5ED0A

Structure of the shigella flexneri vapc mutant d7n
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
132
structure length
132
Chain Sequence
HLKFMLNTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHTGQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords tRNA(fMet)-specific endonuclease VapC
publication title Structural analysis of the active site architecture of the VapC toxin from Shigella flexneri.
pubmed doi rcsb
source organism Shigella flexneri
total genus 54
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01850 PIN PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 5ed0A00
3ZDEA 1YE5A 1A76A 1TFRA 1TAUA 5ECWA 1V8PA 5SV2A 1V8OA 1Y82A 1TAQA 2H1OA 5HNKA 3TNDA 5HMLA 3H8JA 3H87A 3QE9Y 1UL1X 1W8IA 3ZDCA 5L6LB 1EXNA 2DOKA 3Q8MA 5ECYA 4XGQA 4WA8A 2LCQA 3ZVKA 5K8JB 3H7IA 1UT5A 2FE1A 2HWWA 1BGXT 3QEBZ 5ED0A 1RXVA 3ZDDA 3Q8KA 2MDTA 3ORYA 1XO1A 3Q8LA 2IZOA 3H8SA 1V96A 2BSQA 5L6MB 3DBOB 4MJ7A 1O4WA 1A77A 3I8OA 2HWYA 2HWXA 2QIPA 5HMMA 2H1CA 2WP8J 5H4GA 1RXWA 4XGRA 1B43A 5FV7A 1MC8A 1UT8A 5ECDA 5HP4A 2IHNA 3ZDAA 3ZDBA 3H8WA 3IX7A 3ZD8A 3QEAZ 5H4HA 3ZD9A 4CHGA
chains in the Genus database with same CATH superfamily
1CZLA 1JIVA 5FPPA 3IJRA 5C1OA 3R77A 1ULZA 4I6GA 3JQ7A 3RU2A 1RQNA 3GEPA 3EMVA 3VQTA 1P5RA 2AFIA 5SICE 1CDZA 1MC5A 1BWQA 4FR0A 1TPYA 4ND5A 3SLGA 4UHHA 1ZESA 5GQSA 1XTIA 1P2DA 3TDNA 3LDFA 4KIJA 1YB5A 4BATA 1ZAYA 1UAGA 5LP6C 3D3QA 2F1RA 4NAVA 4JI4B 1Z4JA 2ASVA 1OZAA 3QXCA 4RTQA 5U9CA 1OXVA 2XSZA 2X0FA 5KTPA 1QO7A 5EXDA 3W2TA 1GPWB 2TSYB 5EZSA 4YCCA 5IBCA 1F9EA 4N0QA 1NFQA 2PGAA 4PLTA 1S3GA 1UXJA 1WBJB 2RHRA 3F6CA 1ZWKA 2P9ZA 1WDTA 3LUPA 1MZVA 4X8MA 3OA2A 3JZFA 3KTAA 4XCXA 2IOYA 2QRZA 1ZNQO 2EF0A 5CDHA 1FZTA 2I5PO 3EGVA 2JZOA 4DGSA 3FMIA 1I4WA 2JLXA 1SKYE 2XZPA 2RGYA 3V80A 2RGBA 1OH6A 4WLOA 3O3MB 1E18A 4WOCA 5CVTA 1JJAA 2M6SA 3N2ZB 4M0KA 1Q1ZA 1CVRA 2Z1MA 3JZAA 3QH4A 1KI4A 1A88A 1XQ1A 1P2SA 2FPSA 2WKPA 3COZA 5JCPA 5LZ2A 4UUPA 2CT8A 3G9ZA 1T24A 3R6WA 1X8JA 2W2PA 2Y1LA 4BKQA 3ICQB 1IMOA 2BBOA 2SHKA 2BKEA 2V0CA 3MGCA 4M8IA 3UKDA 3M1YA 1XE3A 1DO0A 3PLAE 3P7MA 3RM3A 3BIXA 1PE0A 3U3DA 1BROA 4PFSA 3TKYA 4IDHA 1NN5A 2AWNA 2WTXA 2Y71A 4JX8A 2WRZA 3PC2A 4OFWA 5KWVA 2J0SA 2DMRA 4YJ3F 4BNLA 4AY3A 4H1WA 2DWUA 1JWBB 4TVSA 3E9QA 1TU3A 3W6OA 3LECA 1JLHA 4I4NA 5HCIA 4J0KA 3KRTA 3UVEA 3QVKA 4XDYA 2ZYWX 4BGVA 1GU7A 3EARA 4RGBA 2QTAA 1C0IA 2JJ2A 2CLMB 3H5NA 1UMBA 1NVAA 1X13A 3CV3A 4M6WB 5ECGC 2NN3C 5FL3A 2C2MA 1E6CA 2Z30A 2Z43A 3IMFA 4OHCA 4F86A 1RC8A 3URMA 4LF5B 1EX9A 1X1TA 2J1LA 4AZSA 4CLRB 5HZGA 2PWYA 3MOIA 1CQIB 3A6LA 4MA0A 5ICCA 2V1UA 3HFJA 2PU7A 1IN7A 4QNMA 1H1DA 1KZGB 4KFCA 3BB4A 3DDSA 2FLWA 5CRIA 5EIWA 5U4QA 3T54A 4YWHA 4D8UA 3M81A 3NC1C 1JQLB 4LHYA 2R96A 4QUEA 3UG6A 1PT9A 1M34E 1VJ1A 1CETA 2J59A 4FJ0A 4UU8A 4BNJA 4RANA 1BMDA 4KLZA 1XG5A 4CEIB 1KQPA 4Y6OA 1SVSA 3L43A 2W6ZA 4M46A 5CXQA 1FTYA 1W85A 5K45A 1L4GA 3ZVLA 5CT5A 2V03A 3B1KA 4E46A 2NO4A 2OOSA 2X0JA 5FOUA 2WZDA 3ADCA 5E3JA 1KVQA 1UFRA 4JIMA 4R8RA 1U2TA 3BWYA 2H4WA 2V58A 4JBLA 3EXHA 2QPTA 1C50A 3LGAA 3NHYA 5IHXA 4NNPA 1OROA 3MTQA 1OHHA 2FEAA 3G2JA 2LRHA 3HACA 3QIVA 4L8WB 3T3EA 1WP4A 2J5XA 4X92A 4Y18A 4AO8A 1QF6A 1XVIA 3ZV7A 4DBVO 1IN6A 2BN4A 1YE5A 1ZITA 1G4HA 2WU1A 2V6FA 4JWKA 3EVCA 2CXHA 2XA1A 1QGYA 2WTEA 5IAOA 2MINA 5ICSA 3B38A 1Q91A 4HBZA 2E4ZA 5B58T 3ZZTA 3PDIB 3PICA 4IVPA 4ZJUA 4RIHA 2H1OA 1BWSA 3LX5A 2Q2NA 2QLBA 1XCMA 3RYCB 3C24A 4WNAA 4TWRA 3V1KA 2OPHA 4A27A 2FWBA 3GEIA 5DI9A 5AJYA 4MYUA 3TYXA 4ALIA 3MXTA 3D2LA 4IWYA 2BI8A 4BNFA 3Q3VA 5ECYA 2IOFK 1Y6ZA 2ZVJA 1HTWA 4I6JA 4UAJA 2M2IA 3K20A 5IN5A 3OZAA 4NLLA 4DBLE 1PFUA 1Q1QA 1A9ZA 1BHO1 4CKWA 5K6RA 2FGJA 4YTEA 2RE8A 1LDMA 3HUDA 1CEQA 2GVDC 3D9QX 1G55A 2AMJA 3FDIA 5EKSA 4QULA 1TJ3A 2G6TA 1PTJC 2EZ8A 3ICWA 3M6MD 1OQAA 4WEOA 5EINA 2OC9A 1GUYA 3R7AA 4EJSB 4NS1A 3HVUA 1NONA 1MNQA 4IJKA 1CW2B 4ENWA 2R6HA 2BOVA 3G6WA 2P1RA 4G1VA 5KNCH 1JN0A 5CX1A 1Q0UA 4H3SA 4YDHB 5JZVA 1P7YA 1U1EA 2YRXA 2ZIAA 4RM3A 1Y5IA 2RMKA 1PK7A 3L8YA 1AG9A 1X9HA 4K81B 3X1DA 4EPTA 5JY6A 1GQYA 1IXSB 3BREA 4YJHA 5BV1A 1GPBA 4GI3A 4B46A 1GTJ1 3T7KA 2B36A 4BCCA 1V0JA 1OOEA 4E5NA 2OD2A 1XWIA 1Y6RA 2FPLA 2JCYA 1J8FA 2JD0A 4XFKA 1CXZA 3W5BA 2QRPA 2F1KA 2VHTA 3ZCSA 5EIBC 4LRUA 1QCYA 2OG1A 2QL7A 3AUUA 3I1YA 4P3KA 3ZHZA 3GQVA 4M98A 5BUQA 1G42A 1PJRA 4HPJB 4LZJA 1VCOA 5TV2A 5IJ9A 5BMOA 5AVWA 4GBMA 1SC3A 4M99A 5KKNB 1Z82A 2ODBA 1KVUA 1JKXA 4DNOA 2F4VB 3QMWA 1DAGA 3R6GA 1J97A 1TX4B 1JA9A 3A11A 1YZLA 1YZGA 1ZMRA 4N0MA 5J2TA 2RAFA 5G41A 2FQQA 1RACA 1TEZA 3DEKA 4GI1A 1T5HX 3D6UA 1CUEA 3M6WA 5EWLA 1L7AA 4B4WA 3IAEA 3GRVA 4UBJA 5KINB 1JQ3A 1GZ4A 3TR0A 2ZCJA 1C9NA 5FUBA 5ELXA 1VJ0A 1H1TA 4KQ9A 4LJAA 1Q17A 1IHXA 3AI1A 4ZC8A 2WA1A 3V2IA 3UJCA 3I52A 5A6SB 3BRQA 2Q2VA 2WM8A 1P5HA 5BSRA 3GEDA 4E5DA 1DINA 1HDGO 3C8MA 5D3QA 3RK1A 5EVCA 3X44A 3GJ3A 3DEJA 4F5ZA 3HGMA 4O4IF 2QTBA 5T41A 4X7RA 5CW1A 4QGHA 3L8DA 4AU1A 3T7TA 1RC0A 2DJIA 3I1JA 1QHGA 3Q3JB 2QJTA 2O59A 2E7ZA 1OXSC 3PA8A 4TROA 4MJLA 1SBCA 3NBXX 2OHXA 2BY4A 1BIFA 1ENOA 2R1VB 2WJAA 2ZDGA 1Z2OX 3AF2A 3FSJX 4WCFA 1U0LA 4QYWA 3TO5A 1NI4A 3P9NA 3L40A 3CNOA 3SXUA 4EJMA 3THOA 2V8OA 3K9LA 1BEUB 1ZSVA 2F1JA 2VNAA 5KOJA 3GNSA 2REXB 2R6CA 4RKYA 2GJ4A 4E14A 4JYPA 3C6MA 1QC5A 2ZSIA 1B6RA 2P4UA 1SH7A 2P2ZA 4W1QA 3RQIA 3CCCA 4X00A 1UZNA 1Q6YA 1RLJA 1OWLA 1Z3CA 2KJQA 2QP9X 2O2CA 4DA8A 3NH9A 2WINI 5BNZA 2FV8A 5JC1A 5BPHA 1KIAA 1LQTA 4RWEA 4B3RB 3HWWA 3FFXA 2DFNA 2O48X 5I01A 1SKYB 2ZIUB 1IQPA 2Z1DA 5JCOC 1TLTA 3CT4A 3FWYA 4JEIA 5AKEA 3AEQB 4JQZA 1XZAA 4TTTS 1ACMA 1J42A 4EF6A 1DG3A 3D1LA 2MJLA 5I9LA 5CT8A 1B73A 1NY6A 2XQKA 3RSOA 3CUTA 3C6BA 3VKFA 1CY1A 1YI0A 3HA5A 3JSAA 4LJYA 4D9HA 3GH1A 3JALB 2HADA 1N7GA 1QCDA 2VP3A 2Y92A 6REQA 1K7FB 3OC6A 1QB8A 2J5BA 3SZGA 4TS1A 4CGYA 4GQBA 4CMEA 1Z6PA 4ZCQA 1XPOA 4JBHA 2CB0A 3BQ9A 3S8MA 4HH3C 1VCNA 1E8NA 1TNDA 1WXXA 4D57A 3OIGA 1R9NA 4Y2UA 4XQCA 5EE3A 3CXUA 1TC2A 2E1PA 4V03A 4EPYA 4FN5A 4KIWA 5DLPA 3TUIC 2YASA 3FROA 1ZEJA 4F2DA 1JHPA 2NACA 3GJSA 1R5OA 4V0NA 4A92A 1XLTA 3IR6A 3ED5A 5JXHA 1RRGA 5GY7A 3WDKA 2JHPA 1A9OA 2WUDA 5H1YA 3C3BA 3DV0A 3B85A 3N2GA 1JKFA 4M0MA 2WTNA 4HTAA 3RJ5A 1E2MA 4HDKA 2OHIA 2D3TA 3FMVA 3ACCA 3CX3A 5IKEA 4BBPA 2O3SA 1FYXA 5HDBB 2VRWA 3CZMA 1JHRA 4GLOA 1L8XA 2BM0A 5DJ5A 2CN1A 4DC9A 2QG4A 3FPSA 4UDOA 3KTFA 3GDOA 3M7IA 1N57A 1WR8A 1RWVA 3BXFA 3BF7A 2PZLA 1M34B 5H16A 1SB9A 1LF0A 1O89A 3AM5A 2JAHA 3K7EA 3PS9A 2I1LA 1W9MA 1OLSA 2YV4A 4Q48A 1M8FA 5FTLA 3OD5A 1G8FA 2H4HA 3G89A 1B00A 2BBSA 3NGMA 4CV2A 3HCEA 4ER3A 4MGZR 3PTAA 3ZDAA 1FY2A 4CMIB 2QN8A 4EB6A 1L5ZA 3QG5A 3UWPA 1Y9EA 3OF2A 3Q7IA 4D9BA 2GTPA 2Q45A 3C7DB 3ZWXA 3OCJA 5ALZA 2GCPA 4FYIA 5BYBA 3TUJC 2BBWA 2EYUA 2H2HA 3NR2A 2C5EA 4KLCA 5C4MA 2A4MA 3E58A 4RTSA 1DXQA 4JCOA 2GAIA 1U8XX 2PSEA 3AG5A 4Q18A 3WE7A 4BQOA 5JU6A 1ECGA 5EZ5A 5CHYA 1RLMA 1SO8A 4R2LA 1UBLS 4B6QA 2ZJ3A 2QW1A 4LY9A 5EHQA 4DCVA 4UXJA 4DS3A 4P2GA 2JS7A 3P4UA 3SJAA 7AT1A 2XRZA 1KEWA 3E7FA 2IF0A 3DUFB 4IIUA 4CQMA 3T5AA 2W6IA 3AG6A 1Y63A 3AETB 1G16A 3G5LA 4Y3UA 4DR1B 1CUJA 3B7WA 2Q07A 1L7EA 1ZVJA 1B8UA 1YAHA 1VJCA 4MLZA 4MVJE 2XSZD 5DLDA 4TV9A 2CMFA 3HJGA 4MRMB 3KWFA 2GD1O 2WG2A 2FP4A 3TW8A 4LXQA 4QDUA 1NBAA 1II8B 1N3YA 1RZVA 1UPTA 1VQ1A 2F9LA 2PLRA 2VAVA 1U3TA 3I5MA 3RF7A 3USES 3QUQA 1MGPA 3V4ZA 4YUYA 5LPNA 3LC0A 3HB0A 3QVUA 4L3WA 5K03A 2ZSJA 2RGGA 3MYRA 4Z0TA 4D82A 5BWLA 5KTNA 4YONB 2JIRA 4KXXA 4ZPXA 2ZKLA 5B3LA 4IYJA 1H8EA 2QUAA 3ADKA 4HFMA 5BVGB 1LBEA 1NL3A 3T1YB 1H2FA 3R6LA 4BP1A 2IHVA 1N32B 3JQFC 3K8QA 1ZI8A 4C4YA 4EI8A 1AH2A 5K2MA 1K97A 1XFDA 4KYUA 2YZ7A 3D7KA 1Y80A 1K5GA 5AVSA 5GJBA 1Y5MA 2G5GX 1LCIA 3MXOA 1J0EA 2JANA 3UJNA 4NICA 3MELA 4R16A 4D6PA 4ZO9A 1NJ6A 1SK9A 3GARA 1DL5A 1SCIA 2W93A 3AWIA 2J5RA 3PT5A 2IE8A 3FVVA 4MQUA 1UJBA 4WXPA 4I4TB 1JIIA 1DADA 2FR8C 1G8MA 2WF6A 5KJFA 3AUSA 5CDGA 2LNDA 2YKGA 3JRXA 1QKIA 1HZZC 3CTPA 4C3VA 2ZJAA 3EA5A 1GWNA 4YUAA 3BQNB 3R0JA 1MENA 5J59A 1CUCA 1U6KA 1ML3A 3PUWA 4M1WA 2YV3A 4ZGBA 4IXMA 1PGPA 4CM7A 5KX5F 1MMFB 2JJ2D 4RIIA 3CUSA 4KQEA 1SQ6A 3T06B 2XZOA 1MD9A 3S2YA 4IG9A 5FPYA 4BMXA 1KF0A 5AM5A 4KPFC 3ZK7A 4MKFA 4DDKA 1CQWA 2LDXA 1GV0A 4LVNA 5E9WA 2ZSEA 1MQSA 5EXXA 4RTKA 4KQFA 4LJ5A 3FWPA 1L4YA 2BSAA 2BUCA 2FEKA 2WW8A 3WS7A 1J0CA 2WFZA 3FUTA 2XD4A 2A5LA 3DDCA 4INJA 3IAS6 3CNEA 3I0NA 1I7NA 2EARA 4QUDA 1SQFA 1Y6FA 5KNBH 3E7PA 2HJSA 3LSYA 4IMRA 2G1JA 3G49A 2VDWA 4I50F 4CCWA 4CN9A 2MMCA 3E5MA 3I4FA 5G3YA 1QQAA 3JWGA 3PG5A 3WTCA 2JLYA 1MRSA 1XT6A 4CI0B 3EBPA 1KOGA 1G17A 1U3DA 2FR1A 2G5CA 3K73O 3R24A 2HL6A 5DKFA 3WR5A 4CL2A 3MEQA 4K6GA 3K0CA 1EZ1A 1OHHD 4HRYA 3G2IA 3CVUA 4CUKA 2JJ1A 3GLFB 5JQGA 3A3OA 1KSFX 3ZI7A 1EBFA 4R2IA 4AJOA 2JLQA 3CVXA 2B83A 5A9SB 3BIJA 2VP2A 4WLNA 4MO2A 1HC7A 1SQSA 3AINA 4TYPA 1OVGA 2F1IA 4LF9B 4XR4A 1YZNA 4DB2A 2X4IA 2X8JB 3VR0A 1HEYA 2OGUA 1YBAA 5TR9A 3ET4A 4ACAA 3C45A 2MOKA 3ZIAA 4CTMA 3C8ZA 3DE0X 4F9FA 4CQNA 4H60A 2X3UA 1E94E 3CKLA 4LXXA 1MP0A 5A62A 4W5NA 4CVNA 3K05A 3IP3A 4IIJB 4PCVA 2GAJA 4D26A 3G9XA 4LC1A 4K86A 5KTMA 2QTNA 5TX7A 3CN7A 2UUPA 4ZAFA 2AYZA 3PC6A 4FCCA 1AZTA 1M1YE 1HT1E 1JU9A 3LHSA 4HEA6 4BLWA 4DRXB 3ZQUA 2F62A 2LIPA 4YREA 3EC1A 1GD1O 1H1LA 1Z7GA 2ZBUA 1EFCA 2PHZA 2R5NA 1ATZA 1M2FA 3E0QA 3PUIA 5SY6A 4YAKA 2K2WA 3IEVA 3LDHA 2LUOA 1M2WA 3ZWPA 1J1UA 1R18A 4MV8A 3WWCA 5REQB 2I34A 4LG1A 4K9MA 3GFQA 4OJYA 4QASA 3IUYA 2P9JA 4ER6A 4PY2A 4OFZA 2G5PA 1ULTA 3ODPA 1KJWA 3AEUB 3BL5A 5HE8A 9GPBA 4YAIA 4JYMA 5GZ3A 1C14A 2HU2A 1ZX1A 2EL9A 5EJFA 5LQUA 2IS2A 5HRCA 4FM9A 4OGLA 1B14A 4AQYB 4DNXA 2CL0X 1JSCA 3OP1A 2ID7A 3G82C 4Y6PA 5CX4A 1ORHA 1NR7A 3H8SA 5DM70 4BQPA 2ODAA 3GJQA 2XDQA 4U2FA 3TQQA 2HCFA 3TNJA 3RJMA 3ZTWA 4MB6A 2VAMA 3I9KA 3O8OA 3WXBA 1Z35A 2QBYB 2BMEA 4G8DA 4QGFA 3T3MB 1GZUA 2FCAA 4GI7A 4Q4HA 4X97A 3HRKA 4DMUB 4WESB 1NUTA 1T1SA 4MLDA 1T6NA 5T4BA 4BVBA 5B58C 1EFPA 2OQ2A 3L07A 4JUDX 4WSOA 1YIOA 2JRLA 3QKWA 1I1OA 1QYCA 4JXZA 2DWCA 4UQOA 5TQVA 1XVVA 3HKEB 4ENUA 1IY8A 2R4UA 4LJKA 1JHOA 2B37A 2YS6A 5C5EA 4ME6A 1VJRA 2VOJA 4EJFA 4G2NA 5JWOA 3WGIA 4LHWA 4PCAA 3WLFA 2R1TA 4A03A 1FDVA 2Y2UA 5FBLB 1UAYA 3AQ4A 3FUVA 2NVUB 4RFSA 1NP7A 2RHJA 2VTEA 4ETMA 2JFUA 1AGYA 1LFDB 1TM2A 2D7CA 2ZBRA 1VRCA 4EVRA 4C5BA 1S5PA 2RI0A 4PPNA 2OXFA 4M9RA 4H16A 3NDPA 3WIEA 1TLLA 2I7VA 1GA4A 1FMCA 3HJFA 1QH1B 2D0OB 3F46A 1FXUA 1ISIA 3HXKA 1KO5A 3FI0A 2V7EA 4N5IX 1FDOA 1ZFNA 2BJVA 2IYOA 3H0EA 3X2EA 4Z8XA 1CUIA 2QAGC 3BH0A 3EIHA 1WW8A 1WLYA 2NLOA 5A4DA 3SC6A 3PPWA 1GRQA 2JATA 4GBJA 1L7XA 1BW9A 1GYQA 1N5JA 1U9IA 1ULUA 2RGNC 3FVQA 3N3AC 4B7XA 4DDUA 5K8UA 1T6YA 4FYKA 1N9GA 2VQ3A 3OM1A 4FGUA 1RI5A 3UO8B 4GXRA 2B2XA 3ZLUA 4N76A 3IT1A 3CH6A 4IIGA 2PKCA 5J1TB 4R5MA 3W3AA 2VHJA 3G0IA 1BQ3A 4PZUA 3LT5A 3IKJA 4URHA 2JC3A 3EQ8A 1A76A 4HL6A 1P7ZA 4RF5A 3SJBA 1KI8A 1X74A 5EUMA 4NKRA 4E33A 3LVFO 3GRCA 1R15A 2X4GA 4ZAYA 3ZDFA 1EXWA 3RWOA 2ZRPA 4MCAA 4RDIA 4KOEC 4MVXA 1K1EA 2W4IA 4MS4A 2YZMA 3TS1A 1IN5A 1TLFA 3MF4A 4ZVQA 1H4QA 3DEAA 2REQB 1K7SN 3EVZA 4BWFB 4BO3A 2XZTA 5EJIA 1FRNA 3RWBA 4BBAA 5LJIA 3E18A 1BZYA 1GPH1 2PZBA 4QA9A 2IYTA 1V8DA 3QUTA 3ILYA 4TWBA 4AKEA 3U1BA 5IJ0B 3G2PA 4TV8B 3TQTA 5ES3A 1V7QA 3F6EX 2R86A 3ABSB 3KQSA 1WXDA 1XOIA 4V39A 5JBQA 1PL6A 3LC7O 2YWFA 3F47A 5CTAA 1G5RA 1QHHA 1U65A 3A9WA 4P7KA 1G59A 3OZVA 4IF6A 3SD7A 2QL5A 4NCBA 2OSVA 3K96A 4TLAA 3HBNA 5K3DA 1YOVB 2MIIA 4MR9B 1FJ2A 2VTKA 1NUAA 2AFHE 2WJ6A 3KEQA 5FBWB 4FOLA 1SA0A 3RFXA 4DN6A 1G60A 2B35A 4NHEA 5ELLA 3LXUX 2QU7A 4JFAA 2Z8YA 2HI0A 4YBZA 2R6ZA 1PLJA 3CLTD 1JIXA 2JH3A 4ALKA 1QM5A 2J3HA 1C0PA 1CDDA 1FQKA 3FNFA 3GR6A 5JBNA 4XIYA 5JI3E 3WO0A 1X14A 4HDNB 5CFLA 1U2GA 4WFIA 3M34A 2E55A 3MB8A 2C3YA 3EW9A 3IBCA 4JVSB 2JCBA 5BSVA 3IV7A 5EIEA 3A1CA 1QHNA 1N92A 2BDUA 1R0ZA 2KI5A 2NPOA 2FETA 3WJAA 2QENA 1KYIA 2V7GA 4QPJC 2VCEA 3HE3A 5EIAA 4IHJF 4FDUA 1AGXA 1CUVA 3Q7PA 1P9RA 4Q1DA 3OQNA 4KHPB 1ID8A 2EKPA 4UU7A 3T12A 5JISA 1APBA 3JZMA 3WK7A 2KLHA 4QC2A 4KR7A 1CQZA 1A8QA 1WIWA 4G1BA 4MYHA 3P2IA 1BX3A 3WQSB 4W9RA 4XYLA 4DUZB 1VE9A 4FE7A 2AQKA 2W58A 4IJMA 2GN4A 1CVIA 4PW0A 1ZUNA 4K6CA 4LNAA 1OV4A 3PEYA 3EMBA 5LN1A 1VBMA 5TQ0A 4F3NA 4IP0A 2YYYA 3D7LA 5JLAA 3IAS1 4FFOA 3TSYA 3K31A 4KACA 1L2TA 2QSJA 3DYVA 3KJHA 1MJFA 3GT4A 2JK0A 2QMOA 1W2WB 5CH5A 1LNZA 3EXG2 1KMQA 1PZXA 3GF4A 2O3UA 2J3JA 1M2VB 2V7BA 3WSTA 5DULA 3OX4A 3THWA 5IM5A 5FWDA 5FAKA 4CM5A 3B1WA 3SBDA 3VU9B 3TM5A 1DIHA 4WVLA 2HDOA 4E13A 1TQ8A 4FW9A 4EPXA 3TXAA 4HGQA 4YRLA 3ELWA 3NHRA 2YWBA 3BGOS 4UTXA 3BMQA 5FV4A 3QA9A 2WYOA 4MZXA 4CW7A 1N36B 3QMVA 1XMXA 1FUIA 1Q7EA 2B1GA 4Q00A 4CE6A 2PM8A 5MN6A 4C2BA 2B6NA 5FUVA 4PZ9A 2HC9A 2N47A 1YS9A 3FSGA 1RPNA 4TMZA 4ZVMA 4DEYA 4B09A 4PWZA 1CDOA 3BA1A 4IIVA 4JVOA 4Y0AA 3T9DA 3B9BA 1YIDA 1JTVA 1PFGA 2QJFA 4HEA1 2X3YA 5HMLA 5T57A 3RUPA 2D2XA 4A23A 4CQMD 1FSZA 2PKQP 2W6ID 3R3ZA 4E1AA 1EM8A 4BTVA 1M2HA 1IWOA 1M1YB 2Y0CA 1UJNA 3QM1A 3W7BA 1G5FA 2XQFA 1ODKA 1S8FA 3FYUA 3M4JA 3VVCA 3ZE2B 3H2BA 3ZH2A 2VJMB 3WLEA 1PSWA 5AM3A 3JVDA 4F4JA 2I29A 4EI7A 1G20E 3ANSA 4D81A 1E2HA 3AX6A 5FUYA 4FLEA 4LF4B 4OMUA 2PSDA 2XBMA 5TDHA 3N8IA 4P3PA 3WG9A 4B71A 1GZSA 1L4LA 3KB1A 4HAZA 2G06A 1XA4A 1IM8A 3GG2A 5I7UA 3R5SA 4JSRA 3PNPA 1CKEA 1F60A 1T13A 3HYLA 2QVCA 1QG0A 2ET6A 4MUHA 5JJCA 4F9TA 3P9RA 4IILA 1BU8A 1H8ED 1Y48E 1DTSA 3ZBQA 4CKBB 3DLHA 3D64A 3DGEC 1D2MA 2GFQA 2ZBEA 4YP6A 5BW4A 3DE6X 3SIXA 3SYTA 3Q40A 4O5OA 2H85A 3P9SA 2O7RA 2JK1A 4L08A 3BIFA 4C4SA 3AW8A 1RXUA 2AW5A 2GCGA 1U2PA 3LCJA 3QZUA 1GT91 4M2LA 4Z4CA 5HKBA 5JNWA 1IM2A 1IXYA 1M6NA 5DO9A 1PNTA 1Z7WA 2ZIXB 3R0VA 2PWPA 3T3PB 3AUKA 2XJ9A 4P80A 2ZWPA 4DZTA 3CINA 5KDOA 2ZZKA 1QH0A 2PRYA 3WGNA 2VDVE 2VYQA 2FK7A 2AOWA 1SHLA 5F2NA 4H35A 2C5SA 3U4CA 1BHSA 2Q2OA 3MLAA 2Y93A 4FFWA 2GMWA 3UFXA 3S2GA 2ZB4A 5FQNA 3OZDA 5A0TA 3AV3A 2W2OA 2PU5A 3HVJA 3WYGA 3C1OA 5FL7A 1J8QA 4KMRA 3TI9A 4AG3A 2GJAA 1V9SA 4AYWA 2JJMA 1VLMA 2JFVA 3HP7A 1BTOA 3K1YA 4N3NA 3WAJA 2QYTA 4UHDA 3LBNA 3GO4A 3DHNA 3HR4A 4DSOA 3TVTA 4GPEA 1PSDA 3W4JA 3D31A 2QUIA 4YRAA 1E7YA 4H0CA 1MB4A 4HDQB 4EF4A 4ZHQA 4Y1RB 3UGQA 3GRAA 2GPJA 4GEGA 2QTFA 1Z56C 2DULA 4FGSA 1GKKA 2AS0A 1E69A 2GERA 2H1WA 5LP1A 3KKQA 4ZT5A 3BT7A 4EA7A 2PTHA 2QA5A 4NE9A 3GQBA 3FPHA 1FDSA 4WKPA 1H2WA 2QRMA 4CLXA 2HA4A 1K7XB 2HX1A 3L8ZA 1L0BA 5F1PA 5TMBA 4MQ5A 4EG5A 4K2AA 3GLIA 4P58A 3QVJA 3QY0A 4I5DA 4LGCA 1ZUD1 4BNGA 2UZ4A 1M5UA 1Z74A 4HGZA 4U7WA 5CLIA 4AKGA 3PQ4A 3QPVA 4WOPA 5BW5A 3K0EA 3U3RA 1OBHA 4NMLA 4MO9A 4B3JA 5CB6A 1O0SA 1HNNA 5JDIC 5CBPA 1R6XA 4MR8A 4QKQA 1CE8B 1XLWA 3IPCA 4WDQA 2JJ1D 5IS2A 1NW8A 3G68A 1AY0A 2GBIA 5CLFA 5JNUA 2I2CA 4DEXA 1P31A 3ZS8A 2J3MA 4RA6A 2C96A 5IPFA 2CSXA 1ISRA 5BSTA 1PJZA 3D6TB 4B4DA 3MS4A 4BAUA 1ECBA 1MOSA 3ADOA 4DDTA 3GI1A 3SK0A 3GT3A 3DE2X 3UWOA 1YU6A 3ZIAD 2RHMA 4O4LA 1NBMA 1GNSA 2Q6KA 2P75A 1WS6A 2H5LA 2IJGX 2JFHA 2ZIFA 4JUAA 2B8TA 4K87A 2IZ5A 4II3A 5DCUA 4MQFB 2HO4A 1B7GO 2OV1A 1RD4A 2BJWA 5IZ4A 1CF9A 1EWVA 1H2RS 2R44A 1USWA 1C9DB 1RM5A 2F3RA 4OYLA 1MRZA 2R7MA 3VYSB 2Y1EA 5DMHA 2YWEA 4MVJH 4DLBA 5DOZA 5KNLA 4K9NA 1UK9A 4BFSA 3SQOA 4Z4EA 2V59A 4LKRA 4OTZA 2XB4A 3JD0A 3S1AB 3SOZA 1V3VA 1NJ5A 1Y8CA 2J3DA 2XUZA 2AFHB 1E59A 1X7DA 3HEAA 3KJQA 5TNXA 1V1JA 2L69A 3IDAA 3CURA 1GUZA 2WD7B 3FFBA 4IDCA 1ZZGA 3B2EA 4MVYA 3T5TA 2RK4A 4YCJA 1V9CA 4EG1A 3IILA 5LZ7A 4ZI2A 2XYPA 3BSSA 1X7YA 1A9SA 1J24A 3KT6A 3RO7A 3J81k 3KZOA 4C0XA 3ODGA 2VDUE 1XO1A 1I3MA 3AHDA 3W7VA 3L7OA 3JD2A 1X7XA 1QPGA 1XYYA 3QXXA 3R2JA 4O2BF 4OI4A 3MWDB 2ZAOA 2WWHA 1ES9A 2ZRHA 1E6LA 1H93A 4Y1FA 2O7NA 3DYBA 3SKXA 4C43A 1GSHA 1GTL1 4BBZA 3AIOA 1GR1A 3TJZA 1T1GA 4JBXA 3O8DA 1TJYA 3GMIA 1UXKA 2H9IA 3D3WA 1N4AA 1V3TA 4BNVA 1CHNA 4JI2B 4GOLD 2H2GA 3H2YA 1UBRS 1WA5A 2B4RO 2R87A 4YMHA 4OL9A 1RYDA 2QMEA 4MWBA 5EOVA 3A1EA 2GK7A 3PQCA 1L3BA 4CEJB 2E4UA 2PJZA 3PQ6A 4AP6A 5JIBA 4NBSA 2BBTA 1VIDA 2OFOA 4RD6A 4EQ6A 4D9GA 1QIGA 2ZBFA 3RAGA 1CIPA 1DBWA 1CEXA 4YR7A 5EJ8A 3DBLA 1GDTA 1P0MA 5DIZA 4DIFA 4DR4B 4KNWA 1F06A 3D6HA 3N05A 3RWMB 1L3IA 3VGJA 1EQ2A 4JVMA 3N7AA 3CR8A 1P5JA 5EYPB 1WVGA 4BMPB 3DOOA 5AXCA 3OFVA 2O05A 4BRSA 4UATA 4V3BA 4X95A 3IVMA 1IQ0A 4MPTA 3GVHA 2JFNA 1C0LA 3HTXA 1U6JA 3R5TA 4ICIA 1LI4A 2VH5R 1WCIA 4FMDB 4N0PA 4P93A 5HFJA 3RUDA 2VBGA 1VHWA 2HSDA 4QYXA 4ZOLB 3R5KA 2WD8A 2VAXA 1QORA 4PGAA 3T95A 4JZYA 4QJ4A 5ER6A 4NK5A 5JATA 1YJXA 1ZUIA 3F3KA 4KMMA 1G8JA 3TKAA 3B7GA 3EULA 4LOIA 4H4EA 3HC7A 3I61A 3QLUA 5FFMA 5BNTA 2X0EA 3ZDQA 5I7SA 2QI9C 4NBWA 4PIPA 3ULKA 4TUYA 4R8MA 1OXTA 5M34A 2A5FA 1J0DA 4R2KA 5EKUA 4ZAWA 1RAAA 3VR1A 3W3AD 1SBHA 2QMYA 2PS9A 3DP9A 4MCJA 4D9MA 4DWWA 3QXJA 1QGOA 4DHEA 2PVCA 4F93B 1X6VA 1UWVA 4GPTA 3VNUA 1T8UA 1OY1A 1X42A 3LUFA 3OO0A 1G2PA 1IAVA 2WV7A 4W4TA 3HZRA 1PFKA 4XWAA 3UTCA 4HQ0A 3SLRA 4Q3CA 1J4AA 2BR5A 3B78A 5IVPA 2W2LA 3A4TA 3FKJA 3ZXUB 1F6BA 4RJKA 1S2MA 1YQEA 1KJ8A 4LMRA 3FOZA 4Q3EA 2F67A 4U63A 4POOA 1AKMA 1U2RA 2Q27A 3K1TA 2OZVA 4JR1A 1G20B 2H9YA 1T8WA 1KQFA 2ZITA 1AKQA 1YUMA 1JTEA 1U7ZA 2HFKA 2BM1A 1JXOA 2ATEA 4QOHA 1WDWB 3ILSA 3M3HA 1AHNA 2P6PA 1IN8A 2Q5OA 4LISA 2GDJA 5FOSA 4LYAA 5SZJA 1U9JA 3OLYA 4RIEA 2IU4A 4PAGA 1K8QA 4AY5A 1OD6A 3AF4A 2BH2A 3QXSA 4MROA 3VNSA 2FTKE 3A26A 1M5TA 1E0JA 3JYHA 2AYYA 4YJ2B 3WYBA 5TPZA 5C18A 3TAHA 4K3VA 4EI9A 2Y1OA 4TMKA 1LLCA 3GYBA 1A9RA 3N2EA 2Q62A 2V3VA 4KN5A 2RFLA 2X7HA 2ZE7A 4FZ5A 4GOOD 4N3AA 4QECA 4KV7A 2QTVB 2XTMA 1Z06A 2P3SA 3PEFA 1H2XA 1BHQ1 4AJPA 2ESRA 1WZIA 1E61A 5TF4A 1ZGHA 1YS7A 4I3FA 1XL0A 3RK4A 3SYNA 1PQYA 2AFRA 1U04A 3JASA 1IJKA 1V6CA 2VFAA 4ZMRA 2VWGA 4EHDA 3T1TA 3KLNA 3BJMA 4FZRA 2Z4SA 1GQRA 4RHCA 1K3TA 5KCMA 4IS2A 4D8VA 2QRGA 1E9DA 2QXYA 2YFKA 4BX0A 5EJ9A 1ADFA 4OLFA 2C5LA 2RH9B 4JYBA 3M9LA 3EUFA 1G5TA 1MFPA 1ZD2P 1XHEA 2GZAA 4GC9A 4C2AA 2GZDA 3F3SA 1B6SA 3MJRA 4H18A 4R2WA 3F5FA 4FDVA 3I4CA 1F1BA 2VDMB 4JI1B 3LQKA 4UAUA 3T4XA 3U0VA 5JYEA 1DKQA 4BP9A 1PDWA 3IOYA 1SUCA 1T36A 4M60A 3ROEA 1Y8AA 3OJLA 3W2GA 1VCHA 4W99A 2EP7A 2L2QA 4POAA 2CDNA 3HVIA 5KHAA 2FE4A 3JR7A 1Q1AA 1IBCA 3B6ZA 5B3JA 3WGJA 3JCZA 1NRXA 5E2AA 3GUUA 3GLFE 3FGPA 2GD2A 2OMEA 3W9SA 1IZ0A 3HXMA 4ZJPA 2EKLA 3K6SB 1XEXA 4I4IA 4MRAA 2BRUC 1Y42X 1E6WA 2DPXA 3T5GA 5HIMA 1K8ZB 4B83A 2OLJA 3O9VA 1D5WA 4PO9A 5CDSA 1FFWA 4Z99A 4O63O 2SKDA 1PV1A 5JO9A 2YHIA 1WXWA 4BO8A 2GTHA 4EA6A 1SD1A 3W0LB 3EZNA 2J0EA 2H0QA 3A4MA 4MS1A 1KTIA 1I14A 1E5TA 5CT4A 1QE3A 1NXPA 1U8YA 4G36A 3ZY5A 4DDHA 3RREA 3VPDA 1YBMA 3ICPA 1E5VA 4JC4A 5C8YA 2O1EA 2NQ2C 3Q3CA 4OLBA 3LRPA 5JAPA 2ZR9A 1JXAA 2PQ0A 5FEMA 3H86A 3I9OA 5A5GA 2XBLA 1D2HA 1NJ8A 1YL7A 5J2TF 3V1YA 4EKNB 1BOOA 3FSGD 2FQWA 1W19A 1CS0A 1P1HA 2GEDA 4WOJA 2XMDA 4Q7QA 3I3OA 2AXEA 3V8BA 1BAPA 2YJNA 5E4JA 2WM3A 4QTXA 5KNDH 5KJEA 1H0SA 1YVDA 1IUNA 4LDQA 5DEIA 4DJFC 2DE0X 2HYDA 3H2ZA 3TOCA 3QEMB 3IKLA 1Z4KA 3IP1A 4GSKA 1R8SA 2FZEA 1GN9A 2DCMA 1E7WA 3K92A 4GYWA 5T4FA 1SBIA 4YEDA 4XGIA 5IARA 3MYYA 3DPUA 1GTG1 4LBWA 2YJTD 4XKJA 5BYAA 4DGQA 3FPAA 5GTDA 2K6GA 5BOSB 4XUCA 3EMKA 4CU2A 3RU9A 2GD6A 3KS9A 1NBWB 1DPGA 5F7JA 3RRMA 4CKCA 4KH0A 1V37A 2H29A 1NXQA 2BF4A 3IMCA 4DLTA 4DV1B 4R81A 4DBZA 3BCSA 1CG6A 1KH1A 3KVYA 4Y7DA 5EIOA 1FBTA 4KRGA 3CX7A 5ITZA 5FPKA 4HLQB 2ID8A 3T3NA 1B8PA 3OZRA 2JA1A 1K92A 2ANCA 2NXCA 3A9UA 3CW8X 3BAFA 3IDFA 1GNVA 2Q0XA 3ONEA 4EJSC 2O8FB 2W6CX 3ZHCA 4WUVA 4RWZA 2QOEA 3C48A 1H2ZA 1KI6A 2CF6A 3D1JA 5G0WA 1RKUA 4DUGA 2ECQA 3MPOA 9ATCA 4JSTA 4KRYA 2IH4A 1WSWA 5FO0A 4EVQA 1X9GA 2IS1A 1C4XA 3PNOA 5DBGA 1SXJA 3DJFA 2B0JA 3GVPA 4RH3A 4WLEA 3S4YA 3R8CA 1NG1A 4H3VA 1I24A 4QJIA 1PL8A 4J16C 3EMDA 2XCSB 1PZGA 5F76A 1KS9A 3LC2O 5IAEA 4XWWA 3A1WA 1P2FA 2HTEA 3HDVA 3OJWA 1CUYA 2BFFA 2ZTHA 4US0R 5J9FA 5HKOA 4WOBA 2G0TA 5B6JA 4N0EA 4Y6GB 3TOSA 3WRVA 5HR5A 7MDHA 1E1RD 1J5PA 3IQGX 4ZU3A 3VVLA 1H66A 1JZSA 1VFNA 1JDBB 2Q41A 2WF9A 4WFJA 2FFHA 4I55B 4QICA 1A9TA 1SHJA 4GKAA 4PPFA 4BLQA 5JD5A 3BXXA 3M1AA 5FL7D 3QE3A 4DRZA 1BFKA 1K86A 3MTDA 3ZHTA 1QBGA 2AG1A 3DTVA 1YTUA 1IBLB 1DMSA 2HJGA 2H11A 2OCIA 2XGMA 4N7MA 1C3JA 3TKLA 1REQB 5B7NA 3Q2KA 6YASA 3TLKA 1HLFA 5K0JA 1CFZA 4XDZA 2O6LA 4XZ3A 1AHIA 1GUBA 2ZYRA 4F2GA 1ZP6A 4LGVA 5A02A 2HMWA 1MAHA 2XT6A 1GCOA 3W4KA 2RCNA 4J4BA 3E8XA 3HSYA 1NPYA 1NZFA 2NIPA 1X8LA 4IMPA 4B43A 4GGOA 2E5LB 1IK6A 1RAIA 3AIKA 3RTDA 2YX1A 3KR2A 4IQ4A 4KOAA 1H6BA 1FX0B 4WD3A 5CDFE 1PNRA 3D4LA 1IG3A 3LZDA 2H1IA 3RVMA 2HGZA 3ILVA 4ZO6A 5DV9A 5JHGB 3KELA 3WLTA 4FZJA 4OHUA 3B9RA 4W63A 4CNQA 5EXTA 2P2CA 4ZXPA 3EGDB 2AYXA 3OFNA 2BCGY 4BNZA 2IEBA 1IUOA 2CYCA 2YUIA 1XN1A 4YUXA 5LP6A 1PUJA 2F00A 3AVVA 3D4PA 3P9PA 5M3BA 1JVBA 4OMFG 3RS9A 1Z0FA 2C4TA 3VNBA 1E60A 2NP6A 4F1JA 2VJQA 1DWUA 2BMFA 2GA8A 3E7DA 1GITA 2VI5A 3O38A 1E9EA 2ZIVB 1SPBS 2JCVA 3PTLA 2EWMA 1KZ9A 4M38A 4RMNA 4XEHA 1M73E 4HVAA 3VO1A 1U5BA 1B41A 1HPLA 4B80A 1HXHA 3C74A 4B3XA 2UYHA 2P2LA 1U0SY 2IUEA 4HXGA 4BFCA 1ZZEA 4I9UA 3QE9Y 3ICOA 1EHIA 3HUTA 1NBMD 3NEPX 4TTAA 3VZQA 3RVBA 5JXIA 2VA8A 3DOUA 1UBCA 3DXZA 4RA9A 2QWXA 2VN8A 4L7VA 2OZLB 1SBYA 4FIZA 2PGOA 4W8GA 4QFDA 3ISTA 1Z6YA 3EA4A 3I6YA 4FCVA 4JLJA 2OEPA 4DLRA 3RRBA 3GAFA 4PX3A 1ZEMA 2ZJYA 4H7HA 1JI0A 4IDDA 4WA8A 5AI9A 2CVFA 3GL9A 3TFQA 1CJKC 3UCFA 1WTCA 4PN7A 4NP6A 5SY4A 2ZB3A 3WA6A 2HK8A 2JHAA 2C57A 3KLMX 4PM4A 3KUDA 4FUQA 3VPSA 2XB2A 4Q3AA 4EELA 3CEPB 1ETHA 1G19A 4N6NA 1J7KA 4CKYA 1FXWF 4KR3A 1TTQB 4H7FA 2CW5A 4KAAA 1KK1A 2B4QA 4RGVA 3V8NA 5L3SA 4ZQEA 1F2UB 2I65A 4BZZA 4YRZA 1EK0A 2PYDA 1SCAA 2ODNA 3ORHA 2GGSA 2H8KA 5JTTA 3QELB 4LPSA 4V0LA 3LTNC 1HETA 1PL7A 2EZ4A 4XX0B 1DFIA 3DZBA 3NRCA 3H3XA 3SZUA 3E5NA 1T10A 1VPTA 1UZUA 2DWOA 3ZPXA 3TQHA 3R40A 3NYWA 3PSHA 2HSGA 4H4CA 4KN6A 1U7UA 4WCDA 1H6CA 2CDCA 2PCLA 2PX8A 1PT5A 2JA2A 1U1IA 2YDXA 4QQRA 3LUAA 2RGEA 3X1JA 4D45A 1NNLA 2O2ZA 4JDUA 5JYBA 4KXFB 2R8ZA 4N8SA 4AM8A 4IRUB 4IEFB 1PU2A 5LDHA 2W8BB 4JI5B 3USZA 2CVQA 4Q1EA 1Z5UA 2DHRA 1S89A 2BFBB 1QDLB 3BFJA 3CX6A 4MIKA 1L5FA 2RH5A 1MB0A 3SICE 5C5IA 5CA1F 2NZWA 1RCFA 2EZ9A 3I1FA 1CUHA 4BE4A 1AUQA 1FSGA 3I9FA 4J1TC 1O3YA 1UBUS 4KU4A 4NG4A 5FNVA 3HCAA 5KJCA 4PSVA 4BQSA 1GTSA 2PRIA 1X92A 3OKFA 4P22A 1P18A 5EEHA 3V7UA 1OH7A 1JDJA 2BUAA 3GP8A 5EG5A 4HO1X 2V55B 3U1VA 4AROA 3QPCA 1EE2A 1JW9B 2IHJA 4JLAA 2EWVA 3WK5A 1IXZA 5I5EA 4GYYA 3WNBA 1BH2A 3C8UA 3EK2A 2BKVA 3IO3A 4WN3A 4TTIA 3HKDA 2PBFA 2R79A 4A2PA 1F5NA 1U1FA 5I4CA 1RJEA 3K4PA 1UK6A 3FLAA 1YR2A 3A3PA 4G97A 4TX1A 4MI6A 5K0SA 2SECE 3ZCXA 4TTSA 4ATNA 5CD9A 2ZS7A 1RADA 1UPXA 5JDCC 1U3UA 4TTQA 4W9NC 4L0DA 1BG6A 1Y1RA 2E37A 3K9GA 4OGGA 2NX2A 4QARA 2Q9BA 1D3AA 3RVLA 5KTTA 2F17A 1B23P 4UTOA 2R7AA 1AKVA 3B7PA 3QFFA 1UADA 1L7MA 3QNWA 1XRJA 3ZY4A 1FS6A 1JBKA 2Z04A 4OQEA 3TI7A 1P91A 4CN8A 1BSVA 1ICEA 3ITNA 2QZPA 3O2JA 3OFSA 1S3FA 4OB7A 3HL4A 2H4YA 1PTJA 2JCGA 1U99A 2J0VA 3MNFA 2VNSA 2W2LD 4B73A 5JXJA 3DS8A 1WX1A 2GN6A 3E7WA 3A31A 4RBNA 1JG6A 2XUGA 1OR8A 2M1ZA 3K0AA 3KU1A 3N6XA 4PBRA 1I4DD 3K8ZA 3KSRA 4WI1A 4EX7A 1QP7A 1MHTA 1OWOA 2C84A 4XLZA 5CLHA 4YUZA 3A2MA 3BCUA 1HWYA 1MJNA 1WXHA 2KS6A 3KYCB 4EEZA 4MIYA 1HMPA 2R8XA 2XWBF 1NDUA 3AF0A 3EC2A 4JJEA 4FFDA 3QHQA 5EJMA 1L4BA 1Y7LA 1UPUA 4NU6A 3MG9A 3IUQA 1FFSA 3EQZA 4GVLA 2V45A 2DHQA 3ZIDA 1E99A 2O0MA 3KXDA 1BE6A 1U9ZA 2AZDA 2XRYA 5TPZD 3DT8A 5FTWA 4CMBA 4EKEA 4YUWA 2JCXA 2OO7A 3L4EA 4HUQA 1EYZA 1OXXK 3H17A 4FQ8A 2RHCA 3S5JA 3V4SA 4Z49A 4P0PB 3D8SA 4P32A 5T5QA 3HM2A 3EPKA 8ABPA 1AQJA 2NUAB 3O90A 3G0DA 4UHEA 2LKDA 3BWMA 2EZUA 3IEKA 3AKZA 3RHZA 4JKYA 1Q3KA 4AMBA 1MA0A 1V9LA 5DLYA 5LNK6 1UBJS 2Q5CA 3G0BA 4UDYX 1Z18A 3BC1A 4AJ9A 1KHTA 4G4SP 4DILA 1HTTA 5KB3A 1QRDA 2BEJA 3PCTA 3R0XA 2I7DA 3TD2A 3U7IA 2XCQA 3P2JA 1XJQA 3FLBA 5CB8A 1X2EA 1GLNA 2LZ0A 3U9LA 1AVTA 4D8WA 2BVNA 1KDZA 4N01A 4EFDA 1KR5A 3GFTA 2H1CA 3ZJVA 2I4MA 3HUEA 3I37X 3REOA 2ZDQA 3VYUB 3V1UA 3HADA 2XI4A 3F7NA 4BX8A 1DDOA 1BD3A 1BGWA 3GEGA 2O06A 1JPVA 5JV5A 1FFCA 2K2QB 4QVIA 1IRXA 3L6BA 4RCVA 3CNHA 2PVPA 4W8OA 2Q6VA 1TKBA 3RHSA 4BEBA 3U17A 4Z6KA 4ZCRA 4MV4A 1ZGZA 3GA0A 4LWOA 5LSAA 5IT9A 4XTCS 1BEZA 1EDEA 1ND5A 2CJWA 4EY6A 1FVXA 2AG5A 5JPIA 5K8CA 5ADWA 2I3AA 2O2JA 4FJ2A 1KMMA 1T2EA 5BWNA 1AD2A 5BNIA 5G1PA 2QYHA 5MF6A 1U4OA 1LFAA 1R64A 4Z5XA 2EX0A 1G7RA 1UBKS 5E6RB 1C81A 2A0XA 3LY9A 2P78A 2W6NA 3KB2A 3OH8A 1G1MA 1MJHA 3DH0A 3LQ4A 1YDWA 1JQ5A 3EEFA 5IASA 2ZYHA 5AH0A 3ZWOA 1NLFA 4LIPD 4GI5A 1VPWA 3BMOB 2H2WA 3WQBA 2QX8A 3NHWA 3OZBA 4QOGA 2HT1A 1RPJA 1XV5A 3OZCA 3FDXA 1N3LA 4HCJA 4MAAA 2O19A 3RVJA 4KZPA 1TAUA 2BEUB 1V6SA 2AX4A 5EMHA 2BTEA 2JVIA 3HMQA 3HABA 3F8WA 3CZ9A 3NUQA 1ZAKA 1M3SA 1OT5A 1TAQA 2PIAA 3NJ8A 3UT5A 3W5JA 3HCCA 1TMKA 2AT1A 4MV1A 1EFLA 4HVLA 4KXYA 1UDCA 2QMQA 4CG0A 2X8AA 3KOYA 4AUMA 4J0DA 3OU7A 2JFXA 3ZW8A 5D86A 4WNYA 3PQ2A 1Q92A 1W36B 1IPHA 1L5QA 3DBRA 2F8SA 1P44A 1IHYA 1O97D 3D2AA 3OG9A 2C4HA 1G66A 1PS9A 3Q8MA 5ESWA 2HPZA 1GP2A 3CNNA 2RSLA 3NTOA 1HUQA 2CNDA 4AIIA 4NV1A 1ADJA 2BIFA 5BN5A 1NDHA 1XHFA 4U9IS 2FDRA 3K94A 1R00A 3I01A 2H7CA 3IMEA 3ZZMA 1N7HA 2IDKA 2QR3A 3U16A 5H5JA 4LVOA 5JJLA 1CYDA 2WU4A 1PR9A 2IDMA 1O6CA 3L0DA 1KI2A 2AF3C 4G1EB 1Y9JA 4J0QA 3LVRE 3R5FA 4OQQA 2JI8A 4X8HA 1Q1BA 2P11A 2X1HA 3NP7A 3NHZA 3CPHA 4RH1A 1Y8QB 4EB3A 4I1SA 1Z7BA 3KKOA 4FP9A 4EW2A 1YCFA 3CKYA 4F6CA 5MHTA 2R4QA 5E0KB 1EX7A 2W7TA 3F1LA 2JGDB 2BFMA 3IB6A 3PD1A 4JA0A 5H83A 4BGIA 1DBQA 1SQ0A 3M6FA 4GPAA 1TK3A 1GTMA 1HLGA 1Q0HA 1TW3A 2DUNA 1P9LA 3HBMA 3N58A 2ZR7A 4H27A 4RQUA 4YJ3B 1VZ3A 1F0YA 3TD9A 4DUGD 4CMJA 1AJEA 4Q1CA 1P29A 2CFOA 2WJPA 1YE8A 2RHBA 1CUSA 3WYFA 2WNIA 1SXJD 3MB5A 1I13A 2V54A 1J1ZA 1LLFA 1O95C 1T8SA 1GT6A 2VWPA 3LYHA 3CEMA 1W8DA 3K70D 1ECLA 1KA9H 3H97A 2X5NA 2VP4A 3FJOA 3QKUA 4HV4A 4NR0A 3AIMA 2Y67A 3DKVA 1YFKA 1CZOA 1M1NA 2QSZA 5ALPA 3S2IA 1DJMA 3R3UA 3AY7A 1KAOA 2NUPB 5CM8B 5FOQA 2WC1A 4NCIA 4U9HS 5JWHA 3OURA 2J4CA 1DZ3A 5H59A 1XYVA 3STVA 1W0CA 1OZFA 1BMTA 3A6ZA 4HDMA 5AK6A 1DBSA 1NASA 2X8WA 4XM2A 3BUSA 3AR4A 1HTBA 3KSDO 2R6R1 2VJBA 3W8RA 4Z0HO 4Q4JB 2NYVA 1GQFA 1C3LA 3O94A 3DTVD 3Q87B 4GBED 5KYVA 2IY9A 2ORYA 5U4XA 4WBNA 3UIEA 5ED4A 3IC5A 3PPYA 4FONA 4PPQA 4JYAB 2WBLC 4FJ1A 3GP3A 3S27A 1BMQA 2J3EA 2G36A 2V7XA 1U90A 3RHFA 3KNZA 3C5HA 1GY8A 1HEIA 4J1SA 1HYBA 2I3BA 1AO0A 2C20A 1CY4A 1JR3E 1SZDA 4OGWA 3BS4A 1RRCA 4U7HA 4HTFA 3C8HA 3NOVA 4HATA 4JASB 5BV8A 1BVRA 2C9CA 3IKTA 2GCEA 2E5WA 5EGNA 1YJ8A 3K3PA 3BYZA 1C9EA 2Q5IA 3KB8A 1AS2A 3UFBA 1ABEA 1NC3A 4NJEB 1AUXA 2YW9A 4S1PA 4MUFA 4CF4A 4O4JA 4E15A 3RJ9A 3OFND 5LOVA 3B2QA 3H4IA 1WZ2A 2CYBA 1C1XA 1GGHA 3KZKA 1OAAA 3WGMA 1PGNA 1H2AS 2P9YA 4H0FA 2Z5VA 1NR5A 2C99A 2QK4A 3GGSA 3ZJ4A 5HK9A 1Q0QA 3ICVA 2CE2X 1YQDA 4QDKA 5D3ZA 2IYZA 3TTSA 3VDXA 3RU7A 3CUEF 2GN9A 1BDJA 3LLVA 3WBBA 3ZHBA 4AMYA 4Y2VA 1TL7C 3ESDA 3D2BA 4QFCA 3TXXA 1TRHA 4B74A 4QXAA 1NRJB 1SN7A 2CNWA 2EKZA 3HEMA 1A5BB 3O93A 5F2EA 4CLOB 2GKOA 2J0QA 1LDYA 1SVKA 5GJVC 3IT2A 2I4OA 2HLNA 2W2KB 5E7JA 3V7FA 2I2XB 2BGLA 2NZXA 4RF3A 1DIRA 3DMTC 3QUSA 3JQFA 3EZ9A 5JCJA 1DEOA 3B6IA 4DCGA 3KJXA 2G80A 3IOEA 2HTFA 3JZIA 3DT6A 5KUTA 1RBZA 2YZGA 4XIGS 3ECCA 2VP5A 3R7NA 3W5IA 4W5JA 3CIOA 3HB1A 3UOAB 3WMEA 4RMJA 1DWPA 3E3OA 4IWXA 4PV7A 2WVAA 4R1SA 5EWMB 3ZV4A 1XN4A 3HSKA 4DC0A 4XQEA 3FPBA 3LP5A 2HQ1A 2QM0A 3Q7EA 3EVDA 2O3RA 3VMMA 3FF1A 1AKTA 1TD9A 4KQ1A 1V1MB 5C31A 5ITWA 3L4KA 1HZZA 1OILA 2RHOA 4M1ZA 4PYRA 5LNK1 4NTZA 3JQEA 2ZRDA 4J6EA 4Z86A 4XE5A 6NULA 3ORRA 5A1JA 1M6VA 1BDIA 1PQUA 1Q2UA 3FNRA 3RIEA 4DCNA 1ZG3A 4B6RA 5BSFA 3AVQA 1ST2A 2HF8A 5DM60 1AO3A 1MEEA 1KEEB 3JAKA 3QITA 4OM7A 3EFOA 1EFVB 3ZGZA 2UVDA 1E8DA 1GA1A 1RJDA 4PZPA 1DX6A 4E21A 1HI9A 4UMVA 4F0JA 3GG9A 1UWCA 4BOYA 2M6RA 3RIXA 1U0GA 2XKJE 1DDIA 4YRDA 2G09A 3GVIA 3EVFA 5SZKB 4L9AA 3DO8A 4YN3A 3RUFA 4Z7JA 1I9CA 4G6ZA 4KIGA 3SFTA 5BN4A 1D03A 1RQ2A 4BFYA 4FS8A 1K6JA 2CV2A 3DWFA 4ZAZA 3GAMA 2IH2A 4RABA 4NS4A 5G0SA 2H3EA 3M5CA 1XRPA 3DMRA 3F97A 1HDZA 1XCBA 3JVEA 4D0SA 3I8XA 3RBAA 1IM5A 4EY8A 4M1QA 2O8BB 4V0RA 2Y1KA 3PL5A 3PQ3A 1N0IA 1NAIA 1T9AA 3OQIA 2IU6A 4FMCF 4KJXA 4KKXB 2O2YA 4QBFA 3CVVA 2XXAB 1QQ6A 1NVKA 3PGJA 4YDQA 2QV7A 3F5QA 1JKMA 3GOQA 4BNKA 1FLVA 4O4IB 4B81A 4R3UC 4QM6A 2PUDA 3FHTA 1MJGM 1ZC3A 3IALA 1YI1A 1DAEA 3U7QB 3LZCA 3EPLA 3DDOA 3GGGA 3IOCA 4IG4A 4RAOA 3IIJA 5DYNA 1Q5PA 3GT7A 1TQ6A 3T7AA 5ICGA 3HSSA 1UC9A 4EBFA 1UEXC 4OK6A 1LBTA 5T64A 4BZPA 1Z28A 3NIDB 1KEZA 4LECA 3KPWA 1ZQ9A 1EFHA 1H4SA 2X9GA 1F38A 5E2IA 3E1KA 2WUGA 1D4FA 4MJXA 1WRBA 2DRIA 5JMWA 4CEHB 5DK4A 1U11A 4G5FA 5LLDA 5FJIA 1QK3A 1PWYE 1W0JA 1E2PA 2BTQB 2WHPB 3H2JA 3HP1A 3IIEA 1EX1A 1P1RA 3D4OA 2R6FA 5EN4A 2NU8A 3VZRA 3QENA 4JLSA 1U0FA 3N59A 4QRIA 1R0SA 1UANA 2OD7A 2R00C 3F96A 3O4GA 4TZKA 1O96A 4ZT2A 1OTHA 2VPWA 4TT8A 4F4UA 2HW8A 2GF2A 1OYOA 5AHWA 5K0NA 2B98A 1PK9A 3U19A 3MTBA 1OC2A 3UMCA 4JP5A 1SUFA 3LNTA 5C5CA 5CT6A 3SQNA 4C7BA 4ARVA 2WTUA 5LXTF 3I58A 3F0TA 3NIWA 1EUQA 2P27A 2CYAA 4JDPA 1EGHA 1L5LA 1ANKA 2AD1A 5JZSA 3M1IA 4UMEA 1FVOA 3KLOA 2ZSBA 3V46A 4DADA 3K6JA 5GGXA 2G25A 1CP3A 3BRSA 3Q8KA 2JW5A 2VUIB 2XTNA 5TY0A 4R8KA 5B7PA 2VSNA 1RP7A 3ZY3A 5EIBD 1FYFA 1L5HB 3PDWA 4HB2A 4NE2A 4TL8A 3TRFA 2ONKA 2RDMA 1L7BA 1PEDA 1KEEA 4CF7A 3DHWC 3PHIA 3QMMA 2GBCA 3L93A 3AVTA 3BA6A 3UN1A 5K01A 4MWTA 4CQJA 3DBHA 4HQRA 5EKXA 1ZS9A 4WNIA 4WZBE 5FOXA 1I80A 4HR7A 3ESRA 3TIGA 2X86A 3VC7A 2ZE6A 2XOEA 1MPXA 3ZJTA 3W79A 4CL8A 1UC5B 1YMUA 3Q12A 5CCBA 4EKYA 5ENVA 1YL6A 4PFJA 1FFHA 2XYVA 1SC4A 4L5YA 3PIIA 5ALLA 3W9UA 3UK1A 3S1LA 1Q84A 4B6SA 3GJTA 2ZETA 4MARA 1X19A 2D54A 3BPSA 1K3FA 1T5TA 4YAEA 4BYMA 1N0WA 1N2CE 3G5TA 2W6OA 2QAGA 3NXKA 2XQIA 1ST3A 3DXYA 1DJLA 3R3HA 4RY2A 5HA5A 1U3GA 4KP7A 3ZNOA 2C1ZA 3DVLA 3BXHA 5D7BA 3RYFA 1D4ZA 2HF7A 3PIDA 4JVNA 3P52A 1QHIA 1H4VB 2RGCA 1YBHA 4OYHA 1L6RA 2NU7B 1BD4A 2P35A 4X44A 5FT9A 1L7DA 4F3KA 4U6NA 1YRYE 1J49A 1X87A 2IY8A 2I9KA 4Y1GA 5ULLA 1N6LA 2J5QA 2DKOA 3L7NA 5FPHA 5H7XA 4CKEB 2IW3A 4ZCPA 1RT9A 4ZO8A 1DAPA 4FE3A 5DE3A 2HJVA 3UJDA 4PHTA 1CJUC 3I53A 2XT9A 1L8LA 5IFKA 1XMQB 1RI3A 4K5QA 3NO4A 1YQTA 3P19A 1DOAA 2FI1A 3QWAA 2O8CB 1P77A 5HILA 5LMCA 3FD8A 1SVNA 2K87A 5DBOA 4BO1A 4EB8A 3QGMA 4ODIA 2A1TR 1RHKA 1JQBA 2OXCA 3L6OO 4TT3A 4YAUA 1SU8A 2IZ7A 3VMFA 5ECWA 4E3ZA 4DY6A 4YRBA 4TRNA 5L51A 4JOSA 3GRFA 2CBZA 2H18A 3NBYC 1RJ9B 1JEDA 2NU9A 3QVVA 4NC9A 4S2EA 1O5IA 5IAGA 4I3GA 4BO6A 1AT1A 3DL7A 4HNAB 5IT5A 4AJHA 2GCOA 2BGGA 4L9RA 4N47A 2FPOA 3DZ8A 5ALGA 3UJ9A 4GF5A 3WV5A 2E18A 1FX1A 4LHZA 4NX2A 3F71A 1OAOC 3DAYA 2H54A 3TQRA 1Q95A 4E88A 2BH9A 4YECA 2AH5A 3MOGA 4IJVA 1MLDA 3L92A 4DCSA 4ZAGA 4HQOA 1K6XA 2AJCA 1FU7A 1SFRA 3LNCA 3L79A 1C30A 4F4IA 4U7JA 2GZ3A 1YVRA 2V4UA 3GMTA 1T2FA 2V7VA 3P2YA 1N1EA 2IEAA 2ZT7A 1Z5WA 1AQIA 1XTRA 3VOAA 3LP6A 1XXLA 4IDOA 4IQ0A 4ILKA 4D3XA 3WP1B 2XW6A 1VBKA 2XNDA 2EU8A 3EDQA 5KWEA 1MV8A 5AW7A 2ISQA 2NUTB 4KQGA 4MV0A 3WYEA 1SOWA 3HWX1 2K5UA 1ZK4A 3K35A 4M21A 1UDAA 2H57A 1AU9A 1WMFA 5T3UA 5AW1A 1SXPA 1RYBA 2IYNA 3GFOA 4DSAA 5LWQA 1EJ2A 2GKGA 2WM2A 3PLRA 1XEAA 4PR3A 4UHJA 1R37A 3K72B 3P1JA 5AJHA 3TB6A 3WHKA 1Y0BA 1DQSA 1GYPA 3SSAA 4E4YA 5KWSA 4XSHA 2RB5A 3ZWNA 3EA0A 2OHFA 4MDYA 2CUNA 4LGMA 1HEUA 3MJHA 1AK1A 3PDJA 3IEMA 3FX2A 4ZVOA 2JFZA 4P4UA 1Z5NA 1JR4A 4CLHA 2VNHA 4CIBA 3RBVA 4J0EA 4HB0A 4S3MA 4MQ4A 4NVRA 4FEGA 4ENQA 4ZD6A 4UFPA 1UWLA 3UAYA 1IRIA 1VKZA 3CUUA 4HB4A 2Q2WA 3EGXB 1HZJA 1XNRB 1ISMA 1I33A 3BGVA 4ZN6A 3M6VA 1JILA 2XYQA 3PFWO 1GRNA 1AB5A 3KT0A 4HLDA 3ZWVA 1DJQA 1IVSA 2J45A 1KDRA 1TB4A 2OK8A 2XLCA 3CMMA 3V4OA 4G0QA 2UXDB 2FX5A 2VXBA 3HR8A 3SHVA 3PHLA 5KHLB 3NHBA 3DVRX 3PJGA 3Q85A 5TJ9A 1JNYA 1S1CA 1V3UA 1XDSA 3QWIA 4RV5A 4O4HF 1VE6A 4JR0A 3UUFA 1Z2AA 1C2YA 2D5AA 4I50B 2CLOB 2XQVA 4RJIA 2MMGA 5HIIA 5LBTA 2A3RA 3I2JA 4TLCA 3MINA 4G1FA 4IDPA 1DXOA 1NQTA 4HEHA 1AS0A 3GFVA 1GQQA 5BWMA 4I08A 2A1UA 2GN2A 1ZK2A 3LPLA 5CK4A 1HDOA 5AJWA 1ZCJA 1DJOA 2X5OA 1QYVA 1WUTA 1C4OA 1EDZA 1IZ7A 2Y8EA 4KXUA 2ZBDA 1RQLA 1Z8NA 2JGNA 5ILGA 4CQLA 2NVBA 4F5YA 2AVNA 1NURA 2EFYA 1LJLA 4J8PA 3A37A 3VXKA 5TF0A 3ZWAA 4IXDA 3E8SA 1B1AA 4L1KA 3IR5A 2CKMA 1Q57A 2TMKA 3E9EA 5A4MS 1BA3A 1P33A 3MCVA 1LPPA 1QIEA 4A2WA 5EL0A 4MAFA 1RWQA 3EQ2A 4LX0A 1MJ5A 5IM4F 1X1QA 2AX3A 1HDYA 3H8JA 1EAYA 3EXEA 2P9QA 4FYWA 5I5GA 1D07A 1EPUA 3HNOA 5K9ZA 1H22A 1CJVC 3M6UA 1VDZA 2UV8A 2PUHA 3JQDA 1A9XA 1UEIA 4Q3BA 4KWIA 1T3HA 1ADBA 3DDUA 2CNWD 5E6SA 3VHXA 5JXGA 2IUFA 1JA1A 3D7RA 5ANRB 1F4PA 1QGAA 2O0LA 2AK3A 1SC1A 2B92A 1P7WA 3OPQA 1MIOA 1EA7A 2FEXA 1X7WB 1AE1A 5JCJD 3CT6A 2HPVA 1S0UA 1S1MA 3SF8A 1AZWA 1EK5A 2IEYA 3N1UA 1Y8ZA 3H5AA 4XJTA 2RGAA 2D1RA 3CG4A 1SRRA 4X1KA 4A0SA 1NW7A 1YZTA 4S1VA 1W5FA 4B45A 1OFHA 1TZ2A 4LGYA 1NJ1A 4BKRA 2PMKA 4F6LA 2FPPA 2VDJA 4ID3A 3VR2A 3UG7A 5KWIA 4D0LB 3BWXA 3V32A 2QD4A 3B9PA 1ACJA 4A26A 4W7SA 4NFYA 5KO2A 4WZBB 3OM9A 4RE5A 1W29A 4ZI7A 3CLUC 4HH4A 4WBSA 2BJHA 5FUWA 4BKUA 1GAEO 1H2BA 2TS1A 1JQKA 3EIUA 3F5SA 1TJ4A 2CZGA 1SIUA 3LCVB 3O47A 3ZQKA 4AJ1A 4ROSA 3KETA 4AI6A 2QTHA 3DO5A 4EVIA 2PGLA 3OIYA 3I04A 1Z4IA 1V5GA 1KNXA 3RSQA 4WL0A 1TU4A 5HRAA 2ZUEA 3MMNA 3PFCA 2FLVA 5FBRB 5LLTA 3ER6A 2EIXA 3HLYA 2Y0EA 5ALKA 3N7TA 1N2CB 2FZ5A 2YJ6A 3QVOA 2HCTA 1VZ2A 5K8TA 3TGLA 4BO7A 4JEHA 1L1EA 4FFPA 5C1BA 3UMMA 4TKVA 2AUMA 1J33A 5G53C 3JARB 3DKIA 2QZJA 1XNJA 2XB8A 4PYMA 4B75A 2J3IA 5HOQA 1WLSA 4TKZA 4AIRA 4Q4AB 1R5NA 5J4YA 2XMBA 4TLEA 3U4IA 2EFHB 1W47A 4OJNA 4GR5A 3HWRA 1YDEA 1XZHA 4F5EA 3F5MA 1H2YA 2BCJQ 4JS0A 5JDIA 2IBSA 1XZCA 3ZWYA 2I2AA 2Q1TA 2ZWAA 3EZ7A 1JQEA 2AJTA 1LVGA 2C8LA 2RIRA 1XL1A 1WP9A 2ZE8A 4YCLA 3P0EA 2VNIA 1SIBE 3O21A 1HFJA 3B3GA 3OPYB 3VOBA 4UUOA 5IXSA 1NXXA 5EI5A 4I5EA 3AU9A 5H9VA 5LYJA 4J75A 3VISA 3ZXYA 4NCJA 4XYEA 4TSFA 1DCTA 4FT4A 4O6VA 2ZRNA 3MLEA 3TK1A 3RUCA 3KFXA 3GD7A 1UFOA 3IBTA 3K2IA 4X84A 3CB2A 4AJIA 1FMFA 2G71A 3L1JA 1NVGA 2HIMA 2JDIA 1Q22A 2JJ8A 4V0KA 1G6KA 1DKUA 5BORA 1FE8A 1KMCA 1LLUA 2E9SA 3EIWA 3L01A 4NJOA 2II6A 4O8ZA 4OXYA 2J4FA 3WL8A 2APJA 4BB0A 1W0JD 3Q3HA 3HVHA 3OLCX 4AVYA 4J03A 4IJQA 2OXEA 4G67A 2N0SA 1F5SA 1LK0A 4IGIA 4Q9KA 2I54A 3O91A 5AKJA 5GWXA 4RKQA 4K2HA 3SN6A 4ZVNA 3WLQA 4BFZA 4UHCA 4K05A 1PLKA 4ZDKA 4PPGA 3C3WA 4IAOA 1T26A 2FCRA 2R7NA 4R8VA 4V24A 1ONSA 3V4FA 3WGHA 2BEVA 1Y6JA 4KFUA 1SVOA 2WJZB 1JKIA 3PV0A 4CIDA 5JNLA 2EATA 1Q12A 5LDDC 1T9HA 4HZIA 1NUPA 3P0RA 1WVIA 3AZOA 1ZY2A 1E2JA 3MT8A 4QEDA 5GMOA 4I9GA 3S29A 1FXSA 1QBKC 2QTWB 2Z3ZA 2QL6A 3WICA 1BCSB 3U3MA 2Y6UA 5AKGA 1ZVKA 3VR4H 1FQWA 1M54A 3J81A 4FI3F 4PS1A 1U2DC 5LP6F 4KO8A 4BMVA 2JFBA 1F3OA 4G84A 3DE1X 2GYVA 4H1UA 4OP1A 1YS4A 3GGPA 2AFIE 2Z6QA 1ZU5A 4F3YA 1OIXA 2QRVB 3PUVA 3QRWA 5EUQB 3WHIA 1C1DA 1AOXA 3QKIA 3ZOKA 4CHTA 4FOPA 1P0QA 1DFHA 1DZIA 3P94A 1TJ5A 1G3RA 1RM3A 3KDSE 3PNMA 1XVUA 2P8SA 5JH7A 5CW2A 4EY5A 1BC5A 3G13A 4FR2A 4IHJB 2FPIA 3DCIA 5ALTA 4ZYLA 4M9CA 1IBSA 1KO4A 2X22A 3L6UA 3O75A 4Q7MB 4ZA2A 2QQ5A 4E2XA 1PD0A 2OB1A 4UULA 1C3EA 3IA7A 4M87A 1FA9A 4OYYA 4RX1A 4CM8B 3FHJA 4MV5A 3TRIA 4NV0A 1ZH6A 3HZHA 4HQLA 1RWXA 5G3ZA 1E1LA 5K20A 3WOHA 4D2IA 2WPDA 1D04A 1EGQA 1L9KA 2BP7B 2PSJA 1AHHA 4HEJA 4LJLA 5DHUA 2EBHX 1GL6A 3FOWA 5CB0A 1FLDA 2O0HA 4KRFA 2GXQA 2VYNA 2W00A 4C6TA 2C9MA 4D96A 2CLIB 4RD4A 1QE0A 5EZQA 3VAAA 4WJLA 3HDQA 3IKMB 1ZD8A 2D0PB 3NASA 3R76A 2L82A 2GM4A 4NBVA 1ZJZA 2OO5C 3E5HA 1EA5A 1JDBC 2V6BA 2W90A 3M3PA 4JCCA 2WABA 3KOWA 5KOHA 4OMDA 2R25B 1P7PA 2G08A 4P4GA 5ALMA 2DUJA 3I2KA 2RK3A 1K3UB 4KPYA 4J4TA 1OX5A 4QRHA 4YCMA 2UVQA 4ZYZA 2TRSB 3T0IA 4JKIA 4MNTA 3ZX5A 2KE5A 1T3LA 1PUXA 4F8JA 2P68A 4JI6B 2RJ3A 2R6JA 4EVSA 4BEWA 4MPRA 2GYWA 1YMVA 3KWLA 4LC0A 4ZREA 3UHFA 2RHWA 2XNJA 1SD2A 1JB1A 5LB4A 5I4BA 5DP1A 3H2GA 1FFAA 1PF7E 4WVFA 4KN8A 4WEQA 3KPYA 3SX4A 3WNCA 4JELA 5FBZA 3M9XA 4ENSA 4Z0NA 5JPDA 2I78A 4ND4A 4FSDA 3WL7A 4KEAA 3I42A 4MW0A 4TT3D 2RAUA 3GBSA 4YO8A 4B87A 3BXEA 5GINE 1UT6A 2CUTA 4D9FA 3CRZA 4ESEA 5F9HA 5K7SA 4W7HA 3D8HA 1F0PA 2VK8A 5CEJA 5IKPA 1TJPB 2IX9A 3K9CA 1BWPA 2BI4A 3W90A 2Y3IA 3HJRA 4MQMA 5JFTA 5FNVF 1M1XB 1PJ3A 2OFFA 1H3FA 3ASVA 2R751 5CLJA 1SBTA 3C97A 4YX9A 3I0MA 4MUAA 3OBBA 1KHHA 2XGGA 3OSUA 4AW9A 2H5IA 1Q77A 1YD7A 1XZBA 1XTUA 2GEJA 4JC8A 4R40A 5FCDA 4R0VA 3OZEA 3K1AA 2ANBA 4HAVA 5DTMA 4EO9A 3OCVA 1TVMA 2QRKA 1KARA 2DTEA 2OCGA 2YWHA 2PWZA 3GFGA 3MTJA 4MUGA 2Z95A 1E62A 4R1LA 5FPSA 2OYCA 4EARA 1Z2EA 4DIBA 4XVUA 3QU2A 1YZKA 1RQXA 1UZAA 4LJSA 4LE0A 5EJAA 1GG8A 1AXGA 1GR0A 3BMXA 4OYRA 4QHYA 4WUTA 2XNDD 3IPYA 5CIWA 1NBEA 1RAHA 3VPAA 2ZRQA 4K6MA 3W2HA 4UPEA 4RHYA 4FTWA 5CA0F 4NCAA 3J7AC 2QE6A 1TIPA 3PX2A 1XZGA 5CIYA 4BQNA 3F74A 1HKUA 4UEWA 4FS3A 4CDMA 2HQRA 1O8BA 3URKA 3PXUA 2Z58A 1DBIA 4RMGA 5TGTA 3V2UA 3LRXA 1V1RA 1JLSA 5TSDA 1G6Q1 5KMGA 4F8YA 3BSWA 4RJJA 3SQXA 1X86B 2YXEA 2PS0A 3WDSA 4NFSA 4RTNA 2GR9A 2KMLA 5JSKA 3BD8A 4S12A 4ZDJA 2VHEA 4G0ZA 5K0GA 4JLKA 1GGEA 3SX2A 2HQOA 2WSSA 1B26A 1NF3A 3NOXA 3OECA 4M6WA 3SHFA 3T5DA 4AYXA 4EG4A 5IBQA 5JNVA 5KAMA 5BRAA 1USKA 3AILA 2QVZX 2PRSA 4GX2A 5HMMA 3JTEA 5J40A 2PQ6A 2A67A 3H5LA 2ZWMA 3DV9A 4MW9A 4X20B 5F78A 2ON6A 1B8NA 2D6FA 2BRUA 2XUPA 4RF2A 4BGDA 5CG2A 3DLCA 3BIOA 1X1CA 3CSSA 3GJ8A 4LWPA 4MSUA 1MX9A 5F1KA 1B0PA 2ZVDA 4AS2A 4MQBA 4CIYA 4DQUA 1HYHA 1DAOA 2C54A 1OJ7A 3RC3A 4OSPA 4DZRA 1TF2A 5BV0A 5JEDA 3L4BC 3Q3GE 1PT7A 4CEIA 4WOKA 2EVWX 4B82A 3T5BA 5BWBA 3IJ5A 1XWFA 5IXYA 2D4HA 2X9LA 3BHJA 4MUMA 3OI7A 4XLTA 2G1PA 1O6BA 3QOXA 3V5NA 3DZFA 4RPJA 2XUHA 2Q5JA 5CCEA 3KYBA 2ZXFA 1A2KC 4MWDA 3JAMA 5GVRA 2QZ4A 1IY2A 2VH2A 5KC8A 1IPEA 1F9AA 1WKCA 2A3NA 3N8KA 5EPEA 5HW0A 3UGJA 2FHSA 4AJLA 4IW3B 5A5DA 2YWDA 4TYMA 1GKYA 1T4CB 5CGQB 4WTOA 3RRZA 3SI7A 3K9BA 3M4XA 4UVIA 1AGPA 5PGMA 5FH9A 4P34A 2EFDB 4AECA 1EGAA 2NM0A 4NOMA 1FFYA 2H1FA 4GC5A 3GOHA 3PDIA 3EVAA 2XXJA 3B5EA 2OESA 1YKFA 3DCYA 2Z9DA 3GPIA 5KDLA 5HG0A 3RYCA 3IH5A 3HWSA 3OCYA 1GTRA 2O5EA 1D7OA 1G38A 4TQUS 4K6HA 5JPCA 3GCZA 4JR2A 4DT1A 3CUWA 3U56A 2J9ZB 5JCXA 2EDAA 5E38A 3RKUA 5LB2A 3D8BA 3U62A 3IAM6 4AKSA 3GMDA 3WB0A 3N0RA 3X1ZA 2OCLA 3UUEA 1EVKA 4ZCMA 121PA 2AEMA 2P0EA 1XNQB 4RHUA 2BR3A 5EMJA 1N2IA 1NF8A 4OCZA 1GNPA 4QWWA 1ZVQA 2O8NA 2XNCA 3DEFA 4G23A 1XIVA 1ZK0A 2ZT8A 4EW3A 3THYA 2Q7OE 3EWAA 2MSNA 3KYDB 4EJSA 1TUIA 4W5WA 4KQJA 1ZD5A 2XB9A 3KHKA 1J2TA 4H3KB 3PC7A 4Y2HA 3RFVA 4RVGA 2ZRFA 2L18A 3OY2A 4QO7A 3DEYX 2EW2A 4EG8A 1ZUWA 3HK2A 1RP1A 4OJKA 3RT1A 5KDDA 3M4ZA 3MUNA 3IUNA 2DFPA 3ND5A 3P9CA 5IYZF 5A3VA 2QS9A 1UKAA 2DCUA 1TMOA 3WZLA 4L5BA 4ES6A 2WUFA 3F3YA 4O2BB 4PYKA 5B53A 3QTTA 2HA2A 1NLYA 2AFIB 2A58A 3HCNA 4IPTA 4LQLA 1HV8A 2ZJ8A 4J16A 4XVQA 1KFBB 5KVQA 1C8VB 5ALIA 3EGEA 3TDMA 2IVFA 3GDGA 4TQGA 3QLJA 5D6NA 4JT4A 3O1HB 1XAHA 2QROA 1TM3E 3PWZA 3OZSA 2QT1A 3VR2D 4L4SA 4LSWA 2OKCA 3GHYA 3S28A 5AHRA 4D41A 5FUXA 2CJFA 1JB9A 3EAQA 2VT2A 2VDOB 1E98A 2XQJA 3W6UA 1Y3DE 3A1TA 3DOEA 4AMZA 3VR6H 1E2DA 2XMQA 5AW9A 4NXNB 1R6VA 3RNLA 1B93A 4TRMA 4GQAA 2ZTVA 3ST7A 4UTVA 3AC0A 1FP4B 5K0CA 1P80A 2P2NA 2DXIA 3FBWA 1NOJA 4BNYA 2O0KA 4LI0A 2J09A 4CDRA 2JKVA 5DRYA 3KKKA 1Y4DE 4N82A 3SEZA 1MIHA 2QHXA 4R1TA 1E5LA 4GZ3A 2W11A 2I91A 3I9NA 3U5ZB 1WSBA 2NV6A 5A4IS 2FRVA 1XKTA 3A4LA 2LE0A 2XUJA 3UJAA 3SX0A 4OO3A 4TMTA 3KQNA 5KI6A 1XVLA 5JMOA 1VFPA 2JAQA 4M1SA 3TSAA 1NNI1 1SOVA 4KDEA 3NALA 1U1CA 3DFIA 3UMSA 3FB4A 2GO1A 5FADA 2XE4A 3PZRA 4RACA 3ZLBA 2COKA 4D7AA 5A6SA 2NNWB 4YRNA 4QDXA 1QYRA 4HJRA 1RXIA 4ZU6X 3RLFA 4F85A 2GNPA 5A2GA 1LZLA 1E6MA 3NBFA 2VSYA 3O8QA 4IJWA 2IU0A 4ANFA 4F3RA 2C7PA 4LYDA 3CZRA 3KR1A 5AYVA 3IOBA 1WQ3A 3FNHA 5FNZA 3U49A 1SG6A 4P2BA 1JEYA 4YT4A 3QFTA 1ZGBA 3HYTA 3IP9A 3LW7A 5FDFA 1YQUA 2AW3A 5AW8A 3S40A 3CYFA 1T6XA 4BZWA 1HLPA 2R1VA 4HWRA 4R51A 4OB8A 2D2VA 1U4SA 2ZB2A 3HJHA 4I9NA 4J3NA 4TSFD 3RRNA 5K8VA 4FYJA 2FPMA 2I6UA 4JUFA 4RGYA 2GEUA 2XAUA 3KL4A 3VZCA 4IKPA 4WN9B 1L1QA 2JEYA 2OENG 4WY8A 4NU8X 4YJGA 3EVGA 4Q3LA 2JDID 5HKKA 2RAVA 2VTVA 1BFUA 4E12A 1K5PA 3DTNA 3AUYA 4QUAA 1J2UA 3DP7A 3HJCA 3EXFB 3OF3A 4UC0A 5JAHA 4NBRA 4L0MA 4X6LA 4KTTE 4WBNF 5EIXA 1QVVA 4KI0A 2BMWA 1DBPA 1DCKA 1A5AB 2XH8A 1YC5A 3B1VA 3QEKA 2BHRA 3G0CA 4RDHA 4TS3A 1JG4A 1M6EX 1W85B 4IFIA 5BWCA 3FIJA 7MHTA 5KQGA 1DUVG 3ONWA 1NWHA 3CGGA 2PUEA 3G9QA 1KMNA 1PJQA 3K0BA 5KYXB 1ZJJA 1CUFA 1W94A 3EXHB 3FYSA 4GW3A 4EENA 4MYCA 3F8SA 1OB5A 1B42A 2LCQA 3UMGA 2CBGA 4AF8A 4GWLA 1E8MA 4RQAA 5DVZA 4ABYA 4AXBA 3ZI0A 4PLYA 5DN6A 1QYWA 4DJJA 5JD4A 3CR3C 3GFPA 2B5WA 2JD1A 3GRRA 4RKFA 4X64B 1G2OA 2X42A 2LIVA 3O1LA 5L95A 3UHPA 3JVVA 3SIWA 4NHOA 5LOVF 4HMQA 4F2HA 3LCMA 4FNAA 4WZ6A 1C8KA 4ZEVA 2ONYA 3TLMA 4RJTA 4WASA 3ZWDA 3ESBA 2AJDA 3LUJA 1QAOA 1C29B 2VEOA 4UUNA 4WNAB 1F51E 2PX2A 1HNWB 4FT2A 4KLNA 4TL7A 1AUPA 2PTGA 3A6HA 1JFTA 1GILA 1Y3FE 4BE7B 3V1LA 2O57A 2I67A 4UCWA 2H4JA 3BD6A 4OU4A 3OE7A 3VFDA 1N7IA 3KXIA 3QBDA 3KPUA 4CKWB 4QIHA 3C7CB 3NDRA 4J1TA 4BLOA 2EWWA 3WHPA 1NW4A 2AOTA 1W4ZA 2DPYA 1JHZA 3T0FA 2GSWA 4BO2A 3OQBA 1KQ3A 2P65A 4CLEA 3QX7A 4IOLA 4Q9HA 3PXCX 3AFOA 2WPDD 1ODFA 1W88B 2FZ4A 5EE9A 2J9FB 4HXYA 4E03A 3QJGA 4U7PB 3P96A 2UVPA 2NTEA 1KJZA 1T2NA 3OFKA 2FMFA 3EPPA 4UOQA 5CMLA 1M34A 5CX1B 1AA6A 3Q6IA 3X1YA 1FDWA 1Q21A 1VLLA 1V71A 1SVUA 2X6QA 2DBYA 3A32A 3C0KA 3O7WA 4GPD1 1G2IA 4WIAA 2QMUA 2JLVA 3WY9A 3QQ5A 2AE1A 4RFLA 3PGVA 1D6NA 4PFQA 3DDZX 2I4IA 1T9BA 4Q3DA 3RD5A 1TM1E 2ONCA 4RORA 4EIWA 3CKMA 1ID1A 1XU7A 4NRDA 5DHRA 4W9NA 1PEAA 5JDCA 3P9IA 1J07A 4LV6A 3ZHSA 4X7MA 1JIQA 1EGVB 3V34A 4QTZA 1EKXA 4TKMA 4BHTA 2JHGA 3QBJA 2X23A 3HCRA 4ZGWA 3Q5DA 3M3DA 4BAGA 4KITB 1VI2A 5E4TA 2R85A 1F12A 3M6IA 1W4RA 3IPRA </