3FIUA

Structure of nmn synthetase from francisella tularensis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
244
structure length
238
Chain Sequence
DFSPKEYSQKLVNWLSDSCMNYPAEGFVIGLSGGIDSAVAASLAVKTGLPTTALILPSDNNQHQDMQDALELIEMLNIEHYTISIQPAYEAFLASTQSFTQLVIKGNAQARLRMMYLYAYAQQYNRIVIGTDNACEWYMGYFTKFGDGAADILPLVNLKKSQVFELGKYLDVPKNILDKAPSAGLWQGQTDEDEMGVTYQEIDDFLDGKQVSAKALERINFWHNRSHHKRKLALTPNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Nicotinamide mononucleotide synthetase is the key enzyme for an alternative route of NAD biosynthesis in Francisella tularensis
pubmed doi rcsb
source organism Francisella tularensis subsp. holarctica lvs
molecule tags Ligase
total genus 85
structure length 238
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2008-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fiuA00
1H3EA 3FNRA 3VRHA 1O6BA 2CYBA 2J07A 4MAFA 2CYCA 4KKVA 2J4DA 2PFSA 1GTSA 1O96A 1U0BB 1MRZA 3IOEA 1WKBA 2PZAA 4MWEA 3AKZA 1V47A 4DDMA 1NUQA 1XNHA 3QTTA 2Z08A 5KCMA 1KQPA 2NSYA 4EG5A 4MVWA 2X3FA 3RHSA 1A8HA 4I6EA 4KR9A 1ILEA 4PBSA 4WNYA 3A2KA 1KP2A 4MWCA 4JXZA 3CLSD 4NX2A 1M1ZA 4KPUA 1IFXA 3H9BA 4MVCA 5DASA 4QBTA 2JAXA 4MUEA 3INNA 1N2JA 3CVVA 3A4IA 1U7DA 4DDKA 2R5WA 5H7XA 2QJOA 3KT8A 2QUIA 3PRHA 1NP7A 3NBKA 1OWNA 3X1JA 4EG7A 2D54A 1JZSA 4ZCTA 2RE8A 4KR6A 3CA8A 3FG9A 4CDMA 2A1UB 3H9CA 2WSIA 1ULHA 1N2BA 1O0CA 1IH8A 2YWBA 1J1UA 2AZXA 2GKSA 2XRZA 3QE4A 4NATA 3HFJA 3K9WA 1XNGA 1V8FA 3CLUC 4K0RA 1D2RA 4JZYA 3L93A 1IQUA 1EUQA 2X1LA 4EF6A 3SYTA 1WZ2A 3AIIA 2V0CA 4G5FA 1KKUA 1K92A 4YP6A 4ZT2A 5DB4A 4MUKA 1N77A 1U7XA 1T9GS 5TEVA 3H05A 3GUZA 4U8HA 2B7LA 3UK2A 5BNZA 1VL2A 4CQNA 1KAQA 3CVUA 2J09A 3HMQA 4P2BA 1CT9A 1QRTA 1O94C 3ZJUA 2G36A 3AG6A 1TQ8A 4MW2A 1M8GA 1H1TA 3CLRD 1YULA 1IRXA 3ISJA 1Q77A 4DJAA 1LW7A 4Q16A 3CLTD 2CV1A 1JIIA 1ZUNA 3N8HA 2O5RA 1O97C 3G6KA 4MQ6A 1KH1A 2YWCA 1QNFA 3S3TA 1GZUA 1B6TA 2A7XA 3MMXA 3KT6A 2CSXA 4RPIA 1KAMA 3IVXA 1WXFA 1HYBA 3IOCA 3E27A 4U7JA 3C8ZA 3F3MA 2E18A 4CDNA 2A86A 1KQNA 2GM3A 3ND6A 1PFVA 4MVYA 1H3FA 3VGJA 4HJXA 2OQ2A 4A91A 2CYAA 3JXEA 2D13A 1VLHA 4MUJA 4KR7A 3TQOA 4R2MA 3OP1A 3DLAA 4MW6A 2QUHA 3H97A 1BS2A 2E21A 3KT3A 1O95C 1ZJWA 1N1DA 3TS1A 3UOWA 5FNZA 1M8PA 3IVCA 2PIDA 3NBAA 4S1OA 2A88A 4YMIA 4XSVA 4JXXA 1I2DA 3SDBA 2QTNA 5HUHA 2VTBB 2WQ6A 4HJRA 5DK4A 3ZGZA 1OWPA 1KH2A 3MUEA 2YXNA 1EXDA 3IODA 4NDAA 1G8GA 2WQ7A 2CT8A 3IVGA 2QJFA 2ZP1A 4PY2A 2V0GA 1U3CA 4MW7A 1LI7A 4E1AA 1F7VA 1IHOA 2RD2A 1J1ZA 1J21A 1RQGA 1TYCA 3A04A 3RK0A 2A1TS 1N78A 2A84A 3SZGA 2J5BA 1MOPA 1QRSA 1QJCA 3CVWA 3M5WA 3CR8A 1OD6A 3MLBA 1U3DA 3HZRA 3PXUA 1WJGA 1ZH6A 4MW5A 4MWBA 1YIAA 1WQ4A 3RK1A 1NYLA 5JBNA 2NZ2A 4J76A 4DLPA 2E0IA 4MW9A 1H3NA 1VBNA 3IDFA 1NUPA 2BYTA 1K4MA 4EGAA 1EJ2A 1WQ3A 3KFLA 4MUNA 1YUNA 2H29A 3FHJA 4PBRA 4DE5A 2X0KA 1WXIA 1J20A 5KHAA 1KORA 3FI0A 1I6MA 1N2HA 2A4MA 1TFUA 1DNPA 4EG6A 2CV0A 3MLAA 3SEQA 4ZT3A 4I6GA 3RBAA 3I05A 1JEDA 1PFYA 1X8XA 1EFPA 1G59A 1OBCA 3COZA 3PNVA 5IHXA 2A1UA 3CLUD 1G8HA 4NZPA 1EFVA 3A05A 4CT0A 5DEOA 3COYA 5TEWA 4L2IB 1M8FA 2PXHA 1N2IA 3IMGA 3LCJA 1MC1A 3PNYA 4MULA 4ARIA 3GMIA 3N9IA 3L92A 1YUMA 3FH0A 3D6VA 4GU5A 4HK4A 3IUEA 3X1KA 1O94D 5HG0A 5LM3A 2D5BA 2QTMA 2E89A 1Y42X 5HUJA 1GPMA 1ZH0A 3RJZA 3MXTA 3OTWA 1QTQA 3ND7A 4MW1A 3UC5A 1XNJA 4OUDA 3DPIA 1O97D 1TEZA 2DUMA 4EFKA 1LI5A 1Q19A 2PG3A 2Z3VA 3KT0A 5K0TA 5LFAA 1NZJA 1F7UA 5FO0A 5J59A 5AHWA 4TS1A 1O0BA 1TYAE 4YP7A 1WXHA 1M8JA 4EG8A 1FYDA 3ILVA 1MBZA 2QUKA 5J58A 4F3RA 4R0NA 3FY4A 1VBMA 1PG0A 2I1LA 3AFHA 1NUSA 3PNBA 2IELA 3HGMA 1EE1A 3X1MA 1OWLA 1O95D 1I6LA 1N3LA 4OJMX 3ND5A 1GTRA 2JANA 2CV2A 2X1MA 4NAUA 3IH5A 4R2LA 3AG5A 3QTBA 1R6TA 5H16A 1WXGA 1F4LA 1OWMA 3ZIUA 1JIKA 1KP3A 1JECA 1N75A 3DO8A 4ARCA 1P7PA 2DETA 3IMCA 3FIUA 1I6KA 4MUIA 3U1VA 2O8VA 5FO1A 4BWVA 1O96B 1S4MA 1JILA 1JEEA 3Q10A 4MVXA 5LLTA 4H3SA 1T9GR 4I6JA 4Q93A 4ZT5A 1YIDA 5TS2A 2OV4A 4MW0A 3UMVA 2PZBA 3ZXIA 1QRUA 3SZ3A 1COZA 1N2OA 5IJXA 1TYBE 4KPUB 4PBTA 3RFFA 2WB2A 1M8KA 2H2AA 3G59A 4MWDA 3P0IA 4JFAA 4ZCQA 1EUYA 1N2GA 4DNXA 3LOQA 1QU3A 1QU2A 1IQRA 3SP1A 1JIJA 2CFOA 3G5AA 3CLSC 3TZEA 1NUTA 3LE8A 3ELBA 3GLVA 2HZ7A 4YP5A 1PFWA 1SURA 4NAHA 4G6ZA 2VXOA 2BTEA 2EL7A 1J70A 5EKDA 4MLPA 1K4KA 4RUKA 1FFYA 1MJHA 1XJQA 4MUFA 4MW4A 1JMVA 3FWKA 2PZ8A 1WXEA 1EFPB 4J75A 2DXIA 4ZCSA 1T6ZA 4MUHA 1EFVB 2DR2A 1G8FA 3CVYA 3CVXA 1N2EA 1UFVA 3P52A 2QUJA 1IVSA 4ZT6A 1X6VA 1Q11A 2C5SA 3IUBA 2TS1A 1F9AA 4AS1A 3UY4A 4L2IA 4UZFA 4AQ7A 1PFUA 3TQIA 1T6YA 4ZCPA 2CUZA 3COWA 4QREA 2EJCA 2XRYA 2DPLA 4ND7A 1J09A 3HV0A 4JYZA 1MB2A 4EG4A 1MB9A 2HMAA 1KQOA 3COVA 1NUUA 4X0EA 1JZQA 2A1TR 2ZUEA 4MUGA 3D6UA 4HPWA 4OUDB 1WOYA 4U63A 2DLCX 1JGTA 2DEUA 3K32A 2IJGX 1PG2A 1MAWA 4ND6A 3P0JA 3FETA 5J5AA 3ZJTA 2ZUFA 4EG3A 2AKEA 2DERA 1MAUA 1TYDE 2AG6A 3HL4A 3N2YA 5F23A 1GLNA 3CLRC 3H99A 1QQTA 4GRIA 4G5YA 3CLTC 1WY5A 1T6XA 1K97A 3ZXSA 1GAXA 1JHDA 2Z09A 1IQ0A 3AL0C 3N05A 3NV7A 1KR2A 2IP1A 2HGZA 2QTRA 3VU8A 1OBHA 4QRDA 3ZUGA 1Q15A 1NI5A 3TZLA 4DDHA 4EG1A 3BL5A 3Q12A 4XFDA 5K0SA 1GN8A 1NURA 1VBKA 1M83A 1R6UA 2J08A 5KWVA 4WSOA 4YBRA 4K03A 4UZEA 5TGTA 1KH3A 2YY5A 4XFJA 3DV2A 4FZJA 4F4HA 3P0HA 3FDXA 3TNJA 3ZJVA 1OWOA 4ZT7A 2QJTA 3SEZA 1YI8A 3FOCA 4ZCRA 1O5TA 3IOBA 1NSYA 3IMEA 3Q4GA 2VTBA 4ZT4A 2JA2A 1R6XA 2GOYA
chains in the Genus database with same CATH superfamily
5HQTA 3EGXB 3WKBA 4I81A 4A15A 1KI8A 1P9WA 3AY6A 4WZAE 4AWBA 1YCHA 4RX1A 4B09A 4ANFA 3BA1A 3W9BA 2F1RA 4AVYA 3TJMA 1LX7A 3A6ZA 3KC2A 4TTIA 3RNOA 3HACA 4TRRA 1N2XA 4MWEA 1I7QB 1JAYA 1LLCA 5EHGA 1RM3A 2H3HA 2P3LA 4HQNA 1DUSA 1ZN8A 3R7WB 4IYRA 3M3HA 5CK4A 4EHHA 1T4MA 1DEOA 3K0FA 5KDLA 3UEOA 3HR7A 1DPGA 1LVGA 4KR9A 1ZC4A 5JZVA 3IR5A 3PENA 3ZE7A 1PEYA 4JBIA 4KTTE 2AOUB 3A9TA 1D5CA 3LY7A 5AJYA 5C8ZA 5CDFA 5B5SA 2NNWB 4KPUA 1I32A 2H63A 3K2EA 4BXOA 3F7MA 3UMYA 1E2PA 4R68A 4A6XA 1CS0A 4WVLA 4ZMSA 5CW2A 2AGVA 3D6NB 1PUXA 3FYUC 4C22A 3L6UA 5JCJA 2ZJ2A 5CUQA 3UANA 4BMYA 3ABQB 5JH7F 4ZU1X 4F6RB 2Q5EA 4C4RA 3ZWKA 4NYJR 4CKWA 1JJAA 4WFIA 5I9MA 3X1JA 1JHPA 1PEKE 2NV2B 3CRQA 3L8MA 4EGQA 5IAGA 4ZCTA 3FB4A 2ZULA 5D1HA 4I1PA 4AKHA 4YAWA 3QFSA 1HEIA 3RCBA 3E7XA 4MPRA 4ISCA 4I1SA 2B8WA 4V0KA 3PUIA 2C1XA 3V55A 5D6NA 3RASA 4FFBA 1IBLB 2QX8A 4YXWD 1GG2A 2PVCA 1G6Q1 1X86B 2DWCA 1MLDA 3RAPR 1OXBB 4DJDC 4JGIA 1IL0A 4M7WA 3TVYA 2EKDA 3FGZA 1V7PC 4RKQA 2FPXA 1SK9A 2W6PA 4R8LA 3HKEA 2JATA 2AX4A 4LJ5A 4LY0A 1GXSA 1RJ9A 1YMUA 2I4TA 4KLZA 4DYHA 4DLAA 1E9AA 2REXB 3HDVA 3PQ7A 1WCXA 2BCEA 2Q4RA 2V9CA 4BMSA 2H4XA 4Z0TA 4CMEC 4KQEA 2NIPA 2FOXA 1WF6A 2QTFA 4DMHA 1DARA 1CX9B 1Q50A 1VPVA 2GFHA 3H8SA 2BISA 4Y2UA 1PZHA 3DO5A 5AW7A 1QO0A 4PQGA 5AVYA 3CWZA 4N1AA 5ICMA 3JAKA 5JRZA 1YR1A 3DO6A 3DDSA 3VKWA 3UMMA 4KG7A 1L7BA 2AYZA 4UVEA 1XQXA 1USWA 2PRJA 3A32A 2XYRA 3B82A 3DBHA 3L8ZA 3E35A 3OZBA 1V7ZA 4KXXA 1WE2A 3WGIA 1F8GA 1ZR4A 3ICQB 3Q15C 4Q12A 2C00A 1MRSA 1R5BA 2ZRIA 1VL2A 1WZEA 3O4HA 3QG1A 2HJVA 1SCDA 1YD7A 3DFZA 3MRTA 2CXOA 1L8OA 2QVLA 4H08A 2IXTA 3FJ1A 1OH8A 3WHLA 4MZXA 2HT1A 3DOJA 1TU3A 4YRPA 2G36A 1M2KA 2MJLA 1I80A 4FZVA 5E4YA 2J0SA 1DCKA 3TRJA 1QH1B 4NF2A 1R8JA 1ZM2A 2QNRA 4JI4B 3DAHA 2I2FA 3BD7A 1NV9A 3B70A 3MTGA 3RYIB 3CLTD 4IV8A 1NMZA 3RVLA 4G8JA 2EW1A 1K6JA 2JH3A 1VE3A 2ZKLA 3H0EA 4OAOA 1TW2A 3R5XA 4BLWA 3LLUA 3HU5A 2NGRA 3D7KA 3UBTA 4O4IA 4GYKA 1I2BA 5AP9A 4GMGA 2WJAA 4ZAWA 4G1UC 3DLIA 3KJIA 4YRFA 5GGXA 3R7LA 2ZI5A 3TB6A 3ILYA 1M75A 4NI5A 5ESDA 1Z4NA 2C2YA 3W1VA 4PGGA 4A36A 3ZS8A 4DAEA 3OQJA 5FV7A 5DBHX 5WRFA 2PX2A 4Q21A 4DCJA 3AR5A 2XUIA 3C5CA 1XO1A 3KR9A 5I4BA 1G5RA 4FUQA 5BVGA 1ZCZA 1FYEA 4P0QB 4L8YA 4RYDA 3CR3C 5AVVA 1F8XA 4NFYA 2YNMD 5F2EA 3TSAA 4A2PA 4DL9A 5HFAA 4PZEA 1AUPA 5CXQA 1WSAA 1FNMA 3OF2A 1CE8A 5H82A 5F35A 1XDSA 3UB3A 2XYQA 1GUFA 1JLHA 3C5VA 3WHKA 2GTHA 4OFXA 1GV1A 1TO2E 2REOA 3GB9A 4AI6A 4K0KB 3E7FA 3N2EA 1CVIA 1O77A 1GPDG 3SDBA 2RONA 3T0IA 2QRQA 3ZY5A 4KRYA 4HDNA 4IIYA 1CHDA 3HLTA 2UV8A 1OWPA 5DI9A 1PK8A 4BU1A 3BJIC 3KPYA 2P5YA 2QY9A 5M29A 2ZP1A 4CM9D 4E5UA 4HPXB 5D85A 3DQQA 4DA7A 2XZPA 1FFXA 1UQUA 2XXJA 1KFCB 2J9GA 1FJHA 3K8ZA 3R44A 3PITA 5EZYF 1GFZA 3CF4G 3MIZA 1YHNA 4HRXA 5C52B 4W7SA 4YT8A 5JYBA 1Z5ZA 3Q0EA 1XD2B 3Q3EA 1C9JA 3NWPA 3DUFA 4TSKA 4H1UA 4BFVA 1L4NA 5CLLA 3GZJA 3AUFA 1A9XA 2OGUA 4YPVA 4J1SA 4JH0A 2NVUA 1QHHB 3GPDG 3OCJA 6REQA 1Q16A 4HWGA 2GETA 4KW7A 4NCNA 5FT9A 2NP7A 1LX6A 1ZY2A 2OSVA 3JQ6A 4GF5A 1M2EA 1HL7A 1NMEA 2KBEA 1JFFB 1F2TA 1WP4A 2FI1A 1SC4A 5JSKA 1LKZA 1YT5A 3UBMA 3QBVA 1WQ3A 1YU6A 1DHRA 2IDMA 2ZYVX 1SUIA 1VJ5A 1PNVA 1XJ0A 1GYRA 3F5QA 5K0CA 5J2TB 4JLPA 1WXIA 2NSHA 2YDXA 2FPRA 2EBUA 3KYDA 3NT4A 4DBLC 2CMGA 4CUZA 1SCAA 3ZWQA 2P68A 3DPUA 4NULA 4TMZA 5ITVA 3WIUA 5C51B 1OB2A 4DRZA 3PFHA 5K05A 4E2XA 1A9PA 1R12A 2Z2XA 2JLAA 4GKAA 1U7UA 2JCXA 1KI6A 4TZTA 3DDCA 3BICA 3M33A 4D81A 4MUYA 1TW3A 1U8CB 3BXZA 2XBMA 4L9WA 2IDKA 4QX6A 1GDTA 4DS3A 5A6SA 3I39X 3A25A 3SHTA 4UHEA 3TOSA 3U1TA 3GJQA 4JYMA 2PXXA 2J31A 5C5EA 1T2AA 3C6QA 4IX9A 4JOSA 4WKOA 2VCYA 5KTNA 1DBVO 2ZYDA 2GNAA 2ZI6A 2J45A 2A4KA 2WYUA 1GFSA 1Z45A 1VJTA 2LXNA 3B3QA 4Z4FA 1GHTA 3P9PA 3NHSA 2Q1SA 4U5QA 3T5GA 5EIBD 2X5KO 3LDGA 5B57C 3GLIB 2ZROA 3M6FA 1XZQA 3S99A 1D2CA 4QFCA 1O08A 2BDTA 2BF4A 4OXRA 2HPVA 3HFGA 1ELOA 1I30A 1T4BA 2YIMA 1TKAA 2I7DA 3HU2A 2ZBVA 3UC5A 4WXYB 4ZKDA 3L7NA 3DPIA 2W8BB 3WJ7A 3RSZA 3O1LA 3OE4A 3RPEA 3OPYA 4J4TA 1SOAA 2FUEA 1IRIA 1B00A 1LI5A 3FNFA 3JASB 3NUZA 4IFIA 3IT3A 3UGQA 4L85A 2EFEB 2H4ZA 2Y71A 3M1IA 4PRLA 4CM4A 3KR2A 4BHTA 4LW8A 4AULA 4FQ7A 3C45A 5KOHA 3TD9A 3EZYA 1FSSA 3SQNA 1HDZA 5G1OA 3P1JA 1TYAE 2NUAA 1BXGB 2WILA 4L4XA 3PC8C 4QBIA 1SIWA 4BVAA 2FSUA 2X7XA 3MAGA 2XAAA 3GXOA 3MERA 1KHTA 4CEHB 3I9MA 1JL3A 1RJEA 4AKTA 1RRVA 4I55B 5T4EA 2K7ZA 3VYTB 3F3YA 1NUSA 1N9KA 2HJGA 2A92A 1W4BA 5BN3B 4JC8A 1CWUA 2FPKA 2FW8A 2XLBA 1A27A 1DELA 3PP8A 3WA6A 2C5FA 1ESMA 2D0OB 3G49A 3PL5A 1QIIA 1RRCA 1TEXA 4PM4A 5KQMA 3TL6A 2XUFA 4DJ5X 2OAEA 3T12A 1V8BA 1PU2A 1GTJ1 1I1HA 3GJ6A 3SYTA 3W9UA 4EGJA 4GDFA 3M6MD 2H52A 2FMKA 2PEZA 3HJGA 4B2IA 1H8HD 3GLQA 2UUBB 2JD0A 1NFQA 2GBLC 2CSUA 3IAXA 4XLLA 1WXGA 4LQCA 3N86A 4BUCA 4MP8A 3G85A 3MXOA 2PS0A 1JECA 3OU7A 1A96A 1DAIA 4ARCA 1P7PA 3IV7A 1A98A 1QIEA 5IVKA 4D9NA 4I19A 1HLFA 4G5QA 2IUUA 3GU3A 3T1HB 2RIRA 2O0LA 3VDRA 1U1CA 2GJ9A 3VTKA 4ISBA 4RENA 1TMYA 2XEXA 1LPPA 4LNAA 1O1YA 1P7YA 2QM3A 4A5SA 3DMTA 2HEIA 3HXQA 3CWCA 2OCYC 1GN9A 2AG1A 4P3KA 2SICE 4LMPA 5AM4A 1OIWA 3TLMA 5I8ZA 1F14A 3F8TA 2QP4A 3DKKA 4RD4A 4UEQA 5B2ZA 4F11A 2MSKA 4KJXA 4ZT5A 4E7PA 1R0YA 5DGHA 4Z0PA 3BIJA 5SYAA 3S2YA 1PEAA 2QVZX 4KYTA 1KEEA 3MQ2A 4PGHA 1XAJA 1ISGA 9LDTA 4RZHA 5LP6C 4GRAA 2AUNA 2FPWA 2XMCA 1G9SA 1A9XB 2O9JA 3WZ2A 1OT5A 3EA0A 2OXFA 3WTCA 3WQHA 5D5HA 2Y1FA 3V8PA 5BSEA 2O8EB 2QTZA 4ZEOA 1P1JA 4U7FA 4C0SA 5AW0A 4DPLA 1EHCA 1E63A 2VCHA 2BIFA 4NCBA 1JIJA 1LLDA 2OLEA 3OEWA 1NAHA 4URUR 2GJAA 1G291 2L42A 4RESA 1H6BA 4DILA 2BN4A 1CUZA 2DFNA 2WIAA 1KKLA 3D0OA 3HWX1 1GWNA 2YY7A 3L41A 5C34B 3QPVA 4ND3A 4AP9A 3BE8A 2O2DA 5B36A 2JASA 4GEGA 3GUCA 1EQ2A 3WGGA 5B58C 4NENA 2CJXA 2BTEA 2P2YA 2VPXA 2DQ4A 3F9CA 3U4IA 1EP3B 1JPVA 2NTJA 1NC3A 4R71A 4B9AA 3WXBA 4YAIA 5AW3A 1IJFA 2V7VA 1J99A 1WHTB 2QX6A 1YGYA 3EODA 4W63A 4MWSA 5CDHA 1KZHA 4E6PA 1K7FB 2CZCA 1SKYB 3VNRA 4YRIA 4Q3LA 2R0QC 3A14A 1DJQA 2B4RO 2REQA 5AW6A 1ZVKA 4MCHA 4LOJA 2OILA 3DVAA 1XDDA 2XSZA 4WK0B 4CIDA 1SQ5A 1KA9H 4OUKX 4FHGA 3WRYA 4OLFA 4PXYA 1JR3D 3AF4A 1WDKA 2C1EA 3IT1A 5CP8A 3WI7A 5KJ6A 2FSSA 3BSFA 3IBFA 4JUFA 2FLVA 5I7EA 1PR5A 2JRCA 4R9SA 4KYIB 5A05A 1GKLA 1R4NB 1SXQA 4HR7A 4NG5A 2I6GA 2V7QA 3IYLW 1T6YA 3MSXA 2XGOA 1VI5A 2OP1A 1W5TA 1AZWA 2CUZA 3FZEA 4PRKA 4YRRA 3WYEA 4AMUA 4CM3A 3ISVA 1ULUA 2J5XA 3UATA 3OHMA 4JYZA 5MHTA 4BJ1A 1FP2A 4CGYA 2GCEA 1KYVA 2I33A 2H8GA 3EXHA 1FNBA 4ADSG 2XPCA 3NIFB 1EAYA 3WL7A 1W4RA 4MWOA 1M34E 3LGXA 4Y98A 5IF9A 4LDAA 2QV7A 1QZ3A 3ETJA 3JQ8B 2YVAA 3P97A 4GNKA 2QE7D 1GL6A 3ETLA 4TKUB 1M2HA 2C8VA 3LT1A 3RIMA 4DR4B 5DRYA 4RV9A 4IGFA 1CW2B 1SKUA 2IIBA 3VYSB 1S96A 4JX9A 3CRRA 5HX7A 2FK7A 3OJ0A 2H11A 2CVPA 2XDQB 1LLFA 4M0UA 1U9IC 1ZI6A 1ZK4A 2XMGA 2CB9A 2H48A 3FUVA 2C04A 2MHCA 2IYWA 1AUQA 2SHKA 2QBYA 2XB6A 2B6NA 2IY7A 5SYMA 4DV6B 4N9WA 5J43A 2Z6VA 4G63A 4QNMA 1JVSA 3TZKA 5AM1A 4AJKA 4B87A 2V54A 4UDXX 1T9ZA 3KR0A 4O4JF 4AMYA 3WKCA 5IK2A 4OHCA 1DO2A 1Q2XA 3QLVA 2RKBA 4XQGA 4YT5A 4C05A 3VJKA 1EUCA 5KEIA 2HMWA 2EFGA 3GLUA 4HB0A 4D4GA 1VGRA 2PZJA 5TQVA 2WUFA 2ZS8A 1IQ0A 4N48A 2XQVA 5FPPA 1G17A 3GUHA 4N47A 1XRQA 3TPZA 1SXJE 2BFDB 4QEKA 1B6GA 1PI3A 1N1GA 3HYNA 3MS7A 4KAXA 1CY2A 4LC0A 2ZUWA 4B40A 2GZRA 4X44A 5D51S 5KDOA 4OMCA 2Q6VA 4P34A 5G41A 3EWNA 4AWAA 4PYJA 5AO9A 2AJCA 4XFDA 1FF9A 3RVDA 5C5DA 2MTBA 3TZQA 4EB3A 1VBKA 4AMVA 4ZJYA 1VE5A 4MJLA 4XTCS 3U3ZA 4JU8A 5LNK6 3Q8MA 2FEXA 5CA1A 3OCVA 2FZLA 2H2WA 4N40A 1G4HA 2YBDA 1UKCA 2G72A 2P9FA 3ETCA 2BGUA 1OXXK 3AFIA 4DUZB 1DV2A 1WULS 1VLJA 3PQ5A 4II3A 3FOCA 4Q7JB 1IWBB 2I4IA 2D7DA 3IMEA 1WHSB 5C3UA 3ZD7A 4W4TA 1FZTA 4MJXA 4L27A 4MP6A 3FLAA 4EYEA 4F86A 2C4VA 2YMLA 5DM60 4DDWA 2BH2A 3ODPA 5CH5A 2CBGA 4MAFA 1V3TA 2NO7A 1U8AA 1P8JA 4ZAGA 4RJLA 4EVSA 3IILA 3NI2A 4GZMA 2Q2VA 4AYXA 1GTSA 5TQJA 1U0BB 1XQVA 1TLTA 4MIYA 1WKBA 1DPFA 2Q5OA 4BX2A 1H5UA 5EJ4A 2ZCJA 1PZEA 1RXSA 4C20A 1P7ZA 2CLLB 1KQPA 1MG0A 2QAGB 1LSOA 3AUUA 2VDUE 5BR8B 2CFRA 2XJ9A 1JYFA 2FK8A 2JK0A 1M6NA 1ZUD1 2X5NA 1LI4A 4TVSA 3ZX5A 1O9HA 3RGGA 4ETMA 1GZHB 3NHJA 2UUCB 4NFHA 1NJ1A 4KI7A 4I8XA 2J30A 2XT9A 3VDMA 3W4JA 1XHLA 2NXWA 3FZYA 2Y67A 4AT1A 3EXIA 3DHNA 4IUBS 4BGUA 5CPFA 3E70C 1BMDA 4MUEA 1I36A 4EY4A 3OMWA 4D9BA 1N36B 4KHPB 5TRTA 2DKOA 3GVIA 4M0PA 4DDKA 3RTAA 2C9YA 3HUEA 3OJFA 3PJFA 1O03A 1NQWA 2ZIEA 3KELA 5DRTA 3GLSA 3R9KA 3UUWA 3QF7A 1C0IA 5EESA 3MJHA 2FSIA 5FPSA 1J7KA 3H9EO 4CIBA 2JNWA 2IOQA 3A1CA 4FHCA 2PH5A 4JD5A 4N9QA 4N7RA 5DBOA 3H9JA 2ZM6B 2H4FA 3DBVO 3EH2A 2X2FA 1KU0A 3LA8A 4Z51A 4J16A 2PUJA 1M6EX 2PCLA 1NY5A 5GJWC 3INRA 3WRWA 3OETA 2YHSA 2VHJA 5F4ZA 1AGNA 2DR0A 3LP8A 4WXEA 1I5OA 3FUTA 4AW9A 1A9OA 1GPKA 3JZAA 3M4XA 3OX3A 3ZHUA 4ZGGA 1I4TD 1LPBB 4C30A 5EJ6A 1L4YA 4G89A 5JRDS 1YUBA 3U16A 3EARA 2W43A 3PC8A 3KB1A 3I37X 2QWXA 5LVAA 2D5IA 3F7OA 3GG2A 3OIWA 4M0CA 4YV0A 3QSGA 3LHSA 5AT1A 2H17A 1KOFA 2BFFA 3TX6A 1XTBA 3W0LB 2PR2A 4EI8A 2PLWA 5CIYA 4RFVA 4R9UC 2GPTA 4XRGA 1YVPA 4WCVA 3OZTA 4HS9A 2F59A 1KKUA 3W7VA 2WT9A 4E4RA 2Y2UA 4GVXA 4HFRA 3NHAA 4J7AA 4MUKA 4UDOA 5FNVB 4ZIRA 1TCCA 2V1UA 2ZRQA 3FYHA 1PQ4A 4P3PA 5PNTA 4RADA 4WESA 5IX8A 4H7PA 2WKPA 4NYMQ 4PLFA 4MRRA 2HWYA 5AJTA 4IAOA 3RTDA 5BWCA 3S29A 2QLBA 3DVRX 2C2ZA 2VNKA 3A6JA 1E3DA 3A6EA 1OXVA 3IQFA 3ZK8A 4ZVMA 1R0ZA 3BTOA 2WVAA 5JXJA 2RHJA 4NDZA 1DDGA 4BO1A 4E07A 4XZ3A 4O59O 4YV2A 1H1TA 3CLRD 1W4CA 3BKWA 1T0PA 5DHRA 1Z74A 4KODA 3P9QA 2H85A 2ZYGA 5AK3A 7MDHA 3UGJA 2HAEA 3EASA 3EZNA 5ALTA 2BFMA 3QXXA 1RYEA 4L5BA 5L3VA 2QTAA 2GH1A 3VX4A 4E03A 1TD9A 3BTSA 4XUCA 1H9BA 3E2MA 4I14A 4X7BA 4HNTA 1ODIA 4BP8A 4CCYB 4GM0A 1PUIA 1Q22A 2J5KA 5FI5A 1OX4B 3R8XA 1RLJA 1TJYA 3EB9A 1YF3A 1AQNA 1A7AA 3R9XA 2CJYA 1EP1B 4GHWA 5FI1B 1UJ5A 2FX3A 4QOFA 1B8OA 2PO7A 3NBZC 3F3MA 3AI7A 2PGDA 3L7OA 3BRWD 3RF7A 5AJZA 3ZK7A 3NDJA 4ASUA 4ZYZA 3N5CA 4GI3A 3Q5GA 1PHRA 3L8YA 1YJAA 3QX3A 3E3MA 3ZU5A 2VPPA 2G88A 5LB4A 2YHUA 4AJOA 4EFLA 4JHXA 4R2MA 1IZ7A 3LW7A 1JHMA 3W4IA 3TOXA 3DZGA 3ORHA 2B4QA 1X42A 2GPNA 1IEQA 3H3JA 4HCJA 3TCNA 2J7PD 1Z39A 3WYGA 4GYYA 1NG1A 1KYIA 2NTVA 3GFSA 2WA2A 1VMAA 1XJWA 3H4TA 4FEAA 1L7PA 4PLPA 2VTBB 1KQGA 1C9YA 1DWUA 5FEMA 3ONDA 4XI9A 4U02A 3LUFA 4E7OA 4LC1A 1FSFA 2D06A 3FPGA 3IULA 1C0EA 1NLYA 2J3QA 1P2SA 2QJFA 1CUJA 2F9MA 1EP9A 3EGOA 2GN0A 4OQLA 2OYRA 3GLFA 2ES4A 1N5OX 1WETA 2P1DA 1PW7A 2D74A 3C74A 4P93A 3FTDA 4XWAA 2P6RA 4U00A 1CTQA 1D4AA 1EGVB 4OQNA 3EGDB 3AT1A 1XHEA 4TWJA 3V7YA 3VO9A 4D3ZA 4DSOA 3T6KA 4F4FA 4IMIB 1G7RA 1L5MA 5KYWA 3K0FB 3KWJA 4TTAA 4Z99A 5IAAA 1Z63A 2GHTA 2HPZA 1IXYA 1XA3A 3GC6A 4KDRA 1XDBA 3GT3A 2ZBUA 4XYMA 1E9EA 1D2MA 2HNKA 1EUDA 1JKMA 2OBLA 4XASA 5CIWA 1ACMA 1Z26A 1AURA 3GRPA 2J8ZA 3IEUA 3VH1A 5DTEA 3EMVA 4RF5A 4CLEA 3TRIA 4BXOB 4JSYA 5I48A 1ZD4A 3U49A 1B26A 1CS0B 2HQOA 5FP0A 3GW8A 2BVNA 4NS4A 4N8DA 3L7YA 4YUAA 5JNWA 4QUKA 3V4LA 5I7OA 4O8CA 4HDOB 4QDXA 3AR2A 2VDOB 4PAOA 5F1KA 2ZS9A 2CCKA 1SXJD 1W0CA 2OT3B 1SVKA 4KVGA 4MXDA 4OQDA 1A7UA 4PYLA 2VP0A 4O3MA 4RA6A 1QGUA 1I3OA 3IIMA 1D0VA 4CKWB 3NBQA 5HCUA 1KORA 1VKRA 3FI0A 4NOJA 3AEXA 4JVNA 4OXXA 3A9SA 4EG6A 3MTAA 5ALMA 1TCAA 1Y6QA 3RWBA 3EG5A 1G41A 1PK7A 5H9WA 1PJQA 4GKJB 1Z0KA 1YS6A 4FFBB 1O94A 5JNTA 1RKQA 3EFOB 2Q50A 3H9UA 5LQDA 3RUHA 5LZ8A 5IHXA 2A1UA 4QDOA 5IBPA 4XDZA 4JC5A 1FS5A 2FQQA 2J4FA 3FD8A 3GRUA 1G8HA 3GRYA 3KWLA 3L06A 4DCMA 4EB6A 1OTHA 3K71B 1OXUA 2C42A 3HKEB 5B64A 2JLSA 2CEKA 2VZLA 4HB4A 4FPXA 1GXSB 1N2IA 2DFLA 2HXYA 2NO5A 2NAPA 3HBMA 4L75A 2JH8A 3LOPA 5CM9C 4BNYA 1KBQA 3KTAA 4QLOA 3OPXA 5AQ1A 2M32A 3THWA 5CPBA 2B1GA 3OESA 3LA6A 4WXMA 2QMQA 3GCGA 1OKKA 1ZCJA 3T5BA 3JAKB 2O48X 3O1HB 3W6ZA 1FX0A 4DCNA 3GNLA 2AK3A 3G2NA 3B3AA 3CH4B 4HNRA 2WINI 2HLDD 4IJ5A 5ALRA 1IXZA 2VLBA 3B1XA 4ZODA 2A9QA 2W2XA 4BZWA 1Q7RA 3S2EA 4CV1A 4FJ2A 2Y1CA 3DTVA 2AN9A 3PDHA 3HJNA 1KYXA 1VXOA 2QD3A 4XPIA 2I54A 1HDOA 4OHXA 1GCUA 1S6YA 4BKQA 2OP0A 3KQLA 5K3OA 2IX3A 3QG5A 1P3Y1 1RVDA 4RQUA 2P2LA 2R8OA 4EO9A 2K7FA 3OM1A 1BVHA 1C7ZA 3BIWA 3MCWA 1YJCA 4ND4A 1E64A 1DAGA 3S1LA 3K1ZA 1Q19A 2CF5A 3A06A 3GZTB 2IHTA 4AIIA 1EVEA 3BHMA 5HZKA 2HOQA 2X6TA 3T4UA 4D9CA 1Z07A 4NG4A 4LZWA 1XU7A 2Y1EA 3DEYX 1GL3A 2CD9A 3NG1A 3PSHA 5AM5A 3WJAA 2BW0A 4RM3A 1OXMA 2FSPA 4LKRA 4Z7NB 1EIWA 2JFFA 1BJTA 1UEJA 1GRNA 4LJ8A 1TIPA 4O4IB 5E6RA 2QVYX 2WJVA 3GH3A 5CLIA 3UO8B 3OC6A 2I29A 1RLIA 2NYVA 4MH0R 1AHPA 2ZRPA 3OSZA 2COEA 1Z5UA 4WTOA 5HF8A 1KPGA 2VF4X 4RNDB 2QMYA 3AL3A 3UMSA 2W70A 3U17A 2AMVA 4X97A 1EFUA 2WR8A 5BUSA 3S1SA 5BVGB 5FDFA 4OJQA 5L4LA 1Z56C 4N3BA 3PEWA 4P31A 3MWGA 4IXWA 5T3YA 2DBQA 2R87A 1UXHA 4NARA 3Q7SA 4A8TA 1P75A 3U4QB 1Y9JA 4ESEA 3KKOA 2WUDA 2Y4OA 1DEXA 3TQHA 4B0OA 4U39A 5EXSA 3DMDA 4P8RA 4CLOA 5I8WA 3ZD8A 1RZVA 2X14A 1U7TA 2BJWA 1DC4A 1KP3A 2OTCA 2OCXA 4ZN6A 4HDNB 1W73A 5CDSA 2OKCA 1T2NA 2X41A 3OOHA 2ZXEA 3F4LA 4ENSA 4URFA 3NPMA 2AIRA 3JPWA 4GYWA 1PT7A 2CVFA 2A0FA 3L0CA 3GGSA 5M34A 5CEEA 4YVFA 2MIIA 3AJEA 4JASB 4IQ0A 4AP5A 1FFXB 2QQFA 3IEXA 4YP0A 4FONA 4DSAA 5JJBA 1T9GR 4I6JA 3KVNA 3AJRA 3E0XA 3H6HA 1J5PA 2HQSA 4AMGA 3TNYA 1I4WA 1VDMA 1N7JA 3L1KA 4C6RA 3DUFB 3D1VA 3G79A 1H85A 1K2VN 2BEJA 1AGXA 1K4YA 1CKEA 1R6DA 1TVEA 3Q9LA 3JQBC 1NVUQ 2NVUB 1UPBA 3VSBA 4PZZA 4BB9A 2QMUA 3EHEA 3WGJA 2OLKA 5A5VA 2DJIA 1E6CA 3DWGA 5ED4A 1BQ4A 2EGHA 2OO7A 2PWAA 1NJ6A 2F1HA 4C0BA 4D4JA 3CNOA 1VLVA 1F2TB 3PPIA 4K81B 5A71A 3DEHA 3KPJA 1ECLA 4F7WA 2HSJA 2BMEA 3CB4A 1THGA 4GKVA 3B6EA 4F4UA 5AW4A 4UVHA 4R2IA 1CJUC 1QAOA 4QYTA 3ELBA 2G82A 1T1GA 1WMSA 4ONEA 1PNRA 1ZIXA 3O8NA 4HATA 1L4LA 1EA5A 3A0RB 1XZPA 1Z0FA 4CQMA 1KZ9A 1UT6A 2WU4A 3R3XA 1T1SA 1O9BA 1H8EA 1NVMB 3HDJA 3UTCA 2W48A 1Q7BA 2PKYX 2FKNA 5P8WA 1UBMS 3ZW7A 1I94B 1VKHA 3T3HA 4NE2A 1T6ZA 1WLYA 4CKYA 2PU7A 4BZZA 2B2NA 2FFAA 5A6SB 1PF7E 2Y1OA 4TYYA 4KRFA 3QHPA 2Y68A 2JZCA 3QJGA 3CVXA 3QY9A 2WSSD 5F76A 1R5OA 4CIYA 4N76A 1XMPA 1UANA 1FRVA 2TS1A 1BDHA 2O7SA 3Q6NA 3NW9A 2H06A 3WK7A 4LYAA 4UHHA 2P40A 1DKRA 1XZGA 3OZUA 4KRGA 1JA1A 4MQMA 4DY6A 2ZBPA 4ZOBA 3RYHA 3N0WA 1S3GA 2P7HA 3HB7A 1ONBA 5DW3A 4EMSA 3RRXA 4GD3Q 5BMOA 4LRXA 1J09A 5TARA 4UULA 3NBYC 1IG0A 2PL9A 2QLLA 4DR3B 2AFIA 3L7DA 3LPCA 2CHEA 1EGMB 3X1ZA 1JHOA 1W35A 4LF9B 2WWHA 3EBLA 4KE8A 5JQGB 2WWYA 1UBRS 1OFUA 2JIOA 3ROKA 3OBBA 4Q7MB 5CFNA 3CRW1 5B6IA 1RI4A 1VZ3A 3HN2A 3TG2A 3VNUA 2P9JA 4KL8S 5AYVA 5KSWB 1YFLA 2JS7A 3K6SB 2QL6A 1SXGA 3ESAA 2BHRA 5ADVA 1NATA 3EC2A 5JI3E 3AERB 2V7BA 1YKSA 2XLCA 3H5VA 1ZJ4A 5FLKA 4CM4B 5ITZB 5ENZA 1WMEA 3KJEA 2AN5A 3BH6A 1ABEA 1ZINA 1TQ4A 5JSQA 3URMA 3IQEA 5AVKA 2W2MA 5JSYA 3A36A 4RZ3A 4AYWA 2R62A 1QO0D 3U3KA 1WZNA 3VNVA 4IGEA 5BRJA 1J7JA 5KQGA 3LVBA 3HVJA 3EEFA 3IAUA 4UMDA 4HGNA 5DH9A 4ZV7A 3OTIA 2XYPA 4LRSB 2FQWA 3EZ6A 4MOWA 3LIIA 3L40A 5E6SB 2IS4A 3NVDA 3WLNA 1GD1O 1KAHA 3K35A 4UPVA 2Q2QA 2VAVA 1KJNA 2IP1A 3C48A 3E8SA 2C5BA 3DPSA 2M6LA 2WM8A 1LS6A 3CIFA 2RH9B 1CUYA 3Q12A 4Q01A 1QIJA 1WA5A 5BMVA 1KO8A 5JS1A 2DG2A 5CIQA 2ZJAA 4N8EA 1OZGA 4DKJA 1FFEA 1KEVA 5D84A 4BVJA 1WDMA 1N6OA 1U3FA 4NBNA 4A10A 2CLDX 1DBIA 2A59A 4X3OA 4EHBA 1XGKA 1BU8A 3UJBA 3ADDA 2H1WA 1KH3A 2E2WA 2QJWA 3Q1LA 4ZC1A 1JS1X 1C14A 3LF2A 1UXGA 2GPJA 4BVHA 3DP9A 1N25A 3L0OA 1GQSA 1X9GA 3NOOA 2I3DA 4ZCRA 5CG1A 1NSYA 3Q4GA 2DQYA 3AW8A 1EVJA 5E1OA 3R5TA 2ID4A 3TKLA 1ITZA 2JI4A 2VRBA 3BFXA 5EERA 5DBFA 3FNRA 1H3EA 1M1YA 2G71A 3AJ9A 2J07A 3T06B 3OQOA 2JIQA 1JEJA 2OO3A 3OJCA 4E31A 4AY2A 1KI1A 1ZRNA 5AVXA 3DONA 3ASZA 4HV4A 2NAFA 1O96A 4HH1A 1YR6A 1MRZA 1DAPA 3RWMB 4BGIA 1E6EA 1UT8A 4E08A 2HF2A 5IEBA 4M1KA 4DHWA 3K1AB 4DQKA 2QR3A 8MHTA 1XNHA 5B37A 1KEEB 4XUGB 5TB5A 3KD3A 1ECPA 2Z08A 4TXMA 3THSA 4X62B 4TV8F 1HT1E 3O0DA 3PXXA 4UFNA 5CNMA 4YK7A 1A8HA 2VT7A 4IHJF 5ESXA 3OIYA 4FQ8A 1PS9A 3I4LA 1PJTA 1PJLA 2WJ6A 3IEKA 4TRMA 1M2OA 3QW2A 2EX4A 5CJ2A 5BYKA 2Y1WA 4UTXA 3BM5A 3D02A 1ZWLA 1C1DA 3UIEA 2G1KA 3PTLA 1RAFA 4LDNA 3NDBB 1D2GA 4ARUA 1U7DA 4IRMA 4K9LA 4NYIR 1R9GA 3ZV3A 4J1TA 2AVDA 1WLSA 3GRFA 3VGPA 2I87A 3MZ0A 2ZAGA 3PRHA 4J0JA 1IN6A 1NP7A 3CCFA 2IYFA 2GYUA 4NENB 5JVDF 4YQEA 1M2WA 2FF5A 2X40A 3CH6A 3IC5A 2NXJA 5KOJB 1DKQA 2RE8A 2GK3A 4RS3A 2GBPA 3F6PA 1R18A 3V00A 1F38A 1KK3A 1L8QA 2VK2A 4F72A 1AS3A 1KJZA 2WMDA 3E4DA 5LQRA 1B8PA 4G01B 2PT6A 3QVKA 4O2BB 1UM8A 2PY6A 4C0HA 2C58A 5JMPA 1L4FA 3CR7A 2REQB 2YWBA 5DVZA 5IT5A 2C7OA 1EX9A 1FDOA 3DVAB 3CISA 4HH0A 3T0GA 4RSRA 2KQUA 3DE7X 4A23A 1E6WA 2J48A 4OL0A 1RIIA 3PWZA 3RM3A 1UMBB 1TO1E 4N0PA 3RUFA 4IZHA 1HE2A 1NN1A 3G2KA 3CEMA 3IEMA 2FW9A 3CF4A 1M2GA 2RDMA 3DFIA 2HK7A 3KOMA 4KXLA 4LOAA 4PHCA 4QA9A 3GROA 5THXA 7ABPA 5JDIC 3PWKA 2W6OA 4MGZR 3AX6A 3DHVA 3O75A 4MS1A 3BA6A 3PQ6A 4DWVA 3W5CA 5GZ1A 2O6LA 1X13A 5LYJF 2FMFA 5F4BA 3SLKA 1XZJA 2FFHA 5K3DA 2C2XA 3V4VB 2ORIA 5J4VA 2Q2NA 4P84A 2I9PA 3KL2A 1RYYA 3PQ4A 5F12A 9LDBA 5JZ9A 3T7KA 1C4WA 1OZFA 4PIPA 1T29A 1NW9B 3T34A 2BONA 1HNWB 2H5IA 4K6HA 5SICE 1JHAA 3ZVLA 3JRWA 2DSNA 4ECEA 1OXSC 1QRTA 3LUJA 3CM0A 4IDQA 4DQUA 3UAXA 5F5XA 3ZC3A 4NU8X 1V9SA 2C88A 3AG6A 1CZHA 1XRJA 4ZAXA 1FW6A 1FDRA 1K8QA 1Z6GA 2WEKA 4RVHA 3KQSA 3OHSX 1UP4A 2XT6A 3P27A 5G40A 1Q77A 1XCMA 2FXVA 2QBYB 2FPPA 5A7FA 3BXXA 1G6KA 1R6BX 2O5RA 2VYQA 4FT4A 5EJAA 2E4AA 3BXEA 4IIBA 1HFEL 4RH3A 1EE2A 2ZRKA 4ZYTA 4R1UA 2ZOSA 3IUPA 4TMXA 4MDHA 4K86A 5CVCA 5DP2A 3OKAA 1Q7CA 2E4WA 5JFGA 1QVWA 1UM9A 3QVGA 1U0OC 3CZCA 4C3OB 4CCAA 4DBLE 2W6ID 5KTPA 1LLQA 4KTVE 1MD9A 4LYGA 5K8TA 3L49A 4DRXB 2BP7B 3ZDAA 1G8JA 1X9HA 4ESHA 2PRYA 4PQYA 4ZQHA 4BNHA 4DEYA 1EFKA 1TJ5A 1ULTA 2FPSA 2VSQA 2Y93A 4GIBA 4GX5A 3TCXB 2CXSA 2BM1A 3O74A 5JYCA 2H9AA 4I5FA 3ND6A 1H3FA 1YE8A 5B1YA 3ISTA 4CF7A 1H0RA 1R27A 1YZHA 2VK4A 3DYIA 3PGLA 2D5CA 3ROTA 2FUNB 3KQVA 1ENOA 2OHIA 3SICE 3KWMA 3TVDA 2FWMX 4KXFB 5CA1B 5ALYA 2IUTA 2LKCA 4P98A 2E21A 1U63A 3GWGA 4TTPA 4B85A 4HZUA 2ZJ8A 1IZZA 2V65A 3BE5A 3L7MA 1E2DA 2OOKA 1ZONA 1FQKA 1EGQA 4QSHA 1M6VA 1S4QA 2AXQA 1I10A 2JBAB 4GECA 1QGED 4LXTA 1DKOA 5DHSA 2YYSA 3A1FA 3CZAA 5K03A 4AURA 2VAPA 1JZTA 2DPYA 3ZE9A 4L28A 4RTOA 1ZIYA 1ZN9A 4V0RA 2QRMA 3ZDXB 4MEBA 2V0GA 4FOSA 1UH5A 1QUFA 4RKRA 2X86A 5ALSA 4QNRA 2HWWA 2OXRA 3QE0A 2EGUA 3OQIB 2NWQA 4P54A 4WJZA 2H1IA 1ZPDA 3RK0A 3TTXA 1E1QD 1JAXA 3CXRA 4ZA2A 2IK8A 4OQQA 4AY6A 3UCEA 5HTOA 3CVWA 1DC5A 2PBFA 3MLBA 3UAGA 4EMBA 2EWWA 3NOQA 3ZZUA 2A5GA 1NQOA 3K09C 1NNSA 3C8UA 1QZUA 2QP9X 4D92A 5A1JA 2QLMA 1BOFA 3S2UA 3V5NA 2KMLA 1EGAA 2XE7A 4CM8B 4BFSA 5DP1A 2C7BA 1CUFA 1OZHA 1GVHA 4M22A 4BKOA 1HSZA 3GRVA 2V9PA 5AWFC 2V3WA 3EXIB 3PXAA 5CK5A 3FJOA 2QD2A 2A5YB 4E0BA 4C6SA 1OREA 5TPZA 1ZD8A 3JZFA 4IDCA 5E8RA 2C96A 2HIAA 4E30A 5DOVA 3NR2A 3ADPA 5DM2A 3VDQA 2ZTSA 2QG9A 1V4NA 2NU7A 3FHJA 4CMAA 3LK6A 3W5VA 4LF8B 3CE6A 2IBMA 2G1AA 3UK1A 3QVJA 3HCBA 1YHZA 1DTWB 2WUEA 4S1WA 5G0WA 5FYDA 1UWVA 3GHYA 4IXTA 5L7YA 3F47A 3BILA 4JODA 1YJ8A 2GESA 2YUTA 3AVTA 2ZT8A 3P9KA 3LK7A 1E0AA 3L1UA 1G6HA 3IAM6 2YN0A 1JXOA 1V5EA 3OT5A 3AY0A 1IHXA 2ZRCA 3A9WA 3PNVA 4IW3B 4NBRA 4M60A 4DM7A 4ESOA 3G2IA 2RK4A 2XNCA 4LHYA 4RA9A 4NDNE 1RE0A 1V0JA 2ATXA 1WW3A 5C1OA 3QOXA 4KAJA 2BJVA 4Q24A 4R84A 3WIBA 3WL4A 3WAJA 3DD5A 2FRXA 1YZYA 2O5CA 3TSYA 2AV6A 4LGCA 5AKXA 3KZCA 3MOSA 1U1GA 3M83A 5AKHA 5SY6A 4BO2A 2B4TO 2BFFB 3N9IA 2VHUA 1MOQA 5K6RA 4YJ3A 2PZMA 4L50A 3O93A 1U2EA 1USUA 2UZIR 3AOGA 3KL4A 4NNPA 1JKIA 3OF3A 4MDFA 1RRPA 4LRQA 4BIIA 2E85A 3KALA 1AKYA 1W6UA 1YR2A 3LYAA 4LYYA 3RIXA 2J0EA 2C57A 5DGTA 4CMKA 1NDUA 4JAVC 1Z0JA 2OFWA 3A7DA 1XLTA 3BCSA 2Q1YA 4WESB 4E14A 1B4DA 1IWOA 3HUFA 4EUNA 1ZH0A 4V39A 2R25B 1F0NA 4UREA 2VNAA 3ENVA 3VPAA 4RQBA 3WLMA 1Z2AA 2QZ9A 4GXRA 3K5WA 4H3HB 4OJTA 5F33A 1U3GA 3SJZA 1DIGA 5LU8A 2ZWPA 1I0ZA 3WK8A 3DOHA 1N8SA 4DFDA 4ZQIA 1RHMA 4BQRA 3AOEA 1ZR2A 4XJVA 1WB9A 3IUSA 1E0DA 1ID8A 3VU9B 1R0LA 3F78A 4PHGA 2FWNA 3PEUA 4TS1A 3MJSA 1QYRA 5REQA 4J7XA 5EEGA 5LQAA 2AYXA 3HLYA 2IHYA 3NNSA 3QEJA 1NQUA 3L6RA 1LY1A 2ADOA 2GAIA 3ZNPA 3PV0A 4S1TA 3U3OA 4B6SA 4PCLA 1RE1A 4NCAA 1MA3A 2PVSA 4RZUA 4ER3A 1EK6A 4W5NA 5F7XA 2CXUA 4ZO4A 3OU2A 1VBMA 4PVCA 1TI7A 4AJ2A 2I99A 5M5BA 3R9XB 2G3YA 5HZMA 4ZHQB 3L77A 5LP6B 3FVTA 5EWLA 1C41A 4ZRDA 1UXIA 2OWEA 3C8DA 3IR7A 1QQ5A 5EXEA 4XX1A 3X1MA 1PCXA 4NSNA 1KARA 2QUAA 3N7TA 4M4SA 4ITUA 2HU5A 3C6XA 3EUEA 4QWMA 3LX4A 3CGWA 1JEAA 1X1QA 2A3NA 4XEUA 3U7GA 3W9SA 2IW1A 2ANCA 3AY7A 2PNFA 4LXUA 3ECCA 4TTVA 1RPNA 4XGQA 3VPCA 3MYYA 1X77A 3L4JA 4ZVUA 5H16A 1BE6A 3WADA 3ROQA 4MVJM 3ZIUA 1TMKA 3CBQA 3W05A 5IK2D 4QUBA 3IUJA 5HFNA 2ISSD 4X8MA 3IJPA 5JAPA 4GZ3A 2OG2A 5BORA 4PO9A 1X1SA 1W87A 2F1OA 5HZGA 1XL1A 3T54A 2F9LA 1TUEA 1JEEA 4L7VA 4C6TA 1XRPA 5K8VA 1GARA 3ITNA 1DMSA 1QLHA 3BXGA 4RXUA 3V8QA 2CFTA 2JLXA 3OLZA 1A8IA 4DSZA 4QC2A 4R3UC 3D4NA 3MCAA 3WMWA 4YP1A 4OHOA 2ATEA 2XWPA 2EOAA 1XTJA 4HDAA 2IIQA 1JAIA 3EQ6A 3AP1A 4BQPA 5BR7A 1RBQA 4OD0A 5LNK1 3RBVA 3FPKA 4MHTA 3O90A 1YBVA 2VT2A 3ZZ0A 2PNJA 1LPSA 4XX0A 4WKCA 5IDQA 1OFVA 3AVXA 3IDQA 3Q3VA 3NKLA 3Q7PA 1XCPA 3KAPA 4HADA 2B3DA 4D74A 3SWWA 5B3JC 2D0DA 2PT7A 4FMDB 1H0KA 1X7ZA 3GA0A 4TLBA 3MAAC 2FPLA 4KXYA 1UUFA 5D5PA 4BB5A 3WGKA 2H1RA 1HETA 4DEVA 2NUTB 3FWHA 3I1YA 4OB6A 1CDOA 4IIUA 2HPHA 4BN0A 3T3NA 2DGDA 3GNTA 4DUPA 3GLVA 2HZ7A 3MINA 3ROPA 4RA6B 1QGUB 4QM7A 1SURA 1Y6FA 2KHZA 4MI6A 3DXZA 2B9VA 2CE7A 4WV3A 4H0CA 1VZ2A 1QONA 4UUPA 2RGRA 4BP9A 2CLIB 4RUKA 3EIXA 5JRJA 4FDUA 2UXCB 5KTRA 1FFYA 3QIVA 1E9VA 2OBFA 3LKDA 3KB2A 3VQTA 2JLYA 3VUEA 2X8JA 1PTKA 1FEZA 4MB0A 5IDYA 3G1UA 1RMTA 1RAAA 3PIDA 3RVQA 2XOXA 1BS1A 3D8HA 4EKIA 1H1LA 1G8FA 4G1VA 4EI9A 4UUQA 3U13A 3ZY6A 3V4PB 3H5OA 4UFPA 1YRWA 4OP3A 2RI0A 2ZE6A 1OW3B 4ND5A 3U3MA 4C4YA 3KTAB 5KOIA 4K9SA 1EIZA 1NVWQ 5JWOA 3THWB 2N9UA 1D1SA 2B1IA 5D86A 2VRCA 1JFLA 1KIFA 2YINC 2ALJA 1F4PA 4QUHA 1B0UA 3BMCA 3MM4A 5CDGA 5EHXA 5F7OA 1UT5A 5FL7A 2BSQA 3G88A 2XRYA 4IVQA 3PCRB 4L5JA 4OHVA 2D7JA 3F6BX 2FRDC 4PPFA 3DE4X 5CA0A 1I2ZA 2LRHA 1XPOA 3DTVB 2GYVA 3QVLA 3D8TA 4XPIB 1PLJA 1Z2DA 4FX5A 3LWDA 1OVMA 2A1TR 4KWEA 1C4XA 4WOPA 3JQRA 4KO2S 2BKLA 3TEFA 1FS4A 1RPJA 1X7HA 4GSLA 5D87A 5DNEA 4CTNA 2IXBA 1TECE 1PBNA 3KWFA 4G5XA 5EZSA 4IGKA 4BV9A 2CXRA 1TM7E 4CKEA 4HC4A 3LLCA 4QQRA 3KKZA 2IJGX 4YAJA 1W9MA 3HABA 2GXSA 3FTPA 3N1UA 5J5AA 1YZQA 3OEYA 2XVMA 3RV4A 3HKBA 1V25A 5DO9A 5C80A 4D46A 3DC2A 3ELWA 2FR0A 5JAUA 1AXGA 4CODB 3H86A 3HL4A 3VJRA 1WDLA 1G3MA 1GLNA 2IZ0A 3DZCA 1ESDA 1E7WA 2H1FA 2E1RA 3LDAA 3NM4A 3T0FA 3KSUA 5E6RB 4HFNA 4I5EA 5A3VA 5U1PA 4LS3A 2E4VA 2R4QA 4HMQA 2AG0A 2RHGB 3N05A 2AQ8A 5K4GA 1UDXA 1Y33E 3D43A 3DGFC 4CR6A 4KJZA 2HX1A 2ODTX 3TR6A 3E9ZA 4QRDA 1L8XA 3GDGA 3ND9A 1HV8A 4RXTA 4TYNA 2KLHA 2HCBA 3QU9A 4QU8A 1TO6A 1TFRA 4I55F 4YMHA 1W5EA 1CJKC 4OBBA 1L7AA 3A11A 5E9WA 1NOIA 1IOVA 1KI3A 1R6UA 3BHIA 4IYJA 1ECBA 5AI8A 5E95A 5EQFA 3CRVA 2XXAA 5JZMA 4WGGA 5AOCA 1AQIA 3F5DA 5F7JA 1YB7A 3GGGA 4BJHB 4RTLA 1T1IA 2FZ5A 1AA6A 5F98A 4WN3A 1I2MA 5TGTA 1DDIA 4XFJA 3UZUA 4H4CA 4CLOB 5IFLA 2H7CA 4E2YA 4J0EA 3NKFA 2P8SA 4H3VA 4PTYA 4M7OA 5E4JA 4IOMA 1IBMB 5JEEA 3LQRA 3CX4A 4OSEA 3S1AA 5DSTA 5HJ2A 4YRKA 3MA0A 4EA9A 4AX4A 1TQ6A 4M8KA 3B3FA 4OYHA 2IUFA 2NT4A 2BD0A 1MX1A 3A28A 2WIJA 3B6IA 4MK4A 2XCIA 4LWPA 2UUOA 1EJ0A 1Z2EA 4Z9XA 3B52X 1I01A 3NOVA 2IV2X 2ZJZA 1TB4A 2UUPA 3EZ7A 5H02A 1ORRA 3UK0A 4KKVA 4C7JA 1VECA 5I01A 4HI0E 5GTDA 3PF8A 4HF7A 1NJGA 4WDRA 3IOEA 1ZW6A 3TE6A 2CXTA 1JU4A 3PG5A 1UCFA 1G0OA 1T5TA 1VHDA 3B8EA 1YCGA 3T7IA 5KCMA 1A4XA 4EG5A 1A72A 3IKVA 4PX2A 3RHZA 1JB1A 4AJHA 2D2FA 4BFYA 3NIBA 5FPTA 4GXNA 5I9BA 1E59A 1UQRA 3HBJA 4WNYA 1J5XA 2WK1A 1NP3A 3QPWA 3HP7A 3S2GA 3V1KA 5JZSA 1TADA 2PXAA 1PT5A 4QG7A 4NMHA 1TPZA 2I65A 3HFRA 4B7UA 5JJCA 1XYGA 2H7VA 3GN1A 4M9XA 1XA4A 3U37A 2BKUA 4MVCA 3U0BA 1K7SN 1Z47A 3Q2OA 2OCAA 2GA9A 5E7MA 5JARA 3SZMA 1O3YA 3A4IA 2FZWA 3NS7A 3GFTA 4XQCA 1QRAA 4FR0A 5C53B 4BTLA 1CUWA 2NADA 4FOOA 2E5LB 1L5ZA 3K8QA 3LL7A 1N1MA 2Z43A 2HNBA 1U8FO 221PA 3JQAA 1ADJA 1YQEA 1GPUA 3JARB 3JVUA 4WASA 4AY3A 4M21A 1RI2A 1SKAA 4AN0A 1A7KA 3DOFA 3UMJA 1ISFA 1XRSB 2DPHA 4QXMA 4BMPB 3UB2A 4E2ZA 1E58A 5CX4A 1SBQA 3H9CA 4Q1EA 3L6EA 2C84A 3KDAA 4CMIA 2IQ5A 2J0QA 4IH9A 4HLNA 3K53A 5EJ8A 4WW0A 4OAQA 4KREA 6LDHA 2QI9F 1XX6A 4KV9A 3KYBA 3EXFA 1E8MA 2XITA 4OXNA 1EWQA 1MIOA 1D07A 4PSKA 3W2HA 1M7BA 3D6FA 4L0MA 4NATA 4AUNA 4YRMA 4DLUA 4KVAA 1W5AA 2H4YA 3C24A 2GCIA 2FZEA 2X8AA 4FYJA 1JSLA 2R65A 2JGDA 1P7CA 3IXLA 4Y1RA 3ZJ4A 4YRSA 2I3AA 1D2RA 3CVJA 4FEGA 5KWSA 2VO1A 3DWFA 1G5IA 3L93A 2GF2A 2PGOA 3RYHB 4FMBB 5C31A 5KTTA 4AECA 3AGQA 4G4SP 2O2YA 1N9GB 3VX3A 1X7WA 4YRJA 1FP7A 3W8EA 3KHUA 1S2LA 3AKYA 2AFIB 4RQTA 4TQUS 2AW5A 3R74A 1T9GS 2TMYA 3FPBA 2QTVA 5TEVA 3UJPA 5LKRA 5KSYA 2B7LA 1E4EA 5A9TA 1V1MA 3FLEA 4EWLA 1SU7A 1VG0B 2XQKA 4YCBA 4KX5A 1KO7A 3AF1A 3NGLA 2J09A 4DPKA 4GO1A 4L0DA 4GLLA 1CLEA 4ZEWA 2O3QA 2I22A 3U9LA 2Q3EA 4F4DA 2M9MA 4HDRA 2O1EA 3UMCA 4MIKA 4B81A 3ISJA 1EXVA 1WSWA 4NBWA 3R0XA 1Z4OA 3C7CB 4G1BA 3RFVA 2Q0XA 3A1DA 1NM5A 4B3FX 1MX5A 3ADCA 4ZU6X 3B8HA 2JC3A 2QOEA 3NHZA 4M53A 4OHPA 3KEGA 1J0EA 3OH8A 4BNXA 1UJ4A 3GCZA 2D4AA 5C5IA 3PLNA 5HSGA 1OKKD 3Q9SA 5IBQA 1GGHA 2H0QA 4QXPA 3UFBA 4X91A 4NZNA 1B6TA 3C85A 2Z5VA 3MMXA 4I4TF 2CSXA 4D25A 2XI4A 5THQA 2QG6A 2XDWA 1X80A 5BSVA 1H9CA 1P1IA 1WCYA 3UOAB 4AZ0A 3DTVD 4KIFA 1NRXA 3IOCA 2CDRA 4FI3F 4IDHA 1OU4A 1Y6JA 2C78A 4TLMB 2EJWA 3K1TA 1A1SA 5EKSA 1RXCA 3O73A 3B48A 2ZPUA 3P9CA 3EGCA 3ZTWA 2BHNA 5BMVB 4HX5A 1ISJA 1KI2A 1N3YA 1WCWA 1YO6A 2JJ1A 1XYVA 1WB4A 1KVSA 3BBLA 2P62A 3HY4A 1KE1A 1WXXA 1BHSA 1GQRA 3DYVA 4MQ4A 3X1WA 4Z7JA 3QU7A 1RPZA 3N76A 3HB1A 1XR3A 5AQEA 4EFMA 3DGEC 1O95C 3NATA 5G3YA 3UCXA 2CCGA 5BQFA 1XXHB 5J40A 1AK2A 1Q21A 2P5TB 4JJZA 4XSVA 1H23A 4C21A 2GHIA 3EEYA 4CR8A 1JJFA 3KBBA 1RWMA 2IZZA 1ZG3A 2VHEA 3TNDA 4ZOCA 1PEDA 2GVZC 3O31A 4JT2A 3WQRA 4XDYA 1WVIA 4WK2B 4YWHA 5KNCA 1M1YB 4UE2A 1U2GA 2CT8A 3EY4A 4PY2A 1FUKA 3GARA 4L5CA 4DANA 5LUBA 5CRIA 1LI7A 3DDZX 1V45E 1NBMA 2NPOA 2P9BA 3T61A 3TRFA 2HM7A 2XCQA 2I8LA 3LQ4A 1E61A 4RL4A 2IOHA 1R64A 3AUJB 4R3NA 1JWBB 3SYMA 2J5BA 1UMDA 4MGEA 1MOPA 1PZXA 4KZKA 1T8WA 1EG7A 2PMEA 3GEIA 2BBTA 4HGQA 3PXUA 4RCZA 1WW2A 4B83A 2Y0PA 5IASA 1E6LA 1RLUA 4JJKA 3VYWA 3WAGA 1M2OB 4UAUA 13PKA 4GEKA 4NY1A 1PWEA 2WVGA 4DR5B 4NXNB 2PMKA 3OZRA 4ZOLA 4WPGA 1MORA 1NBEA 3AU8A 2Z9DA 3EPRA 3QPCA 3WBKA 1VBNA 3GAAA 5AHRA 5HZHA 1C1DB 1NNLA 5CLJA 1AZSC 3RADC 1YOBA 2E1PA 4A0FA 2BFPA 5KJEA 1CIVA 4BO4A 4CG1A 5CITA 1H4VB 2HY7A 4ER6A 1V11B 1TT5A 2DTXA 2FRDA 1BN7A 2F7SA 2FGKA 1T2VA 1UWCA 2V8OA 4XH9B 5BXQC 4DXAA 3IAS6 5L51A 3PYXA 3B6JA 2EDAA 5EXTA 3T1VA 5CB0A 2Z9CA 2SBTA 2X4LA 5KYXB 1EWTA 4UM9B 4F2HA 5JMWA 5U9CA 2VH2A 1KGDA 1TFUA 3QENA 1XCGB 1SEPA 2CV0A 1Y63A 3MLAA 3R6DA 2I4MA 2QSZA 5LQJA 1VE6A 3ZCUA 3QVSA 1VGQA 2C29D 1FTYA 1HOTA 4JVSB 4M0MA 2O0HA 2WI8A 4FYXA 4B8WA 5FOQA 1AKNA 1FTWA 4P53A 4R8SA 4UM7A 3VBEA 3BOSA 1QQBA 4GQIA 2DM6A 2P4QA 2WUGA 3BJEA 3I42A 3I6MA 2CVOA 2JJ8A 1TEVA 2LZ0A 1SHJA 3HU1A 4H6VA 1U0GA 5FBQB 2D2VA 3PUJA 1U28C 1Z5OA 4I9HA 5I47A 1QG0A 1OTYA 1ZU5A 2VQSA 3PNYA 2QRVB 3PEVA 1WZUA 1VJRA 2F48A 3CKKA 1EINA 2EP7A 3O4VA 1G3IA 3AILA 4ZV4A 1SUWA 1YUMA 1KOLA 3UWDA 2PKQO 3NTLA 3TXAA 4TX1A 3IUEA 5KSPA 4Z5XA 3ES9A 1RAEA 1S7GA 2MYTA 2O7QA 3GRCA 3PVZA 4GP6A 1SUBA 2O8CB 2O8DB 1Q0QA 3RC2A 3HB9A 2AKAB 3THXA 1H8ED 1PFQA 4EELA 2DWOA 2EIHA 1ZMRA 1TQ2A 2QNIA 2VOJA 5LDGA 3RJZA 9ATCA 1WUYA 3E9RA 3O8QA 4IO0A 4DIMA 1T4GA 2EKLA 3GLHB 3RJ5A 4FCWA 3M2PA 4EPVA 3JQGB 5IWCA 1NVKA 1L4UA 3GD5A 4DXDA 2YYYA 3HLKA 4HD8A 1QNLA 3BC1A 3NUQA 5AOVA 2C20A 2G7MC 1TEZA 1YA8A 3C3DA 4J0QA 4YJHA 5AXAA 4ENUA 1MVLA 2FPPB 4R7GA 1E2QA 1NSFA 2Q2WA 2G17A 3LX6A 3UH1A 1ESCA 1GZ7A 5C8XA 2XB4A 3NFYA 4URHA 1C3JA 4HAUA 5ECWA 4YCSA 5AHWA 4RCYA 4H9GA 4OHYA 5KJFA 3L0PA 4IS3A 3C5EA 1JXQA 4AF6A 4H7DA 1UM9B 2SNIE 3GMDA 1ST2A 1INLA 3F6EX 3ESYA 4Y6PA 3WISA 3BFVA 3ZIDA 4AWXA 4QELA 1U0TA 3HRKA 3MOGA 5DM0A 3RT7A 2R8YA 2XWJI 1U2TA 2C2OA 1RBMA 4DNQA 4FB4A 4YUZA 4D9FA 5K2MA 3DHYA 3BB4A 3WRXC 2GEJA 2BFBA 3S2FA 2O05A 2IELA 4AU1A 3MD9A 3DKRA 4LHVA 4C0WA 4WI1A 4LN1A 4R3WA 4ZK2A 3D3WB 4MDEA 1ONOA 1JLLB 2EP5A 2PX3A 1NX9A 1QPZA 4KGDA 5F64A 3RYFA 3O3CA 2ZTMA 5TMPA 4GBGA 1I5RA 1JLRA 3STHA 1ZA1A 4ARBA 2GF9A 3NYWA 5MF6A 2QN8A 3GGJA 4KWHA 3W06A 3QMMA 4FOLA 4MKGA 1PLKA 4R2LA 5ES4B 3AVOA 2UVDA 3QTBA 4II2A 2PQ2A 3B60A 4OB7A 3A4TA 5KSOA 2YQ5A 3ZI7A 3ZNOA 3CW2A 4HZUB 2FH5B 4KUEA 4HNSA 3IGFA 4W8HA 5EJEA 8LDHA 2D3TA 1M6VB 3GGCA 4MGHA 4BVBA 4X90A 2PA0A 1ISSA 1V35A 2O3TA 4BB0A 2JIMA 2DH5A 4O33A 3O3NB 4OU5A 4EJSC 3HJFA 1RJWA 4HH4A 1N6LA 4FCTA 2C0PA 5FA8A 3NYRA 4FM9A 3CKYA 3HZHA 1ZCAA 1QANA 1WUTA 4G1EB 1E7RA 3ZEIA 5BWOA 4X65B 5JD3A 3BXOA 2NOAA 3VOBA 2VNJA 4EZIA 4KDFA 2G9UA 2DT5A 4XQEA 1JEYA 1WZIA 2NZJA 1DEKA 2F4VB 2Y4NA 4F9EA 3G02A 1FDSA 3JTMA 3NVMB 2NO1A 4TXHA 3TW0A 3WGQA 4JFAA 1OLXA 1UAGA 3JWJA 4ZCQA 2DFDA 1EUYA 4QULA 3IO5A 4QUEA 2ODAA 4FFSA 1H65A 1C9NA 2OCGA 2QZZA 2Y1KA 3CO0S 1RXVA 3CZ9A 3PTZA 4X63A 4X6XA 2XB9A 4CIVA 4CTKA 3G5AA 4AG6A 4K6CA 5IT4A 1FMJA 2NU7B 1Z06A 1ZL0A 3Q3JB 3I64A 2AC7A 4Q47A 3MFYA 3WTBA 3DE5X 2EF1A 1ZD2P 1X8KA 4NAHA 1XP5A 5C9ZA 5LDHA 1P4JA 2QENA 4QYIB 1US8B 2B5WA 2EL7A 1JKXA 3OO1A 4JI1B 3HCRA 5JNUA 2UVQA 4KCGA 3A1VA 3IUNA 3L5KA 3ST7A 2C95A 3HQ4O 1H2AS 1QGAA 1XJQA 3DYBA 7MHTA 4U7WA 1JV2B 3B9RA 4X66B 2W2QA 4OYLA 1B43A 1M2FA 3FUWA 1HYHA 5E2IA 1PWXA 4L4SA 3R0QA 3G2MA 3N8KA 2J87A 5DDIP 1UBJS 4EY8A 3DC7A 2AA3A 2GJ8A 3ND8A 1ZNYA 2IHKA 1KI7A 3BRSA 3SHVA 1AKMA 1NWHA 1SBHA 1UFVA 2G0NA 2O3RA 3GPCA 1AY0A 2V6MA 1Y1PA 2BZSA 1T5HX 4GMDA 4URVR 1NULA 2J4CA 1Z6PA 3U39A 1T3SA 1QYVA 2EP8A 4B44A 4YJ3B 2ANBA 3AV0B 3SLGA 3KJNA 2BJHA 5K0JA 4DC1A 2DPLA 2MMGA 1AU9A 1P0MA 2OV1A 5CT6A 1QIDA 3SVZA 2O4CA 3T7AA 3T3PB 2QU8A 1MB9A 2XTMA 1QZXA 1BX1A 1ZZGA 1JIQA 2AOVA 3EBPA 1O87A 2D1RA 3MPUA 4MPPA 2QRUA 4PANA 4RD2A 1E3TA 4FUTA 2IYOA 3VVBA 5CFLA 4LF6B 1D03A 1PGNA 4KC0A 2XZDA 3FFTA 1SUDA 1NF8A 2BBWA 4HPWA 2HKIA 1MNAA 2ZUCA 1TTHA 3I12A 3NB0A 1LBEA 4Y9UA 3ZIAD 3VZBA 1LD3A 3FZQA 3SOPA 2AOWA 2W98A 4L95C 2ZYSA 2QVCA 3TRDA 3WGOA 3BFPA 3TI9A 3R7NA 5A3RA 1PVDA 3DZJA 3S0JA 4KACA 2HBRA 1U6KA 2Q9UA 3MJCA 3R41A 5SY4A 1G18A 4R69A 5REQB 3RBXA 1TXGA 3P96A 4CQLA 5IDXA 1Y8RB 3SIWA 3WGTA 3FHCB 4Z7QB 1E9DA 4R1TA 3NP9A 4J90A 4RTKA 2VQFB 5LIPA 3L8CA 3RSFA 3TWOA 1KWGA 1Y9EA 2V7GA 4II7A 2WYIA 1LUAA 4G5YA 5EINA 9MHTA 1W94A 4EZEA 5DCWA 4E46A 3BEDA 1GQ2A 1XTZA 5CBPA 1WCV1 2OZLA 2HSWA 2XA2A 3T3GA 3IPYA 3KUUA 5BSKA 4O4IF 5B6JA 4UASA 3IJ5A 1Q44A 1ZRMA 5HJ7A 5EWLB 2IIPA 4I9UA 5IN4A 5IZ4A 2VZ0A 2O59A 4ZANA 3ICEA 4CZ2A 2WJ3A 4XA8A 1GN8A 3PFGA 5I3ZA 3R76A 3EEOA 4MYTA 2AD1A 3JWIA 2ACEA 1PK9A 3OLVA 4MYHA 4BASA 4B6OA 5H0IA 2X9LA 1NXOA 1ZMTA 2B34A 1VSQA 3NEJA 1QHSA 1RYHA 2G63A 2VG8A 3RQSA 4JOBA 3ZXUB 2BZ1A 3QLJA 1RQXA 2XWQA 3GA7A 1A76A 1CZKA 3ZLJA 1EYZA 5BW5A 2OLJA 2Q62A 3N8GA 3O1IC 1NVGA 3PNLA 4O2AA 3PX7A 4ZCLA 1ZH4A 1P31A 3MLEA 4JEUA 5HS4A 2DHEA 2GBGA 1VCNA 2ECOA 2CLHB 5A0FA 2J41A 4Y2VA 4QLBA 3AWDA 4LMBA 2IZ1A 1GQOA 2CYBA 2W6ZA 4LEIA 4C6TB 4MVJE 1ZM4A 3DULA 1N77A 2IOFA 1CEQA 4Y2PA 4CV0A 1P1FA 3KB6A 3DB2A 4G9EA 3DDWA 3KDPA 4EPWA 1EUZA 3MGAA 1SG6A 3AKEA 3I76A 5JFOA 1RI1A 2IHNA 3NDPA 3MRVA 3N5KA 2MYPA 1Q0ZA 5KWEA 1U4SA 3KYJB 1HDCA 4MVWA 2PSEA 2XMBA 2AS0A 2QIPA 4NZZA 4DV5B 3EQ7A 1U28A 2ZTVA 4WFKA 2ST1A 2JDID 1U6JA 3GYBA 2PBLA 2O2JA 3EC1A 1RKXA 1BU5A 3KU1A 4GE3A 3VAAA 4M1ZA 4XUEA 4LRUA 3ZE0B 4O2RA 1KSJA 1NMQA 3C8HA 1G20A 3NO4A 4GPTA 3HRHA 4ZPJA 2IWHA 2JAXA 1X7ZB 1SOWA 2J3MA 4R8RA 1M2NA 1FDIA 3RJTA 1XV5A 3N59A 2C5AA 1N2JA 1KDPA 4G23A 2DWUA 2O3JA 3N58A 1EK1A 1OZAA 3HJTA 3MINB 1GDHA 2FWRA 2XUAA 3CXUA 3DDOA 3SSAA 5LQCA 1QPGA 1RWPA 3NM5A 1Z8HA 1NIPA 4D0GA 2EJUA 1I7NA 2VDWA 1CY1A 4B7ZA 1C2YA 3AUTA 1I9GA 1SXIA 4QATA 2FW6A 4DXHA 3DMFA 1CK4A 1LGYA 1EHYA 1E79D 2X8JB 3MILA 5EHNA 1Z4QA 1N2BA 1N5DA 1JI0A 1U7ZA 2RMKA 2XHZA 4KNVA 4KQ9A 2GCNA 4Y6OA 5ALLA 4PX9A 1DIRA 1H1LB 3UQYS 1LZKA 2CFIA 4OYYA 4X8OA 3B20A 5A3QA 4PHTA 5FWAA 1J42A 4PPGA 3SSNA 1SR8A 3SYKA 1MZVA 2GCGA 5B6PA 1A9QA 2Q2OA 2XNHA 4ZYWA 2EWVA 3DWEX 1DGQA 2G9NA 1HE5A 1Z9BA 1JPJA 2APJA 2W37A 3R5KA 4AD8A 5BUZA 2FG5A 1VP9A 4QWWA 1MIHA 3OE5A 5LYYA 1P61B 2XNKA 4BFTA 4LCJA 1XF9A 3B5EA 2V1XA 3ESRA 521PA 1QKKA 3RT9A 1QHFA 1DUVG 3NRJA 3PFFA 2ZT6A 1Y82A 3AGPA 4TKVA 1C9MA 2KBFA 4R1MA 4TV9B 5EJFA 4BMCA 4DNOA 1MAVA 1WPRA 4RHXA 5CA0B 3DZDA 4Q15A 3OD5A 3AF3A 3BORA 1L3BA 1ZC3A 2ODPA 2O7RA 1GZ4A 1I1OA 4YMWA 1HFWA 121PA 1AA9A 3VO8A 2IXFA 4ESVA 1I14A 2VYVD 1U2DC 3AVPA 3E1SA 4I4NA 4PZCA 4WWHA 1WB6A 4D1YA 5EE0A 4CKEB 1QUEA 4UCXA 1CFJA 2PZLA 2RGEA 3RR2A 3K0BA 3EG9A 1ADYA 4IEIA 1GCGA 4IDEA 1BA2A 2XTNA 4MRPA 4OHBA 3QKUA 1BDBA 1L4BA 2WZQA 3HKBB 1Y8CA 3D2AA 5EUMA 2IP2A 3S70A 3I3OA 3WDKA 3ANSA 4JI0B 3B13B 3E9EA 3FVVA 1KEPA 4JR2A 4BTEA 2GUGA 3CUWA 2IHUA 3BAFA 1M6YA 4EKYA 1H6CA 4PG5A 2BGTA 4OSOA 4D2IA 4IHAA 4LWQA 4QVKA 4G67A 1YBMA 1XFAA 1KJ9A 1RLOA 2XTAA 3HDGA 4I0WB 1IHDA 1KYZA 1ZA2A 4JB3A 3T95A 2PKCA 3VO2A 3VPFA 4A6EA 2YHAA 2YL2A 4C76A 3IJEB 1BXRA 1ZM3A 3HI6A 3V6MA 1D6JA 1RMYA 2CMFA 3IBYA 3WNDA 1OI2A 2PX8A 3BZWA 2DPMA 3LGAA 4FLFA 4O4LB 1Y80A 2EZ8A 2SECE 3C7KA 4PRYA 5HDQA 4AN1A 2RAFA 5CH8A 1HMPA 4I5DA 2VBFA 3RGWS 1PTJA 3VVCA 4BTVA 2Y76A 4Y2SA 1J8MF 4S1PA 4EJFA 5CFRA 3SMQA 2XXAB 3UN1A 1OGJA 5F3RA 4FNOA 4IXMA 4JUIA 3GNQA 1BS2A 3TBKA 3HM9A 1Q1NA 1ES9A 1ISPA 4RD6A 1XJ5A 2AR7A 5FNZA 2I7XA 3DMNA 3ENQA 1B0PA 2HA6A 5EC8A 3WMEA 2CVHA 4PSUA 1SHZA 1BCRA 1PE0A 1NW5A 2CLSA 3FPJA 3K9LA 2YMPA 5HUHA 1TD1A 1Y7PA 3CPJB 2KSQA 3S1AB 3R3JA 4CG3A 1RHUA 3NHBA 4HNQA 3AV3A 3G3EA 3AYZB 5IULC 2LDXA 3I5AA 3OQ1A 1G8GA 1J2YA 3G7NA 3PYMA 5JOQA 1CR4A 4M7RA 4BNTA 3RFUA 4QUDA 4BNDA 4D43A 4G25A 1VIAA 3IXMA 1NMSA 4X7RA 3K70B 2INGX 2BHTA 3V33A 2JPDA 5L40A 3GLGA 3G2PA 3T52A 5KNBH 2A1TS 1Y5IA 1SOUA 1IXKA 1ZYUA 4E2FA 2XMZA 2G0AA 4K9DA 1MNQA 1DS6A 4KHZA 2LBPA 1BMTA 2XKAA 4C2AA 4M0EA 3FFBA 4IIDA 4R5HA 1IAQA 2WTXA 3PUZA 5KNBA 1J9EA 3LUGA 3F3SA 1ESNA 1GSHA 2AC4A 5KB3A 1DADA 4F9TA 1CY0A 2BYTA 3O4JA 2ZJ0A 5KNDH 3A2LA 5DNYB 1NBHA 3GLIA 4C3UA 2OZVA 5A0VA 3PDJA 3GVPA 5KHOC 4DMGA 4RJ2A 1QB7A 2TMDA 5DM70 4K2HA 5FQNA 1Y0BA 4HEJA 3HZZA 1PZFA 3KIPA 3RS3A 5DIFA 2XB8A 3EPPA 3JQAB 2GASA 4WBSA 4IF6A 3F74A 1CRWG 1PJRA 3KP1A 3VC1A 3FLMA 3BXFA 4J6FA 1BHO1 3OSUA 2YS6A 3FRHA 2CXPA 2I2WA 1DBQA 3PE6A 2F3TA 2HCJB 3I05A 4JBGA 4FHDA 2LP4Y 2MYNA 1X1EA 2QN6A 1SWVA 1CUUA 3R3HA 5HQJA 1GYPA 1R88A 5J2UB 1T4CA 1Q3TA 1P45A 2ONZA 3KHKA 3T7CA 4GS5A 3SR4A 4PPQA 2LGJA 3PQDA 4LJ6A 4RMNA 3TN7A 3UPUA 1KEUA 1JFSA 3FUUA 4O2BF 2OG1A 3A2NA 3E8MA 1E5XA 2Q29A 2VWHA 2RK3A 1VSBA 4Y1RB 3RVBA 1AS2A 1GPWB 3VR3A 3H65A 5HRAA 4Y1FA 4LJAA 5IWAB 2QYHA 3EXG2 3W78A 1PZMA 2OGSA 3H8JA 3VR4D 4HAXA 4AUEA 3TEMA 4KWCA 5IXJA 1OFGA 2O23A 3QYJA 1X7WB 2VDKB 2A58A 3C5WP 5ALQA 5FCDA 3R7AA 3C1UA 4BDTA 4UUNA 1MG5A 2QTVB 1U0LA 1YQDA 5FUXA 1E7QA 2VPZA 3G0IA 1V1MB 3JQ7A 5K0ZA 2E89A 1PQUA 1DJMA 2LCFA 1EE9A 1ZITA 3HCCA 1PZNA 3JWHA 3QVWA 4KQKA 2HLHA 2DY1A 4B6PA 4YY3B 2ORWA 1FVOA 2A78A 1J2EA 3G5TA 2CL0X 5DX0A 4HDRB 3EMKA 4MV3A 3GJ7A 2IV3A 3QX8A 4HXEB 3HNPA 1RJGA 3ORRA 1HE4A 3QEMA 2DAPA 5K0TA 4JI7B 3UPDA 4GP7A 3L18A 1ORWA 3A6KA 5T6BA 4BDSA 4RMIA 1JQKA 2VRCD 3U09A 3VM6A 2OUKA 1CQIA 1E89A 1E98A 1NC1A 3IHKA 3OM0A 5KHLB 4OP1A 1WMAA 2BFEB 2PWZA 1RLMA 1XYYA 4Z0HO 4YCCA 5BVHA 1WBBA 4EG8A 1N5KA 5C32A 1BGXT 1BTOA 5DTQA 5CT4A 3WKEA 2QUKA 3C6ZA 4KPFC 2IVZA 2VPYA 4GWKA 4AZ0B 3AP3A 4EHLA 2ZSEA 1OYYA 4DIEA 4WZBB 1Y6RA 1A88A 4X71A 2RARA 2YZ7A 3NHWA 4H31A 4I3GA 3O94A 4IIHA 2BSXA 3WHIA 1EE1A 1PIWA 4RS4A 5HMMA 3V42A 4XUDA 1DO0A 3FA2A 5B1IA 4YMGA 3A1SA 2IP4A 3SZLA 1FRNA 1PKEA 1BZYA 1GPBA 1XQ6A 1IONA 2JAOA 2VTKA 2ZIGA 3OZFA 4BLRA 1B14A 1QVAA 3NP7A 2YXBA 1OCEA 4EJ0A 5BV2P 2Y1XA 1FRZA 5BOVA 4CUKA 2GWRA 4JLNA 4RMHA 1Z17A 3PUWA 4AZWA 4EL0A 5JNRA 5CA1F 4BRZA 5CDTA 2ZDQA 5DCYA 4BRSA 1O54A 1KQFA 3C1AA 3KOZA 2AW3A 3DO8A 1OSNA 3FWZA 5JW6A 3NT2A 5JJLA 3R0JA 2VBCA 1TYZA 2GKOA 1YR8A 1FLNA 3FIUA 2WFLA 1YR9A 2Y77A 3IP3A 5EZ6B 1BH2A 4X24A 2ILTA 2YOGA 1P60A 2OHGA 4UNQA 1T10A 2A9VA 3CZQA 3L5OA 2I1VB 2NO0A 4OQ4A 1IOZA 1OYVA 4FD3A 3RRYA 2XVZA 3S68A 3WX0A 4AUMA 3U3JA 4W7IA 1XU4A 1YIDA 3ESZA 4RVCA 1Y7HA 2B4YA 3UMVA 1R0XA 5LBUA 3BCRA 1XELA 2GCOA 3DTTA 1ESZA 3WGLA 2X58A 2IYRA 3ZXYA 4ALMA 3IE1A 2OBYA 1JXMA 2JI8A 2PRIA 3KU4A 4HFJA 1N2OA 4D9EA 2H2HA 3V2IA 3RFFA 2OHJA