1GFWA

The 2.8 angstrom crystal structure of caspase-3 (apopain or cpp32)in complex with an isatin sulfonamide inhibitor.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CASPASE-3 (APOPAIN, P20)
publication title Potent and selective nonpeptide inhibitors of caspases 3 and 7 inhibit apoptosis and maintain cell functionality.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 145
sequence length 145
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2000-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1gfwA00
1GFWA 3ITNA 4ZVTA 4ZVUA 4FGUA 4JQZA 5LUAA 4DCJA 3D6HA 1JXQA 3NS7A 2H65A 4EHAA 2CNOA 2P2CA 4N7MA 4HQ0A 4IEFB 3IBCA 4I1RA 1GQFA 2DKOA 3H11B 4M9RA 1K86A 2H5IA 2CJYA 4QU0A 3QNWA 3V6MA 1F1JA 2C2MA 5I9BA 1PYOA 5IAJA 4IYRA 1CP3A 3DEJA 4ZVOA 4AWAA 1SHJA 2XZTA 1SC4A 3R5JA 3DEIA 4JJ8A 3V55A 2FP3A 2CDRA 3V3KA 2J30A 1M72A 2FUNB 4JR2A 4ZVRA 4N5DA 2XYGA 3H0EA 2C2OA 4QTYA 4EHDA 3SIPA 2QL9A 3RJMA 3KJNA 4N6NA 3R6GA 4QUIA 4AW9A 5K20A 4QU9A 2HBQA 1RWXA 3PD1A 2FQQA 1KMCA 3S70A 4DCOA 5IAGA 4EHFA 5JFTA 4HVAA 5IC6A 5IBCA 4HQRA 1RHKA 1I3OA 2H5JA 3P4UA 4LSZA 3GJQA 4QUDA 1RWKA 2XZDA 4QTXA 4PRYA 2QLJA 1F9EA 3K7EA 4FXOA 1NMEA 3D6FA 1RHRA 2CNNA 5IANA 3R7SA 5IABA 2J33A 5I9TA 4AWBA 3IBFA 1SC3A 2CJXA 2AR9A 2CNKA 3GJSA 5LU9A 3PD0A 4NOJA 2XYPA 3EDQA 3NKFA 3V6LA 2CNLA 4JR1A 1I51A 4NOLA 5IAEA 3DEKA 4NBNA 1NMSA 2Y1LA 2H51A 3GJRA 2C2KA 1RHUA 1RWNA 4ZVPA 1RHJA 2J31A 3GJTA 3UO8B 4JQYA 3V4LA 1RWMA 2QL7A 3H11A 2K7ZA 2QLFA 2WDPA 4DCPA 1PAUA 1SHLA 4QUJA 4QULA 3KJQA 4JB8A 4N7JA 4D3ZA 2C2ZA 4JJ7A 4QUBA 5IBRA 2HBYA 5IARA 1RWWA 1K88A 1CVRA 2J32A 5IASA 5IBPA 1I4EB 3E4CA 1RE1A 1RWVA 4I1PA 4FEAA 1NW9B 1SC1A 1QDUA 4N6OA 4N6GA 5IC4A 3R5KA 4PS1A 1ICEA 3DEHA 5H0IA 4ZVQA 4ZVSA 5LU8A 3KJFA 4NBLA 3R7NA 3V4OA 2Y0BA 1IBCA 3H13A 4NBKA 3BIJA 4EHNA 4PRZA 2H48A 2QLBA 1NMQA 4EHLA 1QTNA 2C1EA 4QUHA 4QUAA 4EHHA 1RWPA 3EDRA 4EJFA 3P45A 3R6LA 2H54A 3SIRA 3NR2A 4NOKA 4QU5A 1RWOA 1BMQA 2QL5A 3H1PA 4FDLA 4JJEA 5LUBA 3S8EA 5IAKA 4EHKA 2XYHA 4QU8A 4NOMA 1I4OA 4PS0A 1RHMA 4QUEA 3PCXA 3UOAB 1QX3A 2H4YA 4JR0A 2HBZA 4D3XA 2H4WA 3OD5A 4D3YA 4QUGA 3D6MA 1RHQA 3R7BA 2HBRA 2NN3C
chains in the Genus database with same CATH superfamily
4FDVA 3NWBA 5LLSA 3PPVA 4D6YA 4E09A 3ET5A 4JH0A 3HRKA 2OYRA 4X94A 4W5RA 1DO0A 1JXQA 1C8KA 2Z2KA 3QKIA 4J2OA 4ZTBA 4AIRA 4I1RA 1UEXC 3DEAA 4K9NA 4CM5A 4CFZA 3I8OA 5F9MA 1AGYA 4A15A 1PWZA 1TKAA 3PHLA 1YMVA 1N3LA 2YN0A 2Z30A 1JS1X 1M10A 4TWRA 3RSLA 1ZGAA 3LXUX 1UZMA 3C8HA 3EIXA 3SOZA 5P21A 2ZCVA 3QVMA 2J67A 4FOSA 4GL4A 3IQFA 3MWDA 3WIBA 2ATVA 1G5PA 3G88A 5B12A 4V3CA 3IUYA 3TLMA 4WMLA 5JMTA 4JQOA 4M87A 3KB1A 3M34A 3EIFA 3BG5A 1XTVA 1F8XA 1KI7A 2H08A 4KW7A 5CJPA 4C29A 1EFTA 1R0WA 1P3DA 5CW2A 4WACA 3EBLA 3MYRA 4FINA 2C77A 2Q2QA 2ZSDA 1BS9A 1NVBA 4HLCA 1FP6A 1U8FO 3AXSA 4PYIA 4B5LA 4JLKA 4WADA 5AJXA 4B2IA 2QPLA 5LJIA 1UFOA 4I1VA 5HK9A 1GRCA 1OLSA 1AIPA 4TSFD 3DJYA 4M6WA 1CB7A 2IHYA 5CLQA 5ECYA 4ZICA 4PQYA 4F96A 5JCZA 3AM1A 1K3UB 2ACWA 3WHPA 4O4LB 4TTSA 4C4AA 3HBJA 3FY4A 1P0PA 3M1LA 4RHEA 2B8WA 1LEHA 1ISRA 1X8LA 3RGWS 5C8XA 3AFNA 3I4CA 4RK6A 4ALNA 4MVJI 3WL6A 2ZFUA 3A27A 3CLSC 3G0OA 4FLEA 3VKHA 1FVOA 5COQA 4R84A 2NG1A 4NEGA 4KGVA 3U7EB 3SSOA 4OJKA 4IUBS 4X20B 1KR5A 2HJ9A 4UTNA 4XXHA 3VRHA 1O1YA 2VP5A 1N6LA 1R50A 2PGAA 1GGEA 2ZS7A 3TGLA 2PZLA 2W2XA 2COEA 4XFDA 4K3VA 4B17A 1ECCA 3DMDA 1KE2A 3SQMA 5JSHA 3GLGA 2M6KA 3WGZA 4YJ2B 4LF4B 3KLMX 1ZISA 1JV2B 2O8NA 3B3GA 2JB9A 5K09A 2JFPA 3UKDA 5C8DA 4X6UA 2O8EB 2YMLA 1V43A 3I0NA 3HU2A 3INGA 3Q7IA 1THMA 4C0HA 3KYDA 5DLQC 1OX6A 3VPCA 2C9MA 4WECA 4BJ5A 1U2DA 2AJLI 2EKPA 2FMIA 3BGSA 3GAAA 3LHDA 3MD9A 2AFHA 4BMNA 4WNAB 3K31A 4Y98A 2X4DA 4ZCQA 2R00C 1V5IA 3AEZA 1Q1ZA 1E6LA 2BI7A 3AW9A 3DTYA 5BO5A 5BNZA 3SDZA 2OBMA 2XGSA 3RF7A 2GFHA 1C2YA 3KL2A 3VU1A 1O8CA 5IDYA 4F3RA 4XRGA 2O2XA 2BFEA 5A2QA 2ODAA 1W88B 4WKNA 5AHRA 3PITA 4JLOA 2FPPB 1V3TA 2EL9A 3CFYA 4PLFA 5JXIA 4N41A 4OGLA 4G1BA 4UAGA 3BFVA 3DMTC 3ZKAA 4B8ZA 3H7IA 3LYHA 2F4VB 1VYHA 3HVIA 4WJLA 4D3XA 1DEHA 2YCBA 3PEFA 3WK9A 2ES4A 3I28A 4LI0A 2XD9A 4QXPA 5FNZA 3RAFC 4UM9B 1LLDA 2DH5A 2P6OA 2XUOA 3MT9A 5BOSA 4OHMA 2E1RA 3A1TA 5LCXA 3TIGA 4BWYA 2R1VB 5IM5A 2P2CA 1L5QA 1BGWA 1FLNA 2I4IA 4GKJB 1A8HA 3Q7TA 4R83A 2HO5A 1RXYA 1Z0UA 2RKWA 4EUKA 4LX8A 1GDDA 1YQXA 4QAJA 3DXFA 3FZGA 2TMGA 4Q5IA 4F2PA 4MQ5A 1PYOA 1TTPB 3H9QA 4KN5A 3NYQA 5DYIA 4PG6A 1SHJA 3RWBA 5JMWA 1BW9A 5FD8A 5L8VA 3AIIA 2I2FA 3OZ7A 1L4YA 4IOMA 3N2GA 4DMCA 4OIMA 1JWLA 5HGXA 3LC1O 1QR6A 4O1HA 2CSXA 2J3LA 2OGUA 4CLXA 3G5LA 1XKXA 1EM8B 2XPCA 5ECWA 4XWOA 1KFEB 5IT4A 3IAM1 4PAOA 2I4MA 1D6NA 2BGNA 3O2NA 1Q0HA 2VYCA 3RYIA 1F5SA 3MJVA 1YR8A 5BNWA 1QWOA 1ORIA 3R4CA 3DZGA 3PJDA 2B2XA 4E70A 1MCZA 1T9CA 3K72B 3WYDA 1GP2A 2XYRA 1WETA 2C00A 1XZFA 2ETXA 2H5JA 2NU7B 1YL5A 4QOJA 4QUDA 3ZQUA 2J9ZB 2ON6A 1E1QA 2RIPA 4PO3X 2VTDA 1DBIA 5CXQA 1BWRA 3NHFA 1HT0A 3VMFA 3UZUA 2NO9A 5HE9A 4WESA 3UXEA 4EY5A 4REOA 3PK0A 1XQ9A 3W7VA 1XQWA 1A5AB 2EZUA 2G63A 1BQ3A 2Q4TA 3HRHA 2GEDA 3EODA 5K3FA 2PVPA 1TEHA 2AJBA 4LEIA 2XNSA 3ASVA 1K5HA 1LK0A 5IAEA 2WNHA 5AKEA 1X0XA 2HRQA 3MPUA 4PQGA 3PFKA 3WLPA 1Z6ZA 3B1FA 4X1OA 4JVSB 3IEPA 1NZFA 1X7HA 2XUZA 3O74A 4Q1DA 5E7QA 4XLLA 3W79A 3CM0A 3IRVA 5LL6P 3P2EA 2B1GA 1XVLA 3ANLA 1T4DA 4LBVA 4DCPA 1CUHA 2OILA 5JWOA 1JR3E 4X8LA 3T7IA 1KVUA 1PFYA 2XQIA 3ELUA 1CUAA 4DB4A 1MC8A 1J06A 2AFIA 4DDVA 2PMFA 3VISA 3F2VA 1D7AA 2C3PA 3O03A 3JAMA 1P7CA 5LC1A 3JD2A 4Z53A 4GVLA 2A6PA 5THXA 1GHTA 3MWJA 5FI5A 3TW8B 1AK2A 2C5FA 3IUPA 3GRCA 4XFJA 2RJOA 3X1XA 3ROEA 4CEIA 3T4EA 5E8RA 3U3JA 4HDKA 4DAEA 3H84A 3PQEA 4EHLA 4RJTA 1TM7E 3TSCA 1G16A 1XTBA 2HCFA 1O6GA 1U2GA 1GNTA 1K5DA 4MUYA 5KB3A 1H2HA 3IVMA 1DKQA 1NKTA 2GEJA 2NTVA 1US8B 4KIWA 3V32A 4ZQFA 4AYTA 2QL5A 3PDIB 4L72A 4NMMA 1KARA 3SYTA 4MKZA 1ZOSA 3M89A 4RADA 3RS5A 3WYNA 4BOYA 1DJMA 3BMOA 4Z0TA 5BN4A 2XRFA 3TL2A 1UEJA 2F9FA 4FCCA 1B0ZA 1JSZA 2XE6A 5EWLB 4P3NA 1KYIA 4HS4A 2MINA 1KO4A 3GB9A 3OJLA 1HY3A 3T5MA 2NN3C 5JLJA 5JNRA 3FVTA 3L9WA 2LGJA 4H27A 2YWXA 3NHBA 1V8FA 2EJVA 1FP1D 2WWIA 3BILA 3A4VA 3SF8B 2OXFA 4BNGA 2B98A 3TTXA 3CR8A 3K53A 4HRVA 3E5MA 3KXIA 3TG8A 3N3BC 3SPXA 3CUTA 5JHGB 2V7QA 2VC2B 1ZI6A 3IHWA 1WXFA 2WP0A 3K4HA 5JAOA 2W37A 3SWWA 1MJNA 1GCUA 5K4AA 1VJDA 2RB5A 3A2MA 4RTQA 4NBSA 2YHSA 5CLLA 1F9AA 3LGSA 1M0EA 2ICAA 3AEXA 2F3RA 2H0QA 1R5BA 2YWGA 3KS9A 1MOZA 3LUCA 3GBPA 3DLHA 5EIEA 1H5UA 3KU1A 4X5OA 4R7GA 4G24A 3GA5A 2X2PA 2X19A 3GRVA 4XJTA 1ESNA 1SIBE 1XXLA 3L7DA 4NPCA 4WQMA 2NVOA 3PA6A 3OOHA 3WNZA 5B36A 1BWPA 5IK2D 3FPGA 3M9XA 2ZRAA 1M33A 1M76A 5TARA 4NCIA 4AW9A 1D4AA 2XGJA 2CXQA 4QBKA 4QXMA 1RBMA 4DA7A 2P9FA 1H3FA 3V1YA 2IKSA 5LWQA 3A1VA 1IM5A 4RPHA 5CNKA 1OBVA 1OFIA 4QOGA 4V1CB 3WGHA 2IX9A 3MAJA 2FQWA 1U5BB 2VJAA 2YXLA 3ZJ4A 4QC2A 5DM70 2W0SA 3OJWA 2VBIA 3HZZA 1GTRA 1X1SA 1D2HA 5HQ3A 1TUEA 3QG5A 4EY8A 1WPRA 3D0KA 4BKPA 4BAGA 2JGJA 1WQ3A 2PUHA 1ZUHA 2YNMD 3LBYA 4KQGA 2O54A 4C0BA 5AJWA 1H2BA 4QOFA 3VYUB 1VBNA 5J2TA 1GPYA 3N8KA 1Q12A 3RU7A 4A8JB 1PHRA 5LXTA 1ZN9A 2PT6A 4Q1FA 1DQYA 1IG3A 3E35A 1SD1A 2JLQA 2QYSA 1Y3BE 2WPDD 4J7XA 3RDPA 3TD6A 1XDSA 2F9MA 3WL7A 1BA2A 3WXMA 3DHEA 1VL6A 4DQVA 4Y8VA 4RPIA 2RD2A 1GNLA 1T4GA 5GJWC 2VRBA 3GJ7A 1L5KA 3KPUA 2PT7A 2ZRDA 1WPGA 1PEDA 2HL6A 1WU8A 3NETA 4FQ8A 4JYBA 4MRPA 1O94A 4F60A 3LY7A 1X38A 1X6VA 3KKKA 3KUDA 1F2TB 1AUQA 1DBRA 1BHJA 2AF3C 1EP3B 1L7BA 3AZOA 1U0GA 3OU6A 1A7JA 5FNVB 2QROA 4YQFA 4BNTA 1SULA 1XBTA 4YRZA 5C18A 3A2LA 2GBCA 3N6RA 1E5DA 1L3CA 4H1UA 4AUMA 2EGHA 4XUEA 1U98A 3RFUA 2Q07A 2CEAA 2JA2A 2KMLA 3DUFB 4K6CA 3NLLA 3QHPA 1WDWB 2GN9A 2PWZA 4IJKA 3QBEA 3RBAA 1PWYE 3AM4A 3ICPA 3VVLA 4A6EA 3GEEA 2B82A 4KH1A 2CLHB 1Z6YA 1WQ4A 3EGVA 2I54A 1HE4A 1G1MA 4BMZA 1C0EA 4PO8A 5IRCD 1R0YA 1UUFA 2VDRB 3G9ZA 3TW0A 1CDDA 3B36A 4LDQA 1IEVA 1S3FA 5A4KA 4JBIA 4LJKA 2CDCA 3EG9A 3TMYA 4S1WA 1QO0D 1V26A 1FNMA 2VAWA 3FKQA 9ATCA 4N9QA 1SVIA 5GAJA 3ORHA 1PG5A 2XLBA 2JD1A 1HDCA 4IP0A 3QUCA 1N6OA 3MTIA 4HWPA 4JXJA 4LFCB 1T3SA 1Z75A 1UAGA 3AY0A 3WLOA 3TBFA 3A3OA 3MUOA 4X6YA 4ANFA 1AV6A 2D0DA 4PZ9A 2D1TA 3ND8A 3NI2A 3EXFB 1TZMA 3QVSA 5AJHA 1I3NA 2P91A 4G23A 1J1UA 3PTAA 1SCAA 3BL6A 2LVBA 2R44A 2WG2A 1Z5VA 3I9OA 2FVXA 3SYNA 4EQ6B 1LFAA 5DV9A 1N2GA 4R1NA 2PG3A 3S4YA 3GJXC 3THOA 2FMUA 4JR2A 1JG6A 1SN7A 2ERCA 3PLRA 3DC7A 5TF0A 1CVLA 3F5FA 1ZLXA 5DOZA 5I47A 2JLXA 4Z4CA 3PPWA 5AVOA 3DB2A 2O3SA 2QG4A 5LKAA 1W19A 1WV1A 3PB3A 4WJKB 5JZVA 1P9NA 2COKA 1CX9B 1DQZA 3M33A 4IINA 4EEZA 4ZJPA 5GJBA 4RJ2A 4ARZB 3BWMA 4X84A 3IIJA 5I9NA 1VHTA 2ZWOA 4IRXA 5JT1A 2MYPA 3NTRA 4QGAA 4EYGA 3VGJA 3MPOA 3IUEA 1DADA 3WIDA 4NONA 3BXHA 4S35A 5FLKA 2ZE6A 1Z4IA 3PE3A 4OD0A 5KX5A 2CV0A 3KR2A 1QCCA 1QPBA 2ZYGA 4QPNA 2E4AA 1OI3A 3IV9A 3N8GA 1EX6A 2FEMA 3WQRA 1EFAA 3WLHA 5BOVA 3ZKWB 4AJOA 2XWQA 2CD7A 1SXJC 4Q66C 3QEAZ 1W36C 1GAQA 1NIPA 3A4NA 1TA9A 2PGJA 2WMYA 2ZI7A 3Q87B 1TQ6A 4MGKR 3T7EA 3OZCA 3X1MA 1PSDA 2IF0A 1ML4A 3UAVA 2EQ5A 1EMDA 2ZITA 4II2A 3KR1A 2B4RO 3CV3A 3I9LA 3QU9A 1VKNA 4YUYA 2H5LA 3ECCA 4MV4A 2JFQA 3JYLA 2J3EA 3QY9A 4QULA 2DECA 4BFYA 4IJQA 4EJSA 1C30A 1UF9A 2RCYA 3I04A 5E3HA 5IARA 3EXEA 4FB4A 4B3JA 3RUCA 3ZBPA 4J3FA 3EGDB 1K8RA 3HFSA 4M8LA 1UMBA 2JC3A 4ICIA 2XB9A 3B70A 4MP8A 1RQLA 3THYB 2WU1A 2JIBA 3JQRA 3P2KA 2IEBA 1NOKA 2I34A 2CHEA 4JB0A 1XALA 5D85A 4FM9A 2BM1A 1NTRA 3L7AA 3GUCA 4P7JA 5AVVA 1FYFA 1N0HA 1O97C 4LWOA 3RJ5A 4JL8A 2FOXA 1LSOA 5IBQA 4MB2A 3L0YA 1J8YF 4R8MA 3RSQA 1HE1C 3AHFA 4XB6B 1JHAA 4MA4A 4W1PA 4DANA 1MIOA 2YXNA 4P34A 3QX8A 3RTEA 3KJGA 4XYGA 1G63A 1JEOA 1TK3A 3DCJA 3A1FA 4Q3NA 2FEPA 5TQ2A 4RHTA 1WVGA 3QUSA 4HQLA 1TF5A 4TKVB 1ZJ6A 3BA1A 1Z2OX 3HMQA 2OEPA 5IN5A 2V6GA 3T9CA 4AJLA 4F7DA 3WKAA 5GV7A 5HFJA 5J4VA 2Q9BA 2OAGA 3O2SB 2WZQA 1KHHA 1DLJA 4PZDA 1RAHA 3O73A 2QMUA 4J1QA 4MV5A 3CLSD 1U1FA 4FZVA 4QUGA 1BE0A 2ISSD 3QLVC 3U40A 5DN6A 1GFWA 2QJWA 3IQGX 5HIIA 4YO7A 2EV9A 2PY6A 2Y0PA 5U4XA 1KSJA 3VPBA 3LT2A 1RI3A 2PD4A 2VZEA 4MGEA 4UAJA 4MW0A 3P9RA 4XTCS 3NFRA 3QMWA 4FHGA 2YFQA 3DBLB 1YZTA 1K86A 5TQJA 3RVMA 4BX8A 5G02A 3UOGA 4Q01A 2QP4A 4YRIA 3TGWA 5I4KA 3MGCA 4QRHA 5MFPA 2ZZMA 1U28A 3DW1X 2EDCA 2C95A 3DDWA 3ED5A 1XD8A 3TECE 1QHFA 2ZXEA 4MVJP 4EZIA 1TB4A 3FGNA 4GPTA 4MITA 4OP2A 3USCS 2R87A 1JBQA 3BH6A 2ENUA 2HIGA 1KTIA 4X63A 3A70A 1BVRA 2GYYA 3GK3A 2KM1A 1NURA 2OXEA 4JVNA 1CETA 3IAUA 5TT1A 4BC0A 1G7RA 3V1MA 1FS6A 2PSHA 5HHTA 4EG3A 2COUA 3VOSA 1T1GA 3WI7A 1H0HA 2G5CA 3ST7A 3G0DA 4C6HA 3AKEA 3EDCA 2I2XB 3B1VA 3TF5A 4NATA 4HX5A 2ZQ5A 4I1YA 1YL6A 1L7AA 3JAKA 3EIHA 1VFNA 2X5NA 4C0XA 4FGJA 4W63A 5FTMA 1EEHA 1JDJA 2VSNA 3G2JA 2CXRA 5K45A 4G6ZA 1KJJA 2W58A 4YP5A 3E81A 3HTXA 1PR1A 2D54A 3MRTA 1C9EA 4WY2A 1X2EA 4MWSA 5FAKA 3OIGA 2IHZA 2AW3A 1WKBA 3L77A 4FFLA 2VT2A 4BO8A 5JFGA 1XXHA 3CNHA 1X39A 3AZPA 2ZPAA 4ZIRA 2IP2A 2W2NA 4D9NA 2WABA 4R81A 3DTNA 4IJMA 1FLAA 3CN9A 1QH0A 4KQEA 2Q9AA 3TLKA 3KQNA 1A04A 2HIAA 4BY9E 1MO2A 3MMNA 4L27A 1AG9A 4P4GA 1XLTC 5E7IA 5D3QA 4J0QA 1XD2B 3KAQA 4H1VA 4M88A 4TROA 4EI9A 1CR2A 3S81A 2WDZA 4FEYA 4A23A 5BYBA 1RZ3A 1RQPA 3HFRA 3VR6D 3WYBA 5JALA 1L5MA 1LDYA 4DNFA 5CJJA 1BMFA 1E0JA 2HFJA 1SCNE 4LXYA 4K9DA 3FDZB 1DWPA 1CT9A 3H2JA 2KBEA 1GSOA 1L4LA 4POAA 5FPPA 3ZVNA 4RFVA 3V4ZA 2WTXA 4IIHA 1IBCA 2CL0X 4BEBA 1AM4D 1CJCA 2SCUB 5A0VA 1YDFA 3IL2A 3FVRA 1TC1A 1YBAA 3KXLA 2ZYAA 1HDYA 4IDGA 5EI5A 2IW1A 1PK7A 4KREA 2OGZA 2R96A 4NOKA 1RIIA 3KZMA 3GZ4A 4TSRA 1T34A 4JK3A 3MJ4A 3PQFA 4UUQA 2NNLD 1YJXA 4JBNA 1GZVA 1VG0B 4M0PA 4NOMA 1A8PA 4O4LA 2QUHA 4PS0A 4RULA 3ZHYA 1QU3A 4ENVA 2AB0A 3UCFA 3RQIA 3DBRB 1WPQA 3N2NA 3OF5A 1ZSYA 4HAXA 1NVDA 4PPNA 2WICA 1P3Y1 2OT3B 2XADA 4HC4A 3GLFB 4G0VA 2PIDA 4IPTA 3RIEA 1H8ED 1M7HA 4RLFA 1ZZGA 4DCJA 4BZZA 4EPTA 4XVCA 4X20A 3SMVA 4F8JA 4OK6A 5T4FA 4PHTA 1RACA 3KFLA 5HM8A 3KPJA 4JI6B 2Q1XA 3IVRA 4V24A 3MMPA 4LGCA 2V7PA 3AKCA 4O8CA 2ZYSA 2H8KA 1J1IA 3TM5A 4QTUB 3JZMA 1K63A 3C7TA 4LXQA 4L51A 2QBYB 2ZTHA 4YJ2A 2I9PA 1XCMA 2GBPA 4U8GA 3VDRA 1W25A 2ZROA 1GNPA 2O8EA 1EK6A 2A58A 1YQWA 2LCIA 4E5VA 3WDSA 4WKPA 1F6WA 2CD9A 1TD1A 5K0BA 3RARA 4UBNA 4A0SA 3FR8A 4ENSA 4AO8A 4QTYA 2JAUA 1HDRA 4WNAA 5ES3A 1WD7A 5ITZB 5FOUA 3OC0A 4B4WA 4RABA 3RVOA 1FMCA 5CA0B 1UDRA 3ROXA 5AKHA 1JDUA 3MTEA 3NWPA 3WZMA 1X3LA 3GLQA 3VZBA 5LN1A 1F8FA 5WRFA 1XDWA 4YCMA 1W88A 4LF6B 3FOFC 4BB6A 4LXXA 3HSYA 2FPPA 5CFNA 2NXEA 1WV0A 4C6RA 1I1HA 4JEHA 4E5PA 2M6LA 1Z2NX 1EGMB 5A5FA 2O8CA 2CLCX 2ISQA 2HYIC 2WSBA 3PUVA 3UAOA 2BMVA 4XZ3A 5DX1A 4LE1A 5B7QA 5BUSA 1IJFA 1B73A 2ZJAA 1JH8A 3JWPA 1GG9A 1PEYA 2WIBA 4PAQA 4TMYA 1SEPA 3TZKA 1GFSA 1N57A 3ZXXA 3NT4A 3O3OB 2R1VA 4I4LA 4J2HA 5I8WA 1ESZA 5G41A 3LLVA 2SKCA 4B2YA 3JQFA 1C9NA 3AONB 5BR7A 4DBLC 2JCXA 1GPUA 3HP7A 3P96A 4MEBA 5C34B 1CR4A 2JLZA 2G5PA 4DS3A 3H8WA 1FK8A 3HXLA 4M9CA 4C20A 2YVKA 4JKOA 3U7JA 4FWTA 3KYJB 4BQQA 3S2YA 1PR0A 4DRXB 4DTIA 4ZEMA 3LUDA 2I76A 1E61A 5TRTA 3PQ6A 5GJVC 3ZHVA 1G5TA 2QVZX 1PTJA 1YE8A 4IJ5A 4TQGA 3ZLBA 2PX8A 3DYIA 2GH1A 1EM8A 1UC5B 3PYXA 4I19A 4DPLA 3QUTA 4C05A 1Z6QA 4LJ8A 5CXSA 4NARA 2ZIVB 5IC5A 2OFXA 5C3MA 1LQTA 1C4KA 1DX6A 1X80A 1YZ3A 3EPRA 3CF6R 1KAGA 3HM2A 3KYBA 2XCSB 2DQSA 4DM3A 1LU9A 3JPWA 3DE1X 3P9CA 4NV1A 3SSNA 4C1NA 1TYEB 2NU7A 4N03A 4K9PA 1CRQA 1XVAA 1QB8A 2R8XA 3NPMA 3WGNA 3L92A 4DV2B 2N47A 2LPMA 5DNDA 2OLJA 1NSYA 3GR6A 2OAP1 3K2EA 3O8QB 4PWYA 2YV2A 2D4AA 4XQ9A 4BO7A 5KYWA 4DUGA 1RAIA 1W2GA 3WMXA 4LJAA 1OH5A 2NXWA 3L1UA 1GU7A 2WF8A 4M8NE 4EB8A 1J49A 4DIUA 3D0QA 4F3CA 3HR7A 4YP7A 5AUQA 3GJZA 1F8YA 2CW5A 3IHLA 4ZXFA 2W6MA 3DXYA 2D0IA 4O6VA 2H31A 4D80A 4FN4A 4L6AA 3IPRA 3KQPA 1TJ3A 4OB6A 4G97A 5DSTA 3O1IC 2I4RA 1OZAA 2WV9A 4OLAA 3RABA 3BWVA 1Q0LA 4IFTA 1QQ7A 3V6MA 3LQFA 2VF4X 3L0PA 3P1JA 3H83A 1C1DB 4ZU3A 4WY5A 2ZUEA 1SZCA 4CWAA 2O1EA 1Q1GA 1MRZA 3WL5A 4E2ZA 4ETWA 1O5TA 1I30A 1XU7A 5J40A 2D0PB 5KVQA 3TOXA 3WBJA 3FMPB 4WKBA 1U3TA 1U7TA 3RWMB 1I1NA 2HPVA 1MJGA 1YASA 3KKNA 3TW8A 5K3SA 3CG0A 3W7BA 4TZKA 4XPIA 1CQZA 4Z1MA 2JGKA 5KDDA 2EBWA 4C06A 4EG1A 2AN1A 4EY7A 1HSZA 1RQRA 2HFKA 4XRRA 1GTG1 5IAGA 1FFXB 2WT9A 2X9LA 3TGPA 2HWWA 3OZSA 1G291 2HEGA 1AGNA 3CX6A 3KEQA 1OH8A 2A5LA 4L7VA 1US8A 1U9IC 2JDIA 4HN9A 3SDBA 2O48X 4HNVA 1EXWA 2ZP1A 2FPIB 2A0UA 1DQRA 2Z1NA 1P0IA 2DY0A 4NY1A 4RA6B 3A6LA 4BIIA 2PZ8A 3J81A 2C7RA 4XD7A 4OV6B 3BK7A 3C1AA 2I67A 3C6MA 3INYA 2OTCA 3L6EA 3LBNA 4B87A 4RIHA 3CUWA 3I1IA 3JSAA 3OTOB 2BLLA 2PGIA 2RBEA 1QIGA 5M29A 1KR2A 3DKKA 2RHWA 4WBSA 1SK8A 3AHDA 3HU5A 1G8AA 1VG9B 4R2LA 1OX4B 1QDLB 1RAFA 2WYWA 3K0EA 4J4TA 2L18A 5CM9C 5AJTA 3GW8A 3SF8A 3B6ZA 2PEZA 4UMDA 3AKDA 2OHOA 3KCNA 4HCJA 4UZFA 3AUAA 1U7XA 2FG6C 4CTMA 4B71A 2HB6A 1BDHA 2OORC 2O8BB 2HK7A 5LA6F 1A7KA 3URKA 1CS0B 2PR2A 4KU4A 4N7JA 2IOQA 4E2FA 1WIWA 2QUKA 2VEOA 4G4GA 4HVLA 5IEBA 1VI2A 1GG8A 5G2OA 3STXA 1K4MA 4IKPA 2FKAA 2IGBA 1LF5A 1NW9B 1I2DA 1IK6A 1PQPA 1J5XA 2R8PA 3UXHA 4D43A 2H3EA 4JUBA 4PHCA 2Z58A 1Q92A 2QRNA 4K0RA 2WUFA 3SOPA 2HA7A 3R5TA 2KHZA 1PJ2A 1PT8A 5JQWA 1I7QB 4B2PA 2NTEA 3R5XA 5CURA 1QV6A 5AK0A 1U0OC 2FVYA 3D0RA 2DHDA 2I4NA 4V1CA 1K6IA 1ETUA 5DIFA 4KXLA 2IS6A 1U5CA 1U5BA 2W2LA 3AQIA 2GHQA 2W22A 1XTIA 2DUUA 3W3AA 4H17A 3V8PA 1JJIA 1TYBE 4H1WA 2B34A 2WKQA 1NNLA 2NTNA 2H59A 4WNIA 3IELA 3EZ6A 4DJTA 1Q3TA 5BP7A 1B41A 1DRWA 4NXNB 1NN0A 2P27A 1BX0A 2DHCA 3WLEA 3ZGVA 1NDUA 4HFRA 4D4LA 3A1WA 1PV2A 4RTJA 3WGIA 4URVR 4F91B 1W36D 4A8JA 3C3AA 4K9KA 1S2OA 3A9TA 3P19A 1I7PA 3WNQA 2OA0A 4PTYA 4YDSA 3LECA 3DGEC 2CXNA 4REQB 3PUXA 2IZ5A 3KHTA 2F1OA 2VXBA 3TQFA 2GD2A 1PKXA 1VJ5A 1JEEA 2MOKA 3BICA 2HI0A 3GU3A 4TMTA 2BBSA 4P9NA 2H1OA 1T1RA 3OAAD 1S01A 3GDOA 2W2PA 3ZV3A 2O1SA 1Y5IA 5JXJA 4C08A 2BL4A 3W2GA 3R20A 1F2TA 1QMPA 2GZMA 1FX1A 2HNBA 1AF4A 2WOJA 4H4DA 5FNVA 3T4UA 4DLVA 1N2XA 2CBGA 4TTRA 5CHYA 1SVUA 4EL5A 2C03A 5ALDA 3NTQA 3H3JA 4Q3DA 2JFGA 3DUFA 4I4TF 3BYZA 3HEMA 1NF8A 5L53A 1JAYA 3ZCSA 4CL2A 1I7LA 4PW0A 4E4YA 3MGKA 2MWMA 1OIVA 3MLAA 1FFDA 2GBLC 2VYNA 4XI9A 3FSRA 4NMLA 1D07A 3PV0A 4FIDA 5I51A 2R84A 1NMEA 2AQHA 1HTBA 2CY0A 5ADWA 2LTAA 1TKCA 4FYWA 2Q3CA 1JLLB 1XCOA 3MGBA 1Z22A 3D6JA 4R3NA 3T1YB 2HJRA 5UKDA 5F2KA 4ZVKA 4RTLA 1BROA 1IOZA 1FUIA 1I6KA 4EVSA 2QL6A 1KXZA 3IOMA 4KKVA 1Y89A 3FZNA 4F3NA 5AESA 1Z7BA 2VT3A 5ICMA 3RWOA 4AMZA 1VCMA 4FFRA 1F14A 1PKEA 3KT0A 1G66A 3DFMA 3NTXA 5M7EA 1RHUA 1A3CA 4PICA 1GKUB 2GLUA 3AILA 3GAMA 2QRVB 3IJ5A 1RM3A 2A2ZA 4P86A 5EHQA 3EXFA 1S9DA 4BPRA 3GEBA 3KWFA 1JALA 1T10A 2Y67A 3ND5A 4R2KA 4UMVA 3RRMA 3LY9A 3GO4A 3ABZA 4P31A 4W7IA 3UUEA 3FWHA 2VF5X 3ESXA 2FCAA 2C1ZA 1HNXB 3HO1A 3TZQA 4R5MA 3HEAA 3GX1A 1KYWA 1ZRNA 4K9SA 1YUMA 2BEWB 4EQ6A 3WK5A 2FDXA 4POOA 2Q5JA 2SKEA 4HHEA 3I6YA 4F2GA 5G4LA 4GX1A 5B57C 2WWTA 3B8HA 1NHWA 4KRGA 4NENB 5T57A 4C6SA 1KK0A 4QVIA 2Q1YA 3NM4A 3JR3A 2YWCA 2F2TA 4JUCA 4QE3A 4BE7B 2MMGA 4E46A 1O89A 1NXOA 5B7NA 2CYCA 3WMWA 1Y34E 3GZNA 4HQNA 1U8XX 3U3XA 3EGIA 3QBJA 1IWBB 4IIEA 3U5TA 2H1VA 1ZBQA 3GRPA 3EDRA 1NONA 3JU3A 1BHQ1 4MW4A 2ZBVA 3P9PA 3EIOA 4ARZA 2Y1DA 3OO0A 3P5BA 4JODA 4HP8A 2VAVA 5LUBA 4FOOA 3FMOB 5EJ9A 1F2DA 1SXPA 2ETVA 4PPFA 1NF9A 1OGJA 3L5OA 4CV3A 4LFAB 5K6AC 2ZJ7A 4EHJA 1PVOA 1E2PA 2XT6A 3QV1A 3ZGYA 3IV7A 1L5WA 1WZIA 4CT0A 1W94A 2BRUC 1J2UA 2P5SA 2ZQZA 3OI7A 3Q7SA 5J4LA 4MCAA 5K0NA 5AKYA 3ZW8A 2J8ZA 1Q3HA 1FVHA 2W4QA 2WD8A 3VNAA 3ZKWA 5A0TA 1CRPA 3LK6A 1HFJA 3W5AA 2RHHA 1T5DX 1NJGA 2P0EA 4M7WA 2PFSA 3ZVKA 2BYTA 4OBBA 4A1FA 3AI2A 2A94A 1TPYA 3KAJA 5DGHA 1Z39A 3I9JA 3FYUB 2X1LA 1GN9A 4CT5A 4F06A 5K0GA 2GJKA 3FOEC 1GUFA 4Z4QA 3CH7A 5J4HA 4N82A 1CDOA 5HUJA 4LC9A 4HAUA 1COZA 1X1QA 2QT9A 1SUFA 3DOHA 4HAYA 1DCMA 1DHTA 1S2LA 5EVJA 3RCBA 2WHPB 1K7EB 1RFLA 1Z8NA 3EGDA 3HA3A 1YVPA 1JLKA 4GR4A 1FB5A 2C3YA 4MULA 1SOWA 3FDJA 3WADA 1WW8A 2BSQA 1NUTA 3GDHA 1WP4A 3ZDEA 1YHYA 5JS1A 3BWXA 3OLWA 2XMDA 3TNJA 3GGSA 4MUIA 3SHVA 2GZ3A 2ZXUA 1HOTA 2PTGA 4CL3A 3CZMA 2AUNA 4ZAFA 3ZIAD 1DRVA 1UJMA 2D1RA 2QTTA 1SUBA 4YDQA 4MI1A 2J07A 2A14A 4BUCA 5CDYA 3DVQX 1ZMOA 3K6RA 3R3YA 2L82A 4BNFA 4JL5A 3I8XA 4FFWA 2C9DA 4IF4A 4CG1A 1AKWA 2AEFA 1DFHA 1YWGO 3B1XA 3F9RA 1SUDA 2XGGA 5L3QA 3FKSD 4TKMA 2Q29A 3LK7A 4TKVA 1KEUA 2A3NA 4AY3A 1E6MA 1JR4A 1P31A 2BFCB 3QHQA 4EMSA 3PRYA 3A06A 4KRXA 1GJRA 2GXQA 3GAFA 1XQXA 1TCVA 3IAFA 4K6FA 1BCRA 1HV8A 1MHPA 1TFUA 1RLUA 4DT1B 2F8SA 1TJNA 5HS4A 4CIBA 3UMFA 3NNNA 1B16A 1YV9A 1TUIA 2CKDA 3FOAA 5E4YA 3AGQA 5F1PA 2X5JO 3H8JA 2WUDA 3BRWA 2ISCA 4UBOA 1NMSA 5AJYA 4JT9A 5T3UA 4D9MA 8ADHA 4TZ0A 1W85A 1JJAA 2A57A 3TK1A 1JTFA 1RWNA 3X1WA 3IXLA 2B4TO 2QEQA 2YJ6A 1JECA 3OIUA 3DBLA 3O83A 3HK2A 5I8PA 3ZQ6A 2GA8A 4MJXA 1CJVC 3OT1B 4GC9A 2FAXA 3QPBA 1Z16A 3FYHA 3SXJA 2ADMA 2H18A 2V4MA 3LTEA 1WJGA 4FHFA 4Q39A 4ZV4A 2ENWA 2GEBA 1K9VF 1F4LA 2Y1OA 4OTZA 5T5QA 4RF5A 1G5HA 2H9YA 3S1LA 1PNRA 1ZIXA 2WIJA 2FMKA 3DLAA 3HVKA 1CR1A 2GGSA 1KERA 5J43A 1TQHA 2VUIB 4FMDF 4I5GA 3OTQA 1H2WA 3QVUA 3VVCA 2QM0A 3OE4A 3DOOA 2FPUA 3TR5A 2XNJA 2R6HA 1OFUA 1WSBA 3DBOB 5H4HA 3Q2OA 2B99A 2X4GA 3MELA 4M37A 4OB7A 4R05A 1TW3A 3ANTA 3LX6A 3QLJA 1QK5A 1OA1A 2BT4A 3IQEA 4R1PA 5LNK1 3EEOA 1E2FA 2XMQA 1RRPA 4RXUA 5BW8A 3PEEA 3UOAB 1FDOA 3VNSA 2IH4A 4TRNA 1ESEA 3D0OA 2R68A 3KTDA 4RYDA 4DKXA 5DBEX 4HG2A 3UG7A 2Z5VA 1U7ZA 2Q21A 3CRMA 4WA8A 5TLSA 5KYWB 1TZ2A 5FHRA 2Z2IA 3AFGA 3CPSA 5GIPE 2G1KA 4R9SA 2C9BA 2H2AA 3KOWA 3NRJA 5EP1A 4DLXA 3B5JA 5BR8B 4EGCB 2D1FA 1QFJA 4RKQA 4FJ2A 4CFYA 1VL0A 4PXAA 4YMWA 1K4YA 1GEGA 1NATA 1Q7CA 2P77A 1Q0TA 4GMKA 4LQLA 5KSPA 5DB4A 2MCFA 3FZEA 4CF3A 4N8SA 1SURA 1N9ZA 1CF4A 2XAAA 2WP8J 3ZJUA 5DNUA 1N8KA 1U8TA 2GD1O 1F1BA 1MOSA 2QM3A 4AC9A 3AVTA 1J8DA 1ZM4A 1XZMA 1DI0A 1JR3A 1SOAA 2XODA 2ZSHA 4X1KB 1WEHA 3OCUA 1D1PA 2J1LA 4AJ4A 5KC8A 3GEPA 1H65A 1TA0A 4XIFA 3ZH2A 3ZHBA 4C2UA 1Y3DE 5C9ZA 1K7YA 4EOGA 1XDDA 4WI1A 1Y6ZA 4GLBA 4QQFA 4BHTA 3JR7A 5EJ6A 1YBVA 4MHSA 2HDHA 5DBIA 1Y8CA 3Q1LA 4LSMA 5A1TA 4AKIA 4I3GA 2SCUA 4ZC8A 1Y42X 3F90A 3OESA 1DBSA 1M2VB 3MMSA 3N5KA 5E0KB 4DLBA 1U8EA 2LKCA 3L8FA 2XUGA 5DTMA 4Y2QA 5LVAA 1VE6A 1Y0BA 1C9KA 4UXIA 5CXUA 1ESMA 2PUFA 3SLKA 3A0RB 4UDYX 3ML1A 1XTPA 3H6HA 5EGSA 3B2NA 3ZU5A 1A2KC 3D6FA 4QOHA 4Y0VA 1TOAA 1VC2A 1JHQA 4LV6A 4QQNA 4FN5A 1SCUB 1THGA 3E48A 1ADJA 1JIKA 3DBRA 2QXTA 3QA3E 1EINA 4ND2A 4CL0A 4Y7CA 2ECKA 3PXUA 4GW3A 1LNQA 4XDYA 3GLFA 1J22A 1TD9A 3LA6A 1C5KA 4BDTA 1BHSA 3FI0A 5B1EA 2DFDA 3FSJX 2C2KA 4FYJA 4U63A 4ZHSA 4LXUA 2ECPA 2GTIA 4W5NA 2NQ8A 3L7KA 1IH8A 3LVRE 4JFAA 2C2YA 2FX3A 3C14C 1VMIA 2XUDA 4BVGA 1FTNA 3CGGA 1O9BA 4AJHA 1HRKA 1W4CA 5KC9A 2D8AA 2DPGA 2QBYA 3ROFA 3ABRB 1LDMA 1QV9A 1X42A 3A32A 3MZ0A 5DWVA 2PKWA 5M34A 4EA9A 3ZHRA 2JAPA 1A82A 3A3KA 4AB1A 4KI0A 2HJHA 1IQUA 1Q14A 5KNBH 3SQXA 3HXTA 4NC9A 5HZGA 2V8BA 3AUTA 5A3QA 4W8GA 4TX1A 2V58A 4NBLA 3KQSA 3UKOA 3CSUA 3JD1A 1QOQB 3LCVB 3NIGB 1OXUA 1ZM7A 4NICA 5AI9A 5JCJA 3RUEA 3VR4A 3CJTA 1T8YA 3ZBUA 5ITZA 3QVOA 1ECBA 3O0DA 3S27A 1XYYA 4PGGA 2GAIA 4IHQA 3EXG1 5B1DA 4PR3A 521PA 3T7AA 5J58A 3HADA 4R41A 1G55A 1JAHA 2C07A 3WAGA 2ST1A 2O6LA 1EPUA 2AJ8A 5KNCA 4OQDA 2UUPA 3RF6A 3F3KA 3CUVA 2HCTA 4OYHA 1QVAA 1TVMA 1F48A 2J0EA 1HQCA 3F7TA 1WZUA 1E7RA 4TM7A 3FWPA 3GEHA 4IOLA 2DTDA 5ER6A 4DIMA 4OI0A 2BFDB 3ABSB 1N6HA 3TZLA 1NVVQ 3RBXA 3H75A 1VCNA 2HQSA 3BXGA 4RIFA 1MAAA 2HQBA 2YJ5A 1WMAA 3D81A 3GNSA 3IMCA 4IRMA 2C5SA 4QDXA 4C4ZA 4XWWA 3I5YA 2WA2A 3KQOA 2EJCA 5BRJA 2JIZD 1USGA 3MLBA 1XN1A 2X14A 3EVNA 2ZT8A 2RARA 3SEZA 4W1SA 3IC5A 1D04A 2HJSA 2CGEA 2VZLA 3LKZA 4WJZA 5CB4B 3ZS9A 4XYLA 3K8ZA 1FDUA 4NTZA 2W00A 1KYXA 1UP4A 2WSYB 3DG9A 3LUJA 4AVYA 1QZTA 3U4GA 2AXNA 4C78A 2BMWA 1VG8A 5E3IA 3UJHA 4DRXA 4K03A 5GOTA 3GFPA 4EW6A 2JGNA 5I45A 3OLYA 2DFVA 2WWXA 4QT4A 3JVUA 5KSOA 4MEAA 5KJ1A 4QO7A 3WL3A 2IEAA 1B8NA 1HZZC 2A5DA 4B44A 3H0EA 3Q7EA 5CG1A 4LHZA 3HQ4O 1T0HB 3DDNA 4D42A 4ISCA 4JIGA 1IUKA 2DTEA 2YZMA 2FLVA 4QJIA 1PZGA 2CMGA 5HTKA 5C8ZA 4JYCA 1TTTA 2C4NA 3DDZX 1CEYA 3SLGA 3B1JA 2CL6X 3GIDA 4FTWA 4JI0B 2UKDA 3MIZA 4IGEA 5CLIA 3F4KA 2RGWA 1E4OA 3C6QA 4Q9NA 3ORFA 5DT2A 3DE7X 1J7KA 3PKJA 2ARKA 4L5CA 5AI5A 1U6KA 2VPQA 4RF4A 2WHEA 4PSKA 1P6UA 3DMRA 1NQUA 1RBYA 3H5LA 3LP5A 1P1BA 3L8DA 1H1DA 2GCOB 2ZTVA 2ZJ2A 2C29D 2JGLA 3B3QA 3EY4A 3O8QA 4I50F 5E2BA 4YRFA 4G0MA 4Q1BA 2AT1A 4LZWA 1WTAA 4AKTA 4GOND 1KSHA 3ABIA 1CTQA 2P68A 2G80A 5JAIA 3E3MA 4IO0A 1I51A 3IQZA 4FLMA 5JPDA 3TXXA 5B3JC 3HPQA 1UBOS 2ZRCA 4D4MA 2Q9CA 1YAJA 3BA6A 1YRYE 3W2EA 4EPYA 1ODIA 1T6ZA 4B73A 1R8YA 2YDXA 2Q46A 4HXGA 3LX8A 2IYEA 2ZAOA 3UO8B 5KYYB 2QL7A 4DUYB 5BUZA 2UV8A 4N5IX 1IZ8A 2ZREA 1YS6A 2O05A 1YONA 1GGMA 2VPIA 1ENYA 1D4FA 2JF0A 1C1DA 2XLCA 4J6EA 2QUJA 2W8ZA 2HBYA 3GWGA 4QNRA 4RDHA 3REQB 3A7DA 1T3HA 3SKXA 5KINB 4FDTA 4I1PA 1YVEI 3CC8A 1V96A 2HREA 4GFDA 3N70A 3OQPA 4G0XA 2I8LA 2GYUA 2EKBA 1YUNA 3PR2B 5HBRA 3PNVA 2VP4A 3MMZA 3EC1A 3KJFA 4BFVA 3LC0A 4CCAA 1JQ3A 1ZSNA 2NSHA 3OKCA 5K3BA 2GF2A 4NNJA 4DJDC 1WZ2A 4MR9B 1ZHOA 1JA0A 2JD0A 1USKA 3FPJA 1QMGA 3L4EA 1Z28A 1CVIA 4UZEA 4F1WA 2C8KA 3BDIA 4TMZA 2HXYA 1FFXA 1N2OA 1V3VA 1ZH8A 1XMPA 3PC6A 5BSGA 8AT1A 3PC4A 4U7PB 4HT3B 3OEWA 3CR7A 3SSAA 5ARDA 1C3EA 1BRTA 4RD6A 4CU5A 2AVDA 2HNKA 3NORA 1QGUB 3G8BA 3BERA 3LYLA 1FNBA 3NHAA 4I2VA 4MEJA 4RXMA 3W9SA 4L7QA 3ZHOA 5FUVA 2OXCA 2FPIA 2YR0A 1HGXA 3PNLA 1V2GA 3R40A 4G9GA 1F51E 1JHOA 3NNDA 4RA6A 6CHYA 3TTVA 3PQDA 3HCEA 1ZQ9A 1YCGA 1OKKA 2B4AA 2HMTA 2KI5A 2LIPA 3GCZA 3MWLA 3Q3CA 4ECAA 2FY8A 3H9GA 4U2DA 2WD9A 3GRKA 1E6EA 4YLGA 1CUSA 4KR7A 1R0KA 3BN3A 3A1CA 1OX4A 2J5KA 3W6OA 4B84A 4B6EA 4NXMB 4RUKA 1C3XA 2DFLA 1MLDA 3G6KA 1PJRA 3WIOA 1VMAA 2H5EA 3QZUA 2G06A 4DXDA 1FFSA 1QGED 2YW2A 4JGGA 4OHXA 4IY1A 5B5SA 2O8BA 4MTCA 2X4IA 2XIJA 3CVUA 1CS0A 3NPAA 3M8KA 3M6XA 2HJVA 1CYDA 4FPXA 4HADA 5ANRB 3RKRA 2IYOA 4TLEA 3PIIA 1YVUA 2ALJA 4MARA 4NI5A 3ZU2A 3IH5A 5JSKA 5CX1B 4ERNA 2BR5A 3RUDA 4F12A 4XIJA 1E3SA 3WLSA 4ZVRA 3IP1A 3K1JA 2Q5FA 2D13A 5HSGA 3VNUA 3KZCA 3OCXA 2CLFB 2WZBA 3WRXC 1P29A 1XPRA 1YBFA 5KQGA 4N0EA 5E6RB 3LD9A 1O4WA 2BDTA 3EIUA 4MB6A 4XIIA 3R7FA 5JFTA 1GRNA 2R5WA 3G85A 3TLBA 1LDEA 1HLFA 3B9BA 1NMYA 1ODTC 2I6FA 3ETLA 4YUVA 5U9CA 3MA0A 4EB3A 4O2AB 3D3JA 4H7HA 1Z4LA 1JIIA 1ORTA 5KTSA 3VTZA 3SVLA 2FHSA 3NO4A 5TJHA 4A2CA 1L7MA 5CGQB 2BGTA 2A86A 1JW9B 4HY3A 1LVHA 3PPYA 2CCKA 1SUWA 3F49S 1S2MA 2DLDA 2VA9A 2HGZA 3MBKA 2JFHA 1UDCA 1I6WA 5CPBA 1G21E 2ZJBA 4PTZA 3DDHA 4MYDA 1KY2A 2JH9A 2N0SA 2PX5A 1Z15A 4PNEA 5JZSA 3V8BA 3QX7A 4LZZA 4WXMA 3GFVA 3LVFO 1ZJ4A 1GTMA 1JMKC 1PT7A 2BEUA 4OQNA 1Z7EA 3F9CA 4REQA 1BD4A 1GD1O 2BM0A 4HYYA 1SBIA 4XM0A 4D44A 1FMTA 1U1IA 4TS4A 4BLTA 3CRW1 2IIBA 2RH8A 3GHYA 4R1LA 4RH1A 1QWSA 3TRFA 2BJWA 1QHHA 1P1HA 2GDZA 2Z5LA 2I1LA 3N5CA 4HGNA 4RF3A 5IASA 5CFOA 3UEOA 5D6OA 2FLKA 1RWVA 4CQNA 2QMEA 4N6GA 1NJ5A 2RGNC 4FSHA 3ZGNA 2AG6A 4Y2TA 4AYWA 4PNHA 4AMGA 3FROA 1DRKA 4PV7A 3HNPA 4X71A 3WO0A 2CVOA 3U44B 3RI3A 4ZC1A 2ZVQX 3MUFA 1WSDA 4R3UC 4HDNA 4DRZA 4MS4A 2GILA 1BE8A 2WE7A 1I4WA 3OHMA 1H23A 1AZTA 4TL7A 4DV1B 4WBNF 1A95A 4QOSA 5F9HA 4BU0A 1G20E 3L8ZA 2YMPA 2I4TA 3BH7A 2BGLA 2GDJA 5EIHA 2VAXA 3ZC3A 2QGFA 1DP4A 1E1RD 3HCBA 1JLLA 4BQEA 3NIDB 3OFSA 3WOHA 1JU4A 1L3IA 3D6NB 4OHPA 5HCNA 3L8GA 4FE3A 3CRNA 1NFQA 1UBJS 3PZBA 4FYYA 5JHHB 2H7YA 2BFBB 1CUWA 2V4ZA 3PGKA 3DBHB 2CT8A 1CQXA 2EARA 2KSQA 1T2CA 4HQ0A 5AK3A 3O2QB 4UEQA 1UKBA 2N1MA 6PFKA 4DV6B 2YOGA 3HABA 2QRVA 1C4WA 5C46F 3VMMA 3I2KA 4G5HA 2BFAA 2XOXA 3MHPA 3SM9A 4A5SA 1Z5UA 3SR3A 1X7DA 3JQ6A 4O59O 2QX7A 1YZQA 2BEWA 1X15A 3QXJA 1M72A 3F7MA 3FUXA 3M4NA 1IZZA 2GK7A 2VDVE 3UT5B 3WRYA 4BMOB 4E5KA 5BPFA 1C3OA 3LP8A 5HRUA 2RHOA 2Q7DA 1R8XA 3DVLA 4NENA 1X9HA 3SEQA 4KXFB 1T6BY 1XEWY 3LY8A 1SBQA 3OZVA 3N74A 5FJJA 4DYVA 4EY6A 5DHUA 2DPLA 2PUGA 1RKXA 1N5JA 2MTBA 1ZU4A 1NC1A 2C58A 1OWLA 4MA5A 5I7EA 1ZM9A 3I42A 2EQBA 3N59A 2ZSIA 1NRJB 5FO0A 1WW2A 3L43A 3ZHQA 3ND6A 4YJKA 3ZWVA 4R7ZA 2X23A 4HSEA 4KZPA 2EX0A 4RANA 3CXUA 4IV0A 2J0SA 1QQ5A 2FOIA 2F43B 1C4XA 2PL9A 1XJ0A 3PGA1 3ADOA 4ZZIA 1E8MA 2X41A 3Q4GA 1JGTA 4ZT6A 2VQFB 5NULA 1EFUA 4PGMA 2C7BA 2DCMA 4RZSA 1L7OA 2XY4A 5B37A 3PFFA 4FILA 1E8NA 3V5NA 2YKGA 1IY9A 4FFVA 1FYWA 2XNKA 1XKQA 2PNJA 1S2GA 1R6DA 4W5TA 3CG4A 1ZVQA 5ICCA 1XDUA 2A5JA 2ZRHA 3IQWA 3VV3A 4EY3A 4GMDA 4BYMA 2WMDA 3J7AC 3W9BA 2CFOA 4YDHB 3NASA 3DTTA 3FYUA 4RO0A 3DWFA 3QTLA 2O23A 4AY4A 2Q5EA 4XB1A 3U1BA 4JWTA 4RBNA 5BN5B 1W5SA 2JGDB 3MTGA 3OFJA 1OXXK 3EC7A 1XI2A 2DKFA 4YT5A 2WHPA 2OHFA 3UIEA 2G1UA 2E89A 2R86A 2XDWA 3OX4A 1T2UA 3TQRA 3RASA 2FJ0A 3T5BA 2OSBA 2L19A 2VRNA 1OHHA 1I2ZA 3EQ9A 3ETHA 1JIVA 3FDIA 1AS3A 1B76A 2IYQA 3L7IA 3RYHA 3A6ZA 3ZWXA 3N6XA 3QX9A 4R31A 1UBMS 3UTCA 4UULA 5DH9A 3THYA 1Q7BA 3BORA 3QG1A 1UH5A 2RB4A 1A4UA 1XZLA 3JX9A 2H54A 3VC3A 1YZHA 5FBRB 3W77A 4ZYZA 3E1SA 1KYYA 3CKLA 4YJFB 1H4TA 3SJCA 2IHUA 4MGIR 1DC5A 4NCBA 2A30A 2ZULA 1W1UA 4OXQA 1TZBA 5M3BA 1SY7A 3WL4A 1VE7A 3OM1A 3U4IA 3ZCVA 2BFCA 4CMBA 1Y6GA 3UK2A 2IXGA 5J2UB 1P74A 4BQFA 3MCZA 2GFIA 5L4SA 1J24A 3H2ZA 4DT1A 1JPJA 1P72A 2CVZA 4JLBA 1H5NA 3OPNA 1RPTA 4HQKA 4TTQA 4IDDA 3W6NA 1NLYA 4YRLA 4BKQA 4BO2A 1XRNA 3AV3A 3KEOA 3LFTA 4N5MA 3ZD7A 2ZWMA 2IYNA 1P7WA 2FSPA 1A8UA 1HDZA 1YK1A 3G7NA 2V03A 4ZZ2A 4PWZA 3HB9A 2F90A 4CNBA 4Y6PA 3EEBA 5IAJA 2P9EA 2EP8A 1QG2A 1YL7A 4AWAA 5K4HA 2UZ1B 3OT1A 4MP3A 5DN9A 1F7VA 2BR4A 1NA5A 2Q5CA 2QP9X 5JJIA 2O0KA 3CZQA 4M1EA 1G1AA 2QUBA 3HHPA 3TOZA 1CJMA 4A82A 4B7CA 4JUDX 2IHTA 1E96A 4ZVMA 4YFVA 4KITB 3PWKA 2ZS8A 1K06A 1PT6A 4KR3A 3S1AB 1NVAA 4X92A 1Z8HA 2NXNA 4EZEA 1DPFA 1NAHA 1RWXA 1UP6A 2IYZA 3A36A 4X85A 3RS7A 2IHKA 3KZVA 2BFFB 5I7VA 3AJ9A 2WJWA 5FWAA 3W1EA 1U9ZA 2ZXFA 1T8PA 2JRCA 2XTZA 3ILSA 4P38A 4HBZA 4Q4JB 1ANKA 4ARSA 1WUKS 5KTPA 2FEAA 4JUIA 4PRYA 3BREA 2QZ9A 4RWEA 4WVFA 1VBKA 5DE3A 3AT1A 1NW8A 4LDRA 1RYFA 4BEJA 1QQTA 4UM5A 4F3KA 3QXGA 4QTZA 1NVMB 4L8FA 3UH1A 5FOXA 3WBKA 1N5DA 3FRJA 5CBKA 3OY2A 4S0XA 4DZZA 4FKZA 3MS7A 2Q2VA 3T0IA 4G4SO 2NQTA 2NSYA 2NV6A 2QAGC 1RI2A 4QHYA 2I1WA 1NOIA 1ZHHA 3RRBA 4IGIA 3IR5A 3KLNA 2O5VA 3PJRA 5DPMA 1QQ6A 3EPLA 4JLNA 4DLTA 1AURA 2R7KA 3JD0A 3N0WA 1SKUA 1UPAA 1Y9JA 1JSXA 1ZO8A 4K9MA 4W1QA 2A88A 3I0MA 4LHYA 5TGTA 3UHPA 5AW9A 1W5FA 3M3DA 1ID8A 3JQ8B 4OA5A 3WWEA 4O1MA 2PT9A 4QFDA 1OBOA 2ACEA 4YRCA 3KQKA 3ZE8A 3QKSB 3FNGA 2GJ4A 2AKAB 3IT0A 3U48A 4ZV7A 1IY1A 1LDBA 1VPTA 4L6CA 3PHGA 4FOLA 4Y0NA 5J9FA 5JADA 1AMOA 4EB0A 3IBTA 1UKAA 4Z5XA 3UMYA 1PR9A 1CVRA 1FL9A 1Y33E 2W93A 2Z1DA 3LQQA 1U1GA 1FQWA 2R8BA 3NOOA 5JAMA 1A77A 4UUOA 4JJIA 4XCVA 2GF0A 4OLFA 3NAMA 4X1KA 5CVEA 5TEWA 3SIWA 1GIAA 3EARA 5C4MA 1KMNA 3W78A 5BQFA 3R5HA 1FP2A 2PYZA 3HKDB 3VJLA 1O7JA 2BEKA 3OKFA 4ZI3A 2R7AA 3HKCA 4HWGA 2VS1A 3A9RA 1M2VA 3HVRA 2OV1A 4R98A 3GGGA 5CEFA 5DXAA 2JFOA 1A2BA 1E1QD 1MQSA 4QXOA 2HU8A 2Q4OA 4MHOA 4E2YA 5HVNA 3A10A 1G5FA 2OYSA 2PXCA 2QU7A 1QVZA 2BSAA 4N49A 2VHZA 4V0LA 3QVVA 3RTDA 4PR0A 1DEOA 1DX9A 5B3KA 2AUMA 4RPLA 5BYJA 1O9GA 1SCUA 3K94A 3F2IA 3PNMA 2AHRA 2XQKA 3WGVA 2QG6A 4UBKA 2D00A 2HWXA 1R74A 3S6JA 4GM0A 1FP7A 3HU3A 3JZDA 2GM3A 3Q3EA 5H3HA 1Q0SA 1JE1A 3UWMA 1Y3IA 4I5FA 3SE0A 1AKNA 4BWGA 4YCLA 2D4HA 3AVWA 2V9PA 4DDTA 3KBBA 4ZALA 4AQ7A 1NFRA 3QNWA 4H9GA 5AK5A 4G01B 2I7VA 1SNYA 1LTQA 2X5KO 3LT4A 2CUKA 4IDHA 3E9DA 3I30X 1I7NA 1KZ4A 2P9TA 3PRKE 3NH6A 1YKFA 4L9RA 4MKIA 3V1TC 1IAVA 5F5LA 1KZHA 1D0VA 3L6BA 2FN7A 4WZAB 3H19A 3WOVA 4JKIA 2OP1A 3OSUA 3S99A 4NBRA 1O6FA 4OJTA 3RS0A 4XUGB 2JFVA 4GBED 1EZZA 1V9SA 3DXXA 3WV5A 4UUMA 5KEIA 5AM0A 4OVKA 5CR9A 2PLWA 1BDBA 2NACA 3C5WP 4A6XA 2P9BA 4ZREA 1Q44A 1U0BB 2DTXA 3QOFA 4ZVLA 3SVZA 1N3YA 3GLIB 3LXRA 4AN4A 4EFLA 3LCUA 3KPYA 3GFSA 5LDGA 1ULHA 4QOEA 3ACDA 1C1YA 4GE0A 3WK8A 1RYDA 4MR8B 4L0QA 1F9EA 2E85A 5EMHA 3ZZTA 2ATEA 1R6AA 1SEVA 1AKMA 1JQDA 3OZWA 5GQSA 2V3VA 4EQZA 3D3WB 3Q3JB 2HMUA 3OF3A 2RHRA 1PGPA 4I14A 3UJNA 3EGXB 1G60A 1WDLA 4D81A 2B8EA 4MGHA 2ODBA 4UEOA 2VDQB 4TS3A 1DGQA 4CTKA 3LQYA 3PE4A 2BFDA 3F3MA 5EPOA 2HPHA 2VP3A 4LYJA 1BDMA 1E64A 4PPYA 4E5YA 3ZI7A 3IDZA 4TLDA 2IE8A 2UYYA 3EF1A 9GPBA 2V7GA 3CO0S 4Q7QA 3NJ4A 1ZNZA 2H4XA 2NYUA 2REBA 5J1SB 2LBPA 2Q8PA 2FPXA 2V7QD 2ZIAA 1V9CA 5IP5A 3WICA 3CVWA 4CMIB 2XCRB 2WNSA 3H5AA 4YAEA 3IIKA 2EZ4A 4L50A 4PX5A 4Q4AB 1SVWA 1W52X 5FYDA 3RE1A 1Q1AA 1TECE 4B3RB 2IZOA 3I64A 1T9AA 4RGVA 1XMQB 2Q3FA 4RM2A 2PGNA 2XQGA 3VOBA 5AW3A 1U6IA 2X58A 1KK3A 2QVXX 3FB4A 4KFTA 2HU5A 4LMRA 4DYHA 2AKYA 3C8UA 1A96A 3DE5X 3KHKA 1BDIA 3W5UA 4A0HA 4TPKA 1ZUIA 3JWHA 3JW8A 4BB5A 3M6WA 2FZEA 3E7WA 4XW2A 5C1OA 2DSNA 2JJ8A 5F77A 4Q9DA 4QUHA 4F21A 2GJ9A 4NIMA 5FA5A 2HRZA 5ALLA 1XTUA 4GVXA 5HCIA 3EJWA 4X3PA 5KYXB 3QJYA 1EFHA 2OO5A 4FDLA 5JNTA 1N36B 1G5IA 4E5SA 3WGJA 4U39A 4KX5A 5FORA 3Q98A 4Y6OA 1AS2A 4FBGA 1LC0A 2HQRA 4F9FA 2GCOA 5LWHA 2ZK7A 1YCFA 1S4MA 3GCXA 1H05A 1HA3A 3LOUA 1G20B 5A7GA 4Y30A 5CFLA 5JRDS 2B6HA 1UM9B 2PLFA 3CX8A 2J3JA 5CNJA 4F38A 1K2WA 1WBDA 4CHTA 1SHZA 4MUNA 1DEXA 4ARUA 1CRZA 2XB4A 4KO8A 3UANA 6REQA 2EWVA 2H0RA 3IR6A 1QE0A 2ZDGA 3AFOA 4X60A 4COOA 3P0EA 3O0TA 3SXUB 4PSAA 1DCKA 5KYYA 1DHRA 3H97A 5I9BA 3C5CA 1T0PA 5AVZA 2AFVA 1CCWA 3H2HA 3SFTA 4CTOA 5I7WA 4FVTA 4M1ZA 3REQA 1O94D 1P0FA 2JIOA 3DWIA 3RNLA 2I99A 2UZAA 2HADA 2B4YA 4Q3EA 5G53C 2FUNB 1TEXA 5HMLA 4BJ1A 5KKCA 5EL0A 2YS7A 3B2EA 1P77A 3AV0B 2OZLB 1F60A 1CXZA 3GUZA 3IMGA 2H1CA 1KTVA 3NBMA 4HMOA 4RPCA 1NQTA 3FM9A 2AWOA 2FR0A 2VPXA 1EP9A 3QOWA 5GONB 4H3KB 4M98A 4N7BA 5L6MB 1UFKA 3BGOS 4MR9A 4MRSA 5CFRA 4URYR 1DDOA 3DONA 4OXNA 1ONNA 4YWHA 2QZJA 4CODB 5HJEA 3TR6A 4XWKA 2YH2A 1UQRA 5DDIP 5DX8A 4CTNA 4R8KA 5LMUB 2QLJA 4COKA 3VZDA 4LPKA 1QGUA 3B9PA 2VP2A 1PN3A 3SBDA 2NTYC 1Z4OA 1PR5A 5HF6A 1QTIA 2XV1A 3QM1A 3JQCA 4LZNA 1OFHA 4DDHA 1YI1A 2NPOA 1VZ3A 4M9QA 1E3JA 1LBSA 2WF9A 1EZ1A 2ZSBA 1E6WA 2RFLA 1W5AA 3FJYA 1C1XB 2IEYA 3WVNA 4X91A 2JGRA 4NOLA 3UICA 4P33A 4MRRA 4PNZA 4W4TA 4EYOA 1NY5A 1MVLA 4TUYF 4LZOA 1QAOA 3AHCA 3X2EA 1T5SA 4JI8B 1D6MA 5DX0A 4MAAA 4X90A 2Q6OA 2B36A 2YUTA 3NIFB 2OV2A 4WEQA 4EFKA 4F45A 1CR0A 1LBIA 3HZOA 4E2XA 2FK7A 4V0KA 5TVGA 2UVQA 2IE0A 2REOA 4QYSA 4DC1A 1EHYA 1U8YA 4OYRA 2ZWIA 4DTCA 4R2JA 2JI4A 2FF7A 1AGXA 4Z4EA 4ARAA 2Z1MA 1FRFS 5DCYA 2FP4B 2XE4A 3KXKA 4KXUA 1OIXA 2PGXA 1DKNA 3BTUA 4RHFA 1YB6A 5CX1A 2GEFA 4DBLE 4DM7A 3COYA 2XYQA 5FWDA 3NBUA 4J8PA 3OT4A 1FFBA 2B4KA 2XOEA 3MJRA 3IDOA 3KQYA 1ITZA 4KK3A 4NBKA 2ZUBA 3VVBA 3I37X 4E5MA 4LVUA 4UMFA 4DR2B 5E6RA 1A9SA 1UBFA 3CNOA 1NNEA 5AFSA 3S29A 1KFBB 4F5WA 2Q3HA 4B6JA 1E9SA 1L9KA 1M6YA 2GS9A 4ZPJA 2F8TA 4QJ5A 3NR2A 5GVRA 4ACAA 2EKLA 1GN8A 2H17A 2YTZA 1BHO1 4O2AA 4YAFA 3CRQA 3FX2A 1MAHA 3GEGA 1FFCA 3HUTA 3QPVA 1BTOA 3WLQA 5L3VA 2QTCA 2WK1A 4R4JA 1PDVA 4XX0B 5JISA 4HDOB 3OD5A 1IL0A 4RTMA 1OTYA 5J2TF 3JWEA 2HEIA 1QRDA 1YZGA 3KQVA 4DA9A 3QJ5A 3G2KA 3H42B 5LXTF 2VJQA 1DMSA 4ACBA 4LJ6A 4S1NA 4IIFA 5JJBA 2CFCA 2NVWA 3T1TA 2ANBA 3NG1A 1KFKB 1LJLA 1U02A 4I4TB 3QE3A 4K9QA 5EUCA 5HKBA 2XZOA 2R62A 3TR0A 1M1YB 1W59A 4GPBA 2P1DA 1FBTA 3STVA 3EJ6A 4AY5A 3MHTA 1P4AA 1QGZA 1I0IA 3CNEA 4D9IA 3AOEA 3DPSA 4QYXA 3ZQKA 3HA5A 4JJ8A 1UZNA 3PI7A 1MQ8B 2GEVA 2ATIA 3H5WA 5DSXA 4FFOA 4AY2A 3HM9A 2HDWA 4KFUA 1JMYA 1U65A 1L6RA 2HWYA 5IDQA 5LD2B 4JU9A 1FRZA 3BWYA 3CU5A 4W5OA 5KVAA 2ECQA 4LUCA 3AR2A 2WAAA 3PFIA 4O63O 2IQIA 2SHKA 4R2HA 4DCCA 3C3JA 3BTSA 3HKBB 3M0EA 4B79A 1H22A 3C7CB 3U44A 1L5SA 5JYBA 4Y67A 3ND7A 4JIMA 4YRDA 3VH1A 5I8ZA 1SIUA 1NF2A 5LZ9A 4PLWA 3JASB 3P4UA 4UNPA 1U3GA 2B2CA 2NZ2A 4JA0A 4LKRA 4Q18A 1U1DA 5DNEA 4Z7JA 3I72A 4ZFNA 3RYTC 3ZI4A 3Q8WA 1E66A 1V6AA 2BDEA 4PANA 4QFCA 3GMDA 2GJSA 4OKIA 4EGQA 5EAIA 1UXGA 1EWRA 4MUGA 4BU1A 1NVEA 5DLYA 5AVKA 3T1QA 5D01A 3U7GA 3W90A 1QHGA 1VTKA 3GZJA 4Y18A 4Q9KA 1IJBA 3NV7A 4PBRA 5IK2A 5NLLA 3SX2A 3MGGA 2P5TB 3PGMA 4JS0A 4A0FA 4AAYA 1DKLA 3SXPA 1MTOA 2W70A 1KDZA 2BFBA 1ZIDA 1NQAO 5DN6D 4J6FA 1M2WA 2CNWA 4UU8A 1XDGA 1AXGA 1ZDMA 3DBHA 3KOXA 4XR9A 1PD1A 3RFXA 5DW3A 1AD2A 1AU9A 1OPRA 5BT9A 3BFXA 1UPBA 3H65A 3IMEA 3DEZA 2NT4A 2HYDA 4UVIA 2KPOA 4KQFA 4WOKA 3DYBA 1Z4QA 4PINA 4PSCA 4PYKA 4BNHA 1T15A 2O2EA 2ATXA 3NTUA 3QELB 2HA2A 4MKRA 5D51S 2YHUA 2VHTA 1VLZA 1YF3A 1FA9A 1M5TA 2K2QB 3OOYA 2P1ZA 5INTA 1XC7A 2PE5A 2BW0A 2ODQA 4WL0A 4G8JA 2YNMA 3UT5A 5ICFA 2OCBA 2Q8QA 3R76A 2N46A 4EG6A 4UU0A 4RFSB 1SXJB 1H3NA 2J9XB 1W36B 1NW6A 2FR8A 4J0GA 4DARA 4ENRA 3KTOA 3VZPA 3A9UA 1E0SA 4I4CA 1B26A 1ULTA 2WPDA 2QTRA 3BIJA 1CFJA 1V48A 1ILWA 1ZSVA 2G4VA 2H48A 2YW9A 3O1HB 4L1KA 2CKMA 4OQMA 2NUPA 1G8KA 2NLOA 5EE5B 1SA0B 4NFLA 3HR8A 1UBTS 2R79A 5BSFA 1KJYA 5K03A 3GNTA 2WRZA 2OG1A 2P7IA 1Y6JA 1QBGA 2AS0A 2RG1A 2ZRLA 2R11A 4M0FA 4EO7A 3VSDA 3U80A 4YRMA 1TAGA 3FB1A 4DBZA 4L07A 4QLBA 1SG0A 1MB2A 4MRMB 2F43A 2H4YA 1GGVA 5H81A 1NSTA 3HCFA 3JYPA 4RFLA 5BV2P 1R5OA 2B5OA 1TAHA 3PWSA 5K0EA 2PZBA 4NP6A 1K08A 2ZJOA 2R65A 4AO7A 3ZHZA 2QLMA 1LW7A 3EA5A 3C8ZA 1UJ4A 2JCYA 1WP9A 4DCUA 9LDTA 3S1SA 3NW9A 2HA5A 1EWQA 3FWKA 4G07A 5B1SA 3MYYA 3LQKA 3WFIA 4B3DA 4ZI2A 2EIXA 2P3LA 3L6OO 5I5GA 3ZWNA 2PH3A 4JLJA 2GHRA 5C1IA 3R3XA 4OQLA 1QO0A 4Z6KA 3NVAA 1QHXA 4L5AA 5JZMA 1JI3A 3ENKA 4Y2YA 4RDCA 4GOKA 2JGDA 5HILA 5BN5A 1WUYA 4UEKA 1XEWX 1NLZA 3B1YA 3UPDA 4CCYB 1SHTX 1AUXA 3QNMA 2VYVA 1BMFD 5AOAA 5ECDA 4LDJA 2P6MA 1EB8A 3G9TA 4O0MA 3U6KA 3DS8A 3ZCTA 2UXBB 2C92A 4EHDA 1KFCB 3QE4A 4J9UE 4MDYA 3ZI0A 1K7SN 5F2OA 2BM8A 2GRAA 1V16B 2HBQA 2Y6VA 3DV0B 3FOWA 5DWQA 3LDUA 5BVHB 3AI1A 5BV7A 1TZKA 2QMZA 4ZDJA 2Y4NA 1OFUX 1MW9X 3MT8A 2ZVDA 3BF8A 3BIOA 4D9EA 4FZRA 3Q3IA 1IM2A 5CNMA 1JHRA 4CQMB 5GMOA 3JARB 1KETA 3GA7A 3ITKA 3UK1A 1E5TA 4ZT3A 4KOEC 1RPNA 2FR1A 5ELMA 4ZAWA 3UYLA 3WMFA 4DLZA 4YMVA 3EDYA 2WIFA 3BOSA 4OM7A 1VLJA 4XA8A 4DMMA 1U9CA 3IE1A 1SXGA 4FZJA 3T1NA 5HIAA 3OPXA 2WWRA 2YINC 5DRYA 1ZUNA 1GQRA 4GG1A 3GYBA 4MYCA 1P2BA 4N3AA 5J2UA 3WGUA 3JALB 4F93B 1C8VB 2O7VA 5SV2A 4URHA 5B55A 1QKIA 3G7SA 3LH5A 4IR7A 3I9MA 5D7BA 1CK4A 3Q9NA 3LFUA 3JQBC 4FKMA 4FMDB 2GHTA 2Y1LA 3BXPA 2QRZA 5BV0A 1M7BA 2ZI4A 2OBFA 2I71A 2FWBA 3Q11A 4G4JA 4GM4A 3LUFA 2Q50A 1J0DA 3G9XA 3LY5A 3SHQA 1XQ1A 3NOVA 1JT2A 2FW1A 4XPZA 2UZ1A 4Y6QA 4D74A 2YYZA 4GX0A 4ZMBA 1B3BA 1YE3A 2KJQA 2V98A 3E5RA 5LPNA 1L8QA 4W7HA 2WIAA 3SJAA 4WCDA 3TNLA 3CE6A 1G0OA 2QHXA 1ICEA 3IA2A 4G84A 4BO1A 1EBFA 3WBFA 3PU6A 3G68A 3Q9SA 4DIEA 3ZU4A 1ZQ1A 4OSEA 2I7TA 4TL8A 3S1AA 5ISMA 2BZ0A 7REQB 5REQB 4D7AA 1BMTA 1CZNA 3GFRA 4ISBA 4HAVA 3AYZB 3MJEA 3DLBA 1K27A 1B2RA 4KCGA 1Z56C 3FSEA 4D5GA 3MW8A 2BFFA 2QE7A 4JY7A 3X0DA 2EFJA 3X1JA 4CL8A 3VR2D 4Q4JA 4B3MB 3KBOA 3ETGA 3PC8C 2FOLA 3LQ2A 4ZOCA 2H1HA 4WUVA 4WDRA 4K40A 3BSWA 4RPJA 1L4FA 4BC1A 4PONA 1O87A 1CG6A 3UMMA 1L4GA 1CQJB 2J08A 4WLVA 5KHAA 4LJ7A 4Q16A 1P9WA 4U6SA 3SYMA 2PK3A 1NY6A 2H4WA 3HUEA 4BMYA 3E05A 4UQPA 3FHOA 5ADVA 3A37A 2C78A 2F48A 4DGSA 4ZIRB 4AICA 1HG1A 4NRDA 4R0NA 3R3WA 1ZD4A 1VE1A 1FFHA 2H7XA 3CNNA 3UJ6A 2P9GA 3H87A 3HXMA 4MCHA 1QLWA 1XE3A 1KO7A 3JQ8A 1U80A 4J0KA 2AJCA 2VJBA 3A1NA 2GXAA 1WF6A 3PLNA 2GEUA 3HWWA 2VSXA 3K9NA 3QKSA 3ZGZA 2HY7A 4W99A 1DIOB 1PV4A 5IHXA 1M8JA 2R60A 2WYIA 5EXTA 2CCJA 4F72A 2ADFA 1DIGA 2V54A 4DR1B 1EM6A 2AHOA 3PVCA 1UOPA 3NWEA 1QIKA 4A9AA 2JFUA 3BRQA 2O4UX 3G1WA 4I5EA 1WDTA 2BH9A 3CXRA 5BQ5A 1NJFA 4FDAA 4DMRA 1N5IA 4UNRA 1WUJS 4D8VA 3TFOA 1EI9A 4JI5B 1M6EX 1RXEA 3AUKA 4R0VA 4PQEA 4RGQA 3JAWB 4GL2A 1RCTE 2BE9A 4NMWA 4CV0A 4J1TC 621PA 2IYTA 1P7PA 3SZLA 2PS1A 3HKDA 1PS8A 1MBZA 4GR9A 1WZCA 2ZAMA 2EFDB 5JD3A 4TL9A 3VPFA 2IS2A 3H5RA 2Z4TA 4NZPA 1G9TA 1H9BA 1UT6A 2GESA 3FPEA 4OU5A 2QRJA 1HE8B 3C6YA 3M5CA 4WCVA 5IDXA 5L95A 4RENA 1QR2A 2G4LA 5A3RA 3KUUA 1UCFA 4JWKA 3HPRA 1WY7A 4XGIA 3A0UA 1U2QA 3GPCA 3M83A 4C4TA 4EO4A 1D5WA 2F4NA 3QX3A 2WJIA 1Z2CA 3R0ZA 4P2GA 1TK2A 3KZ1E 3PXEA 4BFZA 5AVSA 3I01A 4NEQA 1SQSA 4NG5A 4RAQA 1SO8A 3SJUA 4JC8A 2YV5A 1SKBA 2GN8A 1Y6QA 5FO1A 3LNTA 5EN4A 1SCBA 2IV7A 3S0JA 1FXUA 2P69A 1W4ZA 4FYIA 1J4AA 4RTKA 3WIUA 2R00A 2PMBA 4JXZA 3DCIA 2ZBFA 3AB8A 5EJEA 1VYUA 1SU4A 4EKYA 1Z68A 4CF7A 1K4KA 1SKAA 2BJVA 5IJ0B 3PHJA 2CF5A 1O58A 1GY8A 4EMTA 3N39C 4K81B 3RVNA 3KO8A 2GK3A 1N92A 1KDRA 2QPOA 5J63A 2I91A 1LPOA 2W9XA 3I04M 3VPXA 3N28A 1H66A 3AF4A 4CG2A 3DMTA 4N76A 1WBBA 3UK7A 5DNYB 2ZG6A 3RW9A 2HJGA 5AKLA 4FQ5A 2ZUSA 4FHDA 1G17A 1OA0A 3FG9A 5K3AA 1GT6A 1QFYA 5A4AA 1Q6ZA 3LZCA 1SHKA 3FPLA 1Z0IA 2YWBA 4GUDA 4LA4A 3WK4A 5BUCA 5L45A 3U60B 4CKEB 4GKKB 5A62A 3G17A 4IDQA 2WU0A 4UPEA 2GLXA 3ZX4A 4Z1MD 2GX6A 2H52A 8LDHA 4JZKA 3CTMA 3D1LA 4MCJA 3GLIA 5B7PA 2VBGA 3KOMA 1JNXX 3R6LA 3ZWBA 3AYXB 2YVUA 2O14A 3BD7A 3QIAA 3C45A 3VR6A 4DABA 4MR8A 5BRAA 1IHPA 1QVVA 2RHMA 2OZEA 1PWEA 1KJZA 2B7CA 2PL5A 4FD2A 3Q8KA 4G5QA 4F92B 4HEA6 3D02A 4NBUA 4ND3A 3IVGA 2QMHA 3D3WA 5EP4A 5BSEA 3AJEA 4LYAA 5JC1A 3HR4A 1U90A 4J43A 3U26A 3W2HA 3M4YA 1Z6PA 3AG5A 3WQHA 2RKBA 1ZJYA 4J29A 4OHWA 3V4RA 1SELA 1RPJA 4HAWA 3VJRA 4LJLA 4AXBA 4DFDA 5GOZA 2VRCD 1L7EA 5H9WA 3G0GA 4K05A 4B4VA 1ZOOA 4AK9A 1LDNA 4I99A 3S44A 1Y1KE 5AK4A 1VP3A 1I6MA 3AR7A 2G72A 4MX8A 2J6HA 2AG1A 4M9ZA 2NO1A 1RQGA 3RRZA 3C7AA 4JJ4A 1OXBB 3WBBA 3CHYA 2BMEA 3LOQA 2VBCA 3BE8A 3ZBQA 5B3LA 2C83A 4CMIA 5FUQA 1MJ5A 2RBGA 5KQRA 5LIPA 4Q4AA 2B1IA 2OCKA 3D4LA 4WH0A 1HNWB 1LPSA 5FR1A 3H2SA 3JRWA 1X1DA 2R66A 2C3UA 4P4TA 3C16C 4CM4B 3TE7A 1Z62A 2TS1A 4BRSA 4Y2UA 4MVXA 3GHHA 3OTIA 4I50B 4O1IA 1QNLA 2QN1A 2VBFA 1CJUC 1C80A 1NVVR 1VHLA 1WEKA 2QM7A 3CMMA 3G2OA 3FE2A 3IVXA 1H8EA 1DAKA 1JP7A 4KIUA 4D4HA 5ARBA 3V8RA 4ESHA 2HSJA 5AW1A 1LPMA 2VZ8A 2WJJA 1RRMA 3FTQA 1ULBA 2E4UA 4E11A 2B69A 3LSYA 5EXXA 3BIFA 4NHOA 2WWVD 4N7RA 3ESAA 3I12A 3MCVA 5JU6A 1FY2A 2QVCA 2QSJA 3SI7A 4G2NA 4D4KA 5ABPA 2RE8A 4H18A 3IEVA 3TAUA 5D3KA 4DZTA 2I2CA 2HGSA 4TXNA 2Z9CA 1JYSA 5KYXA 3GH3A 4URUR 3L18A 3UFBA 4BO6A 2ZWVA 5I4IA 3W3AD 4OJNA 4AG6A 2WWFA 4LVOA 1N0VC 3ZD8A 4DUPA 1P1FA 4RNDB 3ACCA 4U2EA 3VPGA 2JHCA 3TBHA 5F5XA 4IHAA 3TX2A 4BGUA 2E5WA 2Y66A 3NANA 2RAUA 2FDCA 3WTCA 2GVZC 3AEQB 2PEYA 1G20A 2IEZA 2CUZA 2FSGA 2C84A 3IOEA 1UM9A 5DF1A 3VJKA 3WC4A 4J2TA 3ZE6A 2AQIA 3I5XA 2XVZA 5EJFA 4KVAA 1Y8QB 4FR5A 9ABPA 4MVJH 4YMUA 3NEJA 3WLIA 4FOTA 1W581 1E89A 4KR9A 2ZWAA 5I7RA 2OXRA 1B3RA 1ZEJA 2QN7A 1REQB 2X5XA 4U8HA 2HCRA 1EE9A 2DR0A 1XFDA 2CBXA 3SXUA 3GD7A 3QUBA 2DWCA 2EF0A 1Q83A 4R8RA 4RA9B 5AKGA 5ALYA 2Y77A 3C3MA 3OE5A 4QUBA 4BMCA 2C9ZA 4P58A 3A1UA 3D8SA 1XQ6A 4IVRA 1IATA 3HNRA 3ID6C 3ILYA 2AMLA 1ZH4A 4MXDA 1F2VA 3OMXA 3CPJB 1LGYA 1L8AA 1U9YA 4WX2B 2OZLA 3E9ZA 4CDMA 1C7RA 4MTLA 3GLGE 1CZKA 5GONA 2RH9B 2VJLA 4J7AA 2IEIA 1EGQA 2VJKA 1H69A 2ONZA 5K6TA 2DM6A 1L4HA 1GZDA 5KQPA 3H9CA 3TW4A 1KDVA 2FX5A 5FTLA 1L1EA 1H2FA 2EL7A 1D9XA 2VYND 3UT6A 1DVRA 1MB9A 3A1DA 4TRRA 2EKQA 1V1RB 2FQXA 2AFHE 3ZLJA 2BZ1A 2WIKA 1UBLS 1XQYA 3HWRA 4WDQA 5JMPA 1QF9A 1UM8A 3SEFA 4B43A 1U81A 4NECA 3DOCA 3CZ5A 4UXJA 2W83A 2P9YA 4Y6RA 1J39A 1SQ0A 2Y99A 1YDHA 3L1KA 5EUMA 5ALKA 2WIDA 3IUJA 4PE5B 3HB4X 2C5EA 3C3CA 3H2KA 4QATA 4A0QA 4B75A 1X2BA 4EATA 1C1XA 1PNQA 5FOQA 2D2VA 3M5PA 4L4SA 4IIJF 2ZSUA 3ADDA 4WA7A 2GCGA 4U3JA 3TVTA 3QBTA 1MO3A 2FEWB 1M7GA 1ZMRA 1ZY2A 4PFKA 2QYOA 4Z7OB 5JCOC 4NS4A 2WFAA 5JE8A 3AF3A 4DMLA 4QU0A 2GNAA 1DIRA 4K86A 1XAGA 1K0UA 3FKJA 1XAJA 1LZLA 1TYCA 5BWBA 4XSHA 2QG9A 4ENQA 1UK8A 2PH7A 4HX2A 4KSBA 4JJAA 4GOLD 1WVIA 4I0WB 3PP8A 1NXQA 1MDBA 4G1VA 5KDLA 4F2DA 3B6MA 3E53A 4EK9A 4M1TA 4BGDA 2FP4A 4RTOA 2YJTD 4DG5A 4CF6A 4YQZA 1G38A 4NFHA 2VH5R 3QMVA 1ULUA 3H5VA 2QJTA 3PFNA 4TRJA 2JGAA 2QD4A 3IBGA 3EMBA 4QUIA 2OBNA 2D1YA 1CNMA 2D5CA 4CIYA 3RAJA