5JSQA

Trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-[7-(phosphonoheptyl]guanine
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
195
structure length
173
Chain Sequence
CKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRDIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVYETWGKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypoxanthine-guanine phosphoribosyltranferase
publication title Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 60
structure length 173
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jsqA00
1BD3A 3QW4B 2VFAA 3ACBA 4LYYA 1L1RA 2JKYA 2XBUA 1O57A 1XZNA 3MBIA 1I13A 3LRTA 1BZYA 1HMPA 1VCHA 5BRNA 5IAOA 4FYMA 1UPUA 2JI4A 2PRZA 1QK3A 4P83A 4RACA 4F8EA 4RQAA 4WMLA 1UPFA 1ECCA 1MZVA 1ZN8A 2GEBA 1A3CA 1BD4A 1V9SA 1XTUA 2EHJA 1JLRA 1GRVA 1STOA 2E55A 3N2LA 4LZNA 1OPRA 3DMPA 4RABA 4MB6A 1QK5A 1WD5A 5ESXA 4QYIA 1FSGA 3DEZA 1TC1A 3KB8A 5KAMA 1P19A 3GEPA 5HKLA 1VSTA 5HIAA 1DKUA 1DBRA 1A98A 1IBSA 1G9SA 4X45A 5E38A 2JBHA 4WN3A 5BSKA 2HCRA 5BQPA 5EUCA 4RADA 4P3KA 1L1QA 4LYGA 1XTTA 3O7MA 4PFQA 2JKZA 1LH0A 4RHUA 4QRIA 2AEEA 2P1ZA 3DAHA 1GPH1 4P86A 5JSQA 2DY0A 4RAOA 1O5OA 4Z1OA 3GGJA 1DQPA 2H06A 4RHTA 3M3HA 3H83A 4ZFNA 1A95A 1DQNA 2H08A 1U9YA 4QYIB 2PS1A 1QCDA 4RHXA 1R3UA 1VDMA 4TWBA 1Z7GA 1J7JA 4LZOA 3MJDA 1ZN7A 4S2UA 4P80A 2C4KA 4LZAA 2FXVA 2H07A 1DKRA 1A96A 3S5JA 4IJQA 3ACCA 1G9TA 1P4AA 1PZMA 4M0UA 5KAPA 5BQOA 1QB7A 4M0PA 1ECFA 4JITA 3ACDA 1I0LA 1TC2A 1G2PA 1ECJA 3GGCA 3NAGA 3OHPA 4RANA 3OZFA 4RV4A 1G2QA 3LPNA 1ECGA 3G6WA 4RHYA 4M0KA 5JV5A 4KN6A 1NULA 1YFZA 1JLSA 1OROA 1QK4A 1I14A 2PRYA 4X44A 1QB8A 1ZN9A 2IGBA 4P81A 4RQBA 1I5EA 1XTVA 1XZ8A 1P18A 1D6NA 2WNSA 1A97A 4P82A 1Y0BA 5K51A 4JLSA 3EFHA 1AO0A 1HGXA 1QCCA 1ECBA 1U9ZA 4P84A 4PAWA 5IPFA 1UFRA 4RAQA 1OREA 3OZGA 4OHCA 1I0IA 1CJBA 3HVUA 5ESWA 1P17A 1W30A 1NONA 2YZKA 1A4XA
chains in the Genus database with same CATH superfamily
1GKKA 3CX8A 1MQ8B 4Q03A 1VG8A 4URWR 1WB5A 13PKA 1K75A 1TM7E 4X3OA 2WUEA 3NW9A 4E94A 4MCJA 3K92A 1XZCA 4URFA 4DJFC 2F43A 2FTKE 1VHWA 4WACA 4S35A 5KWVA 5IXYA 1JR3D 1J97A 1GOTA 2LVBA 4B6GA 2EFJA 2ZBUA 5CB6A 4S0XA 1GGEA 3F46A 1IBMB 5ETJA 4L6IA 5C3UA 1MJGM 3JYNA 1SMKA 4KI7A 4YBRA 3SOZA 1SCBA 3EJWA 4MKRA 5D84A 1NI3A 4HX5A 3I5MA 1F2UA 4RE5A 3T7AA 1R16A 5TY0A 5EZYA 3DGEC 2GDZA 5G2OA 3FIJA 2I4IA 4U7FA 4PLZA 3N0RA 4CG2A 3TOZA 1A9SA 1CUUA 4ZOAA 5I8ZA 4R3WA 4YUAA 5P21A 1MT0A 1R8XA 4TV9A 1KSGA 2ZE5A 1A5BB 4GKBA 1FRQA 3I09A 4JGGA 4PPNA 2ZRGA 5AJYA 4OMDA 4YY3B 1M2KA 1YJQA 3TUIC 4K40A 2VCEA 5L4LA 3WGHA 3S1SA 1C3EA 1UBLS 2CXUA 1VMAA 4M1YA 1TIBA 3BDVA 3RIYA 5CYGA 4NV0A 3VAAA 4MTCA 3PXDA 2B7LA 4PLHA 2VBGA 4QPJC 1GPH1 4LKOA 1Y9DA 4UUPA 1KERA 2Y1GA 2DRIA 1J2EA 4CTJA 1X7ZB 3TTYA 1OQAA 2VZLA 4F38A 1ZJYA 3JQAB 3ZJYA 4D82A 4GR4A 4IDHA 3NOVA 1AZSC 4BFSA 3OQ6A 4EA8A 3UUWA 1NVUQ 4FFDA 3GPDG 1ISSA 1T4CB 5T4HA 4QKQA 2VDNB 1ISJA 3EZ2A 4ZCIA 4G67A 4K26A 1E1CA 4IXNA 2UZ4A 2V7UA 4ZU3A 4BB5A 3B52X 3ZJTA 4AY4A 3T3DA 4ZT7A 3HBFA 4HJXA 4GC5A 4CEJB 2ATIA 4EY3A 5ESDA 3UWDA 3IT3A 4PCLA 1ADJA 2W6PA 4I5GA 4LJ7A 3K1JA 4D46A 5TQVA 3HXKA 4DF3A 2DP4E 4NMHA 4J2TA 3V2IA 5LZ9A 3UTCA 4RTJA 2G8NA 3NC0C 1FS6A 3A6HA 5EMKA 3KQHA 1WDTA 2JHGA 4OQ4A 4CM7A 3LCUA 3OZFA 3WL7A 2XVMA 2NVBA 2PIDA 1NLMA 1RNLA 4DBLC 4HGNA 3R3UA 3IHKA 4BV9A 1UJNA 5IVDA 2A58A 4RD1A 4CQMD 4JKIA 2Q3LA 4BQPA 1J2JA 3VO8A 2AC4A 1G66A 4ZP1A 1Z12A 5EJ2A 4UDNA 4G4IA 2CLSA 3ZXSA 4HZGA 4BATA 2L42A 4HLNA 4OYRA 5C0OE 1ZESA 2AL7A 3U81A 2OHHA 2UDPA 3H2KA 1ONNA 4E5YA 2AJLI 1L5GB 4HRXA 1Q0RA 1H93A 2QTAA 1R88A 1YUNA 3B7WA 3SY8A 2VF5X 4YMGA 1U3GA 3L06A 4Q3AA 4Z9AA 2D00A 3WWPA 5C8DA 2HHHB 3PZRA 2GWRA 3GJZA 5KYXA 1HE3A 1QBGA 4F93B 2YDXA 1ZK1A 3MWYW 3I9NA 1NYLA 1LC3A 1ZD9A 5JSKA 4FGUA 2JHAA 3CPJB 4GP7A 1NDUA 4EIWA 5HIKA 3SHOA 1Q1NA 2RHCA 3KYDB 4FT2A 5IUJC 5JXHA 4CV2A 3AG6A 3MBIA 4JC4A 3QPUA 2FPGB 3JSAA 1LZKA 2G07A 2AFIA 2BRUA 3C74A 5ALHA 1V7ZA 5IAJA 1F6BA 2B8NA 4E32A 3ZZNA 5U9CA 2HPZA 3ZEAA 3CLSC 4F96A 2P0AA 5EZYF 1EXNA 1V26A 1W581 2A1IA 2C8JA 1RYZA 3GRRA 3HKEB 4JB0A 3QM1A 5E95A 3GR6A 1WPRA 2RGNA 1CR1A 2X1LA 2Y93A 5IWCA 3JAWA 5LOVA 4M9UA 2K4MA 4W9RA 4TV9F 3JQ6A 3PXCX 5AK5A 2OHOA 2V7QA 3L18A 4LZJA 2NU9A 2GBLA 2PXCA 4PLCA 1XLWA 4EY6A 4KVFA 4LY3A 3ID6C 3CF4A 4CV3A 1DT5A 2ZR7A 5EINA 3HZRA 5FTMA 4ZU1X 3RSOA 2XF8A 1L4YA 1JNYA 4NNJA 3GNQA 4LGVA 4YB8A 2Q9BA 5IBQA 2NZVG 4XASA 1IQRA 1HG0A 3TTUA 3ZW7A 4E0BA 2O8FA 3DMRA 4U0KA 2YS6A 2WM3A 1H6DA 1V5IA 3QE9Y 4S1OA 2CVPA 1C4KA 2GYWA 5E3JA 5LUAA 4QO7A 2DPYA 3BFKA 1I6LA 1M7GA 4WN9A 3DVAB 4HXGA 2G4VA 2HTFA 3EWSA 3FRIA 1M0SA 4FFLA 1BU8A 4J49A 4I1OA 3VKUA 4JHLA 3F49S 4UBNA 2XRYA 3IJRA 1NY6A 2N1MA 1E4EB 1ZW1A 4OTZA 1HYGA 1XEAA 4MWCA 5K0JA 5JJIA 3OZDA 1T9ZA 2O3TA 4RHCA 5JDCA 3IALA 4B75A 4Z86A 5GP1A 1YD7A 3BXZA 1GRCA 4R69A 3OF2A 1GQ2A 2QAJA 1A2QA 4X8HA 2AFHE 3G1WA 4HC4A 2EP7A 4EM6A 1UXKA 3THYA 1Q92A 4J0CA 2C1XA 4DWOA 1NASA 2QTNA 3QLJA 2CLKB 1A96A 4YAFA 1QTRA 1EXWA 3MELA 1I9CA 2FP4B 2Z56A 4D3DA 2C7QA 3M89A 1PQPA 4F2PA 3RF6A 2ANCA 4WUVA 1Z6PA 1QB7A 4KPFC 4D92A 2IYTA 1QSGA 1KZYC 3LGSA 1C3JA 1KOFA 3RIMA 1TC2A 4ZIRB 1VZ2A 4D0NA 2ZIGA 1P9LA 3IKLA 3Q5GA 2WF5A 1A76A 1M6NA 2PBZA 2QZJA 3WGNA 3K8QA 4P5EA 2CFIA 4C4TA 3WO0A 1TUIA 3LPNA 4N5NA 5FH9A 5G41A 4TXHA 4QXAA 2D1FA 4KE7A 4ZAGA 4N3BA 4HDCA 3JU3A 3I04A 1SD2A 2WM8A 2RGAA 2IHNA 1AA6A 2E9SA 3P9RA 1R5JA 2JAQA 3KQVA 5EJ6A 2VQ6A 4RCZA 5CDGA 4RQBA 2KBEA 3VUFA 3TD2A 4DQUA 1E2DA 2GTPA 3JRWA 1TM3E 3ILXA 4XE5A 4M9QA 5HCNA 1BQEA 4AS1A 2HH9A 5DGTA 2ZS8A 1RZUA 4QAJA 1OXXK 1RM3A 3B6MA 4QWWA 3TO5A 1CY4A 3CTMA 4L5AA 4GT1A 4QECA 3MK31 5HDBB 5HMMA 3RO7A 1QE0A 2OECA 2HRRA 4UE2A 3EF0A 1I2CA 3EQ8A 1ECLA 1YH3A 4IDCA 4OB8A 4YREA 3E7DA 1ZJWA 2DB3A 2B4AA 4QJ5A 4FOPA 5DNVA 1R66A 1YR7A 2O06A 3NGXA 1Q1EA 2CDCA 4H6VA 5GY7A 5ALGA 5L3QB 2BF7A 5CFMA 3D7KA 1E77A 3LUBA 5DX0A 1U2DA 2NU8A 4GVPA 3PRJA 2Q1UA 2WU3A 3A6PC 5EHQA 4QDUA 5F3RA 5KTRA 2VUUA 2L69A 5LOVF 5AVZA 3WA7A 2ZJ5A 2VI5A 5D1HA 4BMNA 1Z56C 2EEPA 1AKVA 1KI9A 2NXJA 1HZZC 1EBBA 3THXB 3BICA 4TLCA 2DJIA 4D02A 2A5DA 3FCYA 4RHFA 2PSDA 4FFPA 1U63A 1I2MA 2VXCA 3DXZA 3MBOA 4REQA 5CPBA 3ROKA 1H5NA 2PGIA 4U7PB 4KB5A 4EZBA 3OX3A 1R10A 2JC3A 4C3ZA 5G1NA 4MWEA 4QQKA 3CB2A 4CMHA 4X84A 4BQEA 1ZGGA 5J4YA 2YQZA 5JY1A 1MORA 3FFXA 3DKVA 1Z0AA 3G1TA 4HEHA 2TMDA 1YKGA 1JBEA 2GM5A 3HJAA 1K7XB 2WWGA 2A7XA 3HKCB 3F96A 1CUVA 4PGGA 5BQPA 3TLGA 4N5LA 4J1TA 3KWJA 2WSBA 3LT2A 3ZVKA 1JXAA 4U7DA 4YAGA 1KPIA 1YZKA 1PS9A 3IS3A 4S2EA 1X1DA 4JFRA 1WOYA 4INZA 1HLPA 4HNHA 4UQPA 3N2EA 2XSZD 4NWIA 1U9CA 1MPXA 2FSUA 5FFNA 2ON6A 1TVKA 2NVUB 1A72A 1R0BA 4P86A 4HX2A 3L7BA 1JKMA 3MJ4A 4EKYA 4JJFA 2O54A 3G8CA 4GNRA 5DNWA 4D0LB 4DNQA 4DMRA 4KFCA 3ROEA 3HV0A 1IVNA 4YASA 3NDJA 2DFKB 5IBCA 1EDEA 3QF4A 4Z4QA 1WZCA 3BB3A 3E3OA 1G5FA 2PS1A 3QFSA 1M6VA 4R3NA 4I81A 1E9BA 2FDRA 2GKSA 3OIWA 4LMPA 1WHTA 2CT8A 1UWKA 1AGNA 1BA2A 1RQXA 3AHFA 3TLAA 2HT1A 2YHIB 4CIBA 1WUKS 1ZITA 3KUCA 1MABA 4ZT5A 5FI5A 4LMRA 4LJ6A 4Y0AA 2GPBA 3HWX1 3RHFA 1H22A 3OZEA 1KGSA 4B82A 3R5FA 1T5DX 2H2AA 1PBTA 1E8NA 5EWMB 3VR6D 1W9MA 2ZWVA 1YOVB 2YHAA 3RH0A 4F91B 1PNVA 3H5OA 4DUGD 1Y8QB 2VWHA 4WGGA 4JT9A 4UZSA 3EN0A 4HWRA 3T4UA 3HEAA 3UH1A 2CKDA 3PWKA 4JP5A 3IH5A 2QPTA 5I9LA 2D62A 2PG3A 5JOQA 2FPSA 2EQBA 2UZIR 4AJJA 2BZ1A 2QRJA 1U8UA 1GKLA 2C31A 3U7EB 2VYVD 1ABFA 3ZX5A 5K8IA 3KXIA 5TF4A 1EBFA 4KVGA 4UNRA 1DADA 2H8KA 5K01A 1N5MA 2XGOA 3I12A 3ADOA 1TPYA 1XPUA 2O2GA 5CK5A 3PC8C 5DMXA 4D5EA 1RJ9B 4D2IA 4E51A 4IJ5A 3TLXA 4ZTZB 5JYEA 4AQDA 4HDRA 1GL9B 4ZVNA 3TRIA 2VP0A 3LBAA 5BT9A 1GAJA 3HFGA 3ZCRA 4AZVA 4YMVA 5F5XA 3Q3HA 2FX3A 2XHEA 4CTMA 2QRMA 4OMUA 3NOOA 4QFDA 1P5JA 5BV1A 4RJJA 4X93A 3BE8A 2PMCA 3H9QA 4MROA 1OLUB 2RHMA 4O2RA 5ALYA 2HFKA 2YR0A 2QL9A 4HZUB 1NLFA 1K7CA 1KMHA 3ODPA 4G5XA 4J0IA 1WABA 4LA4A 5CJPA 3ZWKA 1HMPA 5BT8A 5EIEA 2Q2VA 2H52A 3BG5A 4NECA 3RYCB 1XYYA 2REBA 4YRZA 4KX5A 4B3CA 1PZNA 3I64A 4ZRDA 3AUXA 1SA0B 1NW6A 3MD9A 2P2DA 2W22A 3U31A 1CUGA 3EG5A 2ZQYA 2I62A 5F1KA 1OASA 1YL7A 2ASVA 1NW4A 3OZ7A 2BKLA 4LZNA 1CQWA 2YOHA 4IAOA 2Y4NA 4XSVA 1PZGA 3LUAA 4E08A 1MU0A 2GPSA 3RHSA 4RLQA 2XRZA 3WLQA 3JWEA 2V9ZA 3B9QA 4RESA 1AK9A 3K7EA 2OG2A 2IBSA 3O4GA 3V1NA 2CMDA 4YBZA 2EKZA 2JGDA 4JI4B 4KVZA 3O4FA 4QVIA 1EUZA 1Z62A 3M5CA 4GPIB 3VI4B 4ENVA 2I2WA 2O1WA 2ZZMA 1ZH0A 1XTRA 1D09A 2LNDA 1EX9A 2QGNA 4A2QA 3EVBA 3KAKA 1M34E 4BUCA 4YJ2F 1EFPA 4EYEA 1MRZA 3AQ4A 1B8UA 1CUYA 4CVNA 4E7PA 4HVLA 2EF1A 1D7AA 1OLXB 4OL0A 1EFKA 4LAFA 4Y2TA 1YV9A 4B32A 3SNKA 1D4ZA 5TPZA 4WNYA 2FN7A 1R0RE 4IFEA 4QOFA 5AM2A 5KYWA 2ZM6B 1J56A 4HWSA 3FWZA 4C7KA 2ZE6A 2R97A 2R00C 1NSFA 1HNWB 4FKZA 3WR5A 2XAUA 3R8CA 2BKXA 4FWTA 1GFZA 4IXMA 2WHPB 4YLGA 5G0UA 4IHJA 3HR8A 4PYMA 3ZYCA 1S1MA 2BJHA 2H7CA 2P4QA 2GUWA 3BIWA 2VA8A 3I2FA 3TRDA 2N47A 1H2ZA 3U40A 1RAFA 2D0DA 3KVOA 5EJFA 5MDHA 3PVCA 2HDHA 3UMYA 5I3ZA 5IAKA 5B4UA 1Z8FA 3OLXA 2A0KA 4TL8A 3ZOZA 2X0KA 1A5SB 4UATA 4WA8A 4M60A 3ZJ5A 1DB3A 2IFTA 5EPOA 1CNEA 4MUJA 3TLBA 5J47A 3L1HA 2PT6A 3LC2O 5KI6A 2EJVA 3FBWA 3DAOA 3TIFA 3ESQA 1I1NA 3V8EA 4AIRA 5FWDA 2Z8YM 4IYJA 3FUVA 3OBBA 5TMBA 2IS4A 4C7JA 3I9V6 4WY5A 4Q3KA 1C29B 3NAMA 4NYJR 2DR2A 2W6ID 4ZVLA 2RHJA 3WGVA 4KN6A 2CMGA 3TE7A 3UAOA 3UV6A 4HJRA 3S2YA 3VNRA 1KQPA 2VJOA 5DTQA 4UOZA 4DLAA 1C9EA 2EGHA 5KOYA 1YQGA 1AOXA 1N2BA 1HDGO 3JD1A 3Q40A 2J9YB 1RWBA 1P18A 1QG0A 5EGSA 4FZVA 1X2BA 3O21A 5CLGA 4BO8A 4KQGA 4GP9A 3JQRA 1RZRD 1V11B 3NC4A 4B6PA 4PG4A 4B3JA 4YJ3B 2E5LB 2EFCB 1XEWX 2GILA 4GRDA 2P1DA 4ZV4A 1TCBA 3HXTA 3LQ1A 3DKPA 3QZUA 4KHPB 2RH9B 3BMNA 1DBSA 4D79A 3KQWA 3VPHA 4MEAA 2PUWA 2ZVJA 4ICIA 4WKCA 2BFDA 5DTEA 1FUUA 2Z3ZA 2Z98A 4PFKA 1QFJA 3CRNA 1G1AA 1CU1A 1W8IA 2B2XA 4KMRA 1GZ7A 4FFRA 4MI1A 4Y0NA 3S1AA 5CEJA 3IVXA 4KQCA 4L4UA 1RE1A 1EFAA 3HK2A 2JI7A 1P9OA 2OESA 3AEKB 1S2MA 2PK3A 4UXJA 3BD9A 1QE3A 1W2HA 3RC8A 5EQTA 4P3OA 2E7ZA 3A3NA 1EKXA 4DSTA 1TAUA 1YQ9A 4HK4A 4DVJA 5ICGA 4PQFA 4W5NA 4NS4A 4PRZA 2XUGA 1T9KA 3AINA 1H2YA 3DP9A 4U7WA 4X00A 3DBLA 4X8MA 3HVJA 3GDHA 4YYEA 4Y2SA 3C45A 5ALKA 2FK8A 1PN3A 2ADFA 3CZAA 3FB4A 3PNMA 5GM1A 5K8LA 2EZ8A 4O0MA 4ZQGA 1J00A 2QA5A 2OV3A 3HU2A 4ZQHA 3C24A 1Q57A 5BQFA 2JBWA 3EGWA 5JYBA 1CY8A 1RFGE 4PS1A 1HF3A 4C0WA 2ZJ6A 2IY8A 3CR3C 3UTDA 4XYBA 2EDCA 2DR3A 1H4VB 1XZEA 3T99A 1ULBA 4IDBA 4XEUA 5ES4B 5EWJA 2GWHA 2RB5A 1YS4A 5D3MA 6REQB 4BMOB 3OEHD 1FC0A 3D3WB 2XGJA 4BX8A 1OMOA 2IYPA 3DD5A 1NG1A 2BV3A 4E07A 3KQNA 1T9GS 4BNVA 2P2LA 3AHGA 3WO1A 1JW9B 1ZRNA 2O8EA 2JA1A 2CD7A 2P5YA 2A94A 1W1WA 4DGQA 1HLFA 4ZYLA 3WGMA 4W7HA 5CB4B 5LMZA 3AKYA 3IAAA 1COWA 4EPYA 3U6KA 2ZRLA 4IHJF 4E2WA 4Z7OB 3VH4A 4IGKA 1UMDB 3KAJA 2XNKA 4CKEA 2WD9A 2ENUA 4YMWA 1FZQA 2IXFA 1SVSA 2YV4A 3MJTA 4GRIA 4R1UA 4Q9KA 1TF2A 4CNQA 5HQ3A 3UCEA 5CAEA 3BMOA 1JXQA 2XZPA 4ZOLB 3AIOA 2DOKA 4TMXA 3ZHVA 3SVTA 5ILOA 4W5JA 1CSEE 2EBFX 2EQAA 1U2PA 3KXPA 5EGNA 3LFHA 3BL5A 3U37A 2I7TA 3UJAA 4EG3A 1T10A 2CFCA 4HI0E 4M0UA 3DF9A 1Y42X 3PQ6A 4EB8A 4MYSA 4WK4B 5A03A 3L0PA 4WKGA 3INNA 1OTXA 1P9WA 5EZ6B 3AVXA 3AVWA 1M1NA 1Z4QA 4GE0A 3OU6A 4FNMA 4H59A 3OF3A 2WD7A 2WF7A 3DBRA 1J22A 3ZIAA 2W6MA 3M4JA 1P2FA 1OIXA 2EFYA 2PVPA 1KA9H 2PLFA 1ZU4A 5BV0A 1DKMA 3KYJB 4NYMQ 3WJ7A 5DNUA 1RVDA 1WDKA 4PF1A 1BJRE 1KH1A 1OX4A 5TQ2B 5F76A 4N1AA 3OJCA 1CJMA 5DXAA 3K73O 4A4DA 4WDRA 2X19A 3EVEA 2NZ8A 2XCRB 1FBTA 3KQSA 1XE3A 2ADMA 2QU8A 3O2SB 3SXJA 2VK8A 2Z30A 1QF7A 2PHZA 1K5PA 3HCPA 3LX6A 2R7AA 4DN6A 1QHGA 4GYYA 3D5EA 1KFBB 1OFUA 1CFJA 1P17A 1Y5LA 2OHXA 4G8DA 2XT6A 4MB2A 1ZO8A 2QW0X 3OCZA 1RYDA 3LDFA 3UA4A 1V16A 2QX7A 1NU6A 3NORA 1T1EA 2JKYA 2ZITA 3PFBA 1OIWA 4EHIA 3AR2A 1LUAA 2V0NA 5HR5A 4JEHA 4E4RA 2PQ0A 3KU1A 4BWYA 1JQJC 1IEWA 3PVZA 2CXRA 2VHEA 3BB1A 5L9AA 1DU4A 3CU5A 4M76B 5CG1A 4XRRA 2EW2A 2ERYA 4HN2A 3U4HA 4FT4A 1P1JA 1TYZA 1PV2A 3GLGA 4I99A 4EY5A 1HY3A 2FP3A 4FXOA 4RVGA 2Y67A 3NXKA 5A5DA 4U5QA 2OP1A 3ERCA 1KEZA 3KQUA 1MJGA 3SC2B 2VNSA 2QRGA 5REQB 2SKCA 4GP6A 4E14A 2XRFA 1JQAA 4FI3C 2XITA 4JLDA 3TCNA 2PGLA 4YIKA 4MICA 2IHYA 1DBPA 3RBZA 3ROZA 2CLLB 3DLHA 4G1EB 4RTMA 1P0CA 5EMHA 1QH1B 2VP6A 4U5XA 4QIHA 1YFKA 4ILKA 1Q3TA 5KWIA 1DHRA 1N1MA 3RUEA 3K0CC 4AMVA 5BR8B 4CMIA 1JN0A 4XYMA 4Q7QA 1H42A 2XYGA 4MAAA 3ZEIA 1C7RA 1N6LA 2UVQA 5HRAA 3W2HA 4QYTA 4PAGA 4YDSA 2WD8A 1B8NA 4QOEA 2GR9A 5BN1A 2A9KA 1P61B 1NUAA 1UBFA 3ME5A 5FBRB 4B2IA 2ZREA 1Y5IA 1ORDA 3LC0A 1G0NA 4QDKA 3WK4A 3UAYA 3DSRA 3DO5A 3U4DA 3COPA 1EZ1A 5D51S 2PVCA 1JU3A 4FHDA 3TL3A 4E2FA 5K8VA 2QUAA 2X9VA 3V4FA 1YA4A 2BL4A 3D6NB 4M9SA 3OJ0A 3ANNA 2Q9AA 1MR3F 1LXCA 1ZN7A 2Z9BA 4F06A 3S2UA 1MTOA 2WJVA 3IILA 4HTFA 4G9GA 4G8JA 4OHBA 4PHGA 2P2GA 4HUQA 1N4AA 4LJLA 3PF8A 1C7FA 2PRSA 1GLVA 3DB1A 1V8DA 1CWUA 1WCYA 3A06A 3P9SA 5BQOA 3TVDA 2QM8A 1Q7BA 5KJEA 1N2OA 1NW7A 2HL6A 3A37A 2LCFA 4JYBA 3N2KB 3OUTA 4NE9A 2IPNA 4OU4A 4NCBA 3KUUA 1W36D 3N76A 4KACA 4Q37A 5AI0A 4BHTA 2IHKA 2OAP1 4GX0A 4DG9A 3PX3A 1RSZA 3ZGNA 1NWCA 2EZ9A 2QDKA 5JV5A 4KO3S 1LC0A 5CT9A 2Q5JA 1IN8A 5ERGB 3RUPA 3QJGA 1VP9A 2XOKD 1T9HA 1US8A 4A2CA 2IYOA 5DNEA 2UUOA 2EJUA 4XWOA 3C4QA 3ZLBA 3ZCUA 2ZRNA 1A97A 2OY0A 5GWXA 5KC9A 1CXZA 3J80A 3FWPA 3MCTA 3PEUA 1O9BA 2TMYA 2FPRA 1T15A 1NU8A 2Q4TA 1UDXA 4F3CA 1HMYA 4D99A 4XM0A 4KR0A 2NU6A 4LE2A 1DC8A 2XXAA 3H75A 1ZGCA 4IIVA 4A15A 1MG0A 2WHEA 4XUCA 2GZDA 4PGFA 3DZFA 4GXQA 3RBXA 5DYYA 1CS4C 3LFUA 4BEBA 2YN4A 1O1YA 4L72A 3HB4X 2ZR9A 1M76A 2AMVA 4C0LA 2A33A 2FPPB 2Y1FA 3EIUA 2NUTA 2PMDA 3HPRA 4O2BA 3MLEA 1IOLA 4MVJD 5B12A 1IZ8A 1HO3A 2OCLA 2XQGA 5KHAA 5CA0B 3JQ9A 1LTKA 1P1KA 2NO7A 3PCXA 1USKA 4EYKA 5A0VA 1GTSA 3ROTA 4MLDA 1IOWA 3K05A 2Q5CA 4PFJA 4C89A 4DIBA 1DPFA 1YTLA 4YQZA 2XEDA 3F7MA 2SECE 1VXOA 2Q2QA 4IS2A 3TJZA 3A3OA 3QVTA 4ETMA 4ZODA 3JZDA 3CX6A 4JLMA 2VDRB 3ESBA 4NVRA 3BRCA 3GPBA 2CBZA 5GJWC 3T3NA 2PXXA 3ETNA 3COYA 2AB0A 4NFLA 1I7NA 2VP4A 3OURA 4HSGA 4YTEA 1EGVB 3DBHB 1OC2A 3ND6A 5FI1B 3A6KA 3G2JA 1JG7A 1OFHA 1QX3A 2L17A 4JMLA 5IUNC 4P8RA 4ABTA 5EQDA 5EVCA 2CB0A 3FYCA 5HIJA 1GTRA 4XFDA 3PDIA 5EKXA 3X1MA 2E37A 4TXJA 3N28A 4CYMA 3M7IA 4UVDA 4FTWA 3GOHA 3HVKA 3GJRA 1XMJA 3CG4A 3O95A 4MRRA 1H8HA 2F59A 4QYMA 4WK0B 3NALA 1GN9A 3IDSA 4GXNA 4Q7EA 4WNAB 4LRXA 1JDJA 2R1TA 3DOEA 3IQFA 2ESRA 5C8YB 4ZZ0A 4Z0HO 1FFSA 4XWWA 2WNHA 5IK2D 4YC7A 4B2YA 1R3UA 2GZRA 1N9GB 4LZWA 3S40A 1XHLA 3NLLA 3C4VA 3GFOA 1S2LA 2QE7D 1F0YA 4X85A 2SKDA 1LPBB 1DKPA 3WYNA 1RYYA 2VXYA 4X3PA 1Z5GA 4TSKA 1XR3A 3RWMB 3Q3CA 5H83A 1IXRC 1V3VA 3HA5A 4Y7DA 3E9DA 3BYZA 4KO8A 4MUNA 1UBKS 3BPSA 3E9CA 2X2FA 3W2EA 3WYCA 4HWKA 3MW8A 4OHFA 3WNDA 2BGUA 4KUEA 4LMBA 3MJEA 5B1DA 5LQRA 4QJ4A 4FLMA 1KYVA 3HCRA 4J0GA 2YXLA 3JD3A 4HRVA 5IARA 4I6EA 1U0JA 3P5BA 1KK1A 3I9KA 4NI5A 3VKFA 1I5RA 4FXPA 4KR7A 4DREA 5EIBC 1U5BA 4G0XA 4R1SA 4RJKA 3M1LA 2B8JA 3MUFA 5LB4A 4K87A 1JP7A 4F84A 4S1NA 1REQB 4C7OB 1NHGA 2RH4A 4B0PA 2PL9A 1P0FA 4CKBB 5EFZA 5FLKA 3OVMA 3DPUA 1Z6AA 5KOJA 1ISIA 1RKQA 3O8OA 2DWCA 3T52A 4IX1A 2Q7DA 5DRYA 1ZMXA 3VC2A 1KRHA 2V6MA 1JJIA 1FDTA 5ICEA 5L45A 1YE5A 1VKHA 1VG0B 3BGVA 4JI6B 2PH7A 1MP0A 4CE6A 3QJ5A 2IZ1A 5I4CA 1F6DA 3L6OO 2I1VB 1CJBA 1VGRA 1SCNE 4Q9NA 2Q07A 1KVRA 2R48A 1E4YA 4LRYA 4QBTA 2YN0A 2CYBA 2NZUG 2CE7A 2FUNB 4O2BF 2PUVA 4B5LA 5T57A 1SUDA 3VV3A 4F2HA 2B5OA 1Y6JA 5KDDA 2Q5IA 3EC2A 3ZNNA 3WLIA 1I2BA 4Q16A 4LDQA 3IPAA 5AQEA 1M2EA 1IUNA 2HT6A 3JYPA 3QY9A 4I46A 3Q7PA 4DMGA 4Q7JB 2M1XA 1X7DA 2VSQA 4MTLA 3EPKA 2VTBB 2WFLA 4D26A 5DW0A 3V3KA 4ZT3A 2AS0A 2JKVA 1B3RA 1EQAA 3CWQA 4EG7A 1QJ4A 4JUDX 2VA9A 1LI7A 4WINA 1M2FA 1V35A 3A36A 1QCYA 3IDZA 1PK8A 1LKZA 4MGZR 1IXSB 3D9QX 4QWMA 4R1MA 2H17A 4ARZA 5EIXA 5TS2A 2FEOA 4C0XA 3BAZA 4KSBA 7REQB 3PXAA 3RS2A 1VSTA 3P0FA 5AKGA 4DLLA 2VZEA 3H9JA 1XDDA 1NMEA 2B98A 2WFZA 2V6GA 4P35A 1T0HB 3EXFB 3QX9A 4Q4DA 4WH0A 1SKUA 3R3YA 4MYTA 5HTKA 3GNTA 4QOSA 4IGAA 1I32A 3IAM1 3UM9A 4IUCS 4DJJA 2FUKA 1FBNA 4NHOA 1V7CA 3NNNA 3QRWA 3SZOA 4F3TA 2JKZA 2K2QB 2QRLA 3WYGA 3AM4A 3ZQKA 3JWHA 2BKVA 1EWRA 4JYPA 2B1GA 1B8OA 2YXEA 3KJXA 4NU8X 4A8TA 4FE3A 5KQLA 3A9CA 3OU2A 5FAKA 3RTGA 3N87A 1RWOA 5DP2A 4B3GA 2C2XA 3FTFA 1NJFA 2WF9A 2W43A 2XECA 5F9MA 3D6FA 4GX1A 4E2XA 3I6QA 4EHHA 3PXEA 1UANA 1OXVA 1OXMA 4UBKA 2J8ZA 3IXQA 3OA0A 4PICA 5E9QA 4ZVQA 4YCSA 3IT0A 3M5WA 2WAMA 4U2BA 3IB3A 3PUVA 3GA7A 4MMZB 1NBIA 1CDDA 1YC2A 3A10A 1JB9A 3LLUA 3U3JA 2QN8A 1M3SA 4FFOA 4I5DA 1L5SA 1GZUA 4MRMB 4AS3A 5NLLA 3ANYB 4I4CA 2F8LA 4P38A 4R0MA 4K81B 4BY9E 1E7RA 1T0UA 4IMPA 3P5SA 1L8AA 3IV7A 1CJKC 4QBHA 5CDYA 3ASZA 5FOQA 1I24A 4IUYA 4IM7A 5EHIA 1H1DA 5J9FA 1LS6A 1FDSA 3CY6A 1HSOA 3OM8A 2NUAB 3ZLTA 4KZKA 5FUYA 5DLDA 4QOJA 3TQSA 4NOLA 5I48A 1OV4A 4IGFA 2BFCA 1WY5A 5DYGA 1WAMA 2F6RA 3DTVB 2DPGA 1HUQA 3AYZB 3C3DA 4OV6B 5HE8A 5LM3A 3FY4A 1EM6A 3VZRA 2AVDA 2NZYA 1QTIA 4HPJB 2OO5A 1R4NB 1D04A 2V4UA 3T9BA 1AGXA 1IZ9A 3A9TA 5INTA 4C06A 3NJ4A 4UM5A 5FJJA 1X7ZA 4I5IA 4R7GA 4BMDA 1SKAA 3JQAA 3UK2A 1YZNA 2BVNA 3EWAA 3KQQA 1DMSA 4ERNA 3OLZA 5BSFA 4ZCPA 3O8QB 1IONA 1DIOB 1N5LA 1QE5A 1TZBA 1T4CA 1VRWA 2RK3A 2XMPA 3DDUA 1CULC 4QHTA 3HLKA 3O2QB 3AERB 4Q19A 5EE1A 5EOVA 1NXQA 3GHYA 3HPQA 3AEZA 3W0LB 1A8SA 1TTQB 4PYQA 4Z7NB 4BO5A 5IASA 1WUJS 1JHDA 1YRHA 3NFYA 4JLUA 1C1HA 1HQKA 4D5GA 5AFSA 5L4SA 2JFQA 3B1WA 4HTAA 4EBBA 3UN1A 1WBDA 4JJ4A 1L5LA 1V3UA 1D8AA 2GJ4A 1OI7A 1JG4A 2P41A 2XH8A 3CNHA 4A92A 1GA6A 1Z6TA 4F56A 5IMBA 1EK2A 4KREA 3W5VA 1DJLA 2HZBA 1E64A 2IUYA 3D3QA 5M5BA 2FSIA 1E1MA 5CJ2A 4OQPA 2H0RA 2GA9A 3Q8WA 2GN4A 3V4OA 3V8RA 5AUNB 5JZSA 3T1HB 1HRKA 1D6MA 4BX9A 4N0MA 1XRSB 4IS3A 3W2FA 3LT0A 4Q9DA 5JTTA 1O94D 4I3HA 1HT2E 1QHIA 1CKEA 5JVDB 2QTRA 1E98A 2X14A 4S0ZA 3GJXC 4TWRA 2QPLA 2OCDA 2ZRBA 1QZZA 3OX2A 4BCCA 1W5FA 4D9CA 1EWTA 5K20A 2V3CC 3ZDAA 4NU5A 1S9DA 3NYRA 3O5AA 3TS1A 3I01M 5AK4A 3ZCXA 4KQJA 1ZZGA 3GA5A 3HUUA 3QVOA 3CW2A 5ALTA 2JGNA 2ZE8A 4RADA 4Z8YA 1N3YA 4AJKA 4B7CA 4B7XA 1Q16A 2XCSB 3I8XA 5AWFC 3F73A 2JLRA 2PZ8A 1KDRA 3EZYA 1ZD1A 1C0KA 2C7VA 2AE1A 4WFQA 1MRNA 4GPAA 5KSWB 4XVQA 4G4GA 2XQJA 4EJSB 4BFXA 2CLMB 1XTJA 1QAQA 2A67A 1IFXA 1L3IA 3AL3A 3GMSA 3QFTA 4LCEA 4BKRA 5K6RA 1YNSA 2QTVA 1A5ZA 3NHAA 5JAPA 3GGJA 3HTXA 3DDWA 3KYDA 3ZBUA 3SC4A 3WFZA 1RHKA 5EQJB 1AURA 1A8UA 1RVV1 2FPGA 4UD6A 4ZEVA 4M0LA 4C4YA 4YRTA 1WEKA 2DFDA 5MGNA 1DGQA 3SLRA 3RU7A 4DM4A 3LW8A 1C81A 3MTBA 1EINA 2R1VA 2IL1A 2JAPA 2MINB 3OCJA 1E1NA 1W0KA 2A5FA 3OF5A 3S5JA 3EMKA 2ZT6A 5M29A 3V46A 2VSFA 2P4UA 1BU5A 2BE7A 5JS7A 1XTBA 3K20A 3LI2A 4NPCA 2PUHA 4OXQA 5BN4B 3I1YA 3FRJA 4G1BA 3OHPA 1FF9A 1ECJA 5EXTA 1F7VA 3P1JA 3UOGA 1VB5A 2R3SA 4LTDA 1BDIA 3OJLA 2GXSA 4PYNA 2AOXA 1T6BY 4U2DA 2ZJ7A 4F45A 5DNYB 4EECA 1P2SA 1Q17A 2Z8YA 2FEMA 3KEFA 1UADA 2BIFA 2R84A 4G1UC 1CTQA 3WZLA 4JQCA 3T7IA 4RH3A 4DCNA 4KXMA 2FSHA 1DDIA 1M8JA 2JL1A 3SSNA 1U2EA 2VDQB 1Q14A 2D2VA 3ZWAA 3K0HA 4L51A 1POXA 2FZVA 1E4EA 1SXQA 1U9ZA 2XMDA 1JPUA 2V7QD 4KGVA 2AI3A 2Z09A 4GRAA 1Z4OA 4DKXA 4M9CA 1BDHA 1II0A 3DYIA 1JZTA 3HVUA 2P9YA 5CT8A 3MCZA 3H2BA 1KSHA 3PUZA 3WIDA 2C99A 4Y9UA 4ZK6A 5BQ3A 2HHAA 2ZI6A 3FYUC 4G26A 3I2JA 1YIOA 1CZNA 2Q3BA 1WS6A 3B9PA 3LKZA 2F4NA 2B4TO 3T34A 2F3QA 3Q9LA 5B4VA 5HSGA 3EIWA 1Z0KA 4KE6A 5BXQC 1UP4A 2DSTA 1QYXA 3W34A 1T2NA 2FP4A 2QAIA 4HAYA 4INPA 2OGUA 5CVDA 5IT5A 1NBOA 4R8LA 4ARSA 2F62A 3TLEA 2WUVA 1R18A 2B9VA 1R6UA 1JIJA 1NVVQ 1LBIA 1QBKC 2BJWA 1KI7A 1T35A 3N0VA 4WY2A 1WXQA 1GNSA 4KRGA 3WYEA 3DV0B 3JALB 4BGVA 1P29A 4ZIRA 3C4JA 5BYAA 1M66A 1K8XB 3H9BA 4C22A 4KR9A 2R62A 3HSKA 5EIHA 1DIBA 1HE2A 3AJ8A 1FFYA 1VLHA 3F71A 4WXMA 1UBEA 2FWAA 2QNRA 3BH6A 1UOOA 5FOXA 2PIAA 1U5AA 3H7AA 4DCPA 4QJBA 4HKTA 1L7MA 4C6HA 1DS6A 1WZNA 1GNLA 2V0GA 4JLNA 4MJXA 1NVKA 5J4LA 3IUYA 1XCOA 2F1OA 1BG6A 2OOSA 1YJCA 3L1UA 4MQMA 4UNIA 3R7WA 3SKYA 1VG1A 4TGLA 5JZOA 4REMA 2NVWA 3GARA 1VC2A 2D3WA 2XQVA 4ECAA 4GBMA 2WZQA 2HSEA 2MSLA 4B3HA 3WZ2A 1QAOA 3GJ4A 1PS0A 1I3CA 5AJHA 4FOTA 1ENYA 3WGGA 5E2IA 3EPLA 4G1MB 2ODEA 1J0EA 4K3VA 4LHYA 3WLHA 4H4EA 1CR4A 1JR4A 2C0PA 1YZQA 2V96A 2W98A 4C21A 4F2GA 1AE1A 2YRWA 5L3QA 1R9JA 4O59O 4JXKA 1L7BA 1EX6A 3FE2A 3JR7A 3A3PA 4HWGA 4YJHB 3SX4A 3BJIC 1JR2A 2QY6A 4RIEA 4RVSA 5JYCA 1A2OA 1J9GA 3CR7A 2ZUTA 1BDJA 2G5CA 1UT6A 1ZJ6A 3IJEB 1OIVA 1COZA 1F60A 2WQZA 3IIMA 3TCKA 1N8KA 2PUGA 5JG7A 4UNNA 3TBHA 1A8PA 4LW8A 1JHMA 2B21A 4AJHA 4XB6B 3S81A 1HEIA 2YMLA 4NBTA 5E0KB 1GPAA 4CF4A 2AHRA 4G24A 1ZW6A 4FEEA 4IDNA 1NPYA 3TI9A 4XM2A 4EQZA 2MOKA 4ED9A 2G4LA 4ND5A 2TRSB 1G8KA 2R8EA 4D8YA 1GGHA 2RGWA 5J23A 4DLUA 4D41A 2ZWIA 3HKCA 4OHMA 3RVQA 2YYYA 1PGOA 3UICA 2JCYA 2HJVA 1OROA 2JAWA 4N18A 1NIJA 4G5RA 1F2TB 4F3KA 3QEJA 2FUG1 1PU2A 2J3QA 1QVZA 2AX4A 4LV8B 2W2QA 1PWXA 1UJ2A 1SXPA 3K0AB 1G4UR 2NVUA 5DP1A 3LX5A 2J33A 1NC3A 2AFHB 2JNWA 2P6UA 2JCSA 4RAQA 4UUAA 3VC3A 4NXMB 3I76A 1E2EA 2NQ8A 4UULA 4D4HA 1KO4A 3DEHA 4KC0A 1UIRA 2OGZA 3FCCA 3L1JA 5AW9A 2F1RA 4ASUA 3QNUA 1ZUWA 2CLFB 4HYYA 4LF6B 2IDJA 3SU8A 2W6NA 1QMGA 2YHIA 3BFXA 1AG9A 1G9XA 1XDSA 5EXSA 2GASA 2N3ZA 4YAEA 1EHYA 4HNVA 5BRNA 2YMMA 4WZAE 2XBLA 1QH0A 1HETA 1AGRA 2QL6A 3RIHA 4FP9A 4PG7A 1PGJA 3SC3A 5D5HA 2H18A 4G86A 1PGQA 4RACA 4WCFB 3ZZ0A 5DBGA 4YMHA 4OBBA 5IKOA 5EWMA 1A3CA 3GLVA 4MQEB 1YOVA 4TMVA 4C29A 2BHRA 4UDOA 3UMMA 1Y8QA 3A58B 2IPOA 1R64A 4MRVA 4RMGA 4LQ4A 4UAVA 1QNFA 4W4TA 3U3MA 5DCYA 1MDFA 5KTNA 1PFQA 2HN9A 1QK5A 2GYYA 1NZDA 2HA0A 4LSGA 3FI0A 1O03A 2PXAA 4LDJA 1KY5A 2P2SA 4Y6SA 1P9NA 3P19A 3QFHA 1ZOOA 8ATCA 4NOJA 1E9SA 5CXSA 1GNTA 1U0TA 1VIDA 2B82A 3QVJA 2ENWA 2JFVA 1H65A 2Y1KA 2IQIA 3RT7A 1ZDMA 4YI5A 2X3FA 1RAEA 2A5LA 4OHVA 4CJXA 1LPSA 2JGEA 2OLEA 4I5EA 3VMFA 2OKCA 2ZYIA 2R1UA 3AFIA 4CLRB 2ACVA 3D6MA 3REQB 1A9YA 1HNZB 3O94A 1ZONA 1XMQB 1RJ9A 2PSJA 2X9NA 3LPCA 3NZEA 1PX0A 1H6CA 3HCCA 3AK4A 3R6DA 3E1KA 1Q50A 1GGKA 1YI1A 3PHIA 4HAXA 3CEJA 4XUEA 3SJUA 1SBTA 3Q85A 3V4SA 4FNGA 5KU1A 1D1SA 1XVTA 3CVYA 2V1UA 3H17A 3A1VA 2H9AA 2VDPB 4ZYZA 2WYIA 4NZOA 4HFJA 1KMQA 1ORTA 5HFNA 1OLUA 2BM0A 5GGYA 2Y2UA 3Q6IA 1M74A 3N70A 2QF7A 3S2SA 2PR7A 3FZQA 2H4WA 3SKVA 1ML3A 3KJQA 2BKAA 2B4YA 3UJ3X 3MINA 1ZRSA 3KR0A 5FUBA 3USCS 3DD1A 4DLRA 2CEAA 3RYCA 1IVYA 1QORA 1WTAA 2XTAA 3H1TA 5EC8A 2A9VA 5K9ZA 1PGNA 1SA0A 1TK9A 2I9PA 2QRVB 4EL5A 3LV8A 4AUNA 4EKDA 5JC8A 2BEKA 3ZWQA 2CDRA 3B70A 2B0CA 3LNCA 2OAGA 1BMTA 5TB5A 1EI9A 3G8DA 4K88A 2NYAA 2G63A 4HX9A 4PLPA 3U61B 1FTSA 2WYWA 1IL0A 1EDDA 2I4RA 3G2HA 1ZMRA 4K8RB 2Q1SA 2NTYC 3JPWA 3EFOB 2JFOA 3ZS8A 4UTRA 2ZRHA 2CFRA 3CT6A 5LU8A 1R6AA 1I4DD 5LPNA 1QRAA 2G82A 3ZWCA 2NN3C 1N5DA 4XFJA 3FYTA 1B1CA 4F4DA 6AT1A 1HM5A 4MQUA 4P93A 1O6FA 1ADFA 2Y1DA 4LV5B 2WIGA 5CX4A 4J7UA 4BFVA 3FWKA 1TW3A 4QZVA 3D54D 1KPHA 2W2TA 2YYSA 2V98A 4TX1A 4URXR 1NQUA 3DE0X 1KBZA 1NUTA 1OLXA 3VKVA 3U39A 1UBOS 1SK9A 2XY4A 3CURA 3Q9SA 4IKOA 4XUGB 3IIEA 1CUFA 1YI8A 1EMDA 1KI3A 1N6OA 1WV1A 2XCOA 4OUDB 3EGDB 4REOA 4R7ZA 2BE9A 4HLQB 1B6TA 2CHEA 2WHPA 4C14A 5A5GA 4PFSA 3PG5A 1AMNA 1YBMA 3QW4B 4KHZA 5A4AA 1M54A 3AF2A 3EBLA 3C97A 3FKSA 2WHQA 3RU2A 1IPFA 3NM6B 1UIMA 1DZ3A 3EQZA 2IYNA 1Y6FA 2A0YA 3PC8A 4H4CA 1M7HA 1A1VA 4L5YA 1XX6A 3HS3A 2VSOA 1LBSA 3K5PA 2V7VA 1UKAA 4MVXA 2GNAA 1E2KA 1Q83A 3EUWA 4RLSA 1CQJB 5TPZD 1G55A 2ODBA 2WG1A 4JB3A 4P4TA 4RO0A 2JGRA 4C2BA 3TUZC 2JJ2A 3BH0A 5ILGA 2JFGA 5A2QA 1DAMA 1ULUA 5TIIA 1FMLA 2V5AA 4G9EA 4NJMA 4H31A 1BX0A 2YVLA 4GSLA 3FVQA 4HD8A 4YMUA 3SJ7A 4M1OA 1JKIA 3MTAA 1I01A 2X6RA 5TMDA 1NLUA 3IFSA 5MN5A 2IYVA 3PV0A 3K2EA 4LF7B 2XNDA 1YCDA 2AHOA 1EWKA 2VTVA 2WU0A 2JDIA 1XCLA 2NYVA 4ID3A 1V11A 2I1LA 3S2IA 4YJ3A 1GZ5A 3G2QA 1RQPA 5E7MA 1KFEB 4Q82A 3UQZA 4JGBA 4AL4A 3RS7A 4WASA 4HQOA 3ESYA 3FFAA 3HFRA 2B25A 5KYYB 4ZJPA 3SZ3A 3WA6A 4L08A 1PL6A 4BMZA 3UWMA 2BM1A 4Y2QA 1R00A 4KLRA 3G49A 1BTOA 2IH5A 2PQ6A 2FZ5A 1GFWA 2JH9A 4MW7A 4UHKA 5AKYA 4CDGA 3AEKA 3G85A 5A0TA 1Y4ZA 2PS3A 2QZ4A 1GNQA 3GD7A 2PMBA 3QU5A 1A95A 2J0UB 2D59A 4FYXA 3U3OA 3FKQA 1VXRA 3D0QA 1PS8A 5CK4A 1YS6A 3O8CA 5H3CA 2CLOB 1QQ5A 2QROA 1FTYA 3LQYA 4JBNA 4LC9A 4KGDA 2I2FA 2Q50A 2PJDA 4D0RA 5GINE 3ACCA 2QENA 3SBOA 4EBFA 2VJCA 4FB5A 4P3NA 4PVDA 2I4TA 2R00A 1ISFA 4LHSA 5IC6A 2W00A 1GDHA 2WUFA 4I1SA 3QBVA 1TJ3A 1DOHA 1YDHA 4O2LA 1CZOA 3KEOA 1QHYA 4W9MC 1QF6A 4TMYA 4NR0A 3TI7A 2E18A 4OL9A 3DEIA 4RMHA 3FXAA 1HK7A 3HCDA 1NDHA 4WXEA 1M34B 1HDRA 1NXSA 1XZIA 1YNOA 1LV8A 1J8MF 2EXXA 2D1YA 2GD6A 4PSVA 1A7AA 1DXOA 3UVEA 4YV1A 3OCWA 2LUOA 2YXPX 5LQAA 1QVVA 3OPVA 3WAKA 2WHYA 4RSHA 1E0JA 1W2GA 3ABQB 3KCQA 1FRFS 2YYZA 1I7QB 3F2IA 3K0EA 5CB4A 1ZH6A 1I9GA 1QC5B 3IP9A 1BDBA 2C5GA 2AJDA 4OHZA 4DQKA 3OT5A 4H1TA 2QUHA 1UMDA 3PXGA 1DC7A 1GGMA 5DWDA 4A7PA 4R71A 4QU9A 5EYPB 4EFMA 4FKBA 4OHCA 3TLCA 3NM5A 3L8HA 2HDOA 1DBIA 2ZIXB 4GVXA 1GM5A 1E58A 4C6TB 1GDDA 3ANXA 2YZKA 3B2EA 3N58A 4G5HA 5ALJA 4BEWA 1N6RA 4ZOLA 1OAOC 1YI0A 5FPSA 1ZMTA 4BKOA 4QSMA 5HMLA 1XL0A 2V6BA 2YWHA 2GPAA 2YZ7A 1UXJA 1Z8NA 5DMHA 4PLVA 1CS0B 1JF8A 5TEVA 5C52B 1L5RA 1YVDA 4EA6A 1YIAA 3W9SA 4KV7A 5LZ4A 1XVUA 3FHTA 3ZK8A 4HUJA 2X41A 1H1TA 2PMWB 3K2IA 1XA0A 1COWD 1H1LA 4L0CA 1U8EA 2ACKA 2ILTA 3A4TA 3PUIA 1P9RA 4DA7A 5CFQA 2ZZNA 3KLOA 4LPSA 4FCTA 4H6PA 5FORA 3BJMA 2VF4X 1VFPA 1KJNA 1XJWA 1JHZA 3HDJA 3PIRA 4LDPA 2GVDC 4LVCA 2PFSA 3PC6A 3NC1C 2C9DA 4I66A 4PZCA 1TJ5A 5KAMA 3D8BA 2CUKA 2W2MA 3GEPA 4OP2A 4YJ3F 1A98A 1QLHA 1Y5RA 1JAZA 3T12A 1APBA 1J25A 5DASA 3LPLA 3QKRB 1U4SA 2KB0A 1ZYUA 1ZIDA 2WWXA 5TQ2A 5E8JA 2QN9A 5AM5A 5C5DA 1GSIA 1NX6A 2V6FA 2M1ZA 3CBGA 3FF4A 3OZRA 4L22A 4P3KA 1Z73A 2RONA 1Z13A 2UYHA 2OFPA 1FY2A 2FN3A 2FWJA 2RHLA 3MOSA 4U6SA 3SHQA 4BB0A 1XEFA 3D5QA 3D0RA 2HO4A 2HJWA 4X66B 2PZMA 4KN5A 1E6CA 1VHDA 3DMHA 3SJCA 4O1HA 5JAZA 1JNXX 1DC3A 1BMFD 2AD1A 2BDUA 2H06A 3IPYA 4M88A 4P53A 5CVVA 5DCLA 4BBPA 2HSWA 4EGQA 4I55B 1AIPA 2IYLD 4K86A 3BD8A 3DMTC 4AWXA 4GPEA 5I9TA 1BDMA 2WJZB 1RPAA 1XDWA 5SYNA 1K9VF 3RS0A 3RGGA 4BLTA 1Q84A 3BZUA 4OM8A 2Y66A 4L74A 1N7GA 5B58C 1G8AA 3UJDA 1JDVA 4GM4A 1Q22A 2ODPA 2W2KB 4IDFA 3ZWWA 5A04A 5IKEA 4GO1A 4MPRA 1N6PA 1QQTA 2ZSAA 2O3RA 3QOXA 4J9UE 1ZOSA 4D43A 2G76A 1OXBB 3SC2A 1BHO1 3HXMA 1GU1A 4D8VA 2W0MA 4G07A 3UENA 5REQA 2I3DA 5BYJA 4NJEB 4X3CA 4B80A 4EJ6A 3ACDA 4EHFA 3TF5A 2QW8A 3H5RA 3MAGA 4LGMA 2IY9A 4CKWB 3O9ZA 3EA4A 3M6FA 5AM3A 1K7FB 3BD6A 5TT0A 2UYGA 4IIUA 1IJEA 5GTDA 3OZBA 1GL6A 5LKRA 1D7OA 4BFTA 3RSCA 1GWNA 4DV0B 4RZSA 4MJLA 4Q24A 1EE9A 2AG5A 3A1CA 4XQGA 3FOCA 4CG3A 5CB4F 4G85A 4F46A 3CUVA 4Y1RB 4KFUA 3AO0B 5SY6A 2HIMA 2BMEA 3NJ8A 1L7QA 2QQ5A 4NZPA 4E1AA 4X9XA 2J30A 2FFJA 1KJYA 2XQFA 3DS8A 5DWVA 2D5CA 3ZE2B 1ZSNA 4BKMA 2BEUB 3P9YA 1IIBA 4NYMR 3U17A 2DH6A 3AEUB 1D2HA 4KIGA 3UYKA 4RTSA 1Q0UA 4WL0A 2MCFA 3RYIB 3G13A 5ALZA 1G20E 1YDWA 3I9OA 4BFCA 1M72A 5HPYB 3WK5A 4QQ8A 5KJCA 3DTNA 1JEAA 1XCPA 1M5RA 3BL8A 2XUKA 5JD3A 5KTOA 1ZCZA 1WUHS 2AN1A 4L9WA 4PG5A 4XKJA 2WP0A 5LDDC 3L6EA 4ZAFA 1XF9A 3E5RA 1R9GA 1AKYA 1BXGB 4JC5A 4DZRA 1XCMA 2DSNA 4N47A 5BVHB 4EPXA 4LRUA 4RK1A 1I1QB 3R41A 2IU4A 2JFPA 2P9ZA 2RAFA 4L75A 3L4JA 4KQ6A 3WC4A 1QGDA 3IQDB 2VZ8A 2ZRJA 2IZ5A 3KXDA 3QVSA 1X92A 1JHVA 1DCKA 3JASB 1T8RA 1ZX1A 4DMLA 1H8EA 3N2KA 4R2HA 5I9IA 1RQLA 3T9AA 4B34A 3U6BA 2PQ2A 3FTEA 2XUZA 5EE3A 3KQOA 4E5DA 2AJBA 5K3DA 1KF0A 5LWQA 2CCJA 4DMKA 1OPXA 3PCTA 3OSZA 4ILEA 4TVSA 3I5XA 2BWJA 2VNAA 4MCIA 1P3Y1 1C9JA 4CF7A 5GJBA 1JJAA 4N7JA 2VS1A 1DC5A 3MGCA 4J4BA 4XLTA 2XMSA 2GCGA 4Q4HB 1M2VB 5AK6A 5EMLA 5KTKA 4S1WA 2PS0A 1PQUA 3I01A 3GGPA 2PN1A 4Y0VA 4UHEA 5CW2A 1O4VA 2FKNA 4LZZA 4XPIB 4GE3A 5AJVB 2NO9A 2B78A 4CDRA 2ASEA 1DTWB 1LK7A 1UM9B 1KO5A 3EIQA 4K28A 5FJIA 1LV7A 5GJVC 2EOAA 4JLVA 4N3AA 2RI6A 4UXHA 1JE1A 2BFPA 3V7YA 3I6IA 1KMIY 2FSFA 5CIWA 5F2OA 3UMBA 4MS3B 3RAGA 1IN1A 2OG1A 1PV4A 1MAVA 1NJ6A 1ESZA 3NIGB 3FCSB 2FLVA 2NPIA 3MFYA 4XOIA 3VC1A 3F0TA 3K0CA 4B4UA 1NG9A 4ZFNA 4IPTA 2P77A 3HKDB 2QJOA 2FPPA 4FFNA 4GI1A 4R5MA 5H80A 5JS6A 2HA6A 4RNCA 2V7EA 3EMBA 3BWVA 5CA0A 3DKKA 3CUYA 4W63A 4QEZA 2WJ4A 3RYTC 1Z35A 2G25A 5F64A 3EZLA 3K71B 1YU9A 2RHOA 3QEAZ 3OOSA 5DVZA 1ZD2P 4LXXA 4BNXA 2V74B 2XUIA 4L95C 4XR9A 3FHJA 4E5UA 3QNWA 3DVQX 3EJ6A 2ISCA 1F14A 5THXA 4MW6A 1YJAA 1ZK2A 4R6WA 2BCJQ 4F72A 4ENSA 4WE3A 1MJ5A 1UBUS 1W25A 1X7WB 2H4JA 5AJZA 3RR2A 3ENVA 5IH3A 4BV3A 4MVJP 1XZQA 1NUHA 1GYRA 2AF4C 3PNOA 5DHSA 2P69A 1G2QA 3H3XA 3MMXA 1LK0A 3RC2A 1PT5A 2VNHA 4FJ0A 3FUWA 3WQHA 4NSNA 3KXLA 4M4SA 4NY1A 5FFMA 4XVUA 3HRIA 2QMYA 1FK8A 2QRPA 2KX7A 3CJTA 3WFJA 2R9VA 4KIUA 4QFBA 1IZYA 5CCXA 4FR5A 4EY7A 4I08A 2H3HA 2C2MA 4W6ZA 2AN3A 2WEKA 2ODAA 3GJ8A 1X8JA 3AEYA 2IKQA 4PLWA 5CEFA 3PLRA 3WLTA 5L7WA 1L7NA 5TQ0B 4PANA 2ORWA 3IMFA 2QJTA 3EMDA 1CP2A 4MPDA 2HCFA 4WNAA 3T35A 5FYDA 2Z2YA 4JJAA 3H2SA 3T4PA 1N1EA 5KNCH 3AVYA 5C8YA 2Q49A 2PH3A 5BPHA 4UFPA 4D81A 3NIDB 2OFFA 1N9GA 3LA6A 5HZHA 3UT0A 4ESOA 1U0HC 1VKRA 4ZOCA 3KFVA 3TTVA 4UE6A 4FCVA 1Z8HA 1XZNA 3AZOA 3GLHE 2BMFA 3PF9A 1JKFA 1JQLB 3QNMA 5JMWA 3H7IA 1QIDA 2ZXFA 3AY0A 3GQVA 3Q3JB 4GMHA 3STVA 1PFGA 4K9OA 1C4OA 2AYYA 3NTVA 2AZDA 1TEZA 4EG6A 2ZYSA 3K1AB 2V7XA 3G9XA 4KLZA 4RGQA 4QYXA 4RX1A 3WKDA 1AUVA 2JA2A 3F3SA 4ARVA 4BJ1A 3K70D 4JA0A 3IV9A 3R5SA 4QD3A 1Z2CA 3F8SA 3IVMA 5E1OA 4YYZA 1PR6A 3U7RA 3TNFA 2PX4A 2X2OA 1REQA 5BPFA 2ZBGA 3ORFA 4QT0A 2XBMA 2G36A 4QLAA 2NVOA 1QNLA 2DLDA 3MSCA 2IYEA 3R40A 4CKBA 4I9FA 3F6SA 3HHEA 4J16C 1UOEA 3W7VA 2C9CA 3QX3A 1KR5A 3WLOA 5JWRA 1HFEL 1SXHA 2WJJA 5CX1B 5H5JA 5B5SA 1GCOA 1DG1G 5JS8A 1O6GA 3I23A 2CUNA 3GXOA 2ZXUA 2C7BA 2ODNA 3KZ1E 1R5BA 1OLSB 1YQQA 1KVTA 1SQ5A 2F8SA 3DMNA 1A27A 2WUDA 1VCMA 4RF5A 2JJMA 1P80A 2GK6A 2O7SA 1N32B 2WBLC 4RFVA 3DT6A 2C3UA 5CA0F 4QBIA 1KEVA 4HEQA 4FIDA 1CK4A 1L6IA 2PUBA 1DEKA 3DYBA 3N5KA 5JD4A 1JWBB 4Y2HA 5JAIA 3JWGA 1FJ2A 4I19A 3SJBA 1X1EA 1L7AA 3SLGA 1XO1A 2JGJA 3K96A 3LTEA 1XRMA 4OI2A 4TPKA 3MILA 4EH1A 1P91A 2VTBA 2AG0A 1XTZA 2H92A 1P1HA 1XN4A 2QVLA 4HS9A 1QYDA 3G9TA 3OD5A 4LF4B 1NBME 1GSAA 1Z08A 1SBYA 2P8SA 3U3KA 3Q10A 4LOAA 4OYYA 2I7VA 3QOYA 4C43A 2HU5A 4EKGA 1RW4A 1F48A 3NVDA 2O2SA 4F4UA 4IWNA 2J9ZB 4RDCA 2XDQB 1ZUIA 2XA1A 2OB2A 2WFMA 3GT7A 5DOVA 4K6HA 3ZTWA 2Q5FA 4O4LB 3X1XA 7REQA 1P75A 4KXYA 1S3GA 1SHZA 5I4IA 4DB2A 1EE1A 3HYSA 3HYLA 1LRJA 1YXMA 1ZM4A 4KCGA 3S7ZA 2MHCA 3UB3A 3EXFA 3G6WA 4RHYA 1ZD5A 4XWKA 3FFWA 4KODA 4Q0MA 4NV3A 2HF8A 3KQTA 3SYTA 3EG9B 1ZC3A 4FWBA 3IT2A 1XTIA 5AI6A 2IEGA 3C15C 3OIFA 4QFCA 2QRHA 1G21E 3SXUB 3WL3A 4JP3A 4GOOD 1M1ZA 3REGA 3L01A 4PGMA 4JLSA 5C8YF 2ATEA 1OXSC 1RWVA 1SVIA 3D43A 4HVTA 3HCAA 4B43A 2P11A 3A6EA 2Z6QA 2XYHA 3AFOA 2B99A 3LXRA 5EIAA 1H3FA 5F77A 3PUHA 4UUMA 4CWAA 1NRXA 2ZE7A 3AR5A 2ET6A 5C4GB 2M6KA 1ESNA 1KZ9A 2FEAA 2I8LA 1MC4A 5ALUA 5A4JA 3KC2A 1H3EA 2QY9A 4KMSA 3RWOA 2TMKA 4FU0A 4OP3A 4LJ5A 3RAPR 1EFRA 1VHJA 5EKSA 4DYDA 2ZUFA 2P9CA 2JS7A 3KD3A 4MV5A 3W5IA 1GVHA 4MRMA 1JR6A 1TMYA 1BFUA 1IU9A 4K9MA 2IEYA 2V7TA 5GOTA 3FETA 1U0SY 3CLTD 1ZGHA 3MWGA 5FTNA 1P60A 2AEMA 1YL6A 1Z6XA 4EJFA 1MVLA 4OP1A 5IMSA 3UWSA 1C1DB 4FYIA 4C30A 5EE9A 1STOA 5L6MB 4P34A 4L6AA 3KQMA 1YRBA 3I28A 4ZRNA 4RMNA 4OJQA 1ZOIA 1EEHA 1W4LA 2ZPTX 2NUAA 1JLMA 2OO3A 3GLKA 3Q7SA 4RLHA 1FSGA 2OBNA 5ESXA 1VIMA 3V5NA 2WWVD 3HVHA 3EMVA 3DTVA 3LBIA 3P27A 4I3FA 4JQSA 3UT6A 5KTYA 3HV2A 1YRAA 2QG6A 2YFHA 2I2DA 3CKLA 1EVLA 3JAKB 5LDHA 1NT2A 4UHFA 3TMAA 4BXOB 4JI7B 1SQFA 1R4NA 4G84A 5I5GA 1PX2A 1DC6A 4WDQA 3ZBPA 5GM2A 3RJMA 2IZ7A 1KAQA 3DPIA 4IZHA 3WSVA 3U26A 2Q6LA 3KPYA 5J5CA 3R0IA 2R5NA 4B3FX 1YQWA 1E20A 1WVMA 2OV2A 3O8QA 4QRIA 1HPLA 5IUKC 1A7KA 3RTAA 1LQTA 4LJRA 4GBGA 3VOSA 1W7AA 4D9KA 1G5QA 5JISA 1KE1A 4ZVSA 2O23A 2I8CA 3UB2A 1AD2A 1SCDA 3F6BX 1CNFA 1DC4A 4KZPA 3V7UA 5JH7B 1E7YA 1YZ3A 3CX3A 2W2XA 4H6WA 1QKIA 3IR7A 3NHBA 2I76A 3VZBA 1JA9A 3ND9A 4NEQA 3VVMA 5TX7A 4YRNA 4U7GA 4IOKA 1YE3A 3S5UA 2AH5A 4CUKA 4EKIA 5L3VA 3ZS9A 3AFMA 4XGNA 3V7NA 5T8KC 3GDOA 1JFLA 5JSUA 1ZKDA 3WK9A 2AJ8A 3JQAD 4DQDA 4RMIA 4N5MA 1CZHA 1YK1A 1ODSA 2L18A 4MUYA 2WKWA 3N8NA 5JVDA 1ONBA 1NOIA 1Y48E 4IEFB 3I5YA 2IVZA 3TYXA 1K5DA 1MIOB 2JIPA 5L40A 1Y8RB 1RRFA 1JHOA 5D8DA 2X13A 4MWTA 2FSVC 1HOTA 1WSAA 1YS9A 4YPOA 5KIAA 1RP1A 2ZJYA 1ORVA 4WESB 3ZGLA 4MW4A 1B16A 4NJOA 2UUCB 4ZTUB 1LX6A 3NIWA 2G9UA 4E5SA 2CLIB 1KK0A 2R5FA 5BN5B 4BQNA 2DX7A 2NNLD 4MVYA 3P2EA 3H16A 4TXMA 4ZMRA 1KTIA 4JVLA 4QVGA 4WNCA 4L50A 1E5XA 3ND5A 3LCJA 2PT9A 3MTJA 4TQGA 1E6LA 3WKBA 1IXYA 2WHXA 5COAA 2CV2A 5C1OA 4BCBA 1KDPA 2G3YA 5ALOA 3NTUA 1MFPA 2WA2A 3KB1A 3KM0A 4ARUA 4DE5A 3CINA 1C9YA 1Z4PX 2GZ2A 1RKUA 1YUMA 2A0XA 2DHDA 1KP2A 1DV1A 1MW9X 4W9NC 1NXXA 1PJ3A 1ENPA 5AHKA 3UV3A 2D2XA 3VZDA 1EB9A 1SZJG 2UUBB 3ZY3A 1Y3HA 1ILEA 1SUEA 3A9WA 1UZUA 3GLUA 3VO9A 1MN6A 2DKOA 2SKEA 1DIHA 1WO8A 2DY1A 4RSGA 3P20A 2WW8A 4G56A 2RK6A 4NEHB 2MIIA 3KYBA 4PZUA 4BJ5A 4GOMD 5AXAA 5CEEA 1XNQB 2GZSA 1JHUA 2YTZA 3PD1A 3NATA 2Z6VA 3SM3A 1UM8A 3E7FA 3IBCA 4QPPA 1C9KA 1ES9A 3P32A 5DEIA 3LQRA 4ESHA 5J40A 1CQIB 1UH5A 3ZU2A 3A2KA 1TZCA 1GEEA 4INJA 4V0MA 2MSEB 3VDQA 4WSOA 4MGKR 1IB0A 4A27A 4EI7A 2RGRA 2AG6A 4EB0A 3HMQA 3LY7A 1TD1A 4LHEA 5FIUA 3ORRA 4DLYA 2QN2A 3H5AA 2ZCUA 4J7XA 1EYZA 4MDHA 3EZ7A 1U28C 3ZG6A 1ZY2A 5K99A 3S29A 1ARZA 3U44A 3AH8A 4E5PA 3ANTA 3QKTA 4P4NA 2XPCA 3ISJA 4BQOA 1RRPA 1Q7CA 3GH1A 3NOXA 1QFMA 1BYUA 2YQ4A 3LP8A 4M8IA 1W0KD 3OTQA 2AXNA 4JVSB 1KOGA 1R4AA 4AP9A 1EK5A 2ONYA 3PGXA 3V1MA 1PW7A 5CHYA 1CQPA 2X0JA 3VYVA 4K0RA 3ORSA 1AHPA 2BM9A 4PX9A 1OH6A 3FNHA 2VIIA 1KZ6A 4MI6A 2PZFA 2XB9A 3ZGYA 1I7LA 5C1PA 1Y8CA 1VMIA 3NTRA 4V39A 3H9GA 3L5OA 3BF7A 2ZVQX 4HEA1 5J43A 3HUTA 1U0NA 2G70A 1XNRB 1GG9A 4YAOA 3WWDA 3ZI7A 2IUEA 4LXQA 3RCBA 2VRNA 2OQIA 6CHYA 4RK5A 1V45E 3C6QA 3MJDA 3S44A 3BCSA 3SFVA 3C3AA 3WQQA 5JVDF 1E3WB 3DV0A 3JALA 4N6NA 1OGIA 3FZYA 1OWLA 2KYRA 1NSYA 2MR6A 1UDWA 1FMFA 2EVWX 1XALA 3JZMA 5K09A 2HRCA 3SFZA 4DBZA 1ONSA 1OBVA 2FE4A 1N5JA 3PUXA 2GHIA 1TQ4A 2HMUA 4PSCA 1RTKA 1D8TA 2VWQA 3CNQS 3RSSA 4BNFA 3U80A 1TT5B 3PXUA 1NUQA 3GGCA 3W5AA 3FX2A 4E13A 4B35A 4EENA 3GRZA 2C7RA 1YZGA 3ZWMA 5EPUA 2QVZX 2AX3A 4F04A 1OZHA 3VX4A 3ZHRA 4YQFA 1S2NA 2HHCA 3GFSA 4MCAA 3NT5A 2BR4A 3RV4A 4IHKA 5JD5A 5JZVA 3BHNA 1L9KA 5IVPA 3H1EA 1CB7A 1N8SA 1QGOA 5DSTA 1OTYA 3EQ7A 5IXJA 2I87A 3EEOA 3N7TA 3G5AA 4MKFA 3QUAA 4A1OA 2CD9A 5L51A 1T3ZA 1NURA 2Z95A 3QKUA 4L3OA 2CW5A 3HY6A 4DUPA 3IQXA 1YS1X 3QG1A 5DBIA 4FILA 5CDFA 2GAFA 3MTQA 4DR5B 1LDGA 1OKKA 4YJHA 3GLIA 4DMMA 1MH1A 4U02A 4D9HA 1CETA 2WSMA 3FGNA 4UU0A 4JI0B 1QHNA 1PK7A 2YC2C 1JSZA 1NW3A 2OB1A 3C6BA 3CLSD 3INRA 5DTIA 1V8OA 4QYWA 1D2EA 1GQQA 1VL5A 1GT91 3WHLA 1O3YA 4UMEA 2CKMA 3PJEA 1RCUA 1TVCA 2NSYA 2VR1A 4EEZA 3VOAA 1SVNA 4HEJA 3CRRA 3WMGA 4XJVA 1PJSA 3KEQA 5FBKA 4QQNA 4DJEC 4XJXA 3GCGA 3EOZA 3MUOA 4JJ6A 3TQCA 1P2GA 3KJFA 3RPEA 4V3BA 3SDBA 3ZXUB 1Z2OX 3CM0A 4TQ9A 3MS2A 4MH0R 3T3MB 2K87A 5HZMA 1FFEA 3ESXA 1FE8A 1K88A 1HH4A 3LGXA 3RVRA 3RVKA 2JB9A 3CO0S 3TBFA 3UJHA 3W79A 2EFDB 3FNGA 2BZ0A 3OQVA 5FBWB 3RK0A 1CDEA 3GUYA 1NVVR 3WLNA 1WD5A 5CPFA 1SZCA 3LT4A 1XLVA 4W6QA 3R76A 4RS3A 1JJ7A 3VO2A 4ZANA 1AS0A 3GWZA 1HC7A 3MB5A 5T4EA 4AJEA 2QM3A 4NU0A 2COUA 1L4MA 4KQFA 2MT9A 2VPZA 2Y0EA 5ESRA 4XWGA 2VYFA 4A8JC 2HW8A 3PFHA 1ZM2A 4KLNA 4DYHA 3K0AA 1PHRA 5C4MA 2VQEB 3OIVA 1BXZA 1T5HX 5FUQA 3B1ZA 1FNSA 2AFHA 3I30X 3JSXA 2LD4A 3AU9A 3QTLA 3WE7A 3IIJA 3KOWA 4UJ5A 2DKFA 1K8RA 4ZAZA 4RPLA 4JWTA 5IM5A 4AZ3A 4TQAA 4RK7A 5SZJA 2Q62A 2DPMA 3DCNA 3GQBA 3FFTA 3CZQA 4URYR 3OEEA 5BNFA 2QTHA 5C35A 1GGNA 2VHTA 2WT9A 3BE5A 5IABA 2J67A 1X86B 1CVRA 3I6MA 3TINA 1FS5A 2I34A 4RTOA 3NPAA 4N03A 2P91A 5D1NA 5TMPA 3MYYA 4EGCB 4D9NA 3PWTA 1FXWA 2H1CA 3COVA 5FI0B 4CTOA 2FWRA 4FYYA 2AXEA 4LZOA 4C1NA 2GJ8A 4WCFA 3WIUA 4Q9IA 1P4GA 1QR6A 4J6EA 3SS9X 3D4LA 4YA6A 1JUDA 4UM7A 4MQEA 5KYVA 1O87A 3BULA 3LUHA 3VZSA 3WDSA 2FPOA 1QX4A 1D9ZA 4FJ2A 1GHTA 2X0RA 1B7GO 4RBNA 5AJXA 2HBZA 3SPXA 3V32A 3GJ5A 3EFBA 1YRYE 2VT3A 3LY9A 2FZEA 4OHWA 4WCDA 5EXPA 5T6MA 4E1BA 5T64A 4CL0A 3QYPA 1AHHA 2A3NA 2FHSA 2ZPUA 3S2FA 3MUEA 3DR5A 4FZ5A 4ISBA 4LXGA 4EB3A 1OGYA 1V4NA 2R25B 5JARA 1OAKA 2H1RA 3B20A 4HQRA 3I1FA 4ASUD 2WSIA 2VHCA 3KSMA 1NDQA 1NVEA 2Y9PB 1XMXA 3L7AA 2QVCA 4O8CA 4BQIA 4CLRA 4BRWA 4FC7A 1ZBDA 3REQA 4CM8A 4TTVA 3IKJA 4WLEA 3PDHA 2CVHA 4PSAA 3GAFA 3TD9A 2V6IA 1XNHA 3IEPA 3W5HA 4EGAA 1UBRS 1KNXA 2H31A 4BKUA 1GU7A 1JU9A 3PQ4A 1JFFB 1M33A 1USWA 4K8OA 3F3YA 4ALJA 3F7TA 4WTOA 2BGWA 1E3MA 3CV3A 2Y71A 2X0FA 2EL9A 3MA0A 5F7OA 2NNWB 1NBAA 4DCTA 1N4DA 4A91A 5AVUA 3R3VA 5KREA 3Q9UA 3IL2A 2V59A 5KOIA 5L7TA 2B3DA 2DC1A 3HBAA 4YHBA 4E09A 5MGBA 4OOEA 1EEXB 3H04A 3SI7A 4AJ4A 3ADCA 4FZJA 3JQEA 4XIGS 1FX0B 1NE2A 1W73A 2HWYA 3C3WA 3EARA 3PUYA 4J2OA 4U8GA 9ATCA 1KAHA 1I7DA 2Z5GA 1IXZA 3LRPA 1GNVA 5AP9A 4RY8A 5LBTA 4YUXA 3PQ7A 4FINA 1F1BA 1P74A 1YRLA 4AJPA 1PR3A 3SS7X 1VSQA 2V0CA 5CXXA 3MWEB 2H4XA 3BFPA 2OXIA 2FSGA 1UPFA 5JBNA 5KHOC 1PLJA 1T2EA 2A88A 3RROA 1XZBA 5EG5A 1FUYB 2C5FA 5IXSA 2C4TA 2D2EA 2DWUA 3EFOA 4EPTA 3ZNQA 2IKSA 3B85A 3DHNA 4RCVA 4D98A 3GUUA 1H2WA 1NF8A 5AXCA 1ADCA 2G67A 1P5RA 2NWQA 2R6DA 2VDOB 4QYIA 3OQJA 4BVKA 3KB8A 2DBVO 2P6PA 2Z2KA 1L7EA 2QT0A 1IQPA 1UEXC 3OCUA 4LVUA 4PYLA 4RPCA 4G2NA 4Y9DA 4DLZA 3TM4A 2XYVA 1MLDA 2CXQA 3FF1A 4QARA 2R8PA 1NFQA 2SCUB 3HY4A 3CPEA 3C5CA 4YCCA 5BWMA 3TSOA 1VMEA 1V48A 3BSSA 2W8BB 1UZLA 2BGIA 2XUAA 3IEIA 3R7AA 1E2HA 3EYAA 1GLNA 1XP5A 3OZTA 1O6BA 1XRLA 2NADA 1VSUA 2JCGA 4PO3X 4QYSA 1KZHA 3RF7A 3BORA 1Z88A 3TIXB 3DQPA 4E70A 4LHXA 5KEIA 4GMKA 2FWBA 4OUDA 3EGDA 5K8TA 2BKUA 4G0ZA 1CC1S 3INGA 5IAEA 3T38A 1J1ZA 1X6VA 4TS9A 1ULTA 3T6KA 1BOOA 1V8PA 1FXWF 2B1RA 3FLMA 1IAVA 1YZYA 4MV3A 1IJKA 4O2AB 3C6KA 3K2QA 1ZCAA 4FFVA 4O4JB 1IJBA 1DAHA 4NRDA 1FUIA 2QLNA 3PJFA 5E3IA 1NW5A 4Q34A 1B93A 1U0RA 2J5RA 3IEMA 3GP5A 2HC9A 2FSSA 3K9BA 4KU4A 2GNOA 3GLIB 3EIFA 3AB3A 4C1BA 3K6JA 2QPOA 4NF2A 4P5PA 1CQJA 5E9AA 1I1OA 2E89A 2BFOA 2DG2A 2TS1A 4JITA 3CZPA 3PPIA 4U4AA 1ZD4A 2WSLA 3X2FA 5AMXA 1EP3B 2CJYA 4HZIA 4A0QA 5ICFA 2ES4A 3QFRA 3RNOA 1NNSA 4HT3B 2NUPB 3FKSD 3NBFA 1L4EA 4XB2A 3F2VA 4R40A 2ZT7A 4AULA 3OEWA 3VPXA 4C20A 1XQ1A 3VJMA 1VBKA 1ML4A 2ALJA 2IF0A 2JPDA 3S55A 2FPKA 3IOEA 4TS1A 5LJLA 5TPWA 5KYYA 3CYFA 3G0HA 3CUKA 1XZ8A 3TZCA 5E6RB 1TF5A 3PFWO 1QG6A 4I4NA 1R0WA 4KAFA 3RJZA 2JJ2D 5ELLA 2ERXA 4BVLA 2CV1A 3R7SA 1EA7A 1R0KA 1NZJA 3LDUA 3GRKA 3LP6A 1ACJA 1U1DA 2ABWA 2BZGA 2J0UA 3VTAA 4MV6A 3N2ZB 4DA0A 4B1FA 1WMBA 1YBAA 3ADDA 1PJRA 4DSAA 2J4FA 3BSFA 2W6OA 1MXHA 2NO0A 5C1DA 1JDSA 1L5YA 2XNDD 2Z2XA 3C3MA 3KKEA 2ECFA 2VFAA 4FYJA 4QX6A 2R65A 4CW7A 4YR9A 1M83A 2JDID 2Z2ZA 1B0UA 2HNBA 2E82A 4U3JB 5KQGA 1USVA 1UWLA 2YBEA 3PJDA 4AS2A 1SOUA 5BV8A 4WAUA 4ZDWA 2ORYA 1RI3A 2AYZA 2DUNA 5D7BA 3VPGA 2ZBDA 1CG6A 2NGRA 2C3OA 2PSHA 3DWFA 1M1XB 4HDSB 2IH4A 1G3UA 1NNEA 3K9GA 3O03A 1RC1A 2P4EA 3N1UA 4I9HA 4OH7A 3L82B 1D07A 2Q28A 3H5VA 3OLYA 5KKCA 1ESCA 2RC6A 3T06B 1R4ZA 4POOA 2X2PA 3KZCA 1RYMA 2VZ9A 4WOBA 4RSMA 3K0SA 1M34A 4OQEA 1MENA 3QQ5A 1DLIA 3PDCA 4Y1GA 5CTJA 3I6YA 5FA8A 4D25A 1Q0ZA 1SC6A 1TM5E 3RK1A 1NUUA 4Y2JA 3G23A 5A4IS 5LIPA 1I3LA 1N2XA 2DPXA 3UIEA 4XDGA 4CN9A 4Y2RA 2PX8A 4ZXPA 1QC5A 3ZWYA 2AFRA 1L1QA 3UJ6A 5CMLA 4BNWA 1XTTA 2OHJA 3VOTA 1W85B 1S8AA 3UY4A 3OP1A 1RFLA 1DFGA 5EYPA 3R9KA 3W8DA 2HRDA 2OCAA 3KVNA 4ZPJA 3C5HA 4F6LA 4C6TA 4HAZA 1H4TA 2XHZA 3FCOA 3NH6A 5EXXA 4PG8A 4PGAA 5CITA 3RAEC 3U7HB 3F6EX 5EE5B 3G8BA 4NDNE 3TDMA 1GPBA 1L7PA 4D3SA 3GV0A 1LDYA 2RGCA 2W8ZA 3AF6A 1DQNA 2X0DA 3PBKA 4KXFB 5KYTA 3EEIA 3ELYA 4OF4A 1CS0A 1ZP6A 1XA3A 3HB7A 4PR3A 1N7JA 4ZAXA 4YUZA 5CFLA 1KORA 2ID4A 3WWEA 3W5JA 2JIZD 1SUSA 3ELDA 3KKQA 2FK7A 2IP2A 4W5QA 2AIRA 2O7RA 5CFRA 1NP3A 4BKPA 1B1AA 2BYTA 4TVKA 2QR2A 4B7AA 3WKCA 2Z9CA 3B12A 1NMSA 5JDIC 2H5EA 4XAQA 4GIBA 4ZJUA 1P7WA 1HDOA 5KC8A 5A7FA 1O97C 1Q0SA 3ICCA 5AJWA 2HY7A 2AQKA 4PWZA 2BHNA 3RS3A 2R751 3OCVA 4OYLA 5GZ1A 2C4VA 3KR1A 3LT5A 1YA6A 3EUAA 3DDNA 4IDQA 5KX5B 2HHJA 3OM1A 3R3WA 2QUBA 5KDLA 1TZMA 3UMVA 2HEIA 3WLMA 4B87A 1U9IC 1BROA 3PEWA 5KNDA 3P4UA 3OZVA 2WV9A 5G0TA 4KQ9A 3W2GA 3DEFA 2X9QA 3EVNA 3L7DA 1X80B 3WI7A 4R01A 3ZDCA 4XDYA 1INLA 4MVJE 1IZ7A 4N39A 1ZN9A 4MW2A 2JIBA 4QXQA 1XZJA 4JUBA 3SFTA 2Q2WA 4ENRA 1CE8B 3AYXB 7ABPA 2IS1A 3QENA 3ZBQA 3REOA 3HDVA 1XN1A 4DXAA 5B6JA 1U9JA 4V3CA 1QV6A 4Q9JA 1PEYA 1E61A 3LYLA 4GBED 2NAFA 3F78A 1CRQA 1OVMA 1TK2A 1K3TA 3NYWA 2OAEA 3NQ41 4I55A 4YGXB 4MVCA 1MPTA 4RZIA 4CG1A 5F4ZA 3EB9A 2BGRA 5LIRA 4PZ9A 1UDAA 4TTTS 1RYEA 1W2WB 2VDUE 4HXEB 2R79A 2LIVA 2G83A 2W2KA 4FMCB 3KT0A 2KE5A 4ONEA 4B44A 3AVPA 4MO9A 2O8BB 5B58T 1TKAA 4BNLA 4D3XA 1RIIA 3KOYA 3GGDA 2X3UA 5FL3A 1EPUA 1N57A 4NJEA 2IITA 3UMFA 1A2KC 2WU8A 1HQDA 4CKWA 1U6KA 4ON9A 4TTIA 4DCGA 2O2XA 4BO7A 1OAOA 1UT5A 1D6SA 3R7NA 5CU7A 5CDUA 3AWIA 3AJDA 1B6SA 4EZIA 2P0YA 1G6KA 1L2TA 1IY0A 2Y1EA 4WCVA 2OZPA 5AUQA 3H65A 4L8VA 5I9BA 4Y1RA 1ZGAA 5KQPA 1I7SB 3M81A 3VX3A 3DFMA 3P2MA 3RSZA 2NYUA 2HKIA 3V1TC 2A5JA 4R2JA 4HGPA 4BZZA 4C6SA 3T0IA 1H66A 1ODIA 4BOYA 3AEUA 4DXDA 1SXGA 2AA3A 1D2NA 3RYIA 3IJPA 4Q1DA 4NG4A 1JYFA 4QUDA 4D6YA 4ARAA 2P1ZA 4FGJA 1BE1A 2DKNA 1X1QA 3VR4H 4M38A 9LDBA 4RDIA 4RZHA 4YROA 3T1QA 3UHPA 3VYRB 3LWNA 2F3SA 3CLRC 3O0TA 5KQMA 2IRWA 1V47A 1BXGA 3CUWA 5BVHA 1DAEA 2FFBA 2Q2OA 2I33A 3VSBA 4EYOA 3UJPA 3W5BA 2GEKA 1UBMS 1JKJB 1QHEA 1LDEA 4YK7A 2G9NA 3GMIA 3GLFB 2D5IA 4TOIA 3FOAA 3BGDA 2Z1DA 2Q5OA 4BTLA 5EHXA 2FMXA 4W5RA 3LZDA 1IBKB 5TE9A 3L84A 3TFOA 3BJRA 3BAFA 1E3LA 3ENQA 1JDNA 5DHPA 4ZJYA 5M7EA 1YZTA 4EL0A 4J7AA 5CBKA 1MB2A 3VKGA 2EX0A