3UIEA

Crystal structure of adenosine 5'-phosphosulfate kinase from arabidopsis thaliana in complex with amppnp and aps
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
191
Chain Sequence
CSVEKVDRQRLLDQKGCVIWVTGLSGSGKSTLACALNQMLYQKGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLLPEGDFVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis and evolution of redox regulation in plant adenosine-5'-phosphosulfate kinase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase/transferase inhibitor
molecule keywords Adenylyl-sulfate kinase 1, chloroplastic
total genus 80
structure length 191
sequence length 191
chains with identical sequence B, C
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uieA00
3D3QA 3VNVA 3JZAA 2QI9C 2H57A 1B0UA 2FJUA 2ANBA 2QPTA 3TQFA 4A1FA 3DPUA 1TU4A 4FCVA 2KE5A 2CNWA 3C5HA 1LFDB 5G40A 3OEHD 2ZRIA 1SXJD 5EUMA 4A2PA 3K70C 4HLCA 1R0XA 2C99A 2O0HA 3QENA 4GPTA 3LBNA 3G0HA 4TWZA 1G5RA 1X8JA 5HKKA 1E6CA 5EZ5A 1W5SA 2Q3FA 4RD6A 2BMEA 4I4LA 2YOGA 1QHXA 2HXYA 3UK6A 4GP7A 5FPKA 3SJCA 3FHCB 3EIEA 3KJIA 5EZ6B 3Q3JB 4D0GA 2WIBA 2QT0A 2H92A 3QBTA 4FCWA 5EE1A 5J4KA 3VFDA 1GNQA 3FKSD 2JLYA 3WXMA 2NQ2C 2RGEA 3D8BA 4A9AA 2IT1A 1EG7A 4Q4HA 2E87A 3EWAA 5B30A 5HR5A 1KJZA 3B5JA 1GAJA 2QTHA 4LHWA 4ILEA 2V3CC 2VHCA 4LHZA 4OHZA 3PEWA 3H84A 1JXOA 1ZMXA 2HJVA 1GM5A 1W36C 4CEIB 4JLOA 1CP2A 3HYRA 3LO5A 4HAYA 5FL7D 5KDDA 1TTTA 4IVRA 4KBGA 4IDQA 1Z0JA 1DG1G 1O3YA 1YVDA 2JATA 3CR7A 1NBMA 4LHVA 2QP4A 1S1CA 1AS3A 1KMHA 1RFLA 1U94A 2OBMA 4JYCA 4DT1B 2REBA 3QPUA 3KTAA 2V8OA 4QOSA 1IONA 1NVXQ 2B7BA 4MRVA 4EFNA 3K1JA 1Q1ZA 3TAUA 4G5OA 1HV8A 3PUXA 4IOJA 1IJEA 4GSYA 3EIQA 5CJ2A 721PA 4RZ3A 2Z4SA 4XWOA 2ZJOA 3FMIA 4CYMA 1G9XA 1E99A 4KFTA 2QEQA 4MKFA 2GEVA 2VEDA 1ZYUA 2QM7A 4Q7KA 4ZV4A 4U00A 4B2IA 2Q0HA 3IHWA 3VKGA 1ZM2A 1FNNA 2F43A 2HF8A 1MO6A 4NCHA 5LD2B 3AM1A 4RFVA 3NIBA 1JBKA 1X1SA 3N5CA 3RDPA 1ZD8A 5EE5B 4LBVA 3GCGA 5D3MA 4P4UA 3K09A 4QGGA 2C9YA 2EVWX 4CT5A 2NPFA 1P72A 4HYYA 1GFIA 4XH9B 1ZM9A 1H8EA 1KDRA 3RS0A 2QA5A 2GRJA 2GXAA 4PZLA 3NHAA 4PFSA 1N6RA 3GJXC 4AKHA 4LJAA 3KQNA 2QP3A 4AC9A 1UFQA 4HZIA 2FPLA 4LJ7A 1T0HB 1XEWX 3CH4B 1VYTA 1ZC3A 3LVRE 4QJ5A 5TV2A 4D2IA 4W5HA 1ZM7A 2XITA 3SBDA 2YNMA 3A1TA 3GJ5A 2ZE8A 5FR1A 4BFTA 4OK5A 1KO8A 4DLSA 2VP4A 1OW3B 1U9IA 2D62A 1QVRA 4E22A 3GEEA 2F55A 4Q9HA 1EFRD 3R8CA 4U5XA 2W58A 1IXSB 2O0JA 1II9A 1KI2A 2KJQA 1JQLB 2CL0X 2QSZA 3V9PA 3TSWA 2C2HA 1GIAA 1G21E 1I4DD 3KFVA 4M1TA 2F7SA 1OF1A 3ZH9B 4EPVA 3QG1A 1NJGA 3DEFA 3ZVMA 1W0KD 4GNKA 1D9XA 5L3RA 5DHFA 4TLDA 2A5FA 5BN3A 3LXXA 3ZDQA 2ATVA 5JI3E 5JS7A 3RRZA 1QF9A 1FX0B 2V4ZA 1ZC4A 1KNQA 2R6DA 3CX6A 1P7CA 2XTNA 5G3YA 1JPJA 4UXJA 1E2LA 4L15A 1VTKA 4MITA 4B74A 2YWFA 3U3KA 4XTCS 4EIWA 4TYPA 2G9NA 2XNSA 5FBWB 1QHSA 3PG5A 5JEEA 5K8UA 2XZPA 1YZTA 3CH5A 1YZGA 4XTRA 1DE0A 1JAIA 4A8JC 1Z0AA 4Q19A 1XTKA 1SXJE 1T0JB 2VPPA 1FNMA 3SHWA 1BMFD 5DN6D 1G3QA 3FB4A 1K6MA 2GK7A 1COWA 4MH0R 221PA 5F9FA 2WWGA 1NG1A 1GNRA 4JJKA 4TLCA 5GJBA 1AA9A 2Q9AA 5JBQA 5FOTA 3KJHA 1A5TA 4UXIA 1Z0KA 2UZIR 3AUYA 3QXSA 4ZKDA 2HT6A 4Q5IA 4JLJA 4TYWA 3ASYA 1G7TA 2QRNA 3TSZA 4FWIB 5E7IA 2P2LA 2FDCA 1T9HA 2I1QA 2NGRA 4GI7A 1QDEA 3VR1A 3OEHA 3FKSA 4Z8YA 1NBME 1W36D 3TBKA 4WOPA 3AVTA 2VLIA 2JLWA 4B47A 1AKEA 3CPEA 2DPXA 4KFRA 2CVHA 2JIZD 1OSNA 4X8OA 1UDWA 3VHLB 3QKSB 2D06A 2BV3A 4KXFB 1R5BA 3PIRA 1N5KA 2HV8A 2ZREA 4V0NA 2CJWA 4PQRA 2YC4C 4D82A 3BS4A 1R8QA 1C1YA 1VYVA 3LA6A 2WZQA 2WMOB 3A1VA 1J7KA 3SJZA 3E5HA 4HATA 4G0NA 5G53C 1SVIA 2E9SA 2P65A 2RAPA 2ZYUX 4KCGA 2FNAA 3L0OA 3R7WA 3SQWA 2F43B 1AK2A 3K8YA 3SNHA 5CIWA 4S2EA 4IKEA 1KY2A 2B7CA 4C0SA 2R6GA 2AX4A 5KSPA 1NMXA 3DO6A 4IHQA 1Z63A 2H8KA 4KLZA 3U3RA 1TF7A 1LW7A 1PV4A 5J40A 3U7EB 4LK2A 4AYXA 2KI5A 2BHRA 4NP6A 3ASZA 4F4JA 3HPQA 3TNFA 1ZUNB 3JZMA 3RVBA 3B13B 2XTZA 3JVUA 1TUEA 1P2TA 4PQYA 5E95A 5FTKA 3NXSA 1CRQA 2HXSA 3ZVNA 1KO5A 4QHTA 4IRUB 4ZI3A 3PITA 5JWOA 4R7ZA 2ZPTX 4JL8A 1KSFX 4NYIQ 2LKCA 4UKDA 4DT1A 2AR7A 2KBEA 4M1OA 2XXAA 1YE8A 1SKYB 2PZFA 4Z8XA 3QF4B 2HYIC 3O8CA 3GFTA 5JEDA 1E1QA 2QBYB 3I62A 2MSEB 1M74A 2V9PA 5B57C 1ZBDA 2ZAMA 3DL0A 3FHOA 2FEMA 3NKVA 3VHXA 3CNNA 4B33A 2RGDA 1R4AA 1F2TB 1XXHA 4NCJA 2G6BA 4KODA 2YKGA 2IS1A 4TQ9A 2BJWA 2GKSA 4PO1A 3NEJA 3F5FA 3C4JA 2OLKA 2QAJA 1KAGA 1EFHA 2XB4A 4HUTA 4QG7A 2OT3B 1NNEA 1P61B 3ZD7A 1NN0A 5JMTA 1KSHA 1XPRA 1OT3A 3DKVA 2NOAA 4LV5B 3WBKA 5H8WA 2IS6A 4BWYA 3B2EA 2VQSA 3NVAA 2DCUA 3U7HB 4QL3A 1MOZA 2HF9A 3WHKA 4R2IA 1A82A 4AG5A 3TRFA 2W6JD 2V55B 4NZYA 1EFRA 1DS6A 4JVLA 2EYQA 1NBMD 4CF7A 4MRRA 2PMKA 3EZ7A 1UPTA 3GFPA 4KFUA 2ZE5A 4QBFA 4IFBA 2DFNA 2GHIA 2JA1A 3O8BA 3QUSA 1HUQA 4O2RA 4TMTA 5BN5A 1KI4A 2NTYC 2OEPA 3IUYA 4EJSB 4LV8B 3OIVA 5FUVA 4YXWA 1S9DA 1V5WA 4H1VA 1JQJC 2QENA 1P73A 2WSMA 3M0EA 4MDFA 2GVDC 1AZSC 1GG2A 3FVQA 2CCGA 4EPWA 3AKEA 3AVQA 1E94E 1E79D 3QXHA 3QXXA 3FOZA 5IF9A 1HT2E 1OXXK 1NIPA 4TN1A 1OLOA 2C03A 2REOA 4W5WA 4RKEA 2RCNA 4X8HA 5E7MA 2ZEJA 1YRAA 1VPLA 1W47A 2C9CA 5DI3A 1L8QA 4L9SA 1GSIA 1G64A 4TSFA 5E4FA 3ZIAA 3HU3A 5KTYA 3QXJA 1PUIA 2Y8EA 1Q12A 2WJHA 3D7MA 5EP3A 2V1UA 4F93B 1R5OA 1R0YA 1M6NA 1NN3A 2HCJB 3P26A 2BJVA 3REFA 2ZS9A 2ZJ5A 1BYUA 1DAMA 4R2HA 2JLZA 2O8BA 5HZKA 1IAQA 2V7QD 4FWTA 1S3GA 4NCNA 3CM0A 1UKYA 3RHFA 4Z1MA 2VBCA 4JL6A 4OL0A 4HLQB 4LYAA 2BWJA 5G3ZA 3VMFA 4V03A 1QHIA 1Y63A 3LXRA 5KU1A 2FFAA 4PC7A 1NN5A 5FI0B 3TE6A 2GNOA 5L3QB 2ZRFA 2IX3A 2ZVQX 2PT5A 5FR2A 4DLZA 1DAHA 1XX6A 4BFXA 1RYHA 3Q72A 3MJRA 3N2IA 3B1ZA 3M6AA 1V43A 4TL8A 1CIPA 5GJCA 4V0KA 2AK3A 5AUOB 3FGNA 3U5ZB 4P31A 4G5QA 2ERXA 4KU4A 4KITB 4IXMA 1KI3A 2UVQA 3NC1C 2ZYTX 4QHSA 3NBZC 3AVOA 2FV8A 1GRQA 1NJFA 1SKQA 4JIMA 3A8TA 1E32A 5LD2C 1E9EA 2ZJAA 2JJ2D 3MLEA 1RW4A 3LNCA 1AZTA 3A4LA 3DZ8A 4B3GA 2ZVPX 2IEZA 3AF0A 3SN6A 3AKYA 2WKRA 1W7AA 4BFUA 2ORIA 1DG3A 5FOUA 5HKKD 2IHBA 1HTWA 1RRPA 4UNNA 1DAFA 1P9RA 2JASA 5FL3A 4P4SB 2QY9A 3NBFA 4Q21A 3LW8A 3K0AA 3IIJA 4US0R 4PANA 2J5XA 2ZROA 3QBVA 1HEIA 2GJKA 4U02A 4EAQA 4Z51A 1KMQA 2RGBA 2DR3A 3I5YA 2QG6A 1LTQA 3PV0A 3AVWA 1G8FA 2G88A 1DADA 4K46A 4LJ5A 2H16A 1FUUA 3HR8A 5M04A 4LY6A 5FBQB 3C7KA 2FN4A 1GRRA 3ADKA 1IM2A 4KV9A 2OCYC 2FFHA 1Q20A 4I81A 3SOPA 3K0AB 2PCLA 2NO1A 5UKDA 3B1XA 3DZDA 4OI2A 1VG0B 2BCJQ 4Q01A 4AI6A 3MFYA 1PJRA 3VAAA 4ZCIA 4TYQA 4HLUA 5KHOC 1TQ4A 4CVNA 3AF2A 1Z6AA 3AVYA 4CRWB 1DELA 4DB2A 5CDFE 1UBGA 1OHHA 2WJYA 4RD4A 2Q6TA 1NMYA 5CLLA 1L2TA 5DO9A 3CRRA 1PLLA 1KJWA 3QPWA 3W6NA 3EPLA 1E96A 3ADDA 3P4YA 1AKYA 2ZRAA 4WZBE 421PA 2OLJA 2CHGA 4QBHA 4MGIR 1OH5A 1F5NA 3R9WA 3EZ9A 4XJXA 3EPKA 4OYHA 4JS0A 3THYA 3ZVLA 2JJ1D 3Q85A 2IYWA 2VF7A 4F91B 3AVUA 4ACBA 2A5DA 2IUSA 1E2JA 2V1XA 1E2HA 2F1JA 2YINC 1F48A 3H4MA 3QKSA 1RJ9B 1US8B 2BCGY 4MYUA 3T1QA 3MD0A 1ZUHA 4NYMQ 4C7OA 2QAGA 2ZJZA 1WBDA 2LKDA 3T1VA 3T34A 3BH7A 3U3JA 3U7GA 5HE9A 2R8RA 5KYKA 1KK3A 3RRNA 4HB3A 3FMOB 4N0EA 1S1MA 2OG2A 4O2LA 4BE7B 3CWZA 2ODNA 1P9NA 2V7QA 3IDQA 3SC3A 1CULC 1PLJA 2W2XA 4TZ6A 3VX4A 2KBFA 4OHXA 4JLBA 3U61B 1MABB 3TLXA 4BPBA 1XJCA 1IY1A 2OCBA 3UMFA 1W49A 1G7RA 3K9NA 2GVZC 5DI3B 2DYKA 4M21A 2P6NA 2ZRMA 2IS2A 3RS4A 2J7PA 1NF3A 2OBLA 4Q9KA 4CDGA 2B8TA 2OUKA 1KAOA 3AF3A 2IXFA 2QMEA 1UKEA 2F6RA 2JLSA 2N42A 3K0FA 5B64A 3IBYA 4Q18A 4P33A 1X86B 1RVDA 4F38A 2I4IA 2A2ZA 4LYHA 4X8MA 5BYJA 4HI0E 1NMZA 3V00A 5AUNB 2OAQ1 3KKMA 4TTRA 1G7CA 4LJ6A 2ZSDA 5AJZA 4C9BA 4ASUA 1CS4C 2D74A 2EWWA 4OI0A 2FZ4A 4OKSA 3PUWA 3TSOA 1L4UA 3U3OA 5TXGA 3OAAD 1GKUB 2OAP1 3EA5A 2EYUA 3D31A 1KO1A 4A0FA 1J90A 1U2RA 3SYNA 3T5DA 4Q9JA 1X8LA 3LX5A 2Q9CA 4ABYA 3M1IA 4B76A 5JJKA 2IC5A 3U7FB 2EFHB 2AWOA 3A58B 3CO5A 4LPKA 3U4QA 3WHLA 3LV8A 3UMSA 4DCUA 4XD7D 2WAXA 4PPQA 1HT1E 1E0AA 2ZSEA 2W6ID 4NYJQ 4A0RA 3RS2A 3H1TA 2AK2A 4NCKA 5H70A 3LW7A 1G8YA 1JECA 3T35A 5DH9A 1RYFA 4FMCF 4C0LA 4Q7JB 1KJYA 3QI2A 3U3MA 3PFIA 3IQXA 3BFXA 4LJYA 2RB4A 3HYTA 5G41A 4CEJA 1VIYA 2C96A 3AF1A 2WWIA 4DSNA 5JECA 1TPZA 2R6AA 3BH0A 4Q48A 5JZVA 1BH2A 2GBLA 4LHXA 5DLQC 5ELXA 4C0AC 5JSZB 2ZR9A 4NH0A 3A6PC 1XNJA 3WRXC 1G6HA 1SHZA 1T5IA 4CZ2A 2AKAB 2JAQA 4NYIR 2HDNB 4FIDA 5FUWA 3T5GA 1D9ZA 3X1ZA 5KO2A 2GZHA 4V0MA 1N6LA 1XWIA 1MR3F 3AEZA 4LC1A 4EPYA 4I99A 4YMUA 2J0SA 2C04A 4HAVA 4ZDWA 3THXA 1JEDA 3GFOA 4DLWA 1NKSA 1FUKA 3L82B 2P0EA 5H68A 1I2MA 4LBYA 4AD8A 4ZPXA 3HP1A 1AS2A 4FN5A 3QVVA 1F2UB 1G19A 2P67A 2KSQA 1VECA 1BO6A 3GLIE 4JJZA 2XSZA 1KI6B 2A7QA 4LCBA 2PX3A 1KDTA 4P32A 2PH1A 2J0VA 4EPRA 5A4JA 1N6OA 4II7A 1IHUA 1U99A 2H7VA 4FD2A 1P5ZB 1NVVR 5JHGB 2NZ8A 5IK2A 1CF4A 4G1UC 1E0JA 4GMXA 5GVSA 5SZJA 2AN9A 3RRMA 4C0QC 3CONA 1VYUA 3RANA 4OJKA 1ZVQA 2ZR7A 2W83A 4Q9IA 5L3QA 1GL6A 2JIZA 4G5SA 4V0ME 1ZNWA 1G4UR 1G3MA 1D2MA 5IK2D 3OE7D 2N46A 2PX0A 1FMLA 3WNCA 3PR1A 4M1WA 1R0WA 3GP8A 3K53A 2GJ9A 4HZUB 4JT2A 2ZJYA 3ZD6A 2YC2C 4Q9LA 4YLGA 3R9IA 1KYIA 4LUCA 1E2MA 4DKXA 4BZPA 2FGJA 3CUEF 2GJAA 1XTIA 3KQKA 2GEDA 1OFTA 4R71A 5SZHB 1KHTA 3IPXA 4RFSA 5JI2E 3WNBA 1UEIA 1MKYA 3EPHA 2IYRA 3T61A 4WIAA 4PHFA 3DVLA 3WRYC 3KKNA 2ODBA 3VU9B 3EZ2A 1R2QA 3P20A 3TW8B 4ZDKA 2EFGA 3I8SA 1XPUA 1ZM4A 1S8FA 5HZHA 3OE7A 4LRWA 1P60A 3L43A 4FW9A 4PZZA 2X1VA 4D4LA 3AVVA 3IEVA 1IN6A 4A0GA 1Z29A 4URVR 4G5GA 4LJ4A 2RGCA 3B82A 1R7RA 1OKKA 1SKYE 5FPHA 1DOAA 1FOEB 5AJVB 2D7CA 3QKUA 4TMXA 2HLDD 3FFBA 1NP6A 2WOOA 3A1UA 2CHVA 3AP2A 4B34A 3K0CC 1ZUIA 2GA8A 1G1MA 3PUYA 4M9SA 3VTKA 1H8HD 1ZP6A 2MSCB 5CJPA 5EP2A 1F3OA 1JR3A 1P4SA 4JLVA 3I92A 4B3BA 4DDUA 1EX6A 4J0QA 2ZE6A 3KQHA 1U9IC 4DC9A 3SQXA 1E2FA 3K70D 2WSSA 3IIMA 1UBEA 1G16A 2QRZA 3IGFA 1D2EA 2XSZD 2IYYA 3EIHA 1G7SA 2QL6A 1G41A 5J4HA 2RHMA 2IYLD 1P3JA 4G3XA 4MGZR 4LGMA 4MYCA 2ZETA 1W48A 3PEUA 4IFEA 5F3WB 2CLDX 1XD8A 3PVSA 1ZCBA 1L7VC 5FTLA 1M7HA 2QBYA 4PZYA 3RABA 5AJWA 1NLZA 1Z08A 2VSOA 1NVUQ 1FQKA 1AGRA 1FFHA 1KI6A 1KZ7B 4YDHB 4BECA 2WWHA 1SULA 5DSZA 1FP6A 5L3VA 3R8FA 4DDWA 4ARZA 3EPJA 1NN1A 3OIWA 2F1RA 4TL7A 1SXJC 2IWHA 1Q44A 2QM8A 5CYOA 2YVUA 5E3HA 2IXEA 1XTJA 1BIFA 1MO5A 1OFIA 1SZPA 3GJ0A 1UJ2A 1M1YE 1C4OA 3GEIA 1G8HA 1ZIOA 1P62B 4M8NE 4PAMA 2F1HA 2OZEA 3QEOA 4XWKA 3REGA 1E2GA 1M7GA 2QPAA 2GCOA 1W0KA 4FMCB 1RE0A 2IYXA 3TVTA 2WJJA 1KKMA 1MT0A 4TLAA 3X1WA 4AYWA 1ZJ6A 4KLNA 4MGKR 1GTVA 5FPYA 5K8TA 1W2HA 1XEXB 1CU1A 1N25A 4I1VA 3UPUA 1OH8A 2GK6A 1IY0A 2WV9A 3CZQA 3SS8A 2NO0A 4US2R 3MJHA 1G5TA 1R10A 2GAAA 4ARZB 2VSXA 6Q21A 3EX7C 5J5CA 5JLJA 2FA9A 3HR7A 1GITA 2OCAA 2W0MA 4BEBA 2JEOA 4RSGA 1UAAA 4GZLA 3C15C 1Z07A 1VG9B 5C2JB 4TQAA 2PEYA 5IT5A 4DCSA 3EC2A 2WPDA 1XCGB 4MUAA 2AFIE 1KGDA 2IK8A 3GLGE 4A36A 3THOA 1TEXA 2WM9B 1MRSA 1AIPA 1ZU5A 1QHYA 3K70B 2W00A 3W3AA 1BMFA 2IW3A 1CKEA 1NKTA 1K8RA 1N6IA 2GF0A 5DN6A 1PUJA 3ZLJA 1NVVQ 5CYPA 4C3ZA 1E69A 1MO3A 1Z0IA 2EFCB 2GXUA 2WJVA 2VO1A 4BLQA 3UANA 2BVNA 4P4TA 2JDIA 3B1VA 4A4DA 3QG5A 2JLQA 2K5UA 3NBYC 3Q5DA 1KO7A 3H86A 3Q9LA 1ZAKA 1YKSA 1WXQA 2VP9A 4AG6A 3L8ZA 4UNQA 1N6HA 4F92B 2WKPA 4E09A 2NO7A 3WYFA 1DAIA 2J0QA 2MSDB 1N6NA 1Z6GA 1UEJA 1JNYA 2PJZA 3PCRB 1FMJA 2IUUA 1FW6A 1W0JA 4C0BA 1LNZA 3MGCA 1HQCA 3U6BA 3THXB 1TL7C 2SHKA 3O47A 3OIUA 3TGPA 5AJXA 1KNXA 1U0HC 1K5DA 4L5BA 3FHTA 3R9XA 4Q00A 1N0WA 1YR7A 2XOKD 4JZKA 4TT3A 3NEYA 2PCJA 1KIMA 4L8GA 3CRVA 4CEHA 5KNBA 4A82A 1IY2A 1E9DA 2GXSA 2ZANA 1EESA 5FOSA 2JDID 3BIFA 3EG5A 2ONKA 2IUTA 1IOZA 2FX3A 2NPIA 1FX0A 4OQMA 4DSUA 1KI7A 4TMWA 3BH6A 2CLCX 4XVQA 3NH6A 3WYAA 4DCNA 1RRCA 1Y3AA 1OJLA 4ERNA 5JSZA 8OHMA 1Z6TA 5CLQA 1OB5A 2YWHA 1XJQA 4LHYA 4C4PA 1II8A 4IOMA 5A0FA 5FBLB 4ZI2A 4NMMA 1CRPA 3A4MA 4Q1AA 2BBOA 4DSTA 4MRNA 1HE1C 1QHGA 3KB1A 2O0KA 3NC0C 3RC3A 3RYTC 2X19A 3GD7A 2DFTA 2GAOA 1P75A 2CDNA 3GMTA 3GEHA 4WZAE 3AKCA 1YR9A 2N1BA 2ZYVX 5HCIA 1NSFA 4Q03A 5IRCD 4U7DA 1T8TA 1W2GA 4OI4A 1GOTA 4Q02A 1KKLA 4FMDF 2CHQA 2DHRA 2D4HA 3WY9A 3U4QB 3AUXA 2OFWA 1U8YA 4WZ6A 5JWHA 5ANRB 4RD0A 3TUIC 4YMWA 1JAHA 1LF0A 3BE4A 2B21A 2Q9BA 1ZCAA 4GDFA 2P6UA 3W34A 2DBYA 1YZNA 2YWEA 1RC8A 1W4BA 3GLFB 1JJ7A 2Q3HA 4FI3C 1TADA 1E2DA 4IVPA 3MWYW 2I3BA 4IDOA 2XNDA 2FFBA 4Q1FA 1U98A 2OXCA 5KNCA 1Z6YA 3SHFA 4RZ2A 2X77A 4KHZA 1UF9A 2ZS8A 3UXMA 1Q3HA 2ZJBA 4DLYA 4M1KA 1KTVA 3X1DA 1XMVA 2Z83A 3TQCA 4A2WA 5FH9A 1XCMA 2RGAA 3SFVA 4GOXA 1J2JA 3QQ5A 2I1VB 2R6FA 2ASEA 4GFDA 2R6CA 3HPRA 3W9YA 3I61A 4A0HA 3A1WA 3CRQA 3QXCA 2JCSA 1Q1QA 2OXRA 4Q1EA 2KWIA 2CL7X 1SVOA 3LWNA 3VKWA 5CB8A 2ZU6A 4ZCMA 1U8AA 1N3BA 4HZUA 4PHGA 3CBQA 3QSYA 2P6RA 5EJEA 3WMFA 3NHBA 4LWZA 5HE8A 5EXTA 5JRJA 1AQUA 3W3ZB 3UIEA 4D80A 2WSSD 3TVDA 1E2QA 3IEUA 3NWJA 5FUYA 4NE2A 4EQ6B 3ZQJA 1LV7A 3LQRA 2XOKA 3BFKA 1ZNXA 2R62A 2WWWA 3S1AA 3AV0B 2A5YB 4B6EA 4D81A 2J7PD 1AN0A 2ZRJA 4TZ0A 5TMPA 1E2IA 2AD5A 1W0JD 1SQ5A 1CJVC 2RGGA 4KO8A 2F9MA 3RWOA 4A92A 4N1AA 4TSFD 4B2LA 4C2TA 5BN4A 3RS3A 2HLDA 1WQ1R 2OFOA 1G20E 2W6IA 3K0EA 3SBEA 4F4CA 1OXUA 4NHOA 121PA 2BM0A 4POAA 4OK3A 5D3MB 1C9KA 2J59A 2BEJA 4IVQA 3B7GA 4V0OA 1MO4A 3B8HA 5BW8A 4MKGA 4I1OA 5C18A 1ESNA 1QZXA 2EW1A 3OEED 1OPXA 4GOKA 1F2UA 1XTQA 5FBRB 3KQLA 3BWDD 1YU9A 2BMJA 3AB3A 3IQWA 4MGYR 5AUQA 2VHTA 1IN4A 2UKDA 4QM6A 3GPLA 2BC9A 5E7JA 3NBXX 3L0IB 1U0JA 2ZI6A 4Q66C 3WBJA 4A15A 2PEZA 2GZDA 2IL1A 4GMDA 4DZZA 4DLUA 4GL2A 1M8PA 5FTNA 2WAYA 3T06B 1Q1BA 2VH5R 3I3SR 4CIDA 1KI8A 4HDCA 5BWMA 4MDEA 4WAUA 4DEXA 4A8JB 4W5JA 5AK0A 5EXPA 2BIFA 2O8CB 2WKQA 4EPXA 1S3SA 3KKQA 4HLDA 4UNPA 1R8SA 4M1SA 5JHHB 4Q4AB 5CK5A 3WMGA 1R5NA 3CRW1 1G291 1ZU4A 3W6OA 3A36A 2BMFA 1Z5ZA 3K0SA 3T15A 4L4UA 1GNPA 3TUJC 1ZW6A 1ETUA 1ANKA 1XBTA 3OFND 2FSIA 3OESA 1H8HA 4JMPA 2R65A 3IILA 2FSFA 4YMSA 1T6NA 3W90A 3MWLA 1YZUA 3ZJYA 2FWRA 3LY5A 1SVSA 3IO3A 2FSGA 2QMUA 2DFLA 4R9UC 2WJGA 3G82C 4KSCA 1MV5A 4XSHA 4DIEA 3RAPR 3FDIA 1OXTA 3P32A 1CJTC 4OBEA 2BOVA 3ZGXA 4JLAA 2AHOA 2RGNA 3HU2A 3DMDA 2YHSA 5FTJA 4RD2A 1JPNA 4LC0A 4QGAA 1E1RA 1Z6XA 2QNRA 2X8AA 4E03A 2H1LA 4URZR 1IN7A 1J99A 1HA3A 3RS7A 3TK1A 1E9AA 2XAUA 1FZQA 2B6HA 2TMKA 2C9OA 2HJGA 3QVUA 4PPFA 4TLBA 4A6PA 4LX0A 3OIYA 1BS1A 3R20A 4TTQA 4BRUA 1E2NA 5DYIA 1XXHB 2WPDD 2ZI7A 2Q3MA 4YMTA 2IWRA 4ASUD 3FKQA 4LZZA 1DAGA 2OESA 4DLRA 3X1XA 3K0FB 2GXQA 4CT4B 3CX8A 3BB1A 5CM8B 4DEYA 1P2UA 4JVMA 1X3SA 5DYGA 5TDHA 5L8VA 4OK6A 1X6VA 3Q8XB 2IBMA 1JALA 2QTVB 1XD2A 1VCMA 3CF6R 2CE2X 1GVNB 1M2OB 3KQUA 3TW4A 2V54A 1OB2A 5J4VA 2UZ3A 3AKDA 4TLEA 4NKRA 4RFSB 2VA8A 1NSTA 4IJMA 1WB9A 2NZJA 3QOFA 4TYNA 3QE0A 3AVPA 3QPVA 1SVKA 3RC8A 2A5GA 4P4SA 1XD9A 2H18A 1EFTA 4PPGA 4ZCLA 3I8XA 1Z8FA 3QJYA 1OIWA 5EP1A 1U90A 4CGZA 3AP3A 1US8A 1NIJA 4HAUA 3LQQA 2Q21A 4KJZA 1D5CA 3BGWA 4FXPA 1E2PA 1SVMA 1Z83A 4GRAA 1U8ZA 5EE9A 4B48A 1E3MA 2A78A 4D25A 2WIAA 4F7WA 4CW7A 1XEFA 4HB0A 3BK7A 2IF2A 4JSTA 4BUJA 3M4YA 4B6FA 1ZRHA 3RNLA 4C0JA 4ZIRA 4LYFA 3MCAA 4DVGA 5KSOA 1VCOA 2EFDB 1G18A 2JJ2A 4PX9A 2JJ1A 3F8TA 1EX7A 1QVAA 3P27A 3CLVA 4UXHA 1I4TD 3DDCA 3L2OB 1ZD1A 5CK4A 4PTLA 2O8DB 4PPNA 2G77B 4UNSA 3HU1A 4A2QA 1ZINA 2QORA 3EZ6A 3D6TB 4DIDA 2GCNA 1XDBA 2VIIA 2IYUA 5H1YA 3C16C 1Z3IX 4TYYA 4EQ6A 4XIGS 3KXLA 1I4LD 3C41J 4G5RA 2PJRA 2ZSFA 3KZ1E 4E5UA 2X2EA 3IO5A 4JVSB 2ZRNA 4WXPA 2A5JA 3AP1A 2OSBA 1OFUX 4W9MC 5JJIA 5JS8A 4JLKA 5F98A 1E9CA 3BERA 4HB2A 4OQFA 1QBKC 3WNDA 2O8FB 3ZZ0A 1I2DA 2J7KA 5IHPA 1E1RD 1Z2AA 1OYWA 1Z28A 2FE4A 2QGNA 2VHJA 5FPTA 4EFMA 1E2EA 5KPDA 2VL7A 4LI0A 4PC6A 1FTSA 1P9WA 4LJ8A 3CKLA 2ZJ2A 5KOYA 3QIAA 2P5TB 3VNUA 1OXSC 1X8KA 2ZRPA 1DO0A 1VMAA 5JFGA 1CR2A 2DY1A 3FFAA 4AK9A 2WWXA 2DB3A 4BFYA 2G3YA 1FP7A 2QZ4A 2JLXA 4IW3B 4XVUA 3SR0A 4BFSA 5TB5A 5CDFA 3EW9A 4QGHA 5FOWA 4QXAA 5IDVA 1CTQA 3U44B 4XD7A 1KO4A 3FE2A 3GQBA 4KYUA 3LH5A 4S35A 4D0LB 4HUQB 1NY6A 3FMFA 3B9PA 3DKPA 5C4MA 4IEEA 2J0UB 1OYYA 1TNDA 1L4YA 4BLSA 2OILA 1G3UA 4JVNA 2IA5A 3ZVRA 5KSZA 2G83A 3FYHA 1RKBA 4EKDA 3GLFA 4N3NA 2WOJA 3UWKA 1XF9A 4QJ4A 5LBIA 1JR6A 2AFHE 2W0SA 1EGAA 1NLYA 2PT7A 2JJ8A 2WWFA 3IHLA 2IYZA 2QGZA 2ZRBA 3WP1B 1VDZA 1TQDA 2QMOA 4MA4A 1UKZA 4BZQA 2ZITA 5DNYB 1XTRA 1Q0UA 4D6PA 4Q7MB 4WA7A 1T8UA 2C8VA 4LBZA 2A9KA 1W5TA 1VHTA 1WMSA 2IHYA 1XXHE 2YV5A 1KOFA 2GWHA 2ZI9A 3BFVA 3G5UA 4MYTA 1OV4A 4P3YA 3EZFA 4R98A 1RIFA 1WDTA 2WHXA 2ZRKA 4KSBA 4NPHA 4B73A 2RGNC 4M22A 4HB4A 3W5IA 5BXQC 1ZM3A 4GBMA 5TVKA 4EJSC 2F3TA 5KPJA 2EQBA 2ZE7A 3MWKA 1TAGA 1NRJB 4AKGA 1AGPA 3ND8A 2BBSA 4LSGA 5BYKA 4OJQA 1VCNA 1DO2A 2CCJA 4KVAA 4OI1A 4DJTA 1CJKC 2FH5B 4URUR 4G01B 2F1IA 5P21A 4BZXA 2OCPA 2CNWD 4V0LA 4Q1BA 4URWR 2D2FA 1VIAA 2GILA 4BQSA 4DDVA 4PAOA 1KZGB 4XVRA 3A37A 5EXXA 2BKUA 3B6EA 2MMCA 2GJ8A 3TAHA 4PO8A 1TU3A 1YRBA 3KX2A 1BOFA 3CWQA 2XXAB 2O8BB 4HDOB 3CIOA 4TMVA 2PZGA 1NVWQ 4GP6A 2ORWA 1RRFA 2QP9X 1GILA 4ITRC 2C95A 4A8JA 1TQ6A 4B3XA 2ERYA 2GBLC 3EAQA 5CIQA 4AKIA 3EXAA 2OO7A 1HURA 2AWNA 3LBIA 4B71A 1OE0A 4LYJA 1U0LA 2CLSA 2XZOA 4JLPA 1WBBA 1S4QA 5KUTA 1N0UA 4M2LA 1CJMA 4RCYA 3O8RA 1SXJB 2ODEA 3PEVA 4XSGA 4DB4A 4M4SA 4TL6A 3IKJA 1QG4A 2ZIAA 3UKDA 2QAGB 2CCKA 2YOFA 4KFSA 1E4VA 2J1LA 1KSJA 5KNDA 2H17A 2QSYA 1UBCA 1N0VC 3H0KA 1WCV1 1Z0DA 1XP8A 4IXNA 1CR1A 4MYHA 1E2KA 5EE0A 1FQJA 4FCTA 1U81A 4C0KA 5EQTA 3K9GA 3THYB 3W8NA 3ZZTA 5DGXA 4JLDA 2FGKA 5CM9C 5FBVB 1T5LA 2FZLA 1GL9B 3GJ3A 3LFUA 4DDTA 2XZLA 1K5GA 1XJ0A 3MWJA 5FOXA 1JR3D 2O8FA 2BEKA 3LVQE 4Q4HB 4ESHA 4KVGA 5JCZA 3BRWD 1YZKA 4HAXA 2LCFA 4C0HA 1E0SA 2VHQA 4PR0A 2IF0A 3QKRB 2NG1A 3RWMB 4ON9A 4V02A 2X2FA 3E2IA 4ZDJA 1XTSA 1WRBA 5K8IA 3BJIC 4L9WA 1GUAA 4RCZA 1T3SA 2DWPA 5FPSA 3VR4A 3QKRA 2CMKA 5AJYA 4QKQA 4LDJA 3QF4A 3FPAA 5HPYB 3F3YA 1JI0A 5GADl 2OE2A 4WBSA 5DE3A 1ZNZA 4FMDB 3W6PA 4BLRA 1XEWY 2R44A 5FUXA 4US1R 3UATA 1E79A 4GOJA 3OAAA 2J45A 2V6JA 2RKOA 1XMIA 1XMSA 1E9FA 3V4RA 3DOFA 4M1MA 1KI9A 2J46A 4Q1DA 5AR1A 3W8RA 4OQNA 3LAWA 1TQ2A 1HYQA 1T91A 1Z06A 2ZRCA 4K8OA 1GKIA 4PSAA 4LBWA 1KDOA 4HEJA 3VKHA 1FL9A 3NTUA 4X8LA 2ZTSA 4QNMA 4FINA 1F60A 3SZRA 1S0UA 1XMJA 4HDQB 3T1OA 2BBWA 5GJWC 1IN8A 5GJVC 1GL7A 3TH5A 2Z4RA 2ZSBA 2VTKA 2R9VA 4UQOA 4DCTA 3FWYA 3KDSE 4PAQA 3FTQA 2WWYA 1N5JA 1IN5A 2JGNA 4RVCA 4BFZA 621PA 1OXVA 2NO9A 1NI3A 3U60B 3E1SA 3OZXA 2ANCA 4DLVA 3BC1A 4Z54A 2FU5C 2YOHA 4NDZA 2XX3A 2BBTA 4B35A 3RLFA 4CEJB 2AXPA 2AL7A 4JSYA 1ESMA 3BXZA 4MKHA 2OHFA 2KB0A 3A1SA 1SVWA 2GZAA 1J70A 2XTMA 4K81B 5AUPB 4D4MA 2JLVA 3FMPB 2ZAOA 2ZYWX 3B9QA 2EWVA 2CJWB 2GDJA 5B2ZA 1AS0A 3DOEA 4QRHA 2ZUCA 3WP0A 2GJSA 1KI1A 2D3WA 5C4GB 3TMKA 1GP2A 1E9SA 4RZUA 1HE8B 5CITA 1FTNA 2VF8A 3WYGA 1RPZA 2ZS7A 2QAGC 4IDNA 1W4AA 4ZO4A 3PENA 1AM4D 1XB2A 4O25A 4PHHA 3B1WA 1M7BA 4DUGD 1YR8A 2WICA 1N5IA 5KDOA 1ODFA 1AJEA 4RD3A 3GLHE 5TARA 2YJTD 2ONJA 5EXSA 2FEOA 1BKDR 5K8LA 1H65A 1N2CE 4YXWD 1EK0A 2ZI4A 5D3QA 2DFKB 5HCNA 4BFVA 1F6BA 1GDDA 1NY5A 2WJIA 5BQ5A 2RHDA 3U2QA 3L0PA 1Z22A 4NCIA 3NG1A 4LOAA 4PC1A 3DM9B 2PZEA 4QJ3A 2J41A 2GEUA 2XEXA 4L16A 3U6KA 3B85A 1SVLA 2VP0A 2W6JA 1E0KA 3GLIA 3CNOA 2OBNA 4MRPA 1SXJA 3U44A 2WTUA 1Q3TA 3EWSA 3THWB 2CL6X 3ND9A 3GLIB 1E98A 2GETA 1UM8A 3CRMA 3GJ7A 2V6IA 4HUQA 4JKYA 4JT4A 3B1YA 2C5LA 4ACAA 5A5GA 3ADBA 4B2PA 3SYLA 5C1BA 2QE7D 1DAEA 2J9RA 4XOIA 4TMKA 4AYTA 1Q22A 3AQ4A 4M53A 1MH1A 3VU9A 2P5SA 2O52A 1ONBA 3JVVA 1XZPA 3CPHA 1ELOA 4DWJA 2O8EB 3BAFA 4DCVA 4A6XA 4CEIA 1JXMA 4TQUS 3PJRA 2B92A 3LBHA 4WVFA 5L3SB 1JJVA 1XFAA 1XPOA 3UWOA 2PLRA 3MAAC 4B3FX 2QUZA 4QC2A 4DLTA 4BGDA 4C7OB 2GESA 2QPOA 2CBZA 3CR8A 3KKOA 3X2SA 1WA5A 5DHAA 5EP4A 1NL3A 1GRNA 1G5PA 2ZJ8A 3PUVA 1A4RA 3P1JA 3N2EA 3K09C 2ZM5A 3AVXA 3GLGB 3BOSA 2D7DA 4DSOA 3DM5A 2F3RA 2NO6A 3ZQ6A 4Q7LA 2IYVA 1EWRA 1OFHA 3LLMA 2CXXA 2ECKA 1KK0A 1AQYA 3AH8A 5DIFA 4I1UA 4B32A 2O8DA 2QTFA 4WW0A 1FPMA 1KY3A 3KXKA 3TJZA 2FSHA 3KFXA 1TUIA 3ZS8A 4KYIB 3NDBB 2LWIA 1KK1A 4DUGA 2GCPA 1ZNYA 3RS5A 4Z1MD 3X1YA 4Q4LA 5C46F 1VHLA 4Q1CA 2J0UA 2VP6A 4KBFA 2PMDA 3LDAA 4UJ5A 1D2NA 2W2VA 2FG5A 2GCOB 4FMBB 2FMXA 2QE7A 521PA 4D4JA 4DLXA 3CF2A 1IXZA 1A2BA 4MUBA 1OIXA 1YZLA 1DPFA 1R6BX 1OKKD 4AY2A 5KDLA 3VR2A 1EFCA 3T12A 3QY0A 3TUZC 3SFZA 2YYZA 1LS6A 3BBPA 4NBSA 1VCIA 4UJ3A 4DBLC 1Z2CA 1W36B 4JBYA 4UNRA 1YJ5A 2NIPA 3UG6A 3NDPA 1LVGA 3R7WB 2A3RA 4ESVA 4NONA 3K9HA 2VRWA 5DI9A 3BD9A 1W4RA 3OF5A 3LX8A 2YZ2A 1G6OA 5FL7A 2W2TA 4PQFA 4OQLA 5TY0A 4HLUC 1J8MF 5CB6A 1D6JA 2CE7A 4PXAA 4RJLA 3KKPA 2G0TA 1S2MA 3KUCA 1XD2B 2HEIA 3CW2A 3GJ8A 4QFMA 3PXGA 5HTKA 3H2YA 2FF7A 4URYR 1BYIA 1PLKA 4Y0AA 2B8WA 3I5XA 4HAWA 3TR5A 3AF4A 4B44A 2XGJA 3QEJA 2MMGA 4BLPA 2IYQA 1N6KA 3C14C 3L0SA 4BLOA 4H9GA 4BRWA 2HUPA 4KI0A 4B43A 4M9ZA 4LPSA 2Z5FA 3KL4A 5DISB 4RKFA 3VX3A 1N6PA 1OH6A 2BKEA 3MMPA 4Q47A 5SZIA 4OHWA 1S96A 2H5EA 4PSKA 4D4KA 2C77A 2G1KA 1WP9A 3Q5EA 2A30A 1A7JA 3TR0A 3VR6A 4B75A 5FTMA 3B60A 3UMRA 3NH9A 4NL4H 1RZ3A 1XZQA 1HY3A 3B78A 3Q7QA 1TF2A 1RRGA 2XNDD 3PUZA 2RH5A 3J81k 2YWGA 1W4CA 3RSOA 2G0NA 1WE2A 3VQTA 2C98A 3RRYA 1E9RA 4BLTA 4RD1A 3V4FA 2ZR0A 3CB4A 1HQYE 5GVRA 5FFMA 4M9QA 2QT1A 2IEYA 3QF7A 4MQBA 1E1QD 4EDHA 4JYBA 4WXRA 1XCPA 3L8YA 4TL9A 3SU8A 1GZSA 3MSXA 2JLUA 1W1WA 5EUQB 2BDTA 2C78A 2NMVA 2VP2A 1CR0A 4OHVA 1A2KC 2CVFA 2D2EA 3ETLA 3I72A 2VSFA 4C2UA 3KXIA 3HJNA 4RZXA 4OQXA 2AD1A 1TEVA 2QROA 3GJ4A 5F2EA 4NTZA 5AWFC 1DARA 4Q4JB 1W44A 5JRZA 4DRZA 2ZXUA 1DAKA 4P0TA 2ODWA 3BB4A 3N70A 3IPYA 2XJ4A 2FOLA 2AKYA 2L0XA 1UADA 4JKIA 2OM2A 5J4YA 2RMKA 1UDXA 3LRPA 3GJ6A 4LJ9A 1IQPA 4D0NA 4EPTA 4QBGB 1RJ9A 1QHNA 2RGXA 1JEEA 2QU8A 4EJSA 2FFQA 3PQCA 4DHEA 4B3CA 3KJGA 1YR6A 821PA 1DEKA 2CK3D 3SE0A 1Q21A 2ZUDA 2VHUA 3TIFA 1TMKA 2R2AA 4JBWA 1QHHB 2GTPA 3AGPA 4TT3D 1PZNA 1ZD9A 4BASA 3GLGA 3ZYCA 2WMNB 3ICQB 4QGFA 2PL3A 1G3IA 5J47A 4NU0A 3SDZA 3UG7A 4MRSA 2ZU0C 1XRJA 3KB2A 2ZUBA 1NLFA 5SZKB 1P6XA 2Z0MA 2HT1A 1O87A 3QNUA 4IOLA 4QM7A 4BEJA 1KK2A 2VYFA 2ZI3A 4EFLA 2ZRLA 3ADCA 4M1YA 3ONWA 5LB4A 2Z6VA 5B58C 2ZRHA 5L3SA 3I1FA 1F2TA 4H1UA 1M34E 1YZQA 3O8DA 4PSVA 2OFXA 2OV2A 3RSLA 1QRAA 1PVOA 2ORVA 2BM1A 2QMHA 3MUFA 4QNRA 3I73A 2XJ9A 5KSYA 2QQEA 1CR4A 1LY1A 1ZIPA 2FPMA 4Q4AA 1T3HA 4IDHA 1JB1A 4LV6A 4IEIA 4YMVA 3ZS9A 2P3SA 3KTAB 1G8PA 2J3EA 1DBSA 3C5CA 4BFWA 2O8CA 2ZI5A 1KMHB 3GLHB 2DWQA 1B23P 1G3RA 1LF5A 1DVRA 3MG9A 4NYMR 1EFUA 1QG2A 1XEXA 4AKEA 1COWD 1X1RA 4EUNA 5JJLA 3GLHA 4JLNA 1WF3A 1SHKA 3BB3A 3SEAA 4ZDIA 1W46A 1TF5A 3IIKA 4E07A 4D26A 4MKIA 3OHMA 3ZZUA 1UKVY 1OIVA 4NYJR 1IJFA 3SJAA 3T1TA 1Z47A 5J4LA 1LB1B 4AURA 1UBFA 2IS4A 1P2SA 2ZQ5A 4JLMA 1D8TA 3K9LA 4KAXA 4I1SA 2XB2A 2BMDA 4DXAA 4PC2A 5EE3A 1XU4A 2ZSAA 2QQ0A 1CLUA 3OFNA 2O8EA 2IYSA 1T3LA 4HSEA 2CEAA 5FOVA 3A4NA 1YHNA 4N0DA 1G4AE 4W7SA 1QHHA 3TKLA 2EFEB 3C8UA 3ZIAD 4PHTA 1N5LA 3EASA 1DTSA 2AXNA 1YQTA 4URXR 3SYKA 2JLRA 3EC1A 4XWAA 1KSGA 3LLUA 4O3MA 5LPNA 4JBXA 3DHWC 5LDDC 3E70C 1IBRA 3QKTA 3SJBA 2FPKA 4TMZA 4YQFA 3GLFE 1CEEA 1P2VA 3CX7A 2CK3A 2WBLC 3CNLA 4AIIA 4PC3A 3S1AB 4YDSA 4ZKEA 4ZIRB 1CBUA 4TTPA 5FI1B 1NG9A 2HCBA 3AGQA 4PO9A 2PBRA 3EARA 1J8YF 2ZRDA 3P4XA 4HAZA 1JR3E 1VG8A 2EU8A 3BORA 1Z0FA 2QN6A 3CF0A 2HYDA 3LD9A 5JCPA 3Q7PA 4GT1A 3VR3A 1H8ED 3ECCA 2ATXA 1SGWA 3PEYA 1E4YA 1GKYA 4IDPA 4IOKA 3I32A 4YC7A 4OHYA 4RY2A 2IXGA 1R0ZA 2PLFA 1S9HA 3KUDA 2DWOA 1KDPA 3WMEA 4M9XA 4AWXA 1A1VA 1LS1A 3CPJB 1II8B 2REXB 4C30A 3VR5A 1T4GA 2F9LA 1EXMA 3OEEA 4Q4JA 3ICEA 3IBGA 4YONB 4M0LA 1OHHD 5JWRA 1Q57A 2Z43A 4B3DA 3DMNA 2J87A 2O5VA 1CJUC 3CZPA 4CEHB 4QBIA 4F4IA 1OH7A 4QHYA 1HH4A 1VG1A 1MABA 2G1JA 3KJEA 1CXZA 1G8GA 1TX4B 1VKJA 3F0TA 3THWA 5F9HA 3K0CA 4O0MA 1IXRC 2ZRGA 3HDTA 1E9BA 3HWSA 1II0A 1G17A 4Y0VA 3MRSA 1EWQA 2GF9A 4JL5A 3W5JA 1MRNA 1GWNA 2E1RA 2WVJA 2VP5A 3EA0A 4GZMA 3SI7A 5LB2A 2IYTA 1Q1EA 3I4LA
chains in the Genus database with same CATH superfamily
2AQHA 2ZB7A 4FFOA 4GI3A 3DCNA 3JZAA 1N5DA 2MTBA 4G0VA 4YLEA 4UBNA 3MSCA 3I2GA 2M9MA 5JVDF 2GEJA 2ANBA 1Q77A 3E3MA 1EVEA 4YP5A 1CQZA 3ED1A 4MUMA 4XDGA 1N1GA 2CNWA 2PPVA 3C5HA 4PX3A 4Z49A 1JEQB 2IHUA 3AIOA 1NM5A 2ZRIA 3IKLA 3NP7A 1OU0A 3DFFA 4ADSG 4LQCA 3K70C 1JKMA 2BR4A 1D04A 2XYPA 1O6CA 4GPTA 4NENB 5AVTA 4FLMA 1CF2O 5DK6A 4J0HA 2GYVA 1E63A 2WYWA 3FDFA 3SP1A 4AKSA 2BMEA 3QTTA 1CUVA 1F8FA 2HXYA 4H6WA 1VL0A 1Z2NX 2Z6AA 1ZISA 2IPMA 4XGNA 4XFJA 3Q3JB 1YIOA 1PK7A 2JHAA 4FCWA 5LLDA 2VVTA 3VFDA 2QVYX 3B38A 2JLYA 1XMOB 4GPIB 3JQEA 4A9AA 2WB4A 1HTTA 2AVDA 3SM3A 2E87A 4Y0NA 1J0CA 3B5JA 1EJ0A 1NNI1 5ER6A 3WSTA 4PICA 1GAJA 4ZZIA 5ABPA 2VHCA 1JDSA 4G1FA 4BNIA 1R4MB 2P2DA 3M1LA 5C34B 1ZMXA 3DNMA 1W36C 3NBQA 3WKBA 4KLRA 2PMBA 3DEJA 4A16A 3F74A 3LO5A 3HYRA 4HAYA 3ZCQA 3HXMA 4REQA 1NJ6A 3EXEA 4IDQA 1Z0JA 4QWWA 5KREA 2E4UA 3AI1A 3OLWA 4LHVA 3UPDA 2HHHB 2HRQA 5L9AA 1KR5A 2I1WA 2LIPA 3I6MA 3K8QA 1AS3A 3HYNA 4JYCA 2REBA 3DVRX 1KYYA 3ETHA 4QOSA 4XKJA 1V4VA 1I2AA 4M88A 3E9DA 1G66A 3GI1A 1KJNA 3LJKA 3KLBA 4YRAA 3VJMA 1KEKA 1UXKA 1FMCA 2GZSA 5CXXA 3BRSA 3EIQA 2UYYA 4RZ3A 3RFCA 4ARSA 2DRIA 4O59O 4QIHA 4LOLA 3FMIA 3T0FA 4R2WA 3N2KA 4CYMA 4H7FA 1IG3A 2A4MA 1PNQA 3DP9A 2IPXA 2BFFA 4Q3OA 1XZCA 4QQKA 4Y1EA 3RU3A 1Z5OA 1Z7GA 2CDAA 3I76A 4AZVA 4RPJA 4XR9A 4U00A 1A77A 3VKGA 3B7PA 3FIJA 4NCHA 5LD2B 4RFVA 3NIBA 3KKEA 1LRKA 1X1SA 3N5CA 2OLEA 5DP1A 1WPRA 4DAOA 1ZD8A 3VDXA 3VH2A 1Y6ZA 3BL8A 4DJEC 4LBVA 5D3MA 4Z0TA 4I6JA 3QBJA 4P4UA 3WRVA 4LF8B 2FW7A 3URKA 2C9YA 1LBQA 2PS1A 4HYYA 4DQ0A 3MRXA 1U7XA 3ZWCA 1QIGA 4XH9B 2Q5EA 2OYCA 4ZP1A 3MGAA 2BLNA 3BCUA 3HGTA 3DYVA 1NU8A 1QNLA 2JGMA 4WKOA 3HHPA 4TV8A 1N6RA 3C2QA 5HCUA 4GLBA 4LJAA 2O5RA 4J94A 2QP3A 5LC1A 4KDRA 4Q4DA 1JNXX 4M60A 2VTEA 1T0HB 3MEQA 4QDKA 3PC8A 1T6ZA 1EQAA 4QJ5A 4MTCA 3UJAA 1MX9A 1BU8A 1CYDA 2HH9A 1TM4E 2XITA 3F1KA 4CG3A 2YNMA 2UVPA 3ULKA 4EBBA 2GCEA 2XMZA 4MUXA 4QFDA 4TWIA 1C80A 4MV5A 2X14A 3UOWA 4DLSA 5GQSA 2J5RA 3KJFA 1YRHA 4I50B 4RXUA 4EY4A 1UDRA 1USWA 4ND5A 4E22A 4WERA 2OXFA 3GEEA 1VZ3A 1LA2A 4Q9HA 2F55A 2Y1GA 4BJ5A 1VMIA 2O0JA 4N82A 3V9PA 2QSZA 4RWEA 1Q2XA 2PXCA 1GIAA 2PJUA 2A67A 4QYIA 2QZJA 1B74A 4JI3B 2ZTVA 2F7SA 4PQEA 3HEBA 4GWLA 1ONSA 1OF1A 3GNTA 4EPVA 3QG1A 3HN7A 4MUNA 4CMJA 1NJGA 4YIHA 2X4IA 2G9RA 2HU2A 1YS1X 1PYGA 4GPZA 1EWYA 6LDHA 4L5AA 2OQRA 2NZ2A 2LRHA 4HF7A 3ABZA 4UVDA 1VHWA 3LXXA 3OJ0A 5JS7A 1FX0B 1ZC4A 2J9FA 2V7GA 3FZGA 1OBFO 1B4DA 1P7CA 4G97A 4IMIB 5G3YA 1XQWA 1JPJA 3DULA 3E7FA 3C6XA 4ZRMA 4GSKA 3UFXB 1MB4A 2C7GA 3RIXA 4LCEA 1VTKA 1JIUA 2JHFA 2YWFA 4MITA 1HDEA 1UPUA 1TZBA 2G9NA 3VR6H 1Q91A 1AKNA 4N8DA 5SICE 4ZN6A 1YZTA 1YZGA 1WG8A 3SHWA 3R3VA 4CMKA 1NLUA 5J2UB 2O7SA 2AJ8A 3B1KA 4CTOA 1K4MA 2FSVC 3R0IA 4MH0R 4WINA 4W63A 1FYDA 2WWGA 4BNGA 1A9PA 4YLYA 3M33A 4TLCA 3KNZA 4WY2A 3Q3EA 3ZXXA 3P5SA 3R0VA 4I2NA 2H9YA 2VHEA 4UXIA 3AUYA 3RTCA 4F84A 4JA2A 3V3KA 3COJA 2G1PA 2DFVA 1CPYA 4RZIA 3ASYA 1CUHA 3TSZA 1GADO 1P33A 1F0YA 5ITZB 1CS0B 1QONA 1HZJA 2NTEA 3TQIA 2NGRA 1O96B 5KVVA 3VR1A 3OEHA 4Z8YA 2BFDB 4FYYA 2UUCB 2YQ5A 4RM2A 3FWNA 2WI8A 2R7NA 1NM5C 5JNRA 1YK1A 3VV2A 3AVTA 1XZKA 2M2IA 5B3JA 2A1IA 3SDBA 4LOJA 5CFZA 3QK7A 3NW9A 3RBAA 2DPXA 3EY4A 3EXG2 5EHNA 1JEYB 5K6TA 2WILA 2XUAA 3VPHA 1GGNA 4EEZA 5LQKA 1UODA 1KAEA 2JJMA 4ETIA 4KXFB 5JXHA 1XVUA 1R5BA 3H11A 4JC0A 2HV8A 3ZI7A 1X8XA 5H81A 2A1UB 4PQRA 1PNOA 2QNBA 5BVGB 2BM8A 1U1FA 2Y0EA 3K05A 2YW9A 3A1VA 1I7SB 4F11A 1K8XB 1RKUA 4MVJH 1M2EA 2BTEA 2OWDA 2RAPA 5BNIA 1TIBA 2HHCA 1DTWB 2WRZA 2F43B 3CH7A 3EPPA 5EJGA 3F90A 2NUPA 1U1GA 2ZT6A 3UV7A 4C0SA 3QLVA 2H1SA 5JUWA 4CN8A 3C3KA 2EKZA 2XIJA 1NMXA 1M5UA 2QIOA 4CCYB 1A69A 4LGYA 3WISA 3DLPX 2ZYAA 2BKAA 1ETHA 1JDUA 2B36A 2H8KA 4MP8A 4NS1A 1YF3A 4NFLA 4JDUA 5L7TA 3V2HA 1JI3A 1LW7A 4KQ2A 4MUFA 1QF6A 3TKYA 1Y9ZA 3EMVA 3H4VA 4R01A 1I3LA 2PPLA 5EJ2A 3KC2A 4GI5A 1Z7EA 3CVWA 1DEAA 3SICE 2QRKA 4OH7A 1Z4MA 2X1MA 1TYDE 3B13B 2XTZA 4L1KA 5BWLA 1P2TA 1CDDA 1UKBA 2HK7A 4EG4A 1DLIA 1DBWA 1ZGZA 2HQOA 3L92A 2WT9A 4NDNE 4BO4A 3GLSA 3KOXA 2Q3LA 2OL4A 4R7ZA 5BO5A 2JKVA 3DYBA 2LKCA 4XGRA 1DQYA 1IHDA 3WK6A 2J4CA 3Q10A 1Q95A 3QP9A 2XXAA 4I55F 1S2OA 1IBCA 4RULA 1GTSA 3TL3A 1C8BA 1ZBQA 3S3TA 1ZXLA 1Q6YA 4NZPA 4EW2A 1L4LA 1YH3A 4GR5A 3ABRB 5LZ2A 1WZIA 1XAJA 2HBRA 3BXGA 3DL0A 1KBOA 3FHOA 3NKVA 4AJNA 1SIWA 5HJ5A 4S3MA 4BXOA 1R4AA 1PGPA 4KODA 3QW4B 2BJWA 2GKSA 2XVYA 3L40A 3DE4X 3F5FA 1BC5A 3C4JA 3LKZA 2OLKA 1XTVA 1KAGA 1EFHA 3EH2A 4UULA 4BX8A 4HUTA 4MO9A 5BPHA 1EFVA 3ND7A 5E9JA 1P0IA 1NN0A 3I5MA 5I8ZA 5JMTA 1L8LA 3PFNA 2F62A 5EIWA 2Z6QA 1XPRA 1CRWG 3A6EA 3CNEA 4N3GA 4GKJB 3WA6A 1O9BA 2XQFA 3NVAA 3U7HB 4FDVA 2C58A 1HYGA 1SCUA 4L7VA 4Q3NA 3HY3A 9LDBA 1A82A 2HJHA 4NZYA 1DL5A 1AB5A 2PGJA 2VS1A 5C1PA 2C3UA 3E53A 3H0CA 1FMTA 2XUPA 4LGCA 3HLKA 3S5JA 4PG5A 3MF4A 4K9KA 4MV3A 5ESXA 3GUYA 3FLMA 3PI7A 5TQ0B 5AKLA 2HK9A 1NT2A 2PY6A 2NTYC 3IUYA 1MC5A 1XJWA 4KWIA 1BDJA 3OIVA 4LV8B 1VPDA 1BMDA 1S9DA 1V5WA 4RC9A 1I10A 1Y7TA 4QUHA 2WSMA 2NNLD 3A6KA 1XZGA 5GGYA 1GARA 1GG2A 1DWOA 3NPMA 5PGMA 5BR8B 1MVOA 2CCGA 3AKEA 1EP2B 1E79D 1E6MA 4MKRA 1GHTA 2EHJA 4WFJA 4WVLA 3GJSA 5KYWA 5GOZA 4G81A 1OLOA 2WU8A 2FB9A 5C5EA 3AUTA 1KPHA 4TMYA 4ZOAA 4X8HA 2H1VA 2J9FB 3HKCB 1F6DA 4FK8A 1YZVA 1L8QA 3N05A 2W4QA 4L9SA 4TSFA 4MI3A 4EG0A 4HH4A 1I1OA 2IZ1A 2YWBA 3GFVA 2GBPA 3UC5A 4M46A 1FU4A 5EP3A 3PQEA 1JHPA 1HQKA 1IB6A 1J7JA 2Y2UA 2I67A 5K0JA 1GZ3A 1NN3A 2HCJB 2IDZA 2X4GA 5B53A 3AI2A 3REFA 2JCBA 1BYUA 1OGJA 1QFZA 2O8BA 2OK7A 1X74A 4DDKA 4YREA 1E8NA 4FWTA 4N65A 3UAVA 1P0PA 3AU8A 1BN6A 1L6IA 2PS3A 1Z6PA 3AR9A 5G3ZA 3VMFA 1PR6A 1X19A 1F7VA 3JYPA 5BP7A 3AUFA 4MWGA 3W2GA 1QHIA 3EIWA 1ECCA 1SG0A 4H59A 3UKJA 4C4SA 3T5BA 4D0SA 1Y4AE 1KQGA 1TZCA 1FLVA 1UPFA 2ZXFA 1EDZA 1JLMA 2XCOA 4J16C 2IX3A 2PT5A 4CN9A 4DLZA 4EY3A 4D97A 5BQOA 5TPZA 4BFXA 5BY2A 3MJRA 1BHSA 5IYZB 3B1ZA 3CCBA 2ZSKA 1X14A 1V43A 4PINA 4IG9A 3JQFC 5KOJB 3FGNA 3ZWPA 4CMIB 5L95A 3DVAA 3LGXA 4OXXA 2IV7A 4WT7A 2OP0A 3T3PB 1LQTA 1OFUA 2ERXA 3IL2A 4KITB 5ED4A 5CFLA 1OBOA 5HFJA 1N36B 2DERA 1BEZA 4KO1S 5HF5A 4EVIA 2B3TA 3HFGA 4N0MA 4FFVA 4GU5A 5HKOA 1KOGA 2JHGA 2ZAIA 4AY5A 1TRKA 2VNSA 2XQGA 1XA4A 2XCIA 3O9MA 3GUUA 2VA9A 2FV8A 3W7BA 2QV7A 5DYYA 1C7FA 1GZ4A 2OXEA 4Q7QA 3A8TA 3FWKA 1ZITA 2ZJAA 3NTVA 1R8YA 3UW3A 1AZTA 3DZ8A 3L7KA 1R0LA 1UFKA 1R15A 4M8SA 2IEZA 4C22A 3SN6A 4MJXA 3AKYA 3F9IA 4AU1A 5LVAA 4NWIA 4F85A 3GVPA 2FCAA 4M89A 5MFZA 4K0RA 2JASA 4CMEA 4K28A 2QY9A 3AIMA 3Q98A 1KARA 2GEKA 2LDXA 4MSUA 3WIEA 4ZI5A 1ZZGA 5AKHA 5ILGA 2VZLA 2F1OA 3M81A 4GPAA 2UXCB 4RTSA 3GQBB 4BP1A 4C04A 5HK8A 3NNSA 1HEIA 4U02A 3VOBA 4EAQA 5JPIA 2RGBA 4F6RA 4V0RA 4COKA 1LTQA 1ODIA 3OE1A 1N3LA 1E61A 3PV0A 4CMGA 1FBNA 1ICIA 3GWZA 3INRA 4K46A 3AEXA 4CKWB 1K6XA 2IH5A 1FUUA 1T4BA 4LY6A 4XYEA 4ZAFA 1RCUA 4LG1A 1EZ4A 1IM2A 5BMVA 5DT2A 7YASA 2OCYC 2YIJA 4BNYA 3K15A 4ND3A 4ZJYA 1WCXA 2AVNA 2NO1A 1P29A 4QOJA 5EGNA 3MINB 4BFCA 1ZVVA 1VG0B 2BCJQ 4MARA 5CPBA 2OCIA 1V1RA 3MFYA 4WUTA 5BSVA 5F7JA 2JIDA 3C74A 1K63A 3GARA 3MUNA 2O2EA 3PF9A 4HLUA 4OBWA 4O63O 1YFKA 2Y99A 3AVYA 1HKUA 1ABBA 3AVVA 3FAKA 4KO2S 3OLYA 4DC1A 2CFSA 3WVNA 5CFRA 5CDFE 5TF0A 4FYWA 1TO6A 3SYRA 1HLDA 4P83A 3CRRA 3C3BA 3KQMA 1MORA 3QPWA 1D2CA 1ONPA 5ALFA 2BFCA 4N3AA 1O9GA 3W6NA 3C4QA 421PA 3F49S 3ORRA 2OLJA 2CHGA 2FZGA 3A1DA 4RV5A 2WZCA 3L8HA 4L0MA 2MYTA 1D0IA 4LXQA 4OHMA 1DQPA 4FCCA 2VRCD 3IPRA 3HBAA 3TM5A 3FCYA 4N7MA 4RKRA 4F91B 1QDUA 4XE5A 2MINB 1JQKA 4YRIA 1KA9H 1SO8A 4Z7JA 1O0CA 2V1XA 3QKSA 3T4UA 2EGGA 3O21A 4YRFA 2QRGA 1US8B 3GGSA 4MWOA 3GYBA 3T1QA 4J3FA 1PJ8A 1ZUHA 1E1KA 2Q49A 3GQVA 4C7OA 1B26A 3W3AH 1WBDA 2ZJZA 2LKDA 3PWTA 3BH7A 3EF0A 2C5SA 4YCBA 2D8AA 3L41A 5EZQA 4GQBA 3TPCA 4UNIA 5KYKA 1QE0A 4P6VF 4C1NA 2JLZA 1GQRA 1YASA 3N9IA 4QXOA 4DV0B 1BCRA 4BE7B 4D8UA 1I0IA 2ODNA 1PLJA 2W2XA 4TZ6A 3OLQA 3WNVA 1TKCA 3PR3A 3NTLA 4CODB 1IEVA 1PJZA 1MABB 1TZKA 4P22A 3M4NA 5K3AA 1XJCA 1IY1A 5DCYA 3ET4A 4CKWA 1QUFA 1W49A 2TMGA 2GD0A 2PMWB 4YB8A 2JFUA 1UBKS 3FBTA 2HDWA 4LWPA 5CR9A 2IS2A 4HEQA 5IT9A 3AFHA 3M8KA 1OOEA 3R40A 4RVUA 1EI9A 5TF4A 3T4PA 4CDGA 1M8KA 3ETEA 1ISGA 3JAKA 1CZHA 2JLSA 2QMEA 2EZ9A 1CJCA 1SVNA 4Y2VA 1BTOA 1I1QB 1RBQA 3ICCA 3RNOA 10MHA 2FX2A 1X86B 2MCFA 2D59A 2ZVDA 3GEGA 1Z9BA 2P0AA 5F23A 2I4IA 3RUAA 2O54A 3WLQA 1NMZA 4UHCA 1G8AA 4WY8A 3N2NA 1QFXA 4INPA 3D3EA 3MFQA 3UC9A 1Y82A 2OAQ1 1R6AA 4H4DA 3KKMA 4TTRA 4XARA 3LK6A 3ZGOA 3C3JA 4Z86A 1NXTA 1M8GA 2ZQYA 3ILXA 2BZGA 5LYJA 4EY8A 4OKSA 3QITA 1L4UA 3IERA 4DIUA 3V55A 3QEAZ 4MQMA 1WBJB 1XGKA 1IM8A 3EGOA 3DDOA 2XF2A 4TT8A 1JT9A 4DV3B 4ZU6X 3T5DA 2C2KA 1KAHA 4Q9JA 4ERXA 2D0OB 2UUBB 3VJRA 1WD5A 5C81A 1UJCA 1SN7A 2B99A 3L1JA 1GGJA 2G70A 5IVIA 4B76A 2QIPA 4OPMA 3U7FB 1GLGA 2XIQA 3GRAA 3KJQA 3A58B 3G2KA 3R7LA 2CV2A 3DW3X 1QK5A 3FF4A 5E1OA 3GB9A 5KNCD 5TGZA 2QDXA 3KQVA 2FOXA 2QUAA 1JJBA 3PDIA 5A05A 1G2QA 3B89A 4TTAA 4J9UE 4NCKA 5H70A 3LW7A 4KR2A 5DGDA 4C0LA 3CVVA 3PHHA 1DQZA 4J3JA 2Z30A 2E1PA 4WNCA 5LZ9A 1EZZA 3AG5A 3BFXA 4W82A 3ISVA 3KSRA 3EUAA 4YUWA 3FPSA 4CEJA 4DR7B 4ENRA 1I7DA 4ZAYA 4JEHA 5IJ9B 2FHPA 2R6AA 3H3JA 1NUAA 3BH0A 3I05A 4TSKA 4RH3A 5BSHA 1CQXA 4I55B 1L5KA 3CLRD 1QCDA 4LHXA 5DLQC 1TO1E 5FIUA 3TMAA 5ELXA 2XUHA 3DHEA 4XVCA 3AR3A 4D0RA 1GUZA 5ALIA 1OLXA 1T4CB 5TVGA 2RHGB 1XNJA 2AW3A 3EQ7A 1YNSA 4CMEC 2PUCA 2CUNA 1LX7A 3RYHB 3IMCA 4KE8A 3EGVA 4DV5B 4LK3A 4NYIR 3WK4A 2WKSA 2VNJA 1BJKA 2RK4A 5FUWA 2ZPAA 3ABQB 4URHA 4KK3A 1B93A 1PIWA 4RIFA 3P9CA 4QAQA 4U0JA 4V0MA 4MJ3A 2YYAA 3GGCA 3W5AA 2AFIA 4WZAB 4LC1A 2FW8A 3UENA 1MAAA 5BW5A 3KVNA 3PHJA 1LJUA 5G4KA 1JGTA 3THXA 3HWX1 4WEOA 4PVDA 4DLWA 3T5TA 5CFNA 2PBLA 1NKSA 2BSQA 2P0EA 1F1BA 4QLOA 2PM8A 2H4YA 3NJRA 4PYNA 4YJGB 4M76B 4ABTA 3W5VA 1X7XB 3JW8A 4RNDB 4AD8A 4CV2A 2HHLA 4KQIA 2ACVA 3GLIE 1GGHA 3GHHA 5DX1A 1X7YA 1U8UA 4G9GA 4P32A 4EPRA 5AK3A 4KUGA 1N6OA 2XOXA 3IMKA 2H7VA 4ZU1X 3KOWA 2RHRA 2H4JA 4OFZA 4L6IA 1JTFA 1T2CA 3BEDA 4YCLA 3BSFA 5KVCA 3W77A 5A6VA 5SZJA 1MH9A 2ACEA 4C0QC 3CONA 3LA8A 1ITZA 2IPNA 3RANA 2GLTA 1ZVQA 3U81A 3P9XA 2W83A 5CFOA 3OJFA 1GL6A 4MW1A 5HFNA 4V0ME 3H11B 3O9ZA 3UJBA 1C9MA 1W73A 1D2MA 3MRTA 3CEJA 2N46A 3OE7D 4J43A 5ALJA 3W6ZA 4ALNA 6REQA 3PTZA 5IKPA 1JLSA 2P6MA 3PYLA 4QTUB 4N47A 3G1UA 3G0CA 2O07A 4BNNA 1OA1A 1HDIA 5K0CA 1JAYA 3W6UA 3HYCA 3K53A 5KJ1A 1FBTA 1YDFA 2EKPA 2YC2C 1DLJA 3JZIA 4Q9LA 1RPAA 4X9XA 2AN5A 1LBTA 3M6XA 1KH1A 4AKTA 3LY8A 4B31A 1T8PA 2QX4A 3EVAA 4EY5A 4YAGA 5K0ZA 2GJAA 3AYZB 5TRTA 3S2YA 4BNUA 3FOWA 3HRKA 2GEDA 4DA4A 1MQ8B 4KNWA 1BDBA 3FUVA 3KG2A 1DX9A 3IPXA 4BY9E 3VHRA 3O91A 1DBIA 1H0KA 4ONEA 1UEIA 4GRDA 1HGXA 2HMAA 4PHFA 3T61A 4Z9XA 4C08A 3KKNA 1FLNA 2P79A 3VU9B 5LZ7A 1R2QA 3GZTB 3UAXA 5IJ0B 3I8SA 4QDJA 2ATCA 4C5CA 4Z4IA 5F76A 4WY5A 1L4MA 1RXEA 4PZZA 2X1VA 1FFSA 2BT4A 2G5PA 1Z2OX 1DEOA 1T0BA 1B8PA 3OQIA 4IGEA 1XDZA 4O4IB 4ZEOA 3ACCA 1DNPA 1F0NA 1Z29A 2OQ2A 3MTGA 4URVR 3DKRA 1L7EA 3VVMA 4MQUA 4TM7A 2EW2A 1WQ3A 4RLFA 1C2TA 5LYYA 2Z95A 2HZBA 4YP7A 4WCFA 3GCWA 3LP5A 1I6WA 4N12A 3G0DA 3ZG6A 1VJGA 4XYMA 2HIMA 3TGLA 3LUFA 2C2WA 3HEMA 1PSWA 3FXAA 4NZOA 5CW2A 1YCHA 4B34A 4ZK6A 3WSWA 4FE7A 4ZMSA 1HDCA 4LZPA 3F3SA 5AKYA 3LDFA 1ENZA 3NP9A 3VTKA 3CCFA 4ER3A 1M10A 3N8HA 1A04A 2MSCB 5IAKA 5CJPA 5AVYA 4WZBA 1DDOA 5EP2A 3EVEA 5KCZA 1D7OA 3FNQA 4XUEA 3MCWA 3I92A 2QV0A 2XMCA 1OGYA 4UEWA 1WL8A 4HDMB 3UQYS 3ZC3A 1SC6A 4B3BA 4X6LA 3WYBA 1U3FA 4EL5A 3KQHA 1U9IC 3RWBA 3D5TA 4QYIB 3B6ZA 3THSA 3TECE 4DSAA 2YHAA 3SQXA 3B48A 2R79A 3DZIA 4HVAA 1GVHA 2GAFA 2HNBA 5GP1A 3IGFA 1ML3A 1ZL2A 3MJCA 2XMDA 3D3KA 3O1JC 2IYYA 4JJAA 4YJ3B 4I4TB 2Y1CA 3EIHA 5JISA 4I50A 3ZUGA 5DSXA 1N8SA 1GPAA 4G0ZA 4UASA 3TCXB 2YYYA 1UWVA 1YUNA 2ON6A 2I6SA 5AOAA 3TQOA 4EJFA 1AQJA 4MV1A 4FJ2A 2HCFA 4PM4A 4MYCA 3DZFA 1W48A 3NHPA 2R11A 1I3KA 4IFEA 2CLDX 2O59A 1TGYA 1XD8A 4RJTA 3PVSA 1BGXT 2XKKA 2AC4A 2V7EA 1ZY2A 1ISJA 2ZKIA 3FPKA 4EO4A 1GCUA 1O96A 2H2DA 2ZIUB 2C5EA 5CX1A 4Z9AA 5HUJA 3BL6A 1FQKA 1LNQA 2PAAA 3KZXA 1AGRA 3N0TA 1MIHA 4OUDA 4YDHB 2VQFB 4MPPA 1DRJA 1GL3A 4MNTA 2RIRA 3S68A 3X1JA 3JS5A 1FZTA 5EWLB 2F1RA 4YALA 2HQSA 1Q44A 4G8JA 5IC6A 3HJFA 5CDYA 4YECA 5EI5A 4X3PA 3QFFA 4LX8A 3FYUB 3RARA 1ENOA 3GJ0A 1J25A 1P7ZA 3RBVA 1UJ2A 1M1YE 1V9CA 1PT6A 1G8HA 1SG6A 1C3OB 3RIHA 4C4OA 3N1UA 5AW3A 1X1CA 1ZIOA 2CF6A 1NPDA 2Y71A 3EK2A 1G42A 1U7WA 3ID6C 3NBKA 3PDUA 5KX5B 2F1HA 2WNHA 2B82A 3OPYI 3OTQA 1E2GA 4H18A 5HX7A 4EGJA 1M7GA 1OZHA 1VL1A 3G0BA 3L6UA 4JJ8A 3TBFA 5EC8A 2G7ZA 2IYXA 1ZGCA 5E38A 3BMQB 3TEMA 1JE0A 1DOZA 1HFKA 4PLCA 1YA6A 4UC0A 3PD0A 4AYWA 1X7ZA 4KQFA 4MGKR 1GTVA 5FPYA 5K8TA 3HCBA 1G5FA 1JN0A 4NNOA 1N25A 2D1SA 4L07A 3GG2A 1XDDA 2OV1A 3NLLA 1TMOA 3P0RA 2Z5LA 3HO1A 2W8BA 4CM4B 3TF5A 4KIGA 4TGLA 4F6CA 3IIEA 3RE1A 2X6RA 1EA5A 2GAAA 1KYXA 1EWVA 2XWPA 3H5RA 4Y18A 5DLPA 4EI2A 2PE5A 2X41A 3UGJA 4XPIB 3ZHUA 3QV1A 4CIAA 5F12A 1MC4A 4R1NA 3TLCA 2Q4OA 5FA6A 4OXQA 5J5CA 3Q3HA 1XMXA 1K75A 2R48A 1QKKA 2AG0A 4F3YA 2GJ4A 2JKYA 2E4YA 3W3AD 3FNGA 2IV2X 1AKTA 4BEBA 2XAAA 4JOCA 3RVPA 3IE1A 4IEFB 3C15C 1Z07A 4H6VA 1G8JA 4TQAA 5DTIA 5IT5A 3EC2A 2UVPB 1IUNA 1CUBA 4IYJA 1UMBA 4OHOA 3MYYA 4F86A 1XCGB 3F6EX 2P9QA 4LMBA 4KNYA 1QF7A 5B7GA 3ICVA 1E7QA 1TEXA 2BM9A 1MP0A 2G6TA 2WM9B 3Q41A 3THOA 3PE4A 2VJMB 3K1YA 3CUVA 3TCNA 2OGZA 4RY8A 4Z7NB 5DN6A 2GF0A 2IW3A 2OMEA 3LCUA 1QK4A 2Y05A 3K2IA 3GGGA 4ZC8A 3ZLJA 3Q3VA 3I01A 5JD6A 3K3PA 4L4RA 2FMTA 1GG5A 2WJVA 4ENTA 2VO1A 4F3RA 3ZWQA 4IDFA 4P4TA 2W2KB 4H35A 3NBYC 2W6QA 2H63A 3Q5DA 3HBLA 4PV7A 5K8VA 3SG0A 4UUAA 3L46A 3IODA 1U5AA 1E5XA 4UNQA 4WA8A 2RGRA 1Y6JA 3AESA 3SX2A 2JBAA 5F9MA 4DIOA 1HLGA 2LE0A 1A27A 4B6OA 4ZOEA 1IIRA 2JARA 4FYXA 2VZ0A 4B6RA 4OXRA 3G85A 3VHQA 5HEKA 1EVYA 3I0ZA 4GI1A 1MJNA 1UJBA 3DUFB 1IAVA 3LZCA 4OM7A 1C14A 4UM5A 3RVJA 4Q6BA 2HK6A 1V1JA 4X91A 2G17A 2SICE 3TGPA 1KNXA 1U0HC 3NYQA 4O2AF 4Q00A 4WFKA 2XOKD 1LJLA 2CXQA 4G5FA 3X2SA 3EC7A 1NVMB 3NEYA 2PCJA 1KIMA 3GN1A 1NVKA 5DB4A 5TQJA 5CA1F 3ZNNA 3S1LA 1JJFA 3CRVA 5IW8A 5KX5F 5E2AA 5KNBA 1IY2A 2AG6A 3FNRA 1EESA 1FU7A 1MMFB 3VGPA 1GU1A 3BIFA 1UC5B 2M1XA 4RELA 1XL0A 3TIVA 2NPIA 5EWLA 1FX0A 1SEVA 1BX3A 4DSUA 1KI7A 4F4IA 1VM6A 4TMWA 2WF9A 2PVCA 1QAMA 1PKEA 1TU0A 1VSUA 3NH6A 4JXJA 3KT3A 3VDRA 1CIJA 4AX8A 3QLUA 4BVLA 3Q7TA 1Z6TA 5KTMA 1YR2A 1NVDA 2YY7A 2EGHA 1II8A 1STOA 2BP7A 4EP1A 1U28C 5G02A 1ZRMA 1QV6A 4I19A 4NMMA 5HNKA 3LYUA 3BMNB 2BBOA 2XTAA 4HH3C 4DSTA 1NWCA 4MLPA 4FT4A 3UJ9A 2WEKA 1WPXA 3NC0C 4K5QA 3LHKA 1J23A 2X19A 3E84A 4J7CA 3UGQA 2GAOA 3U4AA 3GMTA 2CDNA 1JFTA 5EJ7A 3EQ8A 4WZAE 1VSVA 1MF7A 4JGGA 5CT4A 4I4NA 1T6XA 1YR9A 1UMDB 2N1BA 2ZYVX 4I7EA 4IHJB 1F7UA 5MN6A 4QO7A 1W2GA 1GOTA 1VIMA 1ZKMA 3KZMA 2P0YA 3KE9A 5F33A 3HXOA 2DEUA 5L3ZA 1ABEA 1JQDA 3W5BA 1CZOA 3HCFA 3M6UA 1FP2A 3HDHA 1PS0A 4KAFA 1L5RA 5JWHA 3CF4A 1SFRA 2QJTA 3ZXIA 1NXXA 5GV8A 1P2DA 1N9GA 2FMKA 3P0HA 3S27A 1BE6A 2XBLA 4Y2RA 3W34A 2JVKA 4HDRA 4OHBA 3ANMA 2DJ5A 1K27A 3A6GA 3IYLW 1EGMB 4GC5A 1B42A 4BX0A 1Q7EA 4F3KA 2HBYA 3QEKA 4D26A 3WO1A 4JUDX 4IDOA 4H3HB 3I2IA 5KNCA 1D0SA 1YA8A 1CRLA 2DY0A 4MW4A 3JSAA 2F64A 3K4PA 4YH1A 5D84A 4KHZA 4YJ3F 1QO9A 2HMTA 3WGNA 4M8KA 1Q3HA 4D8YA 2AFVA 5LMCA 2YZMA 3MJTA 2KS6A 4HNVA 4WZAA 4PRZA 4F8YA 1YQWA 3TQCA 1ID1A 4A2WA 1OXBB 5FH9A 4GOXA 1TFRA 2EJCA 3U31A 1YJAA 2I1VB 1TM1E 2ASEA 4H7PA 1TW2A 1Y1QA 1CQIB 3EH1A 4EUHA 5J63A 3I61A 3EUWA 3LUDA 4EHDA 4L85A 5H02A 3CRQA 3ELYA 1Z56C 4EL0A 3RPEA 1EIZA 2KWIA 1AGYA 4J6EA 3WMXA 1SVOA 1QYWA 2DOKA 4ZCMA 4IUDS 1N3BA 2H2GA 2PX8A 1DX6A 4PYIA 2P6RA 3D8SA 3I6ZA 4IRMA 4MQFA 1V37A 3CW8X 1UDBA 4YDRA 5IJ9A 4LWZA 2O1SA 5K6AA 5GONB 1L4FA 1R4ZA 1MU0A 2EWMA 1SOVA 4ZVLA 5JRJA 5LKAA 1KFBB 3L6DA 4BN5A 4KVZA 3CJQA 1E2QA 4TS1A 1JIQA 4R9SA 3FTNA 3TZKA 1JLRA 3EGDB 5I7EA 1BVUA 4I5DA 2VDJA 1FJXA 2OG1A 1LV7A 1XNRB 4KO3S 4TKMA 4OA8A 1B1AA 2WWWA 2XT0A 2A5YB 3AFMA 3AV0B 3OZTA 4XX0B 3RJ5A 1U7OA 3BXHA 1I13A 4N6NA 1E2IA 2QMYA 1CFZA 3DR5A 2PVPA 1HFWA 3SLKA 1WETA 1SQ5A 2YIVX 5KNLA 2RGGA 5MGNA 2QYTA 2F9MA 3RQIA 4YCDA 1T1IA 3L4BC 4RV4A 4B2LA 2AUMA 4A5SA 4RHFA 3UH1A 3D2LA 3JQAD 1CEQA 5BSMA 3D8RA 5B4UA 2PZJA 3K0EA 3G5LA 2P90A 3JQ7A 3Q4GA 4MEAA 4TUYB 3P97A 4YJGA 1M6WA 1DC6A 2X4DA 2O5CA 5COAA 2IOFA 1MO4A 3B8HA 4M83A 1Z7WA 3JZDA 3UOGA 4I1OA 2AJCA 3EDRA 3HKEB 4GKAA 3M3PA 4K9PA 1N4AA 2NV0A 4B8ZA 2C2ZA 3AB3A 3IQWA 5AUQA 3T5MA 3NHMA 4CUJA 1A96A 2UKDA 1OLUA 2ZJ7A 3LIIA 4J0EA 4YMIA 4YDQA 3NBXX 2CXUA 4EOGA 2QS9A 2XUDA 3NQ41 5CHYA 1IUKA 2DHEA 3BJMA 2O57A 4GMDA 2YHIB 4DZZA 4GL2A 2XMPA 1M8PA 4RXTA 3RYHA 5FTNA 3SZUA 3T06B 2VK8A 2OORC 2VH5R 3V2UA 4IBOA 1ZJYA 3D4OA 4QQFA 1E59A 1KI8A 4L4YA 4OCZA 2VG8A 2IDKA 3ESBA 5FO1A 1XDSA 5D8DA 4WKCA 2XZTA 1UQTA 4OX9B 2ECQA 3T7SA 1EJBA 1X3LA 5AK0A 3RF7A 1BZYA 1ZK3A 2J4DA 1ZUD1 3D7NA 4K9SA 4Q12A 4TX1A 3HJBA 4U2CA 4UAGA 5DLYA 4HLDA 2Q5FA 3TRHA 3WB1A 1R8SA 5G0TA 4M1SA 3V4PB 5LQUA 4IIBA 4Q4AB 3QPAA 5D2CA 3PLRA 5SYNA 3CRW1 1G291 3F67A 2BI7A 4J4HA 3WTCA 3A36A 2BMFA 3PWSA 2X5NA 2HW8A 1MAHA 3BG5A 1U0TA 4L4UA 1EFPB 3ESYA 1ETUA 4K2AA 1CERA 2ZIFA 5HZGA 3OESA 1KZ9A 1MJ5A 2TS1A 5FWDA 1I3OA 1ZVKA 3C7AA 2ZATA 3CKYA 1H3NA 3PEEA 1IATA 3EQZA 3VKFA 3LY5A 3IO3A 3WK5A 2FK7A 1PWEA 3LI2A 4JZYA 2DFLA 5BSTA 4D3FA 4QYXA 5LIRA 4ZGWA 5MN5A 5IKXA 1O6FA 3FPHA 3H9QA 3FDIA 1V9LA 2YX1A 4OHPA 4JASB 4EYOA 4F8EA 2BI4A 2VWGA 4DQKA 3V1NA 5FTJA 2H1OA 2XLBA 3QJGA 4MHOA 2XYGA 2C4TA 1MAUA 3PX7A 4E03A 3R24A 2YUIA 2IXTA 4JP3A 3LCCA 3JRWA 3EVBA 3Q11A 1FTYA 2C9OA 1V95A 2HJGA 2VSQA 2ZWPA 5IC4A 1A7KA 4AJEA 3L18A 4LX0A 4FJ0A 3M1YA 4P3NA 4TTQA 3T7DA 3IVMA 4W8HA 3EVGA 3FOAA 1N2XA 4YMTA 2AS0A 4PSUA 1J5PA 2OYSA 3JQAB 5J3JA 3FKQA 2E7ZA 2Q8NA 4CCSA 5JZSA 1DAGA 2A86A 2VUSA 2Z2XA 4NSNA 2BTQA 1V1RB 3CPSA 4L4XA 3N6VA 1TAHA 1Y42X 2GXQA 3PNLA 5AXDA 1CVRA 4LSWA 1A9RA 1VRWA 1PGOA 1O4VA 3HH8A 5DOZA 4DEYA 1PV1A 2IPAB 2LXNA 5DYGA 4YAJA 1T9KA 4RDIA 4OK6A 1UM9B 3DCJA 2IBMA 4ZJPA 2YVLA 2I3GA 1VCMA 4C07A 5IJWA 4V2IA 2WVGA 1M2OB 3PPWA 3IXMA 5KQPA 3KQUA 1KYVA 2Q3CA 3WIBA 2F8TA 4K87A 2UZ3A 3AKDA 3MD9A