3UIEA

Crystal structure of adenosine 5'-phosphosulfate kinase from arabidopsis thaliana in complex with amppnp and aps
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
191
Chain Sequence
CSVEKVDRQRLLDQKGCVIWVTGLSGSGKSTLACALNQMLYQKGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLLPEGDFVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Adenylyl-sulfate kinase 1, chloroplastic
publication title Structural basis and evolution of redox regulation in plant adenosine-5'-phosphosulfate kinase.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 80
structure length 191
sequence length 191
chains with identical sequence B, C
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uieA00
4L8GA 4ARZB 2XB2A 1MRSA 3WRXC 3KQKA 3EIQA 2FV8A 3LWNA 4I1VA 5BN4A 3QKSB 3HDTA 3D7MA 4OI1A 1FNMA 3BXZA 2C98A 4DLSA 4BFYA 3QXCA 3W8NA 2BM1A 3O8RA 3B82A 1ZNXA 2VHJA 3FTQA 4DSNA 1ZAKA 3EAQA 4OK5A 5KSZA 2QE7A 5IT5A 4TYNA 1E0KA 1FMJA 3Q5EA 3NC1C 3RWOA 2YINC 1W46A 1XBTA 3N5CA 2C95A 4DVGA 1OE0A 3K9GA 5AUOB 3K0AB 4KI0A 3FHCB 4KFSA 2BJVA 5DHFA 3R7WA 4HATA 2PLRA 4KAXA 4PHHA 5E3HA 4A6XA 5GVSA 2QNRA 5J47A 3X2SA 3A4LA 1T8UA 1YZTA 2FWRA 1JECA 2ZAOA 2YVUA 5TXGA 1E79D 2HCJB 2O0KA 1D2MA 1KK2A 1NMYA 4M9ZA 5FBRB 3SYLA 5JRJA 3GMTA 4YDHB 4LBYA 5JWHA 2IYYA 2AKAB 5EZ6B 5BW8A 5TARA 4NZYA 1NKTA 1GSIA 4JBYA 1T6NA 4DUGA 4C30A 2X77A 4GI7A 4YMVA 3K0CC 4V0NA 1WB9A 4DDTA 3H2YA 4WAUA 2B8TA 4LSGA 4P31A 4NHOA 2O8DA 4PPNA 4KJZA 1G19A 2FU5C 1T0HB 3NHAA 2GXUA 3QVVA 4LGMA 1CIPA 5FBQB 3ZQJA 3RRZA 2Q6TA 2BMEA 2VP0A 2ZE5A 2NTYC 5IDVA 3LVRE 1IXSB 4BEJA 3W6OA 3PUVA 5EXSA 2P65A 4IVQA 2O8FB 1PJRA 2A3RA 2IF0A 4LY6A 4DCSA 1JJ7A 5J4HA 1ZVQA 4Q18A 2FZLA 1SGWA 4NCIA 4TSFD 3CH5A 4PSVA 1T0JB 3A1SA 1CJMA 3CX6A 1B0UA 2FFHA 2VYFA 1QG4A 2RB4A 3PUZA 4JKIA 2ZANA 3ADKA 4YMUA 1VCIA 1ZD1A 4JVMA 3MWJA 4OI4A 5HCIA 1BMFA 2GKSA 3KKMA 2J7PA 3AEZA 4NH0A 3UG7A 4P0TA 4W5JA 3KUCA 3THXA 1NY6A 4QJ5A 4B3BA 2RH5A 3R9WA 1Y63A 2ZITA 1R5OA 1XD2A 1NVWQ 4TMVA 4ZV4A 4OBEA 2DFKB 4G5GA 4XIGS 2WPDA 1S4QA 2JAQA 3O8BA 1II8A 3UK6A 4RKEA 4M21A 1DAHA 3U3RA 4B2LA 4M1YA 1SVLA 1XEWY 4TMWA 3G0HA 3MCAA 4EKDA 1EFHA 1XMSA 4D6PA 2R6GA 1EG7A 3FHOA 1KJWA 5HZHA 3QY0A 5HTKA 5J5CA 2ZI5A 3I5XA 3JVVA 1DAFA 2ZIAA 5H68A 2O8EA 2CE7A 1JAHA 3OE7A 3KQLA 4LWZA 1EFRA 2HT6A 1T91A 2O52A 4IDPA 4NCKA 5DYGA 1R4AA 5UKDA 1UFQA 4EAQA 2MSEB 4B3GA 2REOA 1YZGA 3AKYA 1FUUA 3PG5A 1T3SA 3B1VA 3MWLA 4UNRA 5FPKA 3R9XA 2W0MA 3IQXA 1X3SA 4LJYA 3T5DA 2BBWA 2CK3D 1TQDA 2YJTD 4IOLA 1KY3A 1JNYA 3L43A 1UPTA 4JVSB 2WJGA 4AYXA 3W5JA 3I3SR 1AQYA 4R2IA 3S1AA 2QSYA 2DCUA 4LBZA 4Q4JA 2ORWA 2IXEA 1NSFA 3GJ4A 4RKFA 1FUKA 5L3VA 3C8UA 4KYUA 3MJRA 4CEHA 4LOAA 3EPLA 2A78A 1YR7A 1RYHA 4FINA 4P4SA 4CF7A 3AVYA 1CJKC 4LJ5A 3Q3JB 4ZI3A 5EQTA 3CLVA 4ZIRA 1ZBDA 3K70B 1AKEA 1M6NA 2W2XA 4MGYR 2QTFA 3THXB 4RD1A 3TQCA 2R2AA 3BERA 1K6MA 2GEDA 3GEHA 1ZNWA 2F3TA 1XD2B 4MRVA 4DDWA 3TE6A 2DBYA 1P73A 2WWIA 2G9NA 2LCFA 3MLEA 1Z0FA 2QE7D 2AWNA 5CJPA 3T1VA 3ND9A 4F4IA 4OL0A 1VCNA 1II8B 3IO5A 1L4UA 4Q7KA 1GNPA 2W2TA 5CYPA 3U6KA 2OAP1 4L16A 2ZEJA 1XPOA 1H65A 4IJMA 2PLFA 3HWSA 1TF7A 3AKDA 4OI0A 1G291 3I5YA 1JJVA 4MGZR 3EZ2A 4J0QA 1KKLA 3O47A 4P33A 1XD8A 4WVFA 2VBCA 3SYNA 3T1QA 3NC0C 1OFHA 3VX4A 3AM1A 5G40A 1PUIA 1R2QA 2QMHA 1BYIA 4DUGD 1Z0JA 1GNRA 4HAZA 2ZJ2A 3EW9A 2V3CC 4Q9HA 4C4PA 1R6BX 2QL6A 4LK2A 1K8RA 4NCHA 1NJFA 3QPUA 1G1MA 4KVGA 1WCV1 4D0GA 1ZD8A 1E69A 4EQ6B 3CW2A 2GF0A 2YC2C 3I92A 3S1AB 4LI0A 1VKJA 3TBKA 4A1FA 2QAGC 4WZAE 4Q4JB 1SZPA 3B1YA 4BZPA 2XB4A 5J4KA 1W0KA 1E32A 2Q9AA 4MH0R 1IN4A 3LBNA 1YZUA 4CEHB 4UKDA 3RDPA 1GL6A 4WA7A 2HJGA 4P4SB 4EJSA 1N6IA 1UAAA 2C9CA 3FE2A 3I8XA 1IOZA 1RVDA 1MR3F 1JQLB 2JASA 1DADA 4ZIRB 4KFRA 5H8WA 3QG5A 1MO5A 1A2BA 5HKKD 2MSDB 3FMOB 1BMFD 4UQOA 2V7QA 2AD1A 1WP9A 2VPPA 3NKVA 3K70D 2J7PD 3AF2A 4DEXA 1RC8A 1ODFA 1W2GA 5K8LA 2HLDA 3BB4A 4ZCLA 4PC1A 4QGHA 5AJZA 3X1WA 4OHXA 4EFMA 2NQ2C 4EPRA 3RS4A 4GT1A 4U5XA 1SVOA 2ZREA 4Q02A 1MKYA 2ODNA 5EP4A 4HUTA 2YOGA 1JPJA 2XITA 3KL4A 5KNCA 1P7CA 2WPDD 3R9IA 1PLJA 5KDDA 2CEAA 5FPSA 3FKSA 2JJ8A 1NN1A 3LY5A 3LXRA 1W4AA 1QHXA 4XD7A 4KFUA 2R9VA 4LYAA 5KTYA 4QM6A 1U90A 1GDDA 1HT2E 1Q1ZA 3LVQE 4EDHA 2XZLA 4B2PA 2X19A 2Z43A 2FJUA 3OFNA 1KI8A 1E0SA 4PAOA 4JJZA 2QEQA 3CNOA 3VR3A 2G77B 5E7MA 3DHWC 4A0FA 2FNAA 1YVDA 1HQCA 3PEUA 1YR6A 4DT1B 3OE7D 1RPZA 1U0LA 1GL9B 2X2FA 3LBIA 3P1JA 5M04A 1EFRD 1GITA 4C2TA 2GVZC 4RY2A 5F98A 1U98A 1G6OA 1X8KA 1Q20A 4QC2A 4M9XA 1E9DA 3K0CA 1E94E 4TYQA 2BKUA 2YZ2A 1WMSA 1XMJA 3CONA 1DOAA 1VTKA 4DRZA 1NIPA 3VR4A 4P3YA 1QZXA 1XDBA 1PZNA 1NLFA 4XSHA 4JLKA 1JXMA 1U94A 1AS3A 3FKQA 2PH1A 2IBMA 2XEXA 3SOPA 3PJRA 2WICA 4HLUA 4A8JA 3QG1A 3Q7PA 2NZJA 2R6CA 2WIAA 3A4NA 2QM7A 1MO6A 4QHTA 1MO4A 4WIAA 1Q3HA 4KO8A 3LBHA 2ZETA 4KSCA 3TLXA 1CU1A 1ZIPA 3DO6A 3AGQA 4KU4A 4LPSA 4TLAA 2ZJZA 3K53A 5DLQC 1LFDB 1JB1A 5J40A 3ICEA 5FL7A 2V9PA 4PHGA 2F1IA 5TV2A 1NY5A 5JMTA 4IHQA 2IHBA 1OLOA 4HAXA 5H70A 3KZ1E 4DZZA 1W0JA 2B6HA 2QORA 1PVOA 2G3YA 1AA9A 5IHPA 5DN6A 2QMUA 3Q5DA 2WOOA 3ECCA 1KGDA 4YMSA 4GL2A 4M1TA 1AZTA 3HYTA 1SULA 4TQAA 2WIBA 4Z8YA 1S9HA 2EYUA 4JIMA 3UWOA 4FW9A 4JJKA 1P4SA 1FFHA 2ATVA 3QJYA 4DKXA 4BWYA 2WAXA 3CB4A 1KAOA 2SHKA 3QEJA 4AKIA 4C7OA 2CL6X 4R98A 3T06B 1N5LA 4URZR 3UIEA 4LC0A 1FZQA 2NPFA 4GP6A 3ZD6A 2EYQA 3CRQA 2I3BA 4IDHA 4DC9A 2JIZA 1U8AA 1H8EA 1P75A 2KWIA 4G5QA 4BLTA 3WMGA 3PUXA 1BYUA 1YRBA 4BZXA 4AWXA 2WJJA 2RGEA 2EQBA 3R20A 2H1LA 3RS0A 1M7BA 3ZLJA 2EU8A 2Q9CA 3OESA 1Q1EA 4D0NA 1FMLA 2ZRLA 4A15A 1T5IA 1F5NA 1NI3A 3QOFA 4HAYA 4YQFA 1IXRC 2ZRFA 3QSYA 2PMDA 4AIIA 4IFBA 2PZGA 4HZUB 5JI2E 3I32A 1G5PA 1ZUIA 1W0KD 4CRWB 1L8QA 2VSXA 2C9YA 4PZLA 3VU9B 1EFTA 4NYMR 4PAQA 1RW4A 2AFIE 4H9GA 1FTSA 3EWSA 3ASYA 2CXXA 1XZQA 2QP4A 1WRBA 2ZJYA 2YV5A 2OUKA 4MRRA 4OK6A 5TVKA 1DAKA 5D3QA 4YMWA 3VX3A 4B32A 3GLGE 2ZRPA 4MITA 4POAA 3GLFE 1DG3A 3GLGA 3TSOA 4AYWA 4TYWA 1V5WA 3KJHA 3PR1A 3IKJA 4I1SA 2V7QD 3AF1A 3J81k 2FN4A 4F91B 1U0JA 2Z0MA 2GCOA 2HLDD 3F5FA 2IC5A 2G1JA 1VG9B 2DYKA 4DCVA 3NVAA 1OXUA 3QUSA 3UANA 4XWOA 3EZFA 3K9LA 2AHOA 4FMBB 1W4RA 2VSOA 3NG1A 4IXMA 4NYJQ 2QY9A 4BFXA 3B9QA 2XNDA 1KYIA 4I1OA 3PFIA 2IUUA 1ONBA 2ZE6A 2FSHA 4MUBA 4B35A 5A4JA 3FKSD 4RJLA 3HR8A 1NVXQ 4XD7D 2HXSA 1CJVC 2ZRAA 4Q4LA 4URUR 1XTKA 4AKEA 2A5DA 3PV0A 2ERYA 2VP2A 5DH9A 3NDPA 5L3RA 3VKWA 1XPRA 5FPHA 3B5JA 3ZZTA 1YKSA 1Y3AA 1KK0A 3OFND 1LV7A 4KSBA 4FIDA 3U7GA 2WSMA 2ZJ5A 1R8SA 2A5YB 2DB3A 4HUQA 4LV5B 4JVLA 3C16C 2UVQA 4ZI2A 2ZU6A 2GXAA 1Z6XA 3M0EA 4AI6A 2AN9A 2OCYC 4MYUA 3ZVNA 1OYWA 4OI2A 2HJVA 2J87A 2AD5A 3IHWA 4LJ7A 5FOTA 2RGNC 4EPWA 1G7TA 4KYIB 2YOHA 3GJ0A 2IL1A 3DMDA 5C18A 1QVAA 3I61A 2ZQ5A 1I4DD 3CPHA 4PPQA 5IF9A 4LDJA 2E1RA 2ZYTX 3Q9LA 8OHMA 4O2LA 5HE9A 1UADA 2GTPA 4MRNA 1Z83A 2Q3MA 2BBOA 3B6EA 3LX8A 4RD6A 3ZYCA 1E9EA 1M2OB 4JL5A 421PA 1E79A 3QXXA 4QBIA 3GFOA 4DLRA 2JDIA 3LRPA 1HT1E 2X8AA 4HLQB 3QE0A 5CK5A 2F1HA 2ZYWX 5CLLA 2WHXA 4B73A 5FL7D 3HU3A 1E2DA 1MABB 3GLGB 4D0LB 3ONWA 1RYFA 2OT3B 3HPQA 2FF7A 1HEIA 3GLFB 4W5WA 1HTWA 4CIDA 2JLRA 5J4YA 4RZUA 2ZU0C 2IYRA 3GCGA 1W0JD 2XJ9A 1Z28A 3MMPA 3AUYA 2FE4A 5DSZA 4TQ9A 3X1DA 1IN5A 5JEEA 2V55B 4YLGA 1CF4A 4L5BA 4N3NA 1OSNA 2PBRA 3W3AA 4IFEA 3LAWA 2BC9A 1E2GA 1F60A 4LJ9A 2VP4A 1VYUA 3SJAA 4JS0A 2CHVA 3GD7A 1P62B 2BMJA 4JSYA 3R8FA 4EFNA 2WVJA 2EVWX 3DM9B 2C04A 4PC2A 2RHMA 1JPNA 4Q48A 3RWMB 4KHZA 4C0BA 2QMEA 3NEJA 2C03A 4ARZA 1LW7A 2JIZD 4O0MA 1F2UA 2FGJA 1KNXA 1H8ED 1KI9A 4GDFA 1F2TB 2ZI9A 2ZUDA 3RAPR 4PC6A 3SJZA 3WBKA 4HUQB 1OFTA 3UMSA 5TY0A 1BKDR 4AC9A 3MWKA 2EWVA 2OCPA 2AWOA 3AVPA 2RCNA 1E9CA 2LKCA 2B92A 3EG5A 2CHQA 3LD9A 2F7SA 3CF6R 4GOXA 4Q1CA 1KY2A 2C2HA 1YU9A 1ZCAA 3QENA 4MKGA 2V8OA 5CK4A 5FBLB 3AF4A 2NOAA 1HQYE 3OZXA 3LFUA 2OXRA 2KB0A 4FMDF 3ADCA 2UKDA 2GBLC 2HF9A 4FCTA 4KBGA 2G0TA 2P5SA 1CR0A 4XVRA 3U3MA 5JFGA 3E1SA 1D2NA 1VMAA 3V4FA 1E2JA 1KKMA 2VSFA 2JA1A 2LKDA 4CDGA 3THWB 1NL3A 1KI6B 3TUIC 4CEJB 4B47A 1PLLA 2ZI6A 1NNEA 3FMFA 4PTLA 3QF7A 4G1UC 4TTQA 4BQSA 3AVUA 1U2RA 4FMCF 4G3XA 4NPHA 4JL6A 4QBGB 2G0NA 1TF2A 3TK1A 4ACAA 1E99A 1XCGB 1Z8FA 4HDOB 3SBDA 2O8CA 3ZDQA 4PSAA 2GJ9A 4FN5A 3OAAA 1OPXA 2Z4SA 1W1WA 4M2LA 3C4JA 4RZ3A 2ASEA 5FI1B 4DLYA 4ESHA 1Z08A 4M8NE 1KO7A 4FCVA 4AYTA 1IN7A 2C8VA 3TSZA 3W90A 1OH8A 3T1TA 1EWRA 1II9A 1W36B 2ZRHA 4HB2A 4R2HA 4YDSA 5AUNB 3H1TA 4PO1A 4II7A 1G8PA 3VNVA 4U7DA 3WHLA 2DR3A 4NBSA 2ZRGA 2N42A 2GF9A 3LLUA 2WWGA 1Z2AA 2G6BA 1F2UB 4KCGA 3I62A 1ZU5A 2GXQA 4BLPA 2ZI4A 3AVVA 3EZ7A 2JLXA 1SHZA 1R10A 4RZ2A 3ASZA 2W58A 1VECA 1XCMA 3KUDA 3NH6A 3FB4A 1QBKC 1VYVA 4IEIA 4Q7MB 2GRJA 1G6HA 1UF9A 4NONA 3BJIC 3KJEA 3ZVLA 1WE2A 4M9SA 4ZKEA 2VA8A 1X6VA 3A8TA 1N3BA 4O2RA 2JLQA 4ZKDA 1TUEA 5GADl 1S1MA 3GJXC 3HYRA 5DGXA 3B60A 2ZM5A 4WXPA 2QGNA 1D9XA 3IILA 1CRQA 5EE0A 4BECA 2D74A 3QXHA 2YHSA 3ZZUA 3LH5A 1EGAA 2UZIR 4HZIA 1HH4A 3WP1B 4DB4A 2JDID 2ODEA 1FW6A 4CT4B 2RKOA 1KI4A 2J0QA 3RNLA 1A4RA 2LWIA 2WJYA 1OH5A 3SDZA 4OJKA 5AJXA 3U3JA 4BLQA 1X8LA 1G8HA 2CNWA 2O0HA 3WNBA 2WWWA 4B44A 4RSGA 1N0UA 5FL3A 2WWFA 2IWHA 4ABYA 2QG6A 2ZRMA 4YONB 2GJAA 4A2PA 3F3YA 1EXMA 3EZ6A 1G8GA 4RVCA 5GVRA 4ESVA 1E2KA 2H57A 1OXXK 3I73A 3RS5A 4TMTA 2I4IA 4X8OA 2VP6A 5DHAA 3PENA 4C0AC 1T5LA 3EIEA 4DB2A 1XCPA 1W36D 1ZJ6A 4A0RA 1JI0A 4D82A 3SQWA 3P27A 2P6NA 2DWQA 2KI5A 1XTRA 5EP2A 2YWEA 3T5GA 1OKKA 1U9IC 1XTJA 1M1YE 3K9NA 1S3SA 2GAOA 2VL7A 2BBSA 1M7GA 3RABA 4MYCA 1G20E 2IA5A 4CVNA 5HKKA 4LYJA 2GXSA 2J0UA 3VR5A 2ZRDA 5JWOA 1TTTA 4DSOA 1VCOA 3BE4A 3W34A 1E6CA 4DXAA 1ZINA 3MD0A 2YKGA 4AD8A 3CF0A 4MDEA 1W47A 1J70A 4F7WA 2DFTA 4Z54A 5F3WB 2DY1A 4JVNA 4D80A 4Q01A 2PEZA 3U7EB 4B3CA 2QTVB 3M1IA 3A58B 4UXIA 3PXGA 2RGNA 4IDQA 5FH9A 3BFVA 1E4VA 5EP1A 3SN6A 3B78A 4NU0A 2CDNA 4OHZA 1LF0A 4AG5A 4DLTA 2D3WA 5KU1A 2QQEA 2IW3A 1EFCA 5BXQC 1BH2A 1N6NA 1E9RA 3B1XA 5TMPA 2CVHA 1DO0A 5LDDC 1FX0B 2PCLA 3GEIA 4WXRA 4NMMA 2Q21A 2Z6VA 4BRWA 3CIOA 3KXKA 2V6JA 3DOFA 5EUQB 4B43A 1N6KA 1VIYA 4FI3C 1JXOA 2GK7A 1NSTA 1W44A 3BK7A 1DARA 2JLYA 1QHIA 2H7VA 4ZO4A 3KKQA 4DIEA 2ZJ8A 3SU8A 3OAAD 3K09C 3IEUA 1N6HA 3MG9A 5FUYA 2CJWA 1OB5A 1C1YA 1GUAA 2A9KA 3B9PA 3VKHA 5HPYB 2E9SA 4EQ6A 2OZEA 2R6DA 3WNCA 1MT0A 3ZS8A 4HAWA 2IYXA 1T9HA 4D4MA 2W0SA 1S1CA 1E2QA 3QIAA 2FDCA 3ZD7A 1H8HA 5JJIA 3AVXA 3C7KA 2QP9X 2P6RA 3CRMA 3KXIA 3B85A 3NBXX 3WRYC 1SHKA 1Z5ZA 2QPTA 2HV8A 4JLPA 2RGAA 4U00A 4D4LA 2J0UB 2D7CA 4D2IA 1MRNA 2A5GA 3THYB 3BGWA 4B75A 4QJ4A 4KFTA 4QFMA 1NG1A 5KNDA 4XWKA 3B1WA 1VYTA 1UDWA 4NYIR 3BD9A 3RSOA 4HAUA 721PA 1R7RA 4CGZA 3KX2A 4Q1EA 3IEVA 1VG1A 5AJWA 1YR9A 4PPFA 4Q47A 1TX4B 2FPMA 1N5JA 3KJIA 3TRFA 2ZSDA 3FYHA 1RRGA 3N70A 3QPVA 2ZVQX 2DWOA 1AM4D 1OXTA 3KQUA 4S35A 5FOXA 4N0EA 1ZM4A 2RGXA 3K8YA 2NZ8A 2GCPA 3Q8XB 3DEFA 1AKYA 1XU4A 3ZQ6A 1P6XA 3EPHA 1YHNA 2B7CA 4Q03A 4US0R 5TB5A 5JLJA 3FGNA 4KBFA 5DE3A 3AKEA 1T4GA 1Z47A 1ZP6A 2AX4A 1S8FA 4ASUA 1N5KA 1EFUA 1JEEA 2WWHA 1SXJC 1P2SA 2CNWD 4DT1A 2OM2A 2CJWB 2GAAA 2WAYA 1CJUC 3BWDD 4IRUB 2CLDX 521PA 5JS8A 2XX3A 2QM8A 4V0ME 1KI3A 2IYTA 5EE5B 5H1YA 4Q4HA 3RHFA 3TR0A 2ZUBA 2XJ4A 4PSKA 1ZC3A 4V0MA 2FH5B 3IGFA 1ESMA 2IYZA 2R6FA 2E87A 2VQSA 1MO3A 1Q3TA 3NEYA 3P4YA 4Q00A 4PXAA 1NMZA 2HEIA 4BFZA 1P72A 2XTMA 3W6NA 1QG2A 2WWXA 2XNSA 3AF0A 3C5CA 4PPGA 1PLKA 1XX6A 3TSWA 1NMXA 1LS1A 3OIVA 4M4SA 3UATA 4CZ2A 1SVKA 1E9BA 2NPIA 5J4VA 1OKKD 1ZCBA 4JYCA 1G7SA 3IPYA 1A2KC 5FTJA 3RSLA 1ZRHA 3T15A 1F6BA 1UKEA 2JJ2A 2J0VA 2PMKA 4BGDA 5TDHA 1R8QA 2J9RA 2OFOA 1CR2A 1IHUA 5FBVB 1N0VC 2IK8A 3TGPA 1LB1B 4DIDA 1W49A 4DDVA 3CPEA 5AUPB 1UBCA 2RGCA 3VNUA 1RIFA 4V0LA 1TNDA 4PQYA 1KMHA 2ZE8A 4LV6A 4KLNA 4L9WA 4PFSA 5JSZB 2IYLD 1ZNZA 2JLZA 2FA9A 5EUMA 1UM8A 4Q21A 1TPZA 2PZFA 4JMPA 2PX0A 2R8RA 2XSZD 3LV8A 1FTNA 5L3QB 3ADDA 1LF5A 2D06A 3P26A 3M4YA 1J90A 3DDCA 3EA0A 2R44A 4KV9A 3LDAA 1WA5A 4PX9A 2P0EA 2PJRA 5KDLA 4Q9IA 3RS7A 2A30A 1VIAA 2D7DA 4BFTA 4LHXA 3GJ6A 2AKYA 2EFDB 4X8LA 1NN3A 2WMNB 3IO3A 5B58C 4IDOA 3OF5A 4DLZA 1F48A 3K0EA 3Q7QA 4TMZA 1RFLA 4Q4HB 2QPAA 5LPNA 1Z0DA 2EFEB 4B3XA 1CJTC 3GLIE 4LCBA 1XF9A 4WW0A 4FD2A 4HZUA 1OH6A 1A82A 1OB2A 3GLIA 2JLWA 1N25A 2FSFA 1E2EA 4A92A 5CITA 2ZS8A 1OYYA 3SJBA 2R62A 2F9MA 1H8HD 2AK3A 4JL8A 4LX0A 3CX7A 2ZYUX 1EX6A 2FOLA 1KZ7B 3VU9A 1EESA 2TMKA 2XOKA 3VKGA 1YZKA 1JBKA 4LJAA 3KXLA 1DO2A 4LZZA 1SVIA 4R7ZA 5SZIA 3X1ZA 1SVWA 1X86B 2VP9A 1E2PA 1G3RA 2IX3A 4D26A 1ZD9A 4RCYA 1XMVA 2G1KA 1CP2A 3KFVA 4CW7A 2BKEA 3EX7C 2ZAMA 3EIHA 3EXAA 4L4UA 1J2JA 1P9NA 1UDXA 1IJEA 3MAAC 1GOTA 4TLDA 3D6TB 3CX8A 1J99A 1KMHB 5K8UA 1TL7C 1XWIA 4C0QC 2YWFA 1M8PA 4ACBA 5FTNA 1JEDA 2YC4C 2CLSA 5CYOA 4B76A 2XZPA 3BC1A 4MKIA 4LBVA 1ZW6A 3KKNA 2ONKA 2VP5A 3JZAA 3H84A 4C0JA 3FHTA 4FCWA 2H18A 2V4ZA 1W2HA 4Z1MA 2ZS7A 3SC3A 2A5JA 2CBZA 3GJ8A 5CIQA 2OCAA 2ZUCA 4D4KA 3V9PA 3TVTA 2GVDC 4MUAA 1E2HA 2OXCA 4ASUD 2OO7A 1OH7A 5E95A 1GKYA 3K9HA 4PAMA 5LB4A 4UNNA 4F4CA 3TAUA 1KDPA 1KO5A 3K09A 5G3ZA 3FFBA 2ZI3A 4CT5A 2A2ZA 3E5HA 1IN8A 2A5FA 2QMOA 2C5LA 3BRWD 4UXJA 4F93B 5FUWA 4DBLC 3BH6A 3GLIB 1F3OA 1NVVQ 5B30A 1XTQA 1GKIA 2BEJA 1WBDA 3VR1A 3WXMA 3GJ5A 4GP7A 1G5TA 3RYTC 3BOSA 4N1AA 2QSZA 3DL0A 5FOVA 1HV8A 3V00A 1S3GA 2W83A 3WYFA 1CEEA 2OBNA 4C0LA 5E7JA 3W6PA 1HURA 1Q57A 3TW8B 1MABA 5KYKA 2JJ2D 4V02A 4OQNA 3GLFA 3BBPA 5LBIA 2HF8A 1Z22A 1VG8A 4IVPA 5HCNA 3LXXA 5BYJA 5CB6A 1HA3A 3U2QA 3EC2A 2HYIC 5JHHB 5L8VA 2OFWA 4OYHA 4JYBA 4YXWD 3NXSA 1XEFA 1IM2A 1XJQA 2CVFA 5DNYB 3GFTA 2GILA 2D4HA 2KJQA 2WJIA 3BS4A 4Q9JA 4B6EA 1GRRA 1TMKA 1W4CA 1DAIA 2VLIA 1XZPA 2V1UA 2IYQA 3D3QA 3X1YA 5CM9C 3JVUA 3MWYW 1O3YA 1RRPA 1FNNA 4NKRA 4JSTA 4DSUA 2O8BB 4TWZA 3ICQB 4LHYA 1P2VA 1J8YF 4E03A 3QI2A 2QUZA 3W5IA 1KNQA 3CH4B 4URXR 5IRCD 2C9OA 1TUIA 1F2TA 3AP1A 4UJ5A 4B3FX 3GJ7A 1QHSA 1SXJE 3QQ5A 3CR7A 4XVQA 1L7VC 1Z2CA 2AXPA 2XZOA 2ZR7A 5FUVA 2Q3HA 1II0A 3AB3A 4M1SA 2OFXA 1N2CE 4KXFB 4BEBA 2JJ1A 2OESA 5AJYA 3RLFA 5F9HA 1YZNA 4OQLA 2BDTA 4URWR 3QEOA 3NH9A 2PZEA 4QOSA 1NF3A 2D62A 2QAGA 4RD3A 5CM8B 5FR2A 4NYMQ 3UXMA 4UNSA 4RD4A 3U4QA 3LQQA 4EUNA 2WBLC 4I4LA 2H16A 2JATA 1AGPA 3LX5A 4UJ3A 3D31A 4ZDJA 2XGJA 2RAPA 1AJEA 4M53A 5GJWC 5JHGB 3THWA 1KI6A 4CEJA 4LJ8A 2XOKD 2GWHA 2BEKA 2NMVA 5KO2A 1OIWA 1AGRA 2W6IA 1VPLA 3LO5A 4E09A 4ZDIA 4XOIA 2FSGA 4PQFA 4EPVA 2NIPA 3QKRA 3SEAA 4Y0AA 1J7KA 4NCJA 3SJCA 4B6FA 1I2DA 3NDBB 2ZSFA 2A7QA 4GMXA 3SZRA 4TZ6A 3B13B 4PQRA 1NVUQ 1R0WA 3VTKA 4P4TA 4D25A 1GG2A 2QP3A 1WDTA 1D8TA 5EXXA 2R6AA 2D2EA 1BO6A 3CWZA 3Q72A 1FQKA 3QF4A 4PANA 4D81A 1GRNA 1T8TA 2NO6A 1Z06A 4PC7A 2QTHA 4EFLA 3PQCA 1U99A 4Z1MD 4Q4AA 1IN6A 1E4YA 3EPKA 4L9SA 2IS6A 5FBWB 3RRMA 2Q9BA 3TW4A 1E2FA 1Q12A 4B3DA 1WXQA 4F4JA 2AR7A 1NN5A 3NBZC 3IUYA 1SXJB 4BFVA 3FFAA 3L0PA 4HDQB 4E5UA 2EFHB 3QPWA 2PT7A 3ZJYA 1WF3A 1G3MA 2WJVA 2ECKA 1KO8A 1Z0AA 4A2WA 4DHEA 4C3ZA 1P9RA 2AFHE 1GZSA 2QT0A 5E4FA 2DFNA 5IK2A 5SZHB 1XEXB 4JLAA 2QAGB 4U02A 2GJSA 1QVRA 3U4QB 1Z29A 4NE2A 4PR0A 2G88A 5B2ZA 4TLBA 3L8ZA 3TNFA 2MSCB 3B2EA 5C1BA 1MV5A 1VG0B 1GTVA 1GNQA 1Q1BA 3GJ3A 1P2UA 3TKLA 5KDOA 3HR7A 3HU1A 5LD2C 3N2EA 4C0HA 3ETLA 4BZQA 3IHLA 2OLJA 1FOEB 3KKPA 1ZUNB 3GPLA 2Q0HA 1NN0A 4Q5IA 3F0TA 3QKRB 2VF7A 1NBME 4OQXA 4ILEA 1QHHA 1XTSA 4IVRA 1LY1A 2JEOA 1XRJA 1NBMA 1N6OA 4Q9LA 2OG2A 2WJHA 2HDNB 1A7JA 3QBTA 4Z8XA 4TLCA 4DCTA 5BYKA 2OE2A 4G01B 3NBFA 1GFIA 2G83A 4X8HA 1Q44A 4HB3A 4DEYA 2ZYVX 4R71A 1GAJA 1P9WA 4EPYA 3OEEA 4TL7A 3M6AA 3I72A 2L0XA 4A6PA 2K5UA 1Q1QA 4RCZA 4ZDKA 1AIPA 5KOYA 3HJNA 3QF4B 1N6RA 2GESA 2D2FA 1E1QA 4MQBA 4P4UA 5EXTA 4Q4AB 2AK2A 4AKGA 3U7FB 1E98A 1Z07A 2QPOA 5K8TA 1ZMXA 5A0FA 4XJXA 1GKUB 4URVR 5KNBA 4OHVA 4A82A 4QBFA 3TQFA 3OIWA 4QNRA 5G3YA 2C78A 3OEHA 2EW1A 1TADA 4JLJA 4GOJA 2GHIA 2RMKA 3W9YA 2GK6A 1NJGA 2ZE7A 3P20A 3FMIA 4WZ6A 4EJSC 4M1OA 2FFQA 2KBEA 2F43B 2IUTA 1U0HC 2OAQ1 1E9AA 1OT3A 2BIFA 2BMDA 2CLCX 2JJ1D 2P67A 2QROA 2NO7A 4I81A 4LBWA 1E1RA 1GRQA 4JLMA 3TR5A 121PA 1U8ZA 4GRAA 5EXPA 3BB1A 1M7HA 2VHCA 1G8FA 5B57C 1EWQA 5EE3A 1Z6AA 3QKUA 4TL9A 3SFVA 5KPJA 2XXAB 5G53C 3ZS9A 5EJEA 3EARA 2J59A 2N46A 2WM9B 5JS7A 2C99A 2ANCA 2V54A 1LVGA 1V43A 1CKEA 3WP0A 4E22A 5BQ5A 1FX0A 3MJHA 1NP6A 4BFWA 1QHHB 5JI3E 4TYYA 2RGBA 2W6ID 3WNDA 3CWQA 2QENA 5LB2A 2BCGY 1E96A 5KUTA 1ZM2A 3P4XA 3UKDA 2GZHA 1E9FA 1KI2A 3DOEA 3KJGA 3L2OB 4H1VA 4FWIB 2O0JA 4TMXA 2IT1A 5SZJA 4ZCMA 5JCPA 2V6IA 2ZROA 1E0JA 2IYVA 4HI0E 4W5HA 4JT4A 4WZBE 2REBA 3PEWA 5E7IA 2IS2A 3IQWA 2IYUA 4P32A 1GP2A 2GNOA 4CEIA 1MOZA 1T3HA 4O3MA 4TTRA 3O8CA 5GJVC 2FPKA 2V1XA 4M1MA 3QXJA 4D4JA 3VAAA 3ZH9B 1AZSC 1Z0IA 2BMFA 3EPJA 5FOUA 5DI3A 3U5ZB 1YZLA 2J3EA 4KODA 4OJQA 5D3MA 2QZ4A 1GVNB 1A1VA 3KTAB 1C9KA 1DELA 3IIJA 1KIMA 5BN5A 3CO5A 3KDSE 2X2EA 1ZNYA 1S9DA 1UEIA 3NHBA 3L0SA 3I1FA 4OHYA 4OQMA 4GOKA 2HCBA 3HPRA 3THYA 2FGKA 3BIFA 3PUWA 4HLUC 4A8JC 5FPYA 1HYQA 2N1BA 2ZRBA 4C0KA 2IS4A 1DEKA 3BH0A 5ELXA 1ETUA 1QF9A 2P2LA 2ZSAA 3CNLA 2O8CB 5CDFE 1L2TA 1ZIOA 4PO8A 1E9SA 1IY0A 1KJYA 4NTZA 5IK2D 5KSOA 1QHNA 2FSIA 4GFDA 1DS6A 2IF2A 5FI0B 1P3JA 5CDFA 5GJBA 3A37A 3U3OA 4Q1AA 3DM5A 4HLCA 2CCKA 2VHTA 2XSZA 3HU2A 2VTKA 4ZPXA 3SHWA 2ZTSA 4QXAA 5FPTA 4F92B 1G7CA 4KITB 2ZPTX 3VR2A 3AKCA 2DPXA 2PL3A 3EC1A 1W5SA 3U3KA 1DE0A 1ZUHA 2QAJA 4OK3A 3BFKA 4OKSA 1YRAA 1BOFA 2QU8A 3SE0A 3X1XA 1QDEA 4BUJA 1XJ0A 1ELOA 4TL8A 3KQNA 2GJ8A 3R7WB 3U61B 5K8IA 1CTQA 1IAQA 1ZU4A 1KI7A 1ZM3A 2JLSA 1NBMD 3THOA 4BASA 1D5CA 3TJZA 4GMDA 2BM0A 4PZYA 1Z63A 4US2R 2ANBA 3T61A 1VCMA 2NG1A 2FX3A 1IXZA 1OF1A 5F2EA 2QBYA 1W5TA 4CEIB 2QQ0A 3CRRA 2PCJA 2GDJA 3OEED 3QBVA 4Y0VA 1CR4A 1XP8A 3UWKA 4EPTA 3GLHE 4GZMA 2B21A 3EASA 3LW7A 4G5OA 4HYYA 1SVSA 2MMGA 3CKLA 3GLHA 5DI3B 5JRZA 2QRZA 1KK3A 5D3MB 3WBJA 3RS2A 3CR8A 5HZKA 3BAFA 5F9FA 5C46F 1E1QD 4QGGA 2BCJQ 5J4LA 4W9MC 4Q19A 3NBYC 1R5BA 3EZ9A 2O8DB 4BFSA 1G18A 1S2MA 3NTUA 4Q66C 4PHFA 1YE8A 1KDTA 3AH8A 3LLMA 1COWA 3GFPA 4OQFA 3F8TA 2ZXUA 3MGCA 1X8JA 4Q7LA 4M22A 3EWAA 4C9BA 2RGDA 4QM7A 3OEHD 1WBBA 2AXNA 4BLRA 4Q1DA 1AQUA 2IUSA 3E2IA 1G9XA 1G8YA 1EX7A 1DBSA 1CXZA 1EK0A 4L15A 2IEZA 1G4UR 3WY9A 3SR0A 4QGAA 5AJVB 3CZPA 5JZVA 2ZI7A 1Z6GA 4A2QA 2CE2X 1E1RD 5FUXA 4PZZA 2O5VA 3R8CA 2GBLA 4PHTA 5JSZA 3P32A 2J0SA 4RD2A 3TAHA 1I4TD 2GA8A 2HT1A 5L3QA 3CM0A 1BS1A 3L0OA 3T12A 3SFZA 3D8BA 1C4OA 4N0DA 1OV4A 2VO1A 5FTMA 3AQ4A 4G5SA 3VHXA 1ANKA 4E07A 2ZJOA 2IHYA 3DMNA 1N6LA 3H86A 3AP3A 4HEJA 4PO9A 2CL7X 2OEPA 1GIAA 1TU4A 3W8RA 1TEXA 2ZRIA 3K0FA 2ZR0A 3TMKA 4ZDWA 1ESNA 4KLZA 2OHFA 4LHVA 5JJLA 1X1RA 3NIBA 4QGFA 1XD9A 2QBYB 1NLYA 1GM5A 4MKFA 1BIFA 1OFUX 3LW8A 1KTVA 4FXPA 2W2VA 3PIRA 1Q0UA 1JQJC 2O8EB 2WMOB 4TT3A 3GLHB 4TZ0A 3TIFA 5FTLA 1RE0A 4WBSA 1KHTA 4M1KA 4URYR 1TQ2A 3SYKA 4DJTA 1XPUA 4HAVA 3UMFA 1LS6A 1RZ3A 2FFBA 2FZ4A 4US1R 1S96A 1O87A 3G5UA 2B7BA 1FP7A 2JLUA 5DYIA 3IPXA 3BORA 5FR1A 4NYIQ 2CL0X 3CRW1 4O25A 4DSTA 3L0IB 3ND8A 1AK2A 5EZ5A 4NP6A 3B7GA 1IY2A 3CPJB 5KPDA 2PEYA 1FQJA 2Z83A 3T34A 4DCNA 2CHGA 1XXHE 2OBMA 4AG6A 4YXWA 1R5NA 2XTZA 1XXHA 3DPUA 5EE9A 3SQXA 2P5TB 2KSQA 1B23P 1ZM7A 4DDUA 4HB4A 4B34A 5AUQA 3UPUA 4QHYA 3BB3A 1G3IA 4XH9B 4XSGA 3C14C 1KAGA 1A5TA 2IXGA 4GSYA 4ITRC 1XNJA 3AP2A 4AURA 3A6PC 3DKVA 1G3UA 2F55A 3UMRA 4M0LA 5LD2B 1G16A 2FFAA 3AVQA 4A36A 1G41A 4DLWA 3DZDA 1E0AA 2GETA 2ONJA 1XFAA 3OIYA 2VIIA 1KJZA 4XVUA 2XTNA 3TUJC 4MRSA 3K0FB 3ZVRA 1W36C 1PV4A 2KE5A 2GEUA 4QNMA 5FOWA 3RRYA 1N5IA 5A5GA 2EWWA 1KO1A 1NLZA 1OHHA 4K81B 5EP3A 1YQTA 3PEYA 1RKBA 2QRNA 4RD0A 2IEYA 5AK0A 2VF8A 3U7HB 1DVRA 1IBRA 1QRAA 2OCBA 2H5EA 4IW3B 2W6JA 4MYHA 3A1UA 1TAGA 1UEJA 3VQTA 3FMPB 3KB1A 4QBHA 2OV2A 821PA 1ZM9A 4MGKR 4IOJA 4IOMA 4JLDA 2ZRCA 3RVBA 4V03A 2QGZA 2WV9A 3MFYA 3T35A 3RC3A 1KSFX 1UKZA 2GZDA 2I1QA 2OLKA 4QG7A 1K5DA 1U9IA 4TLEA 5JJKA 1DPFA 1D6JA 5DO9A 4A0GA 2ORIA 2OSBA 2BWJA 1M34E 1DTSA 4TTPA 3AUXA 1COWD 2ATXA 2ZVPX 1DAMA 4RFSA 2ZSEA 2VRWA 3LQRA 2BV3A 1UKVY 2P6UA 4AKHA 1IY1A 1W7AA 2CMKA 1XXHB 1SVMA 2ZRNA 4EJSB 4QJ3A 1JR3E 1NVVR 4M9QA 1HE1C 2FPLA 1OJLA 1CULC 4LHZA 1JR3A 4K46A 2EFCB 4NL4H 3DZ8A 3KQHA 4HDCA 3ZVMA 3AVTA 2IYSA 3A1TA 4BFUA 3AVOA 4TL6A 4S2EA 2VEDA 4X8MA 3E70C 4YC7A 3ZGXA 5KSPA 2NGRA 1KSGA 4F38A 3B1ZA 3HP1A 1J8MF 3EA5A 3WYGA 1VDZA 3QKTA 2KBFA 1YR8A 3VR6A 1Z6YA 4Q7JB 4HLDA 3CRVA 1CR1A 1N0WA 1UJ2A 1CS4C 1XEWX 3L8YA 2QA5A 1DAEA 1KMQA 4MA4A 3AVWA 2O8BA 4MGIR 1UKYA 2YWHA 1Z0KA 4JBWA 2PJZA 3K0SA 2ZSBA 3TH5A 3U60B 3CBQA 3A1VA 1Q21A 1TQ6A 1VHLA 5DIFA 3L82B 5C4GB 4C0SA 3MSXA 1N6PA 2F9LA 4JT2A 4NYJR 2ODBA 4JLNA 3UG6A 1G3QA 3RANA 2YOFA 2I1VB 2WKRA 4DLVA 4EPXA 2J46A 2J5XA 2ZS9A 5P21A 1W4BA 221PA 2FMXA 3TUZC 2FEOA 5DISB 4G0NA 3REGA 2GJKA 2WSSA 3O8DA 2IS1A 1XTIA 4TT3D 1IQPA 4LJ6A 1UBFA 3ZZ0A 5B64A 2REXB 1P60A 1AS2A 1ZC4A 5L3SA 2JCSA 2HUPA 3ZIAA 1X1SA 4LV8B 2X1VA 5CJ2A 3WMFA 4RFSB 3FVQA 2EFGA 2QT1A 2ZR9A 1R0XA 2ERXA 5FFMA 4A8JB 4LUCA 4KVAA 1YZQA 5CIWA 4UXHA 3RS3A 3W3ZB 4PC3A 1IONA 2H17A 4FWTA 3QNUA 1NKSA 4LC1A 1D2EA 4MYTA 2HXYA 2JLVA 1L4YA 5DI9A 3WYAA 2IXFA 5FTKA 1D9ZA 3CF2A 2PX3A 4IXNA 1FL9A 1G21E 4UNPA 4Q1FA 4M1WA 4IEEA 2WOJA 1CRPA 2IYWA 3U6BA 1E2LA 3IBGA 1LNZA 4W7SA 4B74A 3A36A 2FG5A 2WKPA 4I99A 1KOFA 4OHWA 5KSYA 4Q9KA 4ZCIA 1KDRA 4BPBA 4B33A 1DG1G 2VHUA 3H4MA 1NRJB 1NG9A 4UNQA 4C7OB 4LYFA 2ODWA 5CLQA 1SXJA 1OHHD 3FPAA 3RRNA 2H92A 3CUEF 3IBYA 1FPMA 1US8A 4LPKA 2DHRA 5AR1A 5CB8A 1Q22A 4JBXA 2C96A 4CYMA 3PCRB 2CCJA 1G4AE 2F3RA 5BN3A 2VHQA 3V4RA 3BFXA 1S0UA 1XEXA 3DKPA 4GNKA 3SS8A 2F6RA 4B48A 2W6JD 3H0KA 5ANRB 2GEVA 4BLOA 3VHLB 4JLBA 4MDFA 5HE8A 1HY3A 3K70C 4RZXA 2CCGA 3PVSA 4TYPA 4K8OA 4HSEA 5L3SB 1HUQA 4XTRA 1QHGA 4FMDB 2F1RA 1CLUA 1G7RA 1GWNA 2J41A 3VMFA 1DAGA 5JWRA 3DVLA 4A0HA 1R0YA 1P2TA 5HR5A 2UZ3A 2MMCA 2WKQA 1FP6A 3SHFA 1KSHA 3U44A 2H8KA 4QHSA 2RHDA 3AGPA 4V0KA 2FEMA 1U8YA 3BH7A 1JALA 1TEVA 3FDIA 1XB2A 3IDQA 5BWMA 1OXSC 1I4LD 1WQ1R 3N2IA 4FMCB 4NDZA 3C5HA 3IIMA 3AF3A 5FOSA 1TQ4A 4TQUS 4JLOA 3RC8A 4TN1A 3G82C 1G64A 4IOKA 5AWFC 3SI7A 2C77A 4G5RA 2BHRA 1JR3D 1OIXA 1Z6TA 2ZJAA 3GQBA 3I4LA 6Q21A 3OHMA 4LRWA 1SKYE 2Q3FA 4WOPA 2BVNA 2NO0A 1U81A 4LYHA 1OFIA 4A4DA 621PA 1TF5A 1M74A 2GCOB 1T3LA 2NO9A 2OILA 1P61B 3LNCA 5DN6D 3MRSA 1GL7A 3C41J 3OIUA 1LTQA 2BOVA 2DFLA 2J1LA 1SKQA 1MH1A 1Z3IX 4AK9A 4BLSA 4B71A 3CNNA 1RJ9A 2B8WA 1UBGA 3NWJA 4MKHA 4HB0A 3K1JA 3GEEA 4IDNA 4ERNA 1AN0A 1W48A 3KKOA 4MRPA 4Z51A 1US8B 4B2IA 4EIWA 5JBQA 1KDOA 4TSFA 1IJFA 3PUYA 2Z4RA 2XAUA 4QRHA 2J7KA 3AV0B 5C4MA 1E3MA 3FWYA 4JZKA 2F43A 4AY2A 3PITA 2YWGA 1XJCA 4BE7B 3IIKA 1AS0A 1KO4A 1HE8B 2ZJBA 1UBEA 4I1UA 3Q85A 5EE1A 2IWRA 1E2IA 1CBUA 1R0ZA 2WSSD 2R65A 3A1WA 3VFDA 3QKSA 2WWYA 2AL7A 2Y8EA 2ZRKA 1G5RA 4DLUA 2XXAA 1E2MA 1PUJA 4LJ4A 5JECA 3CZQA 4GPTA 4QL3A 3ZIAD 2BJWA 4GZLA 3U44B 3SBEA 1KK1A 1ZYUA 2ZRJA 4XWAA 1I2MA 4LHWA 1JAIA 3WHKA 1XMIA 1OIVA 2BBTA 2F1JA 1QHYA 3K0AA 1OW3B 4DCUA 2W00A 2ORVA 1RRFA 5G41A 4NCNA 5GJCA 4GBMA 3A4MA 4JKYA 5SZKB 3KFXA 2NO1A 4QKQA 5JCZA 3ADBA 2QI9C 2GZAA 1SQ5A 3GP8A 4ON9A 3WMEA 5C2JB 3SNHA 1G17A 2GCNA 4YMTA 5JEDA 1JR6A 4A9AA 3FOZA 4V0OA 3B8HA 3T1OA 1TU3A 1SKYB 3QVUA 4BRUA 4RFVA 1OXVA 1YJ5A 2YYZA 3PEVA 3MUFA 2VH5R 2Z5FA 1KZGB 1NIJA 2DWPA 2P3SA 3JZMA 2CK3A 3KTAA 2YNMA 4IKEA 4XTCS 3C15C 2HYDA 1RJ9B 4Q1BA 1K5GA 3LA6A 4JLVA 1E2NA 4DLXA 2RGGA 3QXSA 4R9UC 4C2UA 2WZQA 1GILA 2XNDD 4H1UA 1RRCA 1P5ZB 4DWJA 2JGNA 1KSJA 3KB2A 3TVDA 2OBLA 3REFA 2PT5A 1SXJD 1VHTA 4TMKA 2WTUA 2J45A 2QN6A 1KI1A 5KHOC 2O8FA 3I8SA
chains in the Genus database with same CATH superfamily
4L8GA 3G2JA 2QR5A 2HM7A 4ARZB 4K6HA 4G0ZA 3I30X 4MV1A 4N9WA 2XB2A 1QLHA 2CD9A 2O4UX 4IICA 2EBHX 1NWHA 4PSCA 1U1CA 4HWKA 5BN4A 4A5SA 2X4GA 4ZT4A 3BXZA 4I8XA 4WINA 3RVNA 4DLSA 3TR6A 3DAFA 3W8NA 2VNAA 4YP0A 3K2BA 2BM1A 4EJ2A 3O8RA 1X7YB 2AG0A 1CUSA 1GPH1 3TAXA 4G1EB 2A9PA 5C3MA 5KSZA 2JGRA 4KRGA 1DEXA 2ATIA 2H07A 2PT6A 1WV1A 3E7PA 3CW8X 3UT5A 2PV0A 1FMJA 2A0WA 3Q5EA 4MARA 4ZOCA 5TPWA 1IXKA 2YINC 1W46A 1XBTA 3N5CA 5JTUA 2QVGA 1C0PA 1OE0A 3K9GA 3UK0A 3DKRA 4RZHA 5AUOB 3S68A 1XU7A 3NIGB 4KFSA 4MJ3A 4WKPA 4OX9Y 5KYUB 2PLRA 3KK0A 1ISGA 4ICIA 3HRKA 9GPBA 2OLEA 2W8BB 2QNRA 1T8UA 3V4ZA 4F84A 2ZAOA 1SC9A 3QPBA 2O0KA 5IKEA 1O97C 3QK7A 2Z1NA 3D8UA 4YDHB 5H3HA 1E1MA 5JWHA 2IYYA 3L6RA 1IEXA 3K8QA 3OKFA 4YQEA 1RE1A 5EZ6B 1FMTA 1YNSA 1SH7A 5TARA 3DMFA 4A03A 2BF4A 5MN5A 1EKXA 1WMBA 2UUBB 1GSIA 4JBYA 3TQIA 5AKJA 4DE5A 1X7XA 1QGAA 1WZUA 3HKEA 1PK9A 4AX4A 1GEGA 1SIUA 2H63A 3RVRA 3K0CC 3SR3A 1ZGCA 5MFZA 3EDRA 4H7KA 1CP3A 4LSGA 2WTEA 4NHOA 1RABA 3AESB 5EWLA 1ZNQO 2YXDA 3NM6B 4K1XA 4LDRA 4H27A 4R8LA 4NICA 3OQPA 2HIHA 3OQMA 2FU5C 4M7OA 1VBMA 5F4ZA 5IAOA 3AB8A 2Q6TA 2BMEA 3TRIA 2ZE5A 4YCAA 3PC8A 4JP3A 5KJ6A 4KQCA 1IXSB 2OYRA 2B3DA 4BEJA 1ONNA 5LYJF 1F4LA 2G5PA 3OP1A 3FX2A 3OMLA 4IVQA 4LY6A 4DCSA 2O8FB 4RGQA 2VTBA 3AR4A 2FZLA 3K1AA 3WLFA 4A2CA 2CXRA 2YWRA 4LGYA 2GD0A 4QVKA 1T0JB 3A1SA 3HKBA 2E5WA 4KWTA 4R7GA 3NBAA 5DCUA 2VYFA 3L7AA 4XUGB 3RUAA 3GCDA 5IDYA 3VDRA 4C07A 4YMUA 5TJ9A 2VRBA 1NQAO 4W1PA 3KVYA 2Z8YM 3I23A 4E31A 2WJWA 5I9NA 2ROQA 1M2VA 2FZGA 4DWOA 1QFYA 3FTNA 4II2A 1V47A 4R5HA 3GFGA 4GVXA 5AI6A 1Y63A 2ZITA 1V8PA 3ENKA 1XD2A 2HK6A 3VC7A 3RC2A 5CEJA 4ZV4A 2HA5A 2YHBA 1N8SA 4K9PA 1ECPA 1U8TA 1T5TA 3GVPA 4C1BA 1T2EA 2ZQZA 4W6QA 5J2UF 4BXOA 3SOZA 1NBIA 2P4QA 1YAHA 3C7TA 1ZD5A 4G5YA 1VHQA 4PONA 5AP9A 4ZU1X 4EVIA 1KH2A 4RKEA 3I52A 3AXTA 1V5IA 3D2AA 5CYGA 3DUFA 2JI4A 4TMWA 3ORFA 1K7EB 1ZICA 3FNGA 4KQXA 4ADSG 4CMGA 4PZAA 1HEYA 3M9LA 2O2GA 4UDYX 4XRRA 4DNFA 2R6ZA 5HTKA 5J5CA 3I5XA 5E8RA 5HKAA 5KYXB 4WJKB 4F97A 4N5NA 2FKAA 2GSDA 5A2QA 4OPMA 4H7JA 1FDRA 3U81A 3WLAA 2NN3C 2O7RA 5JALA 2CE7A 2AS0A 3MT9A 4QUDA 1N0HA 5ENVA 3NZEA 1F9EA 2BL4A 3PVZA 2V6MA 4AJJA 2HT6A 2QZ9A 4IDPA 4B3GA 1FP1D 5FPKA 1YZGA 1FUUA 1T3SA 3IQXA 4B4UA 1L5ZA 1A4IA 3NTVA 4X20B 1TQDA 1WPXA 5D3KA 5L7TA 2J9FB 2WJGA 3HUDA 4AYXA 3W5JA 1DXQA 1IZYA 1EWKA 4PU0A 2QSYA 2QWXA 3I9V6 3DUWA 4FBLA 3RPEA 3QFRA 1V6AA 3N8NA 1ST2A 1X7ZB 4II3A 1L8AA 2HLHA 2MWMA 4RKFA 4H0FA 4QBTA 3WYEA 4YXFA 4MEJA 4JBLA 4UFOA 1WSWA 1P74A 3KJXA 3EPLA 1VL5A 3PA6A 3PKJA 3H2IA 3IURA 7MHTA 1G98A 3E2MA 3ZZNA 4BGEA 1CJKC 5JZSA 3Q3JB 2D13A 5SYNA 1V3TA 4I4CA 5CNJA 2IU0A 4LTMA 3A1FA 4ZIRA 2X0NA 2W2XA 3ZW8A 4MGYR 4NI5A 3THXB 4RD1A 3GFVA 1Q84A 3KKLA 3S99A 3TQCA 3TTXA 2I4TA 2GEDA 3S7TA 2DBYA 5KHLB 1AQLA 2G9NA 3BMOB 2LCFA 1YVPA 3ADOA 1Z0FA 2QE7D 2AWNA 3T1VA 1QTNA 4OFBA 4F4IA 1NVBA 4KZPA 1VCNA 4EEXA 1KQFA 1II8B 2HJSA 4Q7KA 2R25B 1N57A 1U9JA 1W34A 2HPVA 2OK8A 5LC1A 3F71A 1TA9A 5AOAA 2OQVA 3U6KA 3ETJA 1QH8A 1J33A 3B1KA 4E7PA 5LBUA 3KV3O 4FE7A 3ZX4A 1H65A 5BRNA 3STXA 4R69A 4R6WA 1N3YA 2OGTA 3PHBE 4IGEA 2H7YA 4JJIA 1V4NA 1T8PA 4RA6A 3AKDA 4XR9A 1G291 2Z95A 4JI4B 5KHAA 4J0QA 2AV6A 3TEFA 2QGFA 4P33A 1M66A 3UN1A 3SYNA 3CMMA 3BK1A 3L04A 2WNSA 1LJUA 4IWNA 4GAEA 3NC0C 4B7ZA 1JDNA 1YF3A 2VH2A 4CM7A 2WA2A 5CB0A 1G55A 3E2PA 1ISRA 2C0CA 2QT9A 1HNXB 1HRDA 2ZJ2A 3EW9A 3Q87B 3ZEAA 4ZTZB 3GEBA 2P2NA 2YJ4A 4LK2A 3IMCA 4MIOA 3I1JA 4DPLA 5BSHA 2FR0A 1WW3A 3TIIA 2OCLA 4KVGA 1P2DA 1W5AA 2B94A 5IMBA 5LN1A 4EQ6B 1RXEA 4NECA 4RIGA 3I92A 1D04A 1LDMA 3MHPA 4LI0A 4RJKA 3ZLVA 4J0DA 4A1FA 5JV5A 3Q4GA 1YASA 4PZUA 1TE2A 2A9VA 1EA5A 5JAQA 4O2BF 1MW9X 3LWDA 1M2KA 4QVGA 2G17A 1IN4A 3AG5A 4MH0R 2NU8A 3SX4A 4PF1A 1YZUA 5H9VA 4UKDA 1GL6A 4WA7A 2HJGA 3NJ8A 2QL5A 1N2GA 4IHJF 4AG3A 2JIDA 3AEUB 3E3MA 4Y1GA 1QH1A 1H2YA 5ESDA 3LQKA 2QTTA 2C9CA 3FE2A 2G4CA 1KY5A 1RVDA 3KM0A 1PK8A 3Q3IA 1MR3F 1JQLB 2JASA 2PKCA 3NUGA 4H3VA 2P91A 5A7FA 3QPCA 5H8WA 2EKZA 1CQWA 3QG5A 4YGXB 1Z4JA 1S7GA 3QWBA 3KTOA 4Q37A 3TDKA 1J22A 2V7QA 1WR8A 4CN8A 2Q2WA 2J7PD 4ND1A 3AF2A 5DT9A 2IH2A 1ODFA 2VUUA 3BB4A 2BN4A 4KV7A 4ZCLA 3CBGA 1ABBA 3IUQA 2RAFA 2XVZA 4OHXA 2HNBA 3G2MA 3X1WA 3OBBA 2HEGA 1V71A 4EPRA 5I9BA 1IU9A 1YI1A 2HGZA 4PLZA 4U5XA 4HUTA 1M0EA 1XRQA 5IJAA 1VJTA 1PIWA 1RKUA 2HLPA 5A05A 3L1KA 2XUQA 1PLJA 3LUKA 3W2FA 2CEAA 3FKSA 4X60A 2JI7A 3CEHA 4H7EA 3LXRA 1PWYE 3M1YA 1P1BA 2L69A 1U6KA 4AZ3A 4LYAA 2R9VA 2IH5A 4ECAA 3R44A 4R2MA 1OBCA 4EY8A 1GDDA 3S70A 3RUFA 2X8JA 4X6LA 3WIBA 1G66A 4NQRA 4ZT5A 1Q0LA 3LVQE 5IM5A 3ILYA 5DGHA 1RHUA 3G6KA 1H6BA 1WTCA 3SXUA 3CKKA 2FJUA 4DNPA 4ALIA 1N75A 1T2UA 1E3QA 3CNOA 1NJ8A 3VR3A 2G77B 3KQWA 3TXYA 2DQ4A 1TKCA 3JD1A 3VNQA 3WLPA 4D97A 4A0FA 1V9SA 4XRGA 4NENB 1EFLA 4IDGA 4KBYA 2X2FA 3WRVA 2POQX 1RPZA 3PQ3A 2JA2A 3DKKA 2FI1A 5A5FA 1GITA 2GVZC 3TOVA 5BNTA 1U98A 1X8KA 1GKLA 1Q20A 5ED4A 2Q3DA 3K0CA 4M9XA 2NU9B 1E94E 3ROZA 4OSOA 2ZDHA 3BL6A 3CONA 3ZOKA 4MCHA 5AK4A 2IDMA 4HNQA 3VR4A 5I7HA 4ZMRA 4Q7QA 4MV8A 4NG5A 3WK9A 1PZNA 2O2IA 3L1VA 2VJMA 3HFRA 3H97A 4HQKA 2PH1A 5M34A 4HLUA 5C0OE 3A4NA 2WIAA 4MQ4A 4LF4B 4QHTA 2OZVA 3HB9A 3MF4A 3TTTA 2FUG1 4KUHA 3JQRA 3LBHA 2ZETA 4X7PA 1Y8RB 3TLXA 2ZYIA 3DO6A 2WJ6A 2CYCA 2ZJZA 3HGTA 1LFDB 1OAOA 3ITDA 5DTRA 1OTXA 3T7KA 4M7PA 5DHPA 1IUNA 5D5HA 4J76A 1NY5A 1MPTA 3FJYA 1VLJA 5CLGA 4C78A 2IHBA 4HAXA 3MHTA 5E9JA 1JXQA 1KJQA 4J1SA 4YFVA 4DZZA 3QVGB 4EHKA 1C9JA 1FP4A 2B6HA 3GP5A 2QORA 4R2WA 1LV8A 3IJEB 4GGOA 3H1PA 5DN6A 3T7SA 3WYBA 1XRLA 1G5FA 3G2PA 4GZ6A 4XGIA 2K7FA 3ECCA 3LQ4A 3T0IA 1K97A 3AOEA 1FJ2A 2O8VA 1SULA 1XLUA 4LXGA 4LY9A 3UK2A 2EYUA 3LY7A 2FMFA 1M5UA 2AZ4A 1ESDA 1GLNA 2H2GA 4FW9A 4JJKA 3JQBC 1GYPA 1P4SA 2YY7A 3S8YA 3QJYA 4P7GA 3NANA 2WAXA 1YFJA 3LI2A 2P35A 3TX2A 4AKIA 3UAGA 1CWUA 3HS3A 1VMIA 2LPMA 1SM4A 2D1SA 2FG6C 4R98A 4LXUA 3KB6A 4NG4A 2JLBA 4B8WA 4ENTA 1FZQA 4OSEA 2NPFA 1U6IA 4C7XA 4EY6A 1U5CA 2YR0A 1O7JA 1S89A 2E82A 2EYQA 3CRQA 3MAJA 4HNAA 3ZHRA 5CFMA 2JIZA 1HPLA 1GZHB 4C76A 4BMSA 2WIDA 3DEZA 4BLTA 3SLKA 4CETA 2IV2X 3A7EA 1BYUA 3DEAA 2XWQA 1HLFA 1WOMA 4P35A 2WJJA 3EUWA 2B1QA 4IYRA 2RGEA 2EQBA 1E3WB 3F5QA 4G6ZA 5IJ9A 3GAAA 4Z4GA 1Z5OA 2UXDB 3L1UA 3R7DA 1Q1EA 1NONA 4KO4S 5AOBA 2V4UA 3ZWWA 3UC9A 4H3KB 2AJTA 4A15A 1HMPA 3DO8A 3H3FA 3KT3A 1LBHA 5E38A 3RIYA 4FN4A 3L18A 3B5EA 1IXRC 1MIHA 4IJVA 4UVEA 3QSYA 1GA4A 4NFHA 1C3OB 4MKXA 4CBVA 5JI2E 4RY8A 3T3HA 5EJ7A 2Q4TA 2O0LA 4G0UA 2CMGA 1KFEB 3QM1A 4G4GA 3VI4B 4NZ9A 1W0KD 3G02A 4D3ZA 4MVJA 1PD1A 3C3WA 3CE9A 3DZFA 1LDEA 1L8QA 1SUBA 1ID1A 1XTBA 3NOOA 4LG1A 4XGQA 5EA2A 3E7DA 3A10A 3VU9B 3EMVA 3KAKA 3LC1O 4I1IA 4PINA 3WS7A 3OSUA 5HA5A 3KRTA 2QP4A 4RY0A 4N3AA 5SV2A 3V55A 1LBIA 3K0SA 3OZUA 3HJCA 1DAKA 4YMWA 2TS1A 2FEKA 5LQDA 4MITA 3QVTA 3GLGA 4G4JA 4RCVA 2A58A 1TIBA 1KWKA 1TO1E 1CFJA 3KJHA 3PR1A 1ZH8A 5CB4B 5HFAA 5FLXA 3J81k 3IHKA 1SNYA 2JBAB 4ZN6A 1U0JA 1AUOA 2Z0MA 1J39A 2UUAB 2DJ5A 4EI9A 3F5FA 4EYKA 3UUWA 2GN4A 1TYBE 2G1JA 3FPSA 1PGQA 4DCVA 3NVAA 4CNBA 5C53B 3UANA 3UTDA 3OLZA 4BGUA 3IOMA 2AHOA 1XA3A 3NHPA 1U9ZA 1W4RA 3ESQA 4IXMA 4P7FA 4U6QA 4R8MA 4F9TA 4RULA 3LSTA 4IAOA 5KNCD 3U3XA 2ODPA 3D3KA 2HCTA 4HTAA 4B35A 2HU7A 2H54A 3DPSA 3I76A 4YQYA 1CJVC 4PYLA 4RDIA 4EI8A 4RIHA 1SCUB 2FF5A 2VTDA 4AKEA 3D6HA 2HA4A 2ERYA 2VP2A 3OTHA 1XPRA 5ALJA 3HACA 5EZQA 1NZFA 4CQLA 1KK0A 2JCBA 1FFXB 2R00A 1EXNA 2R7MA 3RU7A 5BOSB 3OFND 5THKA 3IT1A 3JSAA 4HGNA 1AHIA 3SXJA 3H1BA 4FIDA 4MJLA 1NVAA 2JD0A 4ZQGA 3E48A 3R6TA 1BN6A 3H05A 1GAWA 1TCUA 3SIXA 1BE6A 3R6WA 3ZHQA 2UVQA 4GS5A 4WXYB 2EKDA 2FLWA 2OPBA 4DLKA 4F9FA 1Z6XA 3M0EA 4DARA 4B84A 2WVHA 4RMNA 5EL0A 4Y2UA 3BXXA 2OORA 2Q7OE 1JLRA 5IW8A 5KX5A 3I0MA 1XZAA 4RK6A 3Q6IA 2J87A 4D9BA 5G4LA 3G5LA 2NYUA 3HY3A 4G1CA 4UEWA 5FD8A 3DMDA 1DZIA 2ZYHA 1QVAA 3WQRA 1NYLA 1O95C 2ZQ5A 1HLPA 5FWYA 3I61A 3CPHA 3DE6X 5IF9A 2HHJA 4CDMA 1UMDA 4RY9A 4B6PA 3Q9LA 1QQ5A 2Q6KA 3TJRA 1QP0A 3FSGA 1JG6A 2B8JA 2GTPA 4QWWA 5HE9A 3I58A 3ZYCA 3E3LA 5JS6A 2UUCB 2I9PA 3S5JA 3PDIA 421PA 4DL9A 3GFOA 3DE2X 4UOZA 1G5HA 1Y1SA 2C92A 2JDIA 2G25A 3DFKA 3PXDA 3QW2A 1VPVA 4N82A 5G0TA 3SKYA 1DKNA 3TG8A 4A27A 2ZZNA 2F1HA 2ZYWX 2WHXA 4CV0A 1MABB 3EVFA 4D0LB 1R1DA 1KZ4A 1RYFA 1VRVA 5LWQA 1HEIA 4LQ4A 5CGQB 1ADGA 4G2NA 5AOVA 1Z4OA 2JLRA 3QUAA 4UM8B 3C3YA 4O1IA 2ZU0C 2IYRA 1W0JD 2WMDA 2ZB2A 3LOQA 4NH4A 4B3HA 4PNPA 2OQ2A 2Z1DA 1HZJA 2FE4A 4RDXA 1DIAA 3V6MA 1THGA 3NHMA 4EG0A 4YLGA 4LISA 4XIFA 4NSNA 4MV3A 4RSRA 1ZXBA 4IFEA 3K4HA 2P4SA 2OV8A 4DADA 1I7QB 2DWUA 4OHKA 1WD7A 1WY5A 4D9GA 4WY2A 4JSYA 5ALSA 3CJRA 4XFDA 1A8PA 1J25A 3DM9B 5MGNA 3JAKA 3H8JA 1TO2E 1QE3A 1OTYA 4RLFA 3KP1A 1TM2A 4PC2A 4L0MA 1A1VA 2PGLA 3OQBA 4FQ7A 4WN9A 1E3TA 1NU8A 2DBVO 3FBGA 4R68A 1YR1A 3U7QA 1V39A 2NVBA 3JQ8A 4JX8A 2CYBA 2JHFA 2YJNA 4ARBA 2ZUWA 5IAAA 3BJRA 1V7PC 2WHPA 3RAPR 2ZUDA 4ZOAA 3LUPA 4EB3A 3WBKA 5AH0A 3WLKX 5LA6B 3L6CA 3B38A 2X41A 1EK2A 3A9TA 1SRQA 2V3WA 3H0CA 4S1PA 1YOBA 1MFZA 1L3CA 3GMIA 2G72A 3IUBA 2Q27A 2F7SA 2DKFA 3DO5A 3SZMA 5BSGA 4PSDA 2YY5A 3QVMA 3PUJA 4DQLA 4LMBA 1DIHA 1U0EA 3DBHB 4MKGA 4EM6A 2PV7A 1C8LA 2TMGA 1KQOA 2NOAA 3AF4A 4KWHA 1XK6A 3OZXA 4PYOA 2FSUA 2G1PA 3ADCA 1W2WB 3AM3A 5EEHA 4FCTA 4DJEC 1G2QA 2E37A 2IX9A 3AEKB 4K26A 4G2TA 4UU1A 3WGTA 1CD5A 1WCIB 2Z4TA 3IKLA 4J9UE 5K9ZA 3HH8A 1KPIA 2ZK7A 4I8IA 1GCAA 1A0OA 1OWPA 2CDAA 3WTBA 1NL3A 1KI6B 3P52A 3ITKA 4PLVA 4Y7DA 1PLLA 3PXAA 4HMOA 4CTKA 4JXJA 3QF7A 1V11B 2IODA 2VKTA 4MVJF 4MV9A 4G1UC 4PTLA 1EXVA 4ER5A 5E3IA 1JX6A 3JWJA 1X94A 3PWTA 4EKGA 3TK1A 1KMIY 1EZ4A 5C51B 4N03A 4BV9A 4PYMA 1VP3A 5BXYA 2WJ3A 4AULA 4PSAA 1B00A 2GJ9A 2HTFA 2X8WA 2XRZA 3HXLA 1OPXA 3HRIA 4XOUA 1WUJS 3UV6A 3VZBA 3C4JA 5BNZA 2ASEA 1BNCA 2FXVA 2PSDA 2QRVB 3H9QA 4ZC1A 5F7XA 4NFLA 3V6LA 1W76A 2C8VA 2P2SA 4ZZ2A 3OO1A 1DSSG 3QJGA 1II9A 1W36B 2ZRHA 2XMCA 2UUOA 3NCTA 3OMXA 2NUTB 4P4GA 5LZ4A 3LT0A 4YDSA 5AUNB 3H1TA 4WLVA 2OG1A 3IVAA 4CQMA 5HOEA 1G8PA 1SZCA 3Q10A 2EG5A 1XDUA 2D5AA 2ZYGA 4U3JB 4NCAA 3IMGA 1G8JA 1FLNA 2HBYA 2W8ZA 3R7SA 4BN5A 3DKIA 3VH4A 2GF9A 3LLUA 2WWGA 3OLYA 3QLTA 1M2FA 3P0HA 1UPCA 1U7XA 1JH8A 4LFAB 4IG4A 1KJJA 1NXQA 2ZI4A 3MS7A 2O7QA 1SHZA 1R10A 1ULTA 2FE1A 3VR5H 3UB4A 1ZJWA 4RZ2A 4YRIA 3LDGA 3B20A 4WY5A 1U28C 2FP4B 4MQ6A 5BOVA 1CUFA 2X5NA 1IBKB 3FB4A 1QBKC 1VYVA 4GU5A 3OIFA 2GRJA 2WD7A 2HQOA 2XIJA 3QU5A 5L7YA 3ULKA 4AP6A 1J0EA 1YB6A 4AX8A 4LKOA 4M9SA 4X54A 4KVZA 3T95A 1X6VA 1QS0A 2Y9PB 4OHFA 4F2GA 1LK0A 2P75A 4DRYA 5LMNB 3GJXC 4GE3A 2I6TA 1JDUA 1LGYA 2PH7A 3IAUA 4JUBA 2IP2A 2H51A 4HXGA 5BO5A 1SD1A 4WXPA 3B1JA 3OFJA 5AKHA 2D6FA 1JYFA 5KX5F 4FJ2A 1A1SA 1DUIA 4NLLA 2QJRA 4HHEA 5LIRA 1CRQA 1Z5VA 2D74A 3GC6A 5JMPA 4D98A 3LH5A 1X1TA 1UR5A 2PTGA 3B3JA 1U2GC 4INOA 2XEDA 1I1QB 2ODEA 4BE9A 5A03A 1RYZA 1KI4A 4E4YA 4WD3A 4YCNA 2LWIA 1N1DA 4IGAA 1KMCA 5ABPA 1VJGA 1OH5A 2CXOA 2X6QA 3O8LA 4PLTA 2FPIB 2I55A 3ZH2A 3JASB 5EZYF 3U3JA 5BSWA 4CMHA 4BNDB 2QD2A 3PNSA 5A6SB 5JAOA 2RHRA 2C58A 5EHZA 1XJ5A 2XNHA 1U1GA 4BQQA 4F12A 3GU3A 4C7VA 5AVTA 1VGVA 2W6PA 4A2PA 3F3YA 2QN1A 1JL3A 3EZ6A 2W70A 4JI6B 3LDHA 5GVRA 4NK4A 5COQA 4EQZA 4EYQA 4UAGA 3RS5A 4F91B 2I4IA 3WJAA 1UT8A 5DHAA 1ISJA 3D2LA 3FPBA 4EYEA 4DB2A 2NZXA 3WA7A 3WGYA 2DETA 1W36D 1DBVO 3PFFA 4XDGA 1Z3CA 1XHLA 2X7JA 5F1OA 5T64A 1K8YB 3EHEA 4PZ9A 4YRDA 5HK8A 3KDAA 3FPLA 2HREA 1GR0A 5EP2A 2QR2A 1M1YE 4XQEA 4ARVA 5BYKA 4KR7A 1NXVA 2GAOA 1KY4A 4NAUA 3GELA 3V8MA 13PKA 5IS2A 1HTTA 4FDMA 3FPEA 1CUZA 1SKUA 5M2QA 1G20E 2RGRA 2AG5A 1J42A 4NZMA 4TWRA 5EHQA 4CVNA 4YMHA 3K35A 3SF8A 3UAXA 5A9RA 2NZWA 3TTUA 2XDQB 2VK1A 1KMNA 4AECA 5JWOA 1CRZA 3IR5A 4YRMA 5LKRA 5C5CA 4PGMA 1E6CA 3AUSA 4QUAA 1KFBB 3DL2A 2CYAA 3HUFA 3KSDO 4PGAA 4AD8A 3L7DA 3CF0A 1W47A 4F7WA 2YMQA 4Y2JA 3DW1X 1MHPA 2EGUA 4QDZA 4CHTA 2QTVB 3U17A 3GHHA 4YVFA 5DM4A 4F3RA 5IJ0B 1DRVA 2R96A 5FLEX 3AFGA 1JBEA 3NEAA 4F6RB 3TFQA 4FILA 3IALA 3F5DA 5G4KA 5EP1A 2J3JA 3SJ7A 1T2DA 2PZMA 1JKMA 1O6BA 2D4AA 5H82A 2YQ5A 4ND2A 4OHZA 4Y30A 4DLTA 1QJCA 3FAKA 2QQEA 1FVFA 3U4CA 5BXQC 1BH2A 3AEYA 1WSDA 2I4OA 2GM5A 5TMPA 2CVHA 1SA0A 3E1GA 1FX0B 3KYDB 4HDMB 3T99A 1GARA 4M46A 1T8SA 1XZEA 3NV9A 4NEHB 3C2QA 4NMMA 3KXKA 1TO6A 1GFSA 3V2HA 4YDQA 3L4KA 5EUQB 2AG6A 2XA9A 1E7SA 3DCIA 4FR2A 2M2IA 3QUTA 1FMFA 2GEJA 3I8OA 2GK7A 4CTNA 4GQIA 3G8BA 1WU7A 5I7VA 3FDZA 3CVOA 5JS2A 3C3EA 4ZO4A 2PWBA 1F8YA 1TJPB 2ZJ8A 4YCSA 2P7IA 2AUMA 4INAA 3HCOA 3VGPA 1KZ6A 5A2GA 4D74A 4H3HB 5FUYA 3QKIA 3F9RA 5NULA 2CJWA 4B6SA 4C21A 1X2EA 1GUAA 2A9KA 3B9PA 6YASA 3NUZA 4FC6A 1V25A 2JAPA 3S55A 4CMKA 4E5DA 4MWZA 2IEDA 1Z5WA 2H1IA 3WNCA 3FRHA 3ZE0B 3ZS8A 4BFCA 3NR2A 2IYXA 4WA8A 3DP7A 2AOTB 2OMEA 2ZUTA 1S1CA 3R3WA 1E2QA 1DWQA 3KSMA 3SAJA 3ZD7A 4O5OA 2Z04A 5JJIA 3AVXA 3C7KA 5D6NA 4OEHA 1VKRA 2R1TA 1Y82A 5CP8A 1QG6A 2W2QA 4V0SA 5C7YA 1M1YB 4J2HA 5E2IA 3I04A 3WRYC 1Z5ZA 2WW8A 3UY4A 3KLMX 4JLPA 5E4TA 2RGAA 4E11A 1G20B 1MRNA 2ZTLA 1EHYA 1AF7A 4LI3X 1T3ZA 1SG0A 4X6XA 1KRWA 5KNDA 4I9NA 2NVOA 2VWQA 1GQFA 3B70A 3N2YA 3I9V1 4WSOA 1R7RA 3RRBA 3RSOA 1PVVA 4Q1EA 3EK2A 3VDQA 3QMPA 1MIOB 3WLNA 3MT0A 3JQFC 2PZLA 3QBEA 1PZEA 4B4DA 1YR9A 4PPFA 4Q47A 1TX4B 1Z74A 3KJIA 4F46A 4YAIA 4EI2A 3ZUGA 3FYHA 3OLWA 3G2QA 1U0SY 1DCKA 5BP7A 4BVLA 1BFDA 4DNQA 4ZU3A 2H1HA 3EFOA 4C04A 1ORDA 1X14A 2DWOA 3LOUA 4R81A 1XAGA 2PR2A 1OXTA 4LOKA 3WIVA 5HILA 4BTEA 5IFLA 3L8HA 1E3EA 5FOXA 4BC0A 4N0EA 2UU9B 1AX9A 1ABEA 1Y8QB 3K8YA 5FLYA 1Y7HA 5DM0A 3DEFA 3IDOA 3PXUA 1BCRB 1JILA 1YHYA 2L19A 4KR9A 1ODKA 1VLHA 1MVLA 5FADA 1P6XA 4LVUA 3ODPA 1GGNA 4GXNA 5K3OA 4HEQA 4GUAA 3FGNA 4DNOA 3ZDDA 3RQIA 2NXNA 2I4LA 5A04A 5A7HA 1TAQA 4U2EA 4MP8A 2IPMA 4KI7A 3C39A 5ALMA 5IYZB 5AOCA 1GNTA 1MQSA 4F2HA 1RPJA 1P2SA 1P5RA 1S4MA 1RP7A 2BEVA 2Y71A 4ITUA 1OROA 4FKBA 4IRUB 3GB9A 3EIUA 4FOPA 2DLDA 4ND4A 4R5MA 1MJGM 4BNMA 1QGDA 4BX3A 5IKMA 1ML3A 4V0ME 5DLPA 3BRWA 2IYTA 5EE5B 5AVOA 3VYUB 2JH9A 5HS4A 2ZUBA 4DCPA 4WLOA 1FVHA 4REMA 2BTQB 1ZC3A 5DEIA 4ZVKA 3IKMB 5B1EA 3I9KA 1ESMA 2IYZA 5K8CA 4O33A 3NEYA 2F8TA 1WW8A 3Q9UA 1GUZA 3S29A 4LCJA 2HEIA 1ENYA 1P72A 2WWXA 4NBWA 4XYMA 1PLKA 1XX6A 4GI2A 3U4GA 1EFDN 3OIVA 3P4UA 4M4SA 4ZOLF 1LI5A 3WLRA 5J4VA 1EBBA 1RWWA 1RI2A 3I5AA 4L5CA 1QOZA 4ZAXA 1ZCBA 4JYCA 3IPYA 3OJEA 1A2KC 5FTJA 2V58A 1ZRHA 3USES 4QU5A 5HTOA 4BB5A 1NLMA 5L6LB 4M9RA 3R3YA 5CLIA 1YB5A 1HWYA 3D4IA 2EHJA 4TVSA 1KOGA 2QRUA 3I1IA 4TWAA 5CA0A 1VXOA 3ZHBA 1WEKA 2C2MA 4ND3A 2H5LA 5FBVB 3W2HA 3ODGA 3DEHA 4GW3A 3GAZA 5T4EA 2AI3A 1JFFB 1ORIA 1UBCA 3E8SA 4WVLA 3V4FA 5AUPB 5C8YF 5JNUA 2VT7A 1TNDA 3ONEA 3RT1A 4D8UA 3F9IA 1HETA 4PQYA 5CEFA 1E5VA 4S1OA 4MINA 2HF7A 2ONCA 3GRUA 1BEZA 2IYLD 3MRVA 1DJLA 4ZVVA 1ORWA 1LDBA 4Q21A 4TV8B 5TC4A 2X3UA 1AKNA 3ZV3A 3VR6H 3CB2A 5L3QB 2KPOA 4KLAA 2ZWVA 4RF5A 4AY4A 3HA7A 3KEMA 1DRUA 4P3OA 1M8FA 1L7AA 1DO8A 2R44A 3LDAA 2XQKA 3AUFA 4JJAA 4GYWA 4MVXA 4BWFB 1VBNA 1XZKA 2P6OA 3P94A 4R40A 4A73A 4Q9IA 1XMPA 1FNDA 3QBJA 3S7ZA 2JD1A 1Z26A 5LQRA 3OE4A 1NN3A 3QE3A 2VF4X 3P5BA 4IDOA 1NE2A 1LPPA 4DLZA 3K0EA 2BFFB 5H80A 5IDXA 3K72B 4TM8A 3W06A 3KU1A 1JAYA 4ZTUB 5CTAA 2OK7A 4INPA 4QFBA 1KEEA 3WKCA 4XXHA 1XKXA 3LUAA 4WW0A 3L8DA 4FD2A 3OSZA 1LRKA 1OH6A 4I9FA 5EGNA 1OB2A 1J21A 1N25A 3E61A 3HB5X 3ZI0A 4ZOQI 3LF1A 4O1MA 3A11A 3N05A 1D07A 1C3JA 2R62A 1F2VA 1K6EA 2F9MA 4IJQA 4W1SA 4BMNA 5AJTA 2AK3A 4JL8A 4UOQA 2AFVA 2ZYUX 1M5TA 2VWHA 4XLTA 4F2DA 3PPWA 1JMYA 5FT9A 4OOFA 3VKGA 4PX2A 4UVDA 3OFVA 3M2TA 4E30A 4EHAA 2C7VA 4LZZA 3PQ2A 1SVIA 2XUPA 3O4RA 3X1ZA 4TKVB 3B9RA 2HA7A 3PJEA 5EC8A 1NW7A 1XELA 3DOUA 3KHTA 3ELWA 5ERGB 2H85A 4D7AA 3PDWA 1XMVA 2AMYA 2G1KA 1TYCA 5CVVA 1DV1A 2P4HX 1P9NA 1UDXA 5DTIA 5DU2A 5CDTA 1PT8A 3MAAC 4JGIA 2C4UA 2KLBA 5C8ZA 4RENA 3D6TB 5FEUA 2GPAA 1EMDA 2Z8ZA 5BMVA 2O50A 1EZ1A 1ZA2A 2BHLA 4YAWA 1DXOA 3HI6A 1U2DA 3O9MA 2YVLA 3B6JA 3E3NA 2VR1A 3EXG2 1SBYA 4F56A 3KAJA 5BY2A 1MBZA 2YC4C 4QLOA 3RVSA 3WGJA 1XTPA 2CLSA 2RHBA 1RAIA 1C3VA 4B76A 1Z5NA 4YMGA 4MKIA 2YUIA 1F6WA 3HO8A 3Q2IA 4L73A 2W42A 3O1IC 2VP5A 4JB2A 2DR2A 1LWOA 3PC6A 3H84A 4Y2GA 4C0JA 4YAKA 3MA0A 4UU7A 4ZGGA 1XKTA 1AN9A 1B73A 4IDBA 2ZS7A 1QRSA 4GUDA 3PQEA 5D2CA 2HMSA 3CN7A 3CSSA 5BR7A 3LFTA 1M3SA 2BEWB 3IB6A 3X2EA 4BO0A 1AGNA 4I6JA 3SBXA 2OGSA 4L3WA 4N6GA 1D0SA 2N75A 4X6YA 1MP0A 3T4EA 1E8NA 4OH1A 1OVGA 4WFJA 2OXCA 3H0EA 4HQLA 4ASUD 4QU8A 4DV6B 1D5WA 3TQOA 1YI8A 4BVAA 4BNUA 1R88A 4PAMA 4N5MA 2QMQA 4BJ1A 1KDPA 3ID6C 1V2HE 1WZ2A 3LZ6A 4TSRA 5HF6A 2VVTA 1UFVA 3I39X 2ZIXA 5BV2P 4WUTA 5E9QA 4WGFA 3MLBA 4J0EA 5LU9A 4OFWA 2UYCA 4UXJA 2RI6A 3AEQB 4DBLC 3VUEA 3BH6A 3AHHA 3FETA 3R3HA 2HJWA 1G5QA 5TT1A 5B30A 5JDIA 4Z9FA 1XTQA 1UZLA 1GKIA 3WXMA 2RSLA 3DXXA 4WOBA 3TMAA 3HV0A 4PSUA 2OBXA 3BOSA 1KC3A 4YMIA 5B53A 3W2GA 3ZYZA 3S2SA 3V00A 2JFYA 1M2OA 4L9RA 2O23A 1XQVA 3T9EA 5GGYA 1S3GA 1CEEA 3PDCA 3LDFA 4C0LA 3WRYA 4UPEA 1HDRA 4ZEXA 3W6PA 1H5NA 1Q57A 4MB6A 3MWDB 2NPOA 2PN1A 1BX0A 2JJ2D 5JC8A 3BT7A 1DHRA 3BILA 3MOGA 2GZSA 4J1TA 2IOYA 4IVPA 3L9XA 3BZUA 3D81A 3LXXA 3P97A 4KK3A 4KGDA 5CB6A 3E15A 3U2QA 2VDPB 3Q12A 2CDCA 3JQFA 3LZDA 2CFIA 2VWGA 1Y7IA 4YXWD 2I8AA 1XJQA 4RPJA 2GILA 2D4HA 2NTNA 3MZ0A 4RTOA 2HGSA 2WJIA 1UJ5A 2OVFA 4MUXA 3M4XA 3DHYA 3MS2A 3H19A 1GGKA 4F4HA 3AINA 2CV0A 1BWPA 3EGCA 1Y1RA 4PQEA 4AZVA 2Z1MA 2VLIA 4ZRDA 2JKZA 2IYQA 4O6VA 3RADC 4JGGA 4BNJA 1D2HA 1SUPA 4ER6A 5CXSA 3ZE2B 1Y7TA 1I1OA 2AOUA 1UM9B 3O93A 2XWJI 2J9XB 3DV0B 1XDSA 1WB4A 2G36A 4L57A 4O4IB 3QXGA 4MR9A 2ZYDA 3R7AA 3W5IA 3E22A 1NVDA 3ZHYA 3VC2A 3TQSA 2C9OA 5JXHA 3IEKA 1TUIA 2QM0A 4UJ5A 3AY0A 4UHCA 2AQ8A 5EZSA 2QRQA 4HP8A 3BDIA 3CR7A 4XVQA 3HL0A 1C1XA 4C4AA 4AS2A 1UDBA 3VVLA 4H0NA 2JZOA 2B0CA 3FYTA 4QAJA 2GLTA 1PZHA 5CLHA 3QPAA 4MROA 1Y6QA 2EXXA 4F60A 3UCEA 2JGDB 2OESA 5F73A 2DUWA 4XUEA 1LQ2A 5I4CA 5IX8A 4BQOA 5IZCA 2CXSA 1ZGHA 3DVRX 4OQLA 2BDTA 1H4QA 3PX2A 5ALEA 3QEOA 3EAFA 3LUJA 5CM8B 2QAGA 2D62A 4B6JA 3HXTA 4RD4A 1MC4A 4LK3A 1A27A 3L4EA 4IJWA 4WY8A 2YN2A 1Y98A 5HF8A 4MP6A 2OB2A 4CFYA 1QORA 1SELA 3MWEB 5E1MA 4ZDJA 4NZPA 3UPTA 2FPUA