5ED0A

Structure of the shigella flexneri vapc mutant d7n
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
132
structure length
132
Chain Sequence
HLKFMLNTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHTGQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the active site architecture of the VapC toxin from Shigella flexneri.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Hydrolase
molecule keywords tRNA(fMet)-specific endonuclease VapC
total genus 54
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 5ed0A00
1UT8A 5FV7A 1UT5A 1V8PA 5ECDA 3TNDA 1XO1A 5H4GA 3ORYA 2HWYA 5L6MB 1V96A 3I8OA 2IHNA 3ZDAA 5ED0A 3ZD9A 1A77A 5SV2A 1MC8A 4WA8A 1EXNA 4XGRA 2QIPA 5H4HA 1UL1X 2MDTA 3QE9Y 5HMLA 2BSQA 3QEAZ 3ZDBA 1O4WA 4XGQA 2H1CA 1BGXT 1RXWA 2WP8J 5ECWA 2IZOA 5HMMA 2LCQA 1RXVA 3H8SA 3Q8MA 2H1OA 2HWXA 5L6LB 3Q8LA 1TAUA 1TAQA 3ZDCA 2FE1A 3H8WA 3QEBZ 5K8JB 1B43A 3H7IA 3ZDDA 1V8OA 4CHGA 3ZD8A 3H8JA 3ZDEA 3IX7A 4MJ7A 3DBOB 1A76A 2DOKA 2HWWA 3ZVKA 5HNKA 5ECYA 3Q8KA 1TFRA 5HP4A 1W8IA 3H87A 1YE5A 1Y82A
chains in the Genus database with same CATH superfamily
1IBMB 2I0FA 4NCXA 3I42A 4F9TA 4E13A 4GLFA 2D0OB 1IN4A 3E27A 1BHJA 2RB5A 1C9EA 4HB3A 1OTYA 1ZN9A 3JQEA 1GQFA 1T3ZA 1WDKA 3K3PA 3OUTA 3SSAA 5LL6P 1HT2E 4LHVA 2PQ0A 2B8TA 4P3NA 1YCGA 4QOHA 4G0VA 1P9WA 3D0RA 4DCPA 3T9CA 3H1BA 4HAIA 3BK7A 2NO5A 2DWOA 1DT3A 4HWSA 2BIFA 2Z09A 1ZOIA 4L85A 5AHOA 1RPAA 3BFXA 5G3ZA 2ODNA 4UXJA 2ZU6A 3HC7A 1XWIA 4C2TA 4C4RA 2YXEA 1A7JA 3REFA 2R6JA 4H59A 1X7HA 3VPGA 4ALLA 1UBJS 1SOAA 3DPUA 3HZOA 1Z8DA 2PJRA 1K3FA 1MPXA 3AKYA 4V0NA 1QIMA 2KM1A 4ZKEA 3CLKA 3K71B 8ADHA 5I8WA 3NEJA 4DNPA 1PYDA 3CF4G 3QVLA 4CCYA 1F8GA 3DZBA 5A04A 1OA0A 4EKEA 1L1QA 1LTQA 4XD7D 2CLLB 1SIWA 1IG0A 1BA2A 2PKEA 5BYJA 1MV5A 1U7DA 1U9ZA 1G4UR 3TQIA 3WK8A 4JOQA 3TW6A 5C8YB 1W4LA 1DUVG 2GCPA 3HGQA 3WNQA 4B71A 1FPMA 2FRVA 5JD3A 5F7JA 2UVDA 2XUDA 2NZVG 2OZPA 4PV7A 4IHJB 5A4KA 1A5SB 4D2IA 2XWJI 3IO5A 4XVRA 4DL9A 5AXBA 4J07A 1TJ5A 1PS0A 1ZW1A 3MWGA 2REQA 4M86A 4B84A 3DO8A 3FYUA 4ALKA 1LNSA 5GOTA 5K3BA 4D4KA 5KWVA 5LU9A 3ER6A 4N4AA 2PKWA 3R0JA 1M3SA 3OQIA 3PL5A 2YWFA 2ZB4A 3MCWA 3MMZA 4RXTA 4WCVA 1U0JA 4XZ3A 4HQOA 3M9XA 3VC1A 3C6XA 4NE9A 4WWHA 4HXFB 4Q9HA 3T4EA 4K6CA 4LV8B 1GN9A 4Y1RA 5GM1A 1RZUA 3EY4A 1SCBA 3U9LA 3R44A 7REQA 1WLSA 2JHFA 4M7WA 5FA6A 1IN6A 1V1MB 1T1EA 2H52A 1XEWX 3I5UA 4FFSA 4JCOA 4N0QA 2XOXA 4QICA 2X15A 4O2RA 4K9DA 1F9AA 1QQ5A 1UXHA 4MGIR 2ZYRA 4PXSA 1VSVA 2HUPA 4GX0A 5HYVA 3ZVKA 4RF4A 4IDPA 5EPEA 2YKGA 1U94A 3KT0A 1JN0A 2GVDC 4Y18A 1PF7E 2BM8A 2EGGA 4R2LA 3DMGA 3U9TA 4P81A 5D01A 3JQAA 1QRRA 2I66A 5CW2A 2ZDHA 2WK1A 5KCMA 4J43A 1EAMA 2F59A 4MV4A 1VGQA 4YDRA 3U44B 1SUBA 1KKLA 4OGGA 5CCBA 3B6KA 3AX6A 1U9JA 5BV7A 4JYCA 2YN0A 3RYIB 4HVLA 4B43A 2Z43A 1SOWA 3MZ0A 4IIJF 4ZXFA 4AW9A 4AP9A 3MWDA 1BCSA 2QTLA 2IP4A 4I8IA 3RVOA 3OJCA 3BS4A 3WOVA 3U09A 2VCEA 4G56A 2G5CA 2VPPA 4XUCA 2JB9A 3L7DA 2JJ1A 5IS2A 2QY6A 2B4QA 3HRKA 3LBFA 4NZZA 4Q3EA 2ZJOA 2UXBB 3TD9A 3PS9A 3VJKA 2IYPA 4BFTA 4CMEC 1BO6A 5G4LA 5KTSA 1LW7A 4RLSA 4GM1A 4IUYA 2VNIA 2HA4A 4AKIA 1U0RA 5DBEX 3VSEA 3W77A 4L76A 4RM2A 2GXAA 2I2CA 1J2YA 3ZE2B 5L3SA 3EIQA 5JNSA 2X5NA 1ZU5A 1JFFA 5F64A 3OKFA 4MLCA 5L3QA 3W5CA 1RAGA 4JI3B 2Q1WA 3G9UA 2VHVA 4XGQA 2V65A 4YT5A 2ZRJA 2P9YA 2IYUA 4FYIA 2RHTA 3PENA 4HRAA 4WGGA 5EXDA 1W85A 4P5DA 4BUZA 1KP2A 2QXUA 3IE0A 2H85A 2CWDA 1UZNA 5AUQA 2VP4A 5B58T 4DV2B 1JHZA 3NC1C 2DCUA 2WABA 3A3NA 4U5QA 2D6FA 4WJKB 5DK4A 1SD1A 2C29D 1G60A 4BO0A 2W43A 3I0MA 2IXBA 2PG3A 4NS4A 4R51A 4TL9A 3QOWA 1BROA 3D8SA 5AR1A 2O3RA 2OQ2A 4LZWA 3TDKA 4B8WA 3IPYA 1BC5A 4A36A 1NJSA 2LDXA 3ZLTA 1SWVA 3BICA 3PNSA 5DXJA 2GR9A 3V8QA 3OTIA 4I9HA 5LU8A 1K6IA 1IK4A 2A1UB 1TPZA 2NU6B 3PI6A 2XAUA 5C37A 1EK1A 3EBOA 4Y2RA 5LKRA 5SZHB 4L1KA 5BSVA 1E79D 2DHDA 5FLXA 2O2XA 1QP7A 4YWHA 1LQ2A 3UMRA 3D5QA 1CQJA 2XGGA 3AB7A 2AFHB 1WHTA 5T6MA 2OB2A 4ZAFA 3AM4A 2ZKIA 2O8EB 5JJIA 1F2UB 2Z9BA 1H3EA 3EG9A 3HKBA 1X38A 3Q7TA 4BIMA 1DMRA 2F1KA 2XY4A 3KD3A 3PHGA 2J59A 3BCSA 3DYVA 1N8TA 4UNNA 4DCCA 2UYGA 3IH5A 2QP3A 4JP8A 1QJCA 2II6A 2ZJBA 1NHGA 3T5PA 1E3EA 3RVKA 3CY6A 4IVNA 3D4BA 2VBFA 4IJMA 3WMXA 1EVIA 1W29A 2BFCB 5CEFA 1TM2A 1GNRA 3GQBA 2WHQA 3OFKA 3QPDA 3AKCA 3R6GA 2GKGA 4CUZA 5IAKA 1A8PA 4B6PA 4D1YA 2FDXA 3I5YA 3EE6A 4IJVA 2XCSB 1QV6A 1TD9A 1WMFA 2KS6A 1ZL0A 4B45A 5TQJA 4B3GA 3BEOA 3RUAA 1EGMB 4F2HA 1VPEA 1CDEA 1FFBA 1K8ZB 1XA3A 5JATA 3IKTA 4QJ5A 4Z2AA 4FT2A 4EO7A 4DDWA 1W2WB 3KTOA 1I3MA 1P2DA 3AIIA 1U90A 1Q0QA 1BHO1 2C8LA 1ZMRA 4FP9A 4H7PA 1HMPA 1IY2A 2C5SA 3VPFA 3R9XB 4DRXA 1JYEA 3AKEA 4GKKB 4RFVA 1TADA 3DAYA 4M1YA 3BGDA 4JJ4A 2ZRLA 1NN1A 4FW8A 1VMKA 1WTCA 2HF9A 3M6MD 5BYKA 1PTKA 4ZALA 2B1IA 4XIIA 1HZZC 1UMDA 1E2EA 1XTTA 1PZNA 1T9DA 3KYCA 2ZB3A 1BVUA 2PVSA 3H2BA 3SZLA 1IHUA 1M2HA 1NFFA 4J4HA 1J49A 4OI4A 4ZQEA 1HM5A 3OFND 1W4CA 5TY0A 4CHTA 5KX5F 5DPMA 1M6VA 4MDEA 3W8NA 3ABOB 2ZZKA 1IEXA 4GVXA 1ICIA 2X2PA 4I9FA 4LYFA 4RTMA 1N5RA 4AIRA 2IUTA 3AY6A 3L8YA 2AOVA 4QQ8A 5AI9A 2YMMA 5LSAA 2NIPA 1MRZA 5F2EA 2IBMA 5GADl 3EXIB 3BE6A 4OA5A 3B2NA 4BV8A 3C3XA 1KEVA 1SK9A 3UO8B 1SVKA 1XK7A 4COKA 1OH5A 1P60A 2P3OA 3KR9A 4X1YA 5TJHA 3DGEC 1X80B 2ZYHA 2BGTA 3FDZA 3HJCA 3UWDA 3WFJA 4EPVA 2VA9A 3S81A 3EPHA 3MQ4A 1OQAA 2PKCA 1ZISA 2QZ4A 3TO5A 5FTMA 4E09A 3EZFA 3CJTA 1S6YA 4D96A 1DCTA 2FQXA 5T4BA 1WXDA 4PONA 3F98A 3OLZA 3JAWB 3NTLA 2G08A 1C1XA 3A9UA 4S3MA 4XWGA 3T4PA 5JFOA 4JFRA 1P5ZB 5FB3A 1N75A 3WMRA 3FDZB 4GPAA 1CFZA 1N9GA 3N6XA 2YWHA 4A4DA 1XTJA 1DIRA 4B2IA 4OFBA 3WBBA 1C8VB 1S9HA 5DLYA 4I3FA 1CYDA 4ZICA 1GL3A 2HZ7A 2IDJA 3L2OB 3D6TB 4J03A 1BYIA 2QJWA 2X6RA 3R6WA 2GBCA 5IXYA 5H80A 3GGCA 2VUSA 4BO7A 5ALYA 1A50B 2GX6A 1ZK3A 1WKCA 1H2RS 4ZPJA 4ZCMA 1IYZA 2CFSA 3RC1A 2G88A 2FX3A 4LBZA 4AJKA 1YHYA 1ISFA 1KA9H 1DX4A 1UC8A 1P2VA 1Z2OX 1GUYA 3K2QA 4KSYA 3W3AH 2PDAA 2C3YA 3LAWA 3L4BC 4DLWA 2AXQA 3VNRA 3W4KA 3ZE7A 1OAKA 4KP7A 4E21A 4NWIA 4BO6A 3VAYA 2O2CA 4CKCA 1F2TB 4LJKA 1TC1A 3KYCB 1SXJB 2C61A 3OQVA 2R87A 3ZEAA 1NDUA 2PL1A 2QN1A 1NAIA 2DWPA 1QG0A 2RGBA 3W0LB 2F8LA 3CZ5A 3S70A 3C5HA 3QFSA 3W5SA 1S2IA 1DRJA 2FQWA 2NXCA 4X9XA 5D7NA 1JEYA 1G7RA 4DCUA 1PCXA 1NF9A 4LKOA 1NC1A 3BMQB 1G8SA 4H17A 1DEKA 1RZ3A 1UBGA 2WTMA 1X1SA 3ZY3A 1RWOA 1T9HA 4UUBA 2GSDA 3MD0A 5JS1A 3OQ6A 3JVEA 3WZ2A 1W93A 1PGJA 1TXGA 1ECBA 1ACLA 2W2OA 3VZQA 3EVAA 3OEHD 2LW7A 1UFRA 4FC7A 3U4GA 1TW3A 2C99A 3WJ1A 1NV9A 1X77A 4M4SA 4HNAA 4CM8B 2H2WA 3T06B 3IL2A 2HCJB 1Z28A 3LBYA 3MWLA 1M2EA 3OOHA 3OIUA 5DP2A 1FJ2A 5LZ2A 4M88A 5AVKA 4EFKA 1OJLA 4FDMA 1I2AA 1VXOA 3A3YA 4QGGA 1L9XA 2WIKA 3WQSB 3DKVA 5AKHA 4KJZA 2ODPA 1NM5C 1EG7A 2DPMA 4G5HA 4Q47A 4C4PA 2EERA 4L6CA 2LD4A 1PEYA 2TMGA 3AYXB 3J7TA 1A82A 4IQFA 4ITRC 4KLCA 2JHCA 3FJYA 1AKMA 1S4MA 5B3AA 3G88A 5HRUA 4J1QA 2PXXA 2XD4A 4K6FA 4P4UA 3X1ZA 5KVAA 4YRAA 1B6GA 4D4LA 3B5IA 3Q10A 3NWBA 3IXMA 3QP9A 4XWWA 5ESXA 4LOKA 2EQ5A 2OGZA 3BHMA 4P33A 4URVR 3CEAA 3EUWA 2NQ8A 1YVUA 1Y8RA 4JL6A 2MSKA 5CCXA 3U4HA 1F20A 4Q16A 2WHEA 3CV3A 2AIRA 1HA3A 3TFQA 3L7YA 1TQHA 1FFCA 4G9EA 5C3MA 3HHPA 3WL4A 1CYEA 3HB7A 5IBRA 3RC2A 1PJQA 1XFDA 5BQXA 3MQFA 4MRMB 2ZBQA 3LWBA 2D2IA 5T41A 4EY7A 4G37A 2R1ZA 2J3EA 3L7NA 4KZKA 5PGMA 1SCIA 1KI7A 2B1GA 4DBLE 3BE5A 4NXNB 3A1UA 1PX0A 2R85A 3IP6A 3N8GA 2B1QA 3SJBA 1N3LA 2CHVA 3VTAA 3OEYA 4PYLA 2H31A 1LV8A 1USWA 2TS1A 3KAKA 5F7ZA 4O5AA 1I3NA 2ZWAA 4HVAA 4JEMA 2ERYA 2L18A 4Y98A 3NBMA 3VOTA 3CRRA 3K0FB 3EQ2A 1AHNA 4YK7A 3H2JA 1CW2B 3UK2A 2LIPA 1Y9ZA 4KQHA 4AI6A 3G6WA 3CRZA 2IVZA 4BNDB 2H57A 3FPLA 2ICAA 2FUG6 4N48A 2NYUA 1YBAA 4FYYA 2ATXA 2M9MA 4RZUA 5CM9C 4AO8A 4D7AA 3OCXA 5BNZA 4AUEA 3I2GA 2JJ1D 4G8BA 2A5YB 4RPKA 1U0OC 3UWMA 3PI7A 2ZULA 3RVRA 3LHSA 3JWIA 3NLLA 2UZIR 2QD1A 4PHHA 4CL0A 3GDWA 2GXQA 2OM2A 3IT3A 4LSZA 2RFLA 1DO0A 2FQYA 1OC4A 2PIDA 1SXPA 3LUFA 1J1ZA 3DM5A 4IX9A 4C76A 2Q6KA 1JU3A 2G83A 3F6RA 3HFRA 1WXEA 5MN6A 5E2BA 1RXCA 3ZVRA 4R69A 4UCFA 3MJVA 4EBBA 2GBLC 2UZ3A 1RRCA 3FWYA 1OZFA 1CFJA 2IIVA 3EGEA 5EG5A 1HGXA 1MC8A 2I78A 3MW8A 5ADVA 2DSTA 1FW8A 2CB0A 2F6RA 2B4TO 3J81k 2WILA 3AFIA 5C1DA 3DQPA 1BZYA 2XWPA 4WFJA 5BN5A 4ZZ1A 4DLPA 5K3EA 2VPYA 2BGKA 3JQAB 4QUKA 4AMZA 4BZQA 1Y1QA 3SBOA 3GJQA 2H3EA 3ROPA 3HCCA 4K03A 3VVMA 1VKNA 3H7IA 2JFQA 4I6JA 1UPBA 3QXHA 4LW8A 1D7OA 5C5DA 8AT1A 1QC5A 5JJLA 3QV2A 4EW2A 1ZNWA 2GA8A 4NBVA 4BBZA 4O29A 4C29A 4MRAA 3G2OA 1NBMD 4LOJA 3H0EA 4MQFA 4ZMSA 3MELA 2DFKB 1QBKC 4MB0A 5B1YA 2ZJ0A 4IIXA 4YALA 3TR5A 3O3MB 3L1IA 1ZK1A 3V7FA 1ORWA 2BMAA 2C4WA 4DM3A 4RTOA 5CAEA 1E96A 3MT8A 4J16A 4M60A 3VBEA 3G0IA 5F98A 3OBIA 2C77A 1XDGA 3DJYA 4O02B 5DBHX 3H9EO 1M34B 3HKCA 3E70C 3LCUA 2XF2A 5FQOA 3R9IA 1TAGA 3DEYX 5EZYA 1SUWA 1YBMA 3OLXA 1E2JA 3KR1A 1EX7A 1XCJA 1KR5A 1LS6A 4UUOA 3OZRA 3N3AC 2VHQA 2KLBA 2BELA 1D7AA 1KYYA 3GC6A 3GARA 1KE2A 1Z5GA 5JZMA 5KS2A 4MV1A 4V3CA 1VHDA 1EHCA 2GPNA 4BO4A 5AJVB 1I6WA 3N8KA 4HTAA 2NZ8A 1W5TA 3ZJVA 4IVRA 1YZKA 2NUAA 1KFJB 4QC2A 4X41A 2ATVA 4XGKA 1MW8X 1Q2UA 4DA9A 3QK7A 5JRJA 3UFXB 4DV6B 1HDGO 3H2IA 1XRLA 4HXGA 1PV1A 1FSZA 1OVMA 1RI5A 2CLEB 2N42A 1PW7A 3C3WA 3DOFA 3PDIA 3T7RA 5LMCA 1AN9A 3MCTA 1MJNA 1JG1A 3TX2A 1I4TD 2Q3FA 3F6CA 1N7HA 4CODB 1B0ZA 3VDXA 1Q2XA 3ZV5A 4L8LA 4J0GA 2H00A 2G25A 3JQGA 3LCRA 1MIHA 3K9LA 2K2QB 2V7QD 3ADCA 1Z5OA 3SC4A 1LPPA 2ZS7A 1ZX1A 1IZYA 2YYYA 3AFOA 1DG1G 1DV1A 4I81A 3R7DA 1ZRMA 4C7XA 4FKMA 5TGZA 2C9MA 1YKSA 4B44A 4HUJA 2Z2ZA 5TIIA 1DAHA 2E21A 2R1VB 4IMRA 4TLAA 2VDVE 2X9LA 3DE3X 2ZB7A 3QMWA 1XQXA 1GPKA 2G5PA 4N8EA 3V55A 5KKNB 1EDEA 3BZWA 1XKLA 4S04A 1HL3A 4PHCA 1Y1SA 4I4TA 2WM8A 2HV8A 4OQZA 5TSDA 4XDYA 4R9SA 5NLLA 1T24A 1T5HX 4E30A 5EMNA 2L42A 3DAPA 2OEPA 3GJSA 3LUBA 1RWMA 3AIOA 3NHYA 2PD6A 4K2AA 4M9ZA 4YCMA 1GADO 3PFFA 2RG7A 4HGOA 4Q3DA 4MCAA 3E9CA 5IHXA 3BB3A 3LC1O 3O0DA 1VE6A 4HDRB 3SXJA 1U6JA 2DU8A 2ZIXB 4HX5A 3E5MA 1XAHA 3FSJX 4MUNA 2ZQZA 4FFMA 4HH3C 3NP9A 4FX5A 2VHUA 4QUIA 1XZDA 2AUNA 3MJRA 3TDMA 1EUDA 3WLRA 1A9PA 2WZQA 2ENUA 2ZRIA 4LE2A 4DQVA 5JYDA 2Q50A 1Y4UA 5B37A 3BHIA 1HORA 2F7SA 3IE2A 2XGSA 5BRNA 3TLYA 3P0JA 2O7RA 5ALOA 1CRQA 1XPRA 2WYIA 2P35A 4LYEA 4WPGA 4GXQA 3IP1A 3JX9A 4YI3A 5IKXA 1IVYA 1ESDA 4QGFA 5DX0A 2GJKA 3ZDEA 4GP6A 3AUTA 1Y5NA 1MVLA 3FB1A 4UCWA 5TV2A 3BGWA 5CG1A 4MUFA 1SNYA 4EKIA 5BPHA 2V9ZA 3LYUA 3DYIA 4PGHA 3UJHA 4PQRA 3T7IA 1PO7A 1ZU4A 3I83A 3C2QA 2VBCA 4M38A 4WNIA 4G5YA 4FCWA 1YNOA 1ONSA 2VYFA 1MQ8B 4TYPA 5GJVC 1RZRA 3KU4A 4F1WA 1O0CA 3H5AA 2FVYA 4N5HX 2G0NA 2PEYA 1QHXA 3OU2A 3ZHVA 3DWGA 2FZEA 2RKBA 3EIFA 4Q5IA 3EW9A 4YUVA 4F4CA 5HK9A 5BYBA 1A9TA 4WKPA 4BEBA 3CVWA 1YBVA 5IDVA 4PU0A 1B7GO 2C1EA 2WWWA 1SKQA 4RKRA 3MRSA 4EMSA 5IC4A 5JSHA 3O8BA 1UKAA 3WA6A 4LJSA 2MMCA 2QMYA 3RJMA 1J4AA 2XYPA 4UMFA 3TI9A 5CB0A 1KGDA 1AXGA 3FY4A 4K9QA 4MAMA 3TIIA 2J07A 3A26A 3QA3E 5DX1A 3SNHA 4DLXA 2QV0A 3JPYA 3L1HA 5HKAA 2YNMC 1P81A 3A9RA 3GT0A 2QMQA 2I2BA 4Q21A 4I5EA 3F6BX 3WNCA 4YRGA 4FSHA 2B9EA 2ID7A 3KEOA 3KNZA 4QUBA 4K9KA 5ES4B 2E2WA 3WGIA 1W59A 3IAAA 1FP1D 1ZLXA 1AKQA 1NW7A 4K9OA 1BGXT 4TKMA 5D8DA 1Q12A 2CB9A 3RS4A 1ZLYA 5C80A 2Q62A 1JSXA 3TOVA 3VV2A 2G6BA 2OD7A 1K7YA 3EQ6A 3UPUA 4JI4B 4U7JA 5JYEA 5IDQA 3BXEA 3KXIA 3VHXB 5LQKA 1QU2A 2XNJA 5CD9A 1E3SA 1WNTA 4J3NA 2HO5A 4EZEA 3L8GA 3ZD7A 4IQ0A 1ZOSA 1JJ7A 4F71A 3S1SA 4W5NA 2HK8A 2VJBA 2QXYA 5DH9A 1GOTA 4JB8A 1M2WA 3K1AA 4EW3A 4DT1B 3WGYA 5AW5A 2BZSA 1SKYB 4NH0A 3L7KA 4GX1A 4ZQFA 1GTVA 3K94A 1VJTA 1ABFA 3IVXA 1VBKA 3QBJA 2X58A 3MJTA 2N9UA 2PS9A 2J7PA 2PPLA 1F8XA 3ZGNA 1T2UA 1L4HA 3EEFA 1OWLA 4G4SP 3ACCA 4L57A 2F00A 1R4NB 1T8RA 1DTWB 3VPBA 3IP7A 3HS3A 5COAA 2UZ0A 2DJ5A 2GI4A 4J0CA 1XXHA 2CVOA 2P6PA 3ABRB 2FG7C 2AEMA 3PDWA 4RA9A 3RJ9A 3U39A 1XNQB 2IOHA 1MEJA 2VN8A 1ZONA 4MKFA 3URMA 1AHIA 1U8YA 2O2GA 4TYMA 1GN8A 5DJ5A 2C7RA 3PXXA 1QYXA 4CGZA 4G8CA 2R6AA 4D8VA 5ESDA 3VPCA 1YJBA 4MZXA 4M76B 4BB6A 2HMSA 4B6GA 3EOBI 4UKDA 5A7GA 1FDUA 2NPOA 1H2BA 4DCJA 2O3TA 4A6EA 3PXEA 2ZSBA 2WFAA 4ZO9A 1KJIA 2EFGA 4LPKA 3DCJA 4YLGA 1KMMA 1YGYA 2GF2A 2VATA 2YZKA 4QWWA 2FCAA 2F1IA 3O1LA 2R1TA 1JW9B 5FBLB 5LMUB 1XSEA 1EVLA 1NG1A 4LBWA 2OSBA 2ZRCA 3GK3A 4UAGA 4WNAB 5EESA 1IZZA 4HAWA 4AZ0A 1BFUA 4QL3A 3OURA 1YU9A 4WLFA 1Q1BA 3MFQA 3IGFA 3ZCPA 4GZ5A 2F3RA 4Q39A 1MG0A 2XKKA 3OWOA 5F5LA 2AR0A 2KSQA 2Q5CA 4G5OA 2DBQA 1RKXA 2QL9A 1UBLS 4MI6A 4BPBA 1ZVMA 3ZWCA 4QPZA 3D0OA 2QTTA 4ZI7A 1K98A 3ZZNA 4QQKA 5BQFA 4OX9Y 5F1OA 8LDHA 1U1EA 4KYIB 5K7SA 1I3LA 3LX5A 3KZOA 2J5QA 2FFJA 3NTUA 3PG5A 5LBIA 3ZDZB 5CDYA 1T3HA 1USUA 1FW6A 1P2SA 2IE8A 3ILYA 2V6BA 4FT4A 4M9UA 9ATCA 5IKMA 1NVMB 1GL7A 1H66A 5DISB 4E4TA 5BSFA 5KWEA 3HHEA 5EIBC 3OQPA 4UU7A 4ZA2A 4CKBB 3NIBA 3I5MA 3C6BA 4TTJA 2DHCA 2FRDC 3HDQA 1AUQA 4MWDA 3V8RA 4JI0B 5HF5A 1EESA 5L7YA 1S7CA 2PHZA 1WY7A 4R41A 4LSMA 4HLCA 2WJPA 4N0MA 1EQAA 1E9FA 2RHDA 3ZLJA 2OAP1 3MB5A 2QWXA 4TZTA 1X39A 5IPFA 3QLJA 4Q6BA 2Z8YM 4N7RA 2CK3D 5G1NA 3SQXA 3V00A 3LNTA 4BQRA 5A0VA 1XE3A 3DE0X 4RK7A 5DWVA 4EM6A 1Y1TA 4MGHA 2ZIUB 3IAHA 1WMDA 4YROA 4US0R 4AF8A 1QTQA 4XB2A 4B0OA 2ZI3A 1WXXA 5JH7B 2XWSA 3H75A 4DC1A 4YUXA 1E1NA 2IYQA 4QDUA 3DFIA 2RH8A 1VZ3A 4E2ZA 3JTEA 1PKEA 3HXMA 4EF6A 1ORIA 1M5UA 4G85A 2ZJ8A 4TKUA 4XVHA 3GLVA 3LQQA 4N5IX 1H9BA 3LXRA 4H7IA 4YJGB 4MCHA 5HCUA 1I94B 2PUBA 1OMOA 1QIGA 1ZVJA 5ANRB 2VK1A 3MOGA 1ZUNA 1R9NA 2JA2A 2D8AA 5HKLA 2IDMA 2ID4A 3EUEA 1MDBA 1NYQA 4YP5A 1G9SA 1YIDA 1XEWY 3P97A 1C9NA 5DHFA 4XI9A 2JH9A 2YTZA 4ZVUA 3UNXA 2O07A 3HADA 1GNSA 1UZAA 3PFIA 3RGWS 2CFIA 1ZINA 2V58A 3SVZA 1OC2A 2WSYB 2PWPA 4FEGA 4CEJA 1DX9A 4HNQA 4ON9A 1Z4NA 5ESRA 3WWOA 5LP6A 3K8QA 4MEBA 3KCNA 1Y1RA 2JI6A 1LLQA 3HBJA 4PG6A 4WXRA 1BSVA 1K6MA 5FOWA 5BUSA 1QZUA 2YIDA 1JHMA 4LOAA 2D1QA 4XYLA 4EG0A 4OYHA 2RIPA 5ALUA 1C14A 2ZJZA 1KNXA 3PXBA 3L0PA 4JLUA 3I72A 4JVNA 3VKHA 3PSHA 1KEUA 4I1IA 1APBA 5DEOA 3UJ3X 4PYMA 3WDSA 1ZG3A 3F47A 4GMDA 3OPYA 3AL0C 1RWQA 3IQZA 1Z26A 2J41A 2DBZA 2QVBA 2VF5X 4K6GA 1D4AA 1N1GA 2BR4A 2Y05A 1DHRA 1IUNA 3COVA 4MWCA 3IX7A 3FGNA 1Y8QB 2X19A 1BOOA 3MWJA 4F38A 3K30A 1E6UA 4LNUB 4ODIA 5B1HA 4E1BA 3BA1A 4FFPA 3SZ3A 1MO2A 5EKDA 2F3UA 2M2IA 5JD6A 4UM5A 1C9DB 5ADWA 4OOEA 1GYQA 1E3JA 4OHUA 5BN5B 1E2LA 2Y2VA 5LQSA 2MMGA 4KTVE 2B99A 5TF4A 2CNWD 3HDYA 3FDJA 1U5BA 1UZUA 2JIPA 3G9XA 4ZV4A 3LF2A 3O3CA 4HDKA 4E5KA 1DKUA 2WVJA 3HFJA 3U4AA 1AA9A 3H84A 3RM3A 4ARZB 5HZMA 2IH2A 5TPWB 3X1XA 2IGBA 2YOHA 2ODWA 1NW8A 2PX2A 3PPWA 2AFHE 2DLCX 1U1FA 3O8QA 1B1AA 4OL0A 1E2BA 2BSXA 2UDPA 5HA5A 1VHWA 2FZWA 4JL5A 1KU0A 5ECYA 3SQNA 3TLGB 3VR6A 4TSRA 3MBOA 1OFUX 1FFXB 3FOAA 3PXCX 2RGNA 3LZCA 1QFMA 4GP9A 2QRGA 5H0IA 4PTLA 3I4CA 1IU9A 1VQ1A 2BTOA 1EWKA 3HDHA 3OI7A 4KVGA 2OL4A 3FHLA 4TXHA 5CM8B 4YJFB 3E23A 3WK7A 3AEQA 2VDNB 2BV3A 1O6CA 2QA5A 3PEUA 1LDEA 3IEIA 1JQ3A 3NHJA 1J8VA 4N65A 4PZ9A 4RHEA 3EH1A 5C34B 3IUMA 2F3SA 3MINA 3K6KA 3CNOA 4I6EA 1RD4A 1SELA 1ICEA 2GPTA 2R6HA 3DD5A 1E60A 2IITA 2WJVA 3E53A 4MA4A 1NC3A 1TC2A 4OKIA 5FCDA 1L5HA 3X1YA 4H31A 3GPLA 4FNGA 2FPGA 5EUQB 4XB6B 5J4HA 5GV7A 5B4UA 3WYDA 4MVXA 3A70A 3M1IA 3UYKA 4P1ZA 1VYVA 3CHYA 2BKXA 2EX4A 3H3FA 4GZ6A 4OLFA 4RNCA 4X8LA 2W2KB 3LY5A 4Y6PA 1KAEA 1V5IA 3LQKA 3WDLA 3KTFA 4YR9A 4YQFA 1NX6A 3FCEA 2G9VA 1ZSVA 4B0PA 2WU3A 2JPDA 2PX4A 2P3QA 3L46A 3QFTA 3I53A 2JH3A 4H1UA 3HKEB 4CMEA 3PXUA 5BVGB 1NQOA 1TJ3A 3OZCA 4GZMA 5TNXA 1JNYA 3MS7A 3ZTYA 5HPYB 4KLNA 1NVWQ 1RPTA 1DKNA 1EB8A 4PGAA 4UAJA 1TLTA 4FFLA 4B6RA 5FWYA 2XZOA 1IBSA 3DHWC 3EIXA 3T38A 1UPCA 4QTTB 2BD0A 3KSMA 3L41A 1I0LA 4MHTA 4MPRA 1TCBA 3B36A 4KK4A 5FULA 1GYRA 5GZ6A 1L4LA 1LWOA 5BOSB 4MYCA 4OP3A 1CY7A 2C9DA 3QEMA 2BW0A 1YDEA 2O50A 3KLOA 4KTTE 4ABTA 3H99A 2AVNA 1KRHA 3QVGA 2DR3A 2N3ZA 1MC1A 3CEHA 1RQ7A 1I33A 4TTIA 3RUCA 2YIJA 4HDNA 1EK6A 2QDKA 2ODBA 4UATA 1EH5A 4OQEA 3C7KA 1P6UA 4YJGA 2HWKA 4Z0NA 5AWFC 1O6GA 4TKUB 4LDJA 1QYDA 2JBWA 3IPCA 2V7BA 4DCGA 1EFKA 1U2GA 2QUZA 3L04A 4TKVA 2ECFA 1HMYA 2ASEA 5KTTA 2XOKD 3QWBA 4W1QA 1V8BA 1FBTA 1H6DA 1MO4A 2H29A 4JWTA 1LLCA 2R2AA 4XQ9A 5SZIA 3STUA 3VPHA 3W1VA 2PK3A 3QIVA 1JMKC 1FRVA 3ZZ1A 1UAGA 5B55A 5HWSA 4HNHA 4MW7A 4Y9UA 4R98A 1HF3A 5K01A 3W5HA 4BVFA 5FWAA 1SUEA 1Z5ZA 3QW4B 5BW5A 3QOYA 3PGMA 2R68A 4C22A 3I9LA 5I3CA 4OHYA 2HRRA 1T2EA 2P7IA 1O96B 4DA8A 2FUCA 1Y33E 1J22A 3W2HA 4GNRA 4RTRA 4BDTA 3IJEB 5JXJA 1FX1A 1MA3A 3D02A 4NG5A 4N0PA 5J5CA 3H4TA 2NPIA 2VT7A 3KEFA 4DZZA 1DPFA 3RBZA 2R4TA 1Z5UA 1YVPA 3GFGA 1SCUB 4AO7A 2HRCA 4DJTA 2N1BA 3ANYB 4NP6A 5AW3A 4IR7A 1I8TA 4D9EA 4Z3KA 3EASA 1V4BA 2NACA 2Q4OA 2Q3CA 1LF5A 4EMTA 4CLOB 4BQIA 1GPJA 3ST7A 3KEQA 2NQTA 1QORA 2QMEA 2W6JD 3OQBA 3I9V1 4IY1A 4NRDA 4RQBA 3CZMA 3ZBQA 2JLYA 5FBRB 3DKRA 3PJGA 4OLBA 2PAAA 1ZJZA 1IM5A 3ROQA 2W2XA 5CGQB 3A1SA 1XZIA 2FEMA 1G21B 3F2VA 1MX1A 3DTVA 3L7BA 2EOAA 3LUKA 3OPMA 3A6ZA 3OD5A 4OGWA 8GPBA 3RYCB 1FQWA 1Z5WA 4XW2A 1OBHA 4YACA 4JN6B 2XB6A 3R6LA 4Q66C 3I2YX 1NVFA 3CKKA 1GRCA 5JQGF 5KZMB 3DVSX 5CXXA 1V6AA 2AMVA 3L0CA 1T2DA 2JLSA 1MC4A 4YX9A 5C52B 3A1CA 5E8JA 1NJGA 5AOAA 1C9JA 3ZVMA 1CQXA 2G63A 2H1VA 2QT0A 4JUFA 1K89A 5CGZA 5FPHA 4YCLA 4Q3KA 1UOPA 1LFAA 1PYOA 1UBUS 3CXUA 2HRDA 4ZAYA 1G19A 3FYCA 4R71A 2CVFA 3RYFB 3T99A 1I30A 3TI7A 1HDXA 4YT2A 4R0MA 4V3BA 3F49S 4ZVSA 1M0WA 4PYRA 3HVHA 4PRKA 4QU9A 4O3MA 1GGFA 1GTMA 2CMHA 1N2IA 2H4YA 1KVTA 4C0QC 1CIPA 3BMOA 4L5CA 5JY1A 1A97A 1NQUA 2ZBDA 4AAYA 2RDMA 3T5CA 1ST3A 1PP4A 1T29A 3NC4A 1ODCA 4C30A 1TO1E 1IZ7A 2ZWPA 4B3CA 3PCRB 3QMMA 1Z62A 1KQOA 2HSJA 2JI9A 3PC8A 3NHLA 3Q8MA 1Q0LA 3F4BA 5IUKC 4KE8A 1IZ8A 1J07A 1FP4B 2WYVA 4TSKA 3U7GA 3ICQB 4FE4A 2OBXA 4OKNA 3MMNA 2F55A 1QZTA 1JQLB 5G41A 3OCWA 1BFDA 4O1IA 2CXXA 3NKLA 4HDMA 5T5QA 4ZJUA 2XUGA 1MTZA 4HS4A 4OXQA 4D97A 2VPZA 1ZR2A 2PTGA 1U5CA 1RM5A 1RXSA 3N6VA 4MTLA 3TX6A 5HQ3A 1KK3A 1FEZA 4K88A 5DLQC 4FPXA 1BU8A 1A4RA 2GILA 5KX5B 4TRMA 3A04A 4Y30A 1HLGA 2BGLA 3H4IA 2LV8A 4GMXA 2OCYC 1CQPA 2EL9A 2IIBA 1W46A 1VCNA 3L7CA 1V37A 3FZEA 3WQBA 4F1KA 2WNIA 3HRHA 4GC9A 4YV0A 1S8OA 4K1XA 1NXSA 1A27A 2L2QA 4CIYA 2RGWA 3DMYA 1IOVA 3F67A 3FYTA 5I9TA 5JS2A 4M49A 1B14A 1GITA 2B4KA 2ATCA 3GXBA 5BN3A 2QBYB 1N32B 4AWBA 3ZR4B 2I1WA 4U5XA 2ZUTA 3WRYA 4KREA 1YE5A 2IZZA 3QLVC 4KBYA 3SFZA 2XCIA 1EX9A 4XYGA 3KSRA 1RQPA 1TL7C 2QJFA 3C6YA 2DWCA 3E9DA 1AK2A 3LCMA 1JLLB 2ADMA 1C7JA 3GQBB 4F93B 1A9YA 1OD6A 2F3PA 3PJRA 5JSFA 1G8JA 2VTKA 4B3HA 1AGPA 1K88A 4MW4A 3L5OA 3R3XA 5DHUA 1MHTA 2R2GA 4PQFA 4EHHA 4HRXA 1AN0A 4PPQA 2BF4A 2D3WA 1EXMA 1W9HA 5GZ1A 1SKBA 2WWRA 3WMFA 3IKMB 5I51A 2GOYA 1YZ3A 4IHJF 4MWTA 4COOA 2P41A 3SI7A 1L4NA 3CVOA 1R7RA 4PZCA 2EZ4A 1NJ2A 4RKFA 1DXQA 2M6SA 4PGFA 2XA1A 5TF0A 1DZIA 5C1IA 1O4VA 1JR3A 3NDJA 4BX9A 5JAOA 4DR1B 3T3EA 1LF0A 2QQ5A 2O1WA 3VR3D 5IFKA 4NCBA 2PUHA 1U7PA 2RJOA 1YKGA 4GOND 5HKOA 2C7QA 1Y6RA 4QDOA 5AVRA 2IEAA 5H82A 3V42A 5CURA 4R8RA 3IAS6 2FUKA 3F4LA 4FZRA 1IXZA 3NKVA 4Z0HO 2VRWA 4FGJA 4TROA 3FMIA 2WU8A 3IVAA 3PE4A 3ZKWA 1MZVA 4CMCA 4RAQA 3V1YA 2X40A 3W5JA 4NPCA 1DFIA 1CY1A 3WI7A 5L4SA 2J4DA 4KMOA 3CC8A 2R65A 3VC2A 3MUOA 3RHFA 2ZRMA 4AL4A 3Q8KA 2FFBA 4O3FA 3UA3A 1UP6A 1QE0A 2OGUA 3PNVA 4UARA 4TYQA 3KJHA 1AGXA 1Z56C 2EWVA 3L93A 4PS0A 4AN0A 4CQMA 1M8GA 5GINE 3QJGA 2Z2XA 1ISJA 1SXJD 2AG5A 3EXFB 5A6SA 2O0LA 1LUAA 4LG1A 1DO2A 5D2CA 1SQFA 3B3FA 3C8MA 4IYJA 3MTEA 2IF2A 1JDBB 4L9SA 4FX2A 4MNTA 4MQLA 5GM2A 1MBZA 5HMLA 4L72A 5IJXA 5ICSA 3CBGA 5IMSA 2WKPA 4ZZ0A 1SU6A 5F4BA 1MU0A 3QY9A 3ZH9B 2MYUA 4I8DA 1V16A 4BNLA 5KNBA 5FBHA 3A4NA 4HB2A 4AQDA 5CLFA 4HDRA 5KOHB 1P18A 1WB4A 1X7YB 3V8PA 4F60A 4YCJA 3FF4A 2KJQA 2IU4A 2XA9A 1G38A 2QRZA 3ZV6A 2AOTA 3LDFA 3CJQA 2IQ5A 4ZT7A 1KFCB 1N5JA 1ONBA 2XCRB 1GAWA 1WVIA 4B31A 5CLJA 1P80A 2QLLA 1QONA 1E3DA 2CEKA 3D7LA 3B6IA 1MAUA 1DRWA 3LECA 4KKVA 4AXBA 3E61A 3KUXA 3ENKA 4PX9A 4MKRA 4X45A 5ITZB 3L6DA 4X61A 2W6ID 4U7HA 2FPKA 2CGEA 3HM9A 4XLTA 1YQEA 3KFXA 1HZJA 3R3UA 4UNRA 1YCHA 1EQUA 5DRTA 3DLHA 3VYWA 5FPKA 4JS0A 2VEOA 4G0YA 3IPXA 4IIUA 1YQXA 1RYHA 2FR8A 1IULA 1LSSA 2I9PA 3D6MA 3HO8A 1ULBA 1OH7A 1OTHA 5K3FB 2FN4A 4BZWA 4GOOD 1F1JA 3WV4A 5EZSA 3Q9NA 4Z1OA 3OQOA 2NTJA 2WZBA 4J0JA 1A9RA 3FGOA 3R7NA 3PIDA 1QYRA 4UE6A 4RD2A 2WC1A 1WZ2A 3OE4A 1EKXA 1XL0A 2X8WA 3FCXA 3RU2A 3J80A 3M5WA 5DULA 1VA5A 4ZT4A 1RZVA 4H35A 3W5IA 1YAJA 1PJ4A 1VBNA 1NZDA 3BWXA 2P75A 5K8VA 1A04A 2ZTUA 4FFDA 5KTRA 4D3YA 3LL7A 3WLPA 5TQ0A 2BHLA 1XKQA 1BVRA 1SAYA 1QWOA 4D4MA 2WLSA 4G5SA 4MO9A 1V11B 2BCJQ 2H1IA 2HU5A 2Q29A 4E70A 3EUFA 1TK2A 1JT9A 2C97A 2ONZA 2P68A 4R9NA 1U8FO 1L7QA 2P5TB 2YUIA 2G09A 1T9KA 2DLDA 1RHUA 1EFPA 2EYQA 2L19A 2P9CA 1T4DA 4YMVA 1L6RA 1NRXA 3MFYA 3RRNA 2YDYA 1L7AA 2R7KA 3UA4A 3T1VA 1GFWA 4JLNA 1T1JA 3O90A 4LRWA 4S1PA 4TV8F 3DNPA 3T6KA 3VTZA 5KTYA 3QU7A 2XV1A 1FTSA 4GW3A 4ZOEA 5ICMA 4M0PA 1B76A 3IIIA 2VCYA 1WDWB 4JP2A 4HY3A 1CQZA 3KPJA 2X9NA 1J7JA 1WSDA 1JPUA 2Q1UA 5KSOA 2B2XA 3I09A 1PNRA 4P08A 5M5BA 2J5RA 1U2QA 1EJBA 3D7KA 5B6JA 3G0HA 4UNPA 3LOQA 2H65A 3G5UA 4NFSA 4NOMA 2ZUFA 1Z8FA 4TRJA 3L43A 1QIJA 1EFRA 2BT4A 3DNFA 4GI5A 1KRXA 4BGIA 5A4MS 3U62A 4G84A 3NV7A 3FPFA 4I4IA 1KQNA 1L5LA 1SZPA 2FEXA 1TMYA 2VFAA 2POQX 1XEXA 3QI2A 4YP9A 5LXTB 5DM4A 2Q99A 2FMKA 1ZC3A 4DREA 1M10A 4UNSA 1FVHA 4J1NA 2QVGA 4ZAWA 4BLQA 3GH1A 3A6JA 4O1HA 1CTQA 1FFYA 4ENTA 4FGUA 1SBNE 4NAHA 1ILWA 4GMGA 4MJ3A 1KPHA 3SC2B 2WU0A 4UM8B 1NU6A 4WZBA 5A62A 5JANA 5JS8A 1ODJA 1Z33A 3TLXA 3SQMA 5KNCA 4C4ZA 2A1TS 4U3JA 3LKBA 5F1YA 2HJHA 1C3LA 1EVYA 1ENOA 1CUEA 4O4HA 2YV3A 3A0RB 2AOTB 2G9NA 2XHZA 1GUFA 1DL5A 3GFRA 4PZPA 1QV9A 3GPDG 1IQ0A 4OQPA 4BE4A 1TK3A 3NMUF 3SU8A 2UXDB 1N5DA 1WU8A 2VNKA 4I6GA 2ZYSA 4JU8A 5BQOA 4DCNA 4JASB 2OGTA 4QELA 1ENYA 1WW8A 3WB0A 1VHLA 3GFSA 3QX8A 2UYHA 1S0UA 3C3DA 1T1IA 2N46A 2TSYB 2AOUB 3RUIA 3GP3A 4CF3A 3U0BA 1HL7A 3KXLA 5EPUA 5MN4A 1D2HA 1D9ZA 1Z36A 2J3KA 1DGQA 2VPXA 1YACA 4DDVA 4TMVA 3L7JA 1D2NA 1ADJA 1TVEA 5KSYA 3IEKA 2FPLA 1YI0A 3M81A 4IIFA 1KVQA 1DU4A 1IM2A 4L8FA 1S3FA 1JR3E 1E7YA 3QVXA 9ABPA 2CL6X 3BK1A 1V9LA 4D9NA 1I6MA 1VBFA 3LLMA 4Z9FA 4NARA 1OZHA 4PANA 4PQYA 4P92A 5DNUA 3SMQA 2XUZA 3AHEA 3C8DA 1GUAA 1KYTA 2JGJA 3ED5A 4I46A 4Q9KA 3ZHCA 1NYRA 4AZSA 2BEUA 3E4DA 5DX8A 821PA 1W44A 3GIWA 1P3Y1 1Y4DE 3RS5A 4CG1A 4QBTA 4MVCA 4BQEA 3AU8A 3SYKA 2M6RA 3KUDA 2YYAA 3TZEA 5KTPA 3F5QA 3I8SA 1P19A 2A5LA 3KO8A 2YBDA 3PIRA 3W05A 1YCDA 3VDNB 2KWIA 3IBSA 3I3OA 4J2TA 1XMPA 1TM7E 2G1JA 4Y1FA 3TOCA 4Z8YA 3DTVB 4FS8A 3AM3A 4MCJA 1TIBA 4CM5A 1K6JA 3Q9UA 2C07A 1NRIA 1XYYA 3D6HA 2DC1A 3NI2A 3STWA 3TNFA 4F1JA 3MUNA 2F9LA 1R8YA 2AQKA 3KAQA 4J3FA 4L3OA 1SXIA 3PYLA 5CPFA 5DVZA 3VSAA 4TMYA 2ZRHA 4TSFA 1U98A 3I9KA 5HBGA 3SJZA 1LC0A 1LDYA 1T8TA 1R5JA 2YXDA 4KEAA 4QGHA 3TAHA 1XRMA 4ECAA 4AO6A 4JBNA 4BPRA 1SBTA 3DBRA 3PDUA 5K3CA 3ZIDA 4DWVA 2RARA 2PX6A 4XEUA 5FL7D 4IJ5A 2RH9B 1O6FA 3IDSA 3JZIA 4P80A 5JC1A 1HYEA 1FXWF 3M82A 3Q2KA 2B83A 1JLLA 4XUEA 3AUUA 2NU8B 4MKHA 1OTXA 4EHNA 1KJJA 2HPAA 4Q1FA 3TRDA 1W0KD 3C3CA 1NJ6A 1XQWA 2FKAA 3UAXA 2X3YA 4YR7A 4C4OA 1P5FA 4M0EA 2HBZA 3K6SB 4JNCA 1VKJA 1KRWA 2E3JA 4URYR 4QM6A 3NRJA 1CF2O 1OXUA 2AFRA 3OETA 4KODA 3KQSA 3QBEA 5EIOA 3WBJA 4D80A 2SECE 4EJSB 3PUZA 2AJ8A 4QFCA 2VZ0A 2DQSA 3R7LA 4ZODA 3RU7A 3IR7A 2AV6A 5CLIA 3VR4A 3S3TA 3BXFA 1KY2A 1PT8A 2V03A 2V7GA 2AE2A 2BFWA 2G7ZA 3E3AA 2PRKA 1KH3A 3ZWDA 1JR2A 1QAQA 3M6VA 3VX4A 4AZ3B 1H42A 4IHQA 4MB2A 3O9ZA 1ULUA 4GDMA 3MJHA 1SXJA 4DEXA 4HI0E 3QEMB 5DYIA 1F2TA 2FOXA 4IIDA 2QX9A 4DANA 3MHPA 4CU2A 1KQ3A 1PZMA 2GZSA 3P4YA 2A3NA 4NF2A 3ZWQA 5EZ5A 2RAPA 4BRUA 3ZVNA 3KTAB 4JR0A 4P54A 4JLOA 4TGLA 1NJ1A 2P5UA 3PHBE 3EXG2 3HBLA 4GQBA 2Z4RA 1U9CA 2EIXA 4YAOA 1SC6A 3BPSA 1QHHA 4GF5A 2CN1A 4FB4A 1J0CA 2CSXA 2I7CA 1ND5A 1CQIA 1DEHA 2C2OA 4TWJA 5CFOA 4BZZA 4ZAXA 3L07A 3W7AA 1YUMA 3NHUA 4WQMA 1AQJA 1LBQA 4ZVLA 1IOLA 1EEXB 1Q19A 3LPDA 2AYXA 3ZXUB 3EEQA 5B53A 2VCHA 2AF3C 1KPIA 2XGMA 5JJBA 4GL4A 3AXSA 3UK6A 4WLVA 4QD3A 2VVTA 4IHAA 5DW3A 4Q3BA 1LV7A 2IW1A 4RFSA 4OUDA 4HD8A 1ZK0A 1LRKA 4E3WA 5AI0A 1ATZA 4NR0A 3X2SA 4BUJA 5CXQA 2FPSA 3FUXA 2QMUA 1PJTA 1X8KA 2F2TA 2XMRA 1Z6TA 4J7AA 1M2OA 1H23A 3E5NA 3F6EX 4EJMA 3CLSD 5HTKA 2Q4DA 4YT4A 1YFLA 4RE6A 3SS9X 3HCBA 3BMNA 5AVTA 4WJZA 1FPQA 1RKVA 3FD8A 2X0IA 2ZRDA 4E5NA 1BW9B 5LD2C 5ALEA 4GRIA 4H77A 3RIHA 3ZY6A 4EB6A 1FFXA 2G1KA 4O6VA 2HA6A 1EWTA 1M6VB 2W90A 3BL5A 3HVJA 1Q50A 1ZM7A 4EHJA 2Z98A 2JFWA 2ZJ2A 4OGKA 4BIIA 1CUHA 4L07A 2GEVA 1I9GA 1KFKB 1DBVO 4AJIA 2XXAB 2XB4A 1HT0A 2GJSA 2FW7A 1UMDB 1HQCA 1X94A 3O47A 3M5CA 3OPVA 3E15A 1YR8A 4AKTA 5JNWA 1OX5A 1JFVA 2X86A 4J9UE 1XRNA 1T43A 1D2CA 4PINA 5JIBA 4FZ5A 1HX7A 3MM4A 1ZH2A 1UIMA 4XH9B 3O8CA 4F4DA 3NBFA 4DC0A 4MGEA 2OD9A 1KZ7B 1X8LA 4JJIA 5I8PA 1NVBA 1JYSA 2REBA 2NO1A 1EAYA 1MQSA 4B73A 4FUTA 4CV0A 1GLGA 1G5IA 1DIOB 5BSRA 4ZIRB 4TZ6A 2QX6A 1QIKA 2W8BA 2YRXA 2ZJ5A 3G0GA 3PJDA 3HEBA 3PNPA 4BJ5A 3LD9A 1OLXB 3ZWOA 1FOEB 3PIIA 1ZEJA 3PUXA 4IG4A 4HXYA 3QKSB 4AY3A 4DLRA 3OUZA 1B8NA 1T6ZA 2C2HA 4EB8A 1FMJA 4EFDA 1IHYA 3IUNA 5AK4A 3ZU4A 2V5AA 2OGSA 4EFMA 2NU7B 4TKZA 4URHA 2J9FB 2CJWA 5FNVF 4WBSA 4KR7A 1WKVA 4HDSA 3LO5A 4KV7A 4L73A 4ATNA 1G5TA 4XDGA 2G07A 2ZSUA 4RACA 4LGYA 5KMGA 3VDMA 1U0HC 4CG3A 5EIWA 5IJAA 1CUCA 4ETMA 2Z8XA 3NVMB 3LWNA 3R9WA 1MJFA 1P9RA 4KR2A 4F86A 2UYCA 4NZMA 5F23A 13PKA 3NHFA 1YU6A 3ZWKA 9GPBA 5EHNA 5FFNA 2CL5A 2DHQA 4PX5A 2JAUA 2JD2A 2PYZA 4EPXA 1A8IA 3T3OA 3TQFA 2GEJA 1IRXA 4UUAA 3TL6A 3VFDA 3ZWVA 1S4QA 2OT3B 1NAHA 1YA8A 2HQSA 5AKYA 3IDAA 3EG5A 3HKEA 4OEHA 4URFA 2GCGA 5DE3A 2Q0HA 3V33A 5CJ2A 2F48A 2JKYA 4RJKA 3EGVA 3HLYA 2CJWB 1PT7A 3TWOA 2A86A 2O48X 1BXGA 1GQSA 1FK8A 1MCZA 1S8FA 1Z13A 3BZBA 3ONDA 1OREA 3NWEA 4WAUA 2R60A 3FPAA 1J39A 2YR0A 1SCJA 3PEVA 2C2WA 3CPEA 3HUDA 1Z0DA 4N9QA 1VJ0A 3EWSA 3ZXXA 4FHCA 3X0DA 3RSQA 1BS1A 3W78A 4RJJA 3MPOA 5JY6A 1WO8A 3V8EA 4CM9A 2YHUA 2QJTA 3AY0A 4W8HA 4M0MA 4NSNA 2JBAA 2B25A 1VSQA 1K06A 1NXTA 1UJ5A 1YULA 2I5PO 1K97A 2C78A 2QRPA 4UD2A 5FORA 2ONKA 2JAQA 3U3OA 1M1UA 2CJPA 2J48A 3DVRX 1RAAA 2OMKA 2PRIA 5FBZA 4DNFA 2FZLA 3K8YA 2WJHA 5CYGA 5BW8A 5K0FA 2QTHA 1YRYE 1M1NA 2WJ6A 2YHSA 3H7AA 2LCFA 5B2EA 3QUBA 2IWHA 1FSGA 4LJ9A 2F17A 3VH2A 2IU6A 2Q27A 4A5OA 2I4OA 4N41A 3AJ8A 4F2PA 2ZUEA 3OE5A 1Q92A 4NYIQ 4WLUA 5IZCA 1TVCA 4MIEA 5I7FA 3M9WA 3FNEA 3JQRA 2AGVA 2AHOA 2LGJA 2Y1OA 2WTAA 5EJEA 3GUZA 1KOFA 4K9SA 2WJAA 1FYWA 1KYQA 5CT5A 1QKKA 3CEJA 4A26A 1X14A 5B4VA 1TF5A 1Q1AA 4KFTA 4MPDA 5T7BA 3FAKA 5E1BA 4AY4A 1UDRA 4MUBA 4WUVA 5AMXA 2RGYA 1R0KA 3RFUA 4O2BB 3ZBPA 3ZLUA 4PZAA 4KKXB 1NNSA 1AKEA 1TA4A 2A9KA 3GY0A 4H3SA 4WOJA 3ELWA 2TMDA 2C59A 2J3HA 3HY3A 2P4SA 1ZKMA 4FDLA 4DS3A 2P5YA 4N7JA 4C4TA 1E1YA 1M2OB 4MKZA 3LIPA 5ERYA 1NQXA 3M3PA 1GVHA 3UUFA 4QU0A 4DLVA 4F91B 1CY6A 2P4HX 1FMTA 4WECA 4F84A 3PRHA 1IBCA 4OATA 5C1BA 1L5RA 4OLHA 4Z6KA 5AM2A 1KS2A 2H7YA 3DWFA 2Z5FA 4OUDB 2ZREA 3QE2A 1JBQA 3T15A 1ZIYA 4B8ZA 1AU9A 2Z04A 4N39A 4X1KA 4EG4A 3BQNB 3F3KA 3M89A 3ZY4A 4G24A 3RREA 1HOTA 3K15A 3CG0A 2NSDA 3KSUA 3VPDA 4D9GA 4LGCA 5JSQA 3T1HB 1B8OA 2FW0A 1BKSB 1W0JA 4FIDA 3ZU5A 3AVXA 1E9VA 3SHWA 2NO7A 1ZGAA 1G2QA 4BN4A 5DMHA 3IIKA 4Y7DA 5A7FA 5JRDS 1L7PA 4A7PA 2O20A 1POXA 3LTNC 5HX7A 1CQIB 3FUUA 3AEKB 4PCUA 1PNQA 3HY4A 4B6OA 1ZCZA 3CLSC 3GAMA 4M6WA 3U7QB 3Q7RA 4DG9A 4LPSA 5ALTA 4DCTA 3RVBA 1MQ9A 4D4JA 1AK1A 1M9NA 3THXB 1NMYA 1N7IA 4QUJA 1M1XB 5JFTA 5EIEA 1DWOA 2PRZA 1DTWA 1C3OB 4HQNA 2A6PA 4RXMA 5LC1A 5JALA 2VAWA 2OBFA 4YASA 2D0IA 3T9EA 1TF7A 1W581 3S2FA 3B48A 4C0SA 5LVAA 2RHLA 1Y3DE 3EULA 1PJBA 3H18A 4R7GA 3WBFA 4ZYLA 1CUBA 2HGZA 1J20A 1FNSA 2WG0A 1PK9A 3OTHA 5K5EA 2GZDA 3U56A 4IIJB 4JT9A 1KR2A 1XZAA 4RY2A 2GBFA 1EUQA 3EGOA 4IQGA 4IL5A 3IKVA 4XCXA 2PSSA 4RSRA 2OQIA 1I6KA 2XT6A 4BKUA 5C8XA 4IIGA 4OB7A 3E3LA 3P9XA 4EY4A 1DRUA 4LHEA 5JMWA 3BXOA 3ES9A 2QW1A 4GEKA 4DSUA 1ID8A 3GT3A 2XVMA 4XOIA 3RRJA 1T4MA 4MR8B 2AMYA 4EI9A 4KIFA 5K8UA 2WAOA 3L84A 4FYXA 4LYDA 1TRKA 3F5DA 2NU8A 1QNLA 3DPIA 3EIOA 4IWYA 3RANA 3KDSE 4QXMA 1KMIY 2IPXA 3U7RA 3UYLA 1AO0A 1GQOA 4L4ZA 2Y9MB 5EJGA 2V6JA 3V1LA 1F60A 1ZY2A 5IAGA 3M5DA 3AP2A 5HZKA 5I9LA 1I1HA 1UDBA 3Q8WA 4PXAA 5LWHA 3SEAA 3TD6A 4WY5A 1ZA2A 4BEVA 1ZCAA 1DEAA 1T4GA 4ZOLF 1RWWA 1SCNE 1TU4A 2C5LA 2Z1NA 2NGRA 3GCXA 3KEGA 3OZXA 3WY9A 3WGKA 4X7MA 3KQUA 1FX0B 2W5UA 4JHLA 1XR3A 4FFBA 5AM3A 3E6AA 3CPJB 4LYJA 1U3DA 1F8UA 1JXOA 1RJWA 4O4JF 3CZ4A 5A3VA 3IJRA 4NIMA 1WUIS 1NI5A 3OPNA 1FUIA 2IKSA 2DBRA 4H7DA 1D2EA 2YVLA 2FLWA 4Q7LA 4ZANA 4CIBA 4HWRA 5I4IA 1X86B 3UJ6A 5JSUA 5K3DA 1L7VC 1OWNA 3CPSA 3GFFA 1CC1S 2HBYA 3ETNA 4BFLA 4ZHSA 4D26A 4O4IB 3I34X 1DJLA 5AW4A 2WWXA 1P0PA 3HM2A 3ADOA 4BJ3A 5CTJA 4FVTA 1IDN1 1OLUB 4G0UA 3TJRA 3I23A 3VH1A 1NBIA 5I9BA 2XODA 4IBOA 3AIKA 2R25B 3Q40A 2B8JA 2W98A 1QZXA 4C6TB 4G5FA 4D0SA 1UMCB 1YJQA 2VF8A 5LMZA 3E03A 5B3LA 1Y9AA 4LHYA 3QEBZ 2ZXEA 1XFAA 2M1XA 2R96A 2AK3A 2HTFA 3GD7A 5EHGA 4UOEA 1QP8A 1OLUA 1DDOA 5J3JA 1JPNA 1XCBA 5ALIA 1T0HB 2EL7A 3DW1X 3GEDA 3PDCA 4QOIA 1NW5A 3BWYA 3BL6A 4B5KA 2FOIA 4LE1A 2XYQA 1E66A 3EXG1 3DWEX 2WQZA 3ELDA 2PKYX 3NG1A 4A0HA 1YV9A 1NF3A 3HVIA 2FMUA 2PS3A 3NHRA 1AUVA 3F5FA 5DGHA 2X9GA 4FS3A 4HNTA 2H4XA 4CEIB 5AVOA 5IRCD 4DCVA 2R5WA 4TUYF 4O2AA 1RI2A 2HR1A 1Z2EA 3PCTA 4QG7A 1QBGA 4O4HB 1F17A 4PG5A 4CV2A 4L0MA 3T7EA 3OT1B 2JIQA 2IV3A 3GVCA 3NYQA 1UM8A 4QPNA 3KIPA 3TSZA 1XZPA 3TRIA 1U7XA 2HDWA 2XSZD 2ZYWX 1X1BA 1N6RA 1EFLA 1SD5A 3AUXA 3E9RA 4UBIA 3AI2A 4IZHA 5SV2A 1XZHA 3H05A 2ZCUA 3KQYA 1XJQA 1TLFA 2B0CA 3EVZA 1JL3A 3LI2A 5K09A 2BJVA 2AXNA 3TQHA 5ALSA 2F9FA 4ALNA 1W8DA 1M34E 1MH9A 2O2ZA 1R6VA 3VNAA 4FMCF 1IATA 1LPNA 2J6HA 3EA5A 3H3XA 4G67A 5EP4A 5EJMA 3UJBA 3GL9A 3NDPA 5JO9A 3RVSA 4YMGA 4M87A 3RVNA 4BL5A 4BU0A 2R7AA 3VZDA 2R44A 3LC7O 4DEVA 1MW9X 1VE9A 5B64A 1KYWA 1MX9A 2O0KA 4HK4A 2AYZA 1Z4QA 1JJAA 4JQCA 1PR2A 3ILXA 3VU9B 2V7VA 2NMVA 1QGUA 4FOTA 2V7TA 3ENWA 4CFYA 1FTGA 5GWXA 5FLYA 3STYA 2E4AA 2R8ZA 5AVUA 4EHAA 1SU4A 5FOUA 3HJFA 3FG9A 3ADBA 2GD1O 4MDHA 2XECA 3C85A 3CGWA 4FFOA 2EG5A 1IH8A 1UFQA 3EBLA 3DBHB 3K4HA 2R79A 5H68A 1RCTE 1Z0AA 3AWDA 4YRKA 1BCRB 4O4IF 2BEKA 4C5AA 1YWGO 5JRZA 2O5EA 2O19A 1PUXA 1U5AA 4LZAA 4RZSA 1XDUA 1VLVA 3MGGA 5GONA 5HJ2A 4PFQA 3FOBA 4AP6A 1B2RA 1LI4A 3GEIA 5G3YA 3E0QA 1EIZA 3EOAI 3LKDA 4JDPA 4LHWA 5CB4B 2GFHA 2PGXA 4OK6A 3KQPA 4J4TA 4G2NA 4MVJF 3UQZA 3WZMA 3JARA 3THXA 3B1VA 1HTWA 1QDLB 1B26A 5EZYB 3V4SA 3THSA 5KYWB 2PY6A 5TEVA 3HB1A 1MABB 2J3QA 5GIOE 4FEYA 3WGLA 2XOEA 3BF7A 5A5VA 2CFRA 3RSSA 5KNDD 1QCCA 2LVBA 3DDWA 3GGJA 1Q14A 3CLTC 4IM7A 4YMUA 5JZ9A 3AHIA 3BSSA 1G6KA 4OI1A 5DEIA 2ZR8A 1KSGA 4W5JA 1NGSA 3K32A 1WMSA 2XOKA 4KSBA 5IXSA 5AJXA 2DPYA 3O7MA 1QRDA 1XHLA 3NUGA 1PNTA 4Z9AA 5JSKA 4E2YA 3ND8A 1YQDA 2V6IA 1YIAA 4KH0A 2UYQA 4QPCA 5ECWA 2A3RA 3W9UA 2WUDA 5HQJA 5JNTA 1NL3A 2KMLA 2A1IA 4QZVA 5K3OA 4LZOA 3B1YA 5BVHB 3PFWO 3V80A 4FZJA 1FFEA 3N2GB 1ZXBA 2W4QA 3DH0A 2WW8A 5DCLA 3LWDA 2AXEA 3VPAA 1JG7A 4B32A 4RA6B 4KXYA 5KJ1A 1E5LA 3UK7A 1WPQA 4BYMA 3KZVA 4L02A 3EVBA 1MXFA 2H5EA 4RLQA 1TCAA 3UV6A 1E7RA 3AM1A 4DIUA 4I1RA 1TQ6A 4BKPA 1DKMA 5IKEA 5IF9A 1DC5A 1U0GA 4RKWA 2A35A 3E82A 2NUBA 3LGAA 3QWIA 1PVOA 3W8DA 3WFZA 2IHYA 4I4TF 3DHVA 5REQB 5GPBA 2FV8A 4QREA 1V8FA 1ZRHA 1LVGA 1T3TA 2O7NA 3GFQA 4H3HB 2L69A 4Z7JA 1AB6A 4DN6A 2DEUA 3H2YA 2R5NA 3DVAB 3DCNA 2BI8A 2PWBA 3I6QA 4KIWA 4KQIA 2PR7A 4NE2A 3T1YB 4DDMA 3Q15C 1R66A 5DSZA 4MKIA 2O8BA 3CZQA 3GRYA 5DU2A 5CDSA 3X43A 3AEZA 1XQ1A 3BTVA 4KN9S 2C8VA 1F8YA 1SUDA 5IAEA 4EG7A 1XG5A 3AH8A 1DQSA 3VZCA 1SB9A 4Y6GB 3RI3A 2NO9A 3K9QO 4QPDA 4ZI5A 4ISBA 4DSNA 5A5DA 1ESEA 1H8HD 5HRCA 5BQ3A 3IDFA 4R0VA 3ZJUA 1G64A 3S4YA 2BM0A 2VTEA 3T5BA 1U28C 3E4CA 1Z0ZA 1VLLA 1Z2AA 3TSYA 5DOZA 1QQ6A 4G0OA 3KZCA 5CA0F 1PGNA 1S02A 1WAMA 2I4RA 4KXNA 4M22A 1GNVA 1Q91A 3TTTA 3DB2A 1CRLA 2B3DA 3A9SA 1E3IA 2WSLA 1Z4MA 4OAQA 4RD0A 3PLAE 3UANA 2BKAA 3G2QA 3LCVB 2XMDA 1E3MA 3AP3A 1SZCA 1E6KA 2GCEA 4YS6A 2FF7A 3ANLA 1HG0A 4BMSA 3QVWA 1WCV1 4HF7A 3W6NA 2HW8A 4B3SB 4I55F 3WMEA 4JXJA 1UEIA 4W5QA 4CUKA 4W9RA 4XXHA 2HF8A 5GY7A 2NW6A 1ODTC 4GUAA 1FDSA 4D9KA 4Y9RA 1O94A 4D99A 3PD7A 3TL2A 4ZHQF 1AQLA 1CUZA 1K4MA 3FFTA 4TQAA 5ALKA 2UVQA 3HWWA 2C5AA 4S1VA 3WAKA 3FZNA 4YV1A 1ZDMA 4TQUS 3F8TA 5IBPA 4CLRA 4DZTA 4EWLA 4AB1A 4HDSB 1E6CA 2JLBA 3OZAA 4UUNA 2BN4A 2XE7A 2PZAA 3OOWA 3ZHYA 3GGPA 4B33A 1Y7TA 2ECPA 4ID3A 5C53B 1TCCA 3DL7A 1LC3A 2GYUA 2J1LA 3FWHA 4LDQA 2MCFA 1E7SA 2EP5A 2WG1A 3O4HA 4OB6A 2H1WA 1V25A 1AH2A 5AHRA 1RYZA 3ET5A 4Z9YA 2F64A 2DUMA 4G09A 1JKJA 3ZXSA 2RGGA 3F73A 1MEEA 4DV4B 1NASA 4H6PA 5IUNC 4LF7B 3C5WP 3KKNA 3KLPX 3MQ2A 2VUIB 5CU7A 5K1ZA 2XE6A 3DE5X 3DTTA 1YF3A 2HSWA 2JIOA 3ESYA 1OKKA 2A33A 2ATEA 3HNOA 4OHVA 1EE1A 5DOVA 1W36C 1UCFA 2VRNA 3O8NA 4JUDX 2JH8A 4R2KA 1W47A 1E7QA 1O89A 2PXAA 2P6NA 3BZUA 4HMPA 3VISA 3GELA 2XZDA 3JD0A 4CXMA 1WD7A 4LGVA 5COBA 1HNZB 2PH5A 3A1NA 4IIYA 4GWGA 2X1MA 4G1VA 3R4VA 3EDMA 4QO7A 4CVNA 2H1HA 1WDTA 2AWNA 1M5RA 3CE6A 1XU9A 3V46A 4XE5A 4D98A 3EQZA 4YGYA 3SG0A 4A2QA 4F12A 5KU1A 4A0QA 4IG9A 2UVPA 2G0AA 2NZXA 1CUVA 2PSHA 4M1TA 4WINA 5PNTA 4G4JA 3CCFA 1OHHD 3B6EA 5DCWA 5TRTA 3UAWA 1W75A 3MPUA 4HYTA 5AUNB 5L7WA 4TLDA 4RZXA 1Y6FA 3WIDA 4F72A 4RTKA 3G0OA 1C7EA 4EPRA 5K9ZA 3LC0A 5FNVB 1E1DA 4YONB 4IS3A 4HKTA 1TO6A 5I45A 4NLLA 3JSAA 4BNGA 3DF9A 4Y6LA 1IY0A 2Q8NA 2VQSA 5LQCA 1JQBA 1KARA 2ZSEA 1N2GA 3DE1X 4G1MB 1B74A 1GO2A 5T4HA 2FG5A 3IOMA 2PUDA 3AK4A 1H2HA 1TZMA 1H2ZA 2YCBA 2I7VA 1FXSA 4U2BA 3CIFA 4UULA 3WGNA 4C0BA 2KBFA 3ODPA 4F4HA 4UMEA 4JUCA 3ZE6A 1X6VA 4RHFA 2XB9A 4KAAA 3VPXA 1KL7A 1JMYA 4WSOA 1RRGA 1Y81A 3A2LA 4JJFA 3T1NA 2CD7A 2H2GA 2YXBA 1N2XA 4RQAA 3CISA 1SXJC 3KZXA 1NQVA 4G86A 1X9GA 4MKXA 5J59A 2OCBA 2D8MA 2FW8A 2QTZA 4KVAA 2Q5EA 2YN4A 3CONA 2X0NA 1HSZA 2BZ1A 1L7XA 2OCGA 1AM4D 2NWQA 2VPWA 2Q45A 2YIVX 4ZCTA 4REQB 3FMVA 2NQ2C 2Q3LA 3WGMA 2PSJA 1ETUA 1PJ3A 3B6JA 2COKA 2YW2A 1SHTX 4ENVA 1E0KA 2A9VA 1IJEA 2ZI6A 2RAVA 3WNBA 5ITSA 3UT5B 1SCKA 4AZ3A 1WCIA 4Q37A 4FXPA 1Z0FA 1XO1A 3OZFA 3SX4A 1FB5A 1G8FA 4ENRA 1JWAB 2QVXX 4ZAVA 3B1KA 1HXHA 5MGNA 4K0KB 1EFDN 1GG2A 3V5NA 5HIIA 1J8DA 4BNWA 5JHHB 3V2GA 1ZP6A 3F3MA 3G5AA 2IK8A 5CHEA 1SVOA 3CX3A 4PZ0A 5H9VA 3RBAA 1LRJA 2PL9A 2IFTA 1JZTA 6REQB 2D5BA 2JAPA 4B48A 4JVLA 2VYVD 4D3FA 3DFMA 3NIGB 3GLTA 3KT6A 1TQ2A 2EJBA 3HCFA 3I04M 3X1JA 2ZIFA 5BPFA 1U4OA 3O93A 1VIMA 3H86A 1S7GA 2XVXA 3ZIAA 3CNEA 4PYQA 2QVCA 3DBLB 4MS3A 2EU8A 3UMVA 4INAA 2CNKA 2KQUA 4YMHA 2HHJA 3H0CA 4IUBS 3ZUPA 2BAGA 2O8CB 1B15A 5JXHA 1BXRB 1Q5PA 4NENA 4Y2UA 4QU8A 3CWCA 2C4KA 3A27A 3C43A 2D1RA 2FI1A 4RQUA 3LDHA 5CT6A 1OIXA 1YB2A 5IN4A 4R3WA 1UZMA 3ORHA 5H3LA 3RC7A 1A7UA 3EPJA 3I4FA 1P7VA 1L8AA 3GRVA 3UMGA 4HFMA 1JRLA 3FFAA 1WQ3A 2J7PD 2PWAA 5FUBA 2F1OA 4XDHA 3SHFA 3UVEA 3BJMA 3OJOA 3DE4X 4NNPA 4R8LA 3UJ8A 4X8MA 2OCKA 4QUAA 4BE7B 3UMMA 3RK4A 5JTTA 5LDHA 1ZD4A 4MRVA 3UKDA 3E7PA 4RS4A 3K5IA 4H1WA 4C0HA 2GN1A 1QHNA 3KHKA 2NM0A 4Z54A 2R8EA 3JQQA 5EFOA 1U2PA 3I6ZA 1TLLA 3ICWA 3O26A 3MJDA 3JQFC 5H9WA 1ZL2A 3LA8A 4Y67A 5FUYA 3N0TA 1ECPA 2YHIB 1VE1A 1EZ4A 2Q2WA 2N47A 3FRHA 3A0UA 3DEFA 4L5YA 1XMVA 3VJMA 3R41A 4A73A 4YRLA 3JQCA 4UTPA 2HI0A 4RC9A 2HL6A 4H4EA 4MICA 1PZEA 2W2KA 4GPTA 2Q07A 3I8XA 5DLDA 5HE9A 4J2OA 3V3TA 2IEIA 2BFMA 4D25A 2QSYA 5DYTA 4LJ6A 1H2YA 1Z17A 1IOZA 1AG9A 3DDCA 2FPGB 1I14A 3OX3A 4Y9DA 1CLUA 2VLBA 3DTYA 5A3QA 4HGNA 3UV7A 1YTLA 4W82A 4XX1A 3ESRA 4HAOA 1G16A 3L4EA 3PU6A 1A9OA 1NT2A 1R6AA 5HFJA 3IT0A 5EQTA 1GRVA 1VE5A 3L02A 4RVSA 1EFCA 3ML1A 2QTNA 5F2NA 4E46A 1KU6A 2J9YB 2XDQB 2F43B 2MYTA 5KI6A 1LDBA 3IB6A 4RDXA 3Q72A 1C4WA 3SR4A 4D45A 4PLHA 2KBEA 3PKJA 1G9TA 4Z4QA 2HY7A 1C3VA 2JAHA 2QTWB 3BD6A 3CRMA 5IJZA 2CZGA 5IVPA 1INLA 5DHPA 3E9EA 4ROTA 2BRUC 1ORTA 4YC7A 3G8BA 1P1HA 2R11A 4K81B 5E4JA 5LA6B 5JAPA 3FGZA 5JTUA 2XMSA 1GPWB 1MD9A 1W52X 4HGZA 4IOKA 2LE0A 4Q1BA 4BOYA 1VOTA 4D42A 3AFGA 2EZ9A 4GM4A 4WZBB 4LWOA 2PMDA 3X3HA 1BCSB 1DIGA 5AM5A 4UPVA 3A9CA 4FZVA 4HNGA 3UW1A 3HVUA 3L7IA 1KXJA 1R9GA 1PLLA 3IR6A 3GDFA 1V7ZA 1II9A 3QFRA 4RA6A 1T5IA 3RC9A 3AVYA 3R9XA 3P4XA 2UZ4A 4V02A 3W1EA 1NWHA 6PFKA 4B34A 4M1OA 2R7LA 1MP0A 4IP0A 1U80A 4WZAA 2I33A 3H9QA 3T94A 3ISTA 4QVIA 2CLIB 2M1ZA 4H6WA 2CL7X 4FDUA 2H9IA 4U2EA 4DLYA 1P7CA 5ENVA 1B73A 2JC3A 4L7VA 1O5OA 3UF0A 1OGYA 2Q1SA 1LBHA 1GVNB 4JYMA 3FPHA 3LFTA 4XQGA 5AJYA 3BIXA 4DJDC 1E98A 1LTKA 4KI7A 2NVBA 3RTGA 3ZUGA 5C5IA 2HXYA 1IXSB 1G3RA 5E6RA 2VR1A 4IDAA 2IS6A 4ERNA 3GMIA 2B6HA 1WUJS 1ZIOA 1SIUA 4HR7A 4J0IA 4OIMA 2CYBA 5CX4A 2IU0A 4A27A 1KHHA 5JNLA 2PLRA 1I0IA 4LSGA 2H07A 5JSYA 1J97A 3UHJA 1QDUA 2QNBA 4U2GA 4V24A 1QH1B 2IC5A 3VR5D 3BGVA 3EB9A 1J8MF 4B82A 1C3EA 2FSFA 3JARB 3KD2A 3ZD8A 4C78A 1XA0A 3VV3A 5JG7A 1AQYA 1X7DA 3ZGVA 2YMPA 4Q24A 4WZAE 4LRUA 4PAOA 3LVRE 3R5XA 3IEMA 4AJ1A 5EPOA 3Q3VA 1C80A 1V11A 4H1VA 3M8KA 3ZDAA 5KC8A 2HCBA 5EFZA 1H0HA 2I4MA 5KKAA 3TTYA 3I9V6 3DBIA 5TQ0B 3G2HA 1NQTA 1NVUQ 4CCYB 1GPBA 4FOOA 2QYOA 3BTUA 3CE9A 4LXHA 4ZXPA 1NNEA 4UBKA 4JVMA 3AF6A 4B2PA 3JAKB 5LXTF 1FSSA 3M6IA 1OBCA 4HVTA 2ZAOA 1IWPB 2WOOA 3RJTA 1V5EA 1AS2A 2RKOA 1RJ9A 3MCVA 1XPUA 2J08A 1BS2A 4Q4DA 1E1QA 1A4XA 4XJTA 2WT4A 4A16A 3F5SA 2WQ7A 2A0UA 4K2HA 4HC4A 2DPHA 5EIAA 1JLRA 3X2EA 3BWMA 4JQYA 5FJJA 4CZ2A 3BT7A 4WOBA 1KFEB 3DV9A 2XNDD 2OV8A 1TI7A 3V7UA 2V74B 2BKLA 2WRZA 1N1EA 4NEHB 4DA6A 2JVKA 3BCUA 4A2WA 2C4TA 3N5KA 5EN4A 2FFQA 3DE7X 3EVDA 1XRRA 3GEGA 4J7XA 2UZAA 3OEWA 5ER6A 1JFFB 1LZKA 2QUHA 2SKCA 1U6KA 1N6OA 4RBNA 3P2OA 4EYSA 1A98A 3AILA 4KFCA 5ILQA 4X3PA 1QXSA 3UWOA 2QDXA 3OT1A 1GZSA 3Q41A 3U2QA 1YR3A 3USZA 3G5MA 2REOA 1L5GB 2I3ZA 5A4DA 4JJKA 4R0NA 3PYMA 1SBYA 2B78A 4Z51A 1L5ZA 2A67A 2QTRA 4GX2A 1OFGA 1M0SA 3V4FA 1G4HA 4MINA 2A59A 1E5QA 4ZCPA 1PTJA 3MWDB 5ED4A 3S2YA 3ZXYA 1YVEI 3WRVA 4KXXA 1U1IA 4NBKA 3V4LA 5I9IA 5FI0B 5EAIA 3KSBC 1L2TA 2Q5OA 3ICOA 4FWTA 4NC9A 3U7JA 1DXYA 3NT5A 5J58A 3P1JA 2F3QA 3GWGA 4ESOA 1W73A 1ISGA 1E2FA 4KN8A 3L8FA 5DM70 5D1NA 4M9XA 4JFAA 1CEXA 2CLFB 1PGQA 2DWUA 1BX3A 1JJVA 3TOSA 3N58A 3ZHTA 1FU4A 3WXBA 1RBQA 1PK8A 1SQ6A 3G7SA 2C9ZA 5LZ8A 4YAFA 3OFVA 2ZUDA 2Z95A 5AQ1A 1SOMA 3MYRA 5FADA 1E5DA 1JEOA 2CSUA 3SHQA 2G76A 5FO1A 3VTKA 1TYAE 2ANBA 5A3RA 3HXQA 1Q3HA 4OSPA 1I51A 1L5KA 1FUYB 1DAPA 4IS2A 1H2FA 4E22A 4ZYUA 1LQUA 1M6EX 1Z3CA 2CLKB 4PO3X 1MABA 1GTG1 5ALQA 3FNFA 4EGAA 1F2DA 4C1NA 3OU7A 4KQEA 4BFVA 1M2VA 1W5BA 5IG2A 1D6NA 3AY7A 5AI6A 4YRPA 4ESVA 1OH6A 1P4HA 1RQRA 1FNDA 2I6TA 3QVTA 1DBWA 4KDCA 3AZOA 3HYSA 1PG5A 1MOPA 4MX8A 3WL3A 3DBOB 2Z2YA 3ESBA 4FFBB 3N2ZB 3DO5A 4MV6A 1P6XA 3VA7A 3RSGA 4D82A 3G9QA 5C8ZA 1K92A 1G63A 1WEKA 2FFRA 3ED1A 4LXUA 1S1MA 4MHOA 5ALXA 1U04A 2GNOA 2IOQA 3AW9A 3B8HA 4EVQA 521PA 2C7OA 3DM9B 4DUGD 1XLVA 1T0IA 2MR6A 1D2GA 2O0JA 1C7RA 4UUQA 4X3OA 3SR0A 5CA1F 5ICCA 4C9BA 1G17A 3DT8A 5H3CA 1DLJA 3C24A 5T4EA 1WZNA 3IHLA 2QPOA 2C9YA 5IK2A 4ZGWA 5JECA 1U2DC 2BUCA 2DQYA 4PO9A 1ZJWA 4YRDA 3EJ6A 1HRKA 2HJGA 1OWOA 1L4GA 3LM8A 4I1UA 1FXWA 4DJEC 1EWQA 2FN8A 1F0NA 2NXWA 1B43A 2QQGA 3U1TA 3MRTA 4Q6WA 1QX4A 3GQVA 1XRSB 5CDGA 5JLJA 2HZBA 3KLNA 2ETVA 3SSOA 2WT8A 5ISMA 5T3UA 2EEPA 2QGZA 2HNKA 3EYAA 4KOAA 4PN7A 1SA0B 3RYHB 1ORRA 4PIPA 5B5SA 3IAM6 1M5TA 1TCUA 2JS7A 2Y1CA 4A91A 1HR0B 1HY3A 4BV2A 4YIHA 1N9KA 2JK1A 1J42A 4UMDA 3V4ZA 3GVXA 3WVNA 5IBQA 2QQ0A 3BQ9A 2IYSA 1Y1PA 3OM9A 4R6WA 2OV3A 3TLJA 1OU0A 2E37A 3UICA 3ZJYA 4WBNB 2ZM5A 1SKYE 5CLGA 2Q0XA 5IAJA 3O2QB 4C5CA 4YAGA 1S2DA 4LRYA 3P9ZA 4MUYA 5AICA 4X60A 1XD2A 1F14A 2CE2X 3Q3IA 4R2JA 4A0GA 5L51A 4P3YA 5ARBA 1DEOA 1S01A 3KQTA 4HDMB 4LWPA 4AJPA 1UKCA 2C0PA 3MCAA 2EW1A 1N4DA 1NYLA 1RR6A 1YRLA 4HG2A 4IXMA 4L2IB 4MDYA 1TMOA 4QX6A 5CVEA 3TQOA 4DV3B 1P45A 2RJ3A 2R6ZA 2ZRQA 1AKWA 1NBME 4KO1S 4LMBA 3L7AA 4B1FA 1PS9A 3CRQA 5JDCC 1CE8A 2Y0PA 1D04A 3DL0A 2DFPA 1I4LD 3GRUA 4WFKA 4EJ6A 3GA5A 3T7AA 1Z9BA 1YRQA 2RB4A 2J6IA 2ZJ4A 2UV8A 4F8JA 5HTOA 2PUEA 4YAKA 5J2TF 5KNCD 1FZTA 4IIHA 3I6IA 3QYFA 3R7FA 3I04A 1WA5A 2PS1A 1WULS 2O8VA 2RHMA 3IRVA 3K4PA 2GNAA 1CVRA 1HLFA 3WDMA 3KPUA 5I9NA 3D3QA 3GJ3A 2DY1A 2HOQA 4HO1X 4NL4H 5CR9A 4FQ8A 1OA1A 3GLQA 2I2DA 4PRZA 2ABWA 3BWCA 3A06A 3RRBA 5JWOA 2VF7A 3C3MA 2QAJA 1AJEA 1D1TA 3F2IA 1QQBA 3ZQUA 3ISVA 4RSMA 5KYYA 1E9BA 5EHZA 1MB9A 5IAOA 2IPOA 1E62A 1P62B 4L6IA 1XMSA 1IXRC 1ACJA 1WVGA 4R40A 5EXPA 3OTOB 5FF9A 1SG6A 5AHKA 3EF0A 3OZDA 5IT5A 3C3BA 3ZE0B 4LMPA 4EUSA 5L6LB 4WNYA 3WL8A 5EIXA 4RK5A 2K7FA 1AZWA 2Q3MA 1C30A 4F5YA 4C7OB 4LY9A 1NXOA 2OR3A 4FD3A 1ZR4A 2E4UA 2VJYA 3KR2A 1P2UA 4R8KA 3ZDYB 5F9FA 2FP4B 1Q0RA 3L0BA 3IRUA 5DSXA 3W5BA 1TX4B 5AI8A 3WIVA 3ZCTA 2V0GA 1YK0A 3MTIA 3FF1A 2AR9A 3PF9A 4NG4A 1KIMA 2XVYA 3VR5H 1NYTA 4DCOA 5EJ6A 1XOIA 4CTNA 5JCPA 1WHSB 1AZTA 1TEXA 1T6XA 1AKVA 1BDIA 4J1TC 2WSMA 2AFVA 5CFQA 3HCNA 4GBGA 3W3ZB 1YBFA 3HWSA 3F46A 3KPYA 4D92A 1AKRA 4GXNA 2HU8A 4LZLA 3I05A 1K2WA 4FJ2A 3R0XA 2ESRA 1YB4A 3JCZA 1NBEA 3K0CA 3FKSA 4LN1A 2Z1MA 4UM9D 1HPLA 1B23P 1MUUA 5M7EA 1XC7A 2X3UA 3O4GA 1NUSA 4LJ5A 1N6IA 1JGTA 1RAEA 1WRBA 1XTVA 3Q3CA 2OFXA 4OFWA 4P98A 1OBOA 4YUAA 3RRYA 3EWNA 4JJ7A 2XMQA 4CRWB 1R4MA 5ED0A 2C3OA 1QE3A 4KZPA 2VJOA 4PEVA 4U2KA 2I55A 5FXMA 3OFNA 5EIFA 4JT8A 4RH3A 5J1SB 4YPOA 1T2VA 3ADKA 3HXLA 1XMJA 1RHQA 3OLVA 3WS7A 3OM1A 1XXLA 1FTQA 1DBPA 2HCFA 3VUFA 1R16A 1RE1A 1L4EA 1NUUA 4FLMA 1ZMXA 4RY8A 4LOIA 3EODA 5EGNA 1FDTA 3RRMA 3OCCA 3LY7A 4IRXA 5FQNA 1C3OA 2ZS9A 3CH5A 3SK0A 5BOSA 3K0BA 3EHEA 1G3UA 4M0UA 2VJMA 4KMRA 4U0JA 4YRZA 2ASVA 1P4AA 2FWIA