5JSQA

Trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-[7-(phosphonoheptyl]guanine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
195
structure length
173
Chain Sequence
CKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRDIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVYETWGKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords hypoxanthine-guanine phosphoribosyltranferase
total genus 60
structure length 173
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jsqA00
1QCCA 1IBSA 1LH0A 1P19A 1PZMA 1UPFA 4P86A 1P18A 3N2LA 1G9SA 1ECFA 1ECCA 1J7JA 1R3UA 3G6WA 1U9YA 1VSTA 5BQPA 5EUCA 3OZGA 4KN6A 4RANA 3GGCA 4Z1OA 1XTTA 1D6NA 1VDMA 4P84A 1W30A 1BD3A 1GPH1 1P17A 1QK3A 1OROA 2VFAA 3DEZA 4P3KA 2GEBA 3MJDA 1UPUA 1AO0A 5KAPA 3QW4B 2EHJA 1VCHA 5E38A 4LZAA 4FYMA 2P1ZA 1CJBA 1DKUA 2FXVA 4S2UA 4M0KA 1GRVA 3HVUA 4ZFNA 1QB8A 3M3HA 1XTUA 1WD5A 5BSKA 5BQOA 1ECGA 1QK4A 4P83A 1TC2A 2H08A 4RHXA 3MBIA 1ECJA 1I0IA 4RAQA 2C4KA 5ESXA 4P81A 3LRTA 2PRYA 5JV5A 1HGXA 2H07A 1Z7GA 4LYGA 3KB8A 3ACCA 1G2QA 1ZN7A 4M0UA 4QYIA 4RQBA 4IJQA 4RQAA 1P4AA 1I0LA 2DY0A 1O5OA 1I13A 1A97A 5HKLA 2HCRA 4JLSA 1OPRA 1U9ZA 4X45A 2AEEA 4PAWA 4WMLA 1L1QA 4RHTA 1OREA 3OHPA 1XZ8A 2PRZA 4X44A 1FSGA 4P82A 1ZN8A 1BD4A 1A4XA 1A96A 2H06A 3LPNA 1Y0BA 4LZOA 2IGBA 1G9TA 1ECBA 4MB6A 4WN3A 5KAMA 2WNSA 1DBRA 4JITA 3ACBA 1MZVA 5HIAA 1NONA 3H83A 4RACA 3EFHA 5IAOA 1DQPA 1UFRA 2JBHA 1TC1A 4RV4A 4P80A 5K51A 1YFZA 1QCDA 4OHCA 2E55A 1I5EA 4LZNA 1O57A 5JSQA 5ESWA 3GEPA 1NULA 1A3CA 1STOA 3O7MA 4F8EA 4RABA 3NAGA 1DKRA 3DAHA 1JLSA 2JI4A 4RHYA 4M0PA 4QYIB 1QK5A 4QRIA 3DMPA 3ACDA 4RAOA 1A95A 5BRNA 3S5JA 2JKYA 1XZNA 2XBUA 1DQNA 1BZYA 1QB7A 1ZN9A 3GGJA 5IPFA 4PFQA 4RADA 4RHUA 1V9SA 4TWBA 1A98A 1JLRA 1I14A 3OZFA 2YZKA 2JKZA 1G2PA 1XTVA 2PS1A 4LYYA 1L1RA 1HMPA
chains in the Genus database with same CATH superfamily
2FMKA 3PV0A 3RNLA 2AG5A 2YOGA 4PPNA 3RVDA 1L8XA 2QJWA 4I5DA 2BV3A 3R77A 4AICA 4P86A 1FRZA 1OTXA 4R54A 4MVXA 4TV8B 3OCCA 5JU6A 1JJ7A 4KGDA 3UJ6A 4YGXB 1EBUA 4TMVA 3DDSA 4RW0A 3WGKA 2IZ1A 1QZXA 1SCUB 1HE3A 1EA5A 2RHJA 4NOKA 1CQXA 4RSGA 3AG6A 3HJNA 5G1OA 4P3KA 5ALIA 2OORA 3N2ZB 3L7BA 2E89A 2GEFA 4IZ6A 1XD8A 4UD6A 4H2DA 4F4UA 1FFGA 3RK1A 9LDBA 4E4TA 4AUEA 1OZFA 3B6IA 3V7WA 2B0CA 1CX9B 2EFYA 4XR9A 3GRYA 1B3RA 4LNAA 3V46A 4Q3OA 5CB4F 3QJYA 1OYOA 2ORWA 2UKDA 3ND9A 3A36A 4MRVA 1U3CA 3UH0A 3TKLA 5EJ9A 1M2VA 3NHLA 2JLXA 1A8HA 1YZQA 3KV1A 3DAOA 5BSKA 3K20A 3RSHA 3RU2A 1IM5A 4MVJI 5GOTA 4C1BA 1PSDA 1D7AA 5IT0A 3DDOA 5B1SA 2C57A 1I7PA 4CG1A 3K32A 2C82A 4LZZA 4C43A 1Z7GA 1GKKA 4WW0A 1EZ1A 1FC0A 5DM60 4EJSA 3CBQA 1F14A 1HYHA 3HZOA 4F97A 2FEOA 1XWIA 3JYOA 3PK0A 2OPBA 3CVOA 4MV7A 4ODIA 2QTRA 2HPHA 2FPXA 5K03A 2DJIA 2Y1GA 1HDGO 1F9AA 5C3UA 3VTZA 4C07A 3WZLA 3ZGZA 1Q2XA 4GT1A 3OP4A 1J5XA 3COPA 4TKUA 2VQFB 4CEHA 3QBTA 1P7VA 5BOVA 1IJEA 3F71A 2FRXA 4UCFA 5KBYA 3ON5A 2PYZA 1UKCA 3KSZO 1JQ5A 4XYEA 2D1RA 1LK5A 4PRKA 2C3YA 2E18A 1SBCA 5U9CA 4M9XA 3LUAA 3IL2A 2EJVA 3BE5A 3YASA 2F43B 2XB9A 3D3EA 4QOFA 3F5DA 4R16A 1ZXXA 2IOHA 1XROA 2ZIWB 2CXHA 1EFVA 2G5PA 3KWMA 2XOKD 2BEKA 2B8JA 3C3YA 5EYPB 1E5TA 5GJBA 4I9FA 2GO1A 2FWMX 3BTVA 1ZGGA 5EJEA 3PRKE 4AKEA 4K6OA 4LECA 3X2FA 1BFDA 1N6LA 1Y7HA 5ALPA 1P2TA 2D59A 2X19A 3HKBB 4N47A 5K0TA 3O1LA 4RD6A 2QTLA 4PPQA 1DBSA 2WM8A 1I7SB 4UBMA 5I3ZA 1QOPB 1S2MA 2X8BA 5KREA 1FUEA 3U5ZB 1ZH2A 2NTYC 4TL7A 1V71A 1NXTA 5TVKA 1FQJA 5DLQC 2P2GA 1KFJB 3WGNA 4OX9B 4KPFC 1A04A 5EE0A 3IIIA 4Z4IA 2QMEA 3FTDA 4I8XA 3HDQA 1EA7A 2QD1A 1U0FA 3DT9A 2RK3A 4WEOA 1P1FA 5TGZA 2FSUA 4D3SA 1GDHA 4KIUA 3QKWA 5H7XA 3FCUB 3NVAA 1P2VA 3I09A 1PJLA 4KN5A 3RUAA 5JQWA 4IX1A 3HSYA 4DNPA 3W5VA 3G0DA 3P94A 3PWTA 1AV7A 1IPEA 3LT2A 4PGMA 4EJ2A 3ECCA 4CW7A 4BNDA 3L49A 2QTHA 1EXDA 2JW5A 1VBFA 3CT6A 4B44A 3DT8A 4LJLA 3D1VA 1QRTA 3BWMA 3T35A 2CCGA 2ZGVA 3NRJA 5FWXA 3W5CA 3WYEA 1FMJA 1SURA 4A1FA 1DOAA 2GVDC 5ER6A 3SYTA 3LV8A 1U7UA 4IGAA 4C4XA 4AZTA 3V1KA 4LG1A 3LUBA 3LO8A 5ALQA 1VE3A 7AT1A 5KHLB 4ADSG 4JYAB 2MSNA 3DOHA 2ECOA 3LXXA 2O07A 4GP7A 1KDZA 4G67A 1XTTA 3N05A 4OMUA 4GEGA 5HQ3B 2PA0A 2Z6AA 2J3IA 3MNFA 4F11A 1I3KA 2NLOA 4OBXA 4ZRDA 1FVHA 2AX4A 2HD4A 1CRQA 3DHNA 1T36B 1LS1A 1AGNA 3KDAA 1JNYA 1ENOA 1D2CA 1ZH8A 3NTXA 4MAAA 4UOEA 5JNSA 4GKJB 4O2BA 3TPZA 3DKIA 3NBFA 2NTVA 3NEYA 3G5LA 3AB7A 1U0HC 3VR6D 1HL3A 4F93B 2YDYA 2Z83A 4XVQA 3M81A 5CBPA 1N0VC 5ALKA 4B4KA 3RG2A 4IFEA 2I3AA 3NT5A 2WU8A 1XCOA 4EYQA 4KITB 3WAGA 3OMWA 5DO9A 2EEPA 3WLQA 4YT8A 1N5DA 1IIRA 4P53A 2OFFA 1E8MA 1R6VA 1X1EA 5DTQA 3HCAA 3RVPA 3T0IA 5KSZA 1WAMA 4MDFA 1MTOA 4NV3A 1SHKA 2ARKA 3UWDA 4R9RA 3W5UA 3IXLA 2DMRA 3V4PB 2Y1KA 2ZYTX 1A88A 2Y71A 4C0AC 1T0JB 2ZUDA 4AKTA 1QLHA 3IO3A 2PUBA 2AC2A 2YX1A 3VMFA 4PXAA 2K5UA 2HUPA 2W90A 1GFZA 3EAQA 4LE1A 2ZQ5A 4WKBA 2RI1A 4MDHA 1IHOA 4Y0AA 4GZLA 2H65A 4OKIA 3BK7A 1UJ2A 1OI7A 4JA2A 1CZUA 1J5PA 3C3AA 3S1AA 5LP1A 4L6IA 1H6BA 4JHXA 2KX7A 2ZDQA 3P4XA 3UAVA 1IK6A 4N4AA 3TW8B 1GILA 1SZCA 2WIBA 4N9WA 3HB0A 2C7QA 3FAKA 3OPYB 3DW3X 1I2AA 5TQ2B 3FR8A 5A06A 3AH8A 2HL6A 3A28A 4HDQB 5AVXA 3JAWB 2JBHA 4WA8A 3Q7IA 1GDDA 5LOVB 1JDSA 5EWJA 4E5NA 1LB1B 3WLKX 4JVNA 1OXVA 1ZU4A 4UCWA 4ZC1A 3UXMA 5A02A 4PW0A 5KIAA 3ORYA 3Q3IA 4EHLA 1EM8A 3PUIA 1L8LA 1Y8QA 3EVNA 2ZE6A 3KQWA 4MS4B 4LDJA 1DL5A 4Q4AB 3HDGA 1CPYA 2VJYA 1FNBA 2C5FA 3RNOA 4BWYA 4PNPA 1Q0HA 3KYCA 3WAJA 1ZW6A 3OPNA 2NV0A 3GLGE 1JJAA 3X1DA 3ZY3A 3IRUA 3S5JA 3B1WA 3VPFA 1BFUA 2GBFA 2BM8A 1J4AA 2EJBA 4IMIB 4MGZR 2JGRA 1DBVO 4KXMA 4OG2A 2EZ4A 4JI8B 1D7OA 2MSLA 3RIGA 4BQIA 2I2AA 121PA 2NVOA 3MFQA 4RKRA 2PMEA 3EZXA 4CV2A 4XTRA 4MQMA 4RKEA 1CJSA 1SXPA 3WIVA 1YWGO 1RXCA 4GECA 2X8AA 4Q24A 1P1BA 3HB4X 2A1UB 5CTJA 2J0EA 5C4IA 3GI1A 4TXMA 2IHUA 1LKZA 2LNDA 2QTAA 3STHA 3HC7A 4BGIA 4YXWD 4JD5A 5AVJA 4FZ3A 2J5QA 4J07A 4Q4JA 4UXIA 4DLRA 2R1VA 5FLXA 1AGYA 1J21A 2JFOA 2JAOA 3U3DA 4C7XA 1BDMA 1OILA 2IYZA 3IMEA 4XVRA 2WIGA 1NSFA 4BECA 4COKA 2HRQA 4O4HB 4RTLA 3BZWA 3COSA 3EH2A 2WD9A 4PSVA 4WZ6A 2YL2A 1PJTA 5I7WA 2D2FA 5AM1A 2VRBA 5FL7A 5JLJA 4AF6A 4MWTA 5D6NA 3LUPA 1LDNA 2FX3A 2CJPA 4CL3A 1N6KA 1FVXA 1VIAA 2GXSA 3ZGOA 3NDJA 4L28A 2ZT6A 4XX1A 5CT8A 3O8RA 3LW7A 3AL0C 3AI2A 4I3GA 3WBKA 5JDCA 2O1EA 1BYIA 2F59A 2WNIA 4U39A 1F2UB 3B9RA 3FWHA 5EXDA 3UGTA 4K87A 4GZMA 2PT7A 5AWFC 3VHXA 3HL0A 3MINA 4XB1A 1T5BA 2TSYB 2ZITA 3EXHC 3JVDA 2QB5A 2AFIE 3ESZA 3AUJB 2CLCX 4Y1RB 4XPIA 3TSOA 2F1IA 4E31A 1G8KA 4Q1DA 4ZI3A 5KTYA 1X7HA 2EGUA 4RHXA 3UGJA 1UWKA 4URYR 2M6RA 4NICA 4EVRA 4FJ1A 2OHVA 4Y67A 5K8LA 1L4NA 3TTTA 3L0ZA 4GOJA 1JKFA 2YFQA 3GH3A 5AKJA 5GONF 3VPBA 4A82A 5IAJA 4AFNA 4O6VA 2ZAMA 3VNRA 5CFRA 2SKEA 3Q0EA 2FX2A 1Y63A 3E9YA 4DCNA 2QN6A 1VGRA 3HI4A 1XALA 2FK8A 2BR3A 2JLRA 1ML4A 3GAMA 4IWXA 4HATA 5IU6A 3OQMA 1GQOA 4IKOA 4NBTA 5FT9A 1QAMA 2H59A 4HPWA 4I9UA 5ARDA 4UPEA 4Q7KA 4E2ZA 2X4IA 4Y1GA 5ERYA 1I94B 1SIUA 1Z2PX 2ZSBA 2IUTA 2WD7B 4II2A 1VMKA 3HJBA 2R8EA 4H6XA 1WB5A 1XZEA 3K73O 4L75A 1GA1A 1PD1A 5ALXA 1O96A 4IGKA 5KNDH 2K7FA 4KC0A 2WM9B 1E5VA 3QUQA 4YAUA 3UICA 4YRBA 2FFHA 1FNNA 2NV2B 4QKQA 5KTKA 3CNOA 2QSZA 2WUFA 4PIMA 1M8KA 2I2WA 3T95A 4YRSA 3DGFC 1U2GC 2Q0QA 2GBIA 3PQFA 3R75A 4WZAA 2QG4A 2REQB 3AHHA 4RSMA 3EXEB 3HBFA 3C45A 1CY7A 1ZCBA 2GRAA 2HHLA 3PGVA 5F2KA 2XNDA 4GXQA 2CLEB 3MJ4A 3JS5A 4BZWA 4L8GA 2FJ0A 3ZWAA 2FOIA 4NG5A 4KWEA 3EUFA 1YIDA 2WOJA 3GW8A 4TLMB 5BV7A 3WVNA 4G5FA 3F6BX 1YA8A 2O0LA 3GCWA 5KWSA 3WP0A 2PX6A 1AIPA 2J1LA 3FGOA 2QN9A 4EVSA 4AKGA 1TW3A 2PZEA 1X0XA 5HJ5A 3UWKA 2P75A 3OTOB 5CT4A 2R6JA 4IIEA 1PJQA 5F7OA 3BCUA 1UL1X 5EEHA 3LDGA 4OU5A 3BFPA 1BA3A 1KI4A 4KLZA 1YAJA 4LHXA 4L3WA 1PS9A 1Y6JA 4AZ3A 1XDDA 5DH9A 3DHYA 4KQWA 1RR6A 4QICA 4R1OA 1EFUA 3THXB 2FPMA 5I9TA 3BHJA 3LOPA 3RJMA 1QRSA 1OGYA 1QBGA 2FPOA 4MVJM 4HQRA 4NEHB 3DMRA 3R3YA 4B3CA 1WXHA 4KFRA 1R4NB 3KALA 5EWMB 1RLOA 2Z08A 4TLAA 2H2HA 4YRDA 3OCVA 4DADA 5JQGB 2AK2A 4R2IA 3KZCA 1NWCA 2O2JA 4MB0A 1NLUA 4HUQA 3S2FA 2RBGA 1J06A 4HF7A 5CB0A 4IRXA 2R1TA 4KWIA 1XLWA 3IJPA 3FLEA 3ONVA 1KO5A 4YCNA 3ASUA 4PC1A 3B9PA 4N5MA 3T7TA 3ZV5A 2IDJA 2ECFA 1F12A 2W2OA 3OPYA 1ZGZA 4NS4A 3IB3A 4N49A 5JXJA 1NT2A 1UAYA 3O5AA 2RGNA 4IH9A 3QKIA 2C2WA 1C1HA 2NPFA 4MUYA 1A5SB 3RHTA 4YMIA 3T7DA 1NW4A 4IQ4A 1FFWA 1OOEA 3M5PA 4P7JA 5JWHA 3UKOA 1MENA 1JEOA 5B64A 3EXG1 2EFJA 3N2GA 3DYIA 2FG5A 1MDBA 1TRKA 3H0EA 1U99A 1FDOA 3Q41A 4NYIQ 3ELWA 2WBLC 1FBNA 5EY5B 1DKPA 3BF8A 1LZLA 4DV0B 4IHQA 5DHRA 2RCNA 4U5XA 1WZUA 2R2GA 3QP9A 5AKEA 2X58A 4KI7A 4MLDA 4BB9A 10MHA 5IKXA 1FLAA 1G291 4BJ3A 1RXWA 4LY9A 2WWTA 1PV4A 3H4TA 3F78A 3UWMA 3BILA 5SY6A 2CJXA 2PLAA 5DEOA 3E5NA 1ZUNA 3IT3A 1H2WA 2A1TR 2OD2A 5KYVA 4RMNA 2JD2A 5SZKB 1Z47A 3F9IA 3R8FA 4TSFD 5HF9A 3PJGA 2IXFA 4FHGA 2ILVA 3IUJA 3VR0A 2DXIA 2D3TA 3TD2A 1YSCA 3ENWA 3E15A 3MJCA 1MNQA 5AM3A 1T5OA 4D81A 2ZM6B 4JIGA 3TJMA 1XJ0A 1OKKD 3SHWA 2XTAA 4E70A 1VTKA 4BP1A 4CFZA 2PWAA 4DCGA 4KR7A 2HCTA 1QRUA 3A6ZA 4MW0A 4A2WA 1RWOA 4NBWA 1JA9A 4C7VA 2VHEA 1M0EA 2AH5A 4HWSA 4CIBA 2IXDA 2QRVB 3M6UA 3RHZA 3GJ8A 2JI9A 3H16A 2QR2A 5T6MA 5AOVA 5A9TA 5WRFA 3LW8A 2V58A 4D97A 5AIBA 4MPJA 4Q93A 1C8KA 1PW7A 3M9WA 3IUPA 1H1LA 2QTBA 1IATA 2OCGA 1CHNA 2RKOA 2C2BA 2HCJB 3PTZA 3LXMA 1RHUA 4MHSA 3VR3A 5IHPA 4BLWA 3PPWA 3UV6A 3KDSE 4KH0A 3JRWA 1PIWA 3EIQA 3QPVA 1QHHB 2QT1A 3T7AA 4YTEA 2G25A 3K30A 2RG1A 4TROA 4CKZA 1L5VA 2QXUA 1BGWA 3NC4A 4FYXA 2WVAA 4GQIA 3GZNA 3FMVA 1HRKA 3KTAA 1P19A 3NT2A 4AS3A 3CVWA 5I45A 1RABA 1MVOA 3NGMA 3IB6A 3JPWA 1AB5A 2W6JD 2BWJA 3C70A 3F7MA 1TT5B 1NUAA 1I3MA 3NVMB 2XVAA 1X1QA 4J2OA 4L5AA 5HSGA 4YT2A 4A2QA 3WNQA 1L7BA 1Q16A 3FSEA 3GDOA 4GKKB 1J20A 5DK6A 1R4AA 3H9QA 1SUAA 3TN7A 3WGJA 3TLZA 1FXSA 2UXBB 3IQWA 4ENVA 1YRQA 3NDPA 2Z8YA 4E11A 16PKA 1MQAA 1AN0A 4AWBA 1AGXA 2V7PA 2QSUA 2CEKA 2X15A 3TQTA 3WB9A 3TL6A 4MWZA 4BN4A 2O1WA 2Q29A 4BU0A 2I3ZA 3OX1A 5IHXA 4QZVA 3U2QA 1APBA 1SRRA 3JWPA 4DUYB 2WPDD 2H00A 3DXXA 1T0IA 4G5RA 2QU8A 2J4CA 4LVOA 1Y3CE 1XTUA 2CUTA 4QNRA 1E5XA 2Z0MA 4LRYA 1YVUA 2Q45A 2WTXA 4JMPA 3U37A 4IUDS 4A5SA 4J03A 2WUDA 5EPUA 3EDQA 3OT5A 4Z8YA 1W36C 1TIPA 1IUNA 3EGXB 3EVGA 5DM2A 2Y9MB 3DQPA 3C16C 1NVEA 4PYQA 2PUJA 1Q3TA 3DFFA 3G6KA 4GGPA 4NAVA 1IZ7A 1J0CA 3DXZA 3QNWA 4P4GA 4WFJA 2XZPA 4R8RA 2PMCA 1BU5A 4CU2A 2BMFA 2IUEA 5ICGA 3QX3A 1UFKA 3UHFA 5G0UA 2WJIA 3GLVA 3K9CA 4BPRA 4RIGA 2E0IA 1M67A 2B2CA 1YQWA 2F00A 2PRJA 3EOZA 4UUNA 3AEYA 3DP7A 1V4BA 3NTOA 1I5OA 4FZ5A 2BVNA 1NVTA 4MVJE 4QU9A 4Y2GA 1YHYA 2WT4A 4JX9A 2WSMA 3DBOB 2H0AA 2BUAA 3G2OA 3DM5A 3IULA 4UPVA 4GPBA 3DH0A 1Y6QA 3KAPA 1OBVA 1U0RA 5KJCA 2ZRDA 3NBQA 5EKTA 6GPBA 1WBJB 3GFQA 3EXG2 3R6LA 4PONA 5JVDF 2WAOA 1U5BB 2DRIA 3OJOA 5CHEA 1GFWA 5AW6A 3ZCVA 4FDUA 1MMFB 2HHJA 5FNVF 3SF8A 1YJ8A 2GXAA 4QM7A 2C2GA 3H0CA 1CP2A 3CEMA 4KRYA 1DLJA 5H83A 1Z7WA 3CR7A 2MYTA 4XYGA 4ZOLA 4FS8A 2R8ZA 4NCHA 3RRBA 3ZE6A 4JGGA 5LQNA 3A2KA 2R5FA 2OP1A 3VC3A 3ZHVA 2JFVA 1NG1A 1SPBS 4BKMA 3AM4A 2PPLA 3B12A 1K5PA 1A7KA 4JDPA 3SX4A 3RSSA 3E1GA 2IY9A 1ZK1A 1NQWA 2P5TB 1LGYA 3KZOA 1EP9A 4R1SA 2FZCA 2L0XA 5EQJB 3PPVA 3RUCA 3SHTA 3UT5A 5FH9A 4G1FA 4XVCA 1WNFA 2DQYA 4DXDA 1EP3B 3WDLA 5KMGA 3L8HA 1OGJA 1WW8A 4OM7A 5D87A 4Q15A 1W19A 5E6SA 2BKVA 2QUJA 3WQRA 4BLRA 5A9SA 5HUJA 1ODTC 2ZG6A 4Q34A 1II8B 5DHFA 4JU9A 1KI3A 1FFCA 2AVDA 2VP4A 3NKLA 2XNDD 3PXXA 5DSTA 3G2LA 3N9IA 3GA0A 3D6JA 2PUHA 1VBKA 4LS3A 2DQ4A 3WRWA 1W88A 4HR7A 1M7HA 1P1RA 5EWJB 2JJMA 3LUDA 2D1FA 5IYZA 4EKGA 3QSGA 4I5GA 2CKMA 3M83A 2XMCA 4IO1A 4I5IA 5DNDA 2W2MA 1O0BA 4MV1A 4GPEA 3HUEA 1R3UA 4FGZA 5GONA 3AVUA 4JYMA 3IJEB 4ZYUA 4X94A 4DC9A 5F76A 3E84A 1ADFA 1HBJA 4XR4A 4R1NA 2Z3VA 4BJHB 2BISA 2IZ7A 2ZPAA 3S1AB 3NGXA 1T0UA 1BCRA 2UZ0A 4LDQA 3CJQA 3SS9X 4YNBA 4XX0A 4A16A 1U7WA 1LSOA 3DHEA 4U7WA 4YUXA 1Z0FA 2VQ3A 3GJYA 4ZVQA 4KP7A 1YL5A 2P6OA 3HV0A 4MGIR 1E1CA 1OAOA 2DUNA 2ZT8A 1U7ZA 3E2MA 3EISA 2ZWPA 3ROPA 4BC1A 4EABA 3SOZA 5CT9A 1MJNA 2ZYIA 1RAFA 1NI3A 3OTHA 4RY0A 4CF4A 3LSYA 4H31A 5HTOA 2FPWA 3U7EB 1K9SA 4Z4CA 4RVUA 2CW5A 2FPGB 3K9HA 5FI5A 3L0IB 1PLJA 2QW8A 3IERA 3K2BA 4I9GA 1OWNA 4JZKA 4NZPA 3VH4A 3DEIA 2D0PB 3KEMA 1TIKA 2G70A 3C1OA 3R4CA 2IDKA 3FNGA 4PR0A 3BICA 3L8DA 3KZ1E 4KSYA 3E27A 1KO4A 2GDJA 3BEOA 1CRPA 1LCIA 3T3OA 1E7RA 2Y68A 4OHBA 1UT5A 5IWAB 2YZNA 1I13A 2FZWA 4K8RB 2ZLBA 2E4WA 1D2HA 2C2OA 2OCYC 4KACA 2C9ZA 5EVJA 2HQOA 2FHPA 1V7CA 5FAKA 1NURA 2HWYA 1P73A 5FUBA 1V95A 3LQFA 3CGWA 4EH1A 4BVFA 1NC1A 3OTQA 4QPZA 2I0FA 3MXOA 3U4QB 3A9CA 2GUWA 5CJ2A 4HLNA 3VPAA 5FWYA 1UIMA 4TV9F 3VZQA 5FNZA 1VPLA 1UEIA 3Q72A 4K26A 4PYMA 2IEDA 3GN2A 3ISJA 3BA6A 1X1RA 1FTWA 1WULS 3VAYA 3UJ7A 2HXSA 2PVSA 1MW9X 3HYLA 2VUUA 3EVCA 3KUDA 3KWFA 3OEWA 4ESOA 3EC7A 2ZREA 4RF2A 4F8JA 3AVXA 3EHDA 1WA5A 3G2HA 3IPAA 2OZEA 3OIGA 1SXJE 5TV2A 4ASUA 4JGBA 2WWRA 4KX3A 1Y4SA 2NU6B 2V7QD 4QTYA 3WISA 5KPDA 5BR1A 3I61A 1PWEA 3EG9A 5DHQA 3RT9A 3N7UA 4KR0A 3EPHA 1DJMA 4XWGA 4EWLA 3LKVA 4GBGA 5KYGA 1MZPA 4LUCA 3LGXA 3DV0A 5K05A 2F3RA 2VHUA 3LA8A 3GLSA 4KWTA 1SXHA 3L6UA 3W3AA 4JODA 4B3XA 3R44A 3C14C 4AJ9A 3T9BA 4PO3X 1B42A 1WXGA 4BL5A 4P36A 4CF5A 7MDHA 1VJ5A 4L8WB 1NXQA 2VTBA 4YFVA 2YMPA 4MWOA 5EG5A 2Q07A 2RE8A 5CYFA 2R6FA 4N7BA 2IBTA 1SKAA 2HJ9A 2IZZA 2HKIA 2QROA 2RC6A 3HWX1 4M0MA 5CK5A 3W5SA 4E5VA 1NVVR 3HPRA 2AI2A 1ATIA 4FYKA 1A4RA 1L4MA 5K8TA 2VK2A 5CA1F 4Z4QA 2FJUA 2YJ6A 2QMZA 5LCXA 3ZHOA 4YRLA 3S4YA 3CUTA 3IE2A 3OFVA 3R2JA 3WLAA 4CR7A 1ZHOA 3B89A 3BB3A 3AUYA 4RK7A 1I1NA 1Z4JA 3BXOA 4MPPA 3T7CA 4RX1A 3D6HA 4HVCA 4L76A 1L6RA 2FPIB 4GMGA 3MRXA 3V4OA 3FVWA 2HMVA 1BOOA 4F84A 1R66A 1ZM4A 4QBGB 3SS8A 3O2JA 3SQWA 5LYJF 4XLTA 1KJNA 1WDMA 3QVSA 5AHWA 1WZIA 4PG8A 4EPRA 3KEFA 1YAHA 2XUHA 1DT3A 1BD3A 1GPH1 1X1SA 2F4NA 4BFSA 1WETA 4PZDA 1PJ2A 4GGMX 2CDNA 2IOQA 4DGSA 3OE7D 2HNBA 2HOQA 3LBAA 3R5FA 3LLCA 1YDGA 4UHBA 1R64A 2HQ1A 4K9MA 3F4BA 4M49A 1UK7A 3AONB 3LG2A 1W2HA 1UAGA 1X7WB 1H6AA 3GL9A 4DQKA 5U4QA 5FKJA 3A6LA 4OXIA 4GR9A 5E9WA 3RRNA 4TZ6A 3VYSB 1RIIA 1V3QE 3N7TA 4L72A 1RVV1 3OZAA 2CL5A 3A4LA 2OWEA 3FPKA 3JAKA 1TL7C 3RSGA 5JY1A 1TC2A 1IEVA 3G1WA 3WLEA 2EJWA 1P2DA 4UZEA 4NCBA 1TAUA 3VJKA 3THSA 2M1ZA 4L73A 3WSWA 2PGLA 4IJQA 1Q6ZA 1V3VA 3P9YA 3ZU6A 3JRNA 3OWOA 4JFAA 1Y48E 2FMFA 1T3HA 4BX8A 1MH1A 2XOEA 3FSRA 4URFA 2AZTA 4MKHA 4OQZA 1TZJA 2KHZA 2CLHB 3AR5A 1U7HA 4QXMA 5CXQA 1GGKA 5C3MA 1PQYA 4EW2A 4HLDA 1VLQA 3F1LA 2ZIXB 4IJWA 4EUKA 3DT6A 5A9RA 4YMVA 2ZPUA 3ECAA 3NG1A 1G1MA 2Z4SA 4F5EA 2J5KA 1K1EA 2WA2A 4IMJB 4MVJH 3N6RA 4ZYWA 1GXSA 5ECGC 2EVWX 1FP1D 2I8CA 3NASA 4MWCA 1MX3A 3M0EA 1O6BA 3VR2D 4MCJA 3SVTA 1YUMA 4L5CA 5CVJA 3VKWA 2PL5A 1E63A 1FRQA 3PQ6A 3RYHB 3UFXB 1EUZA 3AIOA 4IOKA 4IHJF 1QH0A 2VT6A 2GK4A 5LVAA 2IY7A 4LSGA 1I5EA 4CETA 5EIBD 5JMPA 1DELA 3KKMA 3PYXA 2P4EA 4L5JA 1VCNA 1YKGA 4TOIA 1WXXA 3P7MA 2PX8A 2XQJA 1W47A 3SICE 3GGDA 4PAOA 3S99A 2JLBA 3GRAA 4RMHA 2FOXA 2PZJA 4UE2A 1M83A 1KZHA 2VBIA 4UU7A 3FLAA 4DT1B 3VVLA 5BRNA 1Z6PA 4MS3A 3ZIAA 1KK1A 1A9XA 5K0EA 4LF7B 2DPGA 4QQ8A 1M2OB 1I4DD 4S04A 1QB7A 1AK1A 1ZIXA 3WDMA 2M6LA 1EWYA 2QPTA 4JJ6A 1KC3A 1VMIA 2HSEA 4FCWA 1XL1A 3WO0A 4X20B 2CZGA 4DQ0A 4RD2A 3DM9B 1HDIA 3K1AA 3O26A 4PE5B 4GHWA 1ZLXA 1VYVA 3AHEA 3PGKA 4Z3KA 4WK0B 2FA9A 3FBGA 5AJXA 4E09A 3V2GA 1A8QA 5JHHB 1TADA 5KMGB 4QA9A 5EERA 721PA 1WMBA 1ZIOA 1P7WA 4W5HA 1WZEA 1H0RA 2C95A 3JU3A 1YUNA 4BYMA 5I4BA 2PSSA 1JHMA 1VQ1A 3CMMA 1J2UA 2GJ8A 2C3PA 4KIWA 1X8XA 3OWXA 5AP9A 1V0JA 1WKBA 2YCLA 3TBKA 3WGLA 3LFTA 4BV8A 3LOUA 1TM2A 3G49A 3LE8A 1WZ2A 1ZVMA 1PNRA 1C3OB 1U1EA 3DUFB 3GFPA 1O08A 3KHTA 4LV6A 4M53A 4IIFA 4OFZA 4C4ZA 1PL0A 3HBMA 3BXZA 3OT1B 4OL0A 4MI6A 3M3PA 1DAFA 2IUSA 1MIOB 2X76A 1PLLA 3QKRB 2HSJA 3KR9A 5LQUA 2C9YA 4OKSA 2ZRCA 3CCBA 1UK9A 4D92A 4B84A 1ZI6A 3BTUA 4Y6LA 3W3ZB 3I2JA 1FDRA 2EBHX 1IVSA 2XT6A 1US8A 3N0WA 2OVBA 1KBQA 1G6HA 5AVZA 4JJ8A 3CLTD 2VJLA 5FPTA 4MDYA 1KTIA 3QPCA 2PG3A 4PQEA 3L8EA 4Q21A 4DKXA 4F1JA 5BQ3A 2Z2ZA 3I32A 3LH5A 1R1DA 2HAEA 4PVCA 3GVHA 3GG2A 2CMKA 4KLRA 3DNMA 4CUJA 3ESXA 1BDHA 4EDHA 4M0UA 4WEQA 1AOXA 2JFXA 3IILA 4NJOA 4OUDB 4QDJA 3PWKA 3TBHA 4K1XA 3QQPA 2VTEA 2RGCA 4OXNA 5DHTA 1PGPA 4DWWA 1IJFA 4P4SB 1NKTA 3DEKA 4TTTS 3RI3A 2XB2A 2CFSA 4W5JA 4A8HA 3IELA 1F38A 4RORA 4EB0A 1Q92A 1OREA 3QF7A 1BQEA 1OCEA 2L18A 1PZHA 2Q8PA 1QCYA 3D02A 4RA9B 2CDBA 3GK3A 1ZN8A 4I5EA 3ZK8A 3O8BA 4QC2A 2E48A 2RCYA 4QOSA 1ODJA 1SXIA 4A36A 4H27A 2J5BA 1QH1A 2JEOA 2Z95A 3JSAA 1W2WB 4B7CA 1ADGA 2OUIA 2P6NA 5FPQA 4P31A 4YP9A 1GLNA 3EA5A 1NUQA 4EUSA 4HDRB 3M3DA 3GDHA 1ZHFA 5CFMA 3CIOA 1E7SA 3ITDA 1OX6A 3GMTA 3NTLA 3RH0A 5JS1A 3N1UA 3QU2A 3HBNA 4KOEC 5C1OA 4Q9KA 3LUCA 1YASA 4OHCA 2SKDA 3SFVA 4UHHA 3OLXA 4RIIA 2O48X 3CRNA 3CLSD 3GIWA 4FCTA 4X61A 4A8JB 4AJPA 1LTHR 1HNXB 4LYFA 4UW9A 1ZM3A 1Z45A 2HWUA 3H3JA 4GZ3A 1L7XA 2P2YA 4G4JA 1V3UA 4WY2A 4JLOA 3AJAA 5DWVA 2QLLA 5LZ9A 1JYFA 1PGQA 1FFDA 4KZKA 5KQMA 1RYMA 1NRXA 4GPAA 4JUCA 1ZH0A 3BDVA 2OO5C 3HJHA 3OURA 2O8BB 1UFOA 2IF2A 3PUWA 5B7PA 1KJ8A 5LQCA 1J2YA 3D6NB 1CW2B 3THYA 1A72A 1PBTA 1GKUB 1E6MA 1TLTA 1MO3A 2EIXA 1YR1A 2I4OA 2PAFA 2PGXA 3QTBA 4DQXA 5BMVB 4QQKA 4I50F 1C7IA 2UUAB 2GD1O 2ZBFA 1M5UA 4BNVA 4DJAA 2X0NA 2XWSA 1A0OA 5LZ5A 1GZ7A 4HQFA 3TAXA 1ORVA 3V3TA 3NOQA 4O2AA 2HF9A 4EEZA 5B3JC 2D6FA 2OXRA 2WABA 4HYEA 4H0NA 1EQUA 3V8NA 3VDRA 4DIOA 3P52A 1NUPA 4KK4A 4M0CA 1Q1BA 3SPXA 3SXPA 2IPNA 5KHOC 1S1MA 2C7OA 3QBEA 4I4TB 1E3IA 4LOHA 2Y0DA 4DEVA 1M2WA 3JQGA 3CNNA 1SVKA 4QATA 1ZM9A 1NE7A 4DR4B 2QTFA 4ISBA 4Y6PA 5A4FS 2DFVA 3F49S 3AJ8A 3L7OA 2X7JA 4WIAA 4LDAA 1L7VC 2CCJA 3K71B 1HG0A 3ELUA 3TBFA 3SKXA 3L6BA 3L0DA 2ZROA 2CLDX 5EQFA 3PJEA 3TLJA 4AX4A 3KJFA 3DL0A 1XLVA 1W581 1Z6XA 3PDIA 2VA9A 1PSZA 4B40A 2FXVA 1LX6A 2GBPA 2P62A 3LHDA 3TIIA 1Y3AA 3ESQA 3KJGA 2YXPX 2BFPA 5AR1A 5LZ8A 2AHOA 3I2YX 2PZAA 3L0OA 3AM5A 4TUYF 3L0SA 2YWXA 5BW5A 3PD1A 2O6LA 1JWBB 1OYVA 4LDZA 1SEPA 4BJ5A 3UY4A 4F1WA 5BUQA 4E7OA 4M9ZA 3M1YA 4TS4A 3UJHA 4BTVA 1H9CA 2JZCA 3GGSA 5D5PA 2A2ZA 2CL7X 1NVWQ 5AHRA 1SKYB 3GWZA 3L7IA 4L9SA 2GN1A 5JD5A 2C7PA 3M49A 2OTCA 4H1VA 2WAXA 5FL3A 4KIFA 4DAEA 5HZKA 2FN7A 2ZBUA 4C2TA 4FOPA 1C5KA 3QVGA 1QHFA 1RCTE 1YHNA 3C0KA 3K15A 5BMVF 1JLMA 4XJSA 4A6XA 3SF0A 3SE0A 3AZPA 4K8OA 2R2AA 4WCDA 2UUCB 1YDMA 1Q7GA 1N2IA 4F4JA 3OZEA 1K2WA 5DDIP 4OQQA 2Q5HA 2XE8A 1UBLS 1NZDA 5JSYA 1REQA 5GGYA 4XXHA 3WL3A 2AZ4A 1GAWA 2Y2VA 3WAKA 3SOPA 1GO2A 2IYFA 3GYBA 3D6FA 4JT9A 4O0LA 4PNZA 1PGOA 2PD3A 3OQ1A 3K6SB 5B3AA 1NU8A 4UNIA 3DMTA 1EP2B 3GIDA 2A59A 2VOEA 3W0LB 1M0SA 4YFYA 3W4IA 2IZOA 2KE5A 3WWYA 3ZNQA 1YI8A 3GUZA 4LVUA 5B37A 2YIJA 3NTQA 1R27A 3RUHA 1FDVA 2W9XA 2FQWA 4OSPA 1GSOA 3ZJ5A 1D8AA 3QNMA 4CM6A 3E5HA 1CP3A 1CS0B 1P2GA 1ZOSA 1SZDA 3QLEA 2GJSA 1DO2A 4X6XA 5DCYA 2WIFA 2KLBA 3RSZA 1OAAA 3CGGA 3V4VB 4B3JA 3LWZA 3QFFA 5IEBA 1TLFA 1IFXA 5GIOE 4OIFA 2VDKB 2J6HA 4GMXA 3IUEA 4OU4A 3AC0A 2HGSA 4O4LF 1VKJA 4Z86A 4Z7JA 2QE7D 2XEDA 1T9KA 2A0KA 1B16A 4J91A 5IT9A 4UBOA 3F6SA 1ZIPA 2P65A 1T9DA 5EKUA 2JZOA 3GLHE 3OIFA 3IAUA 4IDPA 1SVLA 1WUTA 1GYPA 1A2KC 1H0HA 2BY4A 5AK0A 5DSXA 3VU8A 4Q48A 4ZK6A 1CTQA 1N1MA 1GGNA 3PRJA 4EY8A 1CVIA 1WR8A 4DNOA 2GJAA 1XJWA 1AX9A 2NT3A 2YJGA 3PHJA 4QFDA 2QBYB 2FQ1A 1AKRA 3F6PA 3O4VA 4I6GA 4ETNA 3OF3A 2HNAA 4IM7A 1ZSYA 1CVRA 1NPYA 4EGQA 3KYIB 1Q22A 1EFAA 3HFGA 3JZAA 3PXCX 4DPMA 4R01A 3HXPA 3PC4A 4GXNA 3RFFA 3SZLA 3QUBA 3H19A 1Q1QA 4GOKA 4Q9LA 1YOVA 2O6HA 1F0NA 3TG8A 2I67A 1KRHA 1VZ3A 3N8HA 3T4PA 5EHZA 2AUNA 1CRZA 2G77B 1UEJA 1UMCA 2OPHA 5TC4A 5TQ0A 3KQLA 4WKNA 1W93A 3J81k 1KO1A 1VIMA 1X86B 4HADA 2JAXA 1DCKA 1T29A 4NNJA 1TPZA 3JVVA 5FUYA 2CHVA 3DTVA 3DJFA 4JJ7A 2QRLA 5KWEA 4W82A 2GN6A 3DTTA 2NVUB 3ROQA 4DABA 1WZCA 4AJLA 4BHTA 4GKBA 3D81A 4LRXA 4V1CA 2HBYA 4XQ0A 3OZSA 5ICFA 4ITUA 1HGXA 5THQA 3OZBA 4B8ZA 4MA0A 4UEWA 3D2LA 2AK3A 3M6LA 1KPIA 1NX9A 5AVVA 1YB6A 2ZAYA 4PLPA 4RLSA 3RRJA 2C1ZA 3ANTA 4PLZA 2EBWA 2F3TA 3ESAA 4N40A 4KI0A 4O29A 2E4YA 3RKRA 4DFDA 4RD4A 1RW4A 1EDDA 1KJJA 2WE7A 2FRDA 3FPEA 4CKBA 2YIVX 1VC2A 4PYRA 4PINA 5E6UA 2VQSA 1BE6A 3EZLA 2JFZA 4P4SA 1FW6A 2GKOA 2DZDA 1T6ZA 3KJEA 3I9V6 1U0LA 1F9EA 1G5IA 3NONA 4H17A 3VU3A 4KYTA 4BNGA 3G5UA 2XSZA 3RB8A 1VJCA 4I4LA 4CLXA 5IP5A 5DMXA 2Q4TA 5KX5B 4K3VA 4XTCS 3Q9UA 1E2MA 4HWTA 3SCZA 5K20A 4C21A 1E1DA 3SQDA 3H83A 5GADl 1KRWA 4X41A 2WMYA 1DWOA 1JB1A 4QAQA 5CMLA 3K05A 4AO8A 1G8FA 2QVLA 4ZA2A 2QZ4A 2QLNA 3HCWA 4EIWA 1RQNA 4GMFA 4X24A 4BN0A 3UAYA 3K0BA 1MN6A 4F2DA 5IVIA 2J46A 3ESCA 4X8MA 3RRMA 3R1IA 3WLSA 1G66A 4JYPA 4PLYA 1IM8A 2A5YB 4RABA 1KJZA 3FYUC 1BVYF 1RXSA 2ZYSA 3I2IA 2DH6A 2YN0A 2IWRA 3HM9A 4KBYA 2Q0HA 3EZGA 3OOWA 5HJ2A 4D4IA 2EJUA 3D0OA 4MS3B 1CERA 4S1TA 4BX0A 4CBVA 4J49A 2MINB 2JKYA 2XLCA 3U56A 3S2UA 4AN0A 3X2SA 1TVKB 4JLKA 2XH8A 3F6CA 3L4BC 4RCYA 2JJQA 3I8SA 5TS2A 3D3JA 2VDMB 3REQA 3PX7A 1V41E 1SBQA 4BRWA 2J8ZA 2WF8A 1E2BA 1NXOA 4MW4A 5CW1A 1ODKA 3DS8A 4P7GA 3HPQA 4AZSA 2DTXA 5ICEA 1DG1G 2Y0CA 4RBNA 2VF2A 3A04A 3MM4A 4WZAB 3UMRA 4BCCA 3ZLJA 1BE1A 1T9AA 4EECA 5KYTA 3A6JA 1Z88A 4LF5B 1CQJA 1P5RA 2VBGA 2ZRGA 4MYHA 4BRSA 3LT1A 5EIHA 4H77A 4LRSB 4ZQIA 1O95C 1AK9A 4TM8A 5GY7A 3VR2A 4C7BA 3CINA 2JA1A 4JLNA 4CEJA 1W96A 1SC4A 5IJ9B 2B7BA 1PUJA 1TKRA 3SE7A 4A8JA 1Z62A 5EMHA 4LSZA 1VHTA 3CUWA 4BX9A 4C4AA 1VRWA 5DI9A 1UPXA 3A1UA 1R0YA 4V1CB 3WRXC 5J2TB 4FDVA 3NWOA 3WSTA 4TTAA 1BXZA 4KHZA 5CCDA 4DDHA 2C5LA 3B1KA 2IYNA 2NQ8A 4D26A 3FZNA 1S8NA 2HW8A 4HDRA 3IEIA 1E6UA 1KY2A 1OX4B 4IVNA 4XOIA 1GT6A 3ILXA 3DBIA 1NPDA 4WNYA 2X8LA 3B48A 4R2XA 1JXAA 3SEAA 1E6KA 4ZREA 5DLYA 4W5OA 4A0HA 4ABYA 1KI6B 4ZVNA 3EVEA 2FUCA 2NUBA 4NAUA 4ZFNA 4EGJA 5KTTA 3IDFA 4L4UA 4DDMA 9MHTA 2IF0A 5LJLA 5CVTA 2XW6A 1VSQA 1YRWA 1FFAA 3ASVA 3ZI0A 4ZIRA 2P0AA 4JYZA 1JSZA 3EMVA 1L5QA 1C9NA 1URPA 2Y8EA 2W98A 4CIYA 5BUCA 3U4DA 3F5SA 3H2JA 1W85A 2W6ID 3ZDYB 3ACCA 5AKGA 4CQLB 4PQFA 2B82A 2YXBA 3BCRA 2E7ZA 4X66B 3E05A 1C9JA 2F9MA 1EINA 2WMNB 3CSDA 2DKFA 5GWXA 4MW1A 3TLGA 3ZIAD 3BMNA 3RQSA 2CB9A 3DKPA 2R25B 1D4ZA 3G0IA 4ZMBA 1LDYA 4M54A 5EP3A 5AH0A 3EMKA 1Z25A 5ALRA 3RRYA 1GAXA 4PCAA 3I1JA 3R3VA 2XVZA 1O94D 2PRZA 3IKLA 2QQGA 4JOBA 3PFFA 4MNTA 3RAJA 1OXKB 1X9HA 2M2IA 1IBCA 2R00C 3RVSA 3VM6A 5IUKC 4C5BA 1GL3A 3PNBA 4EO7A 1HUQA 2ZUTA 4E5DA 4NFSA 4CMCA 1YVRA 1WBDA 2RDMA 1BXKA 1KZ6A 3KBBA 3HVIA 4KAFA 1N7GA 4RJLA 1H8EA 3O1HB 4UHEA 1F60A 2WNSA 4EGFA 3ROXA 4QX6A 2GPNA 5LP6A 1BROA 2I66A 1P45A 1ORRA 4ON9A 1CULC 3GJQA 4GX0A 4OLHA 2JATA 4U5QA 5L3ZA 4ZHQB 1U2RA 1T9CA 1IWBB 1DJPA 1XUOA 2REBA 3BJEA 1HLDA 3B6EA 3FOWA 3JQEA 4RV4A 3CG0A 4RPJA 5HZHA 2GEVA 2GTPA 4CNBA 4HC4A 1EB8A 1O57A 2R65A 2W4QA 4F46A 4PS0A 4JKOA 3EJWA 1X3SA 4OKNA 4OSEA 3MJEA 5HUQA 2PLFA 3OCYA 4JMLA 2QGZA 2V5UA 3LYHA 3E3AA 5B36A 1DPGA 2W43A 1GCAA 4K46A 4RTRA 4NDAA 1E99A 3FNQA 4XSHA 1ZH4A 3TLKA 3RYIA 4J0DA 4BE7B 2GA8A 4CLRB 1AKYA 4FYPA 2NUPB 3HXKA 1ULBA 2FFAA 3QEMB 2PBFA 4XGQA 3DV0B 3SXUA 1B0AA 3LBIA 4D6XA 4UHFA 3IQXA 3B2QA 1TM3E 1VHWA 2G1JA 1EFPB 1FUKA 4DR1B 2R8PA 1D2MA 4JLVA 4X91A 4A7PA 1OH6A 1MO6A 5HKBA 5J2UA 4JI0B 3BQNB 1XMIA 2UUOA 3IBGA 3BM5A 3RV4A 1ZKDA 3HWRA 1CD5A 2JGMA 4A8JC 5IBPA 2X7HA 2YWEA 5EJ2A 5EZSA 3RVBA 4CM4B 4OQXA 1ULAA 4PLGA 3OO1A 3PKJA 3W9YA 2OGUA 1W4LA 2YQ5A 4KLCA 4BP9A 3DBRA 3IIEA 3I2FA 2NSJA 4MP6A 2IOFK 2OHIA 4F60A 5HZMA 2IP1A 1TUEA 4ZHSA 4YCJA 4MROA 1P17A 1BFKA 3LP8A 1I4EB 5EN4A 1WV0A 3MS7A 4NI5A 5IVKA 3OIDA 4ZO7A 3FBWA 4DJJA 3W8RA 5GPBA 5A62A 3Q8KA 1EFLA 1P7YA 1NPTO 3BGSA 3L4BA 1FPQA 1VB5A 4MWDA 2JANA 1GTJ1 2VUHB 4P4TA 4PX3A 1JQLB 1LI5A 4IDAA 3VU1A 2YWJA 4BEVA 1YULA 2G08A 3L1JA 4S05A 1T6BY 5ES3A 1HX7A 4W8GA 3KKOA 2BMJA 2ZKLA 5G41A 2BH2A 1K63A 1SG6A 1O77A 2ZRQA 5F9MA 1RM5A 1CY0A 3RREA 3R3SA 4JXXA 2VSQA 1OWMA 1IEQA 1NBME 3NVKI 5BQOA 5T4FA 1KI1A 2G36A 1XCPA 1N0IA 4PZAA 2GS9A 1WL8A 4OH1A 3LCVB 2XMRA 2V65A 3A3YA 1ZMRA 3GLTA 3D8HA 3L1VA 5HWSA 3THRA 4QFMA 4YS6A 4QQFA 1NP7A 1KJ9A 3KT8A 1HDYA 1PR3A 4UU0A 2VHZA 1C3JA 4UQPA 2PGAA 1SQGA 4CEIB 1ZVKA 2LCFA 2G71A 4JLSA 4LFCB 1U3GA 3QVWA 5B1EA 4QIHA 3AIKA 2GNPA 3NW9A 3UQYS 1DIAA 2J5XA 4Q66C 1XZ8A 2QF7A 5JCPA 5CA1A 1CU1A 1XMVA 1PL8A 3A11A 3MAGA 4L2IB 4Y9UA 1F2VA 1GVHA 9ABPA 4QULA 1A96A 1RC0A 1KGSA 3UMMA 4NZMA 1DFHA 2Y1DA 2C0CA 2O2DA 1A9YA 2ZM5A 1KI6A 3O2QB 4US2R 5IM4A 1EWQA 4A6EA 2YVUA 1FQKA 2QX4A 1N6OA 1CF9A 1Y1PA 3OCJA 1NRJB 4KG7A 5EJ8A 3K70B 1BDBA 1FMTA 3VZCA 1R8XA 1VE5A 3OLYA 3B5IA 4GX5A 4IUYA 5IYZB 3L4JA 4R2WA 3SSOA 3DMFA 4JQCA 1QCDA 2QW0X 4QQNA 1V16B 3L46A 4TS1A 3L7CA 4OOFA 1NYQA 1E9DA 3QU7A 3SIPA 4YJ2A 2A0WA 3A6DA 1KHTA 3NHWA 4DN6A 3OTGA 1SHLA 3E22A 4URVR 4XRRA 2X5XA 1LRLA 4K9LA 3IP7A 2WKPA 1N6HA 2YN4A 4EA9A 3GV0A 3HACA 4G89A 5FA6A 3OE4A 5PNTA 4D42A 3ETLA 5FI1B 1ABEA 3QHPA 2FUG6 2VWQA 2PKXA 3L84A 4S0XA 1U0TA 1G17A 3ZHSA 4C0HA 2NSLA 3UHJA 5K0ZA 4C1NA 4I55F 3L9WA 2GCNA 4L1KA 1W1WA 3KUUA 1OC4A 1RYDA 3ZEAA 1GLVA 2XUPA 4MB2A 3ZWKA 4DL9A 2ICAA 1LPBB 5KOJA 2FLWA 1I2MA 1PWHA 3FTEA 1E6LA 3W5BA 2IV3A 2XE4A 1J70A 1S7CA 1WCYA 1L1RA 1DU4A 4KXYA 4BVEA 5FEUA 2E1PA 5GTDA 1M8PA 4NZOA 3BGWA 1QG6A 3GFRA 3VH3A 1FQWA 3OCXA 3PEWA 1OI4A 1IN6A 1AZWA 1KAHA 3OCZA 4N6NA 1OWPA 3D7KA 3OCUA 4MV8A 3E7FA 2BOVA 3FUWA 4CTMA 1J2JA 3RS2A 5CVEA 4A73A 5BN5B 1C4WA 3IEUA 3PDIB 4UTRA 2OV4A 1GPDG 5HZGA 5JROA 3O8LA 3PJDA 3DVQX 2Z3WA 4GP6A 4LY0A 4N54A 2GSWA 3T06B 2RD2A 2ZP1A 4MV3A 1XAHA 4JBXA 3MW8A 3MJDA 1PWYE 2D1TA 5FD8A 3NBKA 4MUMA 3O8OA 2GXQA 4OI0A 1XQ6A 1NMYA 1RM0A 2BFFB 1V9LA 3HABA 4MCHA 3AUUA 4P8RA 4QDTA 5DBOA 2I6XA 3CVXA 1J2EA 3I30X 3BH7A 3DPUA 2F8TA 3B9QA 1PR2A 2X86A 3MQFA 5AI8A 4OHPA 1MO5A 1NM5A 4EG7A 4Q7QA 1H2XA 3ZU4A 3CVUA 2R1VB 3TM5A 3LQKA 3T15A 5ELMA 5JNLA 5BR4A 2BYTA 4J1QA 3D7MA 4DSAA 2VKTA 2RB4A 4I19A 4G0VA 2DWUA 3BFKA 4GW3A 2UZ3A 3CZCA 5E7QA 2XBLA 3CZMA 3N6VA 4N7MA 3USCS 1F2TB 3IYLW 1MX9A 3MCWA 3MWLA 3NBAA 4B17A 4EW1A 1EU1A 1DDIA 2CMGA 3ILSA 4ENSA 2AEMA 4P33A 3GN1A 3FE2A 2FDRA 4LSWA 4KO4S 4QJIA 5HYVA 1IUOA 1TYAE 3MAJA 3B2NA 4M2LA 3ELYA 3F7NA 1FW8A 4F3NA 2CGEA 3IUYA 3EF3A 3RLFA 4BMXA 1JECA 4NWIA 2ZRKA 3IOYA 2DT8A 2I2BA 2OQVA 1E9BA 4YAKA 1Y82A 4C7OB 1DS6A 1C14A 2G28A 1CUYA 1RQGA 2ADFA 2AJTA 3ELBA 3PXGA 3VO1A 1A5ZA 3NATA 1DJOA 2NQTA 1B0UA 1R88A 2Q3EA 4Z8XA 2ZSHA 2H5LA 1N8NA 1I6WA 1Z7BA 1AZSC 1P2BA 1N8KA 1XN4A 2AQ8A 1QDLB 2KWIA 4F4IA 4F06A 3W2GA 1RJFA 3HA2A 3GT3A 3WGVA 3VNBA 4DGQA 2J3KA 3CKYA 4PSCA 1TF2A 4IPTA 3GO4A 4W6ZA 2IODA 5DNAA 4L3VA 4C4RA 4HYYA 4LQ4A 5SZHB 3TF5A 4DLUA 3PJFA 2GZSA 5HIJA 1SXJD 5B7QA 4UBKA 1EDEA 1XZPA 4E2FA 4ZEVA 4EK9A 2IPXA 1GU0A 5A5FA 1PG0A 5IBRA 1OX4A 4EEXA 1JIXA 3BTSA 5CD9A 1VSVA 3R6TA 1LVGA 4FEGA 2LDBA 5LD2C 4JJKA 3W6UA 4D7AA 2VEDA 1H8ED 1RXYA 4H08A 1OB2A 1GU1A 1JZSA 5H9VA 2X1HA 2I65A 2BCJQ 4D0NA 2V74B 1SUPA 1KY5A 3T4UA 1YZKA 1UUFA 1M54A 1E4EA 5FJJA 2GARA 3HLYA 3LRXA 4FHZA 2VA8A 1UDWA 2CBXA 1LF0A 1NUSA 1YRHA 2QPLA 4OJTA 3WA7A 2EG5A 3IBSA 2JD0A 2VH2A 4LDPA 3E81A 1M73E 4M88A 3TQSA 4CMGA 3OETA 4GMDA 4I6EA 2DWPA 5EHXA 3PPIA 3KKNA 4W7SA 2H29A 5DXJA 1TQHA 2HZBA 2JIQA 2PSHA 3TTSA 1WQ1R 3V8PA 4EL0A 2ZJ1A 1R6XA 3LU1A 1IBSA 2FE1A 5BOSB 1VHLA 1O0SA 3GZ4A 1RQLA 5EE9A 4Q3LA 3WV5A 1JXOA 1QO7A 2ZUVA 3RC9A 4DIUA 2BAGA 1J7JA 1Q0SA 3HCRA 4DOMA 2XCUA 3TH5A 3C6XA 5CPFA 1N2CA 4R84A 4BBJA 3IGFA 1CWUA 1U6JA 2HA4A 3MTBA 4HGRA 4FGUA 4AP6A 3A1TA 5JW6A 1V37A 2WUVA 3DE6X 2ZCVA 2AN1A 1U1DA 1X1AA 2XECA 2XDQB 3EVBA 3AR6A 3A4MA 3IP1A 2IYLD 1NV8A 4G1VA 3UMCA 5JXGA 5A7FA 3ZDQA 3DW1X 3REGA 5KNDD 1IBRA 4HNTA 5CXSA 3MUEA 1W8IA 4LZAA 3BMOB 1Y6RA 1RHRA 3UYLA 1RWBA 1XD9A 2NYVA 3KQQA 2IU4A 2BPOA 3KX2A 4NMMA 1CJBA 1EI9A 1OA0A 4R7GA 1JH9A 3IPYA 4E1BA 5JO9A 1KF0A 3G89A 1NDHA 4N01A 4I1RA 4NATA 4FD2A 3KXIA 1R8YA 2MOKA 2OV1A 4MUGA 4XDGA 5EIFA 3DQQA 1KZ7B 1UOPA 5IASA 3MUOA 5K6TA 3I5UA 2BI4A 1FS5A 2OHGA 2Q5JA 3D5QA 3ULKA 2EL9A 2G8LA 3BDIA 2DR3A 1HORA 1WE2A 1VKHA 4Q4HA 3JQ8B 5KHAA 3CONA 1C3VA 1ZJ6A 2JL1A 3CR8A 4DMUB 4Z49A 1B74A 1ZRMA 2C03A 3HP7A 4PZ9A 4OFXA 4Y2RA 5DHSA 4MK4A 1JQBA 1DT5A 1XTSA 2I6UA 1S2DA 3BZUA 4OQEA 2HSDA 6AT1A 3WXMA 3I4LA 4IXWA 4PN7A 4LJ5A 4AQ7A 3W90A 1E92A 3NPAA 3AKDA 4CPDA 3GLKA 4TMYA 4Y0VA 2AGVA 2OC4A 1OFHA 3FUVA 2WAYA 2H17A 1P8JA 5JPDA 3K9BA 1ECLA 3P9PA 5CDUA 4Q82A 4YEDA 4MEAA 4PV7A 4O3FA 4OPMA 4FCVA 3O21A 4A1OA 3BB1A 3DOUA 3C8DA 2YXLA 3PU6A 1XNGA 2H1OA 1E0AA 1W4AA 2I4LA 1TVCA 1RZRD 1VOTA 3WKEA 1LNQA 1KE1A 2PKYX 1YCDA 2P2LA 4QASA 3ANYB 4G8CA 2ZR8A 5A4MS 4RXTA 2IPAB 2GEKA 5CNJA 2KMLA 1D0SA 5FBKA 2PFSA 3KAQA 1WX1A 2NZYA 4TTSA 4EO9A 5A3JA 3Q1KA 2COUA 3PRYA 3QJGA 1F17A 4X64B 1NA5A 1UJNA 3BHNA 2BLLA 4X65B 5GM1A 1KL7A 1D0VA 1YRAA 1JSCA 1UMBA 2Z1NA 3NIFB 4GPIB 3AJRA 4KUGA 4DCJA 5JASA 2WV9A 1H66A 1GTMA 4TL6A 2P35A 3KTOA 3NU1A 2WF7A 3W04A 4C7OA 5F78A 4BWFB 2PZBA 3U3MA 2ZYRA 1SC3A 4D44A 1HOXA 3P2EA 4GVPA 4KQIA 3ZWPA 1G20A 1X7YA 4BVBA 4YLYA 5LFAA 1CS0A 2WU4A 1OH5A 4UEQA 4N8EA 4L02A 2NO1A 3OZXA 1ENYA 2YHAA 2A84A 4CE6A 2UUBB 3FVVA 4G8JA 4DC0A 4NCIA 3I1YA 3VC7A 3E9NA 4D6PA 4MRAA 3VSCA 1CR0A 2QUZA 3B6ZA 4P92A 2W2KA 4LYGA 1K4YA 4F9FA 5CYGA 3KD2A 3N8DA 3H05A 3Q88A 5FPKA 3Q8XB 1OT5A 3NHFA 5B3LA 2RJOA 1PR1A 4YMSA 1Z6QA 2DYKA 2PUVA 2R6R1 2XOXA 2WYHA 3OUUA 3PNSA 5F73A 1NC3A 3WK6A 2CV0A 3CLHA 5DF1A 3T5CA 1JE1A 5KYXA 1HZJA 2W2LD 4B0PA 2Z2JA 2ONYA 3TLXA 4I1VA 4P5EA 2AR9A 1RI2A 2QP4A 1JIQA 4L07A 4NMWA 4M1KA 4REQA 1NJ2A 2FW0A 2Q3FA 2ZWMA 3CX4A 3KT6A 4DR3B 5BWLA 1PYGA 2XD9A 2O4UX 2QV0A 3GLHA 4N39A 5CJJA 2EWWA 2C54A 2F64A 4IIVA 2ASVA 4MIYA 3WK8A 4JI3B 2O4CA 1N5MA 3GGPA 4IXMA 1TCBA 4E2XA 1EB9A 1OSNA 1XA4A 3OIUA 1F1JA 1PW5A 1BXRB 1RZUA 3QUSA 4KMMA 4M83A 2C96A 4IVRA 3JXEA 4TXNA 2D2XA 2OFPA 4Y3UA 1NQ5A 3S40A 3N53A 3RYHA 3UFXA 1JAZA 2MMCA 2VH1A 3PUHA 3N8NA 5LQAA 2GK6A 1JU9A 1O89A 5KTPA 2GH1A 1QK4A 3TOZA 1ZOOA 2YW2A 5H1YA 3CU5A 4MVJA 3T7KA 3TNFA 4H4DA 1E3LA 2C4KA 3BXPA 2OYSA 4H3SA 2JHCA 1G21E 3LHSA 5G4KB 1BMFD 4BQPA 1RLJA 2FCRA 4H7JA 3VH1A 1DINA 1ESNA 1EX9A 1XCGB 3RVJA 1X39A 3TE6A 3HR8A 4XYLA 1NW7A 4B7XA 4EHHA 2ZIXA 3WWOA 1KXZA 2WWXA 2HTFA 4L4XA 5AT1A 1EHCA 3M6XA 3AL3A 2Q41A 3TIFA 5JJLA 1DB3A 4N7RA 2WMDA 1E58A 3OHMA 2GX6A 1Z5WA 2OCKA 2AMJA 2V6JA 5J5AA 3VDXA 5L3VA 1OYWA 4L3OA 2VJNA 3X0DA 5C46F 3U61B 1F6BA 2CFOA 4U6SA 3SZOA 1FFEA 4D9EA 3MWDB 4R0MA 3R3XA 4QL3A 3EVZA 1RLTA 2XWQA 1B7GO 3T1QA 4KREA 2JFPA 1A5BB 1RP7A 3AVPA 3GA5A 3LXUX 4CV3A 1FYXA 3N5KA 1F8XA 3RC1A 2RHRA 3B3GA 4O5AA 4ALNA 5DM4A 2ZJYA 3H11A 4Q39A 5AVRA 3R7LA 4L95C 2G6TA 1T9HA 4XWAA 1EESA 2WSYB 2QUBA 2P68A 2DBRA 3GLRA 3GZTB 1ZOIA 3PLRA 3FI9A 3ENKA 1MO4A 4NBUA 5B6PA 5EHIA 4LZNA 1C3OA 3DUFA 3LY7A 5AKZA 5A7HA 2FPPB 1ZONA 2M6KA 2FZ5A 2CB0A 4K05A 2IU6A 4JSTA 5KYWB 2VHJA 4R2JA 4LE0A 2OLEA 3T4EA 4FBLA 3AW9A 4LWOA 1RADA 4HRAA 4JB3A 1WDWB 2WMOB 3Q7PA 1DKRA 5J2TF 4LPKA 4R5MA 3EIOA 4Q3CA 3FH0A 4GOXA 4LQDA 5AW1A 5LP6B 1IY9A 1L5ZA 3JQCA 5REQB 1FLDA 4ZI7F 5MFPA 3KQTA 3AR7A 3JVIA 2I1VB 4DQUA 3T1VA 1KWKA 2AUMA 2B0JA 1I80A 1RWVA 3GFFA 1WP9A 1TJNA 4A5OA 3KJQA 2EGGA 3KP1A 5HOEA 1Z0SA 2Y1EA 4A2CA 3K1TA 3I5YA 3LUFA 1RWNA 2CNOA 1QVVA 2PR7A 2WG1A 3AEUA 3TW4A 4EUHA 1KR5A 3L7LA 4F2PA 5BYJA 3V8RA 4HQNA 1MT3A 3DFMA 4RNCA 4IZOA 4PU0A 3OQPA 4Y2XA 3JQBA 2DBVO 4WPGA 4N5HX 1N2EA 1A76A 3CFYA 3O8DA 1GA6A 3SM9A 1NW8A 2H5IA 4KX5A 4TT3A 1H2EA 4L08A 2YOFA 1PVVA 3P9CA 1DEXA 4R8VA 3KQYA 3VOAA 5BW4A 1G9SA 2ZPTX 2OCLA 3WZMA 4S1WA 1PWXA 1NJ8A 2RH8A 3H86A 4QDUA 5JWRA 2PEYA 1ADCA 4GL4A 5ITWA 3IJ5A 2WAAA 2XVYA 4Z99A 4AZWA 4YJFB 1P61B 1ML3A 1NN1A 3K3PA 3SM3A 4ER7A 1V9CA 4LX0A 2C8JA 3MTGA 1P0QA 2C2MA 3DG9A 1W49A 1SEVA 1I33A 1PV1A 3E9RA 2ZBPA 3HB7A 3F46A 3ZLTA 1TJPB 1U7XA 3QY9A 4G41A 1OV6A 1YRYE 3ZQUA 4EG1A 2BE7A 3PDHA 3V00A 1K6IA 1AXEA 3ISTA 3AW8A 4M89A 5FBQB 1Z0DA 3U3ZA 3ZZNA 2X0JA 4JT8A 5CB4B 4Q1FA 1UBEA 1WUKS 4L74A 5LZ7A 2XB4A 3C6QA 5FX2A 2VHQA 4OUDA 4R2LA 4H3KB 3T9FA 4BKRA 1QF6A 3CHYA 1NY5A 3HY4A 4NARA 2Q2OA 4C6HA 4Z4HA 3BGVA 4F1KA 4WNAA 2HJHA 2POCA 4B73A 1M2KA 4W1SA 3MWEB 3T5PA 2PSEA 4Q3AA 4GZ6A 4MO2A 5F2NA 5D3ZA 3C24A 9GPBA 4EB3A 1RSZA 4GUDA 3PQ4A 2I2DA 3VYUB 1ANKA 2EFDB 2RSLA 3F98A 3C41J 1G55A 2R9VA 4K6MA 3GGOA 4A0QA 3KELA 4KO2S 1IZYA 5EWLB 1YOBA 3L0YA 4A0SA 4WASA 2R751 4MWSA 1L1QA 2QN8A 3Q6NA 3STYA 2I6FA 2VAPA 3NTRA 4KV7A 1L8AA 4D99A 3PP8A 4YBRA 4LE2A 3VR5A 4A26A 4TYYA 1K6JA 1Q2UA 4WNCA 1C9KA 1PQ4A 5ICCA 1DNPA 2EP7A 2HEIA 1YK1A 1QGAA 1PJ4A 1VPEA 2ZWVA 3JPYA 3LQQA 1QWSA 1LXCA 4B7AA 4RTSA 4MVCA 4Z7OB 3DDWA 3R5KA 4EFMA 2NUTB 4CIVA 4YV2A 3P96A 3AVTA 4YRIA 1HH4A 1MF7A 2GAAA 1SUFA 4IW3B 1NVMB 2Q5FA 1UBUS 3V6MA 2H4ZA 4H4CA 1LI4A 3LVRE 5K1ZA 3RFCA 3WFIA 3ZR4B 1QHSA 4GGOA 3RSLA 3SZMA 1SUSA 1RWQA 2GRJA 5JH7A 5FBZA 3VO9A 1QP4A 1T5HX 3ORFA 5THXA 3MJVA 1NMXA 1NWHA 3GR6A 2ZYAA 2EV9A 2FP4A 5DYGA 4AN1A 4L0DA 5GQSA 5JE8A 1T36A 1KBOA 5KNCD 4XX0B 1JLSA 3OWHA 4DR2B 5JXHA 2NZUG 1QF7A 3GARA 4HTFA 1E4EB 1Y34E 421PA 2QAGB 1D1QA 3O90A 2B1JA 2ZRLA 3P2IA 4AUKA 5IVPA 3QF4A 3ABOB 3TECE 1NI4A 4EVQA 1X15A 1CQIA 2QA5A 4FMBB 1XNJA 1PZFA 4LJ8A 1NYLA 4WK6A 3H42B 4PZUA 5E6RA 1QC5A 1RQ7A 3Q3GE 3R0QA 1JQAA 5EE3A 1E1KA 1UP7A 1L5YA 4ZVMA 5H02A 5JALA 3EYWA 1LY1A 5JS2A 1J90A 1OBHA 5C8XA 2BEUB 3C3DA 3PFNA 2I87A 2VTVA 2WSIA 3OKFA 3NR2A 3R5JA 4O4JF 3WWEA 1F8FA 4KRGA 1ZH6A 4Q16A 1IULA 1COWD 5KC9A 4N5DA 5L7YA 3H4MA 1NN5A 1FS4A 2CKDA 2DB3A 1W87A 1YACA 3E61A 1B8PA 4BZQA 1UKBA 1KFKB 5BXQC 1D1TA 4KR2A 1OU0A 1N5JA 1E9EA 4F45A 3U7RA 1CJUC 1ZUIA 4WXMA 1Z12A 4OP1A 1IHXA 3PPYA 2A14A 3DEZA 2B1RA 3I3SR 1SRQA 3EH1A 4OQNA 1XRQA 5H59A 2ZJ2A 2MCFA 4BNJA 1TCCA 4FFLA 4BB6A 2SICE 3QW4B 2IUFA 3P5SA 4B7UA 3DEJA 1WUHS 2O20A 5F4BA 2P2NA 3SX2A 1ODCA 5DLPA 2QAJA 3FHCB 4FYMA 1XCBA 2QX7A 3EW9A 3NJ8A 2HU8A 4NQRA 2XA9A 1DRUA 5DASA 3T3MB 4ZQCB 2JHFA 2P3SA 4N1AA 2ON6A 4AUNA 1K86A 3CYFA 1EX7A 3UK7A 2Z3ZA 1G20E 2Z6VA 1EFDN 3ODPA 3VTAA 1K6EA 2VP2A 3CZAA 4P83A 2QP9X 4F8YA 3WDKA 2HYDA 4XD7A 4RU1A 5L3QA 4UE3S 1DMSA 1P3JA 1QS0A 1XTPA 2MR6A 3TFWA 1LJLA 1RTKA 2H1FA 3P4YA 4RFSB 3FF1A 3T5BA 1U3WA 4D0SA 3QENA 5FUMA 2Y27A 3ETDA 3H87A 2B3DA 3P0JA 3ZC3A 1F6DA 1N5OX 4M38A 2O7NA 3I42A 3PGXA 4H9GA 4JLPA 4QJ4A 1EQAA 2PR2A 4I55B 4KE6A 4IICA 3IOCA 5HIMA 3IDQA 5EUQB 1N7HA 1E5LA 3H5IA 1GITA 3GD7A 2FPGA 1ZEJA 3ZWWA 1S2OA 3UK2A 3WMWA 1MJGA 1PVOA 2D2EA 1R2QA 4BLQA 5I7SA 2G76A 3IUSA 1HT3A 4YDRA 4EEKA 4UQLA 1X7DA 2OB2A 5MDHA 3IX7A 3CZ9A 1COWA 2B9VA 3PPXA 5HILA 3AHJA 2C4WA 1G5FA 1NXXA 4TVKA 4XCVA 4ICIA 4ZVSA 4ND3A 4RHCA 1TTHA 3KVOA 3V1TC 1ZESA 3TGLA 3BL8A 3FRHA 1Z18A 2ZIZA 3WR5A 4BMZA 5B2EA 4W7IA 2IHVA 3Q0TA 5DI3A 4DDKA 4YV1A 4HOYA 3QYFA 3OPMA 3TMAA 3WIDA 1PFVA 5GGXA 5BMOA 5KYWA 1NMSA 3WDSA 4ARCA 1W5AA 2GHIA 1NULA 1QH8A 5HKAA 5BN1A 3B1JA 1N1EA 1Y9JA 1VI2A 4FFPA 4HDKA 4TXLA 5C5EA 2FMHA 2ATVA 3UOWA 3V34A 4XAQA 4PQYA 3I6BA 4FX5A 4IVPA 3S2YA 4YI5A 1SD1A 4C0LA 4Z6KA 3U3XA 1HKUA 3HXOA 4GPZA 4R8MA 5GVSA 1M2NA 1B1AA 1GUBA 3W1WA 1N2JA 3MCAA 2YJNA 2G3YA 3SY8A 1SQFA 1TU3A 3N76A 3FOEC 2PUGA 1ISJA 2QNRA 2OEPA 4KPUA 1Q0ZA 2DECA 2G4VA 5I47A 1N5LA 1NXPA 1K0UA 1LC0A 3QYJA 2R4UA 1X7ZA 1DI0A 4MQ6A 3DYBA 4NJMB 5D51S 3ZV4A 1TKAA 2WZQA 5E1DA 3RO7A 2QOEA 4G84A 3WGYA 1DKMA 4X7MA 3EE6A 2XIQA 1PRYA 3PF9A 4G0PA 2MSDB 4M0EA 3IXMA 1RLIA 3DZBA 1J7KA 1JFSA 2GN4A 3OQHA 1CNFA 1CZRA 4F6RB 2P9YA 3MWJA 1VCMA 2DHEA 2EWVA 3A3OA 3BH0A 1NNEA 1QYVA 1BQ3A 1RLMA 3RS8A 2CFTA 2XUZA 1BN6A 5FWYB 4RA6B 3HXTA 5JANA 4OXQA 3CUKA 3R0ZA 2FR8A 1T4BA 2GHTA 1U7DA 4D4LA 3LCRA 2ZI6A 2NU6A 3INNA 4F7DA 4RYDA 3EAFA 2AD5A 3V7UA 1VJTA 3LAWA 4DV1B 3EVTA 3FLBA 4IRUB 4M0KA 1W48A 2ZULA 3I9FA 2QZ9A 4HGZA 5AW7A 1SXJB 1CYDA 1COZA 4W7HA 4WZAE 4MQFB 1JILA 1Z0JA 3Q87B 4KHPB 5E4FA 5E8RA 5HF5A 3IO5A 2F7SA 2RG7A 2I03A 3LPAA 3TZEA 2FB9A 4D9BA 4FFSA 5BSUA 4LRQA 3R7FA 3VO2A 5HX7A 2OCAA 2F1RA 5BSRA 4DDTA 1X7XA 3LWDA 2GHRA 3ETEA 5AK5A 1DC6A 3Q3EA 3UJ9A 1TKCA 2FQYA 2VXBA 3KHKA 5JC8A 1GSAA 3QIVA 1E3JA 3EZ2A 4WUVA 3DLTA 5MF6A 3CH5A 4NZ9A 4X6LA 2GCIA 1FDIA 2WPNA 3KOUA 3UPDA 1AF4A 3O4GA 4WXHA 3PUJA 5EIWA 1K4KA 1EXVA 1C1XB 1GTVA 4EYEA 4B4OA 2JHGA 1FFYA 1DWUA 3VDMA 2HLNA 1XZLA 3DCNA 1YB7A 1H0SA 2O59A 2OGSA 4KPEC 4HFRA 3UHOA 3DOCA 3O47A 2QN2A 3ACBA 1KAQA 2FEMA 3DTYA 4N3CA 2FOLA 4XARA 3BT7A 1INLA 3TZKA 1LU9A 2VPTA 3BFVA 4RELA 5D5HA 4ENQA 4QFCA 1RKUA 5DULA 1RWKA 4FP9A 2QEQA 4PO8A 4Q5IA 4MR8A 4E1AA 5CCXA 3A4YA 3KLMX 4ERXA 4FW8A 3T3DA 5C8VA 1D4OA 1Z8DA 1C50A 2NVBA 1E9AA 3AF0A 1AT1A 2IIBA 2QRMA 4EG6A 2VJMA 1JHUA 4ZZ2A 1QTIA 4GI5A 2W71A 2EW8A 4K9NA 2ZZKA 1DRVA 1CLUA 5AKIA 5HFNA 1JIKA 1GNTA 2O23A 4CFSA 4QPJC 4ALLA 4R41A 1H5QA 4L9AA 4LV5B 2NUPA 4KCGA 1L1FA 1CUEA 2DLDA 1QMGA 2KBEA 4ZDJA 4C3UA 3CCFA 1NF2A 4YVFA 5U4XA 4DQDA 1TF7A 1QC5B 1MB2A 4F4DA 2OFWA 1VRCA 3PC7A 3HCOA 3IAHA 1I14A 2ZEJA 2LV8A 1TM7E 3BA1A 3N58A 2D54A 2PXAA 1GRNA 4L8YA 2G17A 2ZJFA 3PEVA 2CMDA 2OZLA 1KOFA 4HB4A 1I30A 5ECYA 1R6UA 5T5QA 3UFBA 3NP9A 3A05A 4XKJA 4RLFA 3UV3A 4CM1A 5AJWA 1NSYA 5BVGA 1PGJA 1R0KA 1EWTA 3AOEC 3NHZA 3X43A 2CXPA 5A9SB 5L4NA 3ZDAA 4WXRA 2QTCA 4NNOA 2E5WA 2AMFA 1B6SA 2C42A 4JJGA 2BKEA 2G5GX 3ZW8A 5LXTA 1N5RA 3X1YA 3QQ5A 3IESA 4X1IB 4CQNA 4AT1A 2DQKA 4DEXA 2XEXA 1A9QA 2BFFA 3F5QA 4GLFA 2FH5B 4MARA 1UM9A 2D2IA 2JIOA 1F8YA 1X1DA 1M7BA 2V7XA 4JU8A 3IP3A 1NMZA 1DEAA 2H1WA 4J3JA 2JC3A 4KVGA 1KR2A 4M21A 3T12A 7YASA 4HDMB 5JQGF 2WSBA 1SCAA 1Q7CA 1K88A 2OKCA 2Y66A 3O3MB 4HYQA 3IEPA 4XIGS 2Q7DA 5CR9A 4ZCIA 3ROGA 1W8DA 2IOFA 5C18A 4LYDA 1UKVY 3PS9A 3JALB 4H16A 1N6NA 2VAVA 4CMIB 1RE1A 3UPUA 2GAOA 4G1MB 3TRFA 1RCUA 2IT1A 1YIOA 2ZJ5A 3C7AA 4HH3C 5EIAA 4XWKA 2R8YA 4JCOA 1E7YA 1Q84A 4ZU6X 4ACBA 3OFND 4GS5A 2VDRB 2A1UA 2J48A 1PX2A 4Q18A 2Q3HA 3G02A 4D8XA 3SIWA 1OXMA 2A9JA 3TLAA 1L7DA 1USIA 4I08A 3I34X 1JKJB 1Q12A 3ENZA 3R9KA 3SYMA 4DG8A 4AL4A 3E82A 4MQUA 4JVSB 3JYNA 3NV9A 4XM0A 4C29A 5AW2A 2ZU0C 2HCRA 2NYUA 4IJ6A 1XZJA 2O8BA 1DLIA 1E2KA 1L5RA 4U4AA 4Y1EA 1UC5B 3OLQA 2XI4A 4OLAA 1X8KA 1RAGA 2YZ2A 4X84A 4NJEA 4M9RA 4N5LA 4RZXA 1CIVA 1DFIA 5E3IA 3ECSA 5IAEA 4V1CI 2YNMD 2JG3A 5AJZA 3N0TA 2R47A 3KZMA 4P3OA 1YB1A 4G0YA 1NHWA 3OJLA 3HZHA 1EVKA 3E5MA 3HA7A 2IYSA 2QZZA 2WT9A 4YRMA 1JT9A 1P1CA 1ZWKA 2NO0A 1FMFA 3QPAA 1LV7A 1G8AA 4GLOA 3DB2A 2CSXA 3WK5A 4LBYA 3ANSA 1EDBA 1L4YA 2ZR9A 3DE5X 1RKXA 3HJUA 2X0DA 4TRMA 1MEEA 3AGQA 4KNWA 6ADHA 5ILOA 1IQUA 2GZAA 2YWGA 3CF4A 3TOCA 5I8ZA 3HKBA 5DGTA 2C7GA 1QGZA 1DBQA 5DNVA 3MTDA 2VUSA 3ZXUB 2R1ZA 4FMPA 2A3RA 2V3CC 3KFLA 4QWMA 4WFIA 4DKJA 2K2QB 4FJ2A 5G1NA 3EXHA 2OCDA 3ZDFA 2RGWA 1QGUA 2Z9CA 3DUWA 4YCBA 4EKYA 1EAYA 5LB2A 4O4HA 4G97A 3ZWNA 2XD4A 1C30A 3EMBA 3W77A 1ZGBA 3KEGA 2EHDA 1SVOA 5GZ6A 3HO8A 2J0UA 3O93A 2I7CA 2VNKA 4MPRA 1KDOA 5CJPA 1CNMA 1GPJA 1ESDA 1OF1A 1X9IA 2ACVA 3VBCA 5C9ZA 1YH3A 2EYUA 3FNBA 3KNZA 1ZCAA 4GM0A 3UJNA 5AVKA 1YZ3A 3P4UA 3NHAA 4FNOA 4LWQA 4I3HA 4E1VA 1RD4A 2HQRA 2CJYA 1BDJA 1QKKA 3W2EA 1DOZA 1G21B 3JARB 1ORIA 2WJ3A 4I2VA 2GJKA 4RVGA 2XWBF 3K9WA 1XIVA 3FKJA 5F35A 4EPWA 1A7AA 4FSDA 3AOEA 3G2JA 2Q8QA 4FOTA 3WO1A 5FV4A 4AKHA 2B4YA 2JNWA 1Q44A 3I6ZA 1TE2A 2YRXA 1JDPA 1C3EA 1TOAA 1W2GA 1ZL0A 2MIIA 2XMZA 3PICA 1KAOA 1O5IA 4LOLA 5DKFA 1SUEA 2ID8A 2FP3A 3NRCA 3MT0A 3K5HA 2AN3A 1GPWB 3OEYA 3WYNA 2G83A 3RTBA 1XMQB 4ZTZB 2JJ1D 2X7XA 3N2GB 4HEA1 4C5CA 3DBRB 3M5DA 4UTNA 3GLIA 4MQFA 1RCFA 3BK1A 3QU9A 5TEVA 1KQGA 2C77A 3ICWA 3ZZTA 3SZRA 3ZU3A 1P81A 4MVYA 5C5IA 1ORTA 3FNIA 1XQ9A 1NXSA 2M6SA 3LCJA 3HXMA 5CX1B 1PZEA 4J0HA 1BC5A 3IUBA 1D03A 4ID9A 4OXRA 4C6SA 5JV5A 2VXCA 3N3AC 4CM9A 3QXXA 4G1EB 3U62A 2HMAA 2OCIA 3JX9A 3S2IA 2K2WA 3AZQA 1Z2NX 3DZFA 3FJ1A 2IS1A 5CLFA 2O3JA 1J2TA 3R40A 4YDSA 3SHOA 2XCLA 3NAMA 4G56A 4EPYA 5IC6A 1O03A 3QUAA 4G2NA 2QQFA 2XVXA 3K7EA 3LC0A 2UYCA 4KFCA 1AA9A 1U8TA 2PBRA 2A35A 1GL9B 1SPXA 1EBBA 1VXOA 2J4FA 4OI2A 3KWLA 2Y1WA 4N7JA 1WMSA 4F72A 3KIPA 3PNQA 3EMDA 3WYCA 3K5WA 1MJHA 2G0NA 2IITA 2ZRFA 4MYSA 1I4LD 3K9QO 3TDNA 1EP1B 5B1YA 1K4MA 2QGFA 3DVLA 3I23A 5IJAA 2ZUSA 4MR9B 2BCGY 4ZI7A 1S8AA 2QDKA 1AN9A 1PNQA 4HLCA 3DCYA 4P22A 4B48A 1K8RA 3L93A 2PGNA 1E3EA 1AHNA 1TPYA 1ZG3A 3LT0A 4Z1MA 3JQ7B 3O3OB 4INJA 4K6FA 5LDGA 3SN6A 3S1SA 4YAEA 1U2EA 2Q8NA 1VG8A 2R1TB 1Z07A 4IWYA 4QTXA 1N9KA 4WLEA 1M6WA 2G1UA 5HFJA 3GLFA 4PYKA 1N92A 1YGPA 2AMYA 1Z56C 3FA2A 4INPA 3CT4A 2SECE 3EGWA 4C22A 3FUTA 2RGAA 2J6CA 2NO9A 5ISMA 4LMPA 3H1FA 2GFQA 3N2KA 5D3MB 2IEYA 2W5UA 4XWOA 3OKAA 1T2FA 1WCWA 2R6AA 3B2EA 3CZQA 3IBFA 1KE2A 5CH5A 2BJHA 3BERA 4B5KA 4G36A 4FB5A 1JN0A 1O8CA 3K94A 4DJEC 3Q8MA 1NUHA 4IH1A 3AM1A 1NM5C 1XCLA 4UXJA 3LPLA 3ZD6A 1J00A 2JJYA 4XWWA 3B82A 4GBMA 4M55A 1QBKC 1BKYA 1R5OA 4DRXB 2IY8A 2ZZMA 1WSAA 3BOSA 3AETB 4AECA 3K0SA 1VP9A 4U00A 2XRZA 1GN8A 4NZNA 3K6RA 3G68A 1UC9A 3ZE2B 5JNVA 1LW6E 5CCEA 5E2BA 2YY7A 3V1UA 4DLNA 4Y9TA 2XYQA 3OZRA 2UVPB 2ZB3A 4RM2A 4PZZA 3A6PC 4DARA 1E8NA 1WXWA 5I01A 3D4LA 2XGOA 1CY6A 2BGKA 3E3LA 4GF5A 2ZJZA 3JZFA 4LXQA 2FX5A 4EATA 4EQ6B 1U0JA 2JI7A 3COVA 4Q3BA 4WN9A 4FYIA 4Q6WA 1DE0A 2Z5FA 4WSOA 4UVIA 1W75A 4D9IA 1EUDB 3P0HA 3E9CA 2ADMA 2E85A 2YQ4A 1M33A 3KFVA 2IEAA 4FFBA 3TW8A 1RKQA 1U8ZA 1SCUA 4BNUA 5L3QB 1S01A 5CGQB 2PX5A 1R6BX 1KEKA 3UAZA 1MT0A 3W2IA 1YZTA 3AR4A 3QVOA 1VMEA 3AVOA 3HP1A 2FAXA 4YUYA 1MOSA 2DHDA 3FDXA 4IIJF 1FFXA 4LHWA 4Y8VA 4EJMA 1LW7A 1IPFA 2CLIB 3OE7A 2VTKA 2HADA 4KO1S 4YAFA 1KY4A 4CKCB 2P6RA 3KB8A 4HVTA 4UVHA 5F33A 5DOZA 2CUNA 4BV3A 5HDBB 4EPVA 3GCGA 2AXQA 3JWJA 3D3NA 1Z7YA 4NRDA 5F3WB 3H9JA 1GFIA 2DPXA 2XYPA 4PRYA 4ZYTA 4JI4B 2F9LA 2B5VA 1R6TA 1HT2E 4OA5A 1T3ZA 1VJ1A