3UIEA

Crystal structure of adenosine 5'-phosphosulfate kinase from arabidopsis thaliana in complex with amppnp and aps
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
191
Chain Sequence
b'CSVEKVDRQRLLDQKGCVIWVTGLSGSGKSTLACALNQMLYQKGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLLPEGDFVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYLQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyl-sulfate kinase 1, chloroplastic
molecule tags Transferase/transferase inhibitor
source organism Arabidopsis thaliana
publication title Structural basis and evolution of redox regulation in plant adenosine-5'-phosphosulfate kinase.
pubmed doi rcsb
total genus 80
structure length 191
sequence length 191
chains with identical sequence B, C
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uieA00
3JZAA 2AN9A 2V9PA 4JMPA 1PJRA 3K0FB 4B76A 1SXJC 5D3QA 5K8UA 2WMOB 4ACBA 2Z4SA 1XXHE 2D2FA 1SHKA 2C98A 1Z0DA 4FINA 2ZE8A 3H4MA 1ZRHA 2FEOA 1LS1A 1W5TA 1EESA 3CF6R 4L16A 2AWOA 4LJ9A 4CGZA 1LNZA 1BYUA 3QI2A 3MSXA 2SHKA 4FN5A 4LHWA 3HR7A 1XTSA 2RB4A 3SFZA 1PZNA 3QXCA 2ORWA 1EFHA 2LWIA 2ZRNA 4BEBA 4FWIB 3U44A 1Z6GA 2ATVA 3BS4A 2FSGA 2UKDA 3I32A 1QHGA 2J5XA 1CR1A 2ZSFA 1R8QA 2FG5A 2VP2A 4I1SA 1IJFA 1EWRA 2HXYA 4O2RA 3GJ3A 4WBSA 5EUQB 3BBPA 1JAHA 4DIDA 1XMSA 1U0HC 3FFBA 4HSEA 5HCNA 5JCPA 2WAYA 4OHYA 3T1TA 3ZS9A 3PXGA 3LH5A 3GJ0A 2OO7A 1J99A 4D4LA 2J3EA 4Q66C 2OEPA 3U7FB 2HF9A 1RVDA 1TU3A 3HYRA 2CBZA 2OE2A 3BIFA 4IJMA 4BLPA 4ERNA 5A5GA 4NYIR 2J45A 2ZROA 1G291 1SVWA 4PR0A 3KQUA 2GXAA 4DSTA 3TAUA 221PA 1CRQA 2DWQA 1KDRA 3DKVA 2HCBA 1FQKA 1AS0A 2ZUCA 4HAYA 4LSGA 3KQLA 4B3DA 3ZGXA 3ZVNA 4A0HA 1JJ7A 4HLQB 1NVUQ 3BAFA 5DH9A 2IEZA 5FL3A 4BECA 4HB0A 3ADKA 4M21A 1II8A 4IOMA 3DL0A 2O0JA 3KKNA 1XTJA 1UEJA 1V43A 2D7CA 2IBMA 1IM2A 2YC4C 3CWZA 4TLBA 1JB1A 2H18A 4URWR 4AKEA 1A7JA 1US8B 2DWOA 1P73A 4Q01A 2V7QA 5E7JA 4D82A 2ZRFA 1J7KA 4V0KA 2OCPA 2P6UA 4TMTA 1OYWA 4R71A 4GBMA 2VA8A 3N2IA 1RJ9B 1KO8A 1CRPA 4DLXA 4AURA 1DPFA 3KDSE 1TADA 5TARA 3I3SR 5FTJA 1XD8A 3TW8B 4FCWA 3A58B 4MUBA 2IX3A 4LV5B 3B78A 1UAAA 3U7EB 1ZU5A 4TMXA 1E9CA 2ATXA 1RRFA 1SXJE 4BFXA 3DMDA 3FMOB 1J8MF 3I8XA 3FVQA 3IIMA 4YMTA 4URVR 3KQKA 4A0RA 5JJKA 3AKEA 1E2DA 3U3OA 4PSVA 2ODWA 2GTPA 1O3YA 1KI8A 2HT1A 3NKVA 2WWYA 3T06B 4V02A 2J0QA 1AM4D 2IS6A 4IW3B 1U9IC 2ZE6A 4EPVA 2O8CA 2KJQA 4TL6A 5DE3A 4ZKEA 1KSHA 4RVCA 3ADCA 4GMXA 3SZRA 4C9BA 5IF9A 4F4CA 4PO1A 2NMVA 4ASUD 3SYNA 2ZS9A 5CYPA 1QDEA 5BXQC 2NOAA 3G82C 4MKGA 4PAQA 4PQYA 4IXMA 2PJRA 3TUIC 5LPNA 4AYWA 4B3CA 1G3QA 3AUXA 4JVNA 4Q19A 1DOAA 1FW6A 3DM5A 3CONA 1G6OA 1F2UA 2ZJZA 1L8QA 1E79D 2E9SA 4BE7B 1R6BX 1OV4A 4TL9A 5EQTA 5FOWA 2XAUA 4Q4AB 1CS4C 1HT2E 5H70A 4DXAA 2ZJAA 4K8OA 1MO5A 2D62A 2IYZA 4Q03A 1JPJA 2VHJA 1G3UA 5F2EA 1ZM4A 5CIQA 4NZYA 5KPDA 1KDPA 1UKYA 3B1WA 2XEXA 3MFYA 1GL7A 2DCUA 3IIKA 4OHZA 1P7CA 4D2IA 4LPSA 1NMXA 1XF9A 4NBSA 3GLHA 3B9QA 3TVTA 4C0BA 4EQ6A 4KLZA 2Q21A 1YR7A 2GXQA 4MRPA 3RRNA 3KXLA 2OM2A 3OESA 2A9KA 1CF4A 4NCJA 3EZ2A 3OEED 4XWAA 4JYBA 4M1YA 3GLIA 1I2DA 1XJCA 4LK2A 2JDID 4XWOA 2XTZA 3CNOA 4FCVA 3LVRE 1TUEA 1W7AA 1NVXQ 3A1SA 1ELOA 1EXMA 2A5GA 3WRYC 5FTLA 1G3IA 1NN5A 2BKEA 2F1IA 5EXPA 1DTSA 1NP6A 5C46F 2ZSAA 3U6BA 2R62A 3RNLA 4BLRA 2QROA 2IYXA 4KYIB 2CHQA 2BJWA 4F93B 4TQ9A 4PHFA 3NEYA 2W6JD 1F60A 3HDTA 1XCMA 3A1UA 2FX3A 2JGNA 2DR3A 1XEWX 2XNSA 2OG2A 3V4RA 3SJAA 1M7GA 1DADA 4A8JB 4ARZB 2HEIA 1E79A 2DFKB 1RYFA 4L15A 3FMFA 5E7IA 2J7KA 1S3SA 3MD0A 4BASA 2BDTA 3QOFA 4O25A 2WSSD 4B44A 2IYTA 3ADDA 4AKIA 1AKYA 3W3ZB 5HKKD 4RFSB 2OSBA 4EPWA 4MYUA 5F9HA 3SN6A 5FPYA 4QGHA 4MRRA 4UNPA 4ASUA 3U5ZB 2UVQA 3VR3A 1EG7A 1KK3A 1E9AA 3FMIA 5DI9A 3RWOA 4TYNA 3BGWA 1KGDA 1ZD1A 3C5HA 2O8FB 1OH7A 1GRRA 4KAXA 4HAVA 2ODNA 1HA3A 1KIMA 2V6JA 3AGPA 4Q1BA 2W6JA 3AQ4A 2A3RA 1OLOA 4HLCA 2QP9X 4PC6A 3V9PA 3FHCB 3VHXA 4I1OA 2NO9A 4D4JA 4II7A 1KJWA 2FSFA 2NO0A 3WNBA 4KJZA 3K9HA 1RYHA 1U8AA 3REFA 3IKJA 3QKUA 1G41A 2PBRA 2W0SA 4LJ7A 5EE1A 2F7SA 2RGNC 3PV0A 4UNSA 3PITA 3LRPA 1LY1A 4H1UA 3QKTA 1Z29A 5AJXA 1OPXA 3LV8A 1G16A 1UJ2A 4HATA 2ZE7A 5IT5A 4YXWA 3NWJA 3ND9A 1XRJA 2B8TA 1BMFD 4JBXA 2FU5C 1NJGA 3EX7C 1XX6A 3VKWA 1YRBA 5K8LA 1OSNA 4MDEA 2JLRA 5FOVA 1UF9A 4FMCF 4IDPA 4QJ3A 2V4ZA 721PA 4M1KA 3PUYA 1Y3AA 2OCYC 4CW7A 5DYIA 4EPYA 3TK1A 1HY3A 3X1ZA 3B2EA 5JMTA 4A8JC 3IQXA 4M1MA 3CNLA 3RLFA 4Q00A 1DAIA 3ASZA 1G7CA 2WV9A 5TDHA 1VIYA 3LA6A 4PC1A 4TMVA 4LHZA 3GLHE 1XPOA 1ANKA 4M8NE 4O3MA 4LHXA 4ZCMA 1N5JA 3GD7A 2OCBA 2XJ9A 3BFXA 4UKDA 1YR8A 2NGRA 1GUAA 4OQFA 3THYB 4JJKA 1XTRA 1W5SA 5JCZA 1Z8FA 3AV0B 4DSOA 1GG2A 1NBME 3EASA 2F55A 1LV7A 3FOZA 4TWZA 4XTCS 1Z0FA 3PUVA 1AKEA 4OBEA 2J9RA 4YMSA 1XXHA 1HYQA 1GNPA 4JBYA 1ZYUA 4Q02A 1UM8A 2RGGA 1A82A 2VP0A 4TYYA 1MO4A 2W2XA 3IPXA 4KLNA 3CPEA 3IDQA 2CLSA 4OI2A 1E0AA 1KAGA 3E1SA 1C4OA 1N5KA 1U8ZA 2NO6A 3QXHA 1OYYA 3SJCA 4MUAA 1JEEA 3RAPR 2CCJA 1XTIA 2CE7A 3EA0A 5BYKA 3GEIA 5JEEA 5CM8B 3EZ6A 2KI5A 5DLQC 2V1UA 1K5DA 3I5XA 2XTMA 4Q1CA 3FYHA 2WJYA 4OQXA 4WZ6A 4DLZA 1CJMA 2MSEB 3CF0A 4XWKA 5L3QA 4JVMA 4RD6A 4EKDA 5JHGB 1IN4A 1SVIA 4G5RA 2Q3MA 3BE4A 3UXMA 3J81k 2IXFA 3HU3A 1GM5A 4M0LA 2ZXUA 1ZNWA 2K5UA 4MRVA 5HZKA 3GJ6A 5F9FA 1KMHB 4Q7KA 3SYKA 3QQ5A 2H92A 1AA9A 5FI0B 2WTUA 3D3QA 3NDBB 4TYPA 2GCNA 4HUQB 5CITA 3KJIA 3OZXA 2GCOA 2PCLA 4XVRA 1OE0A 5EP2A 3AVVA 3U6KA 1U0JA 2FPLA 2KWIA 2CL6X 4CEJA 2E87A 4QNRA 5JRZA 4KU4A 3IO3A 1XCGB 2IXGA 3UMRA 4QM6A 1F48A 4QHSA 1MO3A 4MRSA 3D7MA 4Q18A 5KNBA 4IVPA 2ZRAA 1G8FA 2HJGA 2G88A 3B6EA 4UXJA 4ZO4A 1OT3A 2A5JA 3CPJB 1S96A 5CM9C 2DBYA 4QKQA 3ZLJA 1OHHD 1XMJA 5J4HA 2WKPA 1NG1A 1W48A 4BPBA 4O2LA 2ZRHA 4EAQA 1H8HA 5GVSA 3Q7PA 3WNDA 3AVPA 2NO1A 2DHRA 1MO6A 1T8UA 1Z83A 4NCKA 3G0HA 1S9HA 2VEDA 3B60A 1MABA 2XOKA 3RS4A 1US8A 1XZQA 2OT3B 3IPYA 5FFMA 2OAQ1 4MQBA 1X86B 2GILA 3R8CA 2R44A 2ZYTX 2P6NA 3CH4B 3LAWA 3GLGB 2QMOA 4AWXA 4TLCA 2AFHE 2JLWA 1MKYA 4DUGD 2VF7A 4GPTA 2ORIA 4KFUA 4CVNA 2VP9A 1N6HA 3T61A 1P4SA 4G3XA 3H86A 1P9RA 4PAOA 2D74A 4ZDKA 1P2VA 2NIPA 1WB9A 2ZJBA 1GDDA 2I1VB 4KSCA 1Z06A 4R9UC 4UJ5A 4DLTA 2RMKA 2RCNA 1KI3A 1I4TD 3QKSA 3DOEA 3BD9A 2GJSA 3A36A 3SHFA 4D0GA 2IHBA 4XD7D 2ZR0A 1RFLA 3AVTA 2CL7X 4X8HA 4KXFB 2GEVA 1XJ0A 1NJFA 1D5CA 4DDVA 1OIXA 3I8SA 2EW1A 1T5LA 5TY0A 3T12A 2QQEA 3RRZA 2XZPA 1JXMA 1K8RA 2BC9A 2E1RA 4NCIA 1M7HA 5D3MB 2BJVA 3CM0A 1R0ZA 3DMNA 5J4VA 4DSUA 2HUPA 3I62A 4NMMA 1GILA 3IHLA 2LCFA 1FNMA 1RW4A 5EZ5A 3SE0A 3PJRA 3FHTA 4LHYA 3CX7A 3U2QA 4URZR 3QKRB 2W00A 3R20A 4IEIA 2VP4A 4RD3A 4BRWA 2O8CB 1VIAA 1BYIA 5ELXA 2OBMA 3RVBA 3E5HA 3K0AA 2AKYA 5LBIA 4HUTA 2ANCA 4LJYA 2IYRA 5GJVC 1U99A 4B2IA 1TF5A 4LV8B 3UG7A 1L2TA 1Q44A 4AY2A 3KKOA 4NCHA 2WJJA 2H57A 2LKDA 2N42A 1HE1C 1T3LA 3KQNA 5FPTA 3VNVA 2CEAA 1J70A 1KHTA 2HF8A 2ZRIA 1MH1A 2VQSA 1CR4A 2VO1A 2YWGA 1E2IA 2ZI9A 4ITRC 4YC7A 2IS4A 1XD2B 4CIDA 1CTQA 1VTKA 1W0KA 1CJVC 1Z6YA 2Q9CA 2ZJ8A 2ZRMA 2XTNA 3NHBA 2F1HA 4OQMA 5EE9A 2RGXA 4Q4AA 3HPQA 4Z51A 4DC9A 1WRBA 4QBHA 5GJWC 1HEIA 4NPHA 2ZIAA 1G8HA 2ECKA 4EFNA 3ZH9B 2IW3A 2CVHA 1M8PA 121PA 3DO6A 5KTYA 3MLEA 3AVQA 1SKYE 1JNYA 3ZD7A 4F7WA 2J7PD 3WRXC 3GJ4A 3LW7A 4OI4A 5JSZB 2BWJA 4YLGA 3D31A 2OHFA 2JJ1D 1E2EA 3GFPA 1DEKA 1GIAA 1KJYA 2BMFA 2XXAB 1U9IA 2F9LA 3QPWA 1ZNXA 2ZPTX 3QG5A 3KB2A 3QVUA 2JDIA 1KI2A 2KBEA 4DB2A 2V54A 1GNQA 1WBBA 4RD0A 3W6NA 3EC2A 1QHXA 1FQJA 5LD2B 4DDTA 2ERYA 3AP1A 3O8DA 2W6ID 4DB4A 2GA8A 2ZEJA 4Q9IA 1KSFX 1GITA 2PJZA 3ZIAD 4M1TA 4ABYA 2CJWB 3H84A 3UANA 4IXNA 5IDVA 5E3HA 2YINC 1FTNA 1M74A 3U7GA 2WIAA 1QHHB 2ZI7A 4NYIQ 4DCUA 1IY1A 4NHOA 3L0SA 4WZAE 2ANBA 4IFEA 4QFMA 3HU2A 4HB4A 5CLQA 2B7BA 5KSZA 4A6PA 1JJVA 1YKSA 1IXZA 1ZUHA 2VF8A 5EE0A 4MA4A 4U5XA 8OHMA 1ZW6A 1TQ2A 5DO9A 621PA 5JWRA 2CK3D 4EPTA 4BEJA 1E98A 1J2JA 2G1JA 1A1VA 1YZLA 1ZCAA 2AK2A 3WHLA 2X2FA 2QMHA 1OIWA 3MJRA 4B6FA 3U4QA 4D25A 3FGNA 4DJTA 2KBFA 3ETLA 3BWDD 1G20E 2AFIE 3GJ7A 4XVQA 1X8LA 1KSGA 3VNUA 2QENA 4BLSA 3BH7A 4QL3A 1SGWA 1KMHA 2QL6A 3BRWD 3NG1A 2W2TA 3SU8A 1OHHA 1FP6A 3MWJA 1GZSA 2RGBA 1WBDA 3W9YA 3C8UA 1OXVA 4TYQA 2ZETA 3U3KA 1X1RA 4G5GA 2JLYA 1DG3A 2QSYA 2WJVA 3F3YA 3LLMA 1H8ED 4MKFA 4Q1DA 1KI4A 1TUIA 1BO6A 2V8OA 2GETA 2PZFA 4CT5A 3TR0A 2OFXA 3QXSA 3FHOA 4MYCA 5DHFA 4PX9A 3GFOA 2QBYA 2YKGA 5JZVA 1BS1A 4FW9A 2ZJOA 3THOA 1WMSA 5EP1A 4GT1A 3VMFA 3I92A 3CRMA 4V0OA 4P31A 5CDFA 2GESA 1RJ9A 5C18A 3QNUA 4HZUB 1I2MA 1NKTA 1GRNA 3GPLA 1AGRA 2OILA 3WP0A 4OYHA 4Z54A 2HDNB 5G41A 2V6IA 3N2EA 3OEHD 2IEYA 4OK6A 3WXMA 2P0EA 1VHTA 2EFDB 4MITA 1W0JD 2Y8EA 4G0NA 4JLPA 521PA 1TU4A 4PPFA 2FFAA 2MSDB 1IQPA 3ZVMA 1YQTA 3IUYA 4Q9JA 5AR1A 3UATA 3L43A 2PMKA 3GLGA 2Z5FA 5HZHA 5L3RA 2R65A 1DARA 4B75A 1HTWA 3M6AA 3CR8A 2WM9B 3ZZUA 1NNEA 2ODBA 1UKZA 1SXJD 2JJ8A 2BEKA 4JT4A 1JR6A 1CR0A 4WOPA 4JVSB 1G5PA 5TMPA 2GBLC 3ZZ0A 4HAWA 1KDTA 4QXAA 2H8KA 2Q0HA 5AWFC 3O47A 2R9VA 2CCGA 2W0MA 2IUTA 5DSZA 1WDTA 2AD5A 2DFLA 1W4RA 3N5CA 4A1FA 4AD8A 4V0NA 4DLYA 4HLDA 4FXPA 5L3SB 5G3YA 2JLUA 3GQBA 3LNCA 1HH4A 2J0SA 1Q3HA 2AX4A 3FTQA 2FWRA 2FSIA 2Q6TA 1R0XA 5JBQA 2PT7A 1RZ3A 2EQBA 1XCPA 5SZIA 3VFDA 4C0QC 1SVMA 1ZC4A 1DAHA 1G64A 1YZKA 2G1KA 3Q7QA 2YWFA 5JJLA 4PPNA 2WKRA 3AP2A 2MMCA 1OH6A 2C9YA 3X1YA 1G19A 1AK2A 1WF3A 3C41J 4URUR 3K09A 3LWNA 5FOSA 3C15C 2VH5R 1JR3A 2O8EA 3L82B 1C1YA 3VKHA 2QPOA 3QF4A 4JJZA 3HWSA 5L3QB 2D06A 3BB3A 3U61B 1PLJA 1OFTA 2JEOA 1DAMA 4YMWA 2IWHA 1RRPA 1GRQA 2GCPA 3F8TA 4LBZA 1N5LA 4M1SA 2XX3A 3B1VA 2XITA 1CJUC 4FMDB 4C0HA 3ECCA 3RABA 4FIDA 2RGDA 4QHYA 3M0EA 3QUSA 2VHQA 1WCV1 4OJKA 4UXHA 1Z0IA 2GZDA 3W3AA 4KI0A 1UBGA 4LYJA 2O8DB 1Z0AA 3CH5A 3AVXA 1EFTA 2IT1A 1FPMA 2P5TB 3QG1A 1WXQA 3A1VA 2FDCA 2QAGC 4IEEA 2AK3A 2FJUA 2ZYVX 4MKHA 2PZEA 2F9MA 2NO7A 1NRJB 1OFIA 2ZM5A 2P2LA 4BUJA 3AVOA 5BQ5A 4BQSA 3KKMA 1GVNB 1ZC3A 4BLQA 4MYHA 3U7HB 2XSZA 1S8FA 2QGNA 2AD1A 2ZU0C 3TUZC 3ADBA 1SVLA 4HB3A 1NMZA 2G83A 2PT5A 3O8CA 2JA1A 3Q8XB 4LRWA 1Q12A 4H9GA 4QJ4A 3SOPA 4BFSA 2O8FA 1DO2A 2PZGA 4KVAA 4W5HA 1N6PA 2OBLA 3UKDA 5KNDA 2R2AA 1ZIPA 1TX4B 4B34A 1N6KA 5GADl 2EFHB 1CULC 2CK3A 1OH8A 4IDOA 4M2LA 2WOJA 4N0DA 2A5FA 2ZVPX 2JLVA 3BC1A 1TF7A 1G5TA 3LBNA 4ZDWA 4XVUA 3REGA 1XTKA 2I1QA 4AYTA 4CZ2A 4HAUA 4Q4HA 3LO5A 3Q5DA 5FBRB 3P4XA 5HE8A 4A9AA 4FWTA 1JQJC 5KDDA 2WHXA 4QBIA 2YWEA 1XEXA 3GLFB 1A5TA 2NQ2C 4WAUA 4DDWA 1IN6A 1NLFA 4QGGA 1FNNA 3PEUA 2OUKA 2VLIA 1AIPA 3D6TB 3FKSD 5J5CA 3PUWA 2VHTA 4N0EA 5LD2C 3QSYA 1KJZA 2GJ8A 3GFTA 2ZSDA 3VR4A 3KJGA 3RS5A 5CDFE 1BH2A 1FMJA 3Q3JB 4QGFA 1W2GA 1R8SA 3AF4A 3AVYA 4DUGA 5FOXA 3PUZA 1K5GA 3R7WA 4D81A 3TGPA 1ZUNB 4KV9A 4PO9A 4OHVA 2BMEA 3PENA 3QF4B 4HDQB 3A8TA 3Q72A 5CB8A 1NSTA 1VECA 2FA9A 3OFNA 4V0LA 3P27A 3ZQ6A 4TTRA 2XOKD 3FE2A 3LBHA 1R7RA 2FV8A 4KODA 4B74A 3C5CA 4V03A 1R0YA 1ZINA 2OBNA 4PAMA 2EFEB 2ZR9A 3KQHA 3DOFA 3R9IA 1IN7A 2OCAA 1FL9A 2A5YB 2ONKA 2VYFA 3NBXX 5CK4A 2ZI4A 3QXXA 2D7DA 1E69A 3OIYA 4JL6A 3A37A 3RHFA 1Z6XA 3RS0A 4B48A 2ZRJA 4JLOA 1QZXA 1YU9A 1JR3E 1E2JA 1QHSA 4Q1EA 1ZAKA 1ZM3A 3AF3A 3GLFE 3L0PA 1OW3B 4G5OA 1A2KC 1DE0A 3VX3A 3OAAD 5C2JB 4KSBA 3RRMA 1Z28A 3T5DA 1DAGA 1OXXK 5J4KA 2NPFA 2IYQA 1G7TA 3DPUA 4HLUA 2GDJA 3W5IA 4AK9A 2QPTA 3EPJA 2CXXA 4OK5A 2ASEA 5K8IA 1E99A 2AXNA 1NMYA 2C99A 1UDWA 3KX2A 2EFCB 4LYHA 1EGAA 2DYKA 2WWHA 3O8RA 3BORA 1P72A 4A8JA 4ARZA 1HQYE 2CLDX 2X8AA 3WY9A 5JECA 2G9NA 3K0EA 1VDZA 3I5YA 4URXR 2VP5A 4NP6A 4PSAA 3QKRA 2EVWX 3MJHA 1II8B 1N0VC 2WPDA 4IDHA 2ZYWX 3SR0A 1IN8A 1GKIA 2FPKA 3C14C 2IS2A 3KKPA 3SHWA 4XTRA 1XBTA 2BV3A 1JQLB 2O52A 1KY3A 1CU1A 2PMDA 2C9OA 2WWFA 1PUJA 3LXRA 4DKXA 1KSJA 5TB5A 3OIUA 4QG7A 3GP8A 4EJSB 2FFBA 1G7SA 1HQCA 1XD2A 2H17A 2BBOA 4PZYA 1XJQA 3GMTA 4N1AA 3S1AB 1GKUB 1NVVQ 2F3RA 1Z3IX 3UK6A 5AUPB 3BFKA 4X8LA 2ZSBA 2P65A 1MOZA 4QBFA 2J1LA 4GFDA 3F5FA 1TQ6A 2WWIA 3TNFA 3BH6A 2EYUA 3TQFA 4C0JA 4P32A 5E95A 4UNRA 4B3FX 4KITB 1G5RA 2KSQA 4Y0VA 1E9EA 4KBFA 1OKKA 5FUVA 2FE4A 1QHHA 3LQQA 2HT6A 5G3ZA 4DCTA 4Q9HA 4EPXA 3V00A 4C0AC 2QEQA 1G21E 1IY0A 4ON9A 3K9GA 1NIPA 2BM1A 3KTAB 3WMEA 4MDFA 1P9WA 1E2GA 1OXTA 2ZRCA 1SXJB 2IF0A 4NYMQ 1ZNZA 4WZBE 1S2MA 3K0CC 1P5ZB 4LBVA 2PX0A 2X77A 2ZE5A 3THXB 1F5NA 2N46A 4OI1A 2QAGB 4A4DA 3CF2A 3CKLA 5E7MA 1X3SA 2PX3A 2VHCA 3X1XA 1UADA 2AHOA 1PLKA 3GLHB 4W5JA 3T15A 2WZQA 5FTNA 3TSWA 3SJBA 1PVOA 1Q20A 1G4AE 1T0HB 3H1TA 3I73A 5KPJA 2JATA 4ZKDA 3EXAA 3NDPA 4BFUA 4FD2A 1YZGA 4RKEA 5L3VA 1C9KA 1E1QD 5EJEA 2J0UA 2RGEA 3SI7A 4DEXA 4P4SB 2VPPA 5DGXA 3U3MA 2DB3A 3CPHA 1NN0A 5FTMA 3Q85A 4Q21A 5FPHA 1E2FA 3W6OA 4EJSA 4AKGA 1A2BA 1U94A 1WQ1R 4JKIA 5CK5A 3C7KA 3QKSB 1T6NA 5DISB 3T5GA 1RRGA 2FFQA 3K8YA 3B1YA 4NCNA 4PHTA 3CUEF 1P3JA 1W36C 5FBWB 2IYWA 3SNHA 1RKBA 3THWA 4DZZA 4BZXA 1JALA 4YDSA 3NC0C 4L8GA 5JSZA 3CZPA 5AJWA 3K0AB 1M1YE 2ZRLA 1E2QA 2I4IA 4GOJA 3VAAA 2FSHA 4TQUS 4D26A 5K8TA 4NE2A 2NTYC 5KSYA 1N6LA 4BLTA 2WWWA 2ZAOA 3SFVA 1VG1A 2BCJQ 1W4AA 4US0R 2REBA 1F6BA 4M9QA 1SHZA 1KOFA 3I72A 2A30A 1OJLA 4TL8A 3TIFA 4Y0AA 1II9A 2BIFA 2IF2A 1BOFA 2JJ2D 4OL0A 2F3TA 3IBGA 4A92A 4BGDA 5EZ6B 3L2OB 3ZVRA 3VHLB 2N1BA 3GEHA 5FL7D 1DAEA 2GK6A 1HE8B 1IBRA 1QHIA 1ZM7A 1VCIA 2HCJB 1VPLA 4HDCA 4WXRA 4Z1MD 1LW7A 1KKMA 2O0KA 2OFOA 3AKDA 3KKQA 4XIGS 4HB2A 4Q1FA 3EC1A 4Q47A 1E9SA 1KK1A 4GP6A 3NH6A 4YDHB 3RSOA 1TPZA 3QPUA 1RRCA 1NY5A 4RD1A 3NC1C 4CF7A 2C04A 4JLJA 4NH0A 4RSGA 4IOJA 3C4JA 2IYUA 2XB4A 2V3CC 4Q7MB 5BYJA 1X6VA 5JWOA 4PFSA 1PLLA 2NZ8A 3P32A 4OHWA 4P33A 2C95A 4F4IA 1A4RA 1W44A 2R8RA 2DFTA 1YR9A 2BVNA 3GJ5A 3BJIC 1QBKC 5B64A 2QTFA 2O0HA 3IO5A 3LW8A 4I81A 1GNRA 4CEIA 1FX0A 1EX6A 3O8BA 1W46A 4B3BA 4BRUA 3R7WB 3I4LA 5IK2D 3UPUA 3AKYA 1P2SA 4IOKA 3T34A 2X1VA 5AJVB 1WA5A 2JJ1A 2XJ4A 1K6MA 2ZS7A 1IAQA 1ZBDA 4DEYA 1VHLA 4EUNA 3TLXA 2WJIA 2QM8A 1LS6A 3AVUA 1R10A 2ZVQX 1KO5A 4NONA 3NBFA 5L3SA 1R4AA 1MT0A 4M4SA 1F2UB 4JZKA 1AS3A 4JLDA 3NBZC 2IL1A 3VU9B 3X1WA 3KUCA 5TXGA 1AJEA 2C78A 3K0CA 4Q9KA 1KK2A 5F3WB 2ZANA 1B0UA 1KZ7B 1CKEA 2WBLC 1XDBA 2ZREA 4PO8A 5A4JA 1BMFA 2YZ2A 4JSYA 1E9BA 2XZLA 3QEOA 4LX0A 4Q4JB 4E03A 4M1WA 3QF7A 1W49A 3THWB 3PEWA 4U02A 3SQWA 1SQ5A 1QHNA 2ZSEA 5H68A 2QZ4A 1H65A 1ZP6A 2YNMA 2B7CA 1Q1BA 1Z22A 2GZHA 1E0KA 1U2RA 3KJHA 2WOOA 1AQYA 1CEEA 1AZSC 4JKYA 5KHOC 1CIPA 3TSZA 4Q4LA 3HP1A 4B2LA 2ZU6A 2C5LA 3ZZTA 3OF5A 4FMDF 4PTLA 1T3SA 1FX0B 3AUYA 1KKLA 4WXPA 1E2PA 5FUYA 2YHSA 5KSOA 5FL7A 3RS7A 4PXAA 3RS3A 5BWMA 3KL4A 4S2EA 3IILA 1DG1G 1II0A 3S1AA 1NIJA 1E1QA 2QBYB 2ZI5A 2W58A 4L5BA 1KI7A 2IUSA 1ZM9A 1XNJA 3L0OA 2C8VA 5JI2E 1FFHA 1XP8A 4AYXA 1Q3TA 1V5WA 4FMBB 1NL3A 1KK0A 1AGPA 1CBUA 1ESNA 1L4YA 2WMNB 5JJIA 4BZQA 2GJKA 3SDZA 4U7DA 3U60B 1UPTA 1AS2A 3FFAA 1E2NA 1XXHB 3K0FA 4JL5A 4OK3A 4ZDIA 5B57C 2QG6A 1P61B 2YOHA 5FOUA 4AG6A 2CHVA 1TAGA 4LJ4A 3EG5A 3TJZA 4OJQA 4PPGA 4EQ6B 1YE8A 3FDIA 4A82A 2OXCA 1LFDB 3OE7D 2GXSA 3K1JA 5L8VA 2RKOA 1ONBA 4H1VA 4JVLA 4MRNA 1S9DA 4NDZA 4RFSA 3DM9B 2FH5B 4XOIA 2CHGA 5EE5B 5SZKB 4HLUC 4MGKR 2ONJA 5CIWA 4PQRA 4W7SA 3SYLA 4HEJA 1FOEB 1W4BA 3U44B 3EARA 3KFXA 5JLJA 5FOTA 1VYVA 4E09A 1OF1A 1CJKC 2OFWA 1Z0KA 4L4UA 3R8FA 4QNMA 4LI0A 2J59A 2WJGA 1NF3A 2RGAA 2B6HA 1Y63A 1JXOA 1U81A 2W83A 1DBSA 1E1RA 4LJAA 3A1TA 3K70B 4DLWA 3ZDQA 3SEAA 1OFUX 4IVRA 1G8PA 2QT1A 1P60A 3EZ7A 2GF9A 2C96A 1E4YA 2FMXA 1KI9A 1VMAA 1UFQA 2VRWA 3QE0A 5CYOA 4D0NA 1IY2A 3AB3A 1W1WA 4AC9A 4P0TA 1KNQA 2A7QA 2D3WA 5KYKA 1IONA 1XTQA 4C7OA 3VR5A 2OAP1 4D0LB 4K46A 1TQ4A 4PSKA 1KZGB 5EXTA 1JI0A 3OHMA 5FI1B 3L8ZA 2J0VA 1M6NA 1YZNA 2Q9BA 3U3JA 4D80A 1Q0UA 4A36A 4WA7A 4J0QA 3GJ8A 3WYGA 3K70C 4HI0E 4TZ6A 4GRAA 3KZ1E 1T9HA 1KDOA 4KO8A 4YMVA 5J4LA 3B8HA 4AI6A 1E1RD 4C0KA 2QMUA 2WWGA 1P9NA 1DAFA 4EFLA 1UKEA 5A0FA 1UBFA 2Z6VA 1I4LD 3R9WA 1N0UA 3IHWA 3WP1B 1ZD8A 2JASA 3HU1A 2AR7A 4X8OA 1XEFA 4KBGA 3Q9LA 4R2IA 2WJHA 4OI0A 4KFRA 5FPSA 2VTKA 4R7ZA 4DCSA 5B2ZA 1IHUA 4TN1A 5FBVB 4PQFA 2L0XA 4OQNA 3LBIA 3ONWA 4GNKA 4NYJR 4W5WA 5IRCD 2JCSA 2ZI3A 2JLZA 1XU4A 2Z83A 2ZQ5A 3V4FA 2WIBA 1XMVA 3CZQA 4NYJQ 5CB6A 3FMPB 3IBYA 1ZUIA 4EPRA 1ZMXA 2REOA 3AF1A 2JAQA 3ZJYA 1VCNA 3A4LA 3CNNA 3EZ9A 1G7RA 4KFTA 1W4CA 3GLIE 1QG4A 4M9XA 4DT1B 1KI6A 2QY9A 3TMKA 2WKQA 5J47A 3MCAA 3PIRA 4TT3A 4LJ8A 3UG6A 5HE9A 5GVRA 2GF0A 1YZTA 4Z1MA 4I1VA 1T8TA 4IRUB 1QVRA 4GOXA 1N3BA 1E94E 3U4QB 1M7BA 4CEHB 2YYZA 1TL7C 3WHKA 2CNWA 4F38A 4LBWA 1Z0JA 2HJVA 1OH5A 3H0KA 2FGJA 4MKIA 3EIQA 3RSLA 4JBWA 4BLOA 3B9PA 1NLZA 4V0ME 2GAOA 3PFIA 2A78A 3JVVA 1P62B 3FKQA 4C3ZA 2CL0X 4A0FA 4DCVA 4DLUA 5KNCA 2FOLA 3F0TA 3QVVA 1UBCA 2BBTA 4HZIA 2F6RA 1OIVA 4JS0A 1PUIA 3NTUA 5G40A 4QM7A 1JECA 3JVUA 1NY6A 1S4QA 2YOGA 2ZUDA 1ZCBA 2C77A 3LD9A 3PUXA 3DDCA 6Q21A 4TT3D 2J41A 4Q7JB 5FR1A 4DIEA 4ZIRB 2R6GA 2DY1A 3L8YA 1QRAA 5H1YA 3TRFA 3ASYA 1E3MA 2GVDC 2OLJA 3VR1A 1CP2A 2XB2A 1SVKA 3T35A 2GVZC 3AKCA 2J7PA 4BFVA 1GAJA 1KI6B 4FI3C 1E96A 3IIJA 4US1R 4LJ6A 4ZCIA 4B47A 2ZRBA 4Z8XA 1DAKA 5FUWA 4GSYA 4BFWA 4JLMA 1E2LA 1D8TA 4AKHA 1KO7A 1JEDA 3W8RA 2FFHA 3I1FA 2Q3HA 3AH8A 1Z6TA 2P3SA 2V1XA 2GAAA 2QRZA 5SZJA 2QQ0A 4GMDA 5EP3A 3T1QA 1H8HD 1UKVY 4PZLA 3MAAC 3B5JA 4IDQA 4LC0A 3EWSA 5P21A 1X1SA 1IN5A 1SULA 2O8BB 2VL7A 1FUUA 3QY0A 1CJTC 3HJNA 3W90A 2C03A 2XGJA 2RAPA 3AGQA 1E9RA 3NH9A 4GL2A 4G01B 2FN4A 3OIWA 5C4GB 3CRVA 3UIEA 4YQFA 3IEVA 4I99A 3TBKA 1XB2A 1NN1A 4I4LA 1RPZA 4GOKA 3VTKA 4DVGA 2R6FA 4NTZA 5FTKA 2ZJYA 5DI3B 4JLNA 2ZYUX 3CRQA 4LPKA 4MH0R 2UZIR 2GKSA 1RE0A 4Q48A 4E5UA 1E4VA 3DEFA 4KYUA 1X8JA 1E2KA 4G5QA 2GNOA 3K9LA 3QENA 4CYMA 4B73A 4V0MA 2XZOA 3WBJA 1KO1A 1G18A 5ANRB 4R98A 4CEIB 4TZ0A 3VKGA 1HV8A 4WVFA 1IJEA 1NN3A 1XD9A 5C4MA 1NLYA 4B6EA 3OEEA 4QBGB 4UQOA 1U8YA 3QXJA 3UWOA 4E07A 3D8BA 5IK2A 1NBMA 3DVLA 2UZ3A 4L9WA 5IHPA 2GEUA 4LYAA 3KB1A 5HTKA 2ZJ2A 3WBKA 1EFUA 3PR1A 4PHGA 3B7GA 4BFYA 5KOYA 2YV5A 1N6RA 1KNXA 3B85A 2GJAA 2QA5A 3AVWA 3VR6A 3L0IB 3GEEA 4A6XA 4LC1A 1Z47A 4HZUA 4GZLA 2XSZD 3TW4A 2CCKA 1S1CA 3P4YA 3K09C 4B71A 2BEJA 1N25A 1TTTA 2WAXA 4W9MC 1T0JB 2FPMA 3KXKA 4JSTA 5CJPA 1NG9A 2NPIA 1GWNA 4IOLA 1N6NA 1Q1EA 2CMKA 3W6PA 1JR3D 3EWAA 1EWQA 3IQWA 1XWIA 3I61A 4K81B 2XNDD 4P4SA 2ZITA 2ODEA 2ZRPA 4CEJB 4TMKA 2V55B 3NHAA 1N0WA 2ERXA 5H8WA 4MGIR 1G3RA 2IYLD 1TQDA 2IYSA 1EFRD 4I1UA 2EWVA 3DKPA 5B58C 4IDNA 2BCGY 2BMJA 2DPXA 1ZU4A 4PHHA 3W34A 3LX8A 1KYIA 4TQAA 4LUCA 3LLUA 1UBEA 3THXA 3TQCA 2HLDD 1E32A 4RZ3A 1COWA 1L7VC 2F1JA 1P75A 1ZIOA 2QT0A 1DVRA 4B3XA 1LB1B 2QTVB 3ZQJA 2RGNA 4YMUA 4Q4HB 4BZPA 2IXEA 3AP3A 4D6PA 1R5BA 1Q22A 3EAQA 2RH5A 2PH1A 1E9FA 3K9NA 4M1OA 5C1BA 3PEYA 1GTVA 2ZTSA 2KE5A 5DNYB 3KXIA 2FZ4A 1NKSA 2NG1A 1MR3F 3CB4A 2ZRKA 3CR7A 4KFSA 2GXUA 5JS7A 2FEMA 2OLKA 2WVJA 2EFGA 2QRNA 4TLAA 3AF0A 1Z6AA 2RHMA 3NEJA 4BFTA 2F43B 5DYGA 5J4YA 4CEHA 4Q4JA 4DDUA 3K0SA 4QC2A 5TVKA 3ZIAA 4EFMA 3KUDA 3K53A 4HAXA 1F2TA 2PLRA 3SQXA 3MGCA 3MWYW 4WIAA 3EW9A 4YXWD 1FMLA 3HPRA 1P6XA 3CIOA 3HR8A 1AN0A 2HXSA 3KJEA 3SBDA 2WICA 4ZIRA 2QAJA 2D2EA 2VSXA 1CR2A 2XNDA 4ESVA 2ZS8A 4FCTA 1YZUA 3FPAA 5AUQA 5D3MA 4P4TA 3DHWC 3NXSA 3PCRB 1MABB 3SBEA 1XPUA 4UNNA 3U3RA 5M04A 1M34E 2ZAMA 3CRW1 4R2HA 4B43A 3E70C 2TMKA 1ZVQA 4GZMA 5F98A 1Z5ZA 3P1JA 3EPKA 2EYQA 1JAIA 4TMWA 1G3MA 4LBYA 4QGAA 4G1UC 2IK8A 1T4GA 2G0TA 5AUOB 3QIAA 1EFCA 3RC3A 3THYA 3CLVA 2H5EA 1S1MA 2O8DA 4HAZA 5KDOA 1TMKA 2PEYA 1GP2A 2YOFA 4L9SA 1ODFA 3BK7A 5KSPA 4RCYA 2DFNA 3NVAA 4B32A 3GLGE 3EPLA 2CE2X 4KCGA 2QMEA 4Q7LA 1COWD 3RWMB 4N3NA 1GKYA 3BXZA 3Q5EA 3VR2A 1KI1A 4IHQA 2BM0A 5DI3A 2ZJ5A 2V7QD 1P2UA 3GJXC 4KVGA 4S35A 1Q21A 1E0JA 4P4UA 2FNAA 2A2ZA 4KHZA 5BN5A 1ESMA 2WWXA 1G8GA 3NIBA 2QORA 2VHUA 2BHRA 4US2R 4NYMR 4JL8A 3QEJA 1XEWY 4ACAA 4B33A 2C2HA 3FKSA 1S3GA 4TL7A 4XD7A 4RZUA 5FR2A 4RZXA 3B1XA 2IYYA 2YWHA 4FMCB 4XJXA 1R2QA 2G3YA 2IYVA 3AF2A 4OQLA 4BFZA 4M22A 1XMIA 1FP7A 4Q1AA 5AK0A 2AWNA 5HR5A 3E2IA 4D4KA 2B21A 4LGMA 2GEDA 1N6IA 4QJ5A 4ZCLA 4C0LA 1DO0A 2JLXA 3PEVA 2ZI6A 5LB2A 2F1RA 2Z43A 3H2YA 2BMDA 1J90A 1GFIA 1E2HA 5FBQB 4C0SA 2GCOB 5BW8A 1YJ5A 2PEZA 3EA5A 2QGZA 4TLEA 4PPQA 1NVVR 3LQRA 3TSOA 3LX5A 2QP3A 1UDXA 5EXXA 3RC8A 3UMFA 4F4JA 1GSIA 4LYFA 1Z63A 3ICEA 3IEUA 1GL9B 3CBQA 2VIIA 1EX7A 2ZRDA 4C30A 4DT1A 4QOSA 3UMSA 1EK0A 1W36D 3PVSA 1VYTA 4HUQA 2MSCB 1TNDA 4RFVA 1KAOA 1XZPA 1IOZA 4JIMA 2QUZA 1YRAA 2W6IA 1CLUA 4B3GA 2B8WA 2QNRA 2R6AA 2YVUA 2QP4A 4EJSC 1R0WA 5FPKA 2G0NA 1XEXB 3GLFA 4B35A 5KUTA 2Z4RA 3LFUA 3BB4A 3QPVA 2D4HA 1U90A 4QHTA 1NBMD 2IS1A 4ZDJA 1U0LA 2VSFA 2R6CA 2Q9AA 4QRHA 1LF5A 1SKQA 1Z2CA 3M1IA 5BN4A 3B13B 5DN6D 1YVDA 2WPDD 3MWLA 4NKRA 2GBLA 1QF9A 2CNWD 2JIZA 4M53A 1QHYA 1LVGA 3MRSA 1AZTA 3FWYA 4LV6A 3CW2A 3EPHA 1N2CE 2OXRA 1RC8A 4U00A 3OE7A 2C9CA 3EIHA 4LY6A 4MGZR 3TKLA 4A2WA 4A15A 2LKCA 2CDNA 2ORVA 4DLVA 3JZMA 4TSFA 3DZ8A 4D4MA 4C2UA 4AIIA 1D2MA 4C4PA 1OXUA 3LDAA 4TMZA 2CLCX 2QPAA 5FUXA 4B2PA 1F3OA 1NSFA 2QE7D 4YONB 3T1OA 1VCOA 4JLVA 4DCNA 1TEXA 2FZLA 3M4YA 3LY5A 1ETUA 3OAAA 5AJYA 4PC7A 5HCIA 3R9XA 1FZQA 421PA 1W0JA 1M2OB 4E22A 1E2MA 3LXXA 4JLBA 3RDPA 3MUFA 1LF0A 1OB5A 1VG8A 1R5NA 4LZZA 1OKKD 4RJLA 5LB4A 2YC2C 1D9XA 1E6CA 1WE2A 3A4MA 2IWRA 4F92B 1VCMA 2JLQA 3SS8A 1GL6A 2HLDA 3BFVA 2J46A 3W8NA 2X2EA 2HYDA 5EXSA 4MGYR 2OV2A 2OESA 5EP4A 4RY2A 2GZAA 4P3YA 3WYFA 4CRWB 1D6JA 5DIFA 3BH0A 4ZPXA 2PLFA 4TSFD 2AL7A 1YHNA 2QN6A 3A4NA 4A0GA 4TTQA 3RYTC 1NVWQ 3AEZA 1D2EA 1QVAA 4C7OB 2G77B 5KU1A 3CX6A 3TVDA 2IUUA 3ZVLA 2G6BA 4Q9LA 4IVQA 3TAHA 2GWHA 3QBVA 2P5SA 4ZI3A 3VU9A 2JIZD 4LOAA 3TUJC 4DRZA 4ILEA 1UEIA 4DSNA 4M9ZA 4LDJA 5CLLA 5JFGA 5DN6A 1Z07A 2BKUA 1W0KD 1SVSA 1HURA 2RHDA 1ZM2A 5JI3E 1Q1ZA 3CWQA 5HKKA 1YR6A 3CO5A 3UWKA 4EIWA 3MWKA 4Q5IA 4CDGA 1G4UR 4OHXA 1JPNA 4O0MA 1Z2AA 1H8EA 2EWWA 4RCZA 4WW0A 2R6DA 5JWHA 1U98A 3WMGA 1Q57A 2DWPA 1G8YA 2P6RA 2QI9C 2YJTD 4UJ3A 4F91B 2IA5A 1KO4A 3G5UA 4GDFA 4IKEA 3SC3A 1D2NA 2XXAA 2QSZA 2JJ2A 3FB4A 1HUQA 1MRNA 4URYR 3CX8A 3PG5A 4NU0A 1FTSA 1PV4A 1VKJA 3P20A 1R5OA 2QTHA 4DHEA 1G17A 2PCJA 1N6OA 2AKAB 4A2PA 3KFVA 1DELA 3OFND 4JLKA 5HPYB 2OZEA 1OXSC 2IC5A 2ZRGA 4TLDA 3MG9A 2HV8A 3B82A 1P2TA 4UNQA 1HT1E 3WYAA 3B1ZA 1W36B 4M9SA 2GK7A 5FH9A 2H1LA 1S0UA 1E0SA 4RZ2A 4EDHA 4X8MA 5JS8A 1W2HA 5GJCA 2H16A 2P67A 3N70A 3HYTA 1JBKA 5CJ2A 1TEVA 3SJZA 4DBLC 4UXIA 2WSSA 3WNCA 4XSGA 5BN3A 4JLAA 1L4UA 2KB0A 1N5IA 1MV5A 2CJWA 2GJ9A 5J40A 1IXSB 4LHVA 3ZYCA 3IGFA 5GJBA 4PANA 4PZZA 4RD4A 3DZDA 4G5SA 5EE3A 4GI7A 4LCBA 1EFRA 5SZHB 2REXB 5AJZA 4Z8YA 1LTQA 1J8YF 4DWJA 3GCGA 4GP7A 4ESHA 3TH5A 1ZJ6A 821PA 3AM1A 3CRRA 4IFBA 2J87A 3QJYA 2QU8A 1SZPA 2BOVA 1T5IA 4TTPA 2I3BA 2NZJA 2WSMA 1SVOA 3ND8A 3RS2A 4A2QA 4NL4H 4ZV4A 1VG9B 3VX4A 4DLSA 1KTVA 2A5DA 3BOSA 4XH9B 1TF2A 1Z08A 4XSHA 4BWYA 2VP6A 1ZD9A 3EZFA 3MMPA 2O8EB 3BB1A 3P26A 3NBYC 5KDLA 2CVFA 2RGCA 4LWZA 3OEHA 3ZS8A 1E9DA 5G53C 1T3HA 3RANA 3C16C 1W47A 3TR5A 4LJ5A 1VG0B 4DLRA 3PQCA 2ZUBA 4HYYA 1FUKA 3X1DA 1F2TB 1KY2A 1QG2A 1BIFA 2ZR7A 3RRYA 5JRJA 4C2TA 1NI3A 1BKDR 1GOTA 2FGKA 2X19A 1CXZA 2H7VA 1YZQA 2BBWA 1B23P 1G1MA 2F43A 2W2VA 3WMFA 4PC3A 2EU8A 4JT2A 3W5JA 2VBCA 1DS6A 1I4DD 2Z0MA 1SKYB 4POAA 2GHIA 5DHAA 4TYWA 1ZNYA 2MMGA 4CT4B 4RKFA 1IXRC 5LDDC 1OB2A 5E4FA 3TE6A 3QBTA 2JLSA 5FBLB 3OIVA 1XPRA 4RD2A 2QAGA 2FF7A 4PC2A 2B92A 3ICQB 1Q1QA 5UKDA 5JEDA 3GLIB 2O8BA 1XFAA 1KMQA 2O5VA 2GRJA 3BERA 2QM7A 1D9ZA 2QE7A 3VQTA 5EUMA 3T1VA 2IHYA 4ZI2A 4OKSA 1O87A 3LVQE 1SXJA 1AQUA 5B30A 1VYUA 2Q3FA 5KO2A 2HYIC 3EIEA 3A6PC 2VSOA 1G9XA 3KTAA 4AG5A 1MRSA 4HDOB 2AXPA 1G6HA 2PL3A 5AUNB 1X8KA 3X2SA 1T91A 1WP9A 1OFHA 5TV2A 5JHHB 3K70D 1RIFA 4JYCA 2BBSA 4MYTA 3ZD6A 3A1WA 2J0UB
chains in the Genus database with same CATH superfamily
3JZAA 4PG5A 4Y2YA 3ZW8A 2F59A 3PRYA 4C7XA 2DFVA 1LJ8A 2QX9A 4M8SA 1ZOSA 4WXHA 1QAOA 3IP7A 3QNMA 2WMOB 2VYQA 5F51A 4YECA 1BFKA 1XXHE 1NBAA 1PJ8A 3NHZA 4RPKA 4FINA 3VVBA 3GCXA 1LS1A 1DXHA 2HIAA 2OCIA 3CF6R 4L16A 3M6FA 4IIGA 3RIEA 2HMTA 3QI2A 4XLZA 1VJCA 1XTSA 3LDGA 4RFLA 1JKFA 3QXCA 2ORWA 4UDXX 4LTNA 1L7QA 1TA0A 2LWIA 5H9WA 3UO8B 4ZRNA 1BXGB 1Z6GA 1Z62A 2FSGA 2UKDA 3I32A 2WLTA 4QATA 1AGNA 2J5XA 2PO7A 3V1TC 1YFLA 4LF8B 5HS4A 1W34A 1NV8A 2VP2A 1DTWB 1ZISA 4J1NA 4DWWA 1A7KA 3BBPA 1JAHA 1NU6A 3FFBA 1KY4A 4BO5A 3CIFA 5T67A 5A4MS 2WR8A 1ADCA 3OF2A 3ZS9A 2VJLA 4C5BA 4D42A 3UJBA 1F6DA 4OQZA 2QX7A 1BX3A 2OEPA 3U7FB 2CMDA 4GZ3A 3AM3A 3HJBA 1W8IA 4KXNA 3BFJA 5A5GA 2AG0A 1RPJA 3C6YA 1J4AA 2Q6VA 5LP6B 3FMVA 4RA6A 4DSTA 221PA 5AK5A 1E8NA 3JQAD 1G5HA 2JGLA 1FQKA 1AS0A 2ZUCA 3DKVA 3JYLA 3N5KA 3KQLA 3ZGXA 2W8ZA 4HLQB 5DH9A 3BAFA 1UFOA 1M8KA 4HB0A 1WS6A 4DA0A 4M21A 2JGRA 4IIUA 3PNLA 1II8A 4IOMA 4ARIA 4X54A 3WDKA 1EDOA 4O59O 4X61A 4XYLA 2WY2D 1UEJA 2YC4C 2WE7A 3DAPA 3P9QA 1UOQA 2B0CA 2D1FA 4HP8A 4JUIA 1EMDA 4QREA 4V0SA 4AKEA 2AOTA 1PWHA 3LO8A 1P73A 4JOQA 4Q01A 2OK7A 4D82A 2RH4A 4LVNA 4MAMA 1Y1RA 2P6UA 3M3DA 1JMKC 1MB3A 1EM8A 2Z5VA 4WVLA 4CNBA 3ZU3A 1CRPA 4AURA 4LRYA 4L8FA 5P8WA 1TADA 4YAEA 3S99A 3VV2A 2AG1A 4O5OA 1PR1A 1ISMA 2ZATA 2GN4A 4BAZA 4FCWA 4BQOA 1A9XA 1KFKB 2JFPA 1V71A 3JRWA 3LC7O 4E6PA 2AG5A 4MS3A 4KYTA 1DRWA 1O6ZA 4BFXA 3UBTA 4M87A 5FQOA 1J8MF 3FVQA 5KYUA 5B1HA 1LBQA 1D04A 1RXIA 3TWOA 4Q7QA 1SB8A 1REQA 3PSHA 4PSVA 3PDHA 3H11B 1I3KA 2GTPA 4HC4A 1X7WA 1NUPA 1P4GA 3FRIA 1SCKA 3NKVA 2YIVX 4K6MA 1L5LA 3BF7A 1NXWA 3ADOA 1IG3A 2CLHB 5L53A 3R77A 4CN9A 1COZA 4QE3A 2DBZA 4TTJA 4BMOB 5BR1A 3H2GA 4TL6A 1DAOA 4RVCA 3WJ1A 5FEMA 3VR4H 3SZRA 2V97A 1BCSA 1ULZA 2VDQB 1TC1A 2CZCA 4PO1A 4IR7A 1HZJA 2NMVA 4ASUD 4EG1A 2UZ0A 2VDOB 3RVQA 4I4TB 3I9V6 2Z5LA 2C0CA 4WNCA 3TJRA 4PLYA 5BXQC 4PAQA 1AUOA 4IXMA 2IP1A 1N2CA 5CT9A 2P40A 4KV7A 1VYHA 2I7DA 1YQEA 3KTFA 4BCCA 4Y3UA 5BQOA 4D5EA 1JE0A 3IPRA 5G4LA 1DOAA 1BNCA 2RC6A 3MS4A 4ZT5A 3AL0C 1F2UA 2ZJZA 1L8QA 4PGMA 2RI0A 1PJQA 5AOAA 3DFKA 2XAUA 5E6RA 5B58T 5JUWA 1HT2E 3EXHC 5KYYA 4LWOA 4EHIA 3HC7A 3IJRA 4NQRA 1H2YA 2ZJAA 4ZV9A 1AZLA 1MO5A 2D62A 3Q6MA 3T99A 2VHJA 3N2LA 4K9PA 1E7WA 3H65A 4MVYA 3DHYA 3VKFA 4P0QB 1DTEA 4DZRA 2DPYA 5CIQA 3WK6A 2KLHA 4O8ZA 5H81A 4OHZA 1FUEA 3B1WA 1C7RA 1K8QA 3KTDA 4KQ1A 3IIKA 4Y6QA 3SS9X 3LC0A 3KDPA 4NBSA 2VT2A 1QFJA 1XZEA 1SG0A 3B9QA 3V1LA 2FKNA 1Z45A 3CMMA 3DD1A 4KLZA 1U9JA 1HYBA 3OUUA 4MRPA 2WYOA 1PF7E 3OESA 4NS4A 1AA6A 4QIHA 4A10A 2Z1NA 2GZRA 1ZI9A 4IUYA 4M1YA 3VVLA 1I2DA 2OOSA 1ECFA 2JDID 3AHGA 4LMBA 1D6SA 2XTZA 2RHRA 3T3MB 1RE1A 5JXGA 1ZLXA 2O7NA 4BO1A 3OJXA 2P91A 4BNYA 3GWGA 3A1SA 5ES4B 4RKYA 2I9PA 2A59A 4YAUA 5PNTA 2A5GA 2BKEA 3A14A 1DTSA 3EDOA 1NXSA 5BMVF 5HA5A 2HW8A 3OX2A 5I9SA 3I6IA 3CLSD 5LP6C 2E48A 3CO0S 4BGEA 1QWOA 2ON6A 2WG1A 3DR5A 4KYIB 3NBUA 4TQ9A 3NEYA 2AJLI 4Y9SA 2W6JD 1X7DA 1MJ5A 1MT3A 4LXQA 5TQ0B 2X2PA 4OJYA 2IV2X 3RVSA 1XCMA 3E53A 3SQOA 2WD7B 4ZEVA 1TI7A 1U1CA 3L6DA 4IO1A 3TLEA 4B6PA 3V4RA 2FPOA 1I7PA 3SJAA 5TT1A 3F8WA 3I2HA 1FJ2A 3OY7A 4ARZB 1M2WA 5ILQA 5HMMA 1KQPA 4DV2B 1E79A 2P90A 2DFKB 1F9AA 2JCVA 5IS2A 4K0RA 1S3SA 1L5MA 4GM4A 1GYPA 5IT4A 3LBAA 4O25A 2ZJ0A 4B44A 3TEFA 4AKIA 1T9GS 1EAMA 4TT8A 2MINB 3W3ZB 3EXEA 5A0VA 2JFYA 2OSBA 3T3HA 1MRZA 4ITUA 1WDKA 3FR8A 4MYUA 5F9HA 4K6OA 4MRRA 4GBGA 1W25A 2QZPA 4XQ0A 2PLWA 4WWHA 4G0QA 4BMSA 3BXOA 1E9AA 1I2AA 1DCMA 1SELA 3DZHA 5DI9A 3LQYA 4BX8A 1KGDA 4EVSA 4W1RA 1EUYA 1YS2X 2DERA 1JDBC 2ZTLA 1BVRA 5AKYA 2A0KA 2VZ8A 4DXHA 1GRRA 4QTTB 2X8JA 2E7ZA 5A9SA 5ICEA 3ICPA 1HA3A 2V6JA 2VWGA 4D9IA 3PL5A 3IUEA 1MXFA 4YAJA 2KMLA 4AZ0A 4X84A 1CQJA 4IIFA 3VHXA 2YMQA 3LVFO 3P0FA 4II7A 3R6WA 4BKOA 5TS2A 2GK4A 3KYIB 1RYHA 2IH4A 4MGHA 4IUDS 1G41A 4B81A 4LFBB 4WESB 1YAHA 4AW9A 4PM4A 1HDYA 3I8OA 3LRPA 4JWKA 4MUEA 3V3KA 4H1UA 3QKTA 5CCXA 4JJEA 5AJXA 3G89A 4G56A 2VNHA 4M6WA 4WEOA 1ZHOA 2ZE7A 3EQ2A 1UC5B 3IV7A 8LDHA 3U3XA 5K6TA 5I7SA 4Z0PA 3S5UA 1V3VA 1WABA 1QB8A 5FLYA 5IJ0B 3SF8B 5DLYA 3JQRA 4UU7A 4KE8A 4XYGA 1KR5A 1EX1A 1LSOA 1Y9AA 4MIKA 5DNUA 5HGJA 1NJGA 3HKEB 4N0PA 3B9BA 4X7MA 1T8YA 3OD1A 4FSXA 3EPPA 4U5QA 4Y2QA 1OSNA 2JLRA 2JF0A 1UF9A 1GUYA 2BRUA 4X6XA 3KJXA 1JZSA 2NZ2A 1P5RA 721PA 4FHEA 4MW4A 2RGWA 3DE6X 2FVXA 3WISA 1PG2A 4HQLA 2XMZA 5TNXA 4WD3A 3RUCA 3X1ZA 1ZUNA 2HNAA 2BKLA 2VOJA 2WWRA 1I24A 3IQXA 4YRRA 3RLFA 1FYXA 5C8XA 3MA0A 2FZCA 4YUZA 4PRKA 2PNJA 1WPQA 3ASZA 1WD7A 1YA4A 1G7CA 3WJAA 4ZZ0A 3BTVA 1VIYA 3FDJA 1SH7A 2BCEA 4RBNA 4CMCA 1WWKA 4IMJB 1XALA 2OMEA 3EXIB 3QLUA 3GLHE 4LHZA 3L49A 5MDHA 1XPOA 4Y2VA 4UZEA 2GPJA 4ZT6A 4WLUA 1LPMA 4Q6WA 4ZJYA 1CD5A 2C2GA 5M34A 1YCGA 3D8NA 4BMZA 1M8GA 1MX1A 1GUAA 2NGRA 3L1JA 4GYJA 4OQFA 3THYB 3N9IA 4D3SA 2EV9A 2PGJA 5J2UB 2HL6A 3AV0B 5D84A 5EUBA 1PGJA 3WKAA 1N32B 4JYMA 3EASA 3OQOA 3K20A 4X24A 3ILSA 2HK6A 2QW8A 4J0JA 1A8HA 4Y6OA 5JAMA 3LJKA 2DEUA 3NOQA 2PMFA 2IPNA 4F6CA 4YMSA 1BROA 3F71A 1PDVA 5HDBB 1KRXA 1ZYUA 4Q02A 1UM8A 4J9UE 4FFRA 1M2GA 2PRKA 1A82A 1P4RA 4IINA 3MCWA 4MJ3A 3IPXA 1BDHA 3IDQA 3EWNA 1AF7A 2CLSA 4OI2A 1RCFA 2Z04A 1RWKA 3SYMA 3Q5GA 3V48A 1U8ZA 2ILVA 2NO6A 4EJ6A 1ECCA 1L3CA 3SJCA 3V7WA 5IFKA 2ZCVA 2CE7A 5JEEA 5ERXA 3LHKA 5CDFE 1FP2A 5CVTA 1QRRA 2B5OA 1SXGA 2JS7A 2V1UA 3FSGD 1JWLA 2WQ7A 1K5DA 1M2HA 3M6LA 1QMPA 1V9CA 3AUSA 2EERA 1TDJA 3MINB 4UZFA 4ZOBA 1KH1A 4Q1CA 4EVQA 1BSVA 3I5XA 2ZCJA 1FVXA 3HJAA 3OCXA 3P97A 4FDMA 1V2GA 2QLNA 1A3CA 3RC2A 3U62A 4KNVA 4MINA 3R7NA 3HU3A 5CDHA 4LRUA 3H2BA 4MQ6A 3BIJA 1RBYA 3PFGA 1CUXA 1VLZA 1Z25A 4MRVA 2E4XA 2V3WA 5ETJA 5FP0A 2CNOA 3HKBA 4P4NA 4Q7KA 5K2MA 1Z35A 1TZBA 3SYKA 4QELA 4JGGA 3UGKA 4CLHA 3OWOA 2MHCA 3AXSA 3FFTA 4O1IA 3NDBB 3KJIA 2X0IA 3OZXA 3PXAA 1LLFA 1XTZA 3D8HA 3KVYA 2JD2A 1OE0A 1E5VA 1T3TA 4GWKA 2AUMA 3EFOB 2CL6X 2A9JA 4EI2A 2C2KA 4MI3A 4A0SA 1FBTA 2GI4A 4MWBA 3VPDA 1H4VB 4DREA 4MDYA 5LXTB 4KWHA 3WA6A 1SOVA 1U6JA 1Y7LA 1SQGA 1Q0ZA 1B3RA 4MRSA 2ZRAA 4LCJA 4M9UA 4RHFA 2G88A 1PJ3A 3B6EA 4KXVA 4Y2SA 3PC8A 5CD1A 1RC1A 3K9FC 3CPJB 3WK7A 3TTSA 1XMJA 2WK1A 3LUPA 4XJTA 2XDAA 1NBWB 2ZRHA 3OFKA 3HWX1 1IZ0A 3SBOA 3VTAA 4F4UA 2ZTMA 3WNDA 1ZO8A 3AVPA 4XPZA 5EEGA 1T8UA 3NCHA 1VA5A 1CK4A 2JHFA 4UBJA 1S9HA 3G0HA 2VEDA 2REQB 1MABA 1NXOA 2PJDA 2XOKA 1US8A 2OT3B 3B60A 3FYCA 4D3FA 5F9FA 1UBUS 1JIJA 2OAQ1 3GUCA 4MQBA 4QASA 1X86B 2F8MA 4BZZA 3ZJTA 2J4CA 4G63A 5JSUA 2ZYTX 3N8HA 3QBEA 2B4AA 3LC2O 1L5VA 4A3SA 1YS1X 2QTZA 3MHPA 4GPTA 2ORIA 1E7MA 1N6HA 1I0ZA 4WCFB 3E2MA 3A3KA 1P4SA 2PXAA 2WFLA 3ABOB 3DW3X 1P9RA 2J9YB 1O77A 3BZUA 4PAOA 3DT6A 2DU8A 2RK4A 1GDDA 1T1GA 2I1VB 1DCFA 1Z06A 2Q5OA 2YHIB 5GZ6A 2F1KA 4KZPA 2QDXA 2VH1A 4OYLA 1EUCA 1A2QA 4TXNA 1Y3CE 2UV8A 4FN4A 3ER8A 2H52A 3SHFA 4V2IA 3MQ4A 3O9VA 1RFLA 4RK5A 2A94A 2A0WA 2CL7X 2MR6A 1Q19A 5EVCA 1A4IA 2GEVA 1PI3A 1XJ0A 4BB9A 4DDVA 1C9EA 3HDHA 4ZWNA 1HNXB 1T5LA 1FU8A 2PWZA 2QQEA 3CE6A 5CM2Z 4ZT4A 4I4CA 1Z74A 3X3HA 4A27A 4J1TC 2NUPA 1QGUA 4UTVA 4ZZ3A 2VJMB 3SQMA 1E6WA 4KL8S 4PGFA 2FWAA 3RU2A 4E1BA 1Q92A 1R0ZA 3DMNA 2OGSA 2WU1A 3FSEA 5J4VA 1ZD4A 1DBIA 4CTKA 5A7HA 1NQOA 4PGHA 3RF7A 1GILA 5EZ5A 3PJRA 1FNMA 4YJ2B 5LLTA 2QLJA 1G5FA 4URZR 2NU8B 4UATA 3V2HA 2QJTA 3Q9UA 2WV7A 2JH3A 4LQCA 4MYTA 4JI8B 5T8KA 2ZTUA 4L5YA 1WB5A 2B69A 1HC7A 5GJVC 1JEYB 2REQA 2AC4A 4D43A 1TF5A 2H9IA 3DTTA 3Q7TA 3EFBA 5B36A 1ABFA 1Q44A 1XHEA 4AY2A 4EY7A 1MJNA 2AFRA 3LY9A 4NCHA 3NDJA 5K8JB 3KQNA 1T3LA 3ZY6A 3VNVA 2CEAA 3R1IA 4ITVA 1KHTA 1WMAA 2OO5A 4GQBA 4QG3A 3SNKA 4GM0A 2VO1A 5EJ5A 1HDEA 4YC7A 5JOQA 5I9BA 1DEOA 2E4VA 4KEAA 2VKQA 1I01A 1W0KA 1CEXA 3S2IA 1Z6YA 4YWHA 1SU7A 4BB5A 4WZBA 2ZRMA 1KMIY 3A1CA 3NHBA 5EE9A 2RGXA 3CZRA 3PD0A 1BDJA 4G81A 1KEUA 3UQZA 4KE7A 1AB6A 1OYVA 2HB6A 3KPYA 5GJWC 3QK7A 1Y6RA 4UAGA 1DDOA 2ZIAA 3KR2A 3CURA 4WCFC 3ZH9B 1C2TA 1B16A 3ZWYA 2CVHA 1U3VA 4TWJA 4GGMX 3E1KA 3O2NA 3DO6A 2F8SA 3V4VB 5G0WA 3Q3CA 1QQ7A 4IDDA 2WUGA 1JNYA 4PZ0A 4Q9DA 1BU5A 1LFAA 3RK0A 1RLUA 3I45A 1B14A 1ZK0A 3WRXC 5DGDA 3WQQA 3HK2A 3LW7A 1PU2A 2UYGA 4PO3X 4YRDA 3D5QA 2BWJA 3VR5D 2G8NA 4EOGA 2Z30A 4HRVA 3V7NA 3K73O 1RSZA 3GFPA 4CKZA 2VKTA 1IZYA 2JGIA 4W8GA 1GZ3A 4HMPA 5DPMA 1USIA 3LYLA 1KJYA 4INAA 5ESDA 3N0VA 3A6GA 3TM5A 4EI8A 3WA7A 3MB8A 2XXAB 3QPWA 4U3JB 1ZNXA 2Q5QA 3QG5A 3KNZA 3RAGA 4O29A 5EERA 1A9SA 2KBEA 4WASA 2D54A 4DB2A 3BHIA 4F1KA 4XIIA 3DZKA 4RIHA 3UN1A 3OH8A 2H0AA 3ED1A 4RD0A 4ZREA 2HLPA 2ZYSA 3B6IA 3DNMA 3IBSA 5AHKA 1LKZA 2ZPAA 1U2GA 2PJZA 5D87A 1KDVA 3RJ5A 1KTIA 3I05A 2VZLA 4M1TA 5AH0A 4X0EA 2O4CA 5GONB 4F96A 4MJ7A 4MPDA 4IXNA 4Z4HA 2ZUSA 3HB5X 5E3HA 2XCRB 1TUBB 1M74A 3U7GA 3SAJA 4Y1RA 3EE6A 2ZI7A 4YIKA 5DZSA 1XLWA 3IOCA 4NHOA 2EP8A 4HNQA 4WZAE 2C2OA 1V35A 3O91A 4IFEA 3EGOA 4QFMA 4CQLA 2G63A 2RG7A 2P35A 3WMWA 5CGZA 4AROA 3FRJA 4A6PA 2WP8J 2EP7A 1Q7TA 2A7XA 3BIWA 3T5AA 1XTUA 1H1LB 1H3NA 3P96A 1E1KA 4IG9A 4MA4A 2J5QA 1ZW6A 2EL9A 3T3DA 5A7FA 4YPOA 3JD0A 4N6NA 5JCJD 4JJFA 3I64A 4FLFA 4QFDA 1I6WA 1L4HA 2CLLB 4B9EA 1UXHA 3FLMA 3ACBA 4B6FA 1WXFA 4UVHA 2ZTVA 4QOGA 1R37A 2BONA 4AF7A 2LR0A 1J0XO 3TLZA 3GJ7A 5EKSA 1X8LA 1BXZA 2QENA 2YJGA 4LNUB 4C0XA 4QL3A 5AVXA 1D6NA 1KMHA 2O59A 2W2TA 4CMKA 3UJ6A 1ZK4A 1ML3A 4PYIA 1NI5A 2NXNA 1JPVA 1U31A 3AF5A 3C8UA 3V8EA 3QLVC 4XGKA 4PNEA 3ML1A 1OA1A 4G5GA 2C4MA 3VVCA 2QSYA 2WJVA 1U4OA 5K0TA 1IRIA 3K9WA 1HM5A 1VLJA 3IPCA 2QRKA 3MXOA 10MHA 3TR0A 3S5JA 3INRA 4PX9A 2JFFA 2C7BA 1ICIA 3QELA 4FW9A 2ZJOA 3VMFA 4V0OA 1A77A 4BVKA 1N8NA 4TGLA 1NUSA 1ZJYA 2HREA 3AZOA 3AC0A 4HZUB 1WHSA 2H3EA 3NGLA 5ESWA 1I2MA 1NKTA 1GRNA 5TPWA 1XK6A 3W9BA 4WDQA 1RHJA 2AG8A 1YRHA 2V6IA 4DW8A 4KXQA 4ZT2A 3I01A 3T38A 2WRZA 3KVVA 1OLUA 1ZGHA 2HA6A 2P0EA 4QDTA 1EVQA 1YACA 1I1OA 3MT7A 1LX7A 2WAMA 2WG2A 1QLWA 2EARA 1YQTA 3IUYA 1PSWA 3Q12A 5GINE 2H4JA 4D3ZA 3UATA 5KWSA 3L43A 2PMKA 2QAIA 3P9PA 1YDFA 2R65A 4PFJA 2BGLA 3CR8A 3ZWPA 2EX4A 4BVAA 1Y3FE 4CJXA 4S04A 4P4LA 2VYND 3TECE 1A1SA 3RE1A 4PZ9A 4DR7B 1G5PA 5TMPA 3DXXA 1L8LA 4MP6A 1KDTA 1VJDA 4QXAA 1C9MA 4UEKA 5EIBD 2H8KA 2NYAA 4X9XA 5J2TB 2DHCA 1RRVA 1PZXA 2VUTA 2XDWA 3FM9A 4I55A 3ZU2A 1MX9A 2CWWA 3ELYA 3QEMB 5JNTA 2W0MA 2HV9A 4WY8A 4KREA 4MO2A 2X5OA 1L8AA 2IV3A 1N1GA 1WY5A 1BFUA 2XYHA 3CT4A 4FXPA 3WO0A 4CM1A 3GQBA 2EF1A 1HH4A 1FFDA 1NNUA 3R3VA 3ZDDA 3HHEA 2V6BA 2CUKA 1SQ0A 3C8ZA 4EL0A 4L72A 5HM8A 5JV5A 3M83A 2G25A 1R0XA 5JBQA 2PT7A 4PWZA 1HETA 4MUJA 4KXWA 5IG2A 4BMVA 1XCPA 1A04A 5SZIA 4TUYF 1LK0A 3CCFA 1LDYA 1AUVA 4OJMX 5KYVA 1O94D 3DFUA 4PPNA 2WKRA 3AP2A 1V5EA 1FW8A 1G19A 1WF3A 3C41J 2RAVA 3QGMA 2B7LA 3O84A 4B7ZA 4TS4A 2A9OA 2AOUA 3MTGA 1O8CA 3FWKA 2ONZA 3R40A 3RVOA 2O8EA 3VO2A 3MBIA 5DNWA 3TX6A 3VKHA 1GCOA 2QN9A 4JJZA 1GU0A 3HWSA 1MA3A 1QH9A 1RXYA 1AKVA 1UWKA 2D06A 2FSPA 5KVSA 5L3QB 1PLJA 4PF1A 4WADA 1KMCA 4CIYA 2J9FA 4EKYA 4RPGA 2JC3A 5JAIA 2IWHA 4RIGA 5EQJB 1RRPA 4LBZA 3TOZA 3ZHRA 2XX3A 3B1VA 1JPUA 3L0BA 4I14A 2LVBA 1OUMA 3RC9A 3NKLA 4OHUA 3WGZA 3H8SA 3JVEA 3KXDA 3GP3A 1A4XA 4FIDA 4YCAA 4QHYA 5F64A 3QUSA 4N76A 2VHQA 3BD8A 3DBRB 4UXHA 3ZHXA 3QMWA 3O3CA 5ALYA 2O8DB 1SEVA 3WWDA 1Z0AA 3AVXA 2BTQB 2RIRA 3A1DA 3NR2A 3AW8A 4ZD6A 2CJFA 4NICA 1E7QA 2P5TB 4N65A 4RDCA 4TV8B 2NYUA 3W1WA 5GOZA 4Q6BA 1S8OA 3KPUA 4I55B 3R0ZA 1VHJA 4IEEA 1C1XA 2J31A 4EW1A 1I7LA 2FJUA 3OSZA 1HDRA 1EZ1A 2PZEA 5EIFA 3QKWA 1RQPA 2PG3A 3ROEA 2WUFA 4OATA 1MTOA 3A9SA 3AVOA 2FQWA 5BQ5A 1EJ0A 2BR3A 2GPBA 3SC2B 4BLQA 3IOMA 1KZ1A 2JBWA 3PHBE 3TS1A 5D5HA 2QGNA 2AD1A 2ZU0C 4ZYTA 2G06A 1UBSB 3HLTA 2M6SA 3O8CA 3TLGA 3WC4A 3JWGA 2SNIE 2CB0A 2VDNB 2ZIUB 3I09A 4UU8A 1WLYA 1QU2A 1C9NA 1Y42X 3PX2A 4JUBA 2YJ4A 4MTLA 4NY1A 3RV4A 3U4AA 1RCTE 3Q3IA 4H9GA 3V5NA 4M3NA 3LT2A 3AEKB 5DVZA 3TXAA 1P6QA 4ERXA 2GMWA 3H5IA 1IMOA 3GC6A 1NWHA 3G1UA 4BJHB 1S7CA 5IBPA 1U7UA 3UKDA 2PQ2A 4RQUA 1PZMA 2R2AA 1ZIPA 3IR7A 1N34B 1TX4B 4B34A 2XKKA 3COWA 2WHQA 2RH8A 2HQRA 1GQQA 1SKUA 4BO9A 4IDOA 4M2LA 4J2TA 3GRFA 2WOJA 4KK4A 4L50A 2OZLA 3Q2IA 1ORWA 3LBNA 3D3JA 3K31A 4L5CA 4OUDB 3DWFA 4CZ2A 5LZ2A 3LK6A 1XEAA 4QFCA 1F8GA 4Q24A 5FBRB 3FCXA 5A6SB 5JS1A 4P7KA 4QBIA 1R27A 4HDKB 1UINA 2QN3A 1K1EA 1U5CA 2Y1FA 4FJ0A 4DCPA 1XDZA 3OT4A 4TUYB 4WAUA 1E1YA 5ALRA 1H93A 1NLFA 2R1VA 2OA0A 4DDWA 5JXWA 5LQCA 1FNNA 4OM8A 4ZTZB 5KOIA 1ACMA 1AIPA 3R0JA 4TKLA 4O4HB 2VHTA 4N0EA 4E46A 3CG4A 3GFTA 2O2GA 1FMJA 1V7CA 3Q3JB 3R3WA 3F7MA 1R8SA 2PBFA 4ND3A 4QGFA 4KPUA 4RH3A 5DBHX 4JXZA 3M9WA 5K0LA 3MGGA 4AG3A 4C7KA 3R4VA 1NQUA 3EZXA 3PENA 3QF4B 2B34A 1T8RA 3RR2A 3U7RA 3TTUA 5EXEA 1USGA 4P92A 5CB8A 3OFNA 3IR5A 2HCRA 3VZPA 3EGVA 4HKTA 1MTZA 1LDEA 4RF5A 1L5YA 5A71A 3RAJA 5FWYA 4Z99A 3RAFC 4KODA 4B74A 1EFAA 3PEFA 2XYQA 4A2CA 3FLAA 3OTIA 1T2VA 5DEIA 3FN4A 2OBNA 1W8DA 3E27A 2EFEB 2ZR9A 4FHZA 5AHRA 5EC8A 4BGIA 4E7OA 4FB5A 1B76A 3R9IA 1IMJA 1IN7A 2PGXA 3L8GA 4PLZA 2OCAA 2NUBA 2ONKA 2UZ1A 2VYFA 3PYXA 1LLUA 3QXXA 1YTLA 3VSEA 4IXWA 4CM8B 3CEAA 4EX6A 5LP6A 3A37A 5F2OA 1HPLA 1Z6XA 4R8KA 3RS0A 5M2QA 1QZXA 1EZZA 2VK2A 1JR3E 1OVMA 1E2JA 3FBGA 3ID6C 1DIAA 1WV0A 2GFHA 5LA6F 3VO1A 2NVOA 4BTLA 2OMKA 3AF3A 4MB2A 4JBIA 5DM1A 2P69A 1BG6A 1JSXA 4Z7OB 4ARVA 5KI6A 1M33A 5JDCA 3VPSA 3T0FA 3OAAD 3RREA 2RBEA 3OQHA 2IIQA 1Z28A 1I4EB 1LK7A 1OXXK 2CHEA 3BTOA 3GVXA 1G7TA 3AXTA 4HLUA 4R4JA 3W5IA 5EWLB 3FVTA 3I34X 1DT3A 3PC3A 1VBMA 2J3HA 4KIFA 4RTKA 4C5CA 1Z5UA 3QUTA 4I6GA 1BS9A 4RNCA 4E13A 1QCYA 1UDWA 3K6SA 2DSNA 1UPUA 2OV6A 4A8JA 2J3MA 1XROA 3OCZA 5CPFA 4IVNA 2NU9B 1IWPB 1GCUA 4YQEA 2X8AA 2F4NA 2VNIA 4AWAA 4K6CA 3SS7X 1JLHA 4LXIA 1RYZA 3RBXA 5FJJA 1L5HA 4H6XA 4PSAA 1N0VC 1MQAA 3L8FA 3S8YA 2AV6A 3SR0A 4QXQA 4Z9BA 1JWBB 2Z1MA 4DV6B 5DHUA 1JG7A 1JQLB 3FTPA 1VI5A 4BLVA 4YT5A 1ZWLA 4XRGA 3OZUA 4KQWA 5BY2A 2WWFA 2O1SA 1DOHA 1YB2A 2C5GA 5SYAA 4BJ1A 5CG2A 4DUYB 3HZZA 3FPFA 4RXMA 1PJ2A 2YHBA 4KE9A 3OIUA 4HX2A 5ALTA 3H6HA 3DLIA 2B36A 2I2AA 1HQCA 3HB4X 4S05A 2BBOA 3KD2A 3TW8A 5LMUB 2Y76A 4N1AA 4ALMA 5AW1A 1NVVQ 1V11A 5AUPB 2X6QA 2OBXA 2YBDA 1WCXA 1JHYA 4X8LA 2ZSBA 5K99A 1HFEL 4F1JA 4E31A 2ZZKA 4NZPA 5DULA 3BA1A 3VYVA 5AFSA 4UPDA 4BNXA 5LQJA 2FVYA 3ICCA 2I6TA 2EYUA 1TJNA 3IV6A 2VWHA 3WJ7A 5JY1A 3LUGA 1J23A 3N7TA 2RE8A 5FUVA 2PPLA 3WK8A 4LWQA 3LQQA 4RX1A 4OU5A 1GEGA 4RESA 4Q9HA 5G3ZA 4N03A 3TZKA 3CLUD 1SR8A 3WAKA 4BNHA 2TECE 4IEFB 1Y48E 3IMKA 4N41A 1OILA 5GGYA 1P9WA 4QXRA 1SXJB 3HXTA 1V25A 1RBMA 2PIDA 5EUCA 4RHXA 2KYRA 3M33A 5DM2A 2NUTB 4GXQA 3ZOKA 4TXJA 1P5ZB 1W75A 2PX0A 2ZE5A 1I0IA 3THXB 4IJUA 2QAGB 2CV0A 1IJKA 1SA0B 4A6DA 3X1XA 3TRKA 3ROMA 3HXOA 4WX2B 1HNNA 1UADA 2AHOA 3DEAA 3GLHB 2OYSA 2ZJ1A 3H18A 1P0PA 3OO1A 4XDZA 3KXPA 4G41A 1G4AE 1KR2A 2BP7B 3I73A 4CQMA 2B1JA 3EXAA 1AN9A 3JATA 1QHFA 1R8JA 3D4BA 1J56A 1PJBA 2KX7A 4AAYA 4PZEA 1P9LA 1E1QD 3UTDA 2J3KA 1C2YA 3H5WA 1U9CA 1HFWA 4R6XA 4Y1FA 4DEXA 4DSAA 3DLBA 4BY9E 2ZUEA 2H11A 4G8BA 1QH8A 4P4SB 5DGXA 2DB3A 3BJZA 3CPHA 2A9RA 4X3CA 3I2IA 4WZBB 4CKBA 3HDQA 4Q21A 4NAVA 3MUNA 2Y1XA 5I7HA 4LC9A 2CLEB 4IZIA 2A58A 4DLBA 1TAHA 5C0OE 2OHIA 5CK5A 1IHXA 2Z09A 1P45A 2XUJA 3QKSB 3QWHA 1KOLA 3B1YA 4J6FA 2RHTA 4G0OA 1QH0A 5LZ8A 4ECEA 5IVIA 3ZBPA 4KQGA 1ZICA 4NBKA 3CRNA 1RPTA 5D8DA 4IDEA 3UT5A 2QZ9A 4CBVA 3IEPA 2OHHA 2YTZA 2OO3A 2Y1OA 3L9WA 2NUPB 3WLIA 2H54A 5AJWA 1FSPA 2ZRLA 5A3QA 1VBNA 2I4IA 4WBNF 4P36A 1KARA 4DDMA 4X1YB 3GZNA 3OQJA 4NE2A 2HJWA 5KSYA 1N6LA 4BLTA 1U1FA 3F9IA 5G0UA 2NU7A 4FEYA 2VATA 2ZUWA 2J3IA 1NQAO 4US0R 2OFFA 1K92A 2VOEA 5AM0A 1D0VA 5BW5A 1KP3A 4GYKA 2FLKA 2R11A 2XA2A 3DONA 5AM1A 1DC5A 2GKGA 1PFQA 4ZOAA 2V6GA 2GM4A 2IF2A 3RD5A 1C81A 1T5TA 4DG8A 3MCVA 1H9BA 5KNDH 5EMHA 3PHCA 2VJAA 3L2OB 4JI4B 3VHLB 2P68A 2ZLBA 3QPBA 3PC7A 1UUFA 5FL7D 4E51A 4WXRA 4CNQA 5JASA 3JTEA 2CKDA 4F3TA 5BURA 1NQXA 1QIGA 3B51X 3FPBA 5EGNA 1D8AA 2OFOA 1WULS 3IFSA 3AKDA 3L5KA 3Q7EA 4LFAB 2P9TA 1PP4A 3HKDB 1GZUA 4HR7A 1TGYA 1OTXA 2ECFA 2OZKA 4M9CA 4H31A 4L0DA 1H9CA 3E2PA 1NY5A 1YT5A 3ZQ4A 4CMHA 3GYBA 4RV4A 5CVEA 2XRFA 3BMQB 4NH0A 2FPGB 1DZ3A 4EHDA 4LW8A 3WJ2A 1Q3KA 4ZOQI 3GFFA 3EMDA 1CY1A 4RCVA 4BVLA 2YV2A 2QI9F 3DUFA 1MHTA 2AFVA 2R8RA 2WZDA 4A03A 3AG6A 8ADHA 3VH1A 1YQWA 3AIIA 5KKAA 5B64A 1ZOOA 2VRNA 2HRZA 3U5TA 3SJ7A 3IO5A 3LW8A 4I81A 4RA9A 2BFDB 5JSKA 1THGA 1C8LA 1FX0A 1GPKA 3WWYA 1QQTA 4B3BA 3R7WB 1XYGA 3RK1A 3I4LA 3KJNA 1XZDA 4UPVA 2JG3A 5A7GA 4W7HA 4IOKA 1JG2A 4LDNA 4R2JA 2JJ1A 2XJ4A 3FOAA 1K6MA 5EMJA 2VYVA 1ZBDA 1O95D 2I55A 4ETNA 2Q7XA 4EUNA 1T9AA 3TLXA 1RP1A 1U4NA 1UK7A 2WJIA 4J1QA 4PGGA 3TL2A 2QG9A 4E2FA 4QDJA 3MK31 3CVOA 4KMRA 1KO5A 1NLUA 3EVGA 3G9QA 4XPIB 1Z8DA 5K1ZA 1YJAA 3NBFA 4OHMA 1L1QA 5FLKA 4L07A 3T7CA 3PUHA 4PE5B 2PNFA 4M4SA 4W5TA 2I1WA 5K0FA 3P9SA 3EIFA 1FYWA 3NHRA 2O5EA 2WC1A 4M49A 4N7MA 4CETA 1VE5A 2O2DA 3EG9A 4YMLA 5K6AA 5F3WB 4AB1A 3LM8A 4NZZA 1ZI8A 2CNKA 1UAGA 3HP4A 1XDBA 4UHEA 1F3LA 4N54A 5IDQA 4EEZA 1GZ4A 2DLNA 3QEOA 4NNPA 1TYBE 3WRXA 4MVJE 3PEWA 4MIYA 1XVVA 3TTVA 2PR2A 3L1IA 4E5NA 4Z53A 3A31A 3DT8A 1XZGA 2ZAGA 4QQRA 3HXPA 3QBJA 2B7CA 2IU6A 5LP1A 1YQXA 4CCYA 1E0KA 5F1YA 1L1EA 2P3OA 1JHAA 2WOOA 1KOGA 3VBCA 1P4JA 2Y9PB 4LECA 1CEEA 4JKYA 1PNRA 5KQMA 3TSZA 2VNSA 2OQVA 3F3MA 3RVJA 1ECLA 4EH1A 5JD3A 4W5NA 3N59A 1T3SA 3IC5A 2EZ8A 1E2PA 3H2SA 1E1MA 2XAAA 1KEVA 1RPNA 2YHSA 2HXGA 4PXAA 2B5WA 1L7AA 1SUSA 3G13A 3IQZA 4IIHA 4EB6A 1OA0A 1XRSB 2NN3C 3M2TA 3IILA 1II0A 2QBYB 3KOZA 3M81A 4KK3A 1XNJA 4O6VA 5JI2E 3HYNA 1Q3TA 2HRQA 2QLBA 3D4LA 1SU8A 4FMBB 1C3JA 5CT4A 1KE2A 1E0DA 4Y6PA 1L4YA 1ZGCA 4QWWA 2K2WA 5EJIA 5F9MA 3SM3A 2MIIA 4BZQA 2GJKA 3AX6A 3G8CA 2QVYX 3SEZA 3BDVA 4XGNA 2G72A 3ITKA 2YOHA 2UYCA 3FA2A 3H99A 4E5VA 1PO7A 1TYEB 4LJ4A 3UHOA 2C94A 3QVWA 1XYVA 2O2XA 2O2CA 4UAUA 4WOJA 4N12A 4YALA 3TLMA 4ZVMA 1ODTC 3KOXA 4KQCA 1ZSVA 1GADO 4A5SA 4JVOA 2WTBA 3K1JA 4JR1A 2IVFA 4YACA 2OKGA 3SX2A 1S9DA 4YGYA 2YZKA 1JA0A 3BICA 3G5TA 2C83A 3JD4A 1X1DA 3F97A 4I9UA 2ST1A 2O0MA 4KP7A 5IU6A 3PQFA 5B1IA 4HLUC 3PTAA 3HS3A 1DBWA 2CVPA 4GKBA 3AUJB 4HEJA 4S12A 4D3DA 1MBZA 3GMDA 4C6TA 3KFXA 4WBXC 5YASA 3HP7A 4YUAA 4QDKA 3J7AC 4NBLA 1EP1B 3C3WA 1RJFA