5JSQA

Trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-[7-(phosphonoheptyl]guanine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
195
structure length
173
Chain Sequence
b'CKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRDIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVYETWGKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypoxanthine-guanine phosphoribosyltranferase
molecule tags Transferase
source organism Trypanosoma brucei brucei
publication title Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
total genus 60
structure length 173
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jsqA00
4P82A 1QCCA 1BD3A 1FSGA 1BZYA 1GPH1 4JLSA 5HKLA 2H07A 4LYGA 1MZVA 3O7MA 1ECGA 2H06A 3GEPA 3EFHA 2JI4A 3S5JA 1HGXA 1I14A 1GRVA 1XTUA 2WNSA 1ECCA 5IPFA 1XZ8A 2PRYA 1IBSA 3OZGA 1P18A 1DKUA 1PZMA 1P19A 4RACA 4M0PA 5HIAA 1A3CA 4LYYA 5KAPA 1HMPA 1DKRA 2FXVA 3DMPA 2EHJA 3LRTA 2P1ZA 1DQPA 4WN3A 4Z1OA 4MB6A 1L1QA 1O57A 4WMLA 1QK4A 5BSKA 1VCHA 4M0KA 1Y0BA 4RANA 4P3KA 4F8EA 4RABA 4S2UA 1G9SA 1NULA 2PRZA 5BRNA 4P84A 4QYIA 1ZN9A 4X45A 1A98A 1QB8A 4TWBA 1O5OA 5BQPA 3G6WA 1DBRA 3OZFA 4P81A 1A97A 1A96A 3ACBA 4RHTA 1ECBA 2XBUA 3QW4B 4JITA 3KB8A 4P86A 3N2LA 4X44A 5BQOA 2IGBA 3LPNA 1V9SA 1W30A 1QK5A 1UFRA 1ECFA 4QRIA 4LZOA 4RV4A 5ESXA 3ACCA 4P80A 2DY0A 1NONA 2AEEA 1L1RA 1XTTA 4M0UA 1Z7GA 4RHUA 1A95A 3OHPA 4ZFNA 2H08A 1J7JA 4PAWA 3M3HA 1P17A 1QB7A 1I5EA 3GGJA 4IJQA 3H83A 4P83A 4RAQA 2GEBA 4FYMA 4OHCA 4RQAA 2YZKA 3DAHA 1A4XA 1QK3A 3NAGA 2VFAA 4RHYA 1JLRA 5JV5A 5IAOA 4RAOA 1QCDA 2JKYA 1ECJA 1CJBA 4KN6A 5K51A 2HCRA 5KAMA 2JBHA 4PFQA 1P4AA 1XTVA 1R3UA 5E38A 4LZNA 1STOA 1I13A 3HVUA 1BD4A 3DEZA 2E55A 4RADA 1AO0A 1U9YA 3ACDA 4RQBA 5JSQA 1DQNA 1ZN8A 1VSTA 1G2PA 1XZNA 1D6NA 5EUCA 1OROA 2C4KA 1TC1A 1WD5A 3GGCA 1G9TA 3MJDA 1YFZA 1I0IA 1UPUA 3MBIA 1ZN7A 1LH0A 2JKZA 1G2QA 1I0LA 4RHXA 1OPRA 1TC2A 4LZAA 1JLSA 1VDMA 5ESWA 1OREA 1U9ZA 1UPFA 2PS1A 4QYIB
chains in the Genus database with same CATH superfamily
2P6NA 2DR2A 5HRAA 1KMCA 3NORA 4EKYA 1Z73A 1CNMA 3K9WA 2K7FA 4YYEA 3E9QA 4IOKA 1PWXA 3ZCTA 3OQIB 4AO7A 1JWLA 5HE8A 4RIHA 2EG5A 1GADO 4OMFG 2FQYA 4DSOA 5A7FA 3PQEA 4EHAA 4ZI7B 3CWCA 5CG2A 2OXFA 4YR7A 1JALA 1UBHS 4L5JA 3DL2A 4MW7A 2I71A 5KYGA 1A9OA 3ZE8A 4KBFA 2O6HA 4MEBA 4ZARA 4EYSA 1D2CA 4BQQA 3CHYA 1VLMA 5GONB 4HSEA 4C78A 2C2KA 2BL4A 3K4PA 2I3DA 2QORA 3GA7A 2FK8A 3E2PA 2QI9C 2OECA 1SUAA 4OUDA 3P9QA 3PUVA 4XGQA 4BDTA 1LEHA 1M33A 4DNQA 1A9ZA 4PGMA 1OX4B 2XUHA 2VL7A 1SMKA 3B6MA 3LUDA 2HF8A 4XE5A 4A1OA 2WSIA 1J6UA 2I62A 2DAPA 2O0KA 2ZTHA 3LC7O 2RE8A 2V6GA 1Z35A 4KWIA 3P27A 3RUPA 2PX0A 3GJYA 1V6SA 1Y5MA 2RAPA 4RF4A 4W1QA 3K2EA 4CQLA 4EUKA 4EUHA 3WZMA 1C9EA 1JTEA 3DMGA 3D64A 3V3TA 2D4AA 2WKWA 5KSOA 3WA7A 3HXMA 3BWDD 3ZWAA 3ZDXB 3LH5A 3O8OA 4F8YA 3BXXA 1NNLA 4W9MC 2C9YA 2NZWA 4IJVA 1VGQA 2YBDA 1ML3A 3QFCA 1XNQB 3AMVA 5E6SB 2G08A 3NRCA 3EY9A 5PGMA 3D6VA 4HDRA 5F12A 4DDUA 2IDJA 4MRPA 3SHFA 4OMDA 4E12A 4LDNA 3SR0A 1JJIA 1USKA 4JX8A 2CEAA 4XRGA 3QWFA 4OTZA 4EWLA 1Y9EA 1IEXA 1UC4B 3G5TA 3UZUA 4P7BA 3DC7A 3WGHA 1O1YA 3LL7A 4QTXA 4WGGA 5LYYA 1HQYE 4IFIA 2WF6A 1ZUIA 2DUJA 3KD3A 4Q48A 1EMDA 2I5PO 3PCXA 2X0IA 4IS2A 4WA7A 2HXSA 3C87A 5DM4A 2D1FA 3I28A 1K27A 3ZPXA 4DQKA 4TTPA 4DDTA 1NXPA 2GEBA 1Z0DA 5TS2A 5JPIA 1HYHA 3BD9A 3FTCA 1TT5A 2CL5A 1Q92A 2ENWA 2VKTA 3PQCA 3IHTA 3CUUA 4L0MA 4YLGA 3ED5A 1RABA 4DG9A 4N41A 2VK4A 4M0LA 2D7CA 5K51A 5BW5A 7YASA 2GRJA 2O19A 3UNXA 1UMBB 1CK4A 2E4UA 5L7YA 5I6DA 1YIOA 3H6GA 3OF5A 4Q1FA 1SCQA 3KWFA 3TFQA 3T5TA 1SCNE 3OFVA 3RTGA 2VH5R 3WICA 4CU2A 2RH8A 3PUZA 4RTNA 3SX4A 4G4IA 1OXMA 3URKA 3JQRA 2Q7XA 4IL5A 1DAPA 2VHYA 4Q9AA 3GCDA 1PD1A 3I04A 1XUOA 4B7CA 3KFXA 4PSUA 2JJQA 1G8PA 5C18A 5JFOA 3GAAA 4TT3D 1ELOA 5AO9A 1EPUA 3BHNA 5B37A 3AZQA 2HA0A 2E4AA 1F5SA 1UF9A 4MJ7A 3ABSB 4BS9A 1IBLB 1TIBA 2O50A 3QTTA 1G0OA 4B7ZA 1Z0IA 1A7KA 1R8SA 2JGDA 3V7FA 2YN2A 1PBTA 3O7MA 3W6ZA 4GBJA 5BYKA 3HUUA 3SEZA 4MWCA 4UAJA 3JPYA 5JXHA 5JLAA 3Q3IA 3JWEA 2X2PA 1RVDA 1XTUA 2OD2A 1DX6A 3AG6A 1U0RA 2QIPA 3OE1A 4KO8A 4RX1A 4WLOA 1YUMA 1VG1A 2FMIA 1I7NA 2WMOB 3D7KA 5KNLA 3KX2A 1PT9A 4CKYA 5CW1A 4U00A 1ZWKA 4UTRA 4EELA 2A9VA 1M34B 1W4RA 3QITA 3DVSX 4U1RA 3WRYC 5JZVA 1GUFA 1J99A 3IP8A 4KFRA 4LJ6A 1UFVA 2A1UB 3D3WA 4N9QA 2NTJA 2PL9A 1XMVA 2V7TA 2AS0A 4QFMA 1JKXA 1XLVA 1NN3A 3KT0A 1T9KA 1I2AA 3NTVA 4KVGA 4MGKR 1CDOA 5CRIA 2WIAA 4BEWA 2G0AA 1QBKC 3AM4A 1HEIA 3K7EA 3NM6B 1TEXA 3FF1A 3RS7A 1DWUA 1E1LA 4RH1A 2UZ0A 2QHXA 1ISRA 1CDZA 1G21A 4I5GA 4WH0A 5KKNB 3BRCA 4RA9A 4YRCA 1EFTA 2VJKA 2WJAA 3S1SA 3KB2A 2C2WA 2FWMX 2PVPA 2EBHX 5H70A 1MLDA 3KOXA 1JPUA 1NBWB 1X7XB 2DSNA 2HU5A 2QLLA 3BCHA 4QU5A 4ZZIA 3ZTYA 4G4GA 3EPHA 4D1YA 2WA1A 1U9CA 1WCIB 2ODNA 3FA2A 3HZOA 4WIAA 1WXDA 5A5EA 5F2EA 1NF9A 2IGBA 5E6SA 1E5TA 1UP6A 4ISCA 5I4BA 1UFRA 4JDUA 2AT1A 3TQFA 1PR0A 2ZBDA 1ZFNA 4RMGA 3VTKA 2BYTA 1DTSA 2IWRA 3GROA 2G7MC 4X94A 5IXYA 4RJTA 2JPDA 3CUKA 4G5GA 4OLBA 4P7KA 3MRVA 4MUFA 5BT9A 5ITSA 1QVVA 5IS2A 1WIWA 2WM3A 3FF4A 3GJXC 4DYDA 1CUYA 1P0IA 3KXPA 2UYOA 2CBXA 4MINA 4MQBA 3EK2A 2R7NA 3CVJA 1Z8HA 5DZSA 3UHPA 3P71T 5EMMA 2QBYB 2V55B 2ZVDA 2R8YA 3VC7A 2FR1A 3MGBA 3ZDFA 1M6YA 1D4FA 4QLBA 1PDWA 3C5HA 4YAOA 3DOEA 1CE8A 1LPBB 4WZAB 1U4SA 1W44A 3L8HA 4YJGA 5E2AA 4X66B 1LSUA 3ZHSA 2QVXX 2A59A 3IQGX 3WADA 1KKMA 3P97A 3RVLA 3VX4A 1MB9A 4MV8A 1USIA 1WMSA 1E1QA 1MB3A 1ZG3A 3QGMA 1Z6YA 4HQ0A 1SXJE 4L74A 2PYZA 4U63A 4YMWA 3T7SA 4DR6B 3A9WA 3IKLA 2WQ7A 2HPZA 4TTVA 1GN8A 1QOZA 3IP3A 1MD9A 3GCZA 1JEEA 3V97A 5IAAA 2H1SA 5BQ5A 2GM4A 4I3FA 1E7WA 3JD3A 2NZVG 2H1LA 2JGKA 2OGZA 3FTPA 3GRVA 2C31A 4O63O 2IPXA 2RHWA 3FYDA 4DRZA 4J9UE 5HIJA 1EBUA 2YQ5A 2YXPX 2ZDGA 4MUKA 4U2BA 2QQGA 4OP3A 4DZRA 2A92A 3GYBA 2A3NA 3Q9UA 4OJTA 2CK3A 2Z6VA 3B6KA 3I53A 3RK4A 1T36B 2RGCA 5IJZA 4X1KB 1GG5A 2CXQA 3UO8B 1FP7A 1B73A 1BD3A 5AKGA 2Z2KA 1XDDA 2G1KA 1Y98A 2ONCA 4ZAGA 1LDEA 3DH0A 2F8TA 5LA6B 2IYUA 3PRJA 4G4JA 5EVCA 3BAFA 5BXYA 1DKMA 1L8XA 3HBNA 1M6EX 1GZ5A 3GHYA 3PC7A 3PDWA 1KOLA 2BGKA 4URYR 1J2UA 1RQ2A 2W2PA 3AL3A 3FLMA 3WB0A 1EFCA 4J1TC 4TKUB 3U44B 1W52X 3VBEA 1P1FA 3EZ9A 1D2GA 2OD7A 2H0RA 4DLWA 2CMDA 2EQAA 2Q6IA 3AJAA 4HQRA 4KDEA 3WR5A 3B9QA 2XXJA 1XZDA 2I2CA 5JEEA 3BCUA 3DT9A 1L7MA 1MC1A 3GJ0A 4OCZA 4QPDA 1J39A 1IXRC 4UC0A 3LJKA 3NAZA 3PQ8A 5A1TA 4WLVA 4QXRA 3LZDA 1J5XA 2CC2A 3AV0B 4GC9A 1N78A 1KI4A 1XJ0A 1LSOA 3M4YA 3MWDB 4P54A 5C5CA 4B6FA 4XVQA 5D01A 4GX1A 4A10A 3OM1A 5EZQA 2DSTA 4K5QA 1E0JA 1A9QA 2P9EA 2XPCA 2XTAA 3CF6R 4QICA 3OO0A 1NZFA 3ELUA 5BRNA 3V8BA 4TTRA 3I5YA 3ZD6A 1J0DA 3CH5A 4TXNA 1FTSA 4FSHA 1M2VA 1V6CA 3K9NA 1JFLA 3AU9A 1NN1A 4B80A 5KTYA 4OQFA 3W7BA 3BMOA 3M4JA 4L6CA 1XMXA 4GMHA 2AFHA 4W4TA 3RRYA 3ZI0A 3ZWDA 4OQDA 2C7BA 4N76A 3D6JA 1VP3A 1YRLA 1HQDA 2C99A 1DAGA 1IQPA 1GG2A 1O6ZA 1VP9A 3L4KA 1QDLB 1QPGA 2VAPA 4P5PA 1JEQA 1T10A 4IIJA 1TCCA 4Q9IA 4XFDA 1K5DA 2RGRA 3KEOA 1DIRA 1KJWA 1I4OA 4Q16A 3HFRA 1FMCA 5A3JA 5H4GA 1T1SA 4TQGA 1A8QA 2HHHB 4WOCA 5K0BA 2WNHA 2ZPAA 3CW9A 3HN6A 3VR4H 4LDJA 3V4SA 3LF2A 1PEAA 1UBEA 2VDWA 1U8YA 1W6UA 5COAA 3PI7A 2W2LD 3II6X 1CUFA 3OLYA 4LQLA 1EFPA 4ZZ1A 3JWHA 3Q85A 3FTNA 1XXLA 3X44A 3S40A 4PHTA 1RC8A 4B44A 4CPDA 4F2PA 1YZFA 1N5LA 2AYZA 2PA0A 2PR2A 1PG0A 3EHEA 1L4LA 4POAA 4R81A 1Z2EA 3PGVA 3TGPA 1N6OA 4CEIB 4NPHA 4KXVA 2R6GA 3BRQA 1E4YA 4LZNA 1STOA 4PZDA 5AI4A 4A9AA 2PH7A 4AQYB 5ERGB 1SXQA 2ACKA 2QIOA 3TCXB 3WIOA 4IW3B 2IYQA 2Z30A 2JHAA 3JQAB 1TIPA 4CODB 3LUFA 5FI0B 1TAUA 3AVUA 1E2GA 1TKBA 3WYGA 1J9ZA 1Y1SA 2R8EA 3LLUA 2WUWE 3MCAA 1AX9A 1ICEA 4DL9A 4DKJA 3U19A 2XB9A 1XPJA 1YIDA 1OBVA 2Q29A 1N9KA 2CUTA 1G4HA 2X6QA 1FFEA 3NJRA 4OHPA 3H4VA 2WSBA 1E7MA 4KK4A 3DXZA 4MQFA 3C8UA 5C5IA 1OZAA 1N9ZA 4HS4A 1DO2A 1C2YA 3IP1A 4D8VA 4JI2B 1D1PA 4KXYA 4BC1A 1YB2A 4ZK6A 3Q40A 1HFWA 3NTUA 4KTTE 4HGRA 3OE4A 2A9FA 4DQDA 4MV5A 4EY6A 1E2HA 1EM6A 4DR1B 1HNXB 2XAAA 4Y2HA 4CKBB 4HN9A 2DHEA 2IRWA 2Z3VA 1GRRA 4RD4A 3WO0A 5HKKA 3UWKA 1RYDA 1E5DA 1VG0B 2IA5A 2PWPA 3Q0TA 2NXWA 3HDGA 3K0FA 3X1WA 1ONSA 4E32A 4GOKA 2I4TA 1P19A 4ZA2A 3G7SA 4ZYVA 1Q1QA 4GF5A 1JBEA 1U11A 4J0HA 4P31A 3G1TA 5E8JA 3TZCA 3L77A 1LF5A 2O5VA 3M6MD 4H7EA 3WK6A 3IAS1 4Y1EA 5CDUA 4X7BA 3S27A 2JIZD 4QQ8A 4WESA 5CGQB 4ZZ0A 4MA0A 4P0PB 5FPKA 2V59A 3EXHC 1JG7A 3HHPA 3SVZA 4C05A 4NHEA 4UTNA 5A0TA 1XJCA 2R1ZA 4E5UA 2IXAA 1DBSA 4RVHA 3FI9A 5EIFA 1DDOA 2AVDA 5MFPA 4UMEA 1ONBA 1R6VA 4PYIA 5JAHA 4ZAVA 2VJBA 3M83A 3PLNA 4KH1A 5DGXA 4JODA 1U0TA 1ZAYA 4Q37A 1QF7A 3UT6A 4DA8A 3OPXA 2RC6A 3JWIA 4TOIA 3GX1A 1RBYA 2I65A 4YMUA 1T24A 4MVJI 4XGNA 2GPSA 4V3CA 4G5FA 1H1DA 3JD2A 1PVVA 4QGFA 5CLJA 3PWTA 5A0FA 2XXBA 5BRAA 3J80A 2NYVA 2OHXA 1G5HA 3WG9A 4R98A 2R5WA 3MCUA 1B0AA 3ITKA 4WXHA 1DUSA 5BYBA 3QYFA 3ZJYA 1C0PA 1SHZA 1FJHA 3R76A 3GT0A 2OBXA 4GBMA 1NBAA 2HWYA 5K8VA 5KWJA 5HKOA 2Q6OA 2G09A 2WD7B 3KJHA 4QJBA 3VR0A 2FPSA 3RGGA 1RHJA 4DCJA 4X85A 4IUBS 5GY7A 3EJ6A 5HX7A 4EQZA 5JS2A 1EZ1A 3L1UA 5KNDH 3C48A 3ZW7A 1KVQA 1W0KD 2GWHA 2QY9A 3H1FA 4IQ4A 1XNRB 2XXAA 1CNEA 4OYRA 4JI1B 2ZCVA 1B3BA 1EUQA 4OX9Y 2B94A 3C3JA 1KK2A 1CJVC 1VJTA 4HUTA 5BWLA 3HEAA 1Z16A 3RM3A 4LZZA 2YRXA 5CK4A 3GFQA 2AXNA 2W22A 3AOGA 1MBZA 5AT1A 2ZJZA 5ANRB 4YP7A 1AKUA 2AYYA 2ZXFA 4QGAA 4NS1A 3L43A 1MG0A 1MT3A 1NJ8A 1QG4A 2J7PD 4IUCS 1P73A 3DEZA 4HGZA 3TPFA 2YRFA 4R2KA 4YRSA 3ER9A 3D3JA 1VHLA 2LR0A 2W7TA 1DADA 1YDGA 2OA0A 3U9TA 1M8JA 1QH1A 1T35A 1W85A 4KGZA 3RK1A 3VZDA 1TECE 3LDAA 3OFND 3QVXA 5JNVA 4BY9E 3UFXA 1N5OX 5IYZF 1JEDA 4IDEA 4XYEA 3V8MA 4DUYB 3T54A 1SCAA 3VYSB 3OAAA 1MEJA 5A9SB 3K0CC 5FLXA 1EFAA 5ADVA 3PX3A 3LQQA 3VXKA 4A91A 4MV1A 3NC1C 1RDFA 5JNLA 2P3QA 3JZFA 3HBLA 3KJIA 1EQ2A 1DOHA 1RM0A 5AESA 4R8SA 1G5TA 2AMJA 4EJSB 5BSFA 1SD5A 3D3NA 2EP8A 2WYVA 3WGOA 2FZCA 1BXRA 3DLCA 1P2SA 3HN7A 4HB3A 4HVCA 2CLEB 1TUBA 2GS9A 2LZ0A 3EUEA 1QZ3A 4FIZA 3LUGA 3N0XA 2H1OA 2ZRPA 3GP5A 5AKJA 3S5JA 3OQVA 5ULLA 5IFLA 1P0FA 1YACA 2EZ8A 1KMMA 3CR7A 3ICQB 1U6IA 1Q19A 3GRPA 2XODA 1SXJA 2CL0X 3KUCA 4M0PA 3QUQA 3WHIA 2I9KA 1JG4A 1U81A 1U0LA 1U8CB 2JFGA 2SKEA 3B13B 2FMHA 3GCWA 4P35A 1WV0A 1E94E 3RS3A 2O54A 1L8LA 1DPGA 1Z74A 1KWKA 4R31A 3E22A 1S4MA 2P5UA 3GBPA 5I8ZA 5DM70 3U7HB 3EB9A 1SHJA 3L05A 2W6NA 4HXGA 2QVLA 1R0BA 2WHPA 3VNRA 2R4TA 1D0VA 3H87A 1PDVA 4K3VA 4MKZA 2QW0X 2V9CA 2BM1A 2VWHA 3H19A 3WXBA 4P3KA 3WJ1A 4ENPA 4IDBA 4FJ1A 5LOVA 1OI7A 4ZMBA 2VZ8A 2C0QA 2WD9A 2OPBA 3G2QA 4OQNA 4M76B 1XVAA 4O2RA 5AKKA 4Y30A 5FTLA 1D2NA 3F7TA 4TUYA 4OGLA 1NPYA 1A98A 3NBYC 4X1IB 3R75A 2DBRA 5EKSA 4EBFA 1OH6A 2F6RA 5KKCA 1X19A 2ZBFA 2YOHA 2P41A 2AKEA 4TT8A 5GWXA 1G3UA 4UUBA 4DLLA 3LCMA 2AF3C 4E7OA 5M7EA 2NNLD 1G18A 1VPDA 3K2QA 4IGIA 3TW8A 3BIJA 3CPEA 2BLNA 1NAHA 3DVQX 2BMFA 1BRTA 3BGDA 2X9GA 2XCRB 1B16A 1TTHA 1SKMA 1YBAA 2JLAA 3CZQA 5IJ9A 2NSYA 1ATZA 1E4EA 3GWGA 1UT5A 3QE2A 3VBCA 3AR2A 1VI6A 3K16A 1QZZA 1KDYA 3DC2A 3GRCA 5EP3A 3GNLA 3DOFA 4TV9F 5AI0A 5C1OA 3KWJA 4CGZA 4K86A 5IU6A 3VC2A 3PUXA 5AOAA 5JBQA 3S2YA 5FQOA 2VPQA 1S2OA 4RZXA 1HFEL 1YV9A 2I34A 1Q16A 3KZ1E 1ENPA 4C3ZA 1N9GA 3MUNA 2LW7A 4FQ8A 3ZZ0A 3ISJA 4OHCA 2J3LA 1K7CA 4RQAA 5COQA 5A5DA 4B32A 1E1RA 3E05A 4F4DA 1CUUA 3REFA 2Q5QA 1XEFA 4JGGA 4J16A 3STUA 5A4IS 2PZAA 4HLCA 2HZ7A 4J1SA 4MIYA 2DFVA 5EQTA 1FX0B 4B2LA 1V5EA 1NM5A 5EKXA 3BXOA 3EGDB 2ZYGA 3SI7A 2HRCA 2ADFA 1VL6A 1DT3A 2C5SA 2FQQA 1PHPA 2PANA 4OSOA 3AEKB 3ETDA 4JK3A 5T41A 1TM3E 2B2NA 2GRUA 2Q3HA 1JE1A 2Y9MB 1CFZA 3WP0A 5JMWA 1J8QA 1PL6A 2RAFA 1L5KA 2JDID 3ILYA 5E1OA 4PZAA 1V2HE 1ZMTA 1JJBA 1DIHA 2NACA 3KKMA 1O87A 3NIFB 3QLUC 4GKAA 5IC6A 1KTIA 3LXRA 2I1LA 4DLNA 4F2GA 1AQJA 4DMFA 3O8CA 1JB1A 3KTFA 4N6NA 3KZOA 3T7DA 2Q0SA 1DEXA 1HWYA 2VQ3A 1IY8A 3UAZA 1FDSA 1VZ2A 2UYQA 4B4VA 4EG0A 4O3MA 3MLEA 4JP3A 3DJFA 4PQGA 1JG2A 3LBHA 2UYGA 1XZCA 4BVEA 3HFSA 3VYWA 4PHGA 3GR6A 2IV7A 1XVVA 4HZUA 1V9LA 5EVJA 1JBQA 2JI4A 3WSTA 4BVFA 2CNDA 4E11A 1Q84A 3LSYA 3MAJA 3NHUA 4C1BA 1FFDA 1I14A 5BORA 4H35A 2D54A 3UB3A 1XHFA 3WHPA 4BBPA 2WFLA 2PX2A 2VA9A 3HV2A 3PR1A 3QPDA 4Y2GA 3WNCA 4R71A 1E1YA 5JO0A 3DP7A 3OOEA 5E9QA 2IBMA 4ME6A 1U0NA 4XWGA 3E0XA 2CNLA 2GAAA 1H2HA 3O1JC 3WGTA 1UBGA 3B3FA 2W5UA 3KV3O 1REQB 2J1LA 2FCAA 2B4KA 1H6CA 2MYNA 4MPJA 4X95A 1WZ2A 5DLDA 1U9JA 5JSUA 5KHAA 2W2QA 3CGGA 1SVNA 3FX2A 3QG5A 4X1IA 2YVQA 2IH4A 4HBGA 3LZ6A 4XOIA 2GOYA 3DOUA 2VF5X 4UNIA 4MMYB 4WCFC 4DUGA 4OI0A 1RYFA 1I6LA 1VKRA 1WU8A 2BHRA 2VT7A 2Z9DA 3KJGA 5AMXA 1UJMA 2BMDA 3IRVA 1VZ3A 4GR4A 1GV1A 1JV2B 3P9XA 4ER6A 5IDXA 5EP1A 3L4JA 2JFUA 3U60B 3NPAA 4KW7A 4HH0A 1G1MA 2HCJB 3BA6A 5FORA 3ZZMA 2ICAA 1ZW6A 2QVCA 3CKMA 3NETA 2P9YA 3Q9NA 1Z7EA 5FBWB 4AJOA 3B36A 4GOOD 2GNPA 1VL1A 2RHLA 3GQVA 2CLCX 1W47A 1VMIA 2FZGA 4NP6A 2W6ZA 3AY3A 1ZA1A 1G6HA 5KNBD 2O3TA 4UAVA 2CXUA 3EQZA 1BO6A 2O52A 1PK8A 2WZQA 2C7VA 4IILA 4OL0A 3EBPA 4R68A 5G1OA 1ESEA 1AHIA 3WIEA 5HZHA 4FVTA 2GH1A 2H0AA 3TPCA 4ISBA 3EZ6A 3NP7A 3EEFA 2E3JA 1U1IA 3L8DA 4ESHA 1E6EA 3A9CA 4C9BA 3B12A 1A76A 4EY8A 1GZDA 4JS0A 1SR8A 2CHGA 3FBWA 2RBGA 5DLYA 2VPWA 2BM8A 2H7XA 4EHIA 1KARA 1YQXA 3E7XA 5CFQA 2O2CA 4F2DA 2COUA 4EHKA 1A1SA 3CU5A 3FFTA 3HJUA 1HYBA 2G77B 5CT6A 2VA8A 5DYYA 1I10A 2R65A 1YL5A 4UTOA 2BKVA 1NY6A 1B76A 1GPLA 2HJGA 3DAHA 2M2IA 3OLCX 3T9DA 4E22A 4X6YA 1ZL0A 4HGOA 1AKQA 1PJLA 5IAOA 3C6XA 1ECJA 2CV0A 5KC8A 3COJA 5KQMA 4PO9A 5HW0A 1Q1AA 4MUAA 5KWIA 2QT9A 3ROMA 3E3NA 3HVUA 3B48A 3L5KA 1JP7A 2XCOA 4LNAA 4FFWA 3FWPA 3UMCA 3A6LA 1FFXA 4GRIA 2C4UA 1BDHA 1ADJA 2C3MA 2ZTMA 4BNNA 4XWTA 1A04A 4D79A 1MORA 2NXEA 4RDXA 3GRZA 2ZIXA 1KK0A 1QOPB 3QHQA 3V4OA 1Y6FA 2P9FA 2V98A 4D25A 3HVIA 4I1RA 3K4QA 2QVGA 3GZNB 2BC9A 2HDHA 2X2EA 3BB3A 4UOQA 4X61A 5KNCH 3LCCA 2UUCB 2Q9AA 2XJ4A 2A35A 3CF4G 3ON5A 5KJ6A 1Z5WA 2BJHA 2L18A 5KNDD 1PQWA 1QHYA 4YRMA 2WYIA 4REMA 4EF6A 5C8XA 4DSUA 2C3OA 2VN8A 3MMSA 4XVHA 3QE3A 1L7PA 1NP3A 3IODA 3QKSA 2E82A 4H4DA 4RF3A 2NUPB 2A94A 2FV8A 3G89A 2C4VA 4YJ2F 1QZUA 3RKSA 1FNDA 1X42A 2BDEA 2G3YA 3H2GA 3QSGA 2CWWA 2PSSA 3LP8A 1ZD2P 4PG6A 1Z0ZA 2VUSA 4IHJA 4V0NA 1CHDA 2BFOA 2BTOA 1SQ6A 3DXYA 4KPUB 2GJKA 4KVFA 3TNFA 4QYSA 3L79A 5K0LA 1A71A 2ORVA 1E5XA 3UQYS 3UT5B 4BIMA 4R0MA 2NZ8A 1YJCA 5AOCA 3L7JA 1RZRA 1Q1NA 1RWXA 2MMCA 2N1BA 2QAGB 1K6MA 1XTSA 2Z2XA 3CRRA 3IB6A 3R3ZA 1EGAA 3SIPA 1ZQ9A 1FVFA 2ABWA 5LWQA 3BOSA 4RK5A 5K2MA 1ATIA 4GVLA 4OHKA 4QSHA 3DBRB 1RI2A 5B1DA 3EZYA 4B43A 1G4AE 1M10A 3GB9A 3AB8A 4MPTA 4X8MA 5AK6A 4DIMA 4MWTA 2QUZA 2H0QA 2AFIA 1WDMA 3LBAA 3PXCX 2YMQA 3SQDA 1HE5A 4EJ2A 3JQAD 1SCUA 1RMQA 1XPUA 3C5WP 4PLHA 5EEHA 1HSZA 4FR0A 1P3Y1 1Z5ZA 2GCNA 3EXAA 1J0BA 1EX7A 3DDZX 2VG8A 4FOSA 2PK3A 1CVIA 4ND4A 5B4TA 2WF5A 3ZJVA 1J0AA 4IGKA 1WVGA 3S4YA 2EIXA 4N1AA 3EDMA 1CP2A 1P7VA 2POQX 1DMSA 2J8ZA 5C8YF 4OQEA 3TLEA 1WZNA 2H2AA 2XUZA 1YZYA 3BZUA 1VE5A 4Q5IA 4H7JA 4R3NA 4YECA 4ZT5A 4EQ6B 3VNVA 4JOBA 1SAYA 2I2AA 4V0MA 2V7GA 3HKBA 4CL8A 3WL4A 2SBTA 4LRSB 4BWYA 2ECKA 5BSTA 3TI9A 2QD3A 1Z7GA 4S1TA 4EEZA 1OV4A 3EISA 4EG5A 2D2FA 2GVZC 5AVSA 4O4IF 2DKFA 1TKCA 2EJUA 5DWQA 4DJJA 2P4QA 3HWSA 3HO1A 1HF3A 3AHIA 2D74A 4Q7LA 4WUTA 3D1JA 3L04A 2BFMA 5AW9A 3ER8A 4FYMA 1BXKA 1L4UA 1MOZA 1MW9X 2P69A 3AY0A 1QIKA 3GVIA 5DFAA 3GLFB 4M9RA 2XDAA 5EFOA 4YRFA 3MWLA 1IN1A 1XTRA 2Q3FA 5DKFA 5F33A 4RM2A 3RJZA 1UKZA 3ZJ4A 3C8HA 2H2GA 2D7DA 3ZHTA 3ZHRA 3WV4A 2VSXA 2R60A 4NAVA 1KA9H 2DPYA 2WUGA 2WUVA 1KMIY 2ZETA 2WVAA 3V1TC 4AJPA 3H2HA 3QVSA 3STHA 3LS2A 4RW0A 4Q1EA 2VK2A 3UM9A 3JQAA 3IHWA 5M5BA 1S9DA 1N6PA 2EP7A 1EVKA 4AJNA 4MAFA 4QAQA 3QEJA 4NDAA 3FIUA 3PKIA 2BRUA 3VJLA 5IVHA 2FLKA 1P5RA 2QPOA 3SYMA 1EDOA 3AVTA 2Z6UA 3KVNA 3U3XA 3GYGA 2XRYA 2B1GA 3PXDA 3BIOA 1VIYA 3KYBA 1G64A 3F6CA 4R8KA 3H5NA 3PNMA 4J94A 3VPFA 4I19A 3ZQJA 3AM5A 3G0GA 3KQHA 2Z5VA 4FKBA 4K6HA 1QUFA 4OJYA 4B46A 4F56A 5KTSA 5C7LO 3V2GA 4DFDA 2B34A 1MGOA 4EW2A 5HZKA 3NAMA 3HKCB 1FSPA 3ZWCA 1FXUA 5C81A 3JALA 4G36A 3GUYA 1HL7A 4KYIB 4PPGA 1U9IC 2LXNA 4DMHA 5K8UA 1F38A 4V38A 5L4SA 1XMQB 3MJVA 2FUKA 2XUDA 5IULC 5AP9A 4DDMA 5EWLA 1KSFX 5FL7D 5EXXA 5JLJA 1COWA 1V2GA 4XYMA 2QLMA 4Z4FA 1WTAA 2P11A 1YL7A 5IZCA 3RT1A 5K5EA 2IP2A 2WD8A 2EZ4A 2C7GA 1A8PA 4G1VA 4EGAA 1U8EA 5F78A 1FDIA 3O4JA 4MV9A 2FFHA 1QYDA 1DJLA 4L4RA 1XQ1A 4QE3A 4MUIA 2BJVA 4P08A 2ZQZA 2FPRA 3EUWA 4HWKA 5EWMA 3P9CA 2P2CA 4U02A 1PWYE 1O95A 3AYXB 3JQBA 1MDFA 1U8FO 2D00A 2WM2A 3GARA 1Z3IX 3P8ZA 4UU0A 4BMDA 4BAUA 2JIQA 5CYGA 2GJ4A 4CLXA 4ZALA 4C3UA 3M33A 3I30X 1QLWA 4KE9A 3GLGE 2PUFA 3O38A 3EUFA 3RT9A 5BSVA 5DCUA 5F3DA 1GZ7A 1BWRA 2QMZA 3ACBA 5IT0A 4P53A 2IHZA 5DGCA 4DOMA 2R2GA 4RY2A 3T4PA 3OIFA 4I2VA 3H5AA 1T4CA 1ZUNA 3TM4A 3GPDG 2PMBA 2VJCA 3UQZA 1FFGA 2P2YA 3TLKA 3VR3A 3V2IA 4ALLA 2YWHA 3TXAA 3DO6A 3LY7A 1BOFA 1SCJA 4KAXA 2OBYA 4M0UA 1A4UA 4JJZA 1PJBA 3LAWA 2IBTA 1JR3D 1VKNA 2WD7A 2N47A 2GARA 1AHHA 1GU7A 3PKZA 3RS2A 2N46A 4ZJUA 1F0PA 3ZD7A 4RA6A 2ZJFA 1XB2A 1ZK3A 3T3IA 2GCGA 3RFXA 4W99A 4ZDJA 1SZJG 1YUNA 2G0NA 3W9SA 1QK3A 3MGKA 3T0FA 4B7UA 1XZHA 3SBXA 1DI0A 5HCNA 1ESZA 4J8PA 5KTTA 1ZCJA 5LZ9A 2MT9A 3T3MB 3OETA 3UB4A 3LOQA 3AFMA 3RWOA 3W5BA 1WBDA 3PXBA 3L8EA 1TM1E 2WUFA 3TRHA 3W4IA 2QGNA 2ZJ7A 4KBGA 5DBEX 4V0QA 3OFKA 1JN0A 4NENB 2W0SA 3WS7A 5H5JA 5FUVA 1JI3A 5IDWA 4LYAA 4PQEA 2C2MA 1BKDR 4WK2B 2EX4A 1ZM2A 2BDUA 3F71A 3H04A 4ZD6A 3H0KA 5LMNB 2HI0A 3Q7SA 1QHSA 2ZLBA 4C4RA 3I0ZA 3WP1B 1QFZA 2LTAA 3M5PA 5EQDA 1SOUA 2J3QA 4DV5B 3NT4A 3X3HA 4N4AA 1AC5A 4J4BA 1UXJA 3U9SA 4LBWA 1S2GA 4NZOA 4WAUA 3RHTA 1VB5A 4D6PA 3QEAZ 4WJKB 4L2IA 3HR8A 3AHDA 4Z86A 5HKLA 4KREA 4TS9A 1C41A 5TGZA 1ZL2A 4PXYA 1IQ0A 1QH0A 1TKAA 2GN0A 2QTRA 4HS9A 3DR3A 4UBMA 2XGOA 3GWZA 3L6CA 4M8NE 2XKJE 4NONA 3GNQA 5H9VA 1MB4A 1HDRA 1NM5C 1I2CA 1J8MF 3Q5GA 2BFBA 2R2AA 3D0KA 2AN9A 4K2HA 4KR6A 1SPBS 2E4XA 4UXJA 3GMSA 1SKYB 4Y2YA 1Z63A 1QDUA 5HQ3B 5EZ5A 5JWOA 5CFLA 2V65A 1ZCFA 1W4BA 2ZU0C 1WSAA 3DBHA 3N8DA 4J7XA 5KNCD 4XLTA 4E30A 1ABBA 3CUSA 3ZHCA 3GEIA 2A67A 2CNNA 4UCQA 3HYCA 3SC4A 4HQLA 3KE9A 4KO4S 3LHDA 3NQ41 1QVRA 4G1EB 1G17A 1Z0AA 3RSGA 2G71A 4ZDKA 4BGIA 1EJBA 2ERCA 3KETA 4BO5A 3FLBA 1QZXA 3HQ4O 4ZVLA 2GD1O 5B36A 1Z5VA 3DE3X 2ZUSA 3GF4A 4ESOA 2OBFA 3EA0A 1ISJA 3N8IA 5TMDA 1R5BA 4QSMA 5DBGA 4L07A 4DLSA 1BCSA 4JKIA 3TLXA 5HXAA 4LMAA 2VXCA 2QX7A 4S12A 5KPJA 1EDZA 3EDOA 4R1TA 1BCRB 4KO3S 3QWIA 2RIRA 3Q9SA 1RQLA 4K9PA 4Z4QA 1T9BA 4WT7A 3ZJUA 3S2UA 5KYWB 3FTDA 1CRQA 5FLYA 1J7KA 1T2UA 4NMWA 3AM3A 1USWA 1XROA 2WJ4A 2ZRBA 4KJXA 4TT3A 2P79A 5HNKA 3B9RA 5TB5A 5F2NA 3V1YA 2ZAIA 5CTAA 2QS9A 3VO9A 2GA9A 1NBHA 3PNLA 1EZ4A 1MA0A 3R5SA 4QHYA 4YALA 3VO1A 5EKUA 4YR9A 4YJ2A 3H5RA 1T6NA 4R2LA 2ACWA 3U3ZA 1FNMA 3SXUB 2OQRA 3B70A 4YACA 1BE0A 3CUTA 3FRHA 4RPJA 4B6QA 1RXSA 4ESEA 4N3GA 1VCMA 4C43A 3C3MA 2F1RA 1F20A 3LZCA 4HNHA 3IQXA 3CIFA 3RT7A 1ESNA 2JI9A 3UYLA 5HM8A 4NBRA 1PLJA 2HIGA 4AF7A 4UNPA 3M3DA 3T1QA 3PWZA 1D9ZA 1CQJB 2I7TA 3RTAA 1M67A 1FB5A 2GWRA 5LQSA 4NF2A 1G6Q1 1KI6B 2G8NA 1AY0A 1ESCA 2XT6A 2HHCA 4RPHA 4S0ZA 2QM8A 4D46A 1GQQA 2ISSD 3JVIA 1P1BA 3HO8A 3QJ5A 1E6LA 4TQAA 5D3ZA 3H5WA 2AZMA 2R79A 3WGZA 3BE5A 4MQ5A 5AHWA 3ND6A 4HLNA 1GXSA 2DHCA 2ZBEA 3WVNA 1KY2A 3HDTA 2QW1A 1GKYA 1NF3A 3LQYA 2ZGVA 4PPQA 3FH0A 3LNCA 3BPSA 1FRFS 4M49A 3ZX4A 4BKUA 4WK4B 4DBLC 1UDCA 1Y89A 1KMQA 2ZYSA 3A6GA 4XIFA 3VAAA 4R7GA 3UGKA 4A6XA 1ODCA 4PC7A 3QVTA 4GQAA 5DX0A 721PA 1KRWA 4CIBA 1XTQA 1NU6A 2QTWB 5EJ6A 2X0EA 4BJ5A 4IHKA 2CXSA 2D1YA 1LLDA 3X2SA 5ESWA 2OOKA 821PA 3GH3A 4CDGA 1I3CA 1Z37A 1N1EA 4S1WA 3SYKA 3EE6A 3HKDB 2W71A 3FPLA 4OAQA 2UYHA 621PA 3TX6A 4Z4GA 1MJFA 2VXYA 2CDNA 2H6EA 3ESQA 4HNRA 1WHTB 1NXXA 3AI7A 3DYBA 4P4TA 5U4XA 4AIRA 3RYIA 1G5FA 5AUOB 1SUCA 4DWOA 3ESRA 1OMOA 1C7QA 1C5KA 2W9XA 3VTZA 2SKCA 1RPZA 4U2DA 1K4MA 2AUTA 4FLEA 4EK9A 4G8CA 4EYKA 4LRYA 4TZ0A 3HADA 5KNBH 3QZUA 2B4YA 3AHCA 3OKCA 4B75A 2HADA 3MPOA 1G20B 4AJIA 5E95A 1KHHA 1MOQA 1TO6A 5FQNA 4Q4JB 2WTXA 1WDKA 4HRYA 1LBQA 4IF4A 3WLEA 4KYVA 4KVZA 4L27A 1QCYA 2IE0A 2VJDA 1Z7WA 2H92A 3FYHA 2TSYB 1QHHA 5DI9A 1UPTA 4J91A 3W06A 3O75A 5KYXB 4R1UA 2Y2UA 4ND7A 4UHKA 3NNNA 5TPWB 1J06A 1AQYA 1I94B 3PEVA 1ZJ6A 1Y8RB 1M6WA 1Y8QB 3CZCA 3WHKA 3KYDB 3ULKA 5KOHB 1E8MA 2BTQA 4IP0A 1NVAA 3ST7A 6REQB 5C53B 5CLHA 1G2IA 1OWMA 1GRNA 4MCIA 1DHRA 3DHNA 2W6ID 1VPEA 4A1FA 4D45A 2F4NA 5LD2C 3RS0A 4I9GA 2QU7A 3NV9A 3N7TA 2VJMB 1YFLA 2B83A 3RHZA 2I2FA 1U7OA 2ZJOA 4FDLA 1OYWA 4HDQB 4N82A 1Y42X 1WMEA 1A2BA 1H65A 4PE5B 3AC0A 4PIPA 1C3EA 4M83A 1VC2A 4R8VA 1XMIA 1W8IA 2IXFA 3SJBA 2WIFA 5D1HA 4L6IA 3HYSA 2W48A 2BZSA 3GJ6A 1UMBA 5GV8A 3A58B 4DWJA 1E3WA 3MS7A 2FWBA 3IDFA 1GAQA 2QUKA 3CNQS 5AJWA 3ONFA 3E18A 3ITEA 4NCIA 1CRWG 3KOMA 1AF4A 3GGOA 5DN9A 1YB4A 5KNBA 1G66A 1CY8A 2BF7A 2PSDA 2PZLA 4CM9D 1WBBA 1J1ZA 1SPXA 4TMXA 4ZI2A 5FTJA 5GTDA 1C4OA 2GN9A 2YWDA 5JZSA 2O8FA 2QAGA 4F1JA 4XWWA 3IJRA 3FFWA 4PZYA 1G5RA 1QCZA 2QNIA 3KB6A 3V6LA 4E2ZA 2D5LA 3KQTA 2ZS7A 3DWIA 2Z2YA 2J87A 4R3UC 3UJCA 3PENA 2WHXA 4DLVA 2JI7A 3F6PA 3FNFA 4K88A 1OTYA 5BMVF 2ZIEA 5KYYA 3FLAA 2YIMA 1QE0A 2N3ZA 1R0XA 2Z8ZA 1XJQA 3R0JA 3BIWA 4GSYA 5ALUA 2D2EA 3OIGA 4EYQA 4KXNA 5D1NA 3LECA 4GX5A 2CSXA 2ZJYA 3TR6A 1E0AA 3I4CA 5A3RA 2QP3A 2CNBA 3IQHX 5JXJA 1FW6A 1T3ZA 1XLTA 2W6IA 4AY6A 3TLZA 1TI7A 2M9MA 3HSKA 3QH4A 2E37A 2QX9A 3UC5A 4B4UA 4F46A 5L4LA 1N32B 1IXSB 1ZH4A 5K0GA 3ORQA 4L9RA 1EXDA 4DCPA 1W5TA 1XU9A 2PQ2A 3HRKA 2Q3CA 5DRYA 3RW9A 4K6GA 4YH1A 3GJ4A 8MHTA 4QGGA 3JARA 3R40A 5ALPA 1IVSA 5EHNA 4Z7JA 1QJCA 3AR6A 4PTZA 3WJ7A 4PQRA 2DB3A 4ESVA 1CZNA 4M54A 5JATA 4LDRA 4O02B 2IFTA 1Y63A 3KTDA 2QDKA 4AL4A 1AKVA 4FD3A 4F84A 1SQFA 4NXMB 2QTLA 3G02A 2WYUA 5F9MA 3FNBA 3GCGA 1KGSA 2YDYA 5J4VA 4A26A 2HUPA 1P31A 1YZ3A 3FKSD 5EMNA 3B2QA 4B3SB 1EG7A 3VNAA 4B9EA 1IB0A 3TOCA 4N9WA 3EIWA 2A4MA 2B2XA 3C4JA 3LO5A 2YV3A 1AD2A 2YXLA 1BRMA 4UULA 4Y9TA 3BFJA 1D0SA 2V7WA 2AV6A 4FS3A 4I5IA 1B1CA 2AI1A 3JYNA 2COKA 5CPBA 5J47A 1BAPA 4G84A 3PL1A 4JLUA 3RO7A 4C4XA 1P8AA 2DM6A 1G1AA 2P91A 5JCJA 1WY7A 1OWLA 4R2JA 3R20A 1O57A 1HLDA 1L9XA 1CBUA 1YQGA 4FSXA 4GLOA 4KPUA 1N2JA 2RGAA 2AG0A 2HO5A 2HA7A 2VQDA 1FXWA 4Q82A 1UK7A 3UHAA 2QN8A 1SIWA 2C2XA 2ZS8A 3SIRA 3GJ8A 3KJZA 3NBMA 2JAXA 1T91A 4DPKA 1LD3A 2HH9A 3MJTA 4MP8A 3WLLA 3QE9Y 3NDBB 5BN3A 1G7CA 4MDFA 4II2A 3HFGA 1NQOA 4NBSA 3ESZA 1OZHA 2XUKA 2YNMA 4EIWA 4IIEA 3NTOA 1T5OA 2Z04A 4PNHA 5CDSA 2CLOB 3ZBUA 2D13A 4IICA 2C1EA 2ZAGA 4MNTA 4ZAYA 2GNOA 3R6WA 3TCNA 3WRVA 4FB5A 4RVGA 3PCRB 2EWMA 4EL0A 1W29A 1GU1A 3IMFA 4OM7A 4D0NA 3M6UA 3ND9A 5AXBA 2I8LA 4YMTA 4PINA 1EVYA 4WZ6A 4B2YA 2OFWA 1D1SA 3RYCA 1HBJA 1CZLA 4HEA1 4EQ6A 1T8SA 5P21A 4DV4B 4O33A 2DQYA 1NQVA 2REOA 2R84A 3T5GA 2YMPA 3PPYA 2AC7A 2SNIE 5JS7A 1JFVA 5P8WA 1O6GA 4NG5A 1P0MA 2B4QA 3TN7A 4OAPA 5AW1A 5D7NA 2B36A 5KB3A 1LX7A 5GZ6A 4IY1A 4XGIA 2FN8A 2YJTD 4E5SA 4Q66C 3GFGA 4ZAZA 1NJGA 1JHDA 4NQZA 2ACVA 2VYNA 3K6JA 3RAJA 3RAFC 1LZKA 1DIBA 3DDNA 3MXTA 3OTQA 3H18A 5K6AA 2HT1A 1OFUX 3C8ZA 3ZXUB 1Z6PA 5LZ4A 3EQ8A 3B82A 1FPQA 1PR3A 4ZJYA 3RJTA 5JCXA 4O6VA 3AHGA 4YMHA 1TLFA 1PSWA 2NVWA 1UAYA 4AYTA 4PONA 5CB4A 3Q3EA 3CZ4A 4RTSA 3BWBA 2QN1A 2HJVA 4ZPXA 3GJ3A 3PVZA 5CW2A 4WX2B 1AKTA 1Q0QA 4X64B 5BR8B 3D7MA 4RGYA 3UV6A 3CVWA 3DLBA 2W43A 2FZ5A 3DG9A 4C07A 1KK1A 3FWYA 4OXIA 5DCLA 1PV1A 2HPVA 1IZ0A 1OX5A 1PF7E 1WD7A 4CYMA 2G1JA 1JTFA 2FEAA 3MWDA 4LDQA 1FFWA 2CCGA 4H6WA 3EFEA 3LQFA 1RRKA 3G9TA 3ZK9A 4BUCA 1FLNA 1GILA 2EW1A 3VDRA 4Z3KA 3HM2A 3ROPA 4EGSA 5A2GA 4C30A 1OREA 1JECA 3OZXA 3EC1A 3HC7A 1YASA 1WLSA 3PITA 2QSZA 3TNYA 3PBKA 2RARA 1WCYA 4B3RB 4UE2A 3KKZA 4LYGA 5EKTA 5HR5A 3AO0B 1FJ2A 5FB3A 2P5TB 2BGMA 2L2QA 3JAKB 4NBTA 4N03A 1JQAA 1X70A 5KX5A 2GXAA 3AP3A 4XDHA 3LO8A 3DPIA 3V48A 5C8VA 5HZMA 1COZA 1RZVA 5THXA 3T7TA 5HZGA 5IPFA 1KAGA 1DELA 3K5PA 5CK5A 1RBQA 2DFKB 3EOAI 4AP6A 3H42B 4Z8YA 2IKQA 4V0RA 5LP6F 3O5AA 1C1DB 2FCRA 2R00C 4PIMA 3UJHA 5ALJA 2PT5A 3KHTA 2VHZA 4GPEA 4L7VA 1OHHD 3T3PB 2CJFA 3NUGA 1MRSA 2XGMA 1PTJC 4WOBA 2HC9A 4DARA 4MK4A 2QSYA 3S81A 3PD7A 1HYQA 4U7TB 4N3CA 4A8JC 1U3FA 4BMOB 3DEKA 4DV2B 2EU8A 4EG4A 4HRVA 3K0AB 4HQKA 4YMLA 5DN6A 3T9AA 3LYUA 4MKXA 4ZT6A 2QNBA 1D2RA 5JRZA 4MIOA 2XA2A 2FLVA 3R3WA 2QA5A 3L6EA 1V39A 1NRXA 4MP6A 2P75A 4AM8A 4YJDA 4C14A 1GARA 3ZVLA 1CRPA 5KMGA 2CDRA 1MT0A 3WL8A 4FEGA 4V0ME 2YZMA 1J8YF 1SQ5A 3HABA 3JVVA 3R5KA 3VR1A 4Y1GA 4URXR 5E6UB 4DRYA 1M5UA 4P86A 2CLIB 3K2BA 5H0IA 5SICE 2CW5A 4FHCA 1EK5A 4Y2RA 4ZREA 4ZYUA 3CTPA 1F4PA 3HP4A 1DJNA 2Q5JA 4EMBA 2Q5LA 1VJGA 3L7LA 4NYJR 4CF5A 1D5WA 5HSGA 1UOPA 2R751 3O73A 1F5NA 2NSDA 4FC6A 2EKLA 3BXPA 2NPIA 2V5VA 1QG2A 1BFKA 4KFUA 1H2YA 4CDNA 1YDFA 3KLOA 5KC9A 2JVIA 2HRRA 4QDTA 4RVDA 3IUNA 3X1ZA 2F3TA 1I3NA 4G8DA 2YJZA 3HVJA 4AW9A 1K3UB 2WKRA 2F7SA 4OHRA 3PPXA 1EFLA 4QKQA 1VXOA 3OC0A 4UPVA 1N34B 1Z9BA 4BVAA 4LSMA 1JPJA 1T2VA 2YZKA 4KR0A 3PZBA 2E5WA 1HNNA 2FPWA 4FR5A 2WTMA 2B5WA 3GQBA 4YJ3B 3SIWA 3PB3A 3WWEA 1JKIA 1LDNA 2W2NA 4B8WA 3N6XA 4C7BA 4F3TA 4D4HA 4MRSA 3W5HA 3BJZA 3ME5A 1JF8A 1PR6A 4I1OA 3OZ7A 2CE7A 3E5MA 3G2OA 2PLFA 3JQ6A 3N2YA 2NUTB 4LBVA 4MYUA 5DXJA 4YWHA 5AVWA 1BD4A 1JSCA 1O95D 5GOZA 3OJWA 3ESDA 3R9KA 1QH1B 1AZWA 2NSLA 3DMRA 3P0JA 4JNKA 5ILOA 2VF7A 1PT5A 1SUFA 2YC4C 4R1PA 1AQ6A 1Z34A 1X7GA 3DL0A 3FPJA 1W59A 1TM4E 3RAGA 1Y5RA 3FYUA 3DZCA 3MGCA 4S1NA 2CKDA 2YJ4A 4A8JA 1YFZA 1RPNA 1IXKA 5HKAA 1RWKA 1JHVA 2XOKD 3D6HA 3IAAA 4TWRA 2VQFB 1Q0LA 4CV0A 5CFNA 5AM0A 5D85A 2FEOA 3COZA 3EQ9A 3TLYA 3AX6A 2YIDA 3WK9A 4ZOAA 2VOEA 4MWEA 5BO5A 2F1IA 1G42A 5EE0A 1IONA 1V3TA 3QVWA 3CLTD 4HFRA 1XWIA 2J6IA 1J5PA 1PO7A 3WMWA 4AXXA 3DR5A 2WWWA 5L3SB 4CXMA 1RPTA 2IIBA 1W75A 3EMDA 2NZ2A 2RAVA 1DARA 2YY6A 3ZR4B 4QNNA 1F12A 1R8YA 1RYEA 3F5MA 5DYTA 3PJRA 2GTHA 1EI9A 4YCMA 3QYAA 4P92A 5NLLA 4NMHA 5BOSA 2AL7A 1DJMA 4NEGA 1X1CA 2LIPA 3ENKA 5IK2D 2YWBA 4Y2PA 5K0SA 3JRXA 1FDOA 2IYNA 3SAJA 2DFDA 4XGKA 3X1MA 1EVIA 1L4MA 3ONDA 2IELA 2FPIA 2ONZA 4UZEA 3KALA 3MT0A 2ADMA 4UMDA 1Z4PX 1JFFB 2ZB7A 3C6QA 3IEMA 1L1QA 4WFIA 3QXXA 4E4TA 4F5EA 4CEHA 1OAOC 4TLEA 2GEJA 1QV6A 1SEPA 2H4XA 4JLWA 1M3SA 5DM1A 3Q6IA 3BMCA 2AVNA 4IQFA 3VDXA 3FPBA 1O0CA 1E69A 4TTQA 4ILKA 3G17A 3NKLA 3KDPA 1OV6A 1H5QA 2C9MA 3RRMA 3ELBA 1M2WA 3HKEA 3VKUA 3WLHA 3Q88A 2V3CC 3G5UA 1X14A 3LMKA 1S4QA 3EOZA 3JQ8B 4GLBA 4CKXA 4D3FA 4E46A 2FEMA 3H65A 3KQKA 5TS3A 3JWPA 1XDZA 5FPSA 1NA5A 3D1LA 2O7RA 1GT6A 5BVHA 3W5SA 2BSAA 3KL2A 3MCWA 2ZJBA 4JENA 1G21B 2GN4A 1IXYA 5IYZB 2AOVA 1GY8A 2ZIZA 3A3OA 2R8ZA 1U0GA 1I5OA 3PYXA 3PEUA 4MS1A 2ZAYA 4LZPA 3RRBA 4B6OA 4EEKA 3WWDA 4BVBA 3CBGA 1PZGA 1JIQA 2PV0A 4BO4A 2CWDA 4G0MA 4D4MA 3LQ2A 3QXJA 1T2CA 3GLHB 3PHCA 4JJ8A 4BNZA 2YV5A 1SKBA 2QGFA 2I4IA 3TW8B 1YMUA 2I7CA 3TS1A 4C29A 3QEOA 4NEQA 2B0JA 3AERA 4C08A 3K1ZA 1NBME 3PUYA 5E3IA 5EGSA 3FUCA 1GFWA 3EQ7A 4BLQA 4EKIA 4BNDB 5C8YA 3FJOA 4OQXA 4S04A 1C0IA 2HQRA 2JB9A 3NYIA 3PC4A 3LVFO 4HWTA 4OJMX 3ICWA 2O2XA 4H4CA 1Y4AE 4P83A 4Q93A 4XRRA 5ECDA 1TAQA 3LGXA 1GD1O 2CDBA 1RAEA 4DQUA 2DERA 3HCFA 1B4DA 3AESB 3WMRA 3K0BA 4E09A 4DV3B 2HW8A 2BR3A 1O3YA 4DLRA 2CL6X 2JKYA 4AF6A 5JXWA 2P9HA 3ROQA 1KY5A 2GF9A 2CFSA 4GZLA 4UBNA 1E96A 4NE9A 1VBNA 1R74A 3TJMA 1WZIA 2VRCA 1WHTA 3ID6C 2WAAA 3ASYA 4G9BA 1EM8B 1OGJA 3PXGA 1A50B 5B58T 2QY6A 4M98A 3IAXA 4JQCA 4PW0A 4R2XA 1Q6YA 1T3LA 4RH3A 5FHQA 3COWA 1LXCA 3C7CB 4AJ4A 3USES 4AS2A 2PSFA 3AUFA 4RKRA 3W5JA 3FROA 5FOXA 2WHPB 2ECOA 2FG5A 1JKFA 3L4SO 4DC0A 5JOQA 4E3WA 1A69A 1JS1X 3D3KA 5A1JA 3ZXIA 4RIFA 1LPMA 2JKZA 4ZEXA 2SECE 3R8CA 2ZBUA 3BXGA 1YHZA 4G5OA 2I8CA 4HHEA 2OCKA 5ALIA 2FW9A 3J7AC 4BNWA 2W2TA 1RAHA 1ADYA 3CR3C 3KBOA 2PIDA 1MUUA 1YCFA 3G5AA 1GGMA 4QYXA 4KCGA 4CQNA 3RGWS 4DLUA 4A0FA 4ABYA 4KFSA 5KUTA 3EW9A 5AUNB 2PWZA 4PHFA 3F9IA 3CVUA 2HQ1A 4KR9A 4AUNA 4WN9A 1RXCA 1ZYUA 1E1RD 3ND5A 4GM1A 1M9NA 4FMPA 3AEUA 2IITA 3FYSA 3PPIA 4RD6A 5FNVA 5KKAA 4KPYA 4E03A 3LX6A 3W90A 4XWKA 1W0CA 1P5HA 2QG9A 1DKRA 1JAZA 1HTWA 3SJ7A 3AG5A 4IXDA 2ILTA 2IZ0A 4D6XA 4JJ6A 2YX1A 4WNIA 3ZV5A 4MHOA 2RMKA 1G20A 3P2JA 3QOWA 4YROA 3NKFA 3CO0S 2B3TA 3HGQA 1ZIXA 5FNZA 3CY6A 4Z7NB 4DILA 5IJAA 3KYCB 4JI5B 2QR5A 3R0QA 3RNLA 3FOZA 4I9HA 4YI5A 3DMTC 4LMRA 5EIBC 3T5CA 1K6EA 3CUYA 1E2QA 3P4XA 2ZM5A 3HLYA 3R2JA 5ALGA 1VHWA 2C3PA 3N2ZB 4FFDA 4B85A 1HLGA 3DTVA 1C0EA 4TUYB 5HJ5A 3W1WA 2A58A 3MJFA 2GEFA 5B7NA 2NXCA 2FWNA 4Q4LA 4ZZ2A 4I2NA 2D3TA 1A8SA 9LDTA 5F5XA 2YVKA 5SYAA 4ZTZB 2A0WA 5FWYB 2VS1A 4EJ0A 5HCUA 4CLOA 3SVTA 1V5GA 2QZZA 3ZIUA 4BO6A 3V42A 5B4VA 4OXYA 1U8ZA 3BA1A 4CETA 3ZGZA 2ZATA 4B0OA 2GM5A 1C30A 1QK5A 2WKQA 4RKQA 3R7WB 1EWQA 3AVWA 5JR3A 4L28A 1E3WB 2GPBA 4QNRA 4XDGA 2RGGA 3A70A 1GITA 3W9UA 1NOJA 4I08A 2XD9A 3E58A 4OOEA 3RUDA 1X1RA 3RYHB 4BE4A 1ISGA 2O8CA 3IMKA 1M8PA 4JYCA 1UQUA 2QJOA 4FEAA 3ZQ6A 1JEJA 2FJ0A 1U0EA 4ZOCA 2NYUA 3ZTWA 2OMEA 1OYYA 1L2TA 2WZCA 2VXBA 1RU3A 4QOFA 1KO4A 3ZE0B 5BWOA 4K9QA 4TYWA 1B2LA 4ND6A 3FAKA 3G9UA 1QHNA 3QG1A 4D9CA 1TYZA 3V8EA 1H2EA 3DLAA 5AVYA 1ZUHA 1W1WA 2ZSIA 1JLRA 3LP6A 4S0XA 1EESA 2TMGA 3WLNA 4BFZA 4RAOA 1ONPA 1OLXA 4LHSA 1Y8CA 3L02A 2JBHA 3AOEA 1Z0SA 2G0TA 4IX9A 2RG1A 4KAFA 4O4HB 1EFPB 2VSOA 2OBLA 5LSAA 1NP7A 1AA9A 3OIYA 1TJ3A 1SNYA 3DCNA 4CFSA 4WBXC 4TQUS 1KFJB 2PWBA 2PUBA 4CEJA 1Z28A 1H3NA 1C9YA 1RQGA 2NVOA 2FE4A 4M9QA 1UANA 3FB1A 1EUCB 3HP1A 3NP9A 1T3HA 3BB1A 3NOOA 5CLLA 4YV1A 1Z8DA 1Z4JA 2FZLA 3T8YA 3VHXB 4NESA 1NMEA 2G04A 3CH7A 4NJMB 1GVNB 4R5HA 4PLVA 3U7RA 1XP5A 2X6TA 3G3EA 3H2IA 1PGJA 3GJ5A 3HCWA 4K0RA 3U4DA 3ZHVA 3C1OA 3DEFA 4E1AA 4FKZA 4TTSA 3H2YA 3HMKA 3TTXA 4FGKA 4U39A 1TZCA 2R8PA 3KU1A 3K9FC 1E2MA 3KOZA 2ZIAA 3V4LA 1V11B 1M2GA 3SBOA 2YR0A 2XECA 4FEEA 1WUTA 2PMFA 2FX3A 1LFAA 3PFIA 4RA6B 4C01A 2JKVA 1EFHA 1ZK0A 4HG2A 2OGSA 4GG1A 5CFPA 4LFAB 4EJFA 4MYDA 1QONA 3WB1A 3HJNA 3V1LA 2IXEA 4AKTA 4PC1A 4MVJM 2VHCA 4RHFA 1NF2A 1DAFA 2XT9A 1W7AA 3CRZA 1H1LB 2PRYA 1E32A 4LIPD 1IBSA 4UHBA 3OC6A 3TTWA 4C0AC 2J5QA 2DJ5A 1Y6GA 1K5GA 2AE2A 1ZRNA 3WIBA 4XZ3A 4U9IS 5LQKA 4XWYA 2OLKA 2JIRA 4ZQEA 2HQOA 5KINB 1Z5OA 4O8ZA 3K0EA 3RTBA 3CKKA 2RSLA 2H4HA 4EFDA 4ZRMA 3VVBA 5A62A 2HBQA 4G5SA 1ZD9A 3AIMA 2R00A 3AWDA 3I2IA 3AKDA 3THRA 2J08A 3RADC 1GUZA 1HX7A 3QBEA 3MTAA 4HT3B 3DTTA 4ZYYA 1TEHA 3PNQA 1DAKA 1EBBA 1MQ9A 1E6CA 3G9ZA 3KYCA 4FGJA 4A5OA 3RKRA 4LC1A 2YCLA 3SIXA 1QLHA 5CDYA 1RRVA 3U61B 3EYAA 5E0OA 3WTCA 5J3JA 1Q95A 3BBPA 2IT1A 3SOZA 3T1TA 1QUEA 3O8QB 3OZFA 3VNUA 4DLZA 1U0JA 1M75A 3NC4A 3LCUA 4YUVA 5DHFA 1XRPA 4MRVA 3DMTA 3BJIC 2NGRA 2FVYA 2RIPA 3BKWA 2FOXA 4X44A 4Y0NA 1CP3A 5JASA 3FTFA 3H1GA 2ILVA 5ECGC 2GX6A 4DCSA 4FM9A 3QY9A 4CMEC 1E1MA 2ZRFA 1Z39A 5DMHA 1SB8A 1L5QA 4IIJB 1X13A 4RV4A 4JNCA 2PCJA 4RXTA 4BFWA 3AF5A 1GZUA 1P9OA 4FK8A 3QU4A 1B8PA 3T1HB 3LV8A 3IUJA 4XPZA 2Q6TA 2J0EA 3RB8A 1IHOA 3T7CA 5DNDA 2AWNA 3C7DB 5IW8A 1W88A 2H3HA 1BU5A 2B1JA 1SUSA 2QN2A 2ZB3A 3CH6A 3EFOB 1P4GA 4LSZA 3SY8A 4ECEA 1NMYA 4L5BA 4BP1A 2AK2A 3HSYA 4L08A 4M2LA 2VSYA 3IA2A 3RJMA 3NWBA 4RTMA 1E58A 4EB6A 2WZBA 2VF8A 4QUDA 3CT6A 3IS3A 4ZGWA 3BM5A 4ZHQA 2Q1WA 4UARA 1XRSB 4JKYA 5BMOA 1TUIA 2YQZA 1U3CA 3JVDA 4GBGA 3Q3JB 1V7PC 4M1MA 3M70A 3EZFA 1UAAA 5FEUA 1S2MA 3L06A 5IVPA 4LJLA 3I2KA 2IODA 3JASB 3BD6A 3U3JA 3VPXA 3I34X 4Y1RB 4Y9SA 1QAQA 3MGAA 3P7MA 3LX5A 3CV3A 5FP0A 2BOVA 4CBVA 4YEDA 4P6VF 5K7SA 2R8XA 5A06A 1XA3A 3SZGA 5DP1A 1W93A 1J24A 3UN1A 1R4NA 1U2DA 4ITRC 2UDPA 3TSAA 3ZU6A 2HMTA 3SF8A 1SK8A 5BRJA 4UW9A 3V1KA 1II8B 3WLKX 4KGDA 3UA3A 3FRJA 5C7OO 3UPUA 3HXQA 4X1KA 3VZBA 1M7BA 1U7TA 4ID3A 2D8AA 4ZQFA 3LKDA 1YE5A 1Y4ZA 3ZJ5A 4MLCA 3HK2A 1DRVA 3GLIB 1AM4D 3U2QA 2E0IA 1KI9A 2WOOA 4AJHA 3FCEA 1C3XA 1E3IA 4E5DA 5EA2A 3VI4B 2B4AA 3SHVA 5FT9A 2O2GA 2VJNA 4TRRA 3VYVA 1GTL1 1W5SA 4QG3A 5KYTA 2Q4RA 2Z0MA 2EW2A 3FUUA 4JU8A 4QGSA 3U5ZB 4NYMQ 3L7IA 2FXVA 3NHSA 5LN1A 3GJRA 1OWNA 2MYPA 4YX9A 4PPFA 2EFJA 1MR3F 3S6JA 4IGFA 1T15A 2CVPA 2ECPA 3ICEA 1XZBA 1GZ4A 2ZRKA 2WWRA 1NULA 1RNLA 3BILA 3K72B 4MP3A 4V2IA 1PU2A 4YQZA 2YXBA 4HPJB 3CF4A 4LI0A 1RM4A 4G0QA 4HRAA 1ORTA 3IVGA 3NXKA 2VUHB 4POOA 1Y6QA 4LOIA 4QBHA 4YRGA 4F04A 5BW8A 3TYXA 1YK1A 1XAIA 2FSVC 2NAPA 1ZI6A 2XUIA 2DXIA 2H1IA 3RF6A 2A6PA 3ZV4A 3EVCA 3WQRA 2EWVA 3CO5A 3D8UA 4I3HA 2A9RA 2A8YA 3G5MA 4D9IA 4TV8A 4JYZA 1G4UR 2V54A 2W6PA 4MV6A 1H4TA 2BFCA 2HIAA 4GPAA 3I12A 1U3DA 3FSRA 5AI9A 4N5LA 2XRMA 3AETA 3KQQA 4PICA 3PFWO 3RFUA 3UAWA 4ZVPA 4EHHA 4CIAA 1ORHA 1ODFA 3Q2KA 4G41A 2GCPA 3QEMB 3ICCA 2DQSA 4N49A 4BKMA 4FYPA 1OT3A 2PX8A 4D98A 5E8RA 1GSOA 2VPPA 4UEOA 4F0JA 5JJIA 1L5HA 2AXPA 2G06A 4WKPA 2C57A 3WKBA 3LL4A 3MB8A 4TYYA 3QE0A 4PLGA 1KZ9A 3U3MA 2GZDA 1JMVA 5KTMA 4HQFA 4FN5A 3PTLA 3W6PA 1BN7A 3UW3A 4MTCA 1LS6A 4MI6A 5EPUA 3TW4A 2FW0A 2H1VA 4KQXA 3DB2A 1ANKA 3ELYA 3F5SA 4UJ3A 4KXMA 4BNKA 1T4GA 1XJ5A 3JQDA 3CRVA 3EVNA 4CGYA 5JSQA 3P20A 2H18A 2VTBA 1ULZA 4BQNA 4QQRA 1I51A 3W78A 2KJQA 3D2LA 3C14C 2BKXA 2FPUA 4U8GA 2E5LB 1DJPA 1FE8A 4ND3A 3UVEA 3TE6A 1AURA 1I0IA 5B57C 4GO1A 2IEIA 5D3MA 3T9CA 4YIHA 2C2BA 3G7UA 4EO7A 1RADA 1HXHA 3WNDA 1M2HA 2UUOA 4O2LA 4WNCA 4I4LA 3ZWNA 3FY4A 1JNXX 2IXTA 4HLDA 4OQMA 3C6ZA 1VG8A 5A02A 3HJBA 3QXSA 1YDEA 3K6SB 4UDOA 1AJEA 2EHDA 3LX8A 1F17A 1DEOA 1QYIA 4Q00A 2XYRA 5GONA 2CB9A 3AF1A 3A10A 1X7ZB 3WJAA 1J0EA 1TAHA 3BXHA 5B1EA 4COKA 1ZZEA 1PJSA 3QVLA 3BKXA 1VA4A 2XOXA 3Q3HA 1UXGA 4ZT2A 2C4WA 2IV2X 2PFKA 4J0CA 1JKJA 3PEYA 1A5BB 3E0QA 4BN0A 4D81A 4ZI5A 2CUNA 2V7UA 4RDHA 3SJZA 1YJBA 3LCVB 5LXTF 1VKOA 4HF7A 2WAYA 1H3FA 4MUEA 2XUGA 4CG2A 3VH1A 5HA5A 5TE9A 3SYTA 1RXEA 1EXNA 4ALJA 1O03A 4GYKA 4R1LA 4WZBA 4F85A 1W36D 4TKVA 1CIVA 2DFPA 4JYPA 2JAQA 3AWIA 2AOWA 4Q1CA 1CNFA 3X1KA 2B92A 2OCGA 2Q1YA 4LZWA 1KBQA 5H82A 4LNUB 1QP0A 3HCPA 3LYAA 1RR6A 4HUQB 1B6RA 6NULA 3RSLA 2ARKA 4B5LA 5ICEA 2I7VA 4F2HA 1TL7C 4DQ0A 3GBVA 4LJ4A 3QKIA 4F96A 3Q7IA 1IUNA 1ORDA 3AEQA 5F35A 1CZUA 2VUIB 2UVQA 4H7DA 1Z4IA 3TB6A 4YUXA 4DYHA 1O6FA 2HSWA 4RE5A 4ATNA 3KCNA 4HEHA 4I55A 5CB8A 3BICA 2XTMA 2WIGA 1NQ5A 1K92A 2OO3A 2OFFA 1GR0A 3EARA 1WV1A 3ZY5A 2R4UA 3HZHA 4BLTA 5IUJC 4C7OB 2LP4Y 2GZMA 1YA6A 2YOFA 1SBZA 2P4EA 5IJ9B 2P67A 1AH2A 1E79A 1NAIA 3L8YA 5AK0A 1B74A 4FYVA 3U16A 3UG6A 1B1AA 1NVBA 2NXNA 3LVQE 1RE0A 1GPMA 1X1AA 1YS1X 2NO5A 3BH6A 1BHQ1 3D0QA 3ETEA 3IFSA 3ZOKA 4FW9A 3QVOA 2XH8A 4K9SA 4ZU3A 4ZO6A 4AS1A 3UMFA 4DM4A 4N39A 5FTWA 2BGTA 2CE2X 2O3UA 2X3YA 2X8JB 3AF0A 3DMDA 1ZGAA 3SOPA 5A9RA 1OGIA 3CISA 1SUPA 1RMTA 3IP5A 1JMKC 4P9NA 2Y0DA 4BB9A 3QUSA 4FYHA 2D0OB 2O2SA 3IEIA 5DSZA 3ZXYA 1F2UB 4BEVA 3RU7A 3VU0A 1J5EB 3C7TA 1P60A 4PYRA 3CZPA 4MQEB 1Z56C 1LCIA 2Q8PA 2WJ6A 2VCYA 3FOFC 4XAQA 1KJQA 4NJEA 3S2EA 2XKBA 4IOLA 4MI1A 2ZJ2A 5ITZB 1J0XO 5CIWA 5CDFE 2ZS9A 1JHMA 4HVLA 3DAOA 1UJCA 4DQXA 2DWCA 5KHOC 1RRCA 4EVQA 4OM8A 2O7QA 3IO5A 3QW2A 5KJCA 4WKBA 1J23A 2NQ2C 3N7UA 5CAEA 3BIXA 3OLQA 3WRWA 2IZZA 4RJLA 3KUDA 4G1UC 5J4KA 1CUGA 2YY7A 2V1UA 5EMHA 3PRKE 2PLNA 3ORFA 4GXQA 4HQ6A 3IERA 2WFAA 1ZR4A 1PNOA 1GNSA 3FBTA 3RJ5A 1SVIA 1Q6ZA 3OEED 3VGJA 2WFMA 2J3KA 2Q27A 4XWAA 1EJ2A 4I4NA 3JARB 2DFTA 4NZMA 5FFMA 5G0UA 3WAGA 1YNSA 2PGAA 4IV5A 4INOA 3RIYA 3E84A 3WFZA 3A8TA 3ADOA 4OQLA 4MMZB 4DNXA 3CNEA 1NUHA 3G0HA 4P98A 1J09A 1CT9A 1DNPA 2AH5A 1WS6A 4CUJA 4NAHA 1OFTA 1SVUA 4MRRA 5J4HA 2BMVA 3GELA 3MJCA 5G0WA 2IX3A 1U0BB 2ZSFA 1E5LA 2P9ZA 2VJPA 1LVGA 4CMBA 3ILSA 3FNIA 3OTWA 1QQ7A 4NH0A 3DAFA 2M32A 5EUBA 3SHQA 4B1FA 3P0IA 3HGTA 4EYEA 4MSUA 3QF4B 4REQB 3RHFA 3L46A 4JT9A 3LRTA 4Q19A 3FE2A 4A82A 4ZP1A 3IOYA 4BQPA 4L1KA 5BN4A 2P9BA 1H4SA 2J5RA 3VR6A 1CUJA 5E7IA 4ZGGA 4G85A 3ZZ1A 3CFYA 3K4HA 2ZZNA 1JHRA 2ACEA 1YR6A 2UU9B 5DX8A 2SKDA 4NBLA 4DA4A 4FYIA 4RETA 1VJ5A 1N4AA 1XZQA 2QENA 3VTAA 1SELA 3UK0A 3FR8A 4B45A 1T1IA 1F2VA 1GU0A 4L51A 2YZNA 1G0NA 5SZJA 1FSFA 1EWVA 5CH5A 1MX9A 1UL1X 1OVGA 3DXFA 4IG9A 2Q3MA 4UU8A 1V7QA 1AQIA 4NOMA 5LQMA 2CVQA 3LIIA 4O2AA 5CDTA 1GXSB 2GTIA 1RYMA 3ADKA 2AEMA 4C4YA 1O0SA 2QV7A 4ALKA 4K1XA 2EV9A 5I51A 3FM9A 1KJZA 1NW4A 1WQ3A 1Z36A 1NE2A 1U2GC 1U2TA 4NATA 4NICA 3TSCA 1GZVA 1M8KA 1ZESA 4RQTA 5FV4A 3LY9A 3KQOA 5AJHA 5HIIA 5FBVB 2V9ZA 2DUWA 1YQEA 2WUEA 1L5OA 1JYEA 2BEVB 2I76A 3SYNA 4BNIA 4BNUA 1K97A 3M34A 4QODA 4RWZA 5GM1A 3ZWWA 1OIWA 1RP7A 1Z07A 3ZLBA 1X80B 1SUBA 1YZUA 1K2WA 3NKVA 4FMDF 4WJLA 4JI0B 1JIVA 4JL8A 1SOAA 1XCPA 3WYNA 1O4WA 4WUVA 2MJLA 3AI2A 4MS3B 1PGNA 4JASB 5JMTA 1X3LA 2GILA 3OE5A 1PFWA 3DEJA 1OH7A 4JYMA 2CXPA 4J6EA 4O1HA 1CQJA 2Y1FA 1V25A 3N2NA 3QFSA 2I6UA 1KAQA 3AI1A 3NAGA 3I73A 5GV7A 1EWYA 1WDLA 4BZPA 5LUAA 1TCUA 2H85A 5G1NA 4DTCA 3AUSA 3BERA 3PQ7A 4GP7A 3W3ZB 1H8HD 1LWNA 3SM9A 2V5AA 4KN9S 1NRWA 3B1XA 1GKKA 3RC9A 3STYA 2B21A 1U9YA 5F2OA 5JARA 1KFKB 4UZFA 3Q98A 2ZYDA 1N2EA 2R85A 4OA5A 4P8RA 1M72A 3O3MB 2H7VA 3UGTA 4GYYA 5I7SA 1GLGA 3D6UA 4RTOA 2EF1A 1U65A 2CXHA 2GXSA 3FBGA 1GQFA 2XCQA 4OK5A 5CYFA 3U4AA 2UYCA 4HK4A 3U3OA 1OFUA 3SMVA 4IV0A 4HZUB 4LZAA 4ZKEA 4IBOA 4V02A 5B2EA 4CU5A 1KJJA 1QRTA 1A9XB 4MGYR 4Z49A 4YJKA 4PG7A 4MHSA 2Y1OA 3VHLB 2QL5A 4MH0R 2D1SA 2R97A 4KN5A 1P9RA 3O4RA 1X7XA 4Y6PA 2V8OA 3SPXA 4FE3A 3WWYA 2Y0BA 4E5NA 3OU6A 1X7HA 2K7ZA 1XRLA 3Q8XB 3TTUA 3C5VA 1GRVA 1GQRA 3JW8A 3VUEA 2AN3A 3VNSA 1XEWX 1V71A 3B38A 3ZDQA 5DDIP 4YMIA 1NI4A 5DM60 1MNQA 1SIBE 2DJIA 4BWVA 1C1YA 2HU2A 4LHZA 1V16B 4CT4B 3G7NA 4E33A 1P81A 3NM5A 2IJGX 3MVEA 2XMRA 1TGVA 3PX7A 2WDPA 3OSUA 4Q3KA 4Z9BA 2VAMA 4M8LA 1QX3A 5J2TB 4NOKA 3HJFA 3EDQA 1T6YA 3OMXA 4PX5A 5EJ5A 2ZREA 1FDRA 4DS3A 2QAGC 3WB9A 3K70B 2EFDB 2XITA 4QQKA 1PFVA 3HA7A 2D1QA 1SVKA 2Z1DA 3NASA 4EJSC 2WWFA 2IL1A 4QREA 3VPGA 2CXOA 1E89A 2A4KA 2MOKA 2OLEA 2JZOA 3OECA 4NCJA 2BUBA 1FVOA 2HBYA 3D8SA 4QXMA 3W3AD 3ZHOA 2OC4A 3C3WA 3KQSA 3MYYA 1RWNA 1NZJA 1TE2A 1MQ8B 3F7NA 2VR1A 2XSZA 1RQNA 3HR4A 3MC1A 3PS9A 4EDFA 5AVVA 5H8WA 2HJ9A 2IQ5A 3QWHA 5AKYA 1U0OC 3OFSA 1PJRA 4OQZA 2C9OA 5KNDA 1WB6A 3LUKA 2ZJ5A 4CF6A 4G0OA 1J2EA 4GEKA 4PZPA 1IBCA 3WRXC 4CMGA 3W3AH 3MEQA 1O94C 1OU4A 3CZ9A 3C8MA 1TTQB 3WKEA 3HI4A 4CL0A 4MR8B 1BE6A 3KSAC 2OVFA 3DV9A 2ZRHA 1RXYA 1FP1D 4UNRA 1QGUA 4Y6QA 4HWPA 4MS3A 2NO7A 2YV2A 1N3IA 2E49A 1GZ3A 3EVFA 1HQCA 3G2LA 2MSKA 3ZY4A 4KQ9A 5KSYA 5ER9A 4G1BA 3ANTA 4GOXA 4ZFNA 4RNCA 2BRUC 5CFZA 5KYUA 4I36A 3A4TA 5AM2A 3UAGA 3N5CA 4C6RA 1T8WA 5E6RA 5EE5B 1RTTA 3M1AA 1H22A 2I29A 3I9KA 5T4EA 5IJ0B 3ENZA 1TEZA 4FYYA 1ZVVA 1ZSYA 3CPJB 4H7PA 3QV2A 1GFSA 2IOQA 4CDMA 2GCOB 5DTEA 4PC2A 5TJHA 4TM7A 1C7JA 1VPLA 5JCJD 3DL7A 4R3WA 2H1FA 3WJ2A 2XF2A 4FOLA 2JATA 1OKKD 3WLJA 3D4PA 3SKVA 2BDTA 2DH6A 4ERNA 3I62A 1MAAA 4Z9YA 3H9GA 4FT2A 3IELA 1HI9A 3M4ZA 4IO0A 4RTLA 4C0XA 5AHOA 3H9QA 1E9VA 4KUGA 2XQJA 3FSJX 4NS4A 2HAEA 5ALWA 1ZIPA 3GFTA 1Z2PX 2RJNA 2RI1A 1JQJC 3K1AB 5IVDA 3FUXA 1JQ5A 5IAJA 2YW2A 1YCDA 2HEIA 3UGQA 1GL3A 1EIZA 1YU6A 4H08A 5TR9A 4AJJA 1IG3A 4ZHSA 1SBTA 3JX9A 2J0UB 4QULA 4XXHA 1I7SB 3AL0C 4IVQA 3D8RA 1EX6A 3AUXA 3THYB 4KACA 1J1UA 4RBNA 1R6AA 1LZLA 2O05A 3AH8A 3JD0A 3WGGA 2OT3B 3U1BA 3D4OA 3EXEB 5LMUB 2H54A 3SJCA 1A2OA 2K6GA 3JRWA 4F93B 1R4MB 4IDPA 1YQ9A 3IUQA 4MO9A 2XNHA 1F1JA 4UVGA 3RI3A 2HWUA 4YYZA 1NJFA 5GGYA 2BP7A 4K40A 3N28A 4H0CA 4KIFA 1CETA 4YGXB 4Z2YA 4DV1B 2QUIA 1PFYA 3N0VA 4N12A 2HA3A 4NZPA 4GM4A 5DNAA 5JSKA 5JU6A 3DBRA 3AM1A 1JR6A 4YRPA 4E1VA 4KXWA 4A6PA 5H4HA 1VI5A 4YJHB 2JD2A 1ZHHA 4K46A 3O2SB 4UEJA 1N6HA 4L3OA 4DN6A 4HNVA 4YPVA 4AX4A 1QVWA 5AQ1A 3I42A 4MROA 1V4NA 1U1CA 3UFBA 1K4KA 3UWOA 4KR7A 4XCVA 2XAUA 3CUVA 3O8NA 1RKBA 2BEWB 3QBDA 2I9PA 3T7JA 1ABFA 1U99A 3LHIA 4FT4A 4IRMA 2PMCA 2J7PA 4B3CA 5A6SB 4Y6LA 1E2FA 4WZAA 4HDSA 1FX1A 5BSMA 4QJ4A 4I4TA 1HZJA 4URHA 3EXHA 1ONNA 2H9AA 1V5IA 2R96A 1WXXA 1O9GA 4R6WA 3V46A 5JPDA 3TMKA 3KXIA 5E6UA 1T8PA 4W1SA 2H48A 1D4ZA 3NEJA 1P1CA 4N3AA 4QATA 4DA9A 1S02A 1F6BA 2RGNA 1IH8A 3LG2A 1L5SA 1CUCA 3GLVA 1UZLA 3JQGB 4JJKA 2FW7A 4IEFB 5GZ3A 1FLAA 1K75A 3DMYA 4QRIA 4XX1A 3WSVA 2QLBA 1HEYA 5BVGB 3RYCB 2I55A 2EEPA 2VHUA 2X2OA 2G63A 2YRWA 3P0FA 4AXBA 2IHNA 3C6KA 3PUIA 5CYOA 1ACJA 4R1SA 2V6IA 1GPBA 3IP9A 4AN0A 1ZO8A 1M76A 3IJEB 4XX0A 3CNBA 2C5FA 4BBZA 5DNYB 1KKLA 1ULAA 4PFKA 3PNOA 2I87A 4H6PA 2JZCA 3C15C 4QYWA 3WQBA 4WBNA 5JH7A 4LHXA 5CH3A 1MABB 5CLQA 4RQUA 4G9EA 3SMQA 2QN6A 3ZD8A 2ETXA 2QL6A 4NY1A 3FUWA 2RH9B 8ABPA 1L6RA 3KOUA 3NLLA 2G28A 3N2KA 1R9GA 1LPPA 3GEEA 1SXJD 5BW4A 4CQMB 3PLAE 3M6WA 4F60A 2JIZA 3LWDA 3LC0A 2PCLA 2Z4SA 4WASA 2H5LA 3Q2IA 3B6ZA 4W5WA 4ALNA 1QH8A 1L8QA 1RIFA 2R86A 3F9CA 3GAFA 1JHOA 4G2TA 2I4OA 3C6YA 1Y3FE 3LUHA 4A2CA 5MFZA 1D2MA 5ALLA 3CB2A 5SV2A 3L0SA 3FPHA 4JVOA 1TLLA 4HNAA 4LPKA 2AMFA 3JALB 5F21A 2QZJA 4ZCMA 1ZU4A 3I9OA 2X77A 3L9WA 1JL3A 2SCUA 1XZMA 2D59A 4AFNA 5EWLB 1QLJA 4HYTA 1XTPA 2WSLA 1G9TA 3AIOA 3QBVA 4BX8A 3H5TA 5H1YA 2WHRA 1CY7A 2A57A 3ITNA 2IIQA 5DGHA 1A82A 4RD0A 4XH9B 3ZNOA 2VBCA 4FWBA 4C3VA 1YHNA 1UDRA 4E51A 2FP4B 2RHDA 4R7ZA 3QPBA 4QOJA 2BHTA 3LBYA 2VZ9A 3QXCA 2J9YB 4LHEA 3NHWA 4QDOA 3THSA 4OF4A 5K4GA 3USCS 1SGWA 4MYTA 4YK7A 1I1QB 2EBWA 3P5SA 1R37A 1Q12A 1W0KA 2VDVE 1NIJA 2A30A 4XYGA 3B3QA 4RHEA 1YCGA 2VBFA 1OFHA 2XB6A 5D5HA 5ALQA 2MMGA 4MQEA 5G4KB 1CQXA 1L1EA 4MJXA 3P9IA 1YQTA 3IBCA 4HDKB 3QJYA 5HVNA 4RXMA 2MSEB 4Y9UA 1IMJA 1PIWA 3DDCA 1PR1A 4KYTA 3BIFA 5DNEA 3WLRA 2ZVPX 3DBVO 3NBAA 4Y67A 4BNFA 1ISFA 2Y9PB 4F3CA 1UEJA 3VKGA 2P7IA 4MV0A 5EZYF 2GJSA 2IU4A 2PA3A 2F43B 4G25A 3CX4A 4G0VA 1I7LA 3S28A 2I80A 3SDBA 4Q7QA 5C1DA 1CS0B 1IBKB 3REOA 1W94A 2GK7A 2XNSA 4YJ3F 1ZINA 2XUOA 3GUUA 2XQFA 4M0KA 3K9LA 4BX2A 3N0RA 5F7XA 1E7RA 3VQTA 3HJAA 3O3OB 1H69A 5IVKA 2X1LA 4P0QB 3KSMA 4BMYA 3OM0A 4G0XA 4FB4A 3MINB 4N6GA 2H65A 1C3JA 3VRHA 4DIKA </