3FIUA

Structure of nmn synthetase from francisella tularensis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
244
structure length
238
Chain Sequence
DFSPKEYSQKLVNWLSDSCMNYPAEGFVIGLSGGIDSAVAASLAVKTGLPTTALILPSDNNQHQDMQDALELIEMLNIEHYTISIQPAYEAFLASTQSFTQLVIKGNAQARLRMMYLYAYAQQYNRIVIGTDNACEWYMGYFTKFGDGAADILPLVNLKKSQVFELGKYLDVPKNILDKAPSAGLWQGQTDEDEMGVTYQEIDDFLDGKQVSAKALERINFWHNRSHHKRKLALTPNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Nicotinamide mononucleotide synthetase is the key enzyme for an alternative route of NAD biosynthesis in Francisella tularensis
pubmed doi rcsb
source organism Francisella tularensis subsp. holarctica lvs
total genus 85
structure length 238
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2008-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fiuA00
1TYCA 4OJMX 4PBRA 2CV1A 1H3EA 4H3SA 3SZ3A 1M8GA 4NATA 2CT8A 1GN8A 1EFPA 3E27A 3DLAA 2CYCA 1GLNA 4MUFA 3BL5A 1IH8A 3IMEA 2J08A 2QUIA 1KH3A 4KR9A 2WQ6A 1NUSA 1S4MA 4ND7A 3X1JA 1MBZA 3P0IA 4ZT3A 3KT0A 4EG1A 4MUKA 2O8VA 4ZT6A 4WNYA 3DV2A 3LCJA 5FNZA 2I1LA 5KHAA 3INNA 2E21A 4QBTA 4AQ7A 1U3CA 1JILA 4I6GA 1EFVB 1OWMA 4XFJA 1I6MA 4DE5A 3ELBA 2QTNA 1I6LA 3AKZA 1Q19A 5DK4A 1MRZA 4MVXA 3P52A 3KT6A 1N78A 4EF6A 2CSXA 1O97C 1F4LA 1PFUA 4TS1A 4ARCA 3CLSC 1J1UA 4P2BA 4UZEA 3RBAA 1KORA 1N2EA 2D13A 1WXIA 1IQRA 3MXTA 4MW0A 1NURA 2A7XA 2VXOA 2WB2A 1MB2A 1N2GA 3HMQA 3UMVA 3ZJUA 2OQ2A 1MC1A 1TYAE 1TYDE 1V8FA 4Q93A 4ZT7A 3SDBA 5K0SA 1O95D 3CVXA 1EFVA 3FY4A 2R5WA 4YP7A 2JANA 5J5AA 3IVCA 1M8FA 1JIKA 3A05A 2J4DA 2H2AA 2DPLA 2YWCA 3PNVA 1J09A 4ZCRA 2E18A 2E0IA 1WXHA 3SYTA 2OV4A 1I6KA 1PFYA 3AG5A 5EKDA 3G6KA 5K0TA 1M83A 5DASA 2HZ7A 4ZCQA 3IMGA 3K32A 2QUKA 4G5YA 2X3FA 1BS2A 1I2DA 1QTQA 4EGAA 5TEVA 4EG3A 1QRUA 1KQPA 1OWNA 3GUZA 2DLCX 4BWVA 4X0EA 5KWVA 3KT3A 1JECA 2V0GA 1H3FA 5KCMA 1N2IA 2IP1A 3FNRA 2CUZA 1DNPA 2D54A 3IUBA 1RQGA 3ND5A 3N9IA 2AZXA 3I05A 2V0CA 3IOBA 3TZLA 3CLUC 4CQNA 2DXIA 1HYBA 2IELA 3COYA 1VBMA 3RFFA 2CYAA 1XNJA 1O5TA 1P7PA 4YP5A 2AKEA 1KH2A 1LI5A 1EXDA 1QU3A 3ND6A 4PBTA 1GAXA 1JMVA 1KR2A 3F3MA 1IFXA 4S1OA 4KR6A 1X6VA 1FYDA 1WQ3A 1YI8A 2J07A 4DDHA 4ZCTA 2D5BA 3H97A 4KR7A 1QRTA 5IJXA 1O94D 3CLTC 3AL0C 3N8HA 3A2KA 1GPMA 1T6XA 4YBRA 4DJAA 2EL7A 2QJTA 1MB9A 4MAFA 1OWPA 1PFVA 3OTWA 2CFOA 3IODA 3N2YA 1N2BA 2QJOA 4DLPA 2HGZA 2YY5A 2VTBB 1XNHA 4EG7A 5HUHA 2X1MA 4ZT4A 1XJQA 3HFJA 2CV2A 4MVWA 5LFAA 3TQOA 1NP7A 3X1MA 1N75A 1O96B 1G59A 1U0BB 1D2RA 4JYZA 3MLBA 1TYBE 1WKBA 3CLRD 1Q11A 3JXEA 4MWBA 3ZGZA 3H9CA 1YUNA 1ZJWA 1CT9A 2DETA 3COVA 1Y42X 1G8HA 2A1UB 4Q16A 3HZRA 3ZXSA 3U1VA 5J58A 1J20A 1LI7A 4MW7A 1WZ2A 4F4HA 3QTTA 3SZGA 2X1LA 1J1ZA 3IMCA 1JEEA 1NUTA 2VTBA 2QJFA 2RD2A 3ISJA 4WSOA 3TNJA 4MWDA 5DB4A 1N2HA 4ZT5A 1PFWA 1JIIA 5AHWA 4AS1A 1T9GR 1O96A 2AG6A 3CA8A 1OD6A 1TEZA 1YIAA 1PG2A 3M5WA 1K4MA 3FH0A 3UOWA 1MAWA 3H05A 4MW5A 2PXHA 4ND6A 2A84A 2BTEA 3L93A 2QUHA 1EE1A 2X0KA 2PG3A 1T9GS 2A1UA 3Q4GA 3OP1A 1N1DA 3ZUGA 2DERA 3C8ZA 1JZSA 3TZEA 1WXEA 1KAQA 1NUUA 1JIJA 1WY5A 4J76A 1ILEA 3K9WA 4OUDB 5FO1A 4A91A 2O5RA 3RK0A 3ND7A 3IUEA 1VBNA 4CDNA 4K03A 1OBHA 1Q15A 4QREA 2E89A 3CVVA 4U7JA 1ZH6A 3IOEA 1WXGA 1NZJA 3SP1A 2GM3A 5JBNA 3ZXIA 3Q10A 3ZIUA 4MUIA 4CDMA 1KP2A 1KQOA 2CV0A 5FO0A 2IJGX 5H7XA 1O97D 1U7DA 1IQUA 4F3RA 1N77A 2DEUA 4ARIA 5F23A 3CLSD 1QQTA 1B6TA 1N2JA 2QUJA 1MJHA 2QTMA 3LOQA 3G59A 3COWA 4G6ZA 1KH1A 4ZCSA 2Z08A 2J5BA 3PRHA 3AG6A 4ZCPA 4L2IB 4RPIA 4OUDA 1GTRA 3MMXA 1K92A 2J09A 4EG5A 2H29A 3SEQA 4MW6A 1J21A 3VU8A 1OWOA 1ULHA 3ILVA 4NZPA 3UC5A 4EG6A 4QRDA 3FWKA 1IRXA 2DUMA 1WJGA 3FOCA 4NAUA 4PY2A 4JXXA 2PFSA 5TS2A 1QRSA 2WSIA 3MUEA 4HJXA 3IOCA 1KQNA 1QNFA 1PG0A 1EUQA 1KKUA 1WOYA 1F7VA 2A86A 1LW7A 1MOPA 1M8JA 3COZA 1R6XA 1UFVA 4NAHA 4KPUB 3A04A 1V47A 3GMIA 3QE4A 4ZT2A 1OBCA 4EFKA 4HJRA 4L2IA 1WXFA 4JZYA 1G8GA 4YP6A 4XSVA 5IHXA 1R6UA 3L92A 2ZUFA 1KP3A 1T6YA 2JA2A 1JZQA 3NBAA 4I6JA 2DR2A 2PIDA 4J75A 3CLUD 5LLTA 1MAUA 1Q77A 2YWBA 4JFAA 2YXNA 3UY4A 1VL2A 1SURA 5BNZA 3HL4A 2CYBA 5H16A 1VLHA 2NZ2A 1K97A 3PNYA 3PXUA 3X1KA 4DDMA 3HGMA 3D6VA 4I6EA 3IVGA 2HMAA 1GTSA 3CVYA 3FHJA 3CLTD 5LM3A 4HK4A 4MW9A 3Q12A 3VRHA 1NUPA 1O95C 2QTRA 4KKVA 3FDXA 1EUYA 3IVXA 4MUHA 4KPUA 1O0CA 2ZUEA 4DDKA 1NYLA 4E1AA 1IVSA 1R6TA 2WQ7A 1N2OA 3P0JA 4NDAA 1X8XA 4MULA 4G5FA 1U7XA 3HV0A 1QJCA 3ZJTA 3IH5A 3FETA 2G36A 4GU5A 1H1TA 5TGTA 3G5AA 1QU2A 4MW2A 4YMIA 3AIIA 4EG8A 1O0BA 4MUEA 5HUJA 1J70A 5HG0A 3RHSA 1ZUNA 4JXZA 1IQ0A 4R2LA 2A1TR 3FIUA 1U3DA 3CVUA 4K0RA 1NUQA 4R0NA 3S3TA 2NSYA 2XRZA 1ZH0A 1YULA 4CT0A 4MW1A 4MQ6A 3KFLA 1WQ4A 3H99A 3KT8A 1M8PA 4MLPA 5J59A 2A88A 1TQ8A 2A1TS 4MVYA 3PNBA 1F7UA 4U8HA 1NSYA 4MWCA 3RK1A 2XRYA 1VBKA 1F9AA 3QTBA 4R2MA 5DEOA 3UK2A 1JHDA 1K4KA 4MUJA 2C5SA 3FI0A 4DNXA 3AFHA 2Z09A 3TQIA 1OWLA 4GRIA 1IHOA 2EJCA 4MVCA 3N05A 4MUGA 3GLVA 1YUMA 3SEZA 1YIDA 1O94C 1A8HA 3A4IA 2BYTA 4RUKA 2Z3VA 1T6ZA 1H3NA 2ZP1A 1GZUA 3NV7A 1G8FA 2TS1A 1FFYA 2A4MA 1XNGA 3H9BA 4U63A 3CR8A 4MWEA 3CVWA 1M8KA 3DPIA 1TFUA 2PZAA 3TS1A 4HPWA 1COZA 3DO8A 2GKSA 1EFPB 1JEDA 1EJ2A 3ZJVA 4MW4A 1O6BA 3MLAA 4NX2A 4PBSA 3LE8A 4XFDA 3IDFA 3D6UA 2B7LA 4FZJA 3FG9A 5TEWA 3NBKA 2GOYA 2RE8A 2PZBA 3CLRC 1NI5A 4UZFA 1JGTA 4EG4A 1N3LA 1KAMA 4MUNA 2PZ8A 3RJZA 3VGJA 1M1ZA 2JAXA 3P0HA
chains in the Genus database with same CATH superfamily
2DSNA 3TN7A 4FYHA 4CMHA 4DCTA 1LPPA 1GGHA 3UK6A 1E6KA 1ULBA 3RFVA 3PQ7A 3AB3A 3HSSA 3U3MA 3SZ3A 1L4HA 3L8DA 1EFKA 1M8GA 1PQYA 3BG5A 3HCDA 3I3OA 1QIIA 3W2GA 4G5XA 2Q6LA 4BLSA 2A30A 1PJ8A 4L9RA 4MR7B 1LRJA 2CYCA 3GG9A 3ZS8A 4R3NA 1C7FA 3DYIA 2DJ5A 1J97A 4HN4B 4TLCA 4BECA 3CTMA 4AP9A 4KO2S 3VO1A 2XUIA 4FFVA 3SSMA 3ME5A 5AIAA 1UJNA 5FRDA 3VPCA 1ZIDA 2JI4A 3HXKA 1UWLA 3PC8C 4Z1MA 4CCAA 2WJIA 4PPQA 4AX4A 4BJ5A 3C6QA 1EFCA 4FMCB 1XZGA 2JFGA 3PEVA 4GMKA 1EUDB 1UDWA 3RKSA 1IPFA 1Q21A 1AE1A 3EDYA 3QU4A 4IDDA 1A2QA 1KMHA 3UHOA 5C7YA 1ZCFA 2O14A 2QYTA 5JNSA 4U39A 1EWVA 3TW6A 1D7OA 1G16A 4A0GA 4RPKA 4DILA 3VZCA 3R8CA 3DMHA 3BHIA 1NPTO 3LQRA 1ZH4A 3GARA 3OQIA 2JIOA 4OSEA 4Y3UA 3T7AA 3S2UA 4EHDA 1CUXA 1MEEA 2I99A 1P9OA 2ECKA 2Q5QA 1WCV1 1XTSA 4Q3NA 2HJSA 5M29A 2IEIA 4MRSA 1OB5A 1CEQA 1BKSB 4F6LA 2ZJOA 4NJMB 1I6LA 1D07A 3IBGA 3RAGA 2NUAB 4LYAA 4D6YA 1ZOIA 5JDIA 3N3BC 3ZCPA 2E4YA 5EIAA 4BVKA 4DZRA 5JJ5A 4Y98A 3IC5A 4OA8A 4BB5A 4DIOA 1NV8A 1XL0A 4HD8A 5GTDA 2G5GX 3VC3A 3KS9A 4NCJA 1N92A 1FDSA 3MJCA 4K0KB 1CZKA 2ZVJA 1C29B 1E5QA 1ZA1A 2Q07A 5CW2A 3ZY4A 4EUSA 5GZ1A 5J3JA 1QZZA 4QTXA 4KP7A 4RS4A 2P9YA 1I30A 5KJ1A 3R9IA 1T36B 2W9XA 2Y77A 3G5LA 5B3JC 1MB2A 5IYZF 1W0KD 3GJ5A 4KH0A 3L7IA 3LT5A 3O3CA 1EM8B 4RF2A 3HCAA 4OP2A 1KEWA 4CV2A 3BIXA 1FFXB 3FY4A 3O2SB 4Q24A 3OF5A 5FULA 4HUTA 4YT5A 4JL6A 3PQ5A 1VTKA 2JH8A 3TSZA 4RK7A 5E2IA 3OLYA 2VNJA 5DM4A 2PUDA 3PNVA 2OBYA 4IQ8A 4V02A 2NU8B 4P7GA 3CJRA 1QOPB 4WWHA 5K0FA 1USVA 3MAJA 4BAUA 4C4OA 3TLGA 4YPVA 1PZHA 3R9WA 4F91B 1IK6A 4J29A 2RC5A 4PGAA 2F1IA 3N1UA 5AK5A 5TXGA 4OBEA 2Z2IA 3S70A 4UEQA 3I52A 3P2OA 2CDNA 2HNBA 3R3ZA 4KRYA 1E2UA 1RBZA 5FDFA 3BD8A 1Z0FA 2VVTA 3CIFA 5ITSA 1DOAA 3V7UA 4IHJB 1VKJA 5TEVA 4CQLB 4Y7DA 5CCBA 5DBIA 4LJ4A 5ESXA 2ZB7A 1L5MA 2PX8A 1RHJA 4BWVA 4QFDA 5M7EA 4LNUA 2OENG 2AMLA 4WKCA 4AXXA 1LTHR 3JQ9C 4M1WA 4F0JA 5J2UA 2IVZA 2ZJ6A 4ZEXA 4F2HA 4UNSA 1Z16A 4EATA 1A8SA 4P1ZA 1FRQA 2CXSA 3OEHD 4UXJA 4DA8A 1I0IA 2WJVA 1N1EA 1E1RA 1WUHS 1IZ9A 1SFRA 2QHXA 2I1WA 2W8ZA 1TCBA 3AJ8A 2WIGA 4HMOA 4PZEA 1PX2A 3BX1A 4TVOA 4HVCA 2OG2A 2OG1A 4IMJB 6AT1A 2IODA 4LJAA 3CBGA 3UWOA 3K0EA 1XNJA 1P7PA 4R8LA 1DXYA 3UJBA 4ECAA 2JFOA 4JR2A 4P80A 2K87A 2NUTB 4C22A 3RE1A 1UMKA 1BGWA 1QAQA 4GWKA 1Y9ZA 1ZM7A 2HQ1A 3DKVA 1T8RA 2P5UA 3DL7A 1A96A 3HWRA 4UNIA 5JNUA 5LQRA 2GESA 4DGSA 1YZYA 3KTDA 1BCSA 1P80A 5NULA 4Q9KA 2HQRA 1FFEA 1ZD4A 4JEMA 1T6XA 2EL7A 2LNDA 4FDUA 1Z5GA 4IDNA 2BEUA 2JH9A 2DWUA 2FCAA 3L0SA 3FM9A 4P3YA 5GOZA 3P9CA 2YS6A 3CZRA 2HTFA 3E7DA 3ETCA 2GSWA 3FDIA 1J0CA 5IMSA 1ADBA 4PYQA 4A15A 1PDVA 5FUVA 3H2SA 3PE3A 1N2BA 2CLMB 1U04A 2QEQA 3EISA 4G25A 4V2IA 2IP4A 3ZY2A 1NVWQ 2WFLB 2FN4A 3W3ZB 4AY6A 1MAVA 1QE0A 3LX8A 4RS3A 4ER0A 1KSGA 1SD5A 1P44A 2GA8A 2GX6A 5E3IA 4CE6A 4CZ2A 3DEYX 2RAPA 2X2OA 4LZWA 1NI4A 3OMWA 4WN9A 5EIBC 3TFQA 5C46F 4YJGA 1N57A 4NVRA 3X1MA 4ADSG 4P4NA 4A92A 1ESMA 2X19A 3GGJA 3FJOA 1ADJA 3WY9A 1AT1A 1MNAA 2O6HA 3ONNA 4J0GA 4KFTA 4O2AA 4YQZA 5BQ5A 1XCGB 5KQPA 1B6RA 5DXFA 1TUGA 2YWHA 3ZQ6A 1J5EB 1UPFA 5ALPA 3P94A 3NH9A 3O8BA 4DANA 8ABPA 2CXQA 4HXGA 5DIZA 4C7OB 4S12A 3PVCA 4MUBA 3DA8A 1MB4A 1R74A 1VJ0A 4IGKA 4W7HA 4B2YA 2Z6VA 3AGQA 4L0CA 3MB8A 2OXTA 4EJFA 3RYTC 2YMPA 4ZEVA 3GBSA 3P19A 3ZJ5A 4AF8A 2BC9A 4AU1A 4LRYA 4BX9A 4F2DA 5JSZB 4Y0VA 2OAP1 1UXGA 1K7YA 3NHJA 2CXUA 3FGZA 3N2NA 4R71A 1JVNA 2VSFA 3C7AA 3SC2B 5JS7A 3OLVA 3RYHB 4N41A 3NPMA 2W2NA 3KBBA 5AKKA 5FBQB 3UQZA 3GLIB 3DBHA 3EODA 4IEIA 5IM5A 1N6IA 2SKEA 4JH0A 3CA8A 3PHBE 3K5WA 3M5PA 4LUCA 4CRWB 3S2IA 1EHIA 5DM70 4R7TA 1AXGA 2GPTA 4K2HA 3FH0A 3GR6A 1MAWA 3DLTA 1RLOA 2HJGA 1I33A 3NFYA 2ZBEA 4J6EA 3N7AA 4DEXA 5H59A 4N5DA 2I4LA 3KG2A 4PC1A 2A84A 4Z7NB 4G81A 2IOYA 3EZFA 4TLEA 2G76A 3BSYA 4TTPA 4NLLA 2WZDA 2WW8A 6ADHA 4MROA 3RVBA 3LF2A 1N1DA 2ZBPA 1OLUA 3A27A 1Z39A 3C8ZA 5U4QA 3ZX4A 4AJ2A 1LSSA 1O08A 1SY7A 1U8EA 4FOLA 2YJNA 4N8EA 3VI4B 2CNLA 1OGIA 3LYUA 4IGAA 4RJIA 2I5PO 4WY5A 2B69A 3IESA 2ATIA 1OR8A 3QUSA 1UBNA 4KXYA 2Q8QA 1T0UA 2QTBA 3IPRA 1HTBA 5GPBA 4K03A 3VI3B 4QT4A 2I66A 2K5UA 3N28A 4I1SA 3GJZA 2C42A 1NXWA 2I3AA 1R0WA 2WJ4A 5EMMA 1M6WA 1ITZA 1GARA 2C2MA 4OYHA 1SCIA 3VNVA 3IQEA 3F7MA 1Q1AA 2YN0A 1KQOA 2A0FA 2PGIA 5CLIA 1CUJA 1UKZA 3FSEA 3BTSA 3OCYA 4G1MB 4LKRA 4D02A 4RCVA 4ISBA 4B40A 4ZYZA 2B34A 3HU5A 1BXGA 1D2EA 1CY4A 1X9GA 3A4TA 5T3YA 3W8NA 1B6TA 4KWCA 4TTQA 3WO1A 4PGMA 1TD9A 2QUJA 2EFEB 4GE3A 3TGPA 5CFZA 2CSUA 4B3HA 5J4YA 3WYGA 4CI0B 4IFBA 2PUHA 4B6QA 4M9CA 1MJGA 4CGZA 5ILQA 2YRXA 2H2HA 3W2TA 1DP4A 3IAS1 2VJNA 2W6ID 3U4IA 4AT1A 4RTPA 2YXBA 2G9NA 2CWDA 2OKGA 4AFNA 1TZMA 3PA8A 3PWKA 2J0UA 2EKQA 3AKCA 2F67A 4DNPA 2DOKA 3D6FA 4WV3A 3JQ7B 1OE0A 2GD6A 1UK9A 1A9OA 2J9RA 4B2PA 1NC3A 2QAGC 3VR5D 1FJHA 1P0QA 1Y7LA 5HYVA 3EVFA 1M54A 1RACA 2P0AA 3O1IC 3VKUA 4B73A 1DZ3A 4M0KA 2AQ8A 5EIHA 4ME6A 1U0RA 2HKIA 2J9FA 4ZYXA 1DUSA 4CF3A 1RJFA 1NXSA 1RLIA 4PYLA 3S2ZA 5L95A 4PS0A 4RO0A 1DJQA 1T6BY 4LN1A 3G2PA 2RKWA 4PLTA 4F93B 1XDWA 4OI0A 4JK3A 2PUAA 2JAOA 3SHOA 2A86A 1DC4A 3WBJA 4ZI7A 4H3HB 5ISMA 5LYJF 3F9RA 2X4GA 1FYXA 1RYMA 3IMFA 3CRQA 4WDRA 2ODBA 3DZCA 3MCZA 4D57A 5HHTA 2VRBA 4PPGA 3CNBA 3UKJA 3NHZA 4DL9A 1E1MA 2C9BA 2P9HA 4XM1A 1T6YA 2F8LA 2Q1XA 3HQ4O 4ZYVA 4MH0R 2V7QD 3EPLA 3B9RA 3IVRA 3KLBA 3U9TA 3ZHSA 4C5AA 1NW4A 4Z2YA 5AUQA 2F3PA 3RRZA 1RQXA 4BVEA 3VOAA 4N7JA 1JYFA 1SU4A 2FRXA 2VF5X 3QVTA 4B5LA 2QSYA 3DWIA 3R6LA 4TS4A 1WUJS 5G53C 4BFCA 2AC4A 1DO0A 1IG3A 1ZUNB 4LXXA 1A3CA 1PEYA 1GZDA 1DXHA 2W58A 1VE5A 5DYYA 5HDQA 3V8NA 3QPDA 4HDMB 4I5EA 3AFGA 2VUIB 4Q7EA 3LPNA 1X9HA 4QBGB 4DPKA 3HHPA 1RVDA 3RUHA 4UUAA 4V0OA 4YRZA 4LQDA 5F3RA 2MYNA 1D7AA 3V4VB 3D3EA 5DM2A 1B8NA 4FFRA 3SM9A 4FVTA 2PVSA 4AJPA 3OIWA 2G5CA 4YP0A 4ZOQI 2Q3LA 5D01A 1SVSA 1AVTA 2VHXA 5DO9A 4M53A 2ZYSA 2IHZA 3C3CA 2ODTX 2V59A 3A28A 3AQIA 2H3EA 3WV5A 1E3IA 1NYLA 4RXUA 1HEYA 3F90A 2ZWVA 1KDPA 4FYPA 1E2DA 1WR8A 3D6TB 3HLKA 4UHHA 3RSSA 3UAGA 1X8XA 1FU8A 3NGMA 4G5FA 2AC2A 4GDFA 3ANXA 2VSYA 2ZE8A 2I55A 3FX2A 4WD3A 4F84A 1H69A 1Z4LA 2AN4A 2QX8A 4FDAA 9ATCA 4QQNA 5AM3A 2FMHA 1C5KA 3VTKA 3K09C 2I2XB 5HUJA 3BIOA 3H8SA 1AD2A 3PR3A 1IQ0A 3HJBA 3LYAA 4MIOA 4NJEA 5EFOA 4UC0A 4GR4A 1HNWB 2VXYA 3DTVD 4YYZA 3GVIA 1A4IA 3VKGA 4ND4A 2R6GA 1L7XA 3MD0A 5H4HA 2C77A 3SBXA 5DBEX 2I9KA 2Y1DA 1A9XA 4BNJA 3RQIA 2I3DA 4MQ6A 3G85A 2OYSA 1JA0A 1R0RE 5JARA 5CM8B 3RSFA 2QN2A 1T9AA 3NTXA 1GRCA 3T1HB 2VAXA 5JSUA 3C85A 4QJ3A 5CFLA 2JGEA 2IH2A 4B3IA 5A04A 2FVXA 2CKDA 3Q72A 1R4NB 1N5KA 3PGMA 3OESA 3NWOA 3QTBA 2WWVD 2JJ1A 4MO2A 4IINA 4ZRDA 5A3VA 3T9FA 4UNNA 5DLDA 1NG1A 2NN3C 5L3SB 1W73A 2PUBA 3TQIA 3UYKA 4TL7A 2IZ1A 1SKBA 2JAQA 2EZ8A 4GRIA 4FNAA 4KX5A 1KIMA 2X6TA 2H11A 3W4JA 1YUMA 2R1TA 1QV9A 1JI0A 3N0TA 3PT9A 3ZU3A 4GSKA 1TEVA 4F9GA 4QHSA 3HMKA 2P4QA 4LZZA 1RRGA 3V8PA 3ICOA 3IX7A 2X0RA 3H5RA 3K0AA 3UW1A 5CYFA 3KKLA 1JU4A 3OBIA 4XWYA 2VJMA 1B3BA 1W19A 2C5AA 3LI2A 2YXDA 5CB4F 3WKBA 2XBUA 3LBNA 3ZJVA 1YDWA 4JV5B 5F64A 3L43A 4KIGA 5BO5A 1QBKC 4H15A 2YUIA 3M1IA 4ESOA 1QHXA 3BCHA 2CVHA 5L3QA 3IQZA 1IMJA 3MJRA 4NSNA 2B7LA 5CU7A 5L7TA 2Q8PA 1CDZA 2R6DA 3T3EA 4DIMA 3BHNA 3CH4B 1A8PA 3U3RA 3NDBB 4MKFA 3GO4A 2DHEA 4ARBA 5MDHA 5FR1A 4BFYA 3I2FA 3I9MA 3LCUA 5F7JA 2VS1A 3Q40A 3BXEA 3OF3A 4XGKA 1T29A 2QU7A 1A0OA 1MQ9A 4XCQA 1UBCA 3PNYA 4C2UA 2V5AA 1GXSA 1PZXA 1Y3DE 3KUCA 5ALYA 5AW6A 3LXMA 2AWNA 3NJ4A 1B4DA 5COQA 2P7HA 4TROA 2JVIA 3CCCA 4K46A 3L8FA 4TLLB 5KREA 5JATA 1G2IA 3GLHA 1UXKA 1VLVA 1MENA 2QS9A 4RK0A 5MFZA 1EFPA 1MVNA 5L7WA 2F55A 4MPRA 1COWA 1XQ1A 3ML1A 4GZLA 1MO6A 1PUIA 3ESDA 2I2BA 3C0KA 3EZXA 3FNIA 1D2GA 2WQ6A 4EP1A 2G28A 5HZHA 2R8XA 3IXMA 3RJ5A 3NTRA 4PWYA 3JQ8B 4I5IA 4EB8A 2CLKB 2I2FA 1P1JA 3F96A 4OXXA 5D7BA 2VHZA 5I9MA 1FDUA 1JNXX 3RVQA 3ANYB 5BUQA 4DBVO 1U2ZA 3UM9A 1BS9A 3E1SA 2WKQA 4C14A 1ZG3A 3S68A 5IEJA 5EQDA 1XLTA 3WIBA 3EWIA 2JBWA 2GK3A 2YYZA 1KVTA 4F1JA 1G8JA 2NU6A 3KZMA 3BQ9A 3DV2A 5ALOA 4RXTA 4PYOA 2I0FA 5DN6D 1TTQB 1E2HA 2G82A 1QHNA 5E6SB 3RC1A 2FLKA 4JDUA 4OTZA 4CV1A 4CMAA 2C2GA 3F5MA 3FKSA 3FZYA 2ZIFA 3NC1C 4ZANA 1DQNA 4E51A 2NP7A 1J2YA 2RCYA 5CFNA 5KOHA 1RW4A 1VYTA 1T5OA 4CT4B 4J1QA 1XDSA 3DLBA 1F12A 1IXSB 4QM7A 2EBFX 1NVVQ 3NS7A 4RKWA 3OQJA 1KO7A 1KR5A 3IUPA 2IYTA 2AR9A 1M5UA 4FMCF 1BFUA 2OESA 4PNPA 2XWQA 3T4XA 5JSHA 4UEWA 2FVYA 1JHYA 2YICA 4JL5A 4TS1A 1WP9A 4OVKA 4V0KA 3DMTC 1WDMA 4ZOBA 2WYWA 4CMIA 4J9VA 3QEMA 5C3UA 4Z4FA 3GUVA 4BXOB 4P2BA 1X86B 2AD5A 2BFFB 4TMFA 2IPLA 4QPCA 1PEDA 4KGZA 3W0LB 1WZNA 2QLNA 2VK8A 1RZVA 5J2TA 1YQWA 2YWJA 3F5SA 2LW7A 2FJPA 2PBFA 3STXA 1X0XA 3QG1A 4OHBA 3KZOA 1AY0A 2OILA 3RHFA 1Z6PA 1KRHA 1D03A 2XYGA 2RIPA 3FVVA 4M0LA 3UMVA 4G0OA 4A16A 4DMGA 1HEIA 3SDBA 4NXMB 1UQRA 1GUBA 3JX9A 1H1DA 3EIEA 3GDHA 2O0KA 5A9TA 4R2IA 4C7JA 1A7KA 5FTKA 3PC7A 3L7DA 1WAMA 3GCDA 4R1PA 3V4RA 1G21E 1N5LA 1L5GB 3FLMA 4B6OA 3VR4D 1EWKA 2QRJA 3B8EA 2QWXA 4RY9A 2PH3A 4IDCA 1BWSA 3EDCA 2PKQO 1JT9A 4D9KA 4B3XA 4WUTA 1ZC3A 1HY3A 4G5YA 3EARA 2WSLA 3CSSA 1YJXA 3DOCA 3HKEA 2ANBA 5CBPB 1VL1A 4LJSA 2UYCA 1OWNA 4C6TB 1JEQB 1E3JA 4WNAA 2Q2QA 3PYXA 5JNTA 3DEAA 3L07A 1S4QA 1N8NA 1JQBA 5LQCA 4RDXA 1BX1A 1GEEA 3BFPA 2VHUA 5F12A 1AS0A 1OJ7A 4QEKA 5ANRB 2VCEA 1FF9A 1X14A 3A0RB 4D6PA 4I2NA 2BGIA 4MA4A 3R76A 4BNMA 4E5SA 2PRSA 2NO6A 4LXYA 5K8VA 3CJQA 4BPRA 1O89A 2G7ZA 4WCDA 5GINE 1HM5A 1JLLB 5CLLA 4UTRA 3ZGZA 3A26A 1J90A 1IN6A 1P0MA 3O92A 4BKRA 3ESXA 2QSJA 3PV0A 4YJDA 1N8SA 2QPTA 4DDHA 2HSJA 1PJ4A 3CN7A 3D81A 4AWXA 4I99A 3UAYA 3DUFB 4C6RA 4KR7A 4O08A 5IJXA 3UO8B 3U16A 3ZDAA 4E03A 4KNYA 1FP7A 1NNUA 3L01A 3CS3A 4OH1A 1R5JA 2Y4OA 4CKWB 1YHNA 2ZZMA 1T0BA 3D3WA 3KR9A 5IKEA 2HMTA 4JC5A 4F8EA 5ICCA 1TK3A 3IIIA 1M0SA 3KCQA 5SYNA 5DTJA 1RXEA 2BTOA 2BSXA 4XR4A 2ZQZA 4YRQA 3PL1A 5BW6B 2JI6A 3MS2A 4UMFA 5FLEX 1KWKA 2WIKA 5HF6A 5T41A 1W30A 1Q6ZA 1YC5A 3NHKA 2XIJA 1ML3A 1YVRA 4YIHA 1EX6A 2VDPB 3DYBA 1M9NA 1LKZA 4PZUA 1AC5A 4CFSA 2QQFA 3BGDA 1P1KA 4E3ZA 4IS3A 5ESDA 4W8HA 4BO7A 3ZD7A 3HFJA 3VOBA 1NVAA 1JHZA 2HT6A 3LD9A 1TUIA 1OLXA 4HLUC 3UJ3X 5BUSA 5EIEA 1I9CA 3PSHA 2D59A 2VAVA 4LVOA 1DGQA 2YNMA 4OQXA 4OB7A 1L7VC 4GL4A 2W6CX 3HKDA 1U0BB 2QLFA 4EJSA 5HZMA 1M76A 3WZ2A 4C9BA 3MMPA 4DR6B 3I9V6 3C14C 3DAYA 4FHGA 3WWPA 5A2GA 2X8WA 3AFMA 1M2JA 3JXEA 3ZU4A 3CO5A 2YZ2A 2GS9A 3FNGA 3S1AA 4LF5B 3BERA 2HB6A 2FSPA 1N2CA 3I39X 4OKIA 5HCUA 4ZYWA 3ZDYB 1Q84A 4XPIA 1OX6A 2D5AA 2GBLC 2SNIE 2V5VA 3W3AA 4INAA 3TQTA 1Y6ZA 1Y8ZA 1WZ2A 3JZAA 2CLIB 2ZIVB 2GEFA 2ZKIA 3KQSA 2WVHA 5ALTA 4C1BA 3R8FA 3OA2A 1VPEA 2IOQA 2MYUA 3AF1A 3ROEA 1WZIA 1C1XA 3F6EX 3S44A 3PSAA 4HCJA 1Z22A 3TI7A 1GU1A 3P0EA 1MJFA 4FE3A 1E1QD 4UARA 3T3PB 4ZYTA 4IO1A 2XF2A 3KWLA 3P97A 4LDJA 5CPFA 4A2QA 1KXZA 1XHLA 3GN1A 4IDOA 4HFJA 3B1ZA 2G70A 3QBDA 1T9GR 4WGGA 3TM4A 1RNLA 1Y34E 1JRLA 2CGEA 3D2AA 3RTDA 1AKRA 4BNYA 4WOPA 2JJQA 2MT9A 3FPEA 4D97A 4ZTUB 2CVFA 2Z9BA 2GKGA 2HR1A 1V45E 4URWR 5EERA 3UOWA 3HRHA 2ZJ4A 4Q3EA 2KYRA 1WKVA 2JCYA 2VP5A 3IBTA 4JP2A 3VPXA 4UCQA 4CNBA 3L7OA 4A36A 4IVNA 3A7EA 1HMPA 3P20A 3FZQA 1PS0A 1JPVA 2ZRFA 1JDNA 1PL6A 1QIKA 5CT8A 2QZ9A 3QELB 5SZHB 4FYKA 4DIKA 4H31A 2V97A 4NCAA 1EAYA 1JF8A 1E1YA 1GAWA 1UWCA 4I5GA 3LCMA 2AJ8A 2ZVPX 2QMQA 1LQ2A 4GOXA 2JJ2A 3EGWA 3O7MA 5C8YB 4OQZA 1EXNA 3PKJA 1LZLA 1VBNA 4JJEA 3ZC3A 3C6KA 4QREA 3HKCA 1VPDA 1WXGA 3B6IA 2D7DA 2ZAIA 2B30A 2QGNA 3W8RA 1TW2A 2Y0CA 4DR4B 2GCGA 3H86A 1GG2A 2J9XB 1ACJA 4IDBA 3AY0A 3EXHB 2YHAA 4OI4A 4TUYA 4ZVKA 1II9A 2H2IA 2NMVA 1XLUA 3ND8A 4JYMA 1BRMA 4F3RA 4EPWA 2IEYA 4OD0A 3EZGA 4MPJA 1CS4C 2JFVA 1F2UA 2SKCA 3F6YA 3OZBA 4LKOA 4B4WA 3QV2A 4BRWA 4DSNA 4BN5A 1ZJYA 5JVDB 4IIHA 1YJCA 4GI1A 5T64A 2CXPA 2Y1EA 1DTEA 2DWOA 5GADl 2QL6A 2B82A 2HLPA 4RZ2A 4ZXPA 1N3BA 3QOXA 3WS7A 5E9WA 4K9NA 1NKVA 1R2QA 1VJDA 2WINI 4F5YA 2VKQA 1BX3A 1JFFB 3ILSA 1UT5A 3RG2A 1PX0A 4EA8A 1A72A 4PHFA 1ZINA 2QSZA 1T5SA 3QFRA 3AC0A 1HDIA 2JD2A 3ORFA 2JLBA 5JZOA 2D6FA 1OWOA 3O1JC 5EJFA 3DDUA 4EGFA 3BE5A 4L5BA 4HKTA 1UINA 1LV7A 5I47A 4OLAA 3FOCA 4ZI7F 2BP7A 4GQBA 3EFOA 4N9QA 3IB6A 3NONA 2OUKA 3FSGD 3C3BA 4G8DA 3TBFA 5JXJA 4OFBA 3GLUA 1T8YA 2W4MA 3PUIA 4XM0A 1NQUA 3MUEA 1OZFA 4N7RA 1P3JA 3R5HA 2QW8A 4UBNA 2FW0A 3Q8XB 1EUQA 2IHJA 3QMWA 3DOOA 3WLAA 1WNFA 2E4XA 3COZA 1UFVA 2IL1A 4PLGA 3SBDA 4NAHA 1Q1EA 4YUYA 4KPUB 3AEQA 4BS9A 2D3WA 3IIEA 2QNIA 3BL6A 5ULLA 4CHTA 1KA9H 1U28C 2FUNB 1NT4A 4BWFB 3DW3X 4M0CA 4S24A 1PGOA 1YK1A 3G8BA 1I1NA 3INYA 1C1HA 1W9HA 3PHLA 4LNAA 1OT5A 4ZV7A 3S27A 4N01A 4BEVA 3AMVA 2AK3A 4B76A 2ZLBA 2PS1A 4W5OA 5JI2E 3HXOA 1Q2XA 5BN5A 5EZYF 2AMVA 1Q1NA 4DUGD 2FH5B 2Y1KA 2DY0A 1RPTA 3RT9A 1GNVA 6YASA 4K05A 5KOJA 1P4GA 3A10A 4TKMA 1CB7A 4JI1B 2CDRA 3E81A 4KSYA 5A6SB 4V24A 2Q7OE 5KJFA 4DLTA 3CVOA 1HLFA 1RXSA 1VLHA 2NZ2A 3HCWA 1NW6A 5AVQA 4LDNA 4BU1A 5TARA 1J4AA 1ORHA 3GFSA 1ID1A 4AUEA 4WPGA 2PKQP 1QKKA 3IILA 4QPJC 4PO3X 4U7GA 4XDZA 4XYMA 1S7CA 1U31A 3RWOA 1QG0A 3CVYA 2OYCA 3HVRA 2J32A 1DU4A 4QD3A 2OD2A 2PV0A 3I61A 1HX7A 3QA3E 2EKDA 2O3QA 3TINA 2ZSKA 2GR9A 3O94A 2WSSA 4GLJA 1Z0IA 4OQ4A 4AG6A 1O0CA 3L4BC 2ZS9A 3UH0A 2PUEA 3INRA 4OSOA 3O8RA 4NYIR 1DMRA 3V7FA 4L74A 3G82C 4PGHA 1HFEL 3PC2A 1YKFA 4NDAA 2IVFA 3EGCA 3T8YA 3M34A 3AR4A 1SBYA 4O2BB 3UJ7A 4YCNA 1EX1A 3DWGA 1CZRA 4GU5A 2IYSA 1H1TA 3T5AA 4NU5A 1D0VA 4LJ8A 3LHSA 4PINA 5G2OA 3VR0A 3HP7A 2J0QA 3IAM6 1V0JA 3JR3A 5KWEA 4MUEA 5G40A 5B2EA 3Q2OA 1N9GA 1YMVA 3FGOA 3NNSA 3RVJA 2OFXA 4JXZA 4Q1VA 1A9YA 5DTRA 1Z74A 1GCGA 4LY3A 4RH0A 1OPRA 1I32A 3K5IA 3KSRA 4HX9A 4U02A 5I7VA 4J07A 1P0PA 2B5VA 4EVIA 5CIQA 1X92A 1X1RA 2JIQA 2MWMA 2OZLA 4AB1A 3RIYA 3WK6A 3KQPA 1AKNA 4MR9A 1IBLB 1LK7A 1LVHA 3IDAA 4J49A 4ENVA 1O94A 2WTAA 1IVNA 1NN1A 5LN1A 2V4ZA 4ZAWA 3ROTA 1EQ2A 2XITA 1IUKA 1Y1KE 1S2MA 3VZBA 3TRJA 3O8NA 4D8VA 3L0YA 1L5KA 4OM8A 1QZTA 3KEGA 1A2KC 1XQWA 2A8YA 4GPD1 4RJLA 5DEOA 2C5SA 2XE8A 1QX4A 1CRPA 1SQGA 1D2CA 3Q85A 2GTHA 3LNTA 2EW8A 4BFWA 2A9FA 1SWWA 1Q7BA 1GTL1 5T4BA 3NMUF 2NW6A 1SG6A 5FPHA 3ZDBA 5FNVA 3H5TA 3IHWA 1AV7A 3IKTA 1U3GA 3E7PA 2WWGA 8MHTA 1Q14A 3L82B 3OAAD 1GAQA 4ZCIA 1J06A 3DC7A 4KIFA 4MS1B 4OOEA 4K6CA 4Y6LA 1EK0A 4RPCA 4ZOLB 5AM4A 4DR5B 4C0HA 1BQ3A 4U63A 1K7XB 3ICPA 3FWZA 1KVSA 3NKVA 4OQPA 3UFXA 1J9ZA 3MQ2A 4X5OA 4OMCA 4YUVA 1T91A 3LRTA 4UM7A 2CLFB 5KNDD 4QBIA 4R8VA 5F2EA 4JJ4A 4MNTA 3KQLA 1WBDA 1RWPA 4ZOEA 2P41A 2V9ZA 4C7MA 2AFIA 4EL5A 4ZAVA 1OC2A 1FFGA 3KNZA 4BNDA 3FR7A 1PFQA 2X9VA 4WK4B 5GV8A 3T4EA 3BWEA 3FFTA 5EUBA 1PT5A 5TMPA 5ETJA 3QVXA 3Q3CA 1NJ5A 1UBOS 3CN9A 5I8PA 4YRDA 4S1NA 1JLKA 3IV7A 1BD4A 4FZJA 4O2AF 4RKRA 1CIPA 2C9MA 3KZVA 2P8SA 3URMA 1CUHA 4QVIA 2C84A 4O3FA 5ELMA 4YR9A 2FF5A 2MJLA 2QP3A 3ACDA 3B3AA 3JAKB 3KPWA 1Q0QA 4CIVA 2WKPA 1GQFA 1B0UA 2PWYA 3P71T 2V9CA 1OH6A 1VYHA 5HCIA 1KJJA 2YX1A 3T4UA 4S2EA 3PQFA 5FI1B 1W25A 3WB1A 3LPMA 4KTTE 4E4RA 5BPFA 5CB8A 1ZMRA 2B25A 1K9VF 2CNKA 4LZJA 3H2BA 4U7TB 4WY2A 4NATA 5K0ZA 2PTHA 4ZICA 4K81B 1QZ3A 1BROA 3P5BA 1M3SA 2QZPA 1NW5A 1WMSA 3DKRA 1RABA 2G06A 1RI2A 3JVIA 3AX6A 1ZK3A 3EB9A 4A0RA 1G20B 4N40A 4NZZA 3FVQA 2BJWA 4TV8B 2A59A 2AOVA 2ET6A 5IMBA 4JYPA 3WWEA 5KVVA 5IKXA 4EQZA 3OLWA 1CEEA 4CIWA 3I09A 4R8KA 3TVYA 1Q57A 2HHCA 1ONNA 4M1QA 4RZUA 5JY1A 3BFJA 3N53A 4C88A 1XD9A 1QO0D 3FYDA 5CAEB 1XG5A 3T7IA 5AJXA 3HJRA 1YQTA 3O5AA 1U2SA 4G0ZA 4O5AA 3R7SA 3UHJA 3ZIAA 1IYZA 3V8BA 1YBFA 1KPGA 4KTVE 4KODA 4QEZA 3HKBB 2IX3A 4FHEA 5JMWA 4QAJA 1KOGA 1HDZA 1MLDA 3JQAB 4XJVA 1SEVA 3G2KA 3KUUA 1LPMA 1ZP6A 4BB6A 1G7SA 3JATA 1GGNA 2E21A 3G2MA 4NV0A 1Z2NX 2VNIA 4PG6A 4RHCA 3AUSA 4AYWA 5TPZD 2O2XA 3BEOA 2GTPA 2W00A 4MVJD 2ATXA 4QRIA 2ZG6A 4I9GA 4QUIA 3B9QA 4UNQA 3F0TA 1QH1A 2X5KO 4PFJA 5D3ZA 4DE5A 2ZR7A 4YRGA 3BC1A 3GGGA 4MQ5A 3OETA 4J1TA 4WADA 4EB3A 3HU1A 1HFWA 2IP2A 1VJRA 1FNBA 4ZO8A 2A9PA 1DCKA 2EJTA 5AMXA 1G8MA 3TCXB 2FOLA 1W85A 1NQTA 4IS2A 2H31A 4YQEA 3R3SA 4I19A 1O3YA 4PG5A 1Z7EA 1PFUA 4BB9A 5I01A 5ALSA 1WXDA 2EFGA 3WRXA 4RV9A 4ZDIA 3CLSC 2BEVB 4ND1A 2LBPA 1J22A 1M1YB 1ORDA 2NVUA 1F0YA 3GL9A 3M5DA 3IIMA 3ODGA 4POAA 1ISPA 2DB3A 4TUYB 5JJLA 5AUNB 1DG9A 3BK2A 5KNBD 2O07A 2WM8A 5JBQA 1B3RA 5C7IO 2FKAA 1ZHOA 1VA5A 5KYTA 4EFNA 1LLUA 4GKKB 5PNTA 3U9LA 3TLAA 4WE3A 2J3QA 3ADKA 2P5TB 2VWHA 821PA 1HL7A 1E1KA 1QRRA 2DBVO 1CQWA 3HNRA 1OYOA 1EVIA 2YJGA 5TQ2B 1BOOA 1X7YA 3RU2A 3UJ6A 1NM5C 3U44B 1AUOA 5LA6A 4E30A 2YWCA 3N59A 1GDDA 1RRKA 4FK8A 3CZAA 1PT7A 3I34X 1RM3A 4H1TA 5C1PA 3O8QA 1EUCA 5NLLA 3H3JA 4QJ4A 1I0ZA 2J3MA 4UMVA 4UQLA 1KYXA 4H08A 1P18A 4L0QA 1TAGA 2HL6A 3WLQA 4YNBA 2BUBA 4UD2A 1YQXA 3AESA 3HUDA 3CJTA 3SR0A 5K0TA 2Z83A 4GOND 5LQKA 1AV6A 2IHVA 2Z6QA 3K32A 2OFOA 3SVZA 4C3UA 3BH0A 3OM9A 2OV3A 3VZRA 3AUFA 3VDQA 4DNFA 2XMGA 1EFDN 1QTQA 1XCPA 1N0UA 3JQEA 3W7AA 2OXCA 1O57A 5FLYA 4TYWA 4K6HA 3FDJA 4AC9A 1UBRS 2ZUWA 1MU0A 4CLOB 1JECA 2FPRA 1XKTA 1H3FA 3AUXA 5KTOA 1MTOA 1JHAA 3FTQA 4H2DA 4YCBA 4MDEA 4TKLA 2Z3WA 4QU9A 3DMDA 3FKQA 4A6PA 3AV3A 4EI7A 4G26A 2OT3B 1R9NA 2KB0A 4KSBA 5CDSA 1BFKA 4RIGA 3HDVA 1JE0A 3IHKA 4I81A 1U8TA 3LC1O 5H82A 1TLFA 1OZHA 4D25A 4UCXA 2OZPA 3A1SA 2VDNB 2WV9A 2E4VA 2PNJA 1FX0B 1C0PA 4CL3A 1YIOA 2JC3A 4GMHA 1E3DA 2ZYGA 3L6BA 3TTVA 4KR6A 1AN9A 2L69A 1I94B 4ZGBA 1ZY2A 2C0CA 1PD0A 1WWKA 4IDPA 1NL3A 5E6RB 4F8JA 4R2WA 3CLTC 2V6BA 3OUZA 5LMUB 1NY5A 1MUUA 3H83A 4AS2A 1PG5A 5DBFA 3UWDA 4ROTA 2QJTA 3LECA 5HJ7A 3E8XA 2NP6A 4H1HA 3WX0A 4PS1A 4GUDA 1YB5A 1OWPA 1SOUA 1VMKA 3IDSA 2MU1A 4LRUA 4BFLA 3VMFA 5L45A 2FPXA 5BYJA 2WPNA 1SOVA 1T6NA 2OY0A 1V2GA 2B9VA 4MRVA 2O8FA 2GF0A 2GERA 3PQ2A 1GA4A 4F2PA 4ZK6A 5CIYA 1Z9BA 3LTNC 5TVKA 1NLUA 3WHPA 2GM9A 1XLVA 2J4CA 3GW8A 4MKIA 1THMA 3EZ9A 3OOWA 1P4SA 5C81A 4BZXA 5F1YA 2HJVA 3H7IA 1WE2A 4A73A 1NP7A 2EFYA 1QGYA 2HH9A 1DEHA 4K9KA 2YIMA 3T1NA 3ZVKA 2JFFA 5J47A 2C58A 2MMGA 4MV9A 1NN3A 2NUBA 2PEYA 2F8SA 5LQSA 1NY6A 2A4KA 5BVGB 5KYNA 1L5YA 4EY6A 3FYTA 4DR7B 2BFPA 2Q4OA 2NNWB 3H9CA 1E3EA 4HWPA 4X91A 3VVBA 3X2SA 3O2NA 5B7QA 2WBLC 1HZZA 3NJ8A 1EB9A 2WNSA 4LIPD 1DQYA 3S1LA 4FMDF 1XP8A 2QGFA 2WT9A 4M38A 3GN2A 3KJNA 4RY8A 1LI7A 3KJIA 3RUCA 1W75A 3EQ8A 5IKPA 1IDOA 3F3YA 1Z7GA 1NF8A 3B7WA 3WAKA 2QV7A 3GGCA 4FT2A 3KR0A 1T0HB 4ZZ2A 1V3VA 1K3TA 2MSKA 2WTUA 1GSAA 2X1LA 3HBJA 3LKBA 4PTYA 4AKHA 1AGPA 4DIFA 3TMYA 1T26A 2NSHA 3TUIC 3VSAA 2ZKLA 3ISJA 3OOYA 2P2SA 1TM4E 4GZ3A 3UC9A 1FMTA 4GIBA 4LOLA 4MB6A 4WXYB 4BE7B 2WSMA 5GVSA 2CLLB 2DT8A 2PH1A 1KXJA 1PCXA 2VHVA 3N8IA 4S05A 3OSUA 3B70A 3L1VA 3IP8A 3ZWAA 2XV1A 4D5EA 1PIWA 2F8TA 2KBEA 3T38A 2GN4A 1MZVA 1X7HA 1E8DA 4DA6A 4GM4A 2AFVA 4AY2A 3B85A 1OV6A 2DQ4A 2VYNA 3ZDXB 3LIIA 5FBWB 3E5MA 4XI9A 2XD9A 4URHA 1YZUA 4RVHA 2QL5A 3DL2A 1QGUB 3VHXB 4DV3B 4MA0A 3H0CA 2JARA 1MOZA 2OLKA 2OVBA 2SKDA 2X9NA 4IIBA 5E7MA 3TTYA 3UGTA 1GPWB 2XCIA 4F3KA 2DERA 2BFBA 1WXEA 3KKPA 2YQZA 4GF5A 1HLPA 2BMVA 3REFA 3KE9A 3PIDA 4AMZA 1BQ4A 1K9SA 2YW2A 3C3EA 1UAYA 3FUCA 5BNTA 3JALA 4F6CA 1UXHA 1WV1A 1EZ4A 3HCNA 1U4NA 3KXLA 3RIHA 1M34B 2WWYA 1AA6A 4LHXA 1OBHA 4G5QA 5FOUA 4G97A 2C7RA 2AVDA 1XK7A 4NCBA 3PXCX 4W1SA 4HWSA 1NQOA 3EGDB 1IWOA 3GEHA 5CFOA 1USKA 1OAOA 2P2GA 1W87A 2WUEA 5M3BA 4BVGA 3QEAZ 1TMYA 1YU9A 4O0LA 5F9MA 2HRDA 4AJEA 1RWVA 3R20A 4AWAA 5C1OA 3GV0A 2BGUA 1W6UA 2HDOA 2X42A 2PLNA 2DEUA 5HWSA 1ISRA 1QHSA 1Y5LA 3IALA 1G8AA 2A94A 1FRNA 3TNYA 3TUZC 1Q6YA 1YTUA 1PL8A 4OH7A 4R2JA 1ULSA 4YK7A 4DR2B 4KE6A 4XTCS 1MDFA 3BQMB 5ALLA 4PCAA 1DWUA 2GJ4A 5KX5F 3AUKA 2JFUA 4DNOA 1S2LA 3AB7A 3ZQKA 3PRYA 4MARA 4ZCSA 2ZB8A 4UDOA 2XQIA 1KDVA 4A3SA 2UUOA 1RQRA 2P2CA 2PGDA 1QKIA 2IXDA 3UJAA 3UH1A 1G8KA 2GZSA 3ZX5A 1C0LA 4OUDA 3MMXA 4YUAA 3BGWA 5JEEA 1HV8A 3E05A 2I3GA 3HR4A 4K3UA 4RIFA 2H29A 4CKCA 4RTMA 3RGWS 1G8YA 3S2SA 3IAXA 4DTCA 1KK2A 4TSFA 1AA9A 1IM8A 3AZOA 3R3HA 5BRNA 1GRRA 1GPLA 1PYDA 1BX0A 2QGZA 2WR8A 5F52A 1NUHA 5HS6A 3WGQA 3EUAA 2QN1A 4G09A 1T4BA 4HFRA 3BK7A 1XHEA 2GK7A 1E2NA 1E1CB 1GNQA 5AO9A 2IS6A 4QQ8A 3NP9A 4QWMA 3P0FA 1V8BA 2CNWA 2ZAGA 2B8JA 4JWKA 3SXUA 5DZSA 1CIJA 1Y4DE 2QMYA 5BNWA 4G0UA 5LBIA 2EJUA 3MERA 3NLLA 4NOLA 2DPHA 4N5LA 2FZ5A 3B6ZA 1HL3A 1YB2A 4PG8A 4FGSA 5GJWC 4RPJA 2Z5VA 1ZMXA 1VCHA 4DQUA 2EL9A 4C1NA 2NWQA 2EZ9A 1PQWA 2A1IA 1C9DB 1W5EA 1UJ5A 1P3Y1 2ACEA 4I46A 4V0LA 4DJTA 4YUXA 4W5RA 1FMFA 2BF7A 1PZGA 2QNRA 3GLSA 1PT9A 4LYFA 1WCIB 4UXIA 1RWNA 2VHQA 5ALIA 2O9JA 1JZQA 3WWDA 3ZDQA 4QLBA 3W6ZA 3L7MA 4YHBA 3T5GA 4BO6A 4EBFA 3EYWA 3S55A 2J3KA 3L8YA 5AI5A 4DPMA 5AQ1A 1CUIA 1ECCA 1VXRA 3Q7TA 1V3QE 2D2IA 4H7HA 4M37A 1SIWA 2IYNA 3CRMA 3L9WA 2CVQA 3CZMA 4NS1A 1U1FA 3QPBA 4IHKA 4JXJA 5F1PA 2PS9A 4AG5A 2PGXA 4KUHA 2BH2A 1U2EA 4YAIA 1DAMA 2YXLA 3O4VA 2RHHA 4S35A 2IS1A 2Z8XA 4KQKA 2HMAA 1V5EA 3IXQA 1OAAA 1A9TA 3FHTA 5E4YA 4L78A 4FHFA 4HK4A 4MW9A 1NHWA 3G0CA 4NBRA 4BJ6A 3SIPA 1NUPA 3NG1A 4MYHA 2QTRA 5SICE 5JS1A 1F6DA 4WJKB 4D9IA 4MUHA 4F9TA 4F3TA 2H2WA 4U2EA 3AR3A 4RTLA 4LF9B 1DIGA 1NVFA 1V7CA 1YBAA 3EGOA 3RSGA 1R6TA 3MFYA 3NAMA 4WFQA 1IVSA 3GXBA 5BORA 2IDMA 3R0JA 3L79A 1NXPA 3CWZA 3P0JA 4MQFA 4O6VA 4A27A 4DIEA 1RYEA 1GZVA 3DVSX 1L5HA 1XTRA 3D8RA 2A9QA 4NH0A 4UBIA 1RQ2A 3S0JA 4CTOA 3Q7PA 2XGSA 3RYCB 2BSQA 5A05A 1E62A 3SD7A 2A5LA 3DF7A 2I4RA 3IR6A 4OGLA 5GAJA 1GL9B 3AIIA 4ZDWA 4Y8VA 4EG8A 1X38A 1SB9A 2YWFA 4G1UC 2J9YB 2H63A 3AU9A 4PZAA 2W22A 4WVLA 5TPWA 1T5BA 2PX0A 2Y4NA 3HJNA 5A0TA 4CHGA 3F67A 2XZTA 4BFVA 1M66A 2LCIA 4PYIA 2YIDA 1YS4A 1AQJA 1XZAA 3R5TA 1MFPA 3TRKA 3VO8A 1R0CA 4D3YA 4MDHA 4DG9A 4Z7OB 5KHLB 3MPUA 4DCPA 1HSZA 1JZTA 1ZH0A 2JF0A 3Q6IA 1GPKA 1OIXA 3HJAA 3Q3JB 3GGSA 3G9UA 4Q9AA 3H7AA 3TFWA 5L3VA 2DZDA 2ZJ2A 3KT8A 3DDOA 3HCBA 1AM4D 1DEOA 1JG7A 3ZHCA 4MLPA 4B43A 1PHRA 3O8CA 2PL3A 2Q62A 4YASA 4AO6A 5ILOA 3ZVNA 4X3PA 4XX0B 4RF4A 4JI0B 1STOA 4JUIA 5IJAA 1I4EB 2QKYA 2VHJA 2GFIA 4HTFA 4QGSA 4K6KA 4UFOA 1TUBA 2CCJA 2BEWA 2VTEA 3TW4A 3FI0A 3P9IA 1E3SA 1AKUA 5ARCA 3PZRA 1JSLA 1EDDA 2GPJA 3F97A 3MWDA 5HMLA 3WP1B 3DE3X 4MVCA 3NAQA 1XRRA 4MI1A 3K9HA 1JPJA 4EPYA 5DGHA 1T2AA 3OEEA 1KC3A 3KEOA 4G9EA 2OHGA 1FP4A 3H5IA 1OXMA 1XD2B 4KIWA 2BHLA 4MICA 3UWMA 5A7FA 5C8DA 1SVLA 4YJ2A 3UBTA 5GP1A 2QAIA 3L7AA 3OCUA 2BCGY 3ABIA 2C3UA 1GU7A 4I1YA 4LY6A 1EFHA 1UP7A 1VL8A 2PX3A 2QBYA 1P72A 2CUKA 1FJGB 3GH3A 2VDMB 2DC1A 3GP5A 3IJRA 4GOLD 3SU8A 3CVWA 1E99A 1X80A 2ZYVX 1T9ZA 5EHQA 5KTRA 5I4KA 1AIPA 1TIBA 2V55B 2JI9A 4BIIA 3OTIA 5CB6A 3IJPA 1TCVA 4D0RA 2HY7A 1RXVA 2FSVA 3ABSB 5JH7B 5KU7A 3HBNA 1Y8AA 3MN1A 3QKSB 4JLDA 1PK9A 3LY8A 1T2DA 2BOVA 3E0XA 3KLMX 4O2LA 2O8FB 2GARA 3PDHA 4Q1AA 3AR7A 3C1UA 4XLZA 4ENTA 4XYEA 2JHFA 2OM6A 4TVBA 4RFSA 3VV3A 1G19A 1NI5A 4IHJF 2BKXA 3FD8A 3KETA 4J2HA 3GLGA 4LXTA 3NORA 4R1SA 5CA0A 3ZDFA 7ADHA 2EQ5A 1H9CA 1BC5A 1PDOA 2GRUA 2YZKA 3UCEA 1KAMA 1RE1A 2VXBA 1EK1A 4KYVA 1YB6A 1USIA 2PZ8A 1G9SA 3O4GA 4LC9A 1M2KA 3OTQA 4NWIA 5FOSA 1ADYA 1QYIA 1SBCA 3V1UA 4ZA2A 1K63A 1KI6B 1NQVA 4OQQA 4BVJA 2C82A 2Y0PA 2VDVE 2ZUUA 3I9FA 1TYCA 1ATIA 1FUIA 1L7QA 1W96A 4KO8A 5EUMA 4TN5A 2E7ZA 2AXPA 4ND3A 5E7IA 1XCOA 1TNDA 5FOTA 1GN8A 3UTCA 3U17A 1I7LA 2ZBGA 1Y4ZA 4OJTA 5AJWA 2BKEA 3DLAA 4KO4S 4KQIA 3QKTA 4XXHA 1TZCA 2C3MA 5DGIA 3WNDA 2G77B 2IBMA 1A2BA 5BYAA 1SQ5A 1NNLA 1VE7A 3CH5A 4CF5A 1XZEA 1I4LD 4BP3A 1NMZA 2P9QA 3IQDB 3X1JA 1DAGA 3D64A 4UM9B 1CF9A 4C6HA 5FTMA 4CKEA 5LJLA 2RGNA 2GMWA 2EWMA 4EI8A 3BOSA 1P73A 2PSHA 1I7DA 1H93A 3H8VA 3DBLA 5I4CA 4FWBA 3UCXA 2JLUA 2SCUA 2VI5A 3AONB 3I8OA 1K6MA 3ZD6A 3JV7A 3CURA 1UZUA 3FMFA 1I5RA 4R6XA 4F3CA 4DJDC 3N5KA 1EP9A 2QL7A 5A4KA 3STTA 2QTTA 3NTUA 5KS2A 4JEUA 5GWXA 1V5FA 3BMNA 4ZVSA 5TMEA 4NARA 3NASA 4CU5A 2C4WA 4WNIA 1ISMA 2IZZA 2OP0A 3E18A 3ENVA 1Z37A 4HN2A 5K0BA 3ZY5A 2ZT6A 2NSJA 1N8TA 5AR1A 3I0MA 4BKQA 4N49A 4JJ6A 1TIPA 1VKOA 3TTUA 4TLBA 3AKZA 3OE5A 2WM9B 1TL7C 4LVNA 1MP0A 1F17A 4FI3C 3ASVA 4KVGA 2Y0BA 4G84A 1XZQA 3A2LA 4RC9A 3NI2A 2MR5A 2QLJA 5FF9A 3SDSA 3UXEA 1WW2A 4RD4A 1EK6A 2IYQA 2WVGA 3U4CA 5IT0A 4GI7A 5JJBA 1JR2A 3FBTA 1HQKA 4EJMA 3NKLA 1K8RA 1KBQA 4LYGA 1GAJA 5IJ0A 4R40A 1FW8A 3CUVA 5LP6A 221PA 1Y8CA 1TFRA 3VNBA 2IXGA 2FY8A 1WU7A 3P1JA 4NHOA 4I4NA 5B1SA 3CE6A 2WI8A 1PK7A 4YRFA 1FVXA 2VQ3A 3K9GA 2ZRQA 5A7HA 3ZI0A 2CK3A 1FSPA 3KLOA 3KFVA 2EDAA 3AB8A 3GDOA 3VPFA 1JAHA 5L6LB 3BD9A 1Q74A 1E5DA 3G8CA 2J5XA 2VNKA 1FEZA 2G8NA 2MCFA 2NUPB 1Z2AA 4DM4A 1RBMA 3CVJA 3KEMA 3GJTA 3LTEA 2H2AA 2DPLA 2AYZA 1S2OA 4A1OA 4Y2TA 4E11A 1AKQA 3L84A 4TYNA 4L27A 3U6KA 1AXRA 2K7FA 4NP6A 4MV8A 1ZGJA 1KYWA 2I2DA 3EF1A 3PPXA 1WXHA 1ESDA 3KDPA 4IZIA 5KC9A 3C5CA 2GWRA 3GP3A 1JSXA 3CEJA 4TZ0A 3H75A 4HYEA 4AY4A 2FI1A 5I9SA 4BVFA 4HNRA 2RGRA 1M2HA 5TV2A 1BD3A 1FOEB 3BWCA 1GQQA 2HO4A 2R9VA 4QYIA 4RIHA 1IDN1 1MH9A 2HCRA 4XUGB 1KSHA 5EE3A 1JVBA 1OMOA 1YFLA 4P7FA 2NAFA 2GD2A 3VMMA 1Y7TA 4O25A 4JJAA 1HRKA 1H1LA 3R0QA 5KWVA 1QPZA 4IY1A 2G04A 2RFLA 1E2GA 4LYDA 4PAGA 4Q47A 4Z9BA 3EC1A 2CL5A 5HPYB 1I6WA 1IHYA 2VNHA 3W1VA 4RJKA 2C7OA 2F3QA 3JWPA 1ZJZA 3HFRA 3IEKA 3PGKA 3L0IB 3L1HA 1CX9B 3D7NA 2PQ6A 1JKMA 1JR3E 3N58A 3LK7A 3DV9A 1WV0A 2GEUA 2GA9A 5KDDA 4BJHB 4ED9A 3C7KA 2CYAA 2WHQA 1L5FA 1R9GA 1WCWA 2YV3A 4PCLA 1NV9A 2VDJA 3ZQ4A 4CM9D 1KZ1A 4GXNA 3GOHA 4I55A 4DBLC 2EWVA 3LL4A 2QN9A 2VHTA 2JW5A 2QG6A 4N0DA 1TRHA 5CR9A 4ZVRA 2BW0A 4BFSA 1EIWA 1LEHA 4TTAA 1T8SA 3U4GA 4LDAA 3KKKA 4RDIA 3JCZA 4K6OA 1RCFA 1QRTA 3BB1A 2YOHA 2EX4A 1V48A 2FEOA 3GLQA 5ALWA 4K87A 1JAZA 4OQEA 4EY7A 1AB6A 1HSOA 4KI0A 5I7EA 4Y6SA 1W88B 1LBEA 1U1CA 2AXNA 2FZEA 1Z0UA 5CRIA 2ONJA 1TCAA 1L7AA 2FX3A 2XYRA 3K72B 1DDOA 4EL0A 4L9WA 4YRLA 4DDUA 3WWYA 2WHEA 2C4NA 5CX1B 3AVYA 1SD1A 2FFBA 2VHWA 2NTNA 1OXBB 4TLDA 4BO9A 3B53X 3AUJB 2CDCA 1KDZA 3ROMA 1P7VA 1MABB 1ECPA 3GJ4A 4DWWA 2H1IA 3DLPX 2R7LA 3NTQA 3SQMA 4DY6A 1FU4A 2CF6A 4XTRA 1ZZGA 3AFIA 2WAMA 4ZREA 2P9GA 4PRYA 4MVWA 4TL6A 2W71A 2YV4A 3MMZA 1E8MA 4G1BA 1T43A 2LR0A 1MIOA 1Y1RA 2XE4A 4B6JA 4BPBA 3R1IA 3DEHA 1Z26A 3E9MA 5AKZA 3NBXX 1DZIA 2VSOA 4NG5A 2B8WA 2F9LA 5G0WA 3TSCA 1J2RA 4WW0A 2CLEB 4IX9A 5DV9A 3COVA 2FP4A 4LGYA 1BKDR 1JG1A 1LC0A 1MO3A 1R6BX 4HTAA 5JSKA 4LHEA 4P4SB 3T3OA 1OZ0A 3BXOA 4EQ6A 2WG1A 3D4OA 5TT0A 5J58A 3PRJA 5FH9A 2BISA 3DW1X 2XA9A 3CZ9A 2A9VA 3SS8A 3VZPA 3H5LA 3ZJ4A 1LXCA 4JP8A 3CBQA 1G17A 4FZ3A 4KV7A 4L15A 1LH0A 5CFQA 4KQ1A 1VGVA 1NJ6A 5JSQA 1I13A 1OXUA 3NHMA 2FYTA 2JCGA 5BSTA 4J94A 2FN8A 3MNFA 4DA7A 1C4OA 5AUOB 1E3WA 5I7FA 5CEEA 4ARZA 4BNXA 3R40A 1VI5A 1SU7A 2OHIA 3MWYW 4P98A 2GO7A 3ESCA 1D4FA 2DWCA 3B52X 1RDFA 3IEMA 2AG6A 1E3MA 1U0GA 1W0JD 4BNUA 1MVLA 4JJFA 3ZNQA 3OZDA 4DMFA 2GJ8A 2AW5A 2VK1A 1K4MA 1VSUA 3AHHA 1LLFA 3OEHA 4IWNA 3FUXA 1OI3A 3AOEA 4M0EA 3RPEA 5B6IA 5JDIC 2PXHA 3DG9A 5EXTA 3QXHA 1XSEA 4ND6A 2X0EA 3UUGA 5HK8A 2EC5A 2QUHA 3NC0C 3VAZA 4C0WA 2IH5A 1TF2A 4PZ0A 1T9GS 2H08A 4F8YA 3W05A 3OICA 2Z2KA 3BA6A 2JCBA 4GBED 1GL7A 3SS7X 4F5DA 4UVGA 4PN7A 1N2SA 2RGAA 5BPHA 3SC4A 4EHHA 1ETHA 3FNQA 3THYB 1JFRA 1X7GA 4NJOA 3VX4A 1WY5A 2AA3A 4BJ1A 2R8BA 3DGEC 3PTLA 1QH8A 2VP0A 1ZN2A 2QENA 3QUTA 3ITDA 4RV5A 2O2SA 1FNMA 5IYZA 1VLLA 2YASA 4KOEC 3UMBA 2VP3A 2C2YA 3MBOA 1QHIA 5C1DA 4EUFA 4M6WB 3KB8A 1AZSC 2C00A 3PFGA 3Q10A 4FUTA 3ZIUA 4P54A 2OCLA 5EJ9A 3VAAA 4MLCA 2MINA 2O8CB 4WKGA 1QE3A 3PX2A 4JLNA 4R7ZA 5FTWA 5INTA 3CFYA 1M1YE 1SHZA 2JI7A 3WGMA 2PMDA 1A4UA 2ZPAA 1R27A 2HIHA 4RL4A 2CXTA 4ZZIA 2FMKA 3LOQA 2JD0A 1WHSA 3I4FA 3LO8A 2EYQA 3WBKA 1KH1A 4YH1A 2FUG1 2VAWA 4HAXA 3AO0B 5KTMA 1NFFA 3HM9A 2XZPA 2CEAA 3OLCX 4DRXA 2K2QB 3ORHA 1Q0SA 3GEEA 1MB0A 4MGHA 5IG2A 5E38A 5CVEA 1WMDA 2YFHA 4DIDA 2EHJA 4KQ9A 4FFNA 4DADA 3GZ4A 1SXJB 1QVZA 4OB6A 2W11A 2O05A 3TW8B 3OT5A 2Q3BA 4WHMA 3SVLA 4MW6A 4MV4A 5C1BA 4S04A 1U0SY 1KMCA 3VU1A 1M72A 3UC5A 2O1XA 3KR1A 3U56A 3S5JA 1T35A 1Z4QA 4QRDA 3Q2IA 3ETNA 4YRMA 1BMDA 4KAJA 3UMCA 4JXXA 4HRXA 2JHPA 1CY2A 1KO5A 3E58A 3YASA 3ETHA 3CF4A 5IEBA 1DIHA 3R24A 3HU2A 1SUSA 2AG5A 4R81A 2FOIA 4FQ7A 1P1CA 2A57A 3MLEA 4F11A 4ZV9A 1D5CA 2PRJA 5A6VA 2X5JO 3AHIA 3AXTA 1C8BA 3PZBA 4RETA 3PS9A 1W5BA 3OPYA 4DC9A 4D82A 3AH8A 4X7MA 5JEDA 2PUGA 3E4DA 4IKPA 2VHEA 4Q01A 1JR6A 3GMIA 3QE4A 3EFHA 1OBCA 4YR7A 3OT1B 4B46A 4L2IA 4D0SA 2Z2XA 1T0JB 4HHEA 1XXHE 1J9EA 3OLXA 3CRRA 4J7UA 2Q4RA 4W8OA 1KVRA 4ZIRB 4J75A 3A32A 3OZCA 1ZNYA 2IKSA 3RUEA 4KJXA 1SUAA 4QVKA 4V0QA 1BDIA 1I7PA 2C61A 3TJMA 1AK9A 2E4WA 5DM0A 4N3AA 5IULC 1MTZA 3BMCA 5J5CA 2CYBA 1O7JA 4CR8A 1YQQA 4LHSA 4GR9A 4K40A 3LQ2A 3HGMA 4R1MA 1JDTA 3OA0A 2VP6A 3CT6A 3ROGA 1DAIA 2J0VA 2NADA 1GTSA 1SXJC 4U00A 5IT5A 2H5LA 1A4XA 4J0IA 5HR5A 2P3SA 3FHJA 3W5VA 1FW6A 2J3JA 1GQRA 3MILA 2D8MA 4CN9A 2OXEA 2GNAA 3ENZA 3HB1A 3KYCA 3FYUA 5BXQC 2M1ZA 3BCSA 3L8CA 3FDXA 2XGJA 2AFHB 3PNKA 1XAGA 1I2CA 3ZKWB 3DBOB 3IFSA 3LAWA 3E7FA 2GJ9A 4YMLA 3CWCA 1B14A 5AW2A 2PT7A 4JC8A 1CDOA 1Y6FA 1H8EA 1R0LA 1N2OA 4WZBB 1DVRA 3EGXB 3NUQA 2HA7A 3Q9LA 3W5JA 4EGCB 4MDFA 3KSUA 4O5OA 4GGPA 3MB5A 2TYSB 4Q4AA 2RHBA 5FA6A 3SFZA 5TGTA 3R77A 5JBIA 2W2PA 2K2WA 1XFAA 4O0MA 3ZD8A 3DCYA 4GWGA 2G5TA 1QHFA 1QHHB 4KYIB 1C1DB 4NBTA 2W6IA 1KEUA 1BO6A 4EYOA 3KZNA 1J33A 4KMRA 3ZZTA 3RVLA 1VMEA 1NR7A 3AVOA 3FAZA 3FIUA 5MN6A 3CVUA 10MHA 1CJTC 2VYFA 3T06B 1CERA 2HDNB 2O06A 2QD5A 3THSA 5G1NA 4I8IA 4R0NA 1RXWA 3IV6A 1AO3A 1RYZA 2HF7A 2QRHA 4AKIA 3GD7A 2VYQA 1I4TD 3PEFA 5DW3A 5D3MB 4IIXA 1RWBA 5DJ5A 4Q4JA 5COAA 5J59A 4YFYA 2HA5A 1EKXA 1TQ8A 2PGJA 3GGDA 3KHTA 5IAAA 3U60B 2WF5A 1FJXA 3EPJA 2RI0A 4MWCA 4P92A 4CEHA 1U6JA 1VBKA 1Z25A 2NT3A 2XGMA 1N7GA 2PIAA 1VE9A 2ERCA 4YDQA 5LMCA 3GAFA 4US1R 3V97A 2HRCA 3RRJA 1O5IA 1E5XA 2EGUA 3QHAA 1AGXA 3G2IA 2B5WA 2ZZKA 3DOJA 1FTSA 5BWOA 3G5UA 1OWLA 4PLZA 3RVNA 1OUMA 1VSVA 5B30A 2WYHA 3E4CA 4N9WA 3H8WA 3EZ6A 3JWHA 4S1TA 2CE7A 2HFJA 2J5KA 4BQEA 3O03A 1M2GA 4XCVA 1TD1A 13PKA 5JCOC 4UHBA 4FJ2A 1QG2A 4HS4A 1QC5A 5JQWA 4PFSA 4BUZA 1I8TA 4GFDA 2IYZA 3F8TA 1JB9A 3EW7A 2V7QA 5F2OA 3ZDEA 1YMUA 3QOYA 4G2TA 2XLCA 1TADA 4O4LA 5EWMA 4NYIQ 4ENPA 5IXJA 5M34A 2HU7A 2HWYA 3JAWB 3Q9UA 4OF4A 4D79A 3AFNA 3FCOA 1W93A 2QOEA 4UEOA 3KQKA 3WXBA 1MX5A 4RJ2A 2BAGA 1QG6A 1SIOA 4QAQA 1P7WA 5K51A 1FCJA 3MJFA 2BJVA 2QUZA 2PWAA 2GN1A 5AH0A 2ZSEA 5F3DA 1KTIA 4KB5A 4TV9A 1G3IA 3DWEX 3K6KA 3D6UA 3G17A 1IWPB 3HDHA 3JVEA 3M89A 4ZRNA 5EZ6B 4EABA 2VJKA 3FPFA 1M34E 4JYBA 2FPSA 1QDUA 4YLGA 3WB2A 2FGKA 3R2JA 4IOJA 2IUTA 4NIMA 5FCDA 3GZNB 4NBUA 1H4VB 2O2CA 4B7ZA 4J03A 3WKEA 3S2FA 4UZFA 3R3XA 2BF4A 3OO1A 4KC0A 1DPGA 5KOYA 1GQOA 2NSDA 5LOVF 3K9NA 4MHTA 3M9LA 4N4AA 3T5PA 2XQJA 1K8QA 4L5CA 4DT1B 2SHKA 1ZO8A 3VR4H 4DCSA 2X13A 2JAXA 4IIJF 4KH1A 4UQPA 4RWEA 1NZFA 2FPMA 3LBFA 4YT2A 1U1DA 2QLBA 1F8YA 3OQ1A 1SCNE 4D4LA 1JSZA 1YZKA 1EBUA 3E9DA 1MO5A 1QIHA 3D4BA 3TZKA 8LDHA 1DI0A 1P81A 1NQAO 3O95A 4BFUA 3RADC 1U9IA 2IZ7A 3N0VA 1MT3A 3E27A 1UUFA 3DDCA 3PHHA 1J56A 1A1SA 1S9HA 1SCAA 1VKRA 4Z4HA 2P2DA 2WKWA 5LYJA 4KR9A 4QTZA 5L3QB 3F5FA 4N03A 2IPAB 4ND7A 3WLMA 5BWNA 1XRMA 3IO3A 3P0IA 3GLFB 1GGVA 2G72A 4BUJA 1E3WB 1SHKA 1VJTA 2I6XA 3FYCA 3NYIA 4PWZA 4DV6B 1EVEA 1LBSA 1T2NA 3D02A 1ABBA 2PPVA 1JPNA 1XMIA 4JOSA 1B76A 2PMFA 3IUYA 4JROA 5JC8A 1T1RA 5JPDA 4H7JA 4YUWA 2CJWA 3C6XA 3HB4X 3QX9A 2O8VA 4UREA 1I5OA 4ABTA 4I50F 2YS7A 1AO0A 3THXA 1D04A 3B1JA 4RD2A 2ZRLA 4L4ZA 1CLUA 1OCEA 4XIYA 5FNZA 4EMUA 4FWTA 1B23P 2NU7B 3EC7A 3NWPA 1U3CA 2EBWA 2R7MA 4PSVA 2XIQA 2I71A 5EWJB 1J2UA 3BKXA 5LC1A 4BX3A 3OWXA 4JQYA 1EFVB 3M4JA 4QQFA 4U9UA 4AF6A 1ICEA 5JFTA 3GVXA 2I8AA 3AIOA 4M55A 3MT8A 1A8QA 1OXKB 3DOUA 5F4ZA 1KERA 4DLKA 4TXJA 5IWCA 2DFTA 4E4YA 3IIKA 1KL7A 1VGRA 3MTQA 4C7VA 3THWB 1XCBA 4HH1A 4NU8X 2WEKA 2H07A 1HKUA 2WMOB 3QGMA 2XXJA 4Y6RA 1Z29A 3KOUA 1H2HA 5DYIA 3BREA 1RLUA 3KZKA 1D4OA 3SHVA 4BAZA 3KB2A 1K6IA 1QGDA 3PDIB 2K7ZA 3I6ZA 2PUTA 1Z08A 2KJQA 1C0EA 1T3TA 2YC4C 4TYPA 4D26A 2PZLA 1B1CA 1L6RA 2AYXA 2D13A 2FG7C 3R6TA 4P4GA 2R5NA 1JMYA 3WLFA 4CTKA 5CITA 3IUQA 5LR6A 4KI7A 3K7EA 2QQ5A 4B3DA 1PJ3A 4V0RA 4YJHB 3V7NA 5EMLA 2C95A 3VDNB 3H3XA 2A7XA 3TZBA 4JLPA 3WYBA 3BQNB 5B4UA 2ZYTX 2BKVA 1RPZA 1P2VA 4A8TA 1M6VB 1FU7A 2ST1A 2Z5GA 1QQAA 1IBCA 4RK6A 2OC4A 1H6BA 1L7RA 1V26A 1ZZEA 1SU6A 1SQ0A 1JIKA 3CEMA 3DKKA 5AWFC 1DXOA 2GETA 4X1KB 3V8RA 4A10A 4D4IA 1YL7A 3SQWA 3ELDA 2G40A 5JWRA 3OP4A 2E18A 2GJKA 4MQEA 5T8KA 2IPMA 2OV1A 1ICIA 3F4LA 4I4TA 1IUPA 1YS1X 2FWJA 3RRXA 4NQRA 3BTVA 3TZCA 3RABA 1J2JA 1W4AA 1R4MA 2X1VA 4KMSA 2DQZA 2QD4A 3A25A 3I2IA 4FOTA 4DZZA 2ZREA 5JADA 4KE7A 3DV0A 4LZOA 1BS2A 3MIIA 3UFBA 3F7NA 2PZKA 4J4BA 2ZBRA 4WZAB 1L7MA 3MC1A 2WB4A 3PNLA 3UT6A 4DY4A 5JHGB 1KQPA 2D4HA 3CO0S 4YAEA 3Q1KA 1QIJA 3AR6A 2JGNA 1C80A 5EIWA 5HW0A 1TT7A 3HVIA 5GIPE 3C15C 5B2ZA 3IJ5A 1K6EA 4DLSA 3QBJA 2V0GA 1CUBA 3U4QB 3GP8A 1YACA 5KYXB 1YBVA 5DHRA 5IC6A 3RRMA 2WICA 3SMVA 2PN1A 2H7VA 4D3XA 2X5XA 1SNYA 2IUSA 2ZBUA 4WXPA 1TLTA 3FRJA 1GL6A 4OKNA 4GWLA 4KK3A 2Q3FA 4QC2A 4BX8A 1BWRA 4MRMA 3ZYZA 3KQMA 1M10A 4AAYA 1UR5A 1HYBA 3CGGA 2D1YA 1LDMA 1II0A 4R84A 1XC7A 4F04A 3DFKA 3LQQA 3NM6B 5DN6A 4Z0HO 1LZKA 1UKYA 5FPKA 621PA 4HV4A 4HQ6A 1YGPA 3N0RA 1RD4A 2XX3A 5IAEA 1E0JA 1REQA 1A9PA 1B00A 1ZVJA 1A7JA 1SKYB 3ORSA 1GVHA 4P4LA 1PEKE 2OHXA 1K8ZB 2B6HA 1JBQA 1OXTA 4QXOA 5JVDF 2QVBA 3I9KA 3ISVA 1ORIA 3L9XA 3OPYI 4XVCA 3CE9A 3W5DA 1LLQA 3WBBA 4EYQA 3AUTA 2JJ1D 2IKQA 3LPLA 3C8UA 4MTLA 4UAUA 3H1PA 4Y2SA 8ADHA 3ZXXA 5EJ7A 2AXEA 1GTZA 3MTGA 2QR2A 3OEWA 4MYCA 1NVEA 4I1PA 1CC1S 2ATCA 3GFGA 2WWXA 2IUEA 2FPPA 3DOHA 1SVKA 1Y82A 2BBWA 3LP5A 3QG5A 4HDNB 3UG7A 1CQIA 3DF9A 2X1MA 5B53A 4JQSA 1XJQA 1T4CB 2Q21A 2AOUA 3IHTA 3JD2A 4RZQA 3R7WA 3U1TA 3MUNA 2RJNA 2YOFA 1CY7A 2ZRJA 3CUTA 3EC2A 4BLVA 3CX7A 1NMSA 3EH1A 4KE9A 1G4UR 4I5DA 4UE2A 1J0BA 5HTKA 4E2YA 4BGDA 2FFRA 5FBLB 2P65A 5TT1A 2KQUA 3ZZNA 4MKZA 1VIMA 2ONKA 1Z4JA 2AIRA 3KOMA 1QCCA 5AM1A 7MHTA 3GQBA 4B84A 1DBPA 1Q11A 1UMDA 1DQSA 1P75A 2DHCA 2RHOA 3QVGA 1IEQA 2B98A 4FYWA 5BOSA 5JNLA 3GDFA 2XF8A 2YHIA 1NVTA 1Z17A 3JTMA 3T6KA 2IZ6A 2Q5EA 2EF1A 5MN5A 3NRCA 3K0FB 4BQNA 1XLTC 4TTTS 3U1VA 5JAZA 3OE7D 5AKGA 2REQB 3VJMA 1TVKA 2BBOA 3VR4A 3VU0A 1B41A 2HF9A 1LU9A 1PQPA 1PR0A 3NC4A 4O4IA 4Z9FA 3WISA 1G1MA 1WABA 4G23A 1L4BA 3PLNA 1IJBA 4G65A 3EAGA 2NZJA 3DLIA 3SZOA 3TSWA 1ZD5A 2BN4A 2ECFA 1N6LA 4MQ4A 4Z9YA 4ZAYA 3O4HA 1R18A 3RS0A 5SV2A 1YDHA 1YAHA 2V5UA 4NE9A 3TNJA 3F47A 3I9JA 4L7VA 3JYPA 1PFWA 1U7UA 4GX2A 2D8AA 1SC3A 4WJZA 4GVPA 4AP5A 2W2LD 3DBIA 1XEXA 1PG2A 2GAIA 3QEOA 4ROSA 4XEHA 5EJ2A 4A82A 3S4YA 4IJUA 5KTKA 1M5RA 3DBRA 4HGOA 4Y7CA 4AN1A 1E9EA 3T3IA 1YJBA 3QWAA 4HNAB 3CPEA 1XWFA 3R7DA 5F9HA 4B32A 4FGZA 1COWD 4D3DA 3BL8A 3MOSA 3JD3A 3EW9A 5FTLA 1YFZA 2PUVA 3ADBA 2WY2D 3FNBA 1UH5A 5EGNA 2X3UA 1WRBA 5K8UA 4MRAA 4O2BF 4D8UA 2ISQA 2BR3A 2CVOA 2JKZA 3AYXB 4PW0A 3TOVA 1TM5E 2WJGA 3MMSA 3K8OE 3THOA 2OK7A 3D54D 3TW0A 3VDRA 3QU9A 1KJYA 3ZE6A 1I7NA 4MRNA 2YYYA 4EEXA 1W29A 2XD4A 2ISCA 3CUWA 3LSTA 4P4UA 3KSAC 2H7XA 1UFRA 2QRGA 5K03A 1SRQA 4IH9A 5E3HA 4KQHA 3PK0A 3VPBA 2ONYA 2DTDA 5IFKA 2R5FA 1X2BA 3LMKA 1VMIA 1UBLS 5JWOA 1JDSA 1W36D 5FOWA 1NX6A 3ZQJA 1E4EA 2LWIA 3VH3A 1PBNA 2PRIA 4CLEA 2UUPA 4X6LA 1V35A 3F3KA 2H9YA 3NV9A 3HGQA 3PFFA 4BQRA 3AEUB 3FKSD 3H1EA 4G07A 2MDTA 1C1YA 3G3EA 3O0DA 2RGEA 5DX8A 1N2JA 3JWGA 1ODJA 1LV8A 4QNMA 3V80A 2OCBA 4K28A 1DRVA 1S1MA 3COWA 4CFYA 3ZCSA 3ZHVA 1YR2A 3AEZA 4ERXA 4NECA 4TKVA 2ZVDA 4XWWA 4OAOA 4JU8A 1EZ1A 5ALGA 2PS0A 1OBVA 2BELA 1QCDA 2H4JA 2HU2A 2IYAA 2Y66A 1ECLA 1PV2A 3OZ7A 3PRHA 4MKGA 3AG6A 2WTBA 4RYLA 3U49A 4DBLE 5EHZA 3DP7A 4D4HA 1X7XA 2V7XA 2QTAA 3DR5A 1X1SA 3WGNA 5FWYB 5HTOA 1R10A 1B0ZA 3A6KA 1QQ5A 1V8OA 5CLFA 3D6HA 3P32A 3NU1A 4F9FA 2H1HA 1YJ5A 1JLHA 3WFIA 3RJTA 3A3NA 2EG5A 4PIMA 1KZ9A 3BWYA 2DWQA 1L4NA 4MEAA 4U4AA 3T0FA 3E7XA 1RHMA 1C0IA 5KQSA 2B21A 3FWKA 4FFBA 4V0NA 3HB7A 3QMVA 4F4UA 5K0NA 1FA9A 2VT3A 4PRLA 1P1BA 2A33A 2VP9A 3ESZA 2C2KA 3WLEA 3ADDA 4XJXA 1QRSA 1DLJA 1N5IA 3OMXA 1YZ3A 3IPYA 2BM1A 3MGGA 4DXHA 3STHA 1UJBA 2BZ1A 4EYEA 2XXAA 2EX0A 4JDPA 3ESBA 1E1QA 4OPMA 5F2NA 4Y2YA 2I76A 3B5EA 1KOJA 1M6EX 4FBGA 2JRCA 4MLZA 3Q87B 4UULA 5E4TA 1MPXA 1UBKS 4J9UE 3AR2A 3H0EA 4UHEA 3RFXA 1YU6A 4RLFA 1ZJ6A 4F97A 2CD7A 5EP4A 5ERYA 2XQKA 3ULKA 4FYJA 1V7PC 2HK6A 2XWPA 3PYMA 3A4YA 5JRDS 3NBAA 5H0IA 4I6JA 5KKNB 2BFOA 2XUGA 2Z8ZA 3NDPA 5KNDH 5COBA 1MAUA 4RAQA 3ZZ0A 4MCJA 5TLSA 3PQ3A 4TQAA 5ICFA 5C5EA 5DNCA 5JXIA 1BS1A 1LI4A 3TPZA 1ZUIA 1U4OA 2A2ZA 3N75A 3VQTA 4AUNA 4OO3A 3U48A 3BA1A 3V2IA 3UAWA 5H16A 3PXUA 4TM7A 1K97A 3ERCA 1JR3D 4L8GA