PMDA 1OE0A 1TL7C 4A4DA 1Z6TA 4ZV4A 2FN4A 2IYSA 1KO5A 5G53C 4CEHA 1Z22A 2L0XA 3PIRA 2YINC 2OFWA 4NYIQ 4B32A 1JXOA 3A8TA 3B82A 5EE5B 5JHGB 3HPRA 2J9RA 3EIHA 3OF5A 1GTVA 4E09A 3KXLA 3BE4A 3MJHA 4X8OA 3TE6A 1P9RA 1HYQA 1OYWA 3FPAA 3RS4A 2JJ8A 3L0PA 1CEEA 2WWHA 1ZRHA 5K8UA 3FOZA 4B43A 3VNVA 4KODA 3SBEA 2QU8A 3K9GA 2IWHA 3X1YA 2FH5B 2AFIE 3F8TA 3KQLA 2VBCA 3MLEA 4WZBE 3C14C 1UBEA 4Q1AA 1A7JA 4M1WA 3RLFA 2BHRA 2FNAA 5J4VA 4I81A 5F98A 5FBLB 4PPNA 4TYYA 2YWGA 3G82C 5LD2B 4LC1A 1KJZA 1ZU5A 4JLVA 4TYNA 3ZD6A 2VHJA 1PLJA 3NBFA 1DTSA 4HI0E 2X19A 1AN0A 1GITA 2R9VA 2WM9B 1SVOA 3MWYW 4TTQA 3U6KA 1E94E 2JLSA 2WZQA 2WHXA 1AQUA 1DO0A 1P2UA 3IIKA 1EFUA 1W48A 4KFUA 3U7GA 2REXB 1COWD 1FQKA 1M7HA 5CIQA 5FTLA 3AGPA 3UK6A 3ZLJA 1TMKA 1MABA 1Z06A 3KTAB 2BMDA 4OHWA 3VR5A 3W5JA 2HF8A 4B6EA 5L8VA 3L43A 4GDFA 2GBLA 2ZETA 1TQ2A 3CRMA 3D8BA 4XSHA 3HR8A 1R5OA 2Z83A 1L4UA 2OG2A 3KL4A 4MGIR 4P4UA 4Q4LA 4A82A 2C95A 2J3EA 5CYPA 1QHSA 2C9CA 3CIOA 4IOKA 1HQYE 1G6HA 2F3TA 2F1RA 4LYFA 4JVMA 4QHSA 4Q21A 4CEJA 1SXJD 2B8WA 3IIMA 4DDTA 5EXXA 4KITB 1MH1A 2R6AA 1N5IA 4TLDA 4Q7KA 5EJEA 5JSZA 2JJ2D 2JATA 1KNQA 5DHFA 5FOTA 3VU9A 5FI0B 3KKOA 3ICQB 4OK5A 4URWR 1OFTA 1JNYA 2RB4A 1J90A 2UZ3A 2VO1A 5J5CA 3SYNA 3LH5A 2H57A 4N0EA 721PA 3AVVA 3PXGA 3AKCA 2QSZA 3OAAA 4LGMA 2BWJA 4NDZA 4G1UC 1V43A 2DFKB 4V02A 3C16C 3R7WA 2UKDA 2WWGA 3CPHA 2GDJA 2PX3A 1DVRA 2V54A 1L2TA 4PAMA 3SHWA 4HAWA 2HF9A 5HCNA 1IXSB 1ZC4A 2GEUA 2DFTA 3KUCA 3FKSD 4IVRA 4KAXA 1TEXA 5KSYA 4G5OA 2QNRA 3CPJB 3RRMA 3RRNA 3V9PA 1FPMA 4BLTA 1ZIOA 4N0DA 1IQPA 2HCJB 2OEPA 1XEXA 3QF4B 4Z8XA 1G7RA 3OESA 3SI7A 1X1RA 3BH6A 3RRZA 4LJ4A 4US2R 4Q7JB 2LKCA 5TARA 4IVQA 1R2QA 2V6IA 3SDZA 3PCRB 1UKZA 1X86B 3BB4A 1Z0FA 3KKQA 4M0LA 1X8KA 1U0HC 1E6CA 1T6NA 1HH4A 1KI4A 2AK2A 4PC2A 4C3ZA 4O2LA 2ONKA 3PEYA 3U3MA 1P2VA 2EFEB 1KY3A 2R44A 2VH5R 3LD9A 4GSYA 1G64A 2DYKA 4MGKR 1MO3A 3RSLA 2OBMA 1O87A 2AWOA 3UMSA 3EPHA 2FPLA 1FTNA 4BLPA 2AR7A 2PT7A 3SN6A 4D0NA 3THYB 2G83A 3AP3A 4DB4A 1CXZA 4ZCIA 2J0UA 2DFNA 1YZQA 2ZRJA 1LS1A 2ZYWX 1NI3A 2ZE7A 5E95A 1AGPA 1XPOA 3MMPA 4A0FA 5HE8A 3SS8A 5KDLA 1JEEA 1MOZA 4GFDA 4W9MC 2XAUA 4HLCA 5HR5A 5EE9A 4PPQA 5CJPA 4IW3B 2WJIA 2JGNA 1KI6B 4GI7A 4I1OA 1RE0A 2YOGA 4LBWA 5DGXA 3RNLA 1I2DA 3J81k 1NJFA 2IHYA 3FFAA 2H1LA 2GZHA 1VKJA 3UATA 3OHMA 1BKDR 1QHGA 1W0JA 3G5UA 2GXSA 4I1SA 1OF1A 1HV8A 1N0WA 5FL3A 4AK9A 2Z6VA 4HUQA 5TXGA 1Z6XA 4LHYA 5LPNA 3QKSA 4NPHA 1ESNA 2FSHA 3IBGA 4JYBA 2D62A 2X8AA 1W7AA 1RRPA 2YWFA 4BE7B 4A92A 5HTKA 3SC3A 2ORVA 3TVTA 3QF7A 1E2FA 2HXSA 3DMNA 3DEFA 4QNMA 1NVWQ 2IC5A 1N0UA
chains in the Genus database with same CATH superfamily
4BNMA 1JNXX 1YR3A 4KFTA 4U00A 2OK7A 3KLOA 2X8BA 1FYEA 2VNJA 1I3MA 3AUKA 5IYZA 3G23A 3B9QA 3VOBA 4N7JA 3UMYA 4RHXA 4F9EA 1F3OA 2FFAA 3PGLA 3ZEIA 4EA6A 4EBBA 1Q91A 3AM3A 3DULA 5C8YF 2LPMA 3WA7A 4XEHA 4NECA 1U4SA 2O8BA 4KQHA 2NQ2C 3T95A 2AQIA 3NDPA 1V95A 2XDYA 3KKPA 4DSAA 3F7NA 4G09A 1JU3A 2EGUA 4E1VA 1HLFA 2JARA 1GU0A 1H0KA 5ARCA 3AEQA 4XD7A 3R8FA 3F2VA 3VC1A 5KYKA 3VR6D 1WP9A 2IELA 2QU7A 2OBFA 3S5JA 1DXYA 1P2BA 4DQXA 2HMAA 1FJHA 4ZXFA 2DQSA 3PDUA 1MQ8B 4AJIA 4DJTA 1X8XA 2C5AA 2OKGA 5KTTA 2ES4A 2KPOA 4R05A 1ZIXA 3AEZA 3OE1A 4B0PA 1OROA 2JLQA 4MUEA 4A8JA 4DG9A 1P91A 1SVMA 3FPHA 3ZYZA 5JDCC 4QAJA 2FWAA 3O7MA 1A4IA 4N6OA 5F7ZA 1NX9A 3KTDA 2GXUA 3BRWA 2VDVE 1KJYA 4Q9IA 2HXYA 2X4IA 4FYIA 4RGVA 1M1YE 3B6MA 3QKSB 1B00A 3MRXA 2RHLA 1TJNA 3ZY5A 1JG7A 2HU5A 2JFVA 2RGXA 1ZNYA 3OJCA 4L5IA 1ZD2P 2YS6A 3FGPA 5EWLA 4IIJA 3T4PA 2GTHA 4EDFA 1TKCA 1Y1RA 3PQEA 3TE7A 3N8HA 4DR1B 2PMWB 4HDNB 5EYPB 3GZTB 3MJFA 1QP7A 3KT8A 4RDXA 2IYRA 1EUYA 4JLAA 1QX4A 3E4CA 4RTSA 4KK3A 1Y5LA 2XLCA 1VA5A 1I2ZA 2C77A 4IO0A 4MIEA 4DR6B 2JFXA 1QGDA 4FUTA 2P35A 1A1VA 3DXXA 2RGAA 1C4XA 1P5HA 2NZ8A 4G4IA 4PZZA 1KI6A 4RH1A 1DMSA 1HURA 5LB2A 3BH7A 5EHQA 4IQGA 4DR7B 3TL3A 1EWYA 5LUBA 2VZ0A 3I3SR 2BZSA 3AFGA 4M9QA 5BQ3A 1PT8A 2WJGA 1IB0A 3SR0A 3NWPA 1MD9A 1MG0A 2QX9A 3ABIA 4GP9A 5JBNA 5KNDH 4I3FA 1UPFA 3GBSA 4JLPA 2ADMA 3Q8XB 2EZTA 3PPVA 3SIRA 1DFIA 1I80A 2CC2A 1YQXA 2BMEA 2GK7A 2ZUUA 3DHYA 2EFHB 3DT9A 5AKGA 3UO8B 5IHXA 3THYA 4ETNA 3BC1A 4E31A 2JLAA 1HUQA 3B89A 3CG0A 3IQHX 2JFYA 4HB4A 4WBSA 1KMMA 1ENOA 1W87A 2C92A 2O6HA 1OHHD 1J8MF 3K6KA 4KWCA 2XI4A 3VZQA 5IC4A 1SC9A 1N33B 4L6CA 1Y42X 3OO1A 3D1VA 3UGQA 2HV9A 3PD0A 3R0JA 3N0VA 1E18A 3FNHA 4ZQIA 5A3VA 5B12A 2Q4BA 3W9UA 3L7NA 3IUJA 3NM4A 1VZ3A 1XD2B 2O50A 3HUFA 4PRZA 1RLMA 1VL6A 2NO7A 1A9XB 4BJ6A 2DHQA 3UJAA 3FOWA 1X19A 4DV5B 2TMGA 1V0JA 3OUZA 4F91B 2DCUA 3QVVA 3AOEA 2NTYC 1HNWB 2XODA 3D8RA 5EIBD 3RC9A 1LSUA 3HDGA 5KSOA 4LI3X 4OI2A 2BFBA 2NUBA 5DTJA 4P8RA 2DPLA 2H7XA 2BKLA 1Z33A 2EBWA 3KTFA 4H1VA 2F3PA 3AJ8A 4LXTA 521PA 1PWZA 4BCCA 3HJFA 3PA8A 3R9IA 2UYGA 2P30A 3DMPA 4QXQA 4YB8A 3EVNA 5JO0A 4JJKA 2GZ1A 3K31A 3NLLA 3AESA 2NZUG 3TLEA 4XRGA 4R41A 3PI7A 4LDZA 2FHSA 2FZWA 4LYEA 4M1MA 3DZ8A 3BAFA 1D4OA 1TKRA 4GPBA 3HP4A 3ZOKA 2J6HA 1KDPA 4NSNA 4UXHA 2VSNA 3K0KA 2YWBA 4MTLA 3U80A 1I4OA 3ZZUA 1EWRA 2J33A 1YVDA 4JC5A 3IP8A 4MCHA 4H15A 4AM8A 5M7EA 1DFGA 1EUCA 4MKXA 5ED4A 2X8JA 3PC2A 4UDNA 8ATCA 5ECYA 2FQYA 1WVGA 2FMUA 3JALB 3ZV6A 2PPLA 5AD1A 5EZQA 3E2MA 4TWAA 5FCDA 3GDOA 1ZN8A 3ZJ5A 5C5DA 4KLRA 3GJQA 2A2ZA 2HN9A 3GMSA 2AW3A 4N7BA 2J4DA 3SYMA 1CS4C 3IESA 5KTPA 3IDQA 3B6IA 4MP3A 1THZA 4QHTA 4X91A 4MDFA 3ND6A 3ZOZA 3FGOA 1WD7A 5AIBA 4AZ3A 5HIIA 4ZZ3A 2GTPA 4ZYXA 2H8KA 3DNMA 2DHEA 3TQSA 4B2PA 4BLVA 2MDTA 3GN1A 4RLFA 5EP2A 5J59A 2HJHA 4IY1A 4AJLA 1Q95A 5AOCA 3KAQA 1VMAA 1K5GA 4DLRA 4Y2RA 1CJMA 4TPKA 4IH9A 3LBFA 2VHQA 3KQHA 2PWPA 4KRGA 1VE1A 1ZI6A 4HZGA 2B1RA 3AYXB 2WFLB 2WSLA 2I6TA 3C1AA 4DWWA 2N1MA 5CDTA 4R9NA 3W1WA 1C7RA 2GYWA 2WIGA 4FEGA 4TLMB 3S6JA 3HR7A 4TKUB 4ZO9A 3L0SA 1W96A 3EUFA 2HMVA 1DCFA 5B55A 3LUHA 2CLCX 2Z98A 4GKAA 4RQAA 4RD2A 3R6DA 2OD7A 1D9XA 4KX3A 2JJ1A 4UUMA 2FF5A 4TS9A 4A8JC 1DXQA 3ZC3A 3P9RA 2I76A 3QG5A 4MR9A 5KVCA 1V6SA 3AILA 3FGNA 1FP4B 3DUFA 1DIRA 3W6OA 2NO6A 5JD5A 1XJ5A 3MJTA 4RFSB 5I4KA 3QI7A 3T3EA 2XF2A 1J0AA 4Q3OA 1NW7A 4P3XA 1LPMA 1LSOA 5CX4A 1U7WA 5U1PA 4XCQA 1E0KA 4HTFA 4WK2B 3RT9A 4Y6SA 1CCWA 2Y6VA 2MSWA 2NSJA 2QYOA 1VG8A 2CXPA 1B6RA 1YIDA 2QRVB 5C8DA 4EG3A 4D1YA 2D6FA 1WBDA 4MRAA 2FRDC 3E61A 5AUOB 5IYZF 1JEJA 4XB2A 1XFAA 2AXPA 4IQ8A 1CLUA 4YJ2F 2B7CA 4C2AA 3W1EA 4MA0A 4RSMA 3E2IA 5KNCA 4CQNA 1MAVA 2WF8A 1P33A 5AKLA 3FLBA 2ORWA 2XCOA 1RXEA 3UMJA 4PBRA 4BIIA 3B8HA 1FVOA 1GD1O 2PJUA 2V7WA 3BDAA 1R0LA 4ZOAA 4JIMA 1GTL1 1KIFA 1I9CA 3TUIC 2ECOA 4PAGA 2DOKA 3GRFA 1E4VA 3KPWA 1L9KA 2PUWA 5K8VA 2GBPA 1UFOA 2JLWA 2B0CA 4ZQGA 3TFQA 4PQEA 3SLKA 1R00A 1N2CB 2HBQA 3C8DA 3WJ1A 2HRDA 2V7BA 3OJOA 4G5GA 2GFQA 3EUWA 4K6KA 1X7WB 1Z82A 5CLHA 3V7WA 4OQFA 4B45A 3COPA 4IP0A 3FCOA 1HNNA 4HO1X 1JSCA 2XHZA 2QRLA 1FLDA 3ODGA 1B8UA 1ZD9A 4HFNA 1TTPB 2R2GA 5DK6A 2XBUA 5KTKA 4JT9A 3K1ZA 2R68A 2I6XA 3OPMA 1L1EA 5ER9A 4KMRA 1NLYA 2OCGA 2B4KA 2ON6A 4CKWA 3MWEA 1DHTA 1R9NA 2DBZA 3RPEA 2OKCA 4IKEA 1MABB 4BQSA 4YASA 2JLUA 1WDLA 2J08A 4LF5B 4POOA 3PPXA 2COEA 4XTRA 1KYTA 5CBPB 2GAAA 1YVEI 5FXMA 1OYVA 3FTEA 1P2GA 2QL7A 3SJAA 2CHUA 3F6RA 1DWPA 3B9PA 1G6KA 1DKPA 2EJWA 2QTWB 1FSSA 3AB3A 3DB1A 3OOYA 1JKFA 4I2VA 4Q4HA 4FKBA 1PVOA 3DPUA 2CVPA 2EX1A 2QJRA 3HN6A 1FVXA 2QTRA 2R62A 2PQ2A 4PGFA 3TPCA 4V1CI 2WINI 2ZRKA 1FUKA 5T6BA 3OZCA 3E8MA 5J40A 2BSQA 3GZ4A 1G3QA 2OOKA 2B21A 5JCPA 3EIEA 1TVKB 1UQTA 2J8ZA 2LZ0A 2O3UA 3P2MA 3PFIA 4EMSA 4AY3A 4B3JA 2CYBA 3DOJA 2PCLA 1IHXA 1OHHA 2QVYX 2PZ8A 5A9TA 2VRCD 2C2KA 3PXAA 5KNBD 1UT6A 2XTZA 1FP4A 2A9RA 1ZVVA 4GBED 4R8VA 1KOLA 1J56A 4KFRA 5LFAA 1P9WA 4PW0A 3ITDA 2JRLA 3B6JA 1SXJB 1RWWA 2BGTA 2GK4A 4D3FA 4D6PA 2OYSA 1IU9A 1NR5A 3PHGA 2WE8A 4LJKA 3EWSA 2N47A 2XRMA 3N39C 4JEUA 2JASA 3GROA 3LLUA 5I9TA 5EIXA 4ZT6A 1DJMA 5CLIA 1NJSA 3LT5A 2C31A 3O8LA 2IZ1A 4IO1A 4Q3BA 4EA8A 2X5XA 3HN7A 3BF7A 3PUIA 4G5XA 4WD3A 5JLJA 4DUGA 3K0SA 2ZU6A 4KP7A 2AS0A 1ZVQA 2CEKA 4P86A 5SYAA 2GM5A 5G4LA 2P4QA 1FB5A 1T8PA 2XQVA 4J91A 4KVFA 3MCZA 4Z7NB 3JCZA 3A4YA 1AXRA 2JF0A 1JJVA 3E7DA 5JUWA 1AKRA 3P0JA 1KEZA 1QV9A 1PS8A 1CQJB 3QE2A 4KGZA 5DEOA 5HMMA 5C32A 4O02B 3G17A 2G0TA 3FUWA 4PIPA 5ALZA 1CVIA 2BP7B 2J46A 1JWLA 1RHQA 4ZXPA 4C06A 5KZMB 5DLYA 4GVPA 2WVJA 4XVUA 5BWCA 2I1WA 4ZOCA 3DBOB 1D2HA 2P67A 2H07A 1JWBB 3C3EA 1BDHA 2JGRA 1MJ5A 4E5YA 5KJCA 4M89A 3H17A 4PC1A 3TWOA 1A27A 1HYGA 1P6QA 3MELA 3ZJYA 2FX2A 3WI7A 1ZMXA 4HB2A 4WZAA 4P7JA 1BH6A 2E49A 2XT6A 2IBTA 3AI2A 3CEMA 4YCMA 4Y2TA 1C7QA 1LK5A 4DMGA 4OJQA 1KYWA 1Y4AE 1SG0A 3IXQA 3USZA 4XYMA 3KSAC 1IZYA 3E23A 1EVKA 3MTAA 1WOYA 4H4EA 3BGIA 3MTDA 4OHOA 4JKOA 1F2VA 2EKDA 2YIMA 3OPNA 3VKGA 4C22A 4B81A 4ESVA 1NBMA 2D5AA 2IDZA 3LL4A 7REQA 3WDLA 3GDGA 5LKAA 2XZOA 1E58A 1XK7A 4BMVA 1UAGA 5H3LA 1UUFA 4DYDA 5KNBA 4IL5A 4QJ4A 4QOJA 4C0HA 4C6TA 1EUDA 1NX6A 5H82A 1T26A 1E9DA 3VMMA 2UXDB 3RROA 1A5AB 2GARA 1OREA 2PJZA 1QC5B 3W3AH 3ESYA 4AS1A 2A5LA 2L19A 5J9FA 3KS9A 1SGWA 5DPMA 4NH4A 2OHFA 2QT1A 5T6MA 4DN6A 1P1HA 1IPFA 2ZJ7A 1V41E 2NUAA 2FPRA 3OLQA 4UHCA 3VHRA 4F5EA 1IOLA 3HVKA 2DWCA 2IGBA 2QMEA 3GLVA 3PNYA 3BREA 4GRDA 3AM1A 3FSGD 4QYIA 3H1PA 2NYVA 2XA9A 4PYLA 4C7OB 2IP2A 1HR0B 1F6BA 4TZTA 1SR8A 2HUNA 1POXA 1MO5A 4JOCA 5J5VA 2ZUWA 2GBLC 3RV4A 4MWCA 4PHGA 1MB0A 4BZWA 1CUIA 2WZCA 1YKSA 3S7TA 1K2WA 1F1BA 4RGBA 3EVAA 2XVMA 3CRW1 1BFDA 4G97A 5BSRA 5JNVA 4KPUB 1ZA1A 3V8PA 4CM8A 2G76A 1O9BA 1X15A 2IIBA 1WQ4A 4MULA 3HYLA 3R7NA 4EYOA 3BGVA 5BYJA 1EAMA 3BS4A 1ABEA 1LVUA 2I78A 1S89A 1KEVA 2KI5A 4KW7A 3KJZA 4G25A 4NU8X 3ZIAD 4G9BA 3CRNA 4Y98A 3TZKA 4DLWA 1EM8B 3GEIA 2XMDA 1SKMA 4PRLA 5THXA 1PAUA 1YOBA 5DSZA 4EWLA 3U19A 3WOVA 1PW5A 2HPVA 3NX4A 5BVGA 1ULUA 3G89A 4TSRA 1Z9BA 3UPUA 1YOVB 4CF5A 4X1IA 2RGBA 1KBZA 1ISIA 1JF8A 4FDUA 3MBKA 3L7CA 1N6NA 5KMGA 1O6ZA 2ZEJA 1FUIA 3OMLA 3BMOA 2EQAA 1ZX1A 3LXRA 2JI4A 1KZ4A 1N5KA 2Q5LA 4ZO6A 1U0FA 4BB5A 4CF6A 3EQ8A 3T0IA 3IV7A 1SCIA 3PNLA 4OMCA 1X80A 2DHCA 2XNKA 2GBCA 2HIMA 1QIMA 2VP0A 3LO5A 5ALUA 3TSOA 3VDNB 2C9OA 3P32A 4YONB 4BO0A 4FFLA 5KYTA 5ES4B 4EUSA 1UEJA 2WAXA 2FW8A 1AS2A 2CDCA 3LX5A 4ID3A 2C9BA 4A0QA 2DUWA 1CETA 1CIVA 3K9LA 3REQB 2HA3A 2GEBA 1Y6GA 3CS3A 4DLNA 2OWEA 1NVKA 3DL2A 4JITA 2A0UA 1D6JA 1HZZC 3T3DA 5A9SB 1VE5A 5SZHB 3PQ4A 1MPXA 4S12A 2GX6A 4PTLA 3WMRA 1FX0A 1ZISA 2WA1A 2H2DA 2V74B 2R96A 1HG1A 3OURA 1TJ3A 1V4NA 2I55A 3PQ3A 5AHXA 3DUWA 1OT3A 5EUBA 4OOFA 2BFDB 3SM9A 3ETNA 3UWDA 5MN5A 4PO3X 2OZLB 3SLRA 1F5SA 1PSDA 3C4VA 1HY3A 3ADBA 2PO7A 3F3YA 4NPCA 1VLVA 4IIUA 2BP7A 3E9DA 3GLUA 2QDKA 3KPVA 2CLMB 4HLNA 5H80A 4BE9A 4EEKA 4ZYWA 4FR5A 1PJTA 5EHNA 4GOND 1AZTA 1G18A 3TXAA 1NMEA 1QH8A 1TK2A 3NYIA 3I61A 1OTHA 1VJ5A 2QA5A 3UJNA 1TYCA 4FYVA 3R8CA 1DUSA 1XNGA 2H9IA 1G5IA 4YP0A 1VLHA 1I5EA 4LXGA 4OCZA 2D2XA 3IKLA 5JE8A 2K2WA 4WNIA 2YFQA 5E9WA 4C3OB 3OG9A 1KL7A 5AIAA 8OHMA 2PMFA 1XEFA 1WMBA 2FPIB 5PGMA 2FPGA 3QUSA 2EVWX 3GFQA 4TMWA 1OIVA 2B69A 1WOMA 4UHEA 1J2RA 1EK6A 2FFRA 3UPDA 3VNAA 2VKTA 1TU3A 3RIHA 2AE1A 2PKQP 2VHTA 4BS9A 3K70C 4BVFA 1ATZA 4H0NA 1GLNA 4NJEB 4UNIA 3G1UA 4YUYA 4ZAZA 2N75A 2R1TB 5F64A 1U7XA 1U3UA 2OV2A 4XARA 4DF3A 3WP0A 1T8YA 3DWEX 1OLOA 5K3BA 3TJZA 3P96A 1KJ9A 1VYHA 5AW3A 1HEYA 5BSTA 4QC2A 3V46A 4GM0A 4JKIA 1JDTA 2X7XA 4ZI2A 4EKYA 4FE7A 3QFTA 4XIYA 1CUSA 5E7IA 5B64A 4HDNA 4BV8A 3HQ4O 3MRTA 2G09A 2PS0A 5F7XA 1K4YA 2FYTA 4W5NA 4CTOA 5G0TA 4OKNA 1JT9A 1OXMA 3T34A 4E08A 1IZ8A 1MW9X 1G2OA 2Y99A 3WBBA 2WJHA 4Z8YA 1U2ZA 2V3VA 4X90A 3L49A 3PQ5A 1P6XA 1KEPA 4J0IA 7AT1A 1Y6JA 3S70A 4PHFA 3HBFA 1EINA 4RXMA 1C0PA 1U7ZA 3LECA 1EBFA 4JAVC 4L6IA 2HUPA 4JQOA 3LKBA 5IAGA 3F71A 4G5SA 4TKMA 5DM1A 4LRWA 4LE0A 3M4YA 1XJQA 3QKRA 4GVLA 4RORA 3ZX5A 2I71A 2E89A 2ARKA 1EZ1A 4IJVA 1HKUA 2MSNA 4UZEA 3EZ9A 3ZJTA 3MBOA 1E1NA 3FFTA 1FXUA 2HX1A 3PFWO 1GHTA 2X1HA 1VHJA 2WSBA 3FCSB 4DCNA 3EPJA 1U0TA 1VBKA 3HDJA 4M21A 4MRPA 2BEVB 2AR0A 1XHEA 2HBRA 1VIVA 3RIMA 1FJXA 5CEFA 1S5PA 1EP3B 1YE5A 5JRZA 5IANA 3GPCA 3UT5B 5F4ZA 5KX5F 1ORWA 4HUTA 1X7WA 2AKAB 4BYMA 3DOUA 2ZIVB 2QQ0A 4JS0A 3BJEA 1TIKA 1OWPA 3PXXA 4NHOA 4XOIA 3B9RA 4DA0A 4DIOA 3ZWNA 1Z2EA 1DZIA 4D9FA 3PGA1 1WTCA 1XEXB 4UNPA 4Y1GA 4YMLA 2W6OA 3DDHA 4O63O 3DL7A 1RFGE 4B7UA 5PNTA 1TYBE 3CBGA 4UOEA 1EJ6A 1XTKA 1RKXA 2E4ZA 4AAYA 1H4QA 2IV3A 4NENA 1YJAA 1H94A 4V0OA 4Z0PA 2W2LD 4NWIA 4IRUB 1RI3A 4CMGA 3TIXB 3HZOA 2ZVDA 1EP9A 1U1CA 4B17A 4MTCA 2AD5A 4NOLA 1Q1EA 3GGGA 3INRA 3QFHA 3R4CA 4EX7A 4M6WB 1T5BA 2Q9UA 2QENA 1OZ0A 3EZNA 3H5TA 3I01A 3G5MA 2V6BA 4FWTA 5FTNA 1C7FA 2F9LA 3I9V1 3WAJA 3VO1A 4UVEA 4J1TA 3QWFA 3DC2A 4HNRA 5BR8B 3PC4A 1V1RA 1U8TA 3TLYA 2EWWA 5HRAA 1QQAA 2G0AA 3E5NA 1RLOA 2YV5A 5AHOA 2B7BA 2G71A 2AX4A 3ENKA 4JP3A 2AZMA 3U3DA 4EI7A 1N7GA 4E4TA 5BYKA 4QULA 4XKJA 3CNOA 1H2AS 1FU8A 4BMPB 5CGQB 3TR6A 3RVRA 1E5DA 3H9CA 1W88B 16PKA 1F8GA 4GBJA 3WNCA 5DNYB 2RI1A 2ZITA 3UGTA 4HNQA 2C7QA 2VRBA 2CHFA 2BKXA 1JS1X 3L8HA 1CQPA 3A25A 1JUDA 4CKBB 1C3EA 1DEKA 1G1MA 1DWQA 2QX7A 4K2AA 3UM9A 3EA0A 3W6PA 3GLKA 3ADDA 1KQ3A 2X41A 3OQIB 2VTEA 5IT0A 4YPOA 2FSVA 2QTVB 4AN1A 2OY0A 2PG3A 3H5IA 3M8KA 4KMSA 4OATA 4WLEA 1ZK4A 2WPNA 5KNCH 1P4HA 5JNTA 3V4RA 3WLSA 4BO8A 4MS4B 1O94C 4LY3A 3PGVA 4I50B 1UC8A 1X42A 4QTTB 5IHPA 5LMNB 5CG1A 1VIYA 4UVHA 4DREA 3AUXA 5FUMA 3K5WA 4YO8A 3WKDA 3GA7A 1AHNA 4PZEA 4EY6A 4BMOB 1KI8A 4A3SA 3KYBA 3HB9A 2HZ7A 1EM6A 3NTUA 4MJXA 3GFTA 4YAUA 1N2XA 5B3LA 4CTKA 2H1RA 2IP1A 4INPA 1WULS 2PQ6A 3AEUA 4R98A 4OB7A 2O23A 5B7QA 1AMNA 2KWIA 2WI8A 3T52A 5JZ9A 1MNAA 2C61A 4M8NE 4EG5A 1KVTA 5SZIA 4D6YA 1D5WA 4JKYA 3U31A 2F1IA 1RI4A 3FHTA 4GG1A 3V33A 4PNHA 5DP1A 5EUQB 4MPJA 4PQRA 2XD9A 3CNHA 3DDUA 4E03A 5B4TA 5BV2P 2O7NA 4MI3A 1J0BA 3IUYA 4PSAA 1P17A 5HDBB 2IF0A 3JS5A 1Y1PA 4RADA 7ADHA 3T1TA 1ZD4A 4G1EB 3GFSA 1TAHA 1N78A 2HL6A 2WJYA 3NVAA 3WKEA 2HRQA 4ENQA 3ER9A 3MA0A 1FCJA 1CRPA 5AOAA 4PZPA 2O52A 2VZ9A 4FKZA 1V1MA 4BLOA 1QCZA 1RTKA 4B1FA 3U3JA 2F43B 2CY0A 2FOIA 3H2YA 3JQ8A 4G4GA 4LMPA 2BDTA 3LFUA 4NBSA 4CZ2A 4EHLA 2TMKA 2Q0XA 5JVDB 4GKKB 2HT6A 1K98A 4Y7CA 1GO2A 1GGNA 4BO6A 3W3ZB 1MEEA 1CT9A 3OJXA 4TQ9A 1ZUHA 4K0KB 1NNI1 4A6PA 1M1UA 2NLOA 4LCBA 4CTNA 2VCEA 3VVBA 4C9BA 2WIFA 1HFKA 2QNIA 2W6MA 3O75A 3ILHA 2Q50A 1L4YA 1O03A 1P1RA 3ANTA 1W1IA 1NQXA 1G66A 4X3PA 5EHIA 5EE1A 3STYA 2WTBA 3EZ2A 1CUEA 1X1TA 3LQ4A 2ZSFA 5F4BA 5AM2A 2NZXA 4MWBA 4CGZA 2R5NA 4F8EA 621PA 4OHYA 4UE2A 3E5RA 2ECPA 4D4JA 2ZXUA 1NZJA 1UINA 2YR0A 4PSVA 1AUVA 2PBRA 4Q9AA 4XJXA 4Q3NA 4RDCA 5DDIP 1ZVJA 2GPSA 2XUGA 4KXLA 4QFDA 2C8JA 1W94A 3HG7A 3OIVA 1T2FA 1UBRS 2K6GA 3DWFA 1AKVA 4MV3A 4OH7A 1GNTA 4A8TA 5JS6A 3FOCA 4DMMA 2NPIA 3PKZA 2XH8A 5FHRA 4BFYA 2E9SA 2CCKA 4LZAA 3BULA 2PVCA 1R0ZA 2CXTA 3BL5A 3KV1A 4JCCA 2WMNB 3WMXA 2QV0A 4K9DA 4LJYA 3K0CA 4HNSA 4ZV9A 1JQ5A 4FFMA 2ZRIA 2BDUA 4QQ8A 3GVXA 3IRVA 1E2NA 2A9JA 4WXRA 4LV8B 5F1OA 3U5ZB 1KO1A 2VYND 2X6QA 3GQBA 4M8IA 2RJNA 4N12A 1E9EA 1K8RA 1XYGA 2PPVA 1CEYA 5J2TF 4ARUA 1SHLA 1DJLA 3F7TA 1L7DA 1NVAA 1R6DA 2E4WA 4OQNA 4RJLA 1JLHA 2YMMA 5JAZA 5KMGB 1N9GA 1R0SA 1GQFA 4N8SA 3LY9A 5L53A 1KFBB 3TDMA 4OJYA 2DWPA 3LVFO 3VPDA 4IQ0A 4Q7LA 1L4HA 3PP8A 2OCAA 3PF9A 4QICA 3TG2A 2PZLA 4ZVOA 3WLMA 2P2YA 4KYVA 4HKTA 4TTVA 4IDEA 3LCMA 1WXIA 2O0HA 4PC6A 3WJ2A 1GADO 3HLKA 1XN4A 1UC9A 4PLWA 3N0WA 1JR3D 4UNQA 5I9IA 1REQA 2ENWA 4DEVA 3GLFB 3N28A 5F2EA 1WPQA 2V3CC 7MHTA 4CEHB 1XAGA 1DJNA 3BJIC 2PYDA 2GT1A 5DHUA 3WB1A 5JYEA 3INTA 5DH9A 1PFKA 4XGIA 4XIIA 3TD9A 1UIRA 2ZJZA 3TRDA 3MJSA 3BZBA 2GCEA 3BDIA 2XNSA 3I2KA 4U2DA 3VX3A 3G8AA 4PBSA 3A0RB 5TMEA 5J3JA 4YYZA 4JWKA 2ID7A 2BE9A 4EQ6A 4YV2A 5CUQA 5U4XA 4U4AA 5A4AA 3QPAA 1G3UA 5HUHA 1NMSA 3FIJA 1S96A 2BFPA 3JSAA 3P20A 1ULSA 1T34A 1USWA 3BD9A 4JLKA 4JR0A 3DH0A 4M0FA 4MRNA 5SV2A 4YCNA 4WBNF 4P38A 3AEYA 3DG9A 4K8OA 4UZFA 2CCGA 1SPXA 4L57A 2JFNA 3KE9A 1LDYA 1JI0A 2ETXA 1L1QA 1YZVA 3GLQA 3WLNA 5HJ5A 5JEEA 1CUZA 2WF9A 3AJDA 4OJKA 4S04A 1BN6A 4BFVA 5A4JA 4HBGA 2MINB 1MO4A 3GMTA 4C3UA 2B8JA 3WGHA 2OV4A 4L2IB 1KQPA 2XGMA 2G4CA 1QFYA 1E2LA 1MO2A 4E7PA 5CD1A 1E64A 2XMRA 4TMXA 1JXMA 1QO9A 2XVXA 1L7QA 1WF3A 3AP2A 2WYHA 1G8YA 2BI4A 4I4TF 3VKHA 4QEZA 1LXCA 3RTEA 1RKQA 1QCDA 2X1LA 1H2EA 4L5JA 1G3IA 1MF7A 2XWJI 3HRKA 1XZDA 3GT0A 3R09A 2MYUA 4KOAA 5EMKA 1NFQA 4QGAA 2D2IA 4X3OA 2HW8A 2XUKA 3KPYA 2VWHA 1IBCA 4REMA 1UJ6A 2NVUB 4J7CA 4KNYA 4TM7A 4W8GA 2H17A 2HA6A 2VRNA 4N5DA 4FYHA 3GJ8A 1T3LA 4DOMA 3QPBA 4G0MA 1US8A 4HAVA 1GA1A 1H8HD 1YL7A 4KQ6A 4EQ6B 1KY4A 2AFHA 2MYPA 4IV5A 3FUCA 4WINA 1VJCA 4OF4A 3QKIA 2DLNA 4A8HA 1Y1QA 1IUKA 1KIMA 1NQWA 1XZPA 4QQNA 4E5DA 4FMBB 3UPTA 2NO0A 4PCLA 1ISFA 3QQ5A 3HA5A 3IDZA 4EHAA 5IZCC 1VSBA 1WHTA 4RYDA 2WSYB 3GLHE 4PG7A 1L4BA 5CFZA 4B32A 2AOXA 3PFBA 5DKFA 2FWMX 3NASA 1JFSA 2BM8A 1HK7A 3TW6A 1REQB 4BGEA 4F3RA 3THSA 3O0DA 3I0ZA 3MT8A 4JYAB 1ZUNB 1CR0A 2FW6A 1Y4DE 2WG0A 2YFHA 4YUAA 3V00A 1BYIA 1WB9A 2QX6A 3DT8A 1JG3A 3ORSA 1UOQA 4IEIA 4F4IA 5LLTA 1EVZA 2V7GA 2RI0A 2WYOA 4RK5A 1ZH8A 2AN9A 3WLJA 2C4TA 1CRWG 1K27A 1YRQA 2VVTA 3R9XB 4RA9A 4W1PA 1SXHA 2OXIA 5H81A 4D7AA 3LS2A 1UJNA 2V5UA 3ULKA 3ZDFA 3GYBA 5KOYA 3NB0A 4F4CA 2ZIXB 1QV6A 2WUWE 2IBSA 3ETEA 5LQDA 2ZJ2A 2LV8A 4MR7A 4WFQA 1BWPA 1NZDA 2NGRA 2PVPA 1QCCA 3DMYA 3MRSA 4RAOA 1DRUA 1P3DA 5K0SA 4W1QA 4UUBA 5F2NA 4WLNA 1L3CA 1TIBA 1ZRMA 4MUXA 3J7TA 4TKVB 4Y2XA 3VOSA 5BXYA 5KYYA 1VKHA 1AGNA 1IY8A 2RCNA 5CX1B 2ZBQA 3B2QA 4JEHA 4X41A 3ETHA 3COVA 2UVPB 4TVBA 3R3UA 4EHJA 3RWOA 4QDXA 4RXTA 1O77A 4I5EA 3N8DA 2AOTB 3OO0A 4IJKA 1JW9B 4IXTA 4REQB 1L5RA 3SBOA 2JD0A 4KUHA 3C15C 3NQ41 3VMFA 1T4CB 3FDZB 3VRHA 3BEDA 2VYQA 4F2PA 3VR4A 3HA2A 5HKLA 1YZLA 2PZJA 5DEIA 1WMAA 2JCVA 2AD1A 3AH8A 5TX7A 1XOIA 2IDKA 3O4FA 3A9TA 4JLMA 1U81A 1AZLA 2ODNA 2IZZA 3RE1A 4OHXA 4B3FX 4YMUA 4DKJA 2XEDA 4YCCA 3AVYA 4C76A 1EUQA 4RULA 2I1LA 4JYMA 5HJEA 3AMVA 2PU5A 3JWJA 1EFLA 3RYFB 5ELXA 4QU5A 1I4EB 1BQEA 1Q7BA 2HMUA 5AKZA 2NXNA 3VU9B 4HXGA 2HEGA 2C03A 2Q0QA 2Q62A 4ENVA 3PGXA 2W11A 3OT1B 4S1WA 2CHEA 3JZMA 4L7VA 4UEOA 5EPUA 5TPWA 3TI7A 5A3JA 2IYEA 3K53A 1P9OA 3UKOA 3T9DA 1YS9A 1LV8A 2BBSA 3WYBA 4E88A 3ICEA 4LVUA 4WOKA 1WXDA 3LUPA 2VPPA 4MV5A 4QRDA 2P4UA 3ZN2A 4C4TA 5LQKA 1J7KA 4R40A 1NYTA 2AFIA 2DULA 6ABPA 2YZNA 2HREA 1I3LA 5BOSA 3I34X 1E7MA 2C1XA 2Y4NA 3O4HA 3QE0A 1SVWA 3JAWA 2FLKA 3L5OA 3OLZA 3GP3A 1NMXA 1ENYA 4QDKA 1BW9A 5AHKA 1N34B 2IIQA 2XD4A 2YDYA 4FFSA 4WEQA 2BBOA 4PRYA 3I04M 4Y18A 4EF4A 5JJ5A 2NN3C 1T8SA 1XMVA 3O84A 1EHIA 1SD2A 2FG6C 5DTRA 2IUUA 1T91A 2L2QA 1KDZA 2OO3A 4C6SA 1P1JA 4FJ0A 5BY2A 4D0LB 2XB9A 2PRZA 2IYAA 4YP7A 2ZWIA 2JRCA 1G7CA 3Q15C 3GUUA 2B61A 4CIBA 2XTJA 3AQIA 2ZG6A 4B74A 2AGVA 3TR0A 5HKAA 3D8SA 1V45E 4HTFB 4Q9NA 1C9EA 1OXBB 4FIZA 3VPXA 3MGAA 4KNWA 2MTBA 2VA9A 4KN8A 1U1EA 1YFZA 3T5GA 3FCYA 5KTRA 3KU4A 2C98A 4BVJA 1SG9A 2V6FA 1NVDA 4LF7B 1AH2A 4BFZA 3K9NA 3KSBC 3FGZA 4FM9A 3URMA 3PXCX 3P0RA 5EESA 4DRZA 5AI9A 1SHZA 4US1R 1B14A 2FV8A 2ZUSA 4L02A 2OYRA 4ZVVA 3QBTA 1RPTA 2AN3A 3QENA 2A94A 1K7CA 1XMSA 4MW5A 1GUAA 3CRQA 1YIOA 3HCDA 1OH8A 1OXVA 3BBPA 5JW6A 3SNHA 1KAHA 4WOPA 2F7SA 1L5SA 3NBMA 2F8TA 1QB7A 2CLOB 1L7MA 5JBIA 5ETJA 4YECA 4F2GA 2HHHB 4M0DA 1VL1A 3TOVA 2BZ1A 1ZAKA 3UK0A 4RL6A 1YAJA 1II0A 4XPZA 4BMNA 3MAAC 4BO3A 1ULTA 3F7MA 4JLNA 1IONA 3HUDA 2JAQA 1OKKD 1I4WA 1LPSA 2RSLA 3E84A 4IVNA 5EAIA 4GE0A 4W1RA 3OX3A 5G1OA 2ZSBA 4TWBA 3U9SA 2W2NA 3NBXX 1GKLA 3I5MA 3KD3A 4DAEA 3ZDBA 4RF4A 2YMLA 1TZMA 2O7QA 2VYFA 2C83A 1GTMA 1PU2A 1W0KD 2I4IA 4R2WA 4G41A 1CY7A 1EE2A 4ND8A 3SU8A 1CV2A 1O7JA 3K72B 4CKBA 5A06A 1L7AA 1OOEA 2Z9CA 3HHEA 3LZ6A 4OHPA 5AW8A 4C21A 3I2YX 2I80A 4R69A 3T5BA 4EA7A 4EUEA 1LC0A 2G9RA 3JASA 3NWBA 2QMYA 3V6MA 5BSEA 1RHKA 1BVRA 1G8FA 2CHQA 3D0KA 1QQTA 4Q9JA 5GZ3A 1QBKC 2ZOSA 1EFPA 2EL7A 2PK3A 3GJ0A 5AJWA 4AZWA 2ZR8A 1V7QA 3UGJA 4PYIA 2AG1A 2NV0A 2PLNA 3TD2A 4JASB 2UVQA 4NE9A 4M88A 3UAOA 2P2CA 4N48A 5DNAA 4DVJA 4E13A 4ERXA 4ZIRB 3PE6A 3K7EA 2AN1A 2J4CA 3AIIA 4CL8A 5CEEA 3PENA 4LNUB 5FI5A 1Z4OA 4N1AA 4PE5B 4F5YA 1GEEA 1YF3A 1YTUA 2W6PA 3MCUA 3PZBA 4YRJA 1NC3A 4XX0A 4WJLA 1FQWA 2R8OA 2RGRA 2H29A 1BXRA 3ZBQA 2BFBB 2VYCA 3KQYA 2ZTSA 4NTZA 3JX9A 2V7UA 5IUKC 5AJZA 4EGJA 4ZYLA 2O0JA 1YK1A 2OXCA 4HMQA 5LYJB 1QHXA 3LWZA 3TM5A 4CM9A 4YRMA 1YR9A 2R7KA 2AKEA 1HE2A 3AJ9A 5FH9A 1Z16A 3QY9A 4HPWA 4II3A 1Q15A 4EPXA 1J70A 4HXFB 2HA2A 3OPQA 4F3NA 1M2WA 4LSZA 2ATCA 4S24A 4BMZA 2MR5A 2Z8XA 2X22A 1IY2A 2JB9A 2ZB4A 1ZW1A 1J22A 1WXXA 3OKFA 2RHBA 5KYWB 1GTJ1 2PFSA 1QK4A 5A3RA 3PJEA 1PR6A 1MB2A 4AMYA 4Z51A 3UKJA 5F7OA 2QAJA 1OTYA 2X14A 1M5TA 4PXAA 1Z37A 3BOSA 3MSXA 3GIDA 1M34E 4L76A 3WHKA 5B6PA 1JZSA 1C30A 1FDSA 1YA4A 1WABA 2QE7D 1L5QA 1KNXA 2DFPA 2FQXA 4HDRB 4F6CA 4HEHA 3HYNA 3CWQA 3KJQA 2IE8A 3HWSA 2QYHA 3C7KA 4OAOA 2IPOA 3T5PA 1ZL0A