3FIUA

Structure of nmn synthetase from francisella tularensis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
244
structure length
238
Chain Sequence
b'DFSPKEYSQKLVNWLSDSCMNYPAEGFVIGLSGGIDSAVAASLAVKTGLPTTALILPSDNNQHQDMQDALELIEMLNIEHYTISIQPAYEAFLASTQSFTQLVIKGNAQARLRMMYLYAYAQQYNRIVIGTDNACEWYMGYFTKFGDGAADILPLVNLKKSQVFELGKYLDVPKNILDKAPSAGLWQGQTDEDEMGVTYQEIDDFLDGKQVSAKALERINFWHNRSHHKRKLALTPNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Nicotinamide mononucleotide synthetase is the key enzyme for an alternative route of NAD biosynthesis in Francisella tularensis
pubmed doi rcsb
source organism Francisella tularensis subsp. holarctica lvs
molecule tags Ligase
total genus 85
structure length 238
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2008-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fiuA00
5KWVA 1NUQA 5K0SA 1QU3A 3N8HA 4XFJA 4MQ6A 3TZLA 1N2OA 2DXIA 5TEWA 3CVWA 3MLAA 2AZXA 1IQRA 4BWVA 3FY4A 1HYBA 1KR2A 1H1TA 1WXFA 2A84A 1IH8A 4MWDA 4WNYA 1FFYA 1COZA 3DO8A 3ELBA 4DE5A 2R5WA 5TGTA 3JXEA 3L92A 1M8FA 4MW6A 2DEUA 4KPUA 4JXXA 4HJRA 2ZP1A 4Q16A 1F7VA 3CR8A 1WY5A 4ARIA 3PNBA 3D6UA 3M5WA 4J75A 2H2AA 1TYDE 3Q10A 1WQ4A 3DLAA 2NSYA 2XRZA 1JMVA 2X1MA 1T6ZA 2B7LA 2OV4A 3FI0A 5F23A 5HUJA 2JANA 3SEQA 3P52A 3CVXA 2RD2A 1WXHA 3ZUGA 2ZUFA 3HZRA 1EXDA 3ZJTA 3SEZA 3HGMA 1G8HA 4ZCQA 4ZT2A 2IELA 1O95D 3PXUA 2JA2A 4PBRA 1QNFA 4KPUB 2AKEA 2AG6A 4I6JA 4J76A 2QJTA 3FHJA 1KAMA 3ND7A 1R6UA 1GTRA 3DV2A 3IVGA 3QTBA 5FNZA 2QUIA 1V47A 1EUYA 1IHOA 4MUKA 3DPIA 4U7JA 1NUPA 4K0RA 3D6VA 1J70A 3CLTC 4NATA 2PZ8A 3A2KA 1K4MA 2DETA 3VGJA 3X1JA 1O96A 5AHWA 1G59A 1WXGA 1F7UA 4GU5A 1WQ3A 4MUNA 5JBNA 3ZIUA 1ZJWA 3CA8A 1G8GA 1N3LA 1P7PA 3K9WA 1QQTA 1M1ZA 1MOPA 4PBTA 4MVXA 3FNRA 4MULA 1M83A 1KAQA 1WXIA 5BNZA 1I6LA 4AS1A 3H99A 2J08A 3IH5A 4I6EA 2J09A 4MWCA 3CLTD 1OWPA 1U7DA 3AIIA 4MW0A 4EF6A 1Q15A 2XRYA 3G59A 2PZBA 2Z3VA 3IMGA 1J1ZA 1KQPA 1NZJA 1O96B 4JFAA 1MRZA 1DNPA 4ZCTA 4CQNA 3TZEA 3FOCA 1Q19A 1ZH6A 2PG3A 3SZGA 4QREA 1NUSA 3IDFA 1O0CA 2E21A 4MLPA 1YUMA 3FH0A 4DDHA 1WXEA 4G6ZA 4ND6A 1ILEA 3AG5A 1N2BA 3VRHA 1WKBA 4EG7A 3X1MA 1I6MA 4EG4A 3RFFA 3RHSA 5IHXA 1YULA 1X8XA 2DPLA 4RPIA 3A4IA 1S4MA 4MVCA 1GPMA 1N1DA 2VXOA 3KT3A 2DLCX 3CLSC 1Y42X 2HGZA 1MB2A 2CV2A 1GZUA 1N2HA 3SDBA 2A4MA 3ZJUA 2ZUEA 3COYA 3IOBA 3H97A 4L2IA 1U0BB 3IUEA 3G6KA 1CT9A 2A88A 3PNYA 3HMQA 1I6KA 4F4HA 3C8ZA 4ZT5A 1O0BA 1GN8A 1K4KA 1J1UA 3ZGZA 5LM3A 1JIIA 4ZT3A 1N2JA 1NURA 4KR7A 1K97A 2CYAA 1ZUNA 2YXNA 1JEDA 2QTRA 2BTEA 2QTNA 1JILA 3NBAA 3CLSD 1TYBE 4HK4A 4NDAA 1J20A 4YMIA 2I1LA 1XNJA 4ZCSA 4L2IB 2QUKA 4MUJA 4NX2A 2E0IA 4JYZA 2A86A 2EL7A 1IRXA 1XNHA 2D54A 4MW9A 2A1TS 3I05A 4XFDA 4ZCPA 1J21A 3ILVA 2PZAA 3TQIA 1M8GA 2OQ2A 5J58A 4AQ7A 5FO1A 3UY4A 1B6TA 4UZEA 2GOYA 3ZJVA 1MJHA 1TYCA 1JIKA 3MUEA 1EJ2A 5H16A 4NAHA 3G5AA 3IMEA 2A7XA 1MB9A 4EFKA 1H3FA 3IOCA 3BL5A 1KKUA 2CV1A 1OWNA 2J5BA 3IOEA 2QTMA 3FIUA 1ULHA 1JGTA 1VBNA 4PY2A 1TQ8A 1VBMA 1GAXA 4P2BA 3KT0A 3UC5A 1N77A 3A05A 1X6VA 1QJCA 4MUEA 1TYAE 1QRUA 3ZXIA 3NBKA 2H29A 3TS1A 1KORA 1QRTA 4XSVA 1MAWA 3LOQA 1NI5A 1YIAA 4DNXA 2IJGX 1EUQA 3N05A 4YBRA 1R6TA 3RK0A 1PG0A 2HMAA 2DR2A 1OBHA 2E89A 2J07A 1KP2A 1M8JA 4G5YA 1IVSA 2JAXA 4S1OA 5DK4A 1OBCA 2NZ2A 3OTWA 3KT8A 1JEEA 4MVYA 2CYBA 1MAUA 3HFJA 4F3RA 1MC1A 4JZYA 4DJAA 2IP1A 1NSYA 3CLRC 1WOYA 1PFYA 4MWEA 4YP5A 3RJZA 1OWOA 1KQNA 3UK2A 2C5SA 4MWBA 3Q12A 3IMCA 1A8HA 4DLPA 1JZQA 4MUIA 1T9GS 4ND7A 1QU2A 1G8FA 1VBKA 5LLTA 1KH1A 3P0IA 4RUKA 3UMVA 3AKZA 1YUNA 1U3DA 3TQOA 4CDNA 1PFWA 4DDKA 3SZ3A 2CV0A 4ARCA 2D13A 2YWBA 3ISJA 3CLRD 3CVVA 1EE1A 3H9BA 5H7XA 3GMIA 2YWCA 3IODA 4MW2A 3SYTA 1O5TA 3MXTA 3ND6A 1JHDA 1MBZA 1WZ2A 5DB4A 4ZCRA 4HPWA 2Z08A 1J09A 1EFVA 4QRDA 2D5BA 1KH3A 1D2RA 3TNJA 3H9CA 2VTBA 4KR9A 1ZH0A 1NUUA 1TFUA 3PRHA 4MUFA 1R6XA 3FDXA 3FG9A 5FO0A 5IJXA 5TS2A 1O94C 2RE8A 3COZA 1XNGA 3NV7A 4U8HA 3P0JA 1GTSA 4GRIA 5DEOA 1YIDA 2G36A 4A91A 3LCJA 4OUDA 4EG8A 3VU8A 1LI7A 2O5RA 5HG0A 4MW1A 1JECA 1VL2A 4I6GA 1V8FA 2CYCA 1OWMA 3COVA 4WSOA 1XJQA 2QJOA 4X0EA 1N2GA 3CVUA 1YI8A 2V0CA 4U63A 1IQ0A 2DUMA 1EFVB 3FWKA 4E1AA 5KCMA 1RQGA 1BS2A 1NP7A 2VTBB 2J4DA 2HZ7A 1O95C 3FETA 4R0NA 5J59A 1KP3A 1O94D 2A1TR 2Z09A 2WQ6A 4MW5A 3ZXSA 5HUHA 3AG6A 1OWLA 4OUDB 4R2LA 1UFVA 2CT8A 3S3TA 1EFPA 2WB2A 3OP1A 2BYTA 1TEZA 4DDMA 2QUJA 3MMXA 4YP6A 1M8KA 2EJCA 2CFOA 2E18A 3N2YA 3A04A 4ZT7A 4MUHA 2CSXA 3MLBA 3CLUC 3IVCA 1WJGA 4MVWA 1QRSA 4NAUA 1Q77A 1F9AA 2PFSA 3U1VA 1Q11A 3IUBA 1PFVA 4EG3A 1GLNA 1LW7A 1K92A 1OD6A 2PXHA 1O97C 3HL4A 1QTQA 4MAFA 1KQOA 3Q4GA 2CUZA 1EFPB 2X0KA 1JZSA 1NYLA 1PFUA 4EG6A 4R2MA 1T6YA 4MW4A 1O6BA 3PNVA 1VLHA 3RK1A 4ZT6A 5DASA 4EG1A 4G5FA 2O8VA 2WSIA 4UZFA 1N78A 3CLUD 4KR6A 3H05A 1IFXA 3E27A 2TS1A 1LI5A 3X1KA 4NZPA 1M8PA 3P0HA 1N75A 2V0GA 2A1UA 1SURA 3QE4A 2GKSA 3RBAA 1O97D 4QBTA 2GM3A 2QUHA 3HV0A 5J5AA 3AFHA 1NUTA 1F4LA 1H3EA 5EKDA 3INNA 4FZJA 5KHAA 3KFLA 4K03A 4CDMA 4EG5A 3UOWA 1FYDA 1T9GR 2DERA 4H3SA 3GLVA 1PG2A 2QJFA 4PBSA 2YY5A 1U7XA 4TS1A 3IVXA 1U3CA 3L93A 1H3NA 5LFAA 4OJMX 3K32A 4MW7A 3LE8A 2A1UB 1JIJA 5TEVA 3F3MA 4MUGA 3ND5A 4YP7A 1KH2A 3QTTA 1N2IA 1T6XA 4JXZA 2PIDA 2WQ7A 4KKVA 3CVYA 3N9IA 4EGAA 3GUZA 4ZT4A 3KT6A 4HJXA 3COWA 1IQUA 2X1LA 4CT0A 5K0TA 3SP1A 1N2EA 4Q93A 2X3FA 3AL0C 1I2DA
chains in the Genus database with same CATH superfamily
2HJSA 1FJXA 3Q1LA 1A0OA 821PA 1KI6B 3PB3A 4E5PA 1KJJA 3ILXA 3LW7A 2F8LA 1C30A 4PYIA 1DCTA 4M0KA 1BOOA 4MQ6A 1KK3A 2FVYA 2GO7A 3OURA 3PXCX 3HY6A 3ZHZA 3OZSA 2RHCA 4YV0A 3NIDB 2D1TA 2AZXA 3LWBA 2K7FA 3FY4A 3X2EA 5F21A 2XZDA 2XGSA 3HA3A 4XX0B 1Z4JA 3OEWA 4JLKA 3SJCA 4D3FA 1T5IA 1KAOA 2EQ5A 3KHKA 4B3GA 3AVUA 3JVEA 1KA9H 3TFQA 3DOUA 3L8HA 4KPUA 1VLVA 3DOFA 3IUPA 3GEHA 4QBHA 4EITA 4JU8A 3GLGA 3FAKA 3ACCA 4GUAA 3W5AA 3I9NA 2CT8A 4CMKA 4B45A 1IJFA 3JQ8A 1T9BA 5AQEA 3W34A 2P9HA 3VR5H 4ZIRA 1L5MA 3DLAA 3R6TA 3PHGA 1NVAA 3UK6A 3RWMB 4IJ6A 2HJVA 4KNWA 3WMRA 1A1VA 3OWXA 1D6JA 1FY2A 1YDMA 4IVPA 4NMWA 5DCUA 4GO1A 1SCNE 2G63A 4BFCA 4KIJA 1I7LA 4D56A 4ZI7B 1GL9B 1R9GA 1NZDA 2JANA 3DT8A 3W3ZB 5AVKA 3C3EA 2VP9A 1WXHA 1X38A 3LVRE 3WKEA 4CEHA 1L4BA 1PR6A 5AJXA 2J9RA 4HZUA 4NZYA 2CKDA 2ZRDA 1Q14A 1P44A 4XDGA 1KJWA 1M34A 5JCZA 1YZUA 2C42A 2VT2A 2ZT7A 1J00A 4LC1A 1FNSA 1XZKA 2R66A 4B17A 2NT3A 1DG1G 4TMXA 1E0KA 1J0XO 1B74A 1SELA 5KYYB 4TTVA 1YZQA 4B32A 3PE3A 2CCGA 1CQZA 3L6RA 1QKKA 2OLJA 2XUZA 1NY6A 1DARA 2B78A 3I2HA 4LNUA 3UANA 2X58A 3DV9A 2J32A 3GF4A 4KBGA 4KXUA 4LECA 3H3FA 4R01A 4PRLA 2FDXA 4IFIA 2BF7A 1SKUA 5E95A 1OB2A 2CL5A 1QK4A 3GU3A 1RXUA 5EFZA 2VQSA 3RF7A 4C7MA 1G21B 3O3OB 1NW8A 4KQJA 4M89A 2R6AA 1VKJA 3K9WA 1NC3A 2D5AA 3X1WA 3JV7A 2GKGA 4WUTA 5I3CA 4XW2A 5ITWA 3IV9A 2AT1A 2ZM6B 4DV5B 5BNZA 1HEUA 1PEAA 3FPLA 3OOEA 4FOOA 1G5HA 4A10A 2FOIA 3EISA 3FA2A 3OUTA 4YWHA 4TZ6A 3AHDA 4KDCA 3VR6D 4D4IA 1CP2A 1E0JA 3AM3A 3I52A 1L5NA 4MW0A 3I76A 2JLWA 3A2MA 3ZIAA 1EP2B 1Q15A 2PRKA 4GYYA 4J2OA 2D1YA 3PHHA 4HWRA 5IWAB 3HBNA 1EFLA 3PQ2A 2H3HA 2D00A 2JH8A 4HGRA 1YB5A 4OXYA 1DNPA 2EFGA 2ID8A 3FOCA 1CJMA 5HF5A 1I3OA 2RAPA 1NXTA 3CPSA 3CUVA 1O9GA 4JENA 4RWEA 3SQMA 1XMXA 2X7XA 2ZS7A 3KDSE 4QUHA 4H1TA 4E33A 3IIEA 4D4GA 4GP9A 5BXQC 2BEJA 3KOYA 4G6ZA 4F7DA 5TPZD 3LHKA 2AUMA 4FD2A 4M0MA 4YB8A 4M8KA 4U5XA 2VRBA 2Y0DA 2OV2A 4TWAA 2P75A 1B00A 2GMWA 3E9YA 3V6MA 4MHTA 2XKBA 2D59A 2QPTA 2B8TA 1F1BA 2Z2KA 1VYTA 1ETUA 1UL1X 3ZZUA 1P2GA 2QM0A 1FFBA 4MKRA 5LJIA 5A4KA 3PFBA 1RWOA 2PUVA 3M8KA 3REFA 1WCYA 1TQ2A 2R8RA 4G23A 3WLHA 1LPMA 3KKMA 4C6TA 3CM0A 4G5HA 3UJ9A 4YONB 3DYVA 4KWEA 3ITEA 1NJGA 5DNCA 3EQ8A 1EGMB 3PUYA 4RTRA 4K6CA 2Z2YA 4L08A 2BGWA 4ER0A 2CJPA 2OEPA 1MEJA 3KXPA 4ESOA 2I66A 4ZZIA 1CS4C 4IIJB 1IUKA 2P4EA 1Q83A 2QX4A 2Q7OE 3SMQA 2RBEA 2IS1A 3INRA 2Z5LA 4X9XA 2HXGA 2VI5A 4QXQA 5B64A 3H2KA 1R9JA 3OPVA 2RBKA 4J6EA 4N7BA 4XRGA 2PVSA 4MI3A 4KQEA 1YS4A 3KCNA 2FLWA 2PKWA 1UKEA 1PNVA 2HC9A 2YXNA 1P4RA 4PPGA 4R3NA 2IX3A 4OXRA 4M7RA 1CUAA 1Z56C 4TV8A 4WZZA 3AB3A 3K70D 5C1OA 1JKMA 4CN9A 1F12A 1V8OA 2HW8A 1RQXA 3AT1A 4J29A 1Z33A 4C01A 3SBXA 1TU0A 1YR6A 4MUJA 4J6FA 3HJNA 5EERA 2G4CA 2IXGA 3SXUA 1T3LA 1ZXXA 4NI5A 1V6AA 4NX2A 1EHCA 1H2YA 4D0SA 4BQQA 2DUNA 4JYZA 1XRQA 4C0SA 4B3JA 4HDKB 3VC7A 1VJ0A 3CW2A 5CDUA 3VYWA 3VR6A 2FOLA 3BK1A 1A69A 3SCZA 4IUBS 1SHJA 2G4LA 2QMOA 3LVQE 4LX8A 2QK4A 4PYNA 3DEKA 3HC7A 4XOIA 4YH1A 1TMGE 4MVJE 1MORA 5SY6A 3TQIA 1E2MA 1QGED 1UXHA 3SZOA 1QZUA 5KTTA 1CDOA 1J0AA 3DCJA 3C8UA 4QBFA 2GH1A 1GZSA 3NLLA 4DY4A 1AA9A 3RVQA 2PJRA 4N65A 5D7NA 4MR9A 4FSHA 2DFPA 2FB9A 3QF7A 3UH0A 3MINB 1J2JA 4JOBA 1MB9A 4F56A 5JAUA 2R25B 3DLPX 1N0UA 3ET4A 3DV0A 4OSPA 1YRBA 2YV5A 4YT5A 5L7WA 3D0QA 4P08A 1BG6A 1SZCA 2CL7X 3P4XA 4CKEB 3T3HA 1U63A 2KLHA 4GWLA 4I3FA 2F43B 4NWIA 4R1SA 3NKLA 4WLUA 1TQHA 2H1HA 3QWBA 4EPYA 4F8JA 1YVUA 2ZBEA 1JAYA 2FI1A 2X4DA 4HYEA 4I8DA 3O0DA 4L4RA 4ZTBA 2JFQA 2HB6A 2I29A 3PUJA 4Q00A 4BN0A 3FNEA 4EB6A 1CQXA 4HAYA 5K4GA 2Z58A 1ZNZA 5GQSA 4CDRA 4GOOD 1X7ZA 1V35A 4FXOA 5FLKA 3RSOA 1H22A 3ZI4A 1QRTA 5KZMB 4DNXA 4CLRB 2Z9DA 1EESA 1PW5A 2EYUA 2X5OA 4LDPA 1QKIA 1K5DA 4RMJA 1XGKA 4U00A 4ZRNA 4DS3A 1CSEE 1LQUA 5A5EA 3UM9A 4G56A 3O93A 1QO7A 3G2PA 3PQCA 3PQ3A 5P21A 3RSHA 2FW8A 2C2YA 3HFRA 2Y6UA 3D8RA 3IPYA 3OOWA 5L3SB 2DR2A 2AMLA 5EPOA 1NL3A 3D8TA 3GJXC 1ZOLA 2YYAA 5AIAA 3KWJA 3L6EA 5K3BA 1QE5A 3UJBA 1BKDR 1B8NA 1BKYA 1YRQA 2RG7A 3QG5A 2ZRHA 2HI0A 2XLBA 3RHTA 2X1HA 5LQKA 4CL0A 3UAWA 2BKVA 3KT8A 2CVPA 4BNGA 1A9XB 1FFAA 4RV4A 1PL8A 1UDRA 3K0AA 1Z5PA 3CU5A 5AUOB 1OGIA 2IEIA 3DMGA 1UPTA 4B7ZA 2C83A 4ZYWA 1FTWA 2QRKA 2F3QA 3FNIA 1YVDA 5DHUA 1RP7A 1XEXB 1HWYA 1V7PC 3T1TA 2V7BA 3IEIA 4Y6LA 3AQIA 1BE0A 1QYCA 3FB1A 4DA4A 3G9XA 1K7FB 2VUTA 1YL5A 2BKAA 4RHXA 4V0LA 2FMXA 2GHIA 4RKYA 4ND7A 3LECA 1VBKA 3GXBA 2RHJA 2EKDA 2WWVD 3ZKWB 1KH1A 4EHDA 2C2MA 3DQPA 3NI2A 3QJYA 1XC7A 3IEXA 4CU5A 1NYRA 4H1UA 3WK6A 4XI9A 3Q9LA 1PJCA 1TUBB 2ZU6A 4XYBA 1XXHA 4DDKA 1XL1A 4JIGA 3K09A 4X6LA 1IOWA 1VG9B 2LV8A 4LDAA 4S1WA 1PSDA 3PSAA 2JFNA 4TTPA 1T43A 3UWOA 2DJ5A 1Z06A 3H9BA 1REQB 2VPQA 2Z9BA 1LSSA 4FFPA 5JNLA 1J9EA 4PANA 2W71A 2A0XA 2UYCA 1P4HA 5FUVA 1PD1A 1XEWX 3RKUA 4Q7QA 1HNNA 3L0BA 4EX7A 1WZIA 2GBIA 1RRMA 3NHPA 4M76B 5BYKA 4I1SA 3GJZA 3LXRA 4IILA 4OHXA 1W0JD 4V3BA 3TQQA 3EMDA 2D74A 4Q03A 4D81A 4DBZA 3PI6A 1OX6A 3OSZA 3PJFA 1YDGA 2LCQA 1HNWB 1E2NA 1NOIA 3ID6C 2JZCA 1OZAA 2GZSA 3QYPA 4AM8A 5C5EA 1Y4SA 4GRIA 4Q9KA 3AB8A 1E79A 1E2JA 1NDHA 4IDGA 2HLNA 4M7OA 4OP2A 4RMIA 1WE2A 2NPFA 4QFDA 4EG8A 2P69A 4IX1A 1QVZA 3SEAA 4MYCA 1MDFA 2QYOA 5F2OA 4KQ9A 2DWPA 3OQVA 1BRMA 1L7OA 2PBFA 4KNVA 2W42A 2B61A 1BE8A 3CVUA 3O9ZA 1L1EA 3NXSA 4W4TA 4O2BB 1CQJB 3QU9A 5DO9A 1DKUA 3F4KA 1OJLA 5KCMA 3IQDB 3NP7A 2WIAA 3N70A 5CLFA 4EAAA 3AY3A 3U3RA 2PL9A 4GWKA 3EULA 1QTIA 1KP3A 1WUKS 4DJJA 3SQDA 2PANA 3ABOB 1Z8HA 2W2LA 1KSHA 1U9ZA 2WDZA 4XLZA 3W5JA 3IEKA 1RI1A 3DF9A 2CNBA 4IJUA 3L43A 2IEGA 3A6KA 3AF4A 5T5QA 1WDMA 3ZVMA 4II7A 1JQEA 3STTA 2D2IA 3QEJA 2WB2A 2B9VA 1H6CA 2JZOA 3VDXA 5I9TA 3W7AA 3AEQA 2H2WA 2VCHA 4KP7A 4OHBA 2FRDC 2QD3A 4HRYA 4BVBA 3V9PA 1U8TA 4FYYA 1O2DA 2H8KA 2FSPA 4BNUA 2W6JD 1YWGO 1BJTA 5LNK1 1NQAO 2QRHA 4CIYA 3G5UA 4MVJG 5C32A 2HWWA 4NEGA 3VNQA 1YJ5A 1J2YA 1CY4A 1NNLA 1U3VA 2I6SA 2IDJA 3CLUC 3DA8A 4LXHA 4MVWA 4ACBA 1U2GA 4EEKA 1KKLA 2YDYA 3PGKA 5IYZB 1XDUA 2BMAA 3NBZC 1V9CA 3NOOA 4QATA 2OG2A 4A27A 3TSWA 3BH7A 1JA0A 3DZHA 4XUGB 1Z0AA 2JD0A 3IUBA 1XA3A 4DLLA 5BWNA 3EYWA 2JGIA 4CPDA 2H4JA 2AMJA 5EUCA 2M6LA 1A1SA 2PKEA 4B3MB 3OTGA 4RY0A 3F5DA 2C03A 2OHXA 4QBGB 2FNAA 1M7BA 3BBLA 3DTVB 3ZV7A 5LP1A 1E2UA 3KYDA 2Z6UA 2EWWA 2N47A 2VAXA 3ZHYA 1P60A 4B34A 1W0JA 4I8XA 3M2TA 3QLJA 4E5MA 1GM5A 1KGDA 2Q50A 4YNBA 5K3OA 1IN5A 4HWSA 1FSZA 1EVKA 2JKZA 2REBA 4PVDA 1U2EA 5H3HA 5GPBA 1ZCBA 3RIYA 4TRMA 3PDHA 3FKSA 1WRBA 2Q0HA 3LQYA 4FYHA 5FWXA 1U0RA 2J4FA 3MS4A 4W8OA 1TAHA 1H9BA 2IX9A 1F2UA 2ORVA 2ZWMA 2C98A 3B6MA 4FMCF 3RBAA 5HEKA 3GUUA 2E1PA 3WADA 3LIPA 5J5AA 3Q7QA 1FS4A 3KJIA 4IIYA 5CGZA 1X15A 5ALUA 1UWCA 4FEYA 3AOEA 3OLXA 3BFPA 1MFPA 2W2PA 1NVKA 1Q50A 3AR7A 3HKCA 2YIJA 3PJGA 4K6HA 4KLCA 8AT1A 4DF3A 5H9WA 2PQ0A 1PJLA 1ABEA 4O4JA 1ESNA 1KHTA 4ISBA 4CM9D 1WG8A 3MLEA 4TLEA 1G21E 1T91A 2XNJA 1SHTX 4BNMA 4PLWA 2ZREA 2P5TB 2DFDA 3DB2A 2B1JA 1XYGA 3OQHA 4TS1A 5ALWA 3NRCA 4B0OA 5I48A 1GR1A 4D97A 1VLQA 2L0XA 4J1SA 1V96A 4O3FA 4IYRA 3R0VA 4OBXA 3IEVA 4DQDA 4ZVLA 3RAFC 3KTAB 1D4AA 3D3QA 4R2XA 1FFXB 4NH4A 5IAEA 1FRVA 1Y81A 1PR5A 5EG5A 1R4AA 1SCDA 2RH8A 2ZOSA 3PC6A 4YP7A 5C51B 3QTTA 3B5JA 2O7QA 3E5NA 2JH3A 3WBJA 1OLXB 1CY0A 3EY4A 1AS0A 4MI1A 5DX8A 1DEOA 1H8EA 1L7EA 5ALIA 1GV1A 1ZW1A 3C6XA 3EJ6A 3KT6A 2NU9A 3B7WA 3EZLA 3QBDA 4JNCA 3CKLA 4O29A 4RFVA 4CQLA 5CDYA 4IKOA 4ERXA 3RIMA 4H0NA 3NHUA 1TLLA 2FWNA 4I4TA 4EA7A 1IATA 1FUIA 2CFRA 1LDEA 3CNNA 3QVSA 1PWHA 4MKXA 3Q8MA 4U6QA 2OO5A 3SP1A 4EVSA 5EE3A 1DX9A 3L18A 4KE9A 3AL0C 2NNLD 1GQQA 2I6GA 2A9OA 1E92A 2RKWA 3RANA 1RP1A 5TS3A 5B37A 4DTIA 3SQOA 2JEZA 4OP3A 3R0JA 4NYMR 3A0UA 4NF2A 5EQJB 5TGDA 4URFA 4Q3OA 2HMWA 3B82A 1ZR4A 2B4YA 3RC9A 4AD8A 4A0HA 3QV2A 1M2EA 4TV9F 2LVBA 4RZXA 5C81A 2FE1A 3VNAA 5CH5A 2UYYA 1XZFA 3AFGA 1YF3A 3W3AH 1SOUA 2J0UB 1Q95A 1P72A 2HSDA 2NSHA 3B8HA 8ATCA 3D7LA 1X13A 3NWOA 1GXSB 4YAWA 5L3VA 3G49A 3GFOA 5AI0A 3C45A 1W25A 1TA0A 1F4PA 1TYDE 5JXWA 3KR2A 3GVIA 4PYMA 3OLVA 2QRZA 2JGFA 5C37A 2PX0A 2JFYA 3F8TA 5JJ5A 3IT2A 1KVUA 4G5XA 4BVGA 3GUCA 3VU3A 5AVZA 1OYWA 5EKXA 5GVRA 1Z6AA 5EEGA 5C4MA 2GLTA 5IMBA 1YS1X 1QDUA 3MTJA 5LQSA 3ZJTA 4O4IB 4BGUA 3LUPA 3I64A 3OFKA 3AVXA 3FBWA 4IOLA 4HFJA 1PRYA 3PENA 1E1NA 1KEWA 1SB8A 1L2TA 1DO8A 3LX4A 1MDBA 4REMA 4X8MA 4X97A 3A28A 4PBRA 4BBAA 4IH4A 3VPDA 1GPWB 2HJWA 5FUQA 3I62A 2HBYA 2JGMA 3O2JA 1C9DB 3K1AB 3RE1A 5AVRA 2QJTA 3FHJA 3VKFA 5KQLA 1EEXB 3ZY2A 1JG3A 5K8VA 3WA7A 3U5ZB 1IN7A 1F8UA 4D0LB 4F4CA 3S2GA 3G8BA 1KSFX 1VSVA 2OC4A 3KXDA 1J25A 3OHMA 1E7YA 1P75A 3ORRA 3R7SA 1EUYA 3C6ZA 4MINA 3KKPA 2GBLC 3JWGA 1K5HA 1XHFA 5CLIA 2JGEA 2UKDA 2VHEA 3LT2A 5EJGA 3BD8A 4INJA 5AXAA 1NI4A 2XQJA 2P9CA 5EQDA 1GNPA 2PRYA 3U26A 4F9FA 6Q21A 3QZUA 3PJRA 1BFUA 3HGQA 5K6TA 4PWYA 5KX5B 1XQ6A 5AVWA 4RJJA 4PEVA 5HKKD 1A72A 1PFGA 2P40A 4DCPA 2WWYA 2XBLA 3QKUA 2Q3FA 3WE7A 3ZH2A 2O1SA 1I3MA 2DY1A 3I3OA 3U62A 1C8BA 4P84A 3KZOA 4UPDA 5E0KB 2NU6B 5B58C 5DHAA 3F46A 2ZJYA 3M70A 4WA8A 4R54A 4FT2A 2CXSA 4M1SA 2GDZA 2GT1A 2YH2A 1WXIA 3A10A 3ZQUA 2X3YA 1CZRA 1RXIA 4TSRA 3NOXA 3M6XA 3CO5A 4JCCA 1YASA 3LBIA 3RKSA 1AHPA 3W9YA 2GCOB 3KYJB 4IIHA 4ND8A 4LI0A 4FKBA 4LRTB 5DTQA 1SKBA 3HCAA 3NFYA 3C1AA 1B0UA 2XY4A 1HTBA 5I4KA 4RSHA 3EOBI 1K6EA 1Q7CA 3ENWA 3IMGA 1N5OX 3KETA 5FKJA 3ROMA 1TZBA 4OTZA 3H19A 1V4NA 3RG8A 3U44B 1NBMD 3NAZA 4WLFA 3EXFA 2C5EA 1PZMA 1Z82A 1JXMA 3DDNA 2A57A 1QYRA 2EG9A 3HCCA 1QHXA 3ICOA 2YZ7A 4WRRA 3EGDA 5ILGA 1FLDA 4QXPA 5B3JC 3HA2A 5EP2A 3FWZA 4JJAA 4Z7JA 5JD5A 1U1DA 1KYZA 1ZGJA 3MTQA 4KR3A 2VNIA 1ZNWA 421PA 2WYOA 1GTZA 2ZUTA 3AILA 3K0CA 4C4PA 1KE2A 4C6RA 1Q0QA 3H17A 1UKCA 2FGJA 4AB1A 3ZQJA 2IE0A 2X4GA 3KEGA 1BXKA 2FPIB 3INYA 3FSGA 4A82A 4B4OA 1L7RA 4BAZA 3P2MA 3BEOA 3NNSA 1VLZA 2WYVA 2VXOA 4NCJA 5AW4A 1R15A 1C4WA 2ZJ0A 4X1IB 5GZ6A 13PKA 2Q2OA 1T2CA 3Q7PA 5L40A 3QBTA 5A3VA 3ZJUA 4WBNF 4O0MA 1E6UA 3L0IB 3ZVRA 2WVHA 4KWHA 3TQCA 1E6MA 1T5OA 2BKUA 2G7ZA 1XJ0A 1ZMBA 4JL6A 2HFKA 3HSYA 4AJLA 2P35A 5MN4A 1L5YA 4Y2HA 3ODPA 3GZJA 4OHMA 4M7WA 1HQKA 4KIFA 4WY5A 3UICA 3D8UA 2AEFA 1XAIA 1XQXA 4LOHA 3EC1A 6REQB 5JHHB 1AMUA 1SH7A 2A6PA 1Y8CA 3S6JA 3S68A 3JQAD 1G66A 4JUCA 4MX8A 1GRRA 2XA1A 3N6VA 1N5RA 1HYHA 3DTNA 4CKXA 1NURA 1TDJA 4MNTA 1G2IA 4OGKA 1O89A 3GEDA 2BBOA 4DOMA 3D7RA 1U5BB 4TTQA 5HZMA 1TZ2A 1IC6A 4NPCA 2OK7A 2PWZA 5C52B 4RIEA 5IT5A 4AX4A 1CK4A 7MDHA 3NBAA 4EZEA 1TYBE 2QMHA 3N75A 3TSCA 2E37A 1C3OB 1Y5NA 2V7PA 5AVXA 4HGQA 5FFNA 5KQSA 4L73A 3H0EA 4NDAA 3PQ7A 5H80A 2EWMA 2GN1A 3K30A 2I2BA 4E5NA 1AC5A 2OHJA 2YHIA 1YBFA 2H5LA 1THTA 1LS1A 3PE4A 5EY5B 1QDEA 2FQXA 1HC7A 2CLDX 5K0NA 2FPPB 3CQ9A 4PFJA 5ETJA 1XNHA 5EJEA 7AT1A 1DC4A 3MC1A 4IZOA 1XCMA 1QYXA 2C2ZA 1NJ2A 2J9FB 1Y1PA 3COPA 3KWMA 3WQRA 3TW8A 1IY2A 1WZNA 2ZYDA 3NH6A 5ALZA 1F51E 5H3CA 2XD9A 1QVAA 5E1DA 2VVTA 5IUNC 5TJ9A 5EJ7A 4YRPA 4JUBA 2FSHA 3LGAA 4NMHA 4PWZA 2WJGA 2WZCA 3BMOA 3VRHA 3PR3A 3GNTA 4YCDA 4EMTA 2EBUA 1JAXA 1G7TA 1Y9ZA 3Q3GE 3WLAA 3TAXA 1H4TA 3ZKAA 3LLCA 4J90A 2CF6A 1X3LA 4W5RA 3QWFA 5K03A 4IFEA 5DLPA 5CVVA 3HCFA 4RK4A 4LSGA 3C5WP 2WWRA 1N8NA 2L82A 1RWWA 2NTVA 3WB2A 1GAXA 2IYZA 2XD4A 2B94A 2AF3C 3CUUA 3WLPA 5BUQA 4BMZA 1E9RA 4BNZA 1TAGA 1GQFA 1R9MA 3PF9A 3T5TA 1MOSA 4HDAA 4E11A 2VNSA 1RC0A 1NI5A 1ORDA 4TX1A 2B7CA 4RZ3A 2B2NA 3E3MA 3RUHA 3O03A 1XZQA 1THZA 3WWDA 3E2PA 4MROA 1BIFA 5LOVB 1KPGA 2B1QA 1AZTA 1JHVA 4IQ4A 2XX3A 4MSUA 1NVDA 2R6ZA 2A67A 4DKXA 1VI5A 1PR4A 4N6GA 4LRXA 2XH8A 1WNTA 1Z22A 4MMXB 3IAAA 1KP2A 1B1AA 1M8JA 1SFRA 1N7HA 3NIFB 3JQAA 3OE7D 4MVJP 2Y1OA 3DE4X 2LD4A 5I3ZA 2IZOA 1DAKA 4S1OA 1DDIA 4ZAFA 1QRDA 2R6FA 4R8SA 4DR1B 2ZJZA 4MVYA 3ZCXA 2E4XA 3RVSA 1E3LA 2FMUA 2YCLA 3BGOS 4FMDB 2HQRA 2I9PA 3TEMA 2MU1A 4BQIA 4F3RA 1JMKC 2G40A 3HJCA 5EJFA 3ZOKA 1RI2A 1VPVA 2ODTX 1KRHA 2V55B 3SJZA 3IUQA 1JYFA 4B4WA 2WF7A 3BXOA 3GFFA 4BNXA 1IWOA 1KK2A 2W6CX 1LDYA 4MGYR 3GRVA 4MQBA 3T95A 5A3RA 1Z2AA 1JR3D 3NEJA 1Y7IA 2G76A 4MUIA 1LLFA 3V55A 3LKDA 2D2EA 1NOJA 1D8TA 2EFCB 3H87A 3DCNA 4UASA 5BT9A 4M8LA 4ENTA 5JWHA 4GMFA 1HFWA 1U1EA 2XW6A 4PQYA 4Y6GB 5ICCA 3SQXA 1J7JA 2ACVA 4UTRA 3K6SB 4HB3A 2JASA 2WF6A 4MZDA 1IHXA 2C4WA 3R7LA 5K3DA 2HSZA 2NNWB 3NHAA 4IEEA 1HDXA 4R8VA 4DBLE 1R4NB 1I80A 2VHWA 3K16A 4DB2A 1D07A 3ISJA 3B38A 1W8IA 4LBWA 4LPSA 4M1KA 4PG7A 1PNRA 4F7WA 1PL6A 3TZHA 3VZPA 3ZWKA 2PD4A 4QYIA 1U2TA 2ZROA 1BX1A 1G98A 2PWBA 4Y9DA 1FVHA 3GBPA 1ESEA 1QG4A 4RENA 3HBAA 3OTOB 4R0VA 4EWLA 3OECA 4AJEA 1SVLA 1EYZA 2D5BA 3OEHA 1VG1A 3P2KA 3TNJA 2YBDA 4KJZA 1DBSA 4GI5A 4XPIB 3TJMA 2OSVA 3GLUA 2EFEB 4ZQIA 5EGSA 4RLQA 2IITA 1OFUX 3BMXA 4LOLA 1JKFA 1W85A 5D6OA 3RARA 1BNCA 5M29A 3GN1A 2W6IA 1VGVA 4J0KA 2H8GA 4EF4A 2I4OA 3EPHA 1KZ6A 2WDPA 2YFHA 3R77A 1AKEA 1UZNA 3GA0A 3I2FA 4OU4A 2RI6A 4Z8XA 4Z0TA 1S01A 1RXSA 1V8FA 2XYPA 2J3DA 1GCUA 1T4MA 2C99A 1Z37A 2FHPA 4WZBA 4ZQBA 4TL9A 4FFBB 5ICFA 2AG1A 3WDKA 4E22A 3D6MA 4DIEA 5EWJA 2BE9A 1IXYA 3T3PB 4ZGGA 1UP4A 1KEUA 4MQ5A 5B1EA 4EBBA 1QHSA 4E1AA 5BUSA 1PS0A 3PU6A 1NP7A 3UCFA 5CU7A 1TCCA 2VJMB 4HLCA 3SX0A 2YJGA 5F4BA 1CUUA 3IBTA 3LX8A 2QG4A 5GOTA 2V3VA 2FZCA 3A4YA 5HE8A 3FTQA 3RAPR 5ALNA 3O95A 3EXG2 1WUYA 3KDPA 1W5SA 1W7AA 1SUFA 4URYR 3AERA 2JG3A 2FHSA 4KWCA 3T7CA 2GD6A 1HDCA 2HL6A 4G07A 1Z08A 4NBVA 5FV7A 4DLXA 5KNDH 4MA0A 3QA9A 5CK5A 3S3TA 1MGOA 1CJUC 2XWQA 3AZOA 2B8JA 5EMNA 5C35A 3DAPA 1JR3A 2C8JA 3MMXA 4YP6A 5IEJA 1GL6A 2FZ4A 3KBBA 3QF4B 4HKTA 3MYRA 4MRRA 5C2JB 4I5EA 5DEIA 3OQJA 4C0KA 4ZTUB 2O0HA 2JK1A 5HF8A 1R8JA 3WR5A 3EGOA 1ZP6A 1G8KA 2X4IA 1ZQ1A 2F1IA 1JEAA 5L4LA 2DQSA 3QNMA 2YS6A 4J0FA 3W06A 4KJXA 3K9BA 3TZQA 5CDSA 2QL9A 1VYHA 1JJ7A 1E1YA 3E81A 3ZE8A 2C2WA 1ISJA 2FR1A 3IDQA 1Q44A 4RL4A 3K0HA 3WSWA 1WEKA 2B1GA 3PHLA 4BATA 3Q9NA 2DH6A 4EY5A 1EVYA 1RLJA 4LHEA 5HF9A 4Y2SA 2UYQA 4BGVA 3G0DA 2KQUA 4M49A 4MAFA 4DZRA 2J0EA 3HDQA 4RA9A 4ZYYA 1JZSA 4BQEA 4IJWA 1PR3A 5CIYA 1U6IA 5HP4A 3NRBA 2P7HA 1CULC 2BRUA 1O6BA 1P0FA 1WCXA 4BJ6A 2ETXA 2V1XA 3IERA 4R41A 5I8WA 4QGBA 5CB4F 1A8QA 3CLUD 2MIIA 1PT6A 2C1XA 3SJUA 3PRYA 4BO8A 8LDHA 1IFXA 3DDHA 3MTGA 4F06A 4WW0A 1X87A 2JEOA 2TS1A 3VC3A 3E84A 3X1KA 4ZK2A 3R7WA 4J1TA 3ECSA 1ZX1A 1RCFA 1SCKA 1Z2DA 2QWXA 3PPIA 1XNQB 2FFJA 1MD9A 1UPUA 1OUMA 3C3JA 1XOIA 4N41A 2F17A 3KL4A 3QFCA 1QG2A 3MFQA 4UPVA 4C88A 5HQ3B 1JFSA 1FFHA 1ZS9A 1QRRA 2P5UA 3D31A 4X8LA 1C9KA 1JNYA 4QVIA 3HL0A 1YDFA 1U28C 4PFSA 3NHYA 3MGGA 3A9CA 1VKOA 5IAKA 3U7JA 4BQOA 4H9GA 3I6MA 1K6XA 2Z3ZA 3GAFA 1GUBA 1ISIA 4PZUA 1XDGA 2DTEA 2YR0A 4K1LA 5LB4A 3EVCA 4GOJA 2UUAB 4EY8A 5G0WA 4X7MA 3MZ0A 4U7PB 3FVVA 5H83A 4WKBA 4TKUA 3W6OA 3U4CA 4CMBA 1SMKA 2CNWD 2QPOA 3EAQA 3S1AB 3LE8A 3SN6A 4UULA 3RRJA 3SC6A 3BGDA 3F7TA 3AEUA 4BP9A 4FYVA 1HM5A 1SJ9A 4OHWA 2HPAA 2WR8A 3NM5A 1JIJA 3IHTA 1ZNQO 5DYNA 4AMZA 1KZYC 3AXSA 3EG5A 2FEOA 5EKSA 1HETA 3ZLBA 3RW9A 1KH2A 2B0JA 4TWRA 4AP9A 2GD0A 5JRDS 3ZWXA 3CSSA 3AW8A 2ECOA 3ZHTA 3GARA 1CLUA 1DRKA 3N9IA 2YV2A 1O6FA 3L5KA 4AURA 3D3KA 4BMSA 1J42A 3HXOA 2PVCA 3BGSA 3L8GA 1YHYA 2F1JA 4A0FA 2PVPA 3PDUA 4PZZA 1ZN8A 4DLZA 3HUFA 2ZUUA 1BDJA 2R4TA 3CUTA 2HR1A 1KMHA 1PZGA 2RONA 1OE0A 3GK3A 4KC0A 1XD8A 5SY4A 3K35A 3VX4A 1PGJA 4HX9A 3HPRA 5IBRA 3CTMA 3THXB 4E5VA 4OB7A 1Z5WA 3UEOA 3TKLA 1US8A 2XB9A 2AOUB 5DT2A 3U4AA 1WHTB 1N2OA 1UJMA 3L7LA 5CPFA 4Y1RB 5T4BA 1QXSA 1TD9A 3B6EA 4US0R 3AF5A 4L5AA 2H1LA 4FCWA 4F21A 4QQFA 4AF6A 4U6NA 4U9IS 1JA9A 1COZA 1LJLA 1Q7TA 1UDAA 3D0KA 4MKFA 2ZI9A 1ECFA 4JT8A 4N6OA 1QGDA 1S2OA 4L8FA 1ISFA 1NTRA 3KP1A 2CXQA 5AI6A 1XNRB 2GVDC 5LIPA 2LBPA 2BEVA 2FWBA 1B8VA 1VDMA 1WY5A 4MIYA 1E0DA 3GRYA 3PNBA 1FYEA 4MS4B 3RBZA 3RVMA 3UMFA 4FP9A 3GFVA 1GUYA 1KRXA 2QR2A 3O90A 4JI5B 3WGIA 1DC5A 2QAGC 2RGBA 3UC9A 1PX0A 2F00A 2J0VA 4TV9A 4TOIA 2NU7B 1ML3A 4MS3A 4Q1AA 5DBIA 2GBFA 2Q6IA 4H59A 5DPMA 1Q17A 2A0FA 4NFSA 5LNK6 4UNNA 3VX3A 3DL4A 2EGHA 2PFGA 2VWHA 4WKNA 4PYJA 1SR8A 5JE8A 1DAMA 1AQUA 4WEQA 5ALOA 5D8DA 1VRWA 1Z2NX 4KSYA 2RD2A 2P6OA 4FE7A 3UB2A 2OMKA 3IBGA 4QNRA 4DGSA 1E89A 1G8HA 1NV9A 2B30A 3KKZA 1Z2EA 5JO0A 4K9PA 2X6RA 4ZT2A 3ZWDA 3KQOA 1DDOA 1NONA 1N25A 1XX6A 4R2HA 3ZE1B 5M2QA 2YC2C 1EUDA 4D8TA 5KIAA 3WLFA 1QF6A 4E4TA 1FDOA 1V3UA 2CNWA 2ZR7A 1RZ3A 3IAM6 4XDHA 3HP7A 4MRVA 3HI6A 1V47A 1V5GA 4NK5A 3AEZA 3TE7A 1H0KA 1X1EA 2AIRA 3GPDG 3LLMA 4MUKA 1RQ7A 4I5GA 2B2CA 1XJWA 4KMOA 2O7VA 1MVOA 1DEKA 1X77A 1E62A 3D6VA 3A6EA 1S89A 2YXPX 1KI9A 4G1FA 3NIBA 3GCDA 3OQMA 1M6VB 2CMGA 1GPH1 5TGZA 3AVQA 5KKCA 2AD1A 3EPLA 4YRAA 1WSWA 2VATA 2WV7A 4FGSA 3A4TA 2HRQA 3N74A 1S0UA 4GU5A 4LBVA 2IC5A 1W0KD 1WBBA 2WZQA 3S28A 1N3LA 1GADO 4Z8YA 4ZMSA 3L7IA 3BH6A 4GDFA 3GJ3A 1EJBA 3QVVA 2OFWA 1RJ9B 5C80A 3ZD9A 4P0PB 3L1IA 1CBUA 1JVSA 3SK0A 2Q3DA 1QE3A 3OQPA 5COQA 3CKYA 4YV2A 2PPVA 1JU9A 4GZ5A 2O8BA 1ZIYA 2HDWA 3AIIA 3MAAC 4DNFA 5MDHA 2G70A 3U17A 1JV2B 5ADVA 1WPQA 2XRYA 3F6SA 2JCYA 4TT3D 4D0NA 4EI9A 3EEOA 2HJRA 4J0CA 3HLTA 1J1ZA 1Y1QA 4AJ1A 1O96B 4UUBA 1J4AA 3PIDA 4V24A 3UOAB 2HH9A 1M1XB 5CB8A 4D6YA 5KDDA 1FYFA 1UF9A 3L8YA 1A5SB 3IDFA 4QREA 4P4UA 4R5MA 4CNQA 4MLPA 3QEBZ 5CVTA 1L6IA 4DDHA 3EXIB 4IDCA 2HIMA 4G9EA 1X80A 4RV5A 4RTKA 3AG5A 3WB1A 1WKBA 3I12A 3FFTA 3GLRA 1Q3TA 1VC2A 3NG1A 4JOSA 4MK4A 1I4WA 1I24A 2DQ4A 1VCNA 3EK2A 2DWCA 3U6BA 1UOQA 3EXHB 4LXXA 3AF6A 5EUQB 2ANCA 3IQXA 2JBAA 1F3LA 2ZCUA 2ASVA 3JQDA 4AN1A 2B8NA 2XMCA 4C0HA 1U0GA 4CR7A 4URVR 5KJ6A 4ABTA 2OL4A 3K20A 1GXSA 3GVXA 2V5AA 4HATA 4RTNA 1Z4PX 1N2HA 2R7LA 1P5HA 1AHHA 1ODSA 1QFSA 2XIQA 3PLRA 4CIDA 5CFPA 3KZCA 1J2UA 1FNMA 3O0TA 3HBJA 2PN1A 3LNTA 4JGIA 4UM8B 1OB5A 1WB6A 4P3KA 2PWYA 3NX4A 1ZCFA 3OJCA 4JP1A 2VBFA 2QBYB 4ISCA 4KQHA 1J1UA 3A27A 3I9V6 5KVVA 2GJ4A 3T38A 2IKQA 1BH6A 2AJBA 4Q39A 1XA4A 3MOGA 4B7AA 2V45A 4EI2A 4WBNA 3ILYA 1V1RA 2FMFA 1Q7BA 3AQ4A 2IU4A 1MJGA 5BQ5A 3U3DA 3UJ3X 4ZMBA 2BWJA 2C95A 2BMEA 3GOHA 4WJKB 4OAOA 2KSQA 5HCUA 4FJ2A 1YOVB 4DNPA 3W78A 3V4VB 3HDTA 1OQAA 4UHJA 1JLHA 4JVSB 2NU8B 3RV3A 2WYUA 4F46A 3N87A 3C85A 2GXUA 3E3NA 5CEEA 3K8ZA 2JIMA 5AXCA 1DDGA 1SULA 3HB5X 2ADMA 1YDWA 4ZAGA 3VYUB 2GBLA 3MXOA 2J5KA 4EGJA 1GRVA 2H00A 2D54A 2Q2NA 2R8XA 3T7DA 2NM0A 3G8CA 2VZ9A 4G4GA 1UBFA 2VHYA 1T0HB 3ONWA 5J58A 1EX1A 4AQ7A 2CVZA 4B5LA 1Y8RA 1C1DA 1YCGA 4FGZA 1FNCA 3G5TA 1L7MA 1B76A 1UKBA 2I4NA 4MYSA 5CR9A 1A76A 3T8YA 3EEQA 1OX4B 1QZ3A 1TGVA 1Y3IA 1P7VA 2W0MA 2G08A 1EP9A 4LMPA 1HMPA 2ABWA 5FNVF 3JU3A 4EHAA 4ER6A 1A9TA 1IIBA 1R0WA 2ZRCA 1OXVA 3AZQA 3CO0S 1BEEA 1OC4A 3FDZA 3MGCA 3NHMA 4V1CA 5JVDA 1VIAA 2Q4BA 5D1NA 4X20A 1B16A 2CV1A 1PZFA 3DW1X 4N01A 5YASA 5JEEA 3FIUA 3L9XA 4XH9B 2EIHA 1NRXA 1LPOA 4KFUA 1BHQ1 1VBMA 3L6BA 1RHRA 1D2EA 1ITZA 4J1QA 3IOMA 3UC5A 1N6KA 2JGAA 4FW8A 5BRJA 1PK7A 1FSSA 1TUIA 2G9QA 3D4NA 2PZLA 3FYUC 3OE5A 4X45A 4X44A 1RXEA 4YJ3F 4ZXPA 3FYUB 3UKOA 1WM1A 3R3JA 2GDJA 5I9BA 3SSOA 8OHMA 3U44A 5CAEA 4XSVA 3EXG1 1EK6A 3JQ7A 3LT0A 4R3UC 5EWMA 1YQEA 5FTWA 1M6NA 2QTFA 3JQCA 5CCEA 2Z2XA 3USES 3KB8A 5CFLA 1GPLA 2VYVA 1U2DC 1UBKS 1T3HA 1ZCJA 1XZEA 4Y30A 1NQUA 4H7DA 2BCJQ 5DIFA 2C8LA 3CZQA 1LDGA 4WK6A 5IC4A 2ZBUA 1NPTO 4KTTE 3U0VA 2XGJA 5EPEA 5BSGA 3GGDA 1KNXA 3L0ZA 4YIKA 2O2YA 4QUEA 2JAXA 2ZDGA 3A9WA 1O7JA 4FDVA 4LF9B 1IE3A 2UUPA 1QHNA 3TSZA 2DVMA 5K2OA 2F59A 2AI3A 1RAHA 2FPKA 4RK6A 3QW2A 4PLGA 3Q88A 4RK5A 3UHAA 1JVBA 2DCUA 3VR3D 3M1LA 4DIFA 5AOVA 1MG0A 2IP1A 3BJMA 4FNMA 1XLTC 1RC8A 4MGHA 1ZD5A 2WHPA 3NBMA 4QDKA 5CFNA 2VPWA 3ZD8A 5BR4A 1YVPA 4CEJA 4AI6A 2ZTMA 4C7BA 4ETMA 5KNCA 3BF7A 2BFDB 4RJKA 4TWZA 4B2LA 1KQ3A 2QIOA 4GI2A 4IGFA 5EHGA 2NUAB 3QPCA 4MWBA 5IARA 3ZX5A 4OHYA 1A8HA 4ENUA 1A27A 1JAZA 1BWQA 4MGKR 4CM7A 5JYCA 1I7QB 3JVUA 3FGOA 1LSUA 3QLTA 3C3MA 2CVFA 3PITA 3RAGA 1G8FA 2X9VA 5JO9A 5KYWB 3B1YA 1WV1A 3WLEA 4CV3A 4UOZA 4QG3A 1F3OA 3CXRA 3UWSA 3VPCA 3L46A 2Z5VA 1RRVA 4H6VA 2OLEA 2VQFB 4HBGA 3LUKA 2GAIA 2NPIA 1E6KA 1Z4NA 2WUVA 2VDJA 1FTYA 3WO1A 4BU0A 2XKKA 5A4DA 1Y6JA 2YWBA 5EE5B 3M81A 1R18A 5TPWB 2VZLA 1OR8A 1TTHA 5CT8A 5KTOA 3IODA 5HZHA 2BM1A 2AQ8A 2HHCA 4KQCA 3UTDA 1VBFA 4W9NA 2FPXA 1TAUA 3WYCA 1RDFA 1XBTA 4B3XA 5E6UA 1BU8A 4A03A 5GOZA 1RI5A 4K86A 3QVKA 2BGRA 1QHIA 3EF1A 3G0IA 2Y1EA 3LQKA 4QFMA 3VR5A 1Z38A 1T2DA 3LBHA 2VTBA 5B53A 2NO5A 1NUUA 5E3HA 4BUJA 2GN4A 1Y80A 3DP9A 1FTSA 2BCGY 4P3XA 5ALVA 1N9KA 5FO0A 5LP6C 3IVRA 3VOSA 1BSVA 2QSZA 3DCYA 1I7PA 3DHEA 3FJOA 1YZYA 3DPUA 3G88A 3QKRB 2RHLA 4PC1A 3LKVA 1GV0A 4B40A 1GTSA 1ZAYA 3MS2A 2Q4TA 4ESVA 1HEIA 3GCWA 2OLKA 4OUDA 3E15A 3T0IA 5MFZA 5GINE 1P1HA 5EZ6B 4B31A 1H2BA 1QQ5A 4OAPA 1GEEA 3TI9A 3H1FA 3K8OE 5DMHA 1BAPA 2BDUA 4NEQA 4OB6A 3RO7A 3X1XA 2RKOA 1DG3A 3B9BA 1AHNA 4Z4IA 1ANKA 1UDXA 5ERXA 1GOTA 3P0RA 3LYLA 1KOJA 2CNNA 2FZWA 5BP7A 5AT1A 1GO2A 1N2GA 2BOVA 2OSBA 2P9ZA 3V2HA 3FMGA 1YNOA 1TUEA 1QORA 4JLAA 1GAJA 1VQ1A 1SXIA 4PS0A 1JFRA 1WR8A 3GGCA 1FRFS 3GZTB 2VJAA 4FHDA 1GQOA 1QLWA 4AJPA 1XXHE 1ZUHA 4BCDA 1BS1A 3D6FA 2VWPA 3VR3A 1AKNA 5HUHA 3KR0A 4DYVA 2H0RA 2JFHA 4L7QA 2BDTA 2WTEA 3CGWA 2FN3A 3AUYA 1RLMA 1XWWA 2B2XA 2HWKA 3ESXA 3IELA 1YR9A 2J6CA 4H6WA 1RJDA 4L5IA 1GTL1 3U7FB 2QI9F 1EQ2A 1F0KA 3C1UA 1TEZA 5IBPA 2H52A 1VDZA 1YNSA 5AKEA 1AIPA 1TVKB 4IV8A 4DMHA 3N2YA 2A2ZA 2E49A 5DYGA 5F51A 4A8JC 3ZD7A 2JIOA 1L5OA 1AGRA 1P2SA 1CWUA 2PBLA 2Q3LA 3BL6A 3EVAA 3FLAA 3VH1A 4KRXA 4OMFG 2GAOA 1RWKA 3IMFA 2OZEA 3IVCA 3HKBA 4K3VA 3A9RA 3CPJB 1R37A 2C5BA 3LKBA 4ZO8A 3RG2A 2WUFA 4BS9A 5K3CA 5C7LO 5A6SA 1UFRA 3BXZA 5C8DA 2XYQA 4KH0A 2AJCA 3I53A 1M6YA 1W9HA 4LNHA 3EXEA 1Z0SA 3FDFA 5JXHA 2HSEA 2WHEA 4BMVA 1KEEB 4X54A 4XCVA 4YJFA 3WQBA 4F84A 4TXHA 1AU9A 1O58A 2PSHA 3JQEA 3DEZA 4Y2TA 3LMKA 1XTVA 2FA9A 3UYLA 4E5DA 3FE2A 1EU1A 4FLEA 1LPPA 2VDWA 3EAFA 4OYHA 5EIOA 1T8UA 3VHXA 5LKAA 1Q0ZA 1YE8A 1AUVA 3V34A 4DDUA 4LRWA 2JZNA 2W0SA 3FUTA 1A9QA 3T5DA 4TTTS 3ESAA 4V3CA 2RIPA 3PLNA 2Q3BA 5FWAA 4WA7A 2YHSA 3O73A 4IAOA 1R4NA 1YACA 4QXOA 1M1YA 5DTJA 3AHEA 4HUQA 1Z4LA 3TW6A 4ZVNA 5KVCA 3KOZA 3C7CB 5DM1A 1CJSA 4HFMA 1A97A 5LP6F 1DBQA 2JIPA 1JRLA 3ZS9A 1ARZA 4R2JA 3UGJA 1KI3A 2QN6A 3L4KA 4JWKA 4RNCA 1RE0A 10MHA 5REQA 3REQA 5EINA 1FP4A 2G17A 4YCAA 5CB4A 1CF2O 1K86A 4CV1A 1HZZC 5I7EA 5LXTB 4ROSA 4MJLA 1B6SA 4F72A 1DOZA 2A0YA 5ENDA 3C43A 3GA7A 2EJBA 3VSDA 5IHPA 3OJLA 1B0ZA 2UVQA 3WKCA 1Z2PX 4MGIR 3RPEA 3ITNA 1VCHA 1M1NA 1MIOB 3OCJA 3IMKA 4ZOLA 3HCBA 5EHQA 4DSAA 1A9YA 4A26A 4B48A 3TW4A 5DHPA 3R9XB 4ZO4A 4LJ6A 3S2EA 4JI0B 3PDIA 1ADFA 4FNAA 4BNYA 3Q8WA 3KOMA 1E94E 2BFCB 4NJMA 1NXWA 1TM1E 4WJZA 4YJGB 3P2IA 1XQVA 4JBNA 1KDPA 5BUZA 1DO2A 3IE0A 2REQB 3NV9A 2AZDA 3BZUA 3I9OA 3P1JA 4EJSA 3RJTA 2EIXA 4Y2VA 1AKTA 3K4QA 3CVOA 4E6EA 4GMXA 3DPSA 1K6MA 4BB6A 3ACBA 1GZ7A 5JYDA 4JYBA 5MF6A 5AKIA 2EJTA 1YJXA 1DKMA 4YMTA 4JNKA 2A4KA 3DZCA 3RJ5A 5IRCD 2BEWB 2FN8A 4IHJF 1SK9A 2PGDA 3ZCPA 4M1YA 3IJPA 4BAGA 3PNOA 3T3MB 3PR2B 1C8LA 3OPQA 3LWNA 4J0QA 4PTZA 5EP3A 3TO5A 4Q7EA 5HZKA 2BFFA 2PT7A 3BE8A 1Z6YA 4TWBA 1J2EA 1R0YA 3NP9A 4TS9A 5DGCA 1KOLA 1XRLA 3DGFC 4RD6A 4FDMA 4EI7A 4FB5A 5CW1A 3VSCA 5I9LA 2WUWE 4HOYA 4U4AA 2YWEA 1FU7A 1E69A 1FDRA 3T4EA 3DP7A 2H9IA 2FSVC 3ZDXB 4ZZ0A 5FH9A 2P65A 4M98A 2GPYA 2CXUA 2HYDA 3QU4A 4HCJA 5BO5A 1SXPA 4R68A 3T1NA 4ZA2A 3L7YA 4ZHQB 4MW6A 1VMAA 1UADA 4X90A 1QPGA 4JI8B 3CBQA 1SCUA 2F3TA 2OP0A 4NS4A 3R7DA 4FB4A 5HS4A 4HLQB 2REXB 1GKYA 2ZSIA 4OBEA 3WGOA 4FBMA 4Y98A 3LT5A 2HCFA 4IOMA 1T6NA 1JMYA 4J75A 3TPZA 5I7SA 2J9ZB 4AY2A 3HCEA 2Q9CA 1Q1BA 4IX9A 4XWAA 3VJRA 3MMNA 1E1CA 4CKYA 1OASA 1TJ5A 1N9ZA 2QXYA 3J7TA 3ZQ4A 1HLDA 2KYRA 3RADC 2B8EA 3IUYA 2GJKA 4G01B 4RF2A 5HUJA 5T4HA 2ZRFA 1CETA 2QGZA 3UT5A 4Z51A 2QB5A 1S2DA 4ZYVA 4RH3A 1NP6A 3OX1A 3PKZA 3UWKA 2ST1A 1G5PA 3OIWA 1AK9A 3ZNOA 2P5SA 3PHBE 3ZDRA 1HOTA 2BFMA 4NR0A 4XPZA 3VUEA 2JA2A 3V8VA 2GM4A 2AFHA 1Y9JA 3DBRA 1W47A 4NL4H 1FJHA 5KOIA 4QGFA 4EKEA 3MERA 4CGZA 5AIBA 3OCZA 2QUIA 1L9XA 2C4MA 1T4CB 2QLBA 3EDMA 1RJGA 3T6KA 3T99A 1IHOA 1W48A 2P79A 2DJIA 3RUCA 4BGEA 2IBTA 4G8CA 5FD8A 3KFXA 2G0NA 3GG9A 1DKQA 3OFNA 4JB8A 3EVEA 4RGQA 4GI1A 3C3BA 5K4HA 4KQWA 1U28A 1U5AA 4HVAA 3ZZNA 1Y33E 4A92A 5PNTA 3EQZA 5BN1A 4WBXC 4EL5A 3MOSA 1JDZA 1VHWA 1SWWA 4RCZA 1QWOA 4HWTA 5CD9A 4WPGA 5K09A 1Z0DA 3DFUA 1F7UA 1DQPA 3QXHA 1Z7BA 3V8MA 3VZDA 3WMXA 4DXAA 1DBRA 1EG2A 1EVZA 4DILA 1X1AA 2YHUA 4QGSA 5AVQA 3OETA 4PSAA 3X43A 1RCUA 4UHBA 2ECKA 1AQJA 2QD4A 1D1SA 1B0PA 5DTIA 3PNKA 1VCOA 3JRXA 4PCVA 4PAMA 2UXCB 2DULA 2VRWA 4XD2A 2O06A 1KJ9A 1O5OA 4Z3OA 1WBJB 3KSDO 3ZGVA 3DXZA 3K8QA 3O3CA 3OPNA 4RIIA 1POXA 4KO3S 1X7GA 4W9MC 2C9BA 2JKYA 1H2ZA 3G59A 3V97A 2GB4A 1MVNA 2R96A 1N7IA 1CJVC 1PZEA 3IAEA 4KAXA 4OHFA 5ARDA 4K6GA 5LBIA 3T5CA 4AYXA 3HYCA 1PJRA 2OFPA 4BMOB 1MP0A 5BQFA 4QO8A 3NBYC 4PFKA 4DMMA 1SUBA 4TQ9A 2V54A 1MC4A 1Q19A 1PYGA 4M0EA 1WVIA 4YRQA 4ZN6A 2PUBA 4EB8A 3R6LA 1ZD9A 3UAXA 2A92A 4G24A 4L4ZA 3TE6A 3TLMA 1H4SA 1E3WA 2WJHA 2B99A 4MZXA 3AXTA 2D3TA 3L1UA 3UT6A 2FZVA 1QZZA 1GU1A 2ZJ5A 3SU8A 2MYNA 3TIVA 5FT9A 1L4YA 5BRNA 2DZDA 5I7RA 2R1UA 3OFSA 2KM1A 4G5QA 3BM5A 4WXMA 5EYPA 1XA0A 4JVOA 2UUCB 2M98A 4MRAA 4UAVA 5CVUA 4PX5A 2ZI3A 5IAOA 2DCMA 1Q1EA 2BY4A 2RJNA 2WKRA 1NBEA 2B82A 2CE2X 2X9GA 2QLLA 4U2BA 5H82A 2YS7A 2CZQA 3WWOA 1GZUA 1UM9B 1KWGA 4LHYA 2Y68A 1XMIA 2R2AA 1Q0PA 3H5OA 3WYDA 1YQUA 4AF7A 2QAGA 4C0XA 2QM3A 1HMYA 1TZJA 3OLZA 3GI1A 3L7JA 4BO0A 3MTEA 2NVWA 3H86A 3JZDA 4ZP1A 3U13A 4DMFA 5BN3B 1V11B 3CINA 4TTIA 1LWOA 2ISCA 3ZGZA 1KEKA 2XZPA 1ZXLA 2EJWA 3MTDA 5BOSB 1UEIA 2IZZA 2XCOA 3B9RA 5E7QA 4BBZA 4BE4A 5J47A 1MV8A 4DWVA 4O02B 1AZSC 2R1TB 5FWNA 1ZBQA 1ATIA 4GXQA 5D51S 2X4LA 5ITZA 3UA4A 2WTAA 2BTEA 4LDNA 3I9MA 1PO7A 1DADA 3BZBA 1R66A 2JAUA 3H16A 4OQXA 4AUNA 3FBGA 1JB1A 4LTMA 1CIPA 1MC8A 1ZC4A 4MRSA 2NXNA 2IZ0A 2WKQA 3TQTA 2DOKA 2D7DA 4KPYA 3ROQA 2HMVA 4MEAA 3WL4A 1BCSB 5FWYA 2IVFA 1RHQA 3ESRA 3BK2A 3PC7A 4C21A 2HBRA 3BIJA 3E9RA 4NEHB 1NNUA 2FWPA 2NN3C 5AXBA 5LYJA 3V7NA 5I4BA 5BSRA 2MOKA 3NC0C 3RS3A 1WY7A 2ISSD 1GQSA 2YOGA 3FW1A 5KWEA 3GO4A 1DHRA 3ICCA 1JDTA 1A8SA 3I05A 3FYHA 4XGQA 2P67A 4Y9RA 2JLBA 4J4BA 1PKEA 3ILVA 2GUWA 5SY9A 1O8CA 2Z4TA 5G0TA 2ZRJA 2QRLA 1UCFA 2AC2A 5FUWA 5AW5A 3AVWA 3HJBA 1XXLA 2FQWA 4MRMB 3V32A 3ZHUA 4D9CA 1KWKA 4LIPD 2CBZA 4ZEWA 3IKTA 3BJIC 5KNBH 4Q82A 4MEJA 1GKKA 2YY6A 4W82A 4NCIA 2ZAOA 4BV3A 1CX9B 3C3PA 4YRLA 2I3AA 3IOCA 3IKMB 3MT9A 5ALLA 4H7JA 2JRLA 4P4GA 4WXPA 3AR4A 1OWNA 5KOHB 3EBPA 1U6JA 5K0ZA 3D8NA 4E70A 1Y63A 2G04A 3F3YA 4CT5A 2FKAA 3VUFA 5BSHA 1N77A 2FH5B 4C06A 3A05A 1XYVA 1TMYA 2I6QA 4L5CA 2Y2VA 3OZRA 5E9AA 4Q9DA 3IVAA 1F5SA 1C7FA 4L85A 2OA0A 2NQ2C 4EDFA 1PI3A 4M53A 4PPYA 4KBFA 2J46A 3H8VA 1PIWA 3HR7A 2F3SA 5ULLA 1F14A 2OAEA 4F12A 3RU7A 3O31A 2P30A 1SUIA 1C7QA 2G06A 1XYYA 3BWEA 3I4CA 4K81B 4KPGA 1ZK0A 1EE9A 2B1IA 1OH5A 1JQKA 2B4TO 1A88A 4Y2JA 1P5JA 3WAJA 2HMAA 3MVEA 1ZGHA 5K7SA 1SVNA 4YJ3A 4O4LB 4W1RA 2E89A 2Q5IA 1XD2A 3R3ZA 1JJIA 1FLVA 4KYIB 5G1NA 1R8QA 1IONA 1FBTA 2R4UA 4HQKA 4U9UA 4EYEA 2FPGB 5C0OE 5AW8A 2GNOA 3L6DA 4QWMA 4Q1FA 3QXXA 4LYFA 3TOVA 3DZJA 4AVYA 4YMVA 3SI7A 3FTNA 2CYBA 3EIHA 3S1LA 1RXYA 2IT1A 1KY2A 1X1BA 4CQJA 4DCOA 3VNUA 1NW7A 5JPIA 2N0SA 6PFKA 1D6NA 5IS2A 2C97A 3HN2A 1SQ6A 3ME5A 4OF4A 1SXHA 4QUGA 4UC0A 1QPBA 3NVAA 1Z9BA 1TTPB 1NN0A 5F2KA 1IZ0A 3ETGA 4X5OA 5K8TA 4X62B 1Y8ZA 1ZM2A 2MR5A 3L0CA 3A1NA 1KI7A 2IP4A 3IP8A 4NDNE 4QAQA 1H1LA 2KE5A 3UK2A 2QBYA 3RYFB 2FPSA 3C87A 2ZI7A 1F48A 4O2AF 4X92A 4F5YA 2XNCA 1ZZEA 3OZVA 3NHWA 2AQHA 2VLIA 3UXYA 3FJ1A 4HDMA 1QH8A 2FW0A 1YHNA 3BIFA 2X5KO 1K0UA 3LO5A 3H1BA 1T9KA 2RGWA 1PS9A 1N5MA 2WHXA 3DJYA 2ACKA 2B5VA 2NACA 1UXKA 4N49A 2BLNA 4IIXA 5CX1B 3IEPA 4BVLA 1GR0A 3WGGA 4BLSA 4X60A 3KQLA 3TR6A 1VHTA 1AKUA 2HIAA 2JGJA 4YAJA 3QSGA 3ZBUA 4YPFA 3WLJA 3BMNA 5KTRA 4B71A 4FFDA 4UCFA 1U3UA 1WMEA 3OZXA 3PFHA 5AUNB 4IGEA 2YWCA 2ZBDA 3H8SA 1ADGA 4M36A 3W3AA 4LYAA 3KUDA 4S2UA 1Y1KE 3SYTA 5GTDA 3GVCA 2I6UA 2I7TA 4QLAA 1M6EX 2B3TA 3ETEA 3SICE 3GDOA 4ZO9A 2C8KA 4IO1A 1QANA 4HPWA 3RTBA 4DR4B 5DYYA 4LGCA 4EFDA 2AF4C 1VJ5A 3BCSA 3ADOA 5AKHA 4H1HA 5F7JA 1PUJA 1I1OA 2BJWA 4IP0A 2IXBA 3AH8A 2COKA 3NHZA 5KDLA 4GC9A 2PMBA 3ND9A 3UOGA 5BVGB 1ST2A 2EVWX 4Q6BA 1PTJC 1TQ4A 4M2LA 3AL2A 4UBJA 3AP3A 4EIWA 4Y1GA 3ITDA 1WD7A 4MUYA 4GUDA 4YR7A 2D5IA 3MJEA 1F9EA 4PONA 1K9SA 4WOKA 3SF8A 3TTWA 4G0MA 1IXZA 1Z5GA 4AY3A 1RTKA 1DBIA 4LV8B 3CH4B 2B7BA 2PZGA 3ILSA 4Q9JA 3COVA 5I51A 3DULA 2O2HA 3UYKA 1V7QA 2DR3A 2J85A 3DMDA 3GP3A 3ZLJA 4EJFA 1E3MA 2FAXA 4ZKDA 4LF6B 2DT8A 3VO9A 1R00A 2G28A 4QEZA 5EZ5A 2X8WA 4K46A 3OKFA 3UHPA 3ZHQA 2QN7A 5J4LA 4MO2A 5IXSA 3FYUA 3K96A 3LY5A 1GU0A 4QYWA 5KOJB 3E23A 4GICA 4A6PA 3W5HA 5FADA 3WGQA 1FDIA 3E3LA 5L51A 1CJKC 5EHIA 4JB2A 4TKVA 1TQ6A 2QRPA 1LPSA 3I30X 1K5PA 5K6RA 1PSWA 2WIDA 1Y4AE 1KTIA 5F1OA 1GNTA 1U2DA 2HWUA 3HE3A 1SIUA 1UFVA 4R8KA 5AKXA 1Q12A 4QPJC 1O77A 2PD6A 4URZR 2YBEA 1X42A 2BKLA 4RIGA 1FDUA 3QXSA 1U8YA 3TMYA 5TXGA 1EFCA 2JATA 1Q84A 4BLQA 4BGDA 2GF2A 4CKBB 1HBJA 2ZYAA 4LYEA 2IZ5A 2WD8A 4R1OA 1T4GA 4EMSA 3L79A 1IULA 1JKJA 4OL9A 1RZVA 4REOA 5DWQA 3U3XA 4BUCA 4XQEA 1YOBA 3KVRA 2IYUA 4BGIA 1VHDA 2Q46A 4F6RB 2I67A 3O8CA 1E18A 2ACWA 3IE1A 4YQZA 5D3QA 5AK4A 2PX8A 4MKHA 5HIIA 4B47A 2ATEA 1KY4A 4FCCA 3OX3A 3SC3A 3ROTA 1ISRA 1DRWA 1M54A 1DAOA 4MLCA 5C4GB 1GA4A 3LC0A 3JQQA 1XLTA 2AOTA 2PWAA 1W19A 4QTTB 4G1UC 2IUYA 4LSWA 4UM9D 4MV1A 3RFTA 4B4VA 2XGGA 3CURA 4UREA 2FP4A 5J5CA 1QGAA 4C2TA 5AVSA 4WZBE 3DD1A 2ZYVX 3B3AA 1KQOA 2YWHA 2VUUA 1CS0B 3DYBA 1IG0A 1JS1X 1T0JB 4BNWA 5T7BA 2JB9A 4CFZA 5B3AA 5J1SB 4Y1FA 2O8DB 4AIIA 6GPBA 4AZWA 1E3SA 1T6YA 1D6SA 1XRJA 2DUUA 2NXEA 4MW4A 3GT7A 1JF8A 1UANA 3FTDA 3V2IA 4R8RA 3EGIA 4D44A 3WNBA 4EO7A 4QXMA 1MJ5A 2O8VA 5J4HA 2PMWB 2Q6TA 3KVYA 3IR6A 5B4TA 5JADA 1CDEA 3BS4A 3OM1A 5CTJA 1HR0B 3AM4A 1L1FA 2GEVA 4P4LA 4BV9A 3WGKA 3TIIA 3DFFA 1RYNA 3M33A 3IJEB 1P33A 1XTZA 2JGNA 4AQYB 2PLFA 5IVHA 3KALA 4KE8A 2DKOA 2Y8EA 1EKXA 3T7SA 3ETDA 5A9TA 1AQ6A 2JJ1D 3H11A 3TRKA 2CFTA 1Z35A 1CUGA 1B2RA 4KXLA 3VMFA 3VYSB 521PA 3AFHA 1YXMA 3H1PA 1XEWY 2FFAA 3CEHA 2BI7A 1XTBA 3B3JA 4MV8A 3LVBA 2WFZA 4BVHA 3KFLA 2J6BA 3MWKA 5T3UA 3BSSA 3FRJA 1Q1GA 3N0WA 3ZLUA 4OHZA 4HXYA 3R0QA 3ZWBA 4V0SA 1FDTA 2G67A 5LP6A 3T1HB 3GZNB 3PD7A 3TXYA 4N76A 4XIJA 2FETA 1TAQA 4DXDA 1GUAA 3PEWA 1I1QB 1QGUB 4WHMA 2DRIA 3CNOA 1OIVA 3L93A 4CMIB 3W5BA 1NQTA 2CHUA 3QENA 5KTNA 1NKVA 3D7SA 1E1QD 2XMZA 3WAKA 4DHEA 1JFFB 3UMBA 3AKEA 1JEYB 5T41A 2A1UB 5CBKA 4MKZA 1P17A 3IPLA 4GM4A 3ZE7A 3Q3IA 3QUBA 5TR9A 4QM6A 1PLLA 3KD3A 1TW2A 3VNBA 1IEWA 3HWWA 2PIDA 2BZ0A 1ISSA 3CUWA 4UVDA 4LZAA 2BTOA 2O4CA 3PUHA 4ZKEA 5SZKB 3R2JA 1WKCA 4DJ5X 4G0WA 4DV1B 2BEUA 4BO5A 1TLTA 3NC1C 3QBVA 3KSAC 1FRNA 5JSYA 3ENZA 4O25A 2X1LA 3GNSA 3NAQA 5E6SA 3BWMA 2NYRA 3GRKA 4TVOA 4P6VF 3N2GB 4GZLA 4A8JB 4PIVA 3UJDA 4RD0A 3VTZA 2Z1MA 1NUQA 1OAOC 5K0SA 3L6OO 1E98A 3E7WA 1NF3A 2PGAA 1ADJA 4RMNA 4BN5A 4ZPXA 4C5AA 5AM2A 1UINA 2NZJA 2PXCA 4YGYA 1QHEA 3PUZA 4BX2A 2CZCA 4B76A 1YQWA 2I4RA 3E5MA 1Q91A 3EFBA 5HF6A 4AO7A 3QVGA 4IHJA 4I55B 1OH6A 2QVCA 1C80A 4R6XA 1AD2A 1XAHA 3JXEA 1S2LA 1JH9A 1SBCA 4J0IA 2W8BA 1BN7A 4OAQA 1FU8A 3BSWA 2F1HA 3Q2OA 4DRXB 2O23A 5JMPA 1M72A 5JD6A 1B73A 1SD5A 5EE0A 2EKPA 1KO7A 3MWEB 4DZZA 5K0EA 4YJ2B 2Q45A 1PNOA 2AHRA 2XT9A 1KEEA 2FUKA 2YWGA 4WD3A 3MYYA 1WQ4A 4UMVA 4X6UA 2SBTA 4UTXA 1TA9A 1SUDA 2XXBA 3N2KA 3CYFA 3RSZA 4W5NA 4H7HA 2DBVO 2HO5A 2ZTVA 5ELLA 4LI3X 4PZDA 3URKA 3IDZA 5JS1A 4RNDB 2IWRA 3DDWA 1GSHA 3G0GA 5B7QA 3SEQA 4W5TA 4MWTA 4RZHA 3ETNA 3FWPA 4M1ZA 4OQPA 1VPWA 2A5GA 2IZ1A 1NR1A 3RVJA 4IH9A 4UKDA 2W4QA 3FIJA 2J87A 4BNDB 2R97A 1I3KA 3AF3A 2MYPA 2Z5FA 1YBAA 1FSPA 1U99A 4HGYA 1WF3A 1FEZA 4IEFB 3KYCB 2HUNA 4IHKA 1UAAA 4PO1A 4TYYA 4JC4A 4GSYA 2JLCA 5J4YA 1T0BA 1NFQA 4AW9A 4R1MA 3MIZA 1LV7A 3L0OA 3WB0A 2OTCA 2IYFA 4RC9A 3IVGA 4CG3A 1GTRA 2QMUA 5DGXA 1E1QA 3RWOA 4WACA 1GNVA 1T5SA 1G63A 1V45E 3E58A 4PZ0A 4EW6A 4CEIB 4U7HA 3E9NA 4EYOA 1WOMA 2JGKA 5JAZA 4Q7MB 2GXAA 1SVIA 2SKEA 3OEEA 5ESWA 3C7AA 1UKYA 1KEVA 1NVTA 4KGDA 5K51A 1HZZA 1RVDA 4RQAA 4W5HA 2R6R1 3KB2A 4FEEA 4X00A 3PXGA 1K4MA 2QNIA 3UMRA 2XDQA 2B4QA 1HE3A 3R74A 5JNSA 2DAPA 5JR3A 3TUIC 3DC7A 4BDSA 3QGMA 2H0AA 1A8PA 3ZG6A 2VJOA 3K31A 2P2YA 3QUCA 1UFOA 2OXFA 4B3BA 1ZA1A 3BOSA 4UUPA 4GH5A 5FYQA 3R9XA 2IIVA 4NCXA 4NZZA 1O8BA 3K6JA 2Q9BA 3ZNNA 4C2AA 2Y4OA 1QQTA 2IY8A 4UUAA 4YJGA 5ES3A 4MB2A 1C4OA 3W2EA 3GFGA 4RPJA 1DU4A 2GYYA 2REQA 3D4BA 1OREA 1VTKA 2XDYA 2ZAYA 4KQXA 6NULA 3U81A 4UOEA 3M1IA 4OLJA 1WMAA 4TRRA 5D5PA 3UPDA 1ZKMA 1LNQA 5C7YA 4GPD1 2D1FA 4G9GA 2UVPB 3OCVA 5IULC 1CB0A 1JP7A 2ZIUB 4DREA 1DFHA 5L4NA 1XQWA 2H7YA 3C7TA 3MQFA 4FGJA 4QOEA 3U4QA 1ID8A 5AI8A 1G20A 4QGHA 1M3SA 4DBVO 5FOWA 4CQNA 1MGPA 5THXA 4EY4A 2JI9A 3QBJA 2R48A 4FDTA 4I9UA 4KKXB 2QTVB 1RW4A 3AY7A 1IK6A 1H23A 3S29A 3KG2A 3B1KA 1CY7A 2Y27A 3R7NA 1RRFA 2VH2A 3ZN2A 1WXEA 4MQEA 3AW9A 1N2BA 1A4RA 3DMYA 2WSLA 4PO3X 1K8ZB 2ZGVA 2I6TA 1I6MA 2AN1A 3S0JA 3HXQA 2FPRA 1RVV1 1TO2E 3N8GA 3LLUA 2AOVA 4YYZA 1MABB 3RC3A 3E1GA 2FSVA 2QQGA 4BIIA 1U0TA 3GT0A 4JL5A 1TE2A 4URUR 3V9AA 2ILVA 3SLKA 1AK1A 2W8ZA 1EI9A 3HEMA 1IVNA 3DVAB 2QW8A 1WLYA 3MT8A 4HF7A 1E61A 4OIMA 5DGIA 5HFNA 3SJBA 2A1IA 2Q6OA 1PL0A 2AQKA 2JFXA 4PN7A 4LDQA 4BQNA 5HSGA 2FTKE 5GJVC 5KSOA 3CLSC 3V8PA 5F98A 1V8PA 2DTXA 3ACDA 3LYHA 4NOLA 3KQYA 4L2IA 4RLFA 5AJWA 3T15A 3T0GA 3G6KA 2QZZA 1CT9A 2P3QA 3H6GA 3PNYA 2PMDA 3LPAA 1AKRA 2CVQA 3A7EA 3KD2A 2V6IA 2IP2A 1PGOA 3A2NA 5GM1A 3V1NA 4AG3A 4Y0VA 1JSLA 1ZVJA 3OZDA 4N7RA 1XVUA 2DUWA 4X6YA 2B8WA 4RVFA 4G8BA 2V1UA 1IB0A 1A7JA 3FZQA 3W05A 2IHZA 1EK0A 4L6AA 1HNXB 1PTKA 6ADHA 3FFBA 1QH1A 4PZYA 1K97A 1UBSB 2ZSHA 3KE8A 1JFTA 3S40A 2J41A 3QKTA 4GZ3A 4DQKA 4H31A 1MX9A 1ORVA 2QTRA 3VPHA 2YFYA 1T5BA 3ZWCA 4JFRA 3NANA 2NTNA 2PT6A 4JUFA 1TXGA 2WAOA 4IJKA 2GRAA 4X1YB 2HU5A 5U1PA 4QUAA 1JR4A 4TTAA 1XNJA 4MYUA 1DEXA 1ZUWA 2QUKA 1SAYA 2R87A 1KY3A 1HT0A 3RVNA 3ED1A 3QK7A 3WYEA 4CKCA 5LQDA 2XWJI 4DT1B 3MPOA 1KIMA 4I9FA 4MRPA 1VRVA 3E9EA 1QO9A 2I34A 2WUEA 3RAEC 4ESHA 4YXWA 3EOZA 3BYZA 2JJ8A 2VUIB 1X7XB 3B13B 4V0KA 4RHUA 5HTKA 3NIWA 3OQOA 5MN5A 4BJ5A 2GPWA 2GYUA 4ALJA 4XYLA 1UBCA 1SKYB 4DANA 4QPDA 1E9DA 4ZU6X 1EGHA 3UY4A 2H1CA 2PYIA 2ZATA 3IYLW 3KHSA 1TGYA 1UBTS 4UZEA 3V48A 3Q40A 1MJHA 2CEKA 3CF0A 2AN4A 3R1IA 1TK9A 1Y0BA 5H16A 1Y1SA 2IPOA 2DTDA 1KDVA 3Q0TA 4ATNA 2XCSB 3IMEA 4Z4FA 1QFYA 4RFSB 1Y89A 4CIXA 1T9DA 1OFIA 2HMTA 3PK0A 1ZIOA 3VXKA 4S24A 4AN0A 2ODPA 4DMLA 3H5WA 4QUBA 1DQSA 3EQ7A 2L19A 3K1ZA 4K87A 2G25A 4WNCA 4B6FA 1AGYA 1FMTA 2WFLA 3LWZA 4XASA 1CR0A 1DWOA 3MCTA 3BG5A 3ZWYA 2IHBA 5AW2A 1ORHA 1C9EA 1N0WA 1XMJA 2VT6A 2Y67A 3OWOA 3QKWA 3RKRA 4LJ9A 2H54A 4JYAB 2BFEB 4FYPA 2OO7A 1GRCA 2I8CA 2D1RA 3H75A 3I9JA 4Q9HA 4RQBA 1T6BY 3K2BA 3PYMA 4J2HA 1IMJA 2WLTA 1LCIA 3UFBA 1Y6FA 4IXTA 3FTCA 3VR6H 4OLHA 1XMQB 4XB6B 4AJIA 1ML4A 4M1EA 3RK0A 2UZ4A 2GNPA 1FYWA 3U9SA 4ZJUA 2IYVA 3Q9SA 3BZWA 5FEUA 3TNDA 1G6Q1 5IXYA 2G9RA 1P8JA 2J07A 2C61A 2Z2JA 3ETJA 4IXWA 4XCXA 4DKJA 4DEXA 5BN4B 2CLKB 2XF8A 4UNRA 2MSLA 4QJ5A 1EUCA 4NG4A 3V42A 5JI2E 3CEJA 3E7DA 1DKNA 1E60A 1ZVQA 1QIIA 5BW5A 1OXXK 3P9CA 2Y9MB 1AB5A 1USUA 2V5VA 2PA3A 3E1KA 3AO0B 3NT5A 3Q72A 3PNQA 2CLFB 4NOKA 1G4UR 2LZ0A 1CHNA 5DN6A 4R4JA 4XJTA 3HB9A 4Q1VA 3H9GA 2IPLA 2YV1A 1T3ZA 4GOXA 3W8EA 3X1DA 4GKJB 3AI7A 1IY0A 1WOYA 4WOJA 4M83A 9GPBA 1FP6A 1Q1AA 3DUFB 4HZGA 1N5KA 3A1EA 3EFOA 1II9A 3BGIA 4YQYA 5A6VA 4IZ6A 1CFZA 1XALA 3ZTTA 2IH5A 2NADA 5DSXA 2FFBA 3OG9A 1G4HA 4N5LA 3KM0A 4JJKA 2C31A 4RYLA 1U2RA 3TTVA 1MEEA 5JHGB 1POWA 2QT1A 4URHA 3I2IA 1Z3CA 2IHUA 1H9CA 2L2QA 3W1EA 4K88A 3BKWA 3AV3A 2IUTA 3CPEA 2OBNA 1CNEA 2OOSA 3QPVA 5DSZA 3K0KA 4RZQA 4ZALA 3ZU3A 4JITA 2BGLA 1U3FA 4LVUA 2JFWA 2RGUA 1T4BA 4V0MA 2F90A 3RTAA 2WU0A 3WGUA 1LGYA 4E2WA 3UMMA 4Q0MA 1G5QA 1KAHA 2CV0A 1B42A 3KAJA 1EHIA 1G55A 4F4FA 3BT7A 3FNQA 3FSJX 4CG0A 2RK6A 2QGNA 2YVUA 2QP9X 3ULKA 1XPJA 4B2YA 3KX2A 4ZQGA 3C3DA 4JS0A 3AUJB 1L6RA 2GYWA 3ET5A 4G0VA 1RI4A 3TSAA 5AVTA 4LX0A 3BXPA 4HDNB 4MLZA 1B6GA 4LXIA 1UMBA 2RGDA 4LYGA 4C04A 4BKQA 1Y3AA 4IIFA 5IEBA 5CNMA 1N7GA 4PLVA 1X7HA 5JS7A 1IU9A 1SQGA 2POCA 3H9CA 4QYSA 1EXNA 3N3AC 3HV2A 5AK0A 4OLBA 3H8WA 5TQ2A 1L4EA 2JF0A 2QU7A 4IDQA 1JHOA 3T9BA 2XEDA 3GL9A 1NMEA 5GJWC 3V7YA 1NPYA 4AP5A 5JQGF 2R8YA 4QNNA 4HDRA 5LWQA 2DP4E 1PE0A 2ZJ3A 1PLJA 2C2OA 4L51A 4Q7JB 2JD1A 1EVJA 1I2AA 1P73A 3LPCA 3DMRA 3I5MA