3UIEA

Crystal structure of adenosine 5'-phosphosulfate kinase from arabidopsis thaliana in complex with amppnp and aps
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
191
structure length
191
Chain Sequence
CSVEKVDRQRLLDQKGCVIWVTGLSGSGKSTLACALNQMLYQKGKLCYILDGDNVRHGLNRDLSFKAEDRAENIRRVGEVAKLFADAGIICIASLISPYRTDRDACRSLLPEGDFVEVFMDVPLSVCEARDPKGLYKLARAGKIKGFTGIDDPYEPPLNCEISLGREGGTSPIEMAEKVVGYLDNKGYLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylyl-sulfate kinase 1, chloroplastic
publication title Structural basis and evolution of redox regulation in plant adenosine-5'-phosphosulfate kinase.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase/transferase inhibitor
total genus 80
structure length 191
sequence length 191
chains with identical sequence B, C
ec nomenclature ec 2.7.1.25: Adenylyl-sulfate kinase.
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01583 APS_kinase Adenylylsulphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uieA00
2RGDA 2QSYA 2BBSA 3AP1A 4N1AA 2GXUA 1SXJA 2O8DA 1Z0KA 2IXGA 2V54A 1Q12A 4K46A 2ZVQX 2Q21A 5F9HA 3TQFA 3LY5A 4TL6A 5SZHB 2FFBA 1CR1A 4JJKA 2BBTA 4Q1EA 5DSZA 4TLCA 3T1QA 5KYKA 821PA 2HXSA 4IVPA 1G291 2QMUA 3BH0A 3CONA 1D5CA 2EWVA 3JVUA 5CK4A 1D6JA 3CNOA 1NG1A 3IBYA 1T3LA 4RD1A 1N6NA 3MMPA 3OAAD 4IW3B 4D82A 3THXA 1L7VC 1E9EA 5LD2C 1GAJA 1U0LA 2IYTA 2ZRMA 2ZJ2A 4KJZA 3REGA 1JBKA 4US0R 1ZD1A 1KI6B 3NHAA 2GJ8A 1T0HB 2DR3A 2AX4A 3N2EA 3LLUA 5AK0A 4P4SA 3SFZA 3N5CA 4UKDA 1KK2A 2H5EA 4MRRA 4ARZA 3EWAA 1HURA 2GKSA 1FNNA 1U8ZA 2LCFA 4IDHA 3T34A 4BLPA 2VYFA 2ZYWX 3NKVA 2JLVA 4PC2A 1CULC 3K9HA 3TUIC 3LXXA 3THYB 1VDZA 2WPDA 1O3YA 1S9DA 4JKIA 3LQQA 2FGKA 3KB1A 4RY2A 3A1SA 3L8YA 1D2MA 5FOXA 1U2RA 2VSXA 2ATXA 2QE7A 4M1OA 2E9SA 1JQLB 2R2AA 4U00A 1DTSA 2JLZA 1IJEA 1R4AA 1AIPA 1NLYA 2QTFA 2UVQA 4MGIR 1U94A 3OEHD 3GJ6A 4IDQA 2WIBA 2O8EA 2G6BA 1E0KA 3OE7D 3LD9A 4LPSA 2BV3A 3LXRA 1EX6A 4A8JC 2QI9C 4Z1MD 2ORWA 1H65A 3CPHA 1QF9A 2GA8A 4Q9LA 3T5DA 421PA 3GFTA 4S35A 1E99A 4KLZA 4RZ3A 1KJYA 4ZCLA 4UNRA 4V0KA 1D2EA 5FUWA 2ZRFA 3K0CC 1RJ9B 5BN3A 2JLYA 1T9HA 3ZYCA 4KBGA 4HEJA 4TYNA 1HYQA 2GJSA 3WNCA 1CLUA 4D4KA 2QEQA 3SNHA 3AF3A 1XD2B 2PLRA 4LHZA 1TF7A 2O8FB 3UKDA 1LFDB 2GAOA 3DDCA 4QBIA 4TL9A 4DB2A 1XEXB 5K8UA 5JJKA 2YKGA 1BYUA 1NN1A 1Q1ZA 1SZPA 4D4LA 4HAYA 3DMDA 1G1MA 4FD2A 4Q7JB 4ZV4A 5EZ5A 2CJWA 3X2SA 4US1R 2IA5A 4NU0A 1JAIA 2ONKA 3X1ZA 5FL7D 4CEJA 5JEEA 2XJ9A 3WBJA 2XGJA 4ON9A 4Q4AB 2XSZD 4UJ5A 4Z8XA 5CB8A 4KITB 2O0JA 1L4UA 2QQEA 2R62A 3A8TA 1IOZA 3EA5A 3Q7PA 2XOKA 3EAQA 3MJHA 4QJ3A 3B1ZA 2WOJA 1TPZA 2JCSA 3WP0A 3X1DA 1GRQA 4UXIA 3A1UA 3GJ3A 3I8XA 4OJKA 1N5LA 2ZRBA 4GOJA 3A1TA 2OV2A 3NH6A 3C7KA 2OBNA 3TIFA 1ZM4A 2QT0A 3GLGA 4D25A 3NC1C 5EXSA 4BLTA 2V3CC 1NY5A 2CL7X 3AGQA 2D62A 2MSDB 4KFUA 4M9XA 5CK5A 4XD7D 1Q1EA 2F3TA 2WMOB 3KX2A 4I4LA 4A82A 1E9AA 4Q4LA 4MDEA 4KFRA 4OJQA 4O3MA 2BBWA 1CJMA 4TLBA 1N6OA 1T8TA 4TLAA 3BB3A 5BYJA 3K53A 4TMKA 2ECKA 4JKYA 1P2VA 2JDIA 3CPEA 2QZ4A 3WXMA 4GBMA 4NTZA 4WW0A 2ERYA 2O8BA 3KKOA 3W90A 2D2EA 4WOPA 2QQ0A 5BWMA 1XJQA 3TE6A 521PA 4C4PA 5FUYA 4DXAA 3H2YA 1KIMA 3AF2A 1VYTA 4FINA 1GITA 4NCHA 4BECA 4WVFA 3VKWA 3IEUA 5J4KA 3IEVA 3MWLA 4KVGA 2GILA 2QP9X 2QE7D 4IXNA 4FCWA 1ZMXA 3BH6A 2LWIA 1HA3A 4XVQA 3G0HA 4LHWA 1E96A 2KWIA 2WBLC 2N46A 1KZGB 2WTUA 2Z83A 3U7GA 3QY0A 5KHOC 3ZZTA 1XJCA 2JGNA 3C5HA 4DLYA 4Q4HB 1GKYA 4AKHA 1UDXA 2BMDA 1ZNYA 1OPXA 1T5IA 5UKDA 1U98A 5EE1A 4BE7B 1MABA 1IXZA 3GJ4A 4XVRA 2ZYTX 4B3CA 3THWA 2ZI6A 3FHCB 3OIYA 4IDOA 1JR3E 4UNSA 2Z4RA 2XXAB 1RRPA 1U9IC 3DMNA 3UIEA 2WJIA 1HY3A 1I4DD 1QBKC 4LRWA 4V03A 3RS0A 2F1JA 2J0VA 3FTQA 1ZM7A 2GF9A 3IHWA 2RMKA 3BWDD 2GETA 3GJ0A 2QN6A 2J1LA 4B6EA 2WKQA 2QA5A 3TMKA 5GVRA 2ZUBA 4D2IA 2DFTA 2ANBA 1N5JA 3EZ9A 1ODFA 5FFMA 2FWRA 3IUYA 2AK3A 4MYUA 4OQMA 3KJIA 5JLJA 4AD8A 2MMGA 2PT5A 4G3XA 1O87A 3Q5EA 4AC9A 3TLXA 2GZAA 3VFDA 4YMVA 5J4LA 3AKDA 3T61A 2DFNA 2ZJAA 2ZSFA 2QP4A 5A5GA 3LBHA 1I4TD 3R9XA 1YR6A 4C0QC 1P73A 4BRWA 4ZDKA 1YZLA 3UATA 1KSFX 5B2ZA 1AGPA 4HZUB 5HCIA 3MUFA 3ADCA 2A78A 3GEHA 2Q0HA 4E09A 4QKQA 3GJXC 1RW4A 1CF4A 4IJMA 1W0KD 5J5CA 4NONA 4TL7A 2YJTD 1IY1A 2QRNA 2QMEA 3EZ2A 1QHNA 1MO5A 1US8A 4HAWA 4YXWA 3SFVA 2QT1A 3H4MA 1FOEB 4OI1A 5FOWA 1S2MA 3CF6R 2GRJA 1DAKA 1L4YA 3GLIA 3SE0A 1W4CA 5K8TA 2GXSA 3U3KA 3OFNA 4XOIA 4G5GA 1LV7A 2A30A 1QHHA 4XVUA 5L3SB 1IXSB 1WP9A 5EE0A 4PC7A 2WJHA 2DHRA 5D3MB 1KMHB 4DWJA 3AKYA 1GUAA 3QIAA 2FZ4A 1TADA 5EP2A 2GCNA 3SHFA 1YQTA 3RWOA 2WSMA 3M4YA 3RAPR 2H92A 4M1KA 4P4TA 3IIJA 2XJ4A 1UEJA 1FTNA 2HT6A 3EARA 2WJJA 3AEZA 3GJ7A 1KDRA 3RS4A 2I3BA 2OCAA 5L3VA 4D81A 3RSLA 2ZI7A 2G77B 2ZYVX 4TQ9A 2P2LA 1W36B 1NSFA 4R2IA 5F98A 4S2EA 3U3MA 1KI9A 1KNQA 5BXQC 3LDAA 4D4MA 2IYWA 2OFXA 3HJNA 2WZQA 2VQSA 3O8RA 2VF8A 1RC8A 4XWAA 2ZRPA 1DADA 2DFLA 3U7EB 4MGKR 5EP3A 5IRCD 5AUOB 3VNUA 1NN3A 4PZLA 2AD1A 3EPHA 1T0JB 5TV2A 4CYMA 1KMQA 1DG1G 1M7HA 5AWFC 1KI4A 5FPKA 2WWXA 4LBYA 5TXGA 2F1IA 3U3OA 4QGHA 1LF0A 4JBXA 1TU3A 1AS0A 3AVWA 3KZ1E 2ZREA 3O8DA 1P2UA 5G40A 3BXZA 4ZCIA 4GP7A 3EC1A 4W7SA 5FH9A 4ACBA 2IUUA 3I73A 3B8HA 2Q9BA 4DC9A 3RS3A 1J8MF 3LW8A 3EX7C 3UG6A 4WAUA 1QG2A 3NTUA 2BIFA 3FMFA 4LOAA 1GWNA 1L2TA 2OBLA 1M1YE 4PPQA 1E69A 2V6JA 4Q00A 1GIAA 1E2IA 1TU4A 3KL4A 1G19A 4ZCMA 1S3GA 3TR5A 2HF9A 2R9VA 4HB0A 4US2R 1Z6AA 4MKHA 4GP6A 4L15A 1VG1A 4EAQA 3B82A 4FMDF 4B2IA 4AI6A 3R9WA 1K5DA 2FEOA 4M9SA 3SBDA 4EPRA 4DSNA 3K9LA 4PC1A 2QNRA 2VP0A 5L3QA 5LDDC 3I92A 5A4JA 4LHXA 1II0A 3VHLB 1BO6A 1KDPA 3PITA 4DCSA 2XITA 4E22A 4KBFA 4JSTA 1R5NA 2PMKA 4OQLA 2Q3FA 2HYDA 1VCNA 4D80A 2JEOA 1F60A 3T06B 5JS8A 5JWRA 2ORVA 3HWSA 5H1YA 2IS4A 3NEJA 2J7PA 4WZBE 1G6OA 2H17A 2WIAA 3ZS9A 1V5WA 1KY3A 1M34E 3BS4A 5LPNA 4EFMA 5J40A 3NH9A 3K70C 4BLQA 5EP1A 4W5WA 1GNPA 4LV6A 2MSEB 4TYPA 1G8GA 2IWRA 4DT1B 3A36A 4QBGB 3MAAC 1RRFA 1C9KA 4FW9A 2EYQA 1NI3A 2IYUA 2PEZA 2PMDA 1ZRHA 2C78A 2H57A 3OFND 3IO3A 4BQSA 2DYKA 4Q1AA 4NP6A 4HB4A 1KK1A 3Q8XB 3SYNA 1KTVA 1RRGA 1Z22A 4DRZA 4EQ6B 4ZIRA 4IDNA 2GHIA 4EIWA 3AVUA 4DLUA 2ORIA 2CL0X 1N6RA 4NPHA 1ELOA 3BE4A 1G9XA 5E3HA 3GFPA 3BIFA 1V43A 1ZBDA 2VRWA 4QM6A 4AY2A 1F5NA 2A3RA 5G41A 1Q3TA 1TQ2A 2XEXA 4KCGA 2VTKA 1OFHA 2KSQA 4PPFA 4BRUA 4WXRA 3Q9LA 1PLJA 2CCJA 1E6CA 4QBHA 2QORA 2JLXA 4GI7A 4EPWA 4B32A 4JYCA 3ZVRA 4Q48A 3QKRB 3WYFA 1WCV1 1F2TB 1ZIOA 2IXFA 1VPLA 2IEZA 2AFHE 1T5LA 2JJ1A 4RFSB 2FNAA 5FOUA 3DVLA 3BJIC 4DLZA 4JLVA 5H8WA 1SKQA 2J41A 5AJZA 3EASA 1E0JA 1OH8A 3KFVA 3EZ6A 2HLDA 1AZTA 1XXHB 3JZMA 1II8B 4IVRA 4AWXA 4KYIB 2D06A 2V55B 4DIEA 5KDOA 4JVLA 4LJ8A 4M53A 4IXMA 4MUAA 1J8YF 1Z6XA 2BEJA 2KI5A 2NTYC 4Q21A 1VKJA 2OHFA 1A7JA 1Q20A 3EIEA 1OKKD 1FX0B 4HLQB 3RLFA 1NVWQ 2BCJQ 1GL9B 2W2VA 2ZU0C 5F3WB 4M1WA 3GLHB 2CCKA 4G01B 1ZYUA 1Z2AA 4DLVA 3ZH9B 1IN7A 1F2UA 1P9WA 5DHAA 1P2SA 4M1YA 3QPWA 2D4HA 2IS1A 4RJLA 4A0HA 4TT3D 3KDSE 3VU9A 4A0FA 3MWJA 4QXAA 1VCOA 2AKYA 2CL6X 2HDNB 2WJGA 2BC9A 4HATA 3SBEA 4QL3A 3IKJA 4QBFA 4D0LB 3OAAA 1XMSA 3FYHA 3W5IA 3AVPA 1DE0A 3SYKA 4MDFA 4L9WA 4MITA 2EW1A 4BFXA 2HCJB 4PC6A 2XZPA 2WKPA 5GJBA 5B30A 4LJ5A 1P6XA 2ZSBA 2YWGA 4XIGS 1W36C 4TSFA 2ERXA 2VH5R 3ASYA 3DZDA 3VTKA 1E2EA 4QC2A 2ZRCA 4MRVA 2NMVA 2NO0A 3WMFA 1BS1A 3CR7A 1MO6A 3A4LA 3ZDQA 1G21E 2HEIA 4I1SA 4QRHA 1U8YA 1NNEA 1VHLA 2R8RA 3CIOA 1ZNXA 4X8MA 5KO2A 2GBLA 1CJTC 3VR1A 3NBFA 4C9BA 4HAZA 1Q21A 4NYMQ 4PAQA 4ZDIA 1W47A 4WBSA 2ZRKA 3LNCA 3OE7A 1MT0A 4LWZA 1N0UA 5HKKA 5SZKB 1IAQA 1MH1A 3NWJA 3FDIA 1YZTA 4TWZA 2PZFA 4DSOA 2Q3HA 4IOLA 2IW3A 1TEVA 1Z3IX 4KAXA 1P3JA 4Q1FA 5JZVA 4U02A 3T15A 3SOPA 2P3SA 3U61B 2REXB 2V1UA 4DBLC 2D7CA 2EWWA 3CPJB 4C0AC 2FPMA 4P31A 1EWRA 2OXRA 3CX7A 1QHYA 4DLSA 2J9RA 4Y0VA 5KNBA 2AK2A 2B7CA 3H86A 2F3RA 4PXAA 5K8LA 3FHOA 3HU3A 3KJGA 4LC1A 4KFTA 1SVLA 2BHRA 3TGPA 2J46A 2NPIA 1TQ6A 3QF4A 4PAMA 1XJ0A 1CEEA 3A37A 2ZR7A 3U6BA 4LX0A 4MGYR 4URYR 5DE3A 2ZS8A 3W6PA 1UKVY 1BKDR 2ZETA 5BYKA 5DYGA 5CITA 2ZXUA 3ZD6A 4LI0A 4Q9KA 3CRRA 4JLBA 2D2FA 2ANCA 2GCOB 4UNQA 4HAVA 3BFXA 3K0AB 2OG2A 2ZJBA 4PTLA 1OYYA 3KQHA 3B7GA 1TMKA 4F91B 1KZ7B 2ZRIA 1AQUA 2BJWA 4NYJR 3ADBA 3A4MA 4PQRA 5JJLA 2GXQA 2VSFA 3L0PA 4J0QA 2BEKA 4QGAA 1J2JA 3ZQJA 2H16A 4XTRA 1CTQA 1VYUA 2VHQA 3CZQA 3AVQA 1WBBA 4DKXA 1BH2A 3TW8B 3FKSD 3I32A 3LFUA 3C14C 2GZDA 3QXSA 3WRXC 1JALA 2QPAA 2KB0A 3K0FB 2W83A 3KKMA 4LJ9A 2V6IA 2NG1A 1EFUA 1G64A 4XD7A 1E9CA 2FOLA 2RGNC 1S1CA 1R6BX 1CR4A 1RFLA 3G82C 4LJAA 4DHEA 1GKUB 1IONA 1EX7A 3GJ8A 4LCBA 5D3MA 2FN4A 6Q21A 3FPAA 1HE8B 4BZPA 2A5GA 4C2UA 5KDLA 5C4GB 5FTNA 4CEHA 1GKIA 3U44A 2J59A 3EWSA 5EZ6B 4QGFA 3GLGE 4JL8A 4LHYA 4TSFD 4W5HA 2H18A 2P0EA 2HT1A 5AJVB 1VCIA 1LS6A 2OT3B 2WSSA 4PFSA 4C0BA 1OFIA 5JECA 1LB1B 2Z6VA 2PT7A 3AH8A 2IUSA 2RHMA 4DDVA 3CX6A 3DKPA 1CRQA 3PEWA 5FTLA 2RCNA 1XU4A 1NVXQ 1VIYA 3N70A 2IYVA 1XPOA 4Z51A 2IXEA 3CNNA 1NJFA 3CNLA 1TEXA 3LQRA 4QNRA 4UXHA 1UDWA 5FOSA 4IOKA 3B13B 2ZANA 4PSAA 4LJ4A 5BQ5A 3R9IA 4LYHA 4B47A 1GL6A 4LK2A 1N5KA 2NO1A 1WXQA 1XZQA 4QG7A 2BJVA 2QAGA 2W58A 1XRJA 4G5OA 4BZXA 5JCZA 2ZROA 2AN9A 3KUCA 3MWKA 1E9BA 3LW7A 2BOVA 2P65A 5HKKD 4Q19A 3GEIA 1Z07A 2GZHA 3GQBA 5FBVB 4KODA 3UMRA 2ZE5A 3WP1B 1EWQA 1KO1A 4ZKDA 1K8RA 1ZC4A 1M74A 3TK1A 1OIWA 3HYRA 1GG2A 1OSNA 2L0XA 2X19A 1E2MA 1NBMA 3PV0A 4V0MA 3AVXA 4C0JA 2OCPA 2J3EA 1M2OB 1R10A 2D74A 2ZRJA 3CH5A 3LX5A 2P5SA 5DHFA 1UM8A 1QHIA 4I1VA 3RNLA 1UKYA 1Z6YA 1XTRA 1ZUIA 2JLRA 3ADKA 4URUR 3KTAA 4Q7MB 3RABA 4AURA 1ZC3A 2WOOA 3KXIA 2WKRA 3TKLA 2QY9A 2CVFA 1G3MA 1NIJA 2QMHA 2DPXA 3FGNA 4LJYA 4YQFA 1VYVA 5M04A 1SVSA 2KE5A 3T12A 2IHYA 5KTYA 4EPTA 4C7OB 4GL2A 5TB5A 4I1UA 1OIVA 2QENA 2VP6A 4LV8B 3ADDA 4RKEA 3W3AA 1UFQA 5DI3B 3AQ4A 1NL3A 5FPYA 4D0GA 1XTIA 3QUSA 3SDZA 3PENA 1E9DA 4QM7A 1KKLA 2I1VB 1DOAA 1E2KA 1HV8A 4NBSA 2E1RA 3KB2A 4G1UC 4JLPA 2OEPA 2OUKA 4OHXA 1FZQA 1Q1BA 3KKNA 4IDPA 4TLDA 1YZKA 2F1HA 2GF0A 2J0UB 3K09A 4HAUA 3W6OA 2G83A 1NMZA 4OI4A 4URVR 3T1OA 2P6NA 3UG7A 4RD4A 3CRVA 2GTPA 3AUXA 5FPSA 5FR1A 4Q02A 1W0KA 4UNNA 5KOYA 1KJZA 3AF4A 3L0SA 3BB1A 3A6PC 2N42A 3H0KA 3RRYA 3U4QB 1CBUA 4GZLA 2PX0A 3D31A 3Q72A 2NO7A 2VSOA 1ZCBA 2HCBA 4B2PA 2F43A 4NYJQ 1KYIA 3SQXA 5JJIA 4BEBA 5L8VA 5J47A 3B1WA 3K9GA 1TF5A 4B73A 2IYXA 1L8QA 1JXMA 2I4IA 3CBQA 1U81A 4AKEA 1ESNA 1MO4A 2B92A 2WV9A 4DIDA 2PCLA 3VX3A 3CF0A 1ZU4A 3SN6A 2A5DA 1HTWA 2WSSD 4NCKA 1E9RA 4FWIB 5CYOA 3KXLA 2FJUA 3I1FA 2O8CA 4RD2A 1W36D 1RVDA 4ZKEA 2XB2A 1KI3A 1DEKA 1NY6A 1N25A 4GZMA 3W8NA 3GLIE 3F3YA 3K1JA 5E7JA 2W00A 4Z8YA 4R98A 3R7WA 4D4JA 5CDFA 4L4UA 4EFNA 4HUTA 5JSZB 2QBYA 2KBFA 4Q9JA 1FFHA 3P4XA 1ZM2A 5FBWB 3UWKA 3OIVA 1EESA 1RZ3A 4NMMA 1E2FA 2ZE7A 3K70B 3B6EA 5JBQA 3I5XA 1KO5A 3DM9B 2XTNA 2V4ZA 4H1VA 2VBCA 4KI0A 5KSPA 3UK6A 3ZVMA 4GSYA 1FUUA 3ZVLA 3Q5DA 3HDTA 3A1VA 3NC0C 1CJKC 4TTRA 1I4LD 1VG8A 2IUTA 4HB3A 2ZR0A 3QKSA 4KSBA 5AUNB 4M1SA 1KDOA 5HE8A 1K6MA 4HDCA 2BDTA 1T3HA 3MSXA 4Q4JA 4A8JA 1OXUA 1KHTA 2DWPA 1YZQA 4PANA 4LYAA 4L5BA 4OYHA 4II7A 2WWYA 2RGXA 2IX3A 2CNWA 1NBMD 4PHTA 3CRW1 2VL7A 4HB2A 1Y3AA 2OM2A 3K0CA 5C2JB 1RKBA 2IF0A 4MH0R 5DLQC 2PEYA 5FUXA 1AA9A 1SHZA 1DS6A 3ZD7A 4JLNA 1IN4A 1SKYB 2OFOA 1Q57A 4MYCA 4OHYA 2ZS7A 1DAFA 1NIPA 1CRPA 1W5TA 3ZS8A 2B21A 1FL9A 2ZI9A 4L16A 2YINC 3NHBA 1IQPA 5BN4A 5GVSA 3BORA 2G88A 3P4YA 4WZ6A 2R6FA 1KK3A 2ODNA 3RS2A 2CHGA 1DARA 1H8HD 4X8OA 4JLOA 3MFYA 1U90A 4IOJA 1WDTA 2XZOA 1JPJA 2W6JA 1II9A 2C9OA 3B60A 5EUQB 1IXRC 1XWIA 2QSZA 1NLFA 4Q03A 3S1AA 1OXTA 2ZU6A 2P6RA 2ODWA 1E9FA 4B48A 1MRSA 3V4FA 1RRCA 4U7DA 1WRBA 3U60B 2IS6A 1BMFD 1WE2A 1I2DA 2LKDA 3ASZA 4NE2A 1LVGA 4HUQB 2FFHA 2JLUA 5F2EA 1Z0DA 1WB9A 4ERNA 2BCGY 1JAHA 2Z5FA 4I81A 4DVGA 4A9AA 4ZI2A 1YR7A 3WNBA 1XP8A 4HSEA 4CF7A 1E2HA 1S96A 4JLKA 4JVMA 4HLUC 2JASA 4OQXA 2FZLA 4V0OA 4JMPA 4C0SA 1ETUA 1G8HA 1LNZA 3B85A 1W4BA 4EJSB 3K0EA 4DZZA 1EGAA 3OEED 2B7BA 3NBXX 4EFLA 1Q44A 1KOFA 1J90A 1KY2A 1ZD9A 2NOAA 2VA8A 1IY2A 4KVAA 1SXJB 1G4AE 5DYIA 1R8SA 2O8DB 3QJYA 2CCGA 4OBEA 3U7FB 4DCVA 5HZKA 1GP2A 1XTKA 3RHFA 2X1VA 3VMFA 3ZVNA 1VMAA 1OXXK 1OT3A 3OIWA 2A2ZA 5IF9A 5CLQA 4H1UA 4LBZA 2O0KA 1M7GA 1UJ2A 3GD7A 2DFKB 1W0JA 3PEUA 3W6NA 2OLKA 4QGGA 1OH5A 1GL7A 1KGDA 2R6DA 3P32A 5DGXA 4WIAA 2YC4C 2HJVA 3L2OB 4IKEA 3THXB 1FW6A 1G8YA 2AXNA 5A0FA 2OXCA 3FMPB 3GLFA 5EXPA 2G1JA 4JT4A 2QAJA 1T6NA 1Z6TA 1GILA 2AFIE 4JL6A 4P4SB 4DEYA 2WVJA 1OHHD 4ARZB 2OBMA 5KU1A 4CDGA 1F48A 2EYUA 2QTVB 3EZ7A 3SC3A 2X8AA 5FOVA 3VR6A 1QHXA 3A4NA 4C2TA 2J45A 1E2GA 3P1JA 3DM5A 2ZE6A 1JJVA 5D3QA 5KSOA 1AM4D 5DI9A 1G17A 2FX3A 4P32A 5DN6A 4AYWA 2ZRNA 3B9PA 4DJTA 1XZPA 2CNWD 3OZXA 3M0EA 1NKSA 2FDCA 2OAP1 1PV4A 3NBZC 4TN1A 1W46A 3CUEF 4IEIA 1KO4A 5FTJA 2JATA 1X86B 4YC7A 3R8FA 2OLJA 2GWHA 1BOFA 3AV0B 4XJXA 1U9IA 2O8EB 2HF8A 4JJZA 2HXYA 4KU4A 3E2IA 1NVUQ 1OKKA 1KSGA 1JJ7A 1DPFA 4BWYA 1B0UA 1P7CA 4TMZA 4PPNA 2C96A 1AK2A 2GEUA 221PA 3KQUA 2YOGA 3FB4A 3IO5A 4M4SA 5EUMA 3I3SR 3VKHA 1P4SA 3DEFA 4Q66C 4NL4H 4EDHA 4MRPA 1GM5A 1MOZA 4TT3A 1IHUA 2PBRA 1GRRA 4OL0A 4HI0E 2Q6TA 1MRNA 1ZJ6A 2W6JD 4O2RA 4W5JA 3AVYA 3AGPA 2IWHA 2C5LA 1KI6A 2JIZD 2CMKA 3AP2A 3KJHA 3L0OA 5B64A 1UADA 4M9ZA 4MYTA 1YRAA 1Z28A 4I99A 2QP3A 3SJAA 3QSYA 1JEDA 3P26A 2RKOA 4BFTA 4JZKA 4XWOA 4LJ6A 4DDTA 4LBVA 1H8EA 3EG5A 4PHGA 4MRNA 1UBCA 2PL3A 5IDVA 1SVKA 1Z08A 4A2PA 3QBTA 3THYA 1GSIA 3FMIA 4PHFA 3LRPA 2RGBA 4CEJB 3SI7A 2G1KA 1U0HC 5JCPA 2HJGA 121PA 4M9QA 4C0KA 2OFWA 1X6VA 1W2HA 1MR3F 4QNMA 4Q7KA 4XWKA 4NZYA 3PEVA 4BFYA 2A5FA 3KQNA 4GRAA 4BLRA 3KXKA 1AKYA 4DLRA 1XEWX 1Z2CA 1Q0UA 2FFQA 2OESA 2V8OA 4ZPXA 5TVKA 721PA 5KDDA 1ZM3A 3WNDA 4EKDA 1XBTA 2FE4A 4UQOA 2WICA 4ASUD 2OCBA 1TUEA 4R7ZA 1E2JA 3CO5A 2FSIA 2QUZA 4HDQB 1T8UA 3NDPA 3K0SA 4PPGA 1W4RA 4F7WA 3GLGB 3I61A 5EE9A 3DPUA 1W0JD 1E1RD 1QVAA 1RJ9A 4BLSA 1FNMA 2IK8A 2OZEA 1EFHA 3EW9A 1HE1C 5KNDA 1XNJA 3OF5A 4L9SA 5CIWA 1NMXA 1M8PA 1XD2A 1SVOA 4PX9A 1Z5ZA 4LBWA 5EP4A 2O8FA 2ZRGA 2CHVA 5EJEA 1CJUC 1XEXA 3QXXA 2DWQA 3O8CA 4FWTA 5JWOA 1HQYE 3P20A 4UNPA 1DBSA 1X1RA 2GAAA 3W9YA 4KFSA 3I5YA 2O8BB 3SHWA 2ZRLA 1OH6A 1U0JA 4Q4AA 5FBRB 3QPVA 5HPYB 3RWMB 5DNYB 2ONJA 3X1WA 1DELA 5DN6D 1OXSC 1IBRA 4ACAA 2ZQ5A 2O52A 4FCVA 1JXOA 4ZI3A 1KSHA 1P9RA 3L8ZA 4A36A 3CRMA 1CP2A 2BM1A 5DIFA 4A1FA 2ZS9A 2VEDA 1UKZA 4AG5A 2ZSAA 3G5UA 4PZZA 4NDZA 1D2NA 2CVHA 2QG6A 4IOMA 4HYYA 3WBKA 1XFAA 1CS4C 4GFDA 621PA 2RGGA 2FG5A 2W0MA 1ZD8A 4AKIA 3PQCA 2ZE8A 1N0WA 1XMVA 2ZTSA 2VLIA 3NEYA 3T1VA 3FKSA 2GVDC 1MABB 4EJSC 3MGCA 4DDWA 3TNFA 3TAUA 4JVNA 1VCMA 1AZSC 3LA6A 1D8TA 3THWB 2NZJA 3LLMA 1SVWA 3PVSA 1SXJC 2I1QA 3B1YA 1EFTA 2CXXA 2WWIA 3Q7QA 5JHGB 1COWD 5CM9C 2JLQA 3A1WA 1A4RA 4AIIA 4LV5B 2OSBA 2JLWA 3KFXA 4TZ0A 1NN0A 4U5XA 3HP1A 4NKRA 4TLEA 4YLGA 3VX4A 5IHPA 1UEIA 1H8ED 5B58C 4QJ4A 3D7MA 4C0LA 1XD8A 1YVDA 3DOFA 3NG1A 4JIMA 2P6UA 4MUBA 3RVBA 1OW3B 3SJCA 5E4FA 4B75A 5J4HA 1GNQA 2PJZA 3LAWA 1CR2A 3B78A 3ECCA 4CT4B 1G18A 1CIPA 2IYSA 2O5VA 5EXTA 1YU9A 5H70A 4TZ6A 2N1BA 2PX3A 4MA4A 1X8LA 4OK5A 2AR7A 3VR5A 1X3SA 1FP7A 4M1MA 1YR8A 5P21A 1G7TA 2OE2A 2ZRDA 2AD5A 3GFOA 3C41J 2A5JA 2X2FA 4POAA 3FWYA 3IDQA 1XD9A 2VHUA 4B44A 3AP3A 5AJXA 3GPLA 1NG9A 2PCJA 4Q4HA 3ICEA 3QKUA 1IJFA 3JZAA 1HUQA 1OH7A 5BW8A 3LWNA 4NCJA 4ESVA 2GJAA 1PUJA 3QVVA 4TMVA 1US8B 3TVDA 1GOTA 4F38A 2QROA 1ZAKA 4GMXA 3HYTA 4PSKA 1QZXA 4DSTA 5JEDA 3GLIB 2XXAA 2XNSA 3EZFA 1Z63A 1Z83A 2C95A 4K81B 2OO7A 2C03A 2R65A 2W2XA 3KUDA 5LB4A 1QHHB 1LS1A 1CR0A 4LC0A 4MQBA 1E2QA 4JLAA 1Q3HA 4B3GA 2G0NA 2TMKA 3ZJYA 4HZIA 1WA5A 5K8IA 1NKTA 1S1MA 2EFHB 2GXAA 3U3RA 4OKSA 1WBDA 1JECA 1N5IA 2UZIR 1AQYA 3HU1A 3IPYA 2ZRHA 2QL6A 1SVMA 2YYZA 3ND9A 2FSFA 4ILEA 3DO6A 3RS5A 5KNCA 1NBME 4XTCS 4V0ME 3BK7A 3PR1A 3CWQA 3TSZA 4F4IA 4RSGA 2DBYA 3AUYA 4HDOB 2QMOA 1Z47A 4URZR 3UMSA 4M21A 1G8FA 1OV4A 1U8AA 2FF7A 1KI7A 1LF5A 3QVUA 4NYIR 1W1WA 3B1XA 3LX8A 1UPTA 4HZUA 3PEYA 2VHCA 4PAOA 3U5ZB 4M2LA 3C5CA 4NCIA 3IBGA 2YOFA 4RD6A 3I62A 2FA9A 1XMIA 2JAQA 1OE0A 3AF0A 1JNYA 4PZYA 1XF9A 1W2GA 4CW7A 1R5BA 2BMFA 2ZAOA 4JS0A 2AL7A 4QOSA 1R7RA 5JRJA 1JPNA 3R8CA 4A6XA 1KSJA 2G3YA 2J0QA 3TH5A 3TSOA 2W0SA 4WXPA 2JJ2D 2YWFA 2EFGA 3PCRB 3TW4A 2XNDD 1U99A 3DL0A 2B8TA 5L3SA 2R6GA 3DHWC 4G0NA 4HAXA 4C30A 2NIPA 3CX8A 1KMHA 1G5TA 5FR2A 2GNOA 1XCGB 1YZNA 1G8PA 3GJ5A 1ZUNB 2ZIAA 4R71A 4LYJA 3EPJA 3SR0A 1YKSA 1ZUHA 3VHXA 4FMCB 2CLSA 2FSHA 4KSCA 3D6TB 1TQ4A 2NO9A 3SJZA 4EQ6A 3ZIAD 3O8BA 3BFVA 4MKIA 3LBNA 5TY0A 2GJKA 1XMJA 4OHWA 2YZ2A 3WMGA 5L3QB 2AWOA 1YZGA 1JI0A 1W49A 2XTZA 3K70D 2DY1A 2EVWX 3PG5A 2G0TA 1NP6A 4M1TA 4TTQA 4I1OA 2J87A 2CLCX 5TMPA 1TNDA 5FPTA 3CWZA 3QENA 1DAHA 2EU8A 3L43A 3W34A 3EPLA 2Q9CA 2A5YB 1UF9A 2B6HA 2R6AA 4JT2A 1AS3A 3HPRA 1DAIA 3ONWA 4KXFB 5KPDA 1N6HA 5DO9A 4KLNA 3SEAA 2ODEA 3AF1A 4TL8A 1W4AA 5C18A 1KI2A 4FI3C 3AKEA 4YONB 4DLTA 4Q1DA 4A6PA 5CDFE 2NQ2C 2WJVA 2YWEA 4D6PA 1A5TA 1T4GA 1RIFA 2F9LA 1DAMA 2YV5A 1HH4A 3LVRE 3ZQ6A 2VPPA 2RGCA 2GJ9A 1ZVQA 3H84A 4CT5A 2IF2A 2H8KA 1R0ZA 4ZIRB 2DCUA 4RZ2A 4B74A 3B2EA 2VIIA 2YC2C 2YVUA 4PSVA 4CRWB 4Q5IA 4X8HA 4O0MA 5KSZA 5GJWC 1ZW6A 5AJWA 1G7RA 4GOXA 3AVVA 1E4VA 1A2BA 2OAQ1 4B35A 1XTQA 1XXHE 3T35A 2CK3D 1KK0A 3ICQB 3HPQA 4BFWA 3WHKA 1P72A 1ZP6A 2C77A 2JA1A 3FFBA 1VECA 2ZJZA 4AKGA 1GDDA 2Z0MA 4FMBB 5C46F 3FOZA 2A7QA 1XX6A 2WM9B 3UMFA 1XTJA 1J99A 2QPTA 3AB3A 3B1VA 3VAAA 3U6KA 1H8HA 1FMLA 3QXJA 1E32A 2QPOA 1XCMA 5CLLA 3MD0A 1XCPA 3C8UA 4Q7LA 5CIQA 4CEIB 2ZUCA 3GLHE 5HCNA 1W44A 1Z06A 4W9MC 4TMXA 1MKYA 2YOHA 4JLJA 4LPKA 3IQWA 2F9MA 1VG0B 1BMFA 1G7SA 3THOA 2Y8EA 3RRMA 1A2KC 4JBWA 3AVTA 1CKEA 4BPBA 2GCPA 3AKCA 2DB3A 4K8OA 4B3DA 2IC5A 4DT1A 1R5OA 4F4CA 4GT1A 5JHHB 1PUIA 1OF1A 3DZ8A 3KKQA 2F1RA 2X77A 1DG3A 1HQCA 2XB4A 3SJBA 5C1BA 3NVAA 5JMTA 5KSYA 2ZUDA 4LYFA 4NYIQ 3A58B 5C4MA 2BKEA 5EE5B 5LBIA 1BIFA 1YHNA 1E79A 3CKLA 1E0SA 1JR6A 1SXJD 3OEEA 4TMWA 4XH9B 2RGNA 4B34A 1S4QA 4CGZA 1N6IA 1ZIPA 2J5XA 4LUCA 1D9ZA 3SQWA 1R0XA 1TQDA 4B43A 4B3XA 4KHZA 2DWOA 4OQFA 5FUVA 4IEEA 1G5RA 4JVSB 4L8GA 4CIDA 3E1SA 2BBOA 4PO1A 3D3QA 1F2UB 1WQ1R 5BN5A 4QHYA 4V0NA 5TARA 4ZO4A 3R20A 2EFDB 3RANA 4E5UA 3LH5A 1KO7A 4G5SA 5LB2A 1FMJA 4C3ZA 3VU9B 1TAGA 2IYQA 3PXGA 2CHQA 5HTKA 2FFAA 2ZVPX 3RC3A 1N6LA 4A4DA 2HYIC 3N2IA 2C9YA 4RKFA 2FPKA 1JB1A 3TJZA 3BD9A 4FMCF 3MRSA 1MV5A 3CZPA 2NGRA 4OHZA 1PVOA 1KKMA 3OIUA 2ZPTX 3QKRA 2QM7A 3WYGA 1F2TA 1LY1A 4RD0A 4Q1CA 5FI0B 2F7SA 4E03A 1FTSA 1GVNB 2ZI3A 2ATVA 4RFSA 3QOFA 2QTHA 1OHHA 3QEJA 3C16C 3VNVA 2PZEA 2WPDD 1Z6GA 2R44A 2NO6A 2AHOA 1IY0A 4MYHA 4Q9HA 1R2QA 4GNKA 3REFA 4BFSA 3RC8A 1W5SA 3M1IA 4IFEA 2RB4A 1ZINA 3T1TA 1G7CA 3QE0A 1QVRA 1XXHA 3ETLA 1GRNA 1II8A 3PUZA 4GPTA 5CB6A 5ELXA 2Q9AA 3D8BA 3HU2A 1PJRA 2IS2A 1RPZA 3IHLA 4IRUB 2BM0A 3I72A 4Q1BA 5JWHA 3GLFE 4IFBA 3L0IB 3O47A 3WY9A 2HV8A 1S8FA 3TRFA 1W7AA 3LO5A 3TVTA 2O0HA 3MWYW 3QXHA 1FX0A 4YMWA 2ZAMA 4F4JA 3TQCA 2VHTA 1ZU5A 5JRZA 2P5TB 2VP9A 3GLHA 1DVRA 4RD3A 3QG1A 1YE8A 4M0LA 5CJ2A 2FEMA 1IM2A 1XTSA 2UZ3A 1N0VC 1UBEA 2Q3MA 2WWFA 1XPUA 3WMEA 2ZITA 3ZGXA 1BYIA 1Z0JA 4FN5A 4FMDB 1M6NA 5F9FA 5EQTA 3RRZA 4KO8A 1EK0A 4G5RA 3QG5A 3SYLA 3V4RA 3ZLJA 3AM1A 5JFGA 4QFMA 3VR2A 1HT2E 2JIZA 4FCTA 2F55A 3HR8A 2WHXA 4FIDA 3K8YA 1E1QA 1F6BA 3RDPA 1FQJA 3IQXA 3BH7A 2BVNA 5FTKA 4BFUA 1TL7C 3PUVA 1G6HA 2V7QA 2C8VA 4ITRC 3QF4B 1HEIA 1AGRA 1R8QA 4B71A 1WMSA 3TBKA 2FU5C 2IYLD 2ZI4A 4B6FA 4BFVA 3QBVA 1EFRA 4JYBA 2YHSA 4MKGA 2XOKD 1JEEA 3I8SA 2JLSA 1QRAA 3UXMA 4A0GA 1E79D 2RAPA 1EFCA 2AKAB 5GJVC 2FV8A 2UKDA 1LTQA 4HLCA 2XTMA 5HE9A 5KPJA 1DAEA 4IHQA 4KYUA 2IYZA 1SULA 5ANRB 3NBYC 3E5HA 4R9UC 3BC1A 4ASUA 4C0HA 2G9NA 1UAAA 3FHTA 5SZIA 1TF2A 2GESA 4JL5A 3EPKA 4LSGA 4A92A 5FBLB 1OB5A 3WRYC 3U3JA 4TYYA 1G3RA 2PZGA 3IGFA 3KQLA 4PO9A 2SHKA 5DH9A 4TYQA 2H7VA 1E0AA 1E1RA 1P61B 1I2MA 3PUXA 3TAHA 1K5GA 2IEYA 4OK3A 1GNRA 1DAGA 2GVZC 2W2TA 1FPMA 4P33A 2H1LA 1YJ5A 2ZJOA 3CRQA 3HR7A 1UKEA 2RH5A 2ZJYA 2JDID 2X2EA 4H9GA 4JBYA 2CDNA 4DUGA 3PFIA 4GMDA 3QPUA 3U7HB 1N6PA 1C1YA 3RS7A 4CEHB 3U44B 3GMTA 4D26A 2XAUA 2W6IA 1N3BA 1VTKA 2IYRA 2MSCB 3JVVA 2GDJA 4Z54A 2FMXA 4PC3A 3IIKA 1S0UA 1G16A 3Q3JB 1T3SA 3K9NA 1T91A 1ZNZA 4ABYA 1OB2A 5FTMA 4RCZA 2RGAA 3MCAA 4AG6A 2GCOA 3TR0A 3VQTA 1XB2A 3LV8A 1G5PA 3K0AA 1JR3A 4IVQA 4XSHA 1TX4B 4URXR 3VR4A 3PIRA 3T5GA 3W8RA 1ZNWA 1J70A 3F8TA 4B2LA 2QGZA 1QDEA 1NLZA 1OJLA 3QI2A 1CXZA 4KV9A 3W5JA 2QAGB 3IPXA 2OCYC 1P5ZB 1RYHA 5E7IA 4DEXA 1P62B 2JJ8A 1AKEA 1PLKA 3BRWD 1IN5A 3TUZC 1SQ5A 4A0RA 1Z0FA 1IN8A 2REBA 2ZSDA 4ZDWA 2VHJA 3RYTC 1WF3A 3K0FA 1X8JA 4OK6A 4LHVA 3MJRA 1FP6A 1AS2A 3KJEA 3BERA 3EC2A 1Q1QA 1R0WA 1E3MA 1E2NA 2PJRA 1VHTA 4BEJA 2AXPA 3OHMA 5CJPA 1COWA 5FL3A 4BUJA 3NDBB 4JSYA 1UBGA 2BKUA 1E1QD 3KTAB 3ZZ0A 5IK2A 2YNMA 4FXPA 1X8KA 4DLXA 2C99A 5G3ZA 5E95A 3NXSA 2V7QD 4M8NE 5TDHA 3EXAA 3F0TA 5AR1A 2Z4SA 2CJWB 4MRSA 2QGNA 2Z43A 4DDUA 2GK6A 2A9KA 8OHMA 2EQBA 3ZZUA 1EFRD 5GADl 4F93B 3BOSA 2VP2A 1M7BA 2HUPA 3QXCA 1KJWA 1NJGA 1E2LA 4EPVA 1G3QA 4PQFA 4OI0A 2ZJ8A 4DCUA 1F3OA 1N2CE 1ZM9A 4HLUA 4N3NA 2RGEA 4AK9A 4YMTA 1QHGA 1VIAA 4TYWA 1W48A 1IN6A 2VP4A 1NSTA 4RFVA 1ANKA 2BMJA 4YXWD 1Z29A 4NYMR 5FOTA 4BGDA 3SZRA 4GDFA 3UWOA 1FUKA 1P60A 5G3YA 3GP8A 3BFKA 3M6AA 4YMSA 5J4YA 2V9PA 1D9XA 2IT1A 1ONBA 2GBLC 3CR8A 3FMOB 2IBMA 5JI2E 4BZQA 4DSUA 4TQUS 1G4UR 3WHLA 4RZUA 2F43B 2ZJ5A 4LDJA 4EUNA 3QKTA 1KO8A 4DUGD 1YR9A 2LKCA 1E2DA 1KAGA 3C4JA 1EG7A 1E2PA 2VF7A 4A2QA 5LD2B 3DKVA 4BASA 3UPUA 2WAXA 5IT5A 2W6ID 4C7OA 3CLVA 1NVVR 2ZSEA 3WYAA 1KAOA 3BB4A 3B9QA 2P67A 4RVCA 2O8CB 1EXMA 4GOKA 4YDSA 5DI3A 4JLMA 2ASEA 4JLDA 4PQYA 3V9PA 4DCTA 1RE0A 3LBIA 3R7WB 4BLOA 5EE3A 2QBYB 1E9SA 1XDBA 1JR3D 4Q18A 5HZHA 4N0EA 4A15A 2CLDX 2WWGA 1SKYE 4CEIA 1SVIA 2ZRAA 1SGWA 2QRZA 2J0UA 1CJVC 4P0TA 4M22A 5AJYA 2CEAA 2IYYA 4X8LA 2EFCB 2C04A 3GEEA 4LY6A 1TTTA 4B3BA 5SZJA 4RZXA 4DCNA 2VP5A 1DO2A 1OFTA 3AVOA 3QKSB 4QJ5A 5KUTA 4P4UA 2PLFA 3CB4A 2ZYUX 1YRBA 1MO3A 4O25A 2NZ8A 3CH4B 3B5JA 2D7DA 3U4QA 4NCNA 4Q4JB 1ESMA 1YZUA 2K5UA 4A8JB 3QEOA 1NMYA 2J0SA 2IL1A 3W3ZB 1PZNA 3CF2A 3PUWA 4D0NA 4Y0AA 2V1XA 5CYPA 4EPXA 1KNXA 2D3WA 3NIBA 2WAYA 2GEDA 3PUYA 4TTPA 3RSOA 2F6RA 2JJ2A 2ZM5A 3IIMA 2R6CA 3EIQA 4DLWA 4Q01A 2XNDA 1SHKA 1G3UA 1OLOA 4R2HA 2BWJA 1DO0A 3BGWA 4V02A 1NRJB 1TUIA 4LJ7A 3I4LA 5IK2D 2PH1A 1AN0A 2FPLA 2ZR9A 4NH0A 1Q22A 1B23P 4RCYA 3SU8A 1QHSA 2C9CA 1Z8FA 5E7MA 3X1XA 3FKQA 5JI3E 1P2TA 4LZZA 3SS8A 3ZIAA 2GEVA 2MMCA 5CM8B 1RYFA 4CZ2A 5JSZA 4B76A 1Z0AA 3FE2A 5B57C 1P9NA 1KI1A 3GCGA 4O2LA 1FQKA 2CE7A 3IILA 1X1SA 1SXJE 1JQJC 2WMNB 1A82A 1C4OA 1GFIA 1OFUX 2B8WA 2J7KA 3S1AB 3QNUA 2EFEB 2FSGA 2J7PD 3OESA 4F92B 3F5FA 4WA7A 3VR3A 2BMEA 4BFZA 2IHBA 4PR0A 4TMTA 4HLDA 1OXVA 2OILA 4YMUA 3PJRA 1LW7A 1P75A 5AUPB 4N0DA 4OHVA 4WZAE 4B3FX 1GZSA 1R0YA 4UXJA 2C2HA 4OQNA 5DISB 4ESHA 1E94E 3P27A 1OYWA 4V0LA 3FVQA 1XPRA 1KDTA 2WJYA 2KJQA 1ZCAA 4A2WA 4AYXA 5L3RA 3QQ5A 4E07A 2QAGC 1HT1E 3CM0A 4CVNA 3MG9A 4DB4A 1OIXA 2ODBA 4MKFA 4PO8A 2ZI5A 1PLLA 3OEHA 4URWR 1VG9B 1Z0IA 2AWNA 4G5QA 1A1VA 4QHSA 2QM8A 1KI8A 3E70C 5J4VA 3TSWA 4MGZR 2C98A 4Z1MA 3EA0A 1J7KA 3FFAA 1G20E 1S9HA 3Q85A 4Q9IA 3RRNA 4PHHA 1XEFA 5H68A 5HR5A 2REOA 1E4YA 2XX3A 2WWHA 2CK3A 3LVQE 1GTVA 1G41A 2VO1A 1G3IA 4AYTA 4P3YA 4TQAA 4QHTA 3KKPA 3TUJC 3J81k 5FPHA 4UJ3A 3DOEA 5JS7A 3GLFB 4OI2A 3L82B 2YWHA 3CW2A 2CE2X 1NVVQ 1E98A 1QG4A 2E87A 4B33A 3ND8A 2JJ1D 3QF7A 5FI1B 1UBFA 3V00A 4HUQA 5GJCA 4EPYA 5EXXA 1NN5A 2FGJA 5AUQA 5G53C 3H1TA 2FH5B 3MLEA 3BAFA 2GK7A 5FL7A 2XZLA 2ZEJA 4Q47A 2HLDD 5FBQB 3X1YA 1CU1A 2QU8A 2WWWA 2RHDA 4NHOA 2XSZA 1Y63A 4LGMA 4XSGA 4YDHB 3UANA 1AJEA 1NF3A 3C15C 3KQKA 2NPFA 3U2QA 3VKGA 3K09C 2CBZA 3EIHA 1XEWY 4ZDJA 1N6KA 3BBPA 4EJSA 2KBEA 1S3SA
chains in the Genus database with same CATH superfamily
1QHFA 1TD9A 1PQPA 4BJHB 2BBSA 3AP1A 4RK7A 3Q40A 3JRWA 2IXGA 2V54A 2HBRA 4EJ0A 2OCIA 3IULA 5AOAA 1Y4ZA 3HMKA 2CVZA 2Q21A 1UMBA 2Z2IA 3IJ5A 3WAKA 3TQFA 4B80A 4D43A 1XUOA 1O97D 3NWOA 1OBCA 1HG0A 1YMUA 3CJQA 3QOWA 4TL6A 5SZHB 3QKWA 1TE2A 1ZDMA 1X7HA 5KYKA 2HXSA 4XB1A 3RYCA 4PAWA 4WNIA 4A6EA 4B3SB 1Q92A 5JCOC 3LPCA 3IQHX 4CR7A 5K3EA 3HJTA 2IW1A 3MMPA 3OAAD 3SXJA 3LCMA 5EMHA 1HNNA 3ELBA 3JAKB 1GAJA 3IAHA 2FSUA 4H77A 4P7JA 2IYTA 1IQUA 1PJZA 2ZJ2A 3UCFA 1JDUA 4KNWA 2B4KA 1ZD1A 3D4NA 1JSZA 4NNJA 3IX7A 2QXUA 3KAPA 3WWZA 1XPJA 3CSSA 3MQ4A 1XU7A 2YWDA 3LLUA 1PAUA 5F1PA 5T5QA 3WMWA 2IDMA 4RSMA 3BL6A 3HB0A 3QM1A 3ILHA 4TMYA 1I2CA 1VJCA 3RK1A 2CBGA 2QTVA 2VYFA 2Z2YA 2JLVA 1EGHA 5JD3A 3TUIC 1G98A 3K9HA 1ORRA 1JQEA 2LIPA 2OMKA 4FYYA 4X63A 4GMFA 2WPDA 1KJIA 1ZJYA 1BFDA 1RAGA 1S9DA 3ENKA 3NMUF 4J1TA 1HEUA 2FGKA 1HSZA 1FK8A 1MT3A 5FOXA 4CTKA 3GR6A 4EG1A 4B3TB 1ZZGA 1XELA 5EQJB 4IMRA 2H9AA 3M2TA 3ORRA 2R2AA 2YDXA 3IRVA 1PR4A 3AETA 3MB8A 2JLZA 2IV3A 1PJSA 1PRYA 1FVOA 1NLYA 2QTFA 2UVQA 5DEOA 1U94A 5HGJA 2D3TA 2JK0A 3O94A 2AFRA 3A10A 4J76A 1T1RA 4YXFA 4ZJPA 2GD2A 3KZOA 2F62A 4ZZ3A 2PRZA 4L5YA 1QRSA 2YN2A 1HDRA 1KMNA 3WL3A 1CFJA 4A8JC 4AZ0A 3DSRA 1U28C 2IVZA 2Y1XA 2PSDA 3CPHA 2GA8A 4RYLA 4Q9LA 5DW0A 3GFTA 4IGFA 2EKBA 4K6GA 2P90A 3J81A 4GQBA 1KJYA 4G5YA 4B46A 2LVBA 4EHFA 1NTRA 4DZRA 4UNRA 3IV6A 1D2EA 2AC7A 3W2IA 3K0CC 4Y1RA 5F12A 5BN3A 1T9KA 2XZDA 3G59A 1MC5A 4NENA 4QQNA 4YJHA 1FS4A 3DOOA 4HEJA 1S2LA 4IAOA 3CO0S 4BGIA 2O7NA 3TQHA 2Y05A 2P62A 2LPMA 5COAA 3UKDA 2YUTA 2BFPA 2VA9A 3DDCA 2JPDA 3OURA 3BIJA 4QBIA 1TIKA 2DLNA 1R3UA 3AY7A 3C6XA 3IXMA 4QFDA 3G2QA 3OOWA 1GFWA 3OJLA 1NQ5A 1BYUA 4M46A 4D4LA 1XTVA 5DT9A 1MHTA 4ARVA 2VG8A 3DMDA 3NKFA 3FUTA 4FD2A 4R68A 5EZ5A 4V0RA 2NM0A 1UM9A 3IB3A 5AM5A 5KTOA 5LOVB 4US1R 2IA5A 3P2JA 4N12A 4BO6A 5LQCA 4WJKB 5DBEX 5ALDA 4MPJA 5FL7D 4WJLA 5LR6A 5JEEA 2XGJA 3HHPA 4Z8XA 3RT7A 1JAXA 4KITB 5HQ3A 4FSXA 2C59A 1KKUA 4ZI7A 1L4UA 3IC5A 3N2GA 5IS2A 2D1SA 2Z3VA 3HB9A 1T8SA 4YA6A 3BSSA 2NZYA 2QQEA 3QA3E 5FWDA 4DRXA 1TIPA 2IITA 2E0IA 3A6FA 4GMKA 4QJ3A 1TPZA 1FVHA 3LCJA 5GM2A 3X1DA 4R0MA 1H69A 3NBMA 4OJKA 3U56A 2R4UA 2ZRBA 3H3FA 1C41A 2V97A 1UJCA 5ALYA 5TMDA 3FSRA 5LYYA 3MMSA 5AI4A 1T9DA 1WXDA 1UFVA 4ZZ0A 3DGFC 3BGIA 4UAVA 2QT0A 2XYQA 1H5NA 4B4WA 1M2GA 1NY5A 3KDPA 3VO8A 2CL7X 4EGFA 1OX5A 1O96B 3TTVA 4HNUA 5AXCA 9ABPA 4QTTB 3AWIA 6LDHA 4AJ9A 1TZ2A 4XD7D 4GWLA 4ENRA 3KX2A 4Q4LA 1MC1A 2SKCA 1CJMA 2YFQA 2YIJA 3FAKA 3IVCA 4NOMA 3VNSA 2AE1A 3BB3A 3IKTA 3RYHB 1A7KA 3JQFA 3WRVA 4ZVSA 2ECKA 2Y1LA 5I4BA 4BNJA 5GONB 1P2VA 2JAWA 4Q05A 1FFXA 2RK3A 4XUGB 4AQYB 2BHLA 4K0KB 3WXMA 3ED1A 1GZ7A 4NTZA 3CLSC 1N2CB 3EXG2 4XASA 5B3KA 3RG8A 3ONDA 2O8BA 3KYDA 3W90A 2D2EA 3WS7A 1YVUA 1XJQA 5BVGB 4C4PA 4ZI5A 3PX7A 5FNVF 3EGEA 3CW8X 1DLJA 1OAKA 1GT91 2BISA 3RVLA 5DWDA 1KIMA 3AF2A 1VYTA 4GOLD 4BP9A 1PEYA 4OU5A 4WVFA 3VKWA 3IEUA 5J4KA 3IEVA 3MWLA 4FT2A 4NU6A 2QP9X 5LLTA 3RFCA 5HFAA 1ZMXA 3MS2A 5CD1A 4NZ9A 4IV0A 1HA3A 2QVXX 3F3MA 3OM8A 2UZ4A 2GBFA 2GUWA 3CVUA 5LDGA 4ZEMA 4LF9B 1KZGB 2WTUA 2Z83A 4ZO9A 1B1AA 3G9QA 3IDZA 3KHSA 3ODGA 5FYDA 1EP9A 3DUWA 4GPBA 3UJHA 1OX4A 4P7FA 4MR8B 3PQ4A 4ZTBA 1BD3A 2GGSA 3BMCB 3C5HA 3DCNA 1KP2A 3Q12A 4Q4HB 5KMGA 1JFLA 4ARSA 3LPMA 1J07A 1BWRA 1MOPA 3LUJA 5FHQA 1AMUA 4BE7B 1L4GA 1MX9A 4FJ1A 4YUAA 3T7JA 3P9KA 2ZYTX 5KTKA 5AK3A 4B3CA 1TJ4A 3THWA 4Q9DA 4S1NA 1H0KA 2M9MA 1A9QA 2Z4RA 1U9IC 1UXJA 3DMNA 4PZ9A 3R3ZA 1HY3A 4GF5A 2L18A 4Z4FA 2J0VA 3OICA 4JEUA 2GF9A 2RMKA 2WMDA 4XVHA 2GETA 3R3JA 1WUKS 1ZK4A 3GJ0A 3GOQA 1YJXA 3OCZA 1RPTA 4N7RA 4UD2A 2J1LA 1E64A 2WKQA 3CEPB 4JAVC 4NQRA 2QA5A 5BW6B 3TMKA 2MSNA 4ECEA 5JDIA 5HIJA 1N5JA 3UV3A 3OLXA 2RHHA 1R4ZA 2AK3A 4X1KA 4NU8X 3DBHA 3OLCX 4R2MA 5JLJA 4R2KA 2PT5A 2V3VA 1O87A 4L6AA 1QV9A 4AC9A 3I39X 3O8OA 2CV2A 1LW6E 3ELDA 2AH5A 2C07A 2WJ3A 5EOVA 3E9DA 3FOWA 5J4LA 4MJLA 2Z5VA 3ACCA 1AQJA 3COJA 3WA7A 2JGJA 3T61A 4YV2A 3JAMA 2ZJAA 1LNQA 1USGA 2GZSA 4XZ3A 4Z4HA 5CEJA 3T7TA 1KZ6A 1MN6A 1C9MA 4MJ7A 1YV9A 1XZJA 3KQYA 4Z2YA 3E7XA 1YZLA 4ZDKA 1BC5A 1SC4A 3HL4A 2IPLA 1KSFX 3PTAA 3LNTA 1GZ5A 1RAHA 3HKBA 4XCVA 5HCIA 2R1ZA 3EEIA 5THKA 3SHVA 4EI9A 3ADCA 4OH1A 4QKQA 1RW4A 4EARA 1CF4A 1QXSA 5ES4B 1Z5UA 4NONA 2IZ5A 1P2FA 1BJKA 2QMEA 2QRNA 4G4IA 1QHNA 1XNHA 1HDYA 1CUDA 1ABEA 4FHDA 4HAWA 4JK3A 4YXWA 1CNFA 3SFVA 3U7IA 5E8RA 2QT1A 4OI1A 4BNFA 2GM3A 4A5OA 3MQ2A 4WERA 5FOWA 1QP4A 2G63A 3O4FA 2GRJA 1BEEA 5JNSA 4DAEA 3ZOKA 3HG7A 2FMFA 4K86A 1A5BB 3N86A 4QBTA 3OFNA 5HOQA 4QBKA 2P8JA 1QHHA 1I3OA 2Q41A 3LGAA 4JOCA 3DLTA 4HNVA 4MVJP 2J3MA 3ESAA 3FOCA 4OXNA 4IG4A 4TZKA 4I9NA 3TI7A 5BSVA 4LCEA 5LYJB 3GAMA 3GBPA 3MPOA 2IOHA 4QYIB 4R8SA 3OQJA 5BVHA 5I6DA 3VZRA 3KWFA 2A67A 3DV0A 3RVDA 4XPZA 4PU0A 2FZVA 3M4YA 5FB3A 1MCZA 2H92A 3GL9A 1YFLA 2XJ4A 1UEJA 4LSMA 3R5HA 5IM4F 1QR2A 1KDRA 1N2EA 2I3BA 2OCAA 2G9QA 2ZK7A 4LXXA 4MZDA 4ZHQF 5L3VA 2G77B 3C3WA 1TAHA 2B30A 3VV2A 3U3MA 3L6BA 3HZZA 4FKBA 1ECGA 1WL8A 3WLSA 3AILA 2HQBA 2IYWA 2IGTA 2OK7A 4NS4A 1E7WA 3TXAA 4BKPA 4KN8A 3MTJA 2ZRPA 1VLZA 3DULA 4MGKR 2GFHA 5EP3A 2AEEA 3EIFA 4EMBA 2AXQA 1ESEA 4L9AA 3GUZA 4DSZA 2XDQB 1UZMA 1T0JB 3PS9A 3WKAA 2N75A 3V1LA 3BPSA 2CLHB 1USIA 2BONA 2D4AA 5K3FA 4Z4CA 4CYMA 1JWBB 1YS6A 1KMQA 1WB6A 1PCXA 2FN9A 1ISHA 1DRKA 4IO0A 5AI9A 3GMDA 3GRZA 3MFQA 5CEEA 2KQUA 3TX2A 1T10A 2E4YA 3MUEA 4QGHA 1YR3A 3GVCA 4RPGA 1Z15A 4WMLA 4ZT6A 1L4KA 2JCBA 4JBXA 1TU3A 2GEFA 3CUKA 2A14A 3NRBA 1PZHA 4Z3DA 3SF8B 1A96A 3WKCA 2JGEA 5DRTA 5A3JA 1CHNA 2Q1TA 4CCAA 5AVXA 1XDUA 4EA7A 2QTMA 1D1QA 1YA6A 3BXZA 3NHFA 1ES9A 1PWHA 3OZVA 3UC9A 4PBSA 4ZCIA 3ZY5A 4EF4A 1JHQA 2IUYA 1GU7A 5FH9A 1CZLA 3PXXA 4PZCA 1EQ2A 3JYLA 1U4NA 4GLFA 1P1JA 3G8CA 1CY8A 4NOJA 1S3IA 3LW8A 2V65A 4RE5A 4QOGA 3ICVA 3JQGA 5BNWA 3SGLA 4MPRA 1TDJA 5SY4A 2FSVA 1EP3B 1GQQA 3HCOA 4HWTA 4RDIA 1ZUNA 4ZGBA 4AXXA 3DF9A 2R1VA 3IEXA 3A1NA 3KL4A 5C5IA 3TR5A 1EUYA 3IXQA 2R9VA 5JUWA 3ZGNA 3WB9A 2IQIA 4F0JA 2XT6A 2WT9A 3OWOA 2G76A 4FMDF 1O8BA 4GW3A 3SQDA 1ZLXA 1K5DA 3E9CA 2P4UA 3IALA 3WGOA 3R9WA 4HH4A 2WTBA 2DQ4A 3RYFB 2PNJA 1EINA 4J0GA 3K9LA 4CT0A 4FOLA 4OA5A 5KNBH 1KAEA 2OQ2A 3I92A 5A7GA 3LY8A 4LHXA 1II0A 4MAMA 2Y4OA 4TLMB 2F3PA 3E5RA 3IELA 4H3KB 3VHLB 2ZB2A 1ULAA 4QG3A 2ZWIA 3OPMA 2XITA 1V16A 3BMQA 4JSTA 3W5DA 4HH3C 1TYZA 3AM5A 3ZWPA 3BAZA 3LQYA 4KLAA 1PR0A 1RBMA 3QLVC 4O4IF 5LIRA 1A9XA 5JD4A 1F60A 2AF3C 2JEZA 1W8IA 1VQ1A 2H1IA 5H1YA 1LPAB 3W4IA 2RE8A 1SUSA 2J7PA 5F73A 4J7CA 3O38A 1KOGA 1HRKA 2QZJA 3KKEA 5L4NA 1NOJA 3G2OA 3ZS9A 1V5WA 1PR9A 4Q12A 1C0IA 2E5FA 4HYEA 2ENWA 2QRGA 4ZCSA 3PC4A 3NH9A 4KYVA 3PQ5A 2VF4X 5L7WA 3GIDA 3HXPA 3ZNNA 4LV6A 4TYPA 3B9RA 4AF8A 3DOCA 4Y2RA 3MAAC 1M2KA 1X80B 1KPHA 3PDIA 3UQYS 4U7PB 2O5CA 4HMQA 1C0PA 2EYQA 4F2WA 3AR6A 3OFND 2C78A 1B43A 3E58A 5BSMA 2HWKA 2PSJA 1NMQA 2DYKA 3LOQA 3H4VA 1ZH6A 3H11B 1WULS 3SJUA 2IPOA 3VKFA 4F5EA 5BV7A 2CNBA 3Q8XB 3NM6B 4G25A 1KTVA 1RRGA 4PFJA 3OOYA 4J0DA 5DFAA 2AJTA 3ZQ4A 4E7OA 4EQ6B 5KQGA 2CHFA 3MS4A 2X0DA 4NPHA 1QIDA 3BE4A 5C18A 1AKWA 3URMA 2AFIA 4H3VA 5DKFA 2G06A 4C1BA 5JS6A 5HK9A 3HCBA 3INGA 4G1CA 4MUIA 4TKVA 1Q3TA 3KXDA 5FNVA 4ALIA 2JBAB 2YS6A 4FM9A 2UUBB 4FYWA 4KCGA 1P1KA 1FX1A 2C2KA 2O2DA 1IIBA 3QFRA 5GV7A 2H29A 2YZGA 3UHFA 2KSQA 1AH2A 1GCOA 5CVUA 1JEQB 3F9IA 4WXRA 1R1DA 1KQ3A 1AO3A 4DA8A 4FNGA 4MPDA 4R16A 2ZIXA 4RELA 4H35A 2EV9A 2V6BA 4ZOQI 1ZGGA 1VLLA 1XIVA 1NJSA 4WKCA 4OX9B 2MIIA 1RLJA 4K6MA 4B32A 1EHIA 4N3CA 4EHAA 4UATA 3UXHA 2QDXA 3QKRB 3WYFA 4R8KA 4OGWA 6ABPA 1W9MA 3AO0B 2VHYA 3IBFA 4GXTA 4I5DA 1PK7A 2FPIB 2M1XA 4KIGA 1BQ4A 3S2EA 2AEMA 2B4QA 2HF2A 2PGXA 1VPLA 1M6VA 3IT3A 3MC1A 2YXEA 2AFHE 4IWYA 2FHSA 4EGQA 1Q0SA 2FWNA 2JJ1A 3VR6D 1L5WA 2R5WA 1EZ1A 2OV8A 4HP8A 4IV5A 3BJIC 4B40A 4JLVA 1MEEA 2RAUA 2CDAA 2C2WA 4H7JA 4S2UA 5GZ1A 1E0JA 3KLOA 1COZA 5BQ3A 3A4YA 4IP0A 1OWNA 3NAGA 2QD5A 3DG9A 1TI7A 3SHTA 3FIJA 3JZMA 1AZTA 1Z2PX 3VPXA 1II8B 4AWXA 2V0NA 1MJGA 4OHOA 5T6MA 3VZSA 2AQIA 2VSNA 4CQMA 4TV9B 3O3OB 3OZIA 2A0KA 1CZRA 3ZHVA 1J8YF 1SMKA 3D2AA 3OQOA 1F06A 3U7JA 1VKJA 4PLYA 5ALJA 3Q6MA 1Q20A 2XMZA 4IHJB 3EIEA 1AKVA 4AS3A 4TLLB 4D5GA 1FX0B 1E7QA 4BYMA 3RLFA 2BR4A 1NVWQ 2BCJQ 3V42A 3FF1A 5CA0B 1PSDA 2JH3A 4HGNA 4HF7A 1AMNA 1RQNA 4BQRA 3GGSA 3KQWA 4B82A 2G5PA 3GLHB 1E2BA 1SO8A 1J7JA 3TTSA 3A26A 4RHTA 4DLVA 1IN7A 3BIOA 2NUPA 4KLRA 2XQJA 3W1VA 2Q1YA 3R5TA 5JAQA 5T4FA 2D4HA 4HN4B 1CYEA 4TT3D 3SC4A 4KXQA 4IQ8A 3VVCA 2JGKA 5LU8A 3MWJA 2HPAA 2CL6X 2ZCVA 3BD6A 5IM4A 2WJGA 2BC9A 3FZYA 3ZHOA 1JA9A 2EP5A 2QSUA 3IKJA 4GZ6A 4QBFA 4TRJA 2GPTA 4D0LB 2XZLA 4L8WB 1QAOA 2O2YA 5HKBA 3AVPA 2DP4E 4RY8A 3DBRA 3RJMA 5LQJA 4MDFA 4MITA 1DEXA 4RABA 1YRWA 2CFSA 2V5VA 3C8HA 3EXHC 5B30A 5JG7A 5A9RA 2D2XA 4N6GA 3OCWA 2ERXA 2X1LA 1T9ZA 3ASYA 3TLJA 1NBEA 5F3DA 4C2BA 3S3TA 2II6A 2JIMA 4DR7B 2UYOA 1XWFA 3OKFA 2I66A 1H85A 2GZRA 4F5WA 3X44A 4TXNA 2NO0A 3RUEA 3IOCA 3TOCA 2ZUFA 4EGAA 1CUJA 1BS1A 2R7MA 4EITA 1RM4A 3CYFA 2BE7A 1MO6A 3A4LA 3E9NA 4FW8A 1NRXA 2W93A 2D59A 4NZZA 4R69A 4CQLA 1H4VB 2QGFA 1MD9A 3KZXA 3N8IA 4MQ5A 2BFDB 4LY9A 2R8RA 1F9EA 3L7IA 1JSCA 4X8MA 3LVBA 1H2WA 1PF7E 1P5FA 4BMDA 4HNGA 1CJTC 4I8XA 3T54A 5KCMA 4Y67A 3CGGA 1RKVA 3D6NB 4X91A 5CBPB 1E3SA 1RACA 4Y1EA 4LTDA 4PAQA 2PMBA 1W47A 4WBSA 2IYFA 2ZRKA 3LNCA 3PXUA 4LWZA 3HKEB 4LC9A 5B7NA 2DG2A 2AZDA 1IYZA 2EZ9A 2PZKA 3JZDA 3WQBA 1XO1A 2YCLA 3SOZA 1VJRA 5AM4A 3SY8A 3AW9A 4CM8B 1WY7A 3UY4A 1KE2A 1L5MA 1UFRA 4IOLA 2IW3A 1TEVA 5KNDD 3U09A 3D43A 3JQ9C 1P3JA 2OHIA 1O54A 2O6LA 4U02A 4OKNA 3ZK8A 5HXAA 1ZOSA 4UE3S 3U61B 3U62A 3M6LA 3A28A 1U9JA 1KTIA 2OV4A 1M8JA 2DTXA 1Q95A 1KJ9A 1WS6A 1Y8RB 2FPMA 3OFVA 4P31A 4Q3NA 4F5YA 3EHDA 2OXRA 2RC5A 3ZDFA 2M98A 3CX7A 1A8PA 1DIBA 1EK1A 1IEXA 2ZTMA 2ADMA 2Q7OE 3E9MA 5KSWB 1B41A 3H86A 1IQ0A 3FDZB 3VZBA 3IAM1 1PVDA 3KJGA 3R3UA 3CLUD 4QXOA 1OLXB 5CEFA 1SZDA 5CH8A 3TGPA 3WLIA 2YWJA 1TQ6A 2FWIA 3H1GA 3VR0A 3D3EA 3ABOB 3A37A 1CEEA 2W70A 5CXSA 4DBVO 3FJ1A 4FHFA 3AUAA 5BQPA 4AJPA 4YR9A 1IN1A 4Q82A 5BYKA 5DXAA 5DYGA 5CITA 1UBMS 1D7AA 1Z62A 3N3AC 4LI0A 3EMBA 4MUHA 3CUUA 3Q5GA 3T7KA 3DTTA 4MWGA 2ANCA 2BJHA 4CQMD 2B2NA 1BG6A 2ZJBA 4YT8A 3B7GA 3UA3A 1KZ4A 3F67A 3L4BC 1PVVA 1H42A 4G4SP 3GAFA 2BJWA 4NYJR 4R8LA 2X3YA 2X8JB 4F56A 5JZBA 3OOEA 2VSFA 2VQEB 1PL7A 3FW1A 3M82A 3Q2OA 1UKCA 1U63A 5B1DA 5DX1A 4KBYA 4XTRA 4X44A 3UKJA 1NMSA 2RHWA 2JBHA 2PDAA 3FKSD 5F33A 9LDBA 3JQ8A 3PNSA 2M32A 1OU4A 3EEFA 4YAJA 3RU3A 2AQHA 1JG4A 3QXSA 1AZWA 2QPAA 3K0FB 5CT4A 2WUEA 1E6KA 2W83A 1CF9A 2XWPA 4LJ9A 5CAEB 4RZIA 1EFUA 1G64A 2PUVA 9MHTA 2QR3A 4ZCPA 3FOFC 3LM8A 3G82C 4CMBA 3LHDA 4I9UA 4DHEA 2FP4B 1EX7A 1IONA 4O2AB 4UUAA 4D3FA 4DMCA 2FN4A 4RH1A 1HE8B 1X1EA 4FXOA 4BZPA 1CQPA 1JA1A 2CF6A 5B7GA 2P2ZA 3OECA 1NV9A 3GRYA 2AOUB 3UM9A 1NVBA 2J59A 2WFZA 3U44A 2R8PA 3NALA 2WYIA 1NR5A 4JL8A 4D9GA 2P0EA 1UXOA 2IZ6A 1JEOA 1M10A 1VCIA 2OT3B 2WSSA 5AJVB 4DYHA 2CYCA 2AR0A 1Y8AA 5K0BA 1K88A 1S6YA 4R40A 1TJNA 2JNWA 1LB1B 4UU1A 3DV2A 2PT7A 4HEQA 3OO0A 1YZHA 2Q45A 5JZMA 3T7SA 3I01A 5FTLA 3O3CA 1A4IA 2HPHA 1L7EA 2FLWA 2IPXA 3I1JA 4OB8A 3RU7A 1GQRA 1SBZA 2CUNA 3NJ4A 1J39A 1NVXQ 5LJIA 1KWKA 4YAIA 2PUDA 3Q4GA 1XPOA 4Z51A 3CNLA 3WDSA 1R18A 3KM0A 16PKA 5E6RA 5FA8A 4LJ4A 5FQNA 3EVZA 1P5HA 5BSGA 3HJBA 4YPVA 1N5KA 2JGRA 2NO1A 3JWHA 3KZMA 1WXQA 4ZODA 4RAOA 1F8UA 2IKSA 4G5OA 1Z17A 3EXIA 4O5AA 2WQ6A 2VAPA 3GQBA 3PU6A 5LJLA 1FRZA 5ISMA 1X7GA 2XRYA 1JH8A 1V8PA 2RH8A 4N8EA 1EWQA 3OTWA 4NZPA 5ITZA 3DB2A 1K8RA 4PNZA 3UENA 5H9WA 1X7ZA 2PMWB 1N2HA 1OIWA 1J21A 1KQOA 2QW8A 3TK1A 5CLFA 4CKCB 4UUQA 3EA4A 5KTTA 1ILEA 2X19A 4GKVA 1Z5VA 2GK3A 1Z7WA 1E20A 3JD0A 2XCOA 4HZGA 2IHZA 4DA6A 4C0JA 3V4OA 3D3WB 4IJ6A 1JEAA 5ENDA 4AKTA 3RNLA 1QB8A 3ADKA 3JD1A 1JDZA 2JLRA 4RU1A 5C81A 1C7EA 4AURA 4BOYA 4FQ7A 1N5DA 1NJ8A 2QY9A 4AJNA 1G3MA 2QMHA 3FGNA 4LJYA 3EHEA 4CKXA 1P19A 1SVSA 2KE5A 1TM1E 5KTYA 3UHAA 3GGOA 5TB5A 1OIVA 1G4HA 3PSHA 3RTAA 3WSVA 1IH8A 2VP6A 4XRGA 1U1IA 4LV8B 3R5XA 4YQZA 1EVLA 4HY3A 4L22A 1J8DA 1VFNA 4AY5A 3OTGA 1SB9A 3KB6A 4D0GA 3AY0A 2IH2A 2IOQA 1P4AA 3VTFA 2WU8A 3PENA 5PGMA 3PFFA 1EPUA 1E9DA 3HDJA 3MVEA 4QM7A 4D0SA 1YSCA 2KLHA 3FZQA 3HY4A 2X5XA 1HV8A 4NBSA 4TLDA 1YHZA 4QGSA 2H1VA 2VAWA 1SC9A 2J0UB 4HAUA 4KOAA 4RIIA 3DMTA 3VTZA 3CKYA 1NMZA 3W6OA 3QLUA 2IZ7A 4FU0A 3G0OA 4GPZA 3UG7A 3KR1A 4RD4A 5I7UA 3MQFA 3PEEA 3N7AA 4IDGA 1PSWA 2JI4A 5I8WA 2FFJA 3EE6A 1W0KA 1LNSA 3DWIA 1XZHA 2G80A 4PG5A 3L0SA 5BURA 5JH7B 2VJBA 3A6PC 4HWOA 5CCBA 4IV8A 3A6EA 2X9LA 4GZLA 1J1UA 1EJBA 4HUJA 4BQOA 3A1FA 2PBFA 3RVRA 1TK3A 3ZD8A 2OB1A 1RJWA 5H3HA 3AUTA 3IEMA 3DLAA 2NO7A 2VSOA 2BGWA 4JJFA 2HA6A 4XGRA 3SQXA 5K0LA 2D8MA 3F5DA 1Z4KA 4B1FA 1VYHA 2IYXA 5KQMA 2NUAA 2C82A 3OEWA 2Q4EA 1ESNA 1DTWB 1DT5A 2R1TA 3L6RA 1EDBA 2WV9A 2BEWB 4AKEA 2G07A 2V6FA 3CF0A 1ZU4A 3DDNA 3OC6A 1IPFA 1T36B 1YA4A 3HGTA 4MCAA 3IAEA 5EPUA 5HNKA 4QREA 2WSSD 4NCKA 1E9RA 2PYZA 4J16A 4RE6A 3HDVA 3RV3A 3ONEA 2GCIA 3KXLA 3Q98A 3P19A 4G23A 4HK4A 2J33A 1I24A 1S2NA 2Y1DA 4RD2A 4AAYA 2CV1A 1GSOA 3CT4A 3B3QA 4MS4B 2VQFB 1Y3HA 1ULTA 2ZBPA 3BCHA 4AY3A 2W00A 4QDTA 4Z8YA 1TMGE 4MS3A 5GY7A 5CDFA 4D4JA 3GARA 2FDCA 1PNOA 1F12A 4C5CA 1ZM2A 4GRIA 1FRNA 3OIVA 3WQHA 4DIBA 2AC4A 2P75A 1NZDA 2EKLA 2NXJA 3SYTA 5C4IA 1VP9A 3SVTA 5JBQA 4B84A 2XTNA 2VBCA 4KI0A 3UK6A 3LUKA 1FRFS 4AX4A 2C4HA 3V5NA 3KETA 1EUDA 3ZVLA 3VI3B 1UXHA 3HZHA 4MS1B 1SCJA 1H2EA 3MRVA 2PKRA 3A1VA 4FVTA 1F38A 3EFEA 2QRMA 4OGKA 4WNCA 1EGQA 1VG8A 4HB3A 3AKZA 1QK3A 5JNWA 3TLGB 2PO5A 4CL8A 2EZUA 5JCJA 3QFSA 2V9ZA 1T3HA 1GPMA 4D44A 4I1PA 1KHTA 4M6WA 1PX2A 2NUTA 1WCIA 3SZOA 2GAFA 3LDFA 3WYDA 1Z2OX 1ECBA 3D0RA 3R23A 4KH0A 5DPMA 1WG8A 1K0FA 1WUHS 2PTGA 4AX8A 1SIUA 3EZXA 1DDIA 4HAOA 2VL7A 3PQEA 3NVKI 4KX3A 5B7PA 3I2FA 4PGGA 2OFPA 4DJJA 5C2JB 5JANA 4DJDC 5F4ZA 4WWHA 1YFJA 3CNHA 3C4QA 4BO9A 5BQXA 2EJBA 5K8VA 2WKWA 4HXGA 3KSRA 4MH0R 5BPHA 3H5NA 3TRJA 1SHZA 3EDOA 4F2GA 3ZD7A 1K8XB 4YP0A 3QQPA 3ZU4A 1M83A 1IN4A 1OREA 2SCUA 3F7NA 3LYAA 4MYCA 1V48A 3WGYA 1DAPA 4AMUA 2VWQA 2H1OA 3EUAA 1LLDA 2VH1A 3F7MA 2GI4A 1FL9A 1YUMA 3ZS8A 1N78A 1IHOA 3NDJA 4AKSA 4ZOLB 4GEKA 5EFOA 3ZDXB 2FMIA 3SZUA 3D6JA 3BORA 5DTEA 2ERCA 5TQJA 5IRCD 2Z4TA 4BHTA 3IBCA 3M33A 3VU3A 1BJTA 1D3AA 1I6WA 1KK3A 3ZY2A 3RS2A 3H65A 1P0PA 3UAYA 2JD1A 3KWLA 1C7IA 2C42A 4IOJA 2XZOA 1WDTA 5LQAA 1JPJA 2XCSB 2C9OA 2CLMB 1IXRC 1VE1A 4HDSA 1XWIA 3MJVA 3IMEA 1NLFA 4L08A 3ZOZA 3FY4A 2PZJA 1UL1X 3LMKA 3HCAA 4LRQA 4AP5A 5G4KB 3SLRA 2V7PA 2ODWA 4XM0A 3HL0A 1NJ1A 3K5PA 3NUGA 4Y9SA 2AZXA 3F4BA 2Q1WA 3PGKA 5H5JA 3RK0A 4U7DA 4CU5A 3U60B 1VIMA 1I2DA 3OLVA 1AXGA 5MFZA 4V39A 3HBNA 1SZJG 2ZJ4A 3DAPA 4M8KA 5FWNA 2QRLA 1GPWB 1FYVA 3B3GA 4IIGA 3ID6C 4ETMA 1WB9A 1JJFA 2IXDA 2QRUA 3SHOA 1CYDA 3ESYA 5A0VA 1B3RA 5TT0A 4R7GA 5SV2A 4ZI2A 4ED9A 4HSEA 5IHXA 4JLKA 1S96A 4E70A 1CQXA 2JASA 2Q5EA 1C1XB 1YBMA 3T9EA 4V0OA 4FFOA 4JMPA 4C0SA 4D57A 1G8HA 2DBVO 3L7YA 4K8RB 3B85A 2MCFA 4P2BA 1MNQA 3K0EA 4G8JA 3PHHA 3JS5A 1EGAA 2O50A 2PVPA 5ITWA 1QTRA 3P9NA 4EFLA 3IS3A 3K71B 2WJZB 1Q44A 3R0QA 4BUZA 1KY2A 3K6SA 1ZD9A 1ZH2A 3SXPA 2EP8A 3CLRC 1K2WA 3KZKA 1R8SA 3AJDA 4U2CA 3WZLA 5HJ7A 4BRSA 1AVTA 4IF4A 5HZKA 1XK7A 1GP2A 2XCLA 3RHFA 3VMFA 4ER5A 4UFPA 1VMAA 4Z7QB 2F64A 2JFQA 2UYCA 5DRYA 1PJ2A 4FOTA 5CB0A 1V6CA 1UJ2A 2O0KA 3FOAA 4PCVA 1W0JA 3ES9A 2Q8PA 4JIGA 1OH5A 3UICA 4NRDA 3E2MA 3RM3A 1GL7A 1KGDA 1QONA 4WL0A 3JQQA 4CM9A 1HZZC 2DTDA 4ITVA 4RDXA 1A8HA 5GONF 1LLUA 2VSYA 2HJVA 4PFKA 4ZGWA 2W22A 3GDOA 1FW6A 2IOYA 3NHLA 4KH1A 4Y7DA 2BE9A 4N3AA 4ZRDA 5A0FA 4LXTA 1L5NA 4F6RA 3H6KA 3UYKA 3FMPB 2EEPA 4JELA 5EXPA 3MGBA 3U1TA 4BV8A 3LT5A 1PR2A 4GX1A 1R50A 3B2QA 1Z6TA 1GILA 2YJ3A 3PL1A 3O31A 2FG6C 3FPBA 4YUXA 2XUAA 3HR4A 2HJ9A 4QYTA 4A7PA 3TGWA 4CDGA 4ZO6A 2EYUA 3FF4A 1U6KA 2ZAIA 4Y2YA 4MV9A 3SC3A 2HQ1A 1VKOA 1T0IA 5JCJD 1FQOA 1QHXA 4BZZA 3HKCB 3ZV4A 4QPJC 4YQYA 3LF2A 2ZWAA 1PR6A 1EFVB 1QPBA 2ZE6A 1AM4D 3CX3A 3EVNA 3NASA 5DI9A 1G17A 3DZFA 4P32A 2DULA 3B9PA 3LU1A 3FYCA 4D97A 2XRFA 4EO7A 4OPMA 4F5DA 2W8BB 1NKSA 2CMDA 4F2DA 2NVUB 1YJAA 4UM7A 3NBZC 1RAIA 1W46A 4IEIA 4PYNA 4E5DA 2OLJA 4U3JB 2GWHA 3AV0B 4JGGA 2O8EB 2HF8A 4JJZA 1U5CA 2VAXA 1X7WA 5CXQA 4RXUA 1OKKA 1DPFA 2CUZA 1E61A 4E13A 3TW8A 2EZTA 4AROA 1P7CA 3FUVA 3NNNA 1AQNA 4YQEA 4CKYA 2RJNA 1ZUWA 3BSFA 4PPNA 2C96A 1SOWA 2DF8A 2GEUA 2BFMA 221PA 2J5QA 3GUUA 4AJOA 4C87A 3VPFA 4KAFA 1DC8A 4GU5A 3FKJA 3OI7A 3PHGA 3W6ZA 4BMSA 3VKHA 1TTQB 3B6KA 4YMGA 2WWVD 2XTAA 3F5MA 4MRPA 1ONOA 2NV6A 2NVBA 1S8NA 1MOZA 2QG9A 3D2BA 2CXQA 3JAKA 1IHUA 1K6EA 4YWJA 3LIPA 1LBQA 1W1IA 4QUAA 3TOXA 2XUJA 4PYKA 2FMTA 4UTVA 3TSYA 2DQKA 3FIUA 2BR3A 4EW1A 1P29A 1C30B 1R8YA 4MYTA 3FM9A 3WG9A 1Z28A 4YRTA 3BTSA 4I99A 5T8KA 4BUCA 2QP3A 5BSEA 5FV7A 3QSYA 3P26A 3JYQA 1W73A 2RKOA 4UBKA 3UWDA 2R8EA 3SZGA 3CVXA 4PHGA 2ADFA 3IP3A 1Y5NA 2WG2A 3EQ6A 3QWFA 3I9NA 5IDVA 4A2PA 1CUWA 3IE1A 2I2BA 1B7GO 5LZ8A 4PHFA 4ZREA 1CT9A 1MA3A 1JUDA 1QX4A 4JP2A 4RMNA 3O2JA 3FZNA 2IYOA 4LW8A 4FDVA 4OA8A 5AXDA 3T41A 1GKLA 2OFWA 3HJAA 1W2HA 3ZK7A 4NZYA 2ZR8A 3PEVA 3R3XA 5MFPA 3BK2A 1S4MA 2P91A 4QVKA 2Y99A 4TX1A 2ZUSA 2GSWA 3RIGA 1Z2CA 1SU8A 2R3SA 3BDIA 4J2HA 2V8OA 4ZPXA 4C4RA 4DGQA 1UANA 1A0OA 2A9RA 4OMDA 1KFJB 1E60A 3M6XA 1F0KA 2FVYA 1F8GA 1YDFA 1E2JA 3LC0A 1T0BA 4G85A 4QTZA 3L7NA 5B12A 1T8UA 3KSAC 1KAHA 4PPGA 4F7WA 3GLGB 3I61A 4LF7B 3OCUA 1J0DA 1KJQA 3DPUA 3UB2A 5IUJC 1G5FA 1W0JD 5K5EA 4H17A 1KVSA 1EQAA 5D8DA 1SRRA 1FNMA 1T2NA 3CZ9A 2ZP1A 3NKLA 2IK8A 4IIVA 4CM9D 4AECA 1EFHA 1Z2EA 1HE1C 3EW9A 5F7XA 5L45A 1SHTX 1ZRNA 3RNOA 1CZOA 1OILA 5LYJF 2GQ0A 1NMXA 1OLUB 5FCDA 4YRLA 4QDJA 5FUBA 4CN8A 2QTTA 5U4XA 4D1YA 3E03A 3Q7RA 3QXXA 3WL8A 5CVTA 1P6QA 3P96A 1AXEA 1ZL0A 4J6EA 3TW6A 4HDKB 3U13A 2WP0A 1HQYE 3CZCA 1NYLA 3H5TA 4UNPA 1W59A 2GAAA 2UVPB 1PFKA 2ZIZA 2VPYA 5BN1A 4XR4A 4H4EA 4ZA2A 5LOVA 3SHWA 2WHEA 3RADC 2BSAA 1GA4A 2ZWVA 3WGUA 3IUMA 1OH6A 5AM2A 3E9YA 1TW2A 3I34X 4AULA 1W5AA 1SHLA 5DNYB 2HUNA 3DYIA 3X1WA 5IF3A 1IBRA 4ACAA 5AKEA 1QMGA 2ZQ5A 4HTAA