3FIUA

Structure of nmn synthetase from francisella tularensis
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
244
structure length
238
Chain Sequence
DFSPKEYSQKLVNWLSDSCMNYPAEGFVIGLSGGIDSAVAASLAVKTGLPTTALILPSDNNQHQDMQDALELIEMLNIEHYTISIQPAYEAFLASTQSFTQLVIKGNAQARLRMMYLYAYAQQYNRIVIGTDNACEWYMGYFTKFGDGAADILPLVNLKKSQVFELGKYLDVPKNILDKAPSAGLWQGQTDEDEMGVTYQEIDDFLDGKQVSAKALERINFWHNRSHHKRKLALTPNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nicotinamide mononucleotide synthetase is the key enzyme for an alternative route of NAD biosynthesis in Francisella tularensis
pubmed doi rcsb
source organism Francisella tularensis subsp. holarctica lvs
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
total genus 85
structure length 238
sequence length 244
chains with identical sequence B, C, D
ec nomenclature ec 6.3.1.5: NAD(+) synthase.
pdb deposition date 2008-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3fiuA00
5DEOA 1I6LA 1EUYA 2VXOA 1J1UA 4ZT7A 1OWLA 4JZYA 1F7VA 3SEQA 1M8PA 4MWEA 4U63A 5LM3A 1JIJA 1NURA 2ZUFA 5J5AA 5EKDA 3ZIUA 1V8FA 5H16A 4WNYA 3DLAA 1NUTA 1QJCA 2YY5A 2OQ2A 1KP2A 3JXEA 3KT6A 3P0IA 1JZSA 2NSYA 1KH3A 1K92A 1WOYA 1Q11A 1O95D 1LI5A 1O95C 1COZA 4ZCSA 5DK4A 3FY4A 1NI5A 4JXXA 3CLUD 2A1TS 2D54A 2A1TR 4R0NA 3UY4A 4NAHA 1NZJA 4PBSA 4CDNA 3Q10A 3ND6A 4ZCPA 4R2LA 2JANA 4I6EA 4PBTA 2QUIA 1PFYA 1IQ0A 4JXZA 3ISJA 2QJFA 2QUJA 1TYDE 3COZA 3RFFA 3NBAA 3RJZA 3TZEA 4HK4A 3PNYA 2E0IA 4DLPA 4FZJA 4JYZA 1OBCA 3IVCA 4XFJA 4F4HA 3CVVA 3ELBA 1VBNA 3H97A 4YP7A 3X1JA 3N2YA 1TFUA 1OWOA 2IELA 3IUBA 4OUDA 2XRYA 2PZAA 4NX2A 1NUQA 1MC1A 2WSIA 1G8FA 1RQGA 3VGJA 2WQ7A 1U3CA 3KT8A 3ND5A 2RD2A 4MUIA 1CT9A 3UC5A 1JEEA 1BS2A 4MWCA 1O97C 3A4IA 3FIUA 4DE5A 1QQTA 2E21A 4YP6A 3X1MA 3AL0C 1J09A 3PXUA 2R5WA 1I6MA 4MQ6A 1GPMA 2CSXA 1WXGA 4ZT4A 3TQIA 1MB2A 1NUUA 1WXHA 1XNHA 2E18A 2PIDA 1JECA 2YWCA 3SEZA 1N75A 1QRUA 4S1OA 3TZLA 4DJAA 1N2IA 1XNJA 1J1ZA 3MUEA 1F9AA 4MW5A 1IHOA 1M8FA 3SYTA 3AG6A 3FETA 3MMXA 4HPWA 1M8KA 3QTTA 4E1AA 1R6UA 3AIIA 1XJQA 1NP7A 4GRIA 2A86A 2WQ6A 3CVXA 4YMIA 1MOPA 4YP5A 1LI7A 1QRTA 3BL5A 3K9WA 3VRHA 1U0BB 5FO1A 1IVSA 3ZUGA 1IRXA 1T6XA 2IP1A 4ARCA 2ZUEA 1T9GS 2QTRA 3A05A 3TNJA 3RK1A 3CLSD 5KHAA 4CT0A 2J4DA 1TYAE 4MUJA 3H9CA 1KKUA 1GLNA 2Z08A 1H1TA 3KFLA 5HG0A 3H9BA 2A1UB 1K4MA 2O5RA 4I6GA 4YBRA 3FNRA 3ZJVA 4KR7A 3H05A 4G5YA 4NZPA 1J21A 5TS2A 1JILA 1EE1A 3IOBA 5LLTA 3IDFA 1KQPA 1IFXA 3SP1A 4MW9A 1JEDA 3CVWA 1WQ3A 3CVUA 1WJGA 1PFWA 2RE8A 3AG5A 3K32A 2VTBA 1YUNA 5BNZA 3L92A 2J08A 1KH2A 5HUJA 4Q16A 1I2DA 1Q19A 5F23A 3IVXA 3CLTD 5TGTA 4RUKA 4MW6A 3CLTC 4EG4A 4TS1A 1N2OA 3QE4A 4ARIA 1O96A 3P0JA 4U7JA 4MUHA 1TEZA 4JFAA 1M1ZA 4HJXA 1WXEA 2BTEA 3SDBA 3UOWA 1PG0A 3M5WA 1GN8A 4QBTA 3RBAA 3A04A 5K0SA 3LOQA 2PFSA 3L93A 2DPLA 4I6JA 3MLAA 4AQ7A 2DLCX 2AKEA 3KT0A 1VL2A 2QTNA 4MW4A 1OWNA 3MXTA 4ZCRA 1T6YA 3FI0A 5IJXA 1JIIA 3UMVA 3RK0A 1QU3A 3PNBA 1M83A 3COVA 1YI8A 1EJ2A 1G8HA 1N2JA 1Q15A 1YIDA 3KT3A 3CVYA 1T9GR 2JAXA 4DDMA 1R6XA 4OJMX 3HGMA 3IOEA 3ZJTA 2A88A 2A1UA 4QRDA 1WXFA 1MAUA 2C5SA 4MWBA 1QNFA 3I05A 1JHDA 2J07A 3HV0A 3GMIA 2AZXA 3NV7A 5J59A 4L2IB 2E89A 1OWMA 2HZ7A 3PRHA 3CLUC 5AHWA 3U1VA 4EG5A 4MW1A 2CV1A 2BYTA 4PY2A 5JBNA 2QJOA 2B7LA 3HFJA 4WSOA 1IQRA 4ZCTA 1ULHA 4KKVA 1EUQA 1EXDA 2A84A 3ND7A 3TQOA 5J58A 5DB4A 1WZ2A 4AS1A 3ZJUA 4R2MA 2ZP1A 2QTMA 2EL7A 1I6KA 3OP1A 1XNGA 5TEWA 3P52A 2CUZA 3CLSC 3QTBA 1ZH0A 3G5AA 1N3LA 1YUMA 1GZUA 2DERA 4QREA 3N8HA 4MVYA 4ND7A 3INNA 4ZT2A 1HYBA 1EFPA 1H3FA 1NYLA 2CYAA 2HGZA 4MUGA 4EG8A 3AKZA 3IOCA 4MVWA 1YULA 4MVCA 1YIAA 5H7XA 1NUSA 3LE8A 3TS1A 5K0TA 4NDAA 1KR2A 1X8XA 4ND6A 4Q93A 1N2HA 4OUDB 1OWPA 2DETA 1H3EA 1U7XA 5FO0A 1TYBE 4EG1A 1NSYA 1PG2A 1ZJWA 1O94D 2CYCA 4MULA 2I1LA 2YXNA 3COYA 1N1DA 4DDHA 3IMEA 1EFVB 1J20A 1LW7A 3D6UA 2GM3A 1Q77A 4MUKA 3C8ZA 2DUMA 2EJCA 4UZEA 1EFVA 1EFPB 1F4LA 4EG7A 1M8JA 3PNVA 1GTSA 2PZBA 5HUHA 4UZFA 1JMVA 1MRZA 4MUNA 4EF6A 4F3RA 3FOCA 1X6VA 4ZT5A 4L2IA 4CDMA 1OBHA 3CA8A 1QU2A 2VTBB 1KORA 4PBRA 1J70A 4EFKA 3CLRC 3HZRA 1S4MA 1KQOA 4GU5A 3LCJA 4A91A 2DXIA 1N78A 1MBZA 4KPUB 3IODA 2OV4A 3ZXSA 1K97A 4X0EA 4KPUA 1UFVA 4KR9A 5LFAA 3Q12A 4EG6A 2QUHA 1OD6A 2GKSA 5TEVA 4MAFA 1O0CA 2X0KA 1R6TA 3OTWA 1N2EA 4RPIA 2J09A 3IVGA 1A8HA 2HMAA 5FNZA 1QRSA 1P7PA 2X3FA 4K03A 3IMGA 3CR8A 3IUEA 1MJHA 3FHJA 4DDKA 3HL4A 2PZ8A 1G8GA 4G6ZA 2X1MA 1T6ZA 2JA2A 2CT8A 3GLVA 4XSVA 3A2KA 3H99A 2GOYA 3Q4GA 3AFHA 3ZGZA 2TS1A 2Z09A 4ZCQA 4H3SA 4ZT3A 1G59A 2Z3VA 1PFUA 2PXHA 4J75A 2G36A 2X1LA 1KQNA 1QTQA 4NAUA 2YWBA 1KAMA 3IMCA 4J76A 1Y42X 3NBKA 3UK2A 3VU8A 5KCMA 1VLHA 1O96B 3P0HA 1F7UA 1U3DA 2PG3A 3X1KA 1N2GA 1JGTA 1O5TA 3SZGA 1FYDA 1U7DA 3IH5A 2V0GA 1IQUA 1D2RA 2H2AA 4MUEA 2CV2A 1K4KA 4G5FA 1MAWA 3RHSA 3CLRD 2D13A 1O0BA 3DPIA 4MUFA 1N2BA 1M8GA 5DASA 1JIKA 3D6VA 2O8VA 1O97D 3SZ3A 3DV2A 2NZ2A 3ZXIA 1WQ4A 4HJRA 1N77A 3COWA 1JZQA 1MB9A 4NATA 1ILEA 2QUKA 1ZH6A 1ZUNA 1WXIA 4ZT6A 1KAQA 4MVXA 2D5BA 4MW2A 2XRZA 2DEUA 4MWDA 3E27A 1PFVA 1SURA 3N05A 1TQ8A 3FG9A 3S3TA 3FH0A 2QJTA 1V47A 4U8HA 1VBKA 4DNXA 1H3NA 3FDXA 1KH1A 2DR2A 1WKBA 4BWVA 3G59A 4MLPA 1VBMA 1GTRA 3HMQA 1IH8A 2V0CA 1FFYA 1NUPA 2A4MA 2CFOA 5IHXA 1O94C 3DO8A 1TYCA 3G6KA 4CQNA 3N9IA 4MW0A 2IJGX 2CYBA 4P2BA 2AG6A 1WY5A 3ILVA 2A7XA 5KWVA 4EGAA 1KP3A 4KR6A 3GUZA 2CV0A 2H29A 2J5BA 3FWKA 1DNPA 4XFDA 3F3MA 3MLBA 2WB2A 4EG3A 4K0RA 4MW7A 1GAXA 1O6BA 1B6TA
chains in the Genus database with same CATH superfamily
2IP4A 5DEOA 5B4TA 3L8FA 2QZSA 1IL0A 1TM7E 1OWLA 1EJ0A 1SVOA 1ONNA 1ISGA 4DV3B 3TEFA 3A4TA 3PJGA 4ZGWA 3ZWNA 4BXOA 4K9PA 1J4AA 3Q9UA 2WYVA 4ZYLA 3I34X 2ZWAA 2OXTA 1YQGA 3LC7O 1JIJA 4OHYA 2FUEA 4E4TA 4BFLA 1NURA 3IAAA 3AYXB 1Z6PA 3FBGA 3H3JA 3L0OA 3U49A 3KXDA 4F1KA 4H31A 5JHHB 1YS9A 1AGPA 4JKOA 4UVDA 3B5IA 3R7NA 1K63A 3X1WA 1XQ1A 4U2GA 2W0MA 3NWPA 1GEEA 1C3OB 3RS4A 1SQSA 4FFLA 2H2GA 4KG7A 4TYQA 3S2IA 1H9CA 2WTEA 3P4XA 2DWPA 2PR7A 4IILA 2WT9A 3PGXA 1WABA 3T4XA 3OCXA 3C87A 3QKSA 4E15A 3M5CA 5JS6A 3U7FB 1O95D 2EDAA 2HJWA 4GQAA 2C2ZA 4E30A 3ROFA 2WUEA 1NI5A 4NE2A 3EIUA 1Z6ZA 2N75A 2XNDA 1A96A 2IGBA 3CX3A 4GVLA 4IIUA 4R0NA 3GA5A 4PYQA 4CKBA 1J22A 3FFWA 3ND6A 3MTDA 1BXKA 2WZCA 4C0XA 3KWLA 5A4IS 1NR1A 1Z4NA 3PPIA 1XMVA 2GBLC 1ID8A 4RABA 4XM2A 1R0WA 2QYOA 3AESB 1DRVA 3M4NA 4JLVA 2R1UA 5HS6A 2HNKA 5CNKA 5F2NA 3K2BA 1G4UR 4HHEA 4XX0A 3KKOA 2FOIA 4TTIA 4ZO7A 2CMGA 4JV5B 3KDSE 1B43A 2WIBA 4EY7A 2Q4EA 2O0MA 4ETIA 3HP7A 1IJFA 1E96A 3H97A 4YP7A 1NNI1 3EFOA 1ABEA 1VPTA 3KWFA 1CY4A 4RTKA 5EERA 1QHFA 2H11A 4JVMA 2OO5C 4KSYA 1P3Y1 1R4ZA 3BD7A 2GCIA 2FE4A 3SXPA 4ZO9A 1OFTA 4ZMBA 5LUAA 4DIFA 2AMVA 2IV2X 1MU0A 2QP3A 4MYTA 3KVNA 1BU8A 3VGJA 1JI0A 5DGDA 3TUIC 1FEZA 1XZLA 2XMCA 5JNUA 5A3SA 2FPIA 2PNFA 4HL6A 4PG6A 4QYXA 2AR7A 2X8WA 4KQEA 4QUHA 4OHKA 4AUEA 1ZR2A 4EAAA 4EL5A 1Z74A 3HCNA 2HU2A 5COQA 3LVRE 4JB2A 2AD5A 1R9NA 2E21A 2F59A 5G0UA 3BFPA 3NTVA 4CUJA 1ACJA 2CJWA 5C8YB 5AO9A 4Z0PA 3DB2A 4J9UE 5BRNA 3UN1A 5CU7A 4IVNA 1T9CA 1OUMA 4B87A 4X95A 3UHFA 3GLFB 2OY0A 1X1AA 1T8YA 3LQKA 3PSHA 2J31A 4BCBA 2HA4A 5IVDA 4B74A 3DE2X 3W5SA 1X9GA 4E31A 2JGJA 3TBHA 4QYIA 1KO1A 1PNTA 2HB6A 3TL2A 1BH2A 1DQRA 1SH7A 4LRWA 4Q66C 2IYYA 2NXCA 4NENB 5DJ5A 5FI3A 3SQDA 2H1FA 4BNLA 3JQAA 5COBA 1PR0A 2BMJA 1IHPA 3BKXA 1S8NA 3IILA 4RIFA 2AZMA 1A4XA 4TRRA 2VSNA 1FDVA 3QLUC 4CQMA 2WOJA 1XX6A 2B8EA 3NC4A 2YZMA 4HAXA 4HOYA 3QEOA 4JBGA 3RYHA 4AJEA 5HF9A 1K0FA 1MHPA 3WLKX 2VSFA 3C1TA 4MKZA 3HJGA 3ON5A 5DLYA 3CCFA 1AZLA 3I2HA 3P71T 4P35A 4MS1A 4FQ8A 4XX0B 4N41A 4MRRA 3SJBA 1IXZA 4UUQA 3RS7A 1QUFA 4XTCS 3G0CA 1GCAA 3EQZA 4GO1A 4HLQB 3F4BA 4RGBA 4FNOA 2FA9A 2HK9A 5F7JA 1GLNA 3T1TA 5CITA 3AVPA 1BHQ1 1TTHA 2P1DA 4FR2A 4H77A 3GJZA 1KDPA 3CG0A 3WHPA 5AWFC 4K6CA 4W9NA 2YHBA 3AEQB 3H9BA 1WE2A 3ZW7A 1FDRA 1JJBA 2GJ4A 2RG1A 1YFKA 3K05A 2BDTA 3WKBA 1XNQB 4FMCB 3Q8XB 5JAUA 2Q3LA 2C7RA 1JILA 3UTCA 1L1EA 2FU5C 1QWSA 1JTEA 4XQ0A 1R0XA 1K1EA 2X3UA 4TWRA 4KH0A 5F9FA 3NEAA 1U5BA 2PXCA 3HQ4O 3F5SA 3CEJA 2GPYA 5HIJA 1I4DD 2QU8A 1B3BA 2WJWA 4G5HA 3Q2IA 2PWAA 4PHTA 3TPFA 4KXQA 5JDIC 3ZJYA 1IG0A 4D9HA 2W98A 1FQJA 4PVDA 3KQWA 4RA9B 5JIBA 3K32A 3OM0A 4F9GA 3CZMA 4WASA 3W5AA 4BZQA 1MJGA 5K8IA 3KL4A 1E6CA 1UBHS 2H08A 3I23A 2RHLA 3L0BA 1AK2A 3QPBA 3KTAB 1HQKA 2RGRA 3NAZA 3NHBA 2FUCA 1NKSA 2VYVA 2Y3IA 3IVXA 3OZBA 4R71A 4ER0A 3D7NA 3AUKA 1GNQA 1H2WA 3QW2A 2GB4A 2JFFA 1LF5A 3HBFA 2CFCA 4KJZA 4R5HA 5AP9A 4O02B 2CW5A 4N7JA 4PZ0A 5L40A 5CXUA 5A4JA 4OLHA 2YY6A 4DAEA 3P97A 2PR2A 2I1VB 1BHO1 1H8ED 1MF7A 2I9PA 2XR1A 1DIGA 3ZCRA 3HCDA 1TA0A 1T5BA 3N8KA 5KOJA 3F9RA 4BNIA 5L8VA 2DECA 4K9RA 4RK7A 1V35A 1D2CA 4R3WA 1A4IA 2JGIA 1FY2A 3EVFA 4JJGA 1PJ4A 1HFKA 1O2DA 2VF7A 4HB4A 3U0VA 3E22B 4OK5A 3PS9A 3O90A 2FEXA 4LY6A 4O2BB 4BTVA 1EXWA 1XF9A 1IZ7A 3WZLA 3DYVA 1OZFA 3GMSA 2IU4A 5EIEA 3IC5A 2Q6VA 3IVRA 4QQNA 3VPHA 4DDTA 3RODA 3RU2A 3H19A 1H1LA 4JI0B 4L0QA 4ZQBA 1FTQA 1RI2A 4ITUA 2FTKE 3KT0A 4AZ3B 2WWIA 4Y2PA 1LPSA 1PV1A 3KAQA 3U1TA 4RPCA 2JLZA 1SBTA 4ZV7A 2KSQA 3A1VA 2D5AA 2YXEA 4D43A 5C37A 3HWX1 5H82A 2TYSB 1RYMA 1KIFA 4RYDA 4UEJA 4LBZA 1N9GA 1SWWA 1WCXA 4PLVA 4MYUA 2YVKA 1Q1QA 4PEVA 5DNVA 4HGYA 2G9VA 5GV7A 1OX4B 1XQXA 2WWHA 4RK6A 2FPOA 3T7IA 2B83A 3CG4A 3WGLA 3V33A 1OVGA 1CHNA 3ULKA 3F2IA 2AJLI 4X1YB 1Q15A 4L8WB 4QOSA 3K0KA 4JGGA 5ALTA 3G2OA 4QYTA 1SCJA 1ADBA 1ZRHA 1Y34E 3T34A 1G6OA 3DYBA 2VDMB 2EFCB 3HGMA 4AQYB 3AP2A 3OAAD 1NBMD 1VG0B 1BKDR 2PS0A 2ZYAA 5TJHA 3WNZA 3MMZA 5ALOA 3MOGA 1A4RA 2G9ZA 5IYZF 3KPJA 5ADUS 2HGSA 3ITEA 4OB7A 2D06A 2ZXFA 3NWEA 1EXVA 4XYLA 1XZFA 2E89A 5GONB 1ENZA 4UTOA 3WO0A 4UUBA 2EZTA 2Y1OA 3EUEA 4GGOA 3U1VA 4AWBA 2QDKA 3GJ6A 3H0EA 4MW1A 4MUXA 1TX4B 2CV1A 2JCSA 1NQXA 1PLLA 3GT3A 5JBNA 4YS6A 2D5IA 3P5SA 1DJMA 3WVNA 4KI7A 1ULZA 3I9V1 2VNJA 5ALSA 5CCXA 5AMXA 3ZI4A 5CB6A 1BX3A 2X40A 3ANXA 1DJNA 1F8YA 1PRYA 3SHWA 2G70A 5ITZB 4A82A 2AH5A 5L4NA 3VO2A 3LUHA 5DGIA 2JCBA 4BNDB 4AS1A 4QAJA 5H81A 9ABPA 4FMBB 2CD9A 4TTAA 2FMTA 1E2GA 4JUFA 1GTJ1 2Q6IA 3I53A 1UZAA 5IBQA 4FQ5A 4S12A 2R6R1 4IIDA 3PD1A 1FUEA 3DAGA 3CLSC 5KVCA 1DMRA 2AJCA 1S7GA 1ZH0A 3GR6A 3HYRA 4GMKA 2JZOA 4P4GA 2OZKA 3U2QA 2GN0A 3V8MA 5BV2P 4PAGA 1CB7A 5B5SA 3VI4B 4LBWA 1XDSA 2BGGA 3Q98A 4DMLA 2JGDA 4Z9AA 1EX1A 1H9BA 2CCJA 4F2DA 3FOAA 2XZLA 2JLUA 4IHJF 4MVWA 3EXEB 3PGMA 4NCHA 1E2MA 5FOXA 5H7XA 4UTRA 4X8HA 3R74A 4CEHA 4PHGA 1G3MA 2HLDA 1I0IA 1X8XA 4OIFA 5DI3B 2AR9A 5JROA 5KINB 5KYGA 2AMJA 1T8UA 1YMUA 3BXZA 4Q9AA 2FQYA 3NJ8A 4Z53A 3TMAA 1DTSA 1NC1A 1LNSA 3AIOA 3ZH2A 3D6AA 3GEMA 4ZODA 2RGDA 1E69A 3FUXA 4D4HA 1V9CA 1GTMA 2Q5HA 3FVTA 1ZOOA 3FDZB 4S2EA 3ETEA 2CYCA 4XR4A 3TJZA 5CFRA 1CUGA 1ETHA 3COYA 4HZIA 3ZV7A 4G65A 3PUKA 1N1DA 4DUZB 2I65A 3WK9A 5A5DA 1G38A 2DPMA 1WLYA 1EGMB 1L0BA 1ZI6A 2JD2A 2VBGA 4PLFA 4QUGA 5LB4A 4W9MC 3QV2A 2O5CA 4WK2B 1CZLA 1M8JA 5LD2B 3WJ7A 3GD7A 4XUCA 2VDLB 1PX2A 4I1SA 3L7IA 1XZCA 3FB1A 3NI2A 4GLLA 3OX4A 1KDVA 3TOVA 2XUGA 2IXBA 2J6IA 4CI9A 3WRWA 4C78A 2PT9A 2BH9A 1JHOA 4Q7LA 5KYTA 3CKLA 1PTKA 4XRGA 1HE5A 2Z4TA 3BSYA 2ZUVA 2QZ9A 3DVSX 4LOHA 1II9A 2IUFA 5IAGA 3DM5A 2ONCA 1NTOA 2WFZA 1B42A 1U0SY 4PTLA 2BEVB 5EP4A 4DCTA 5CCEA 2LBPA 1DB3A 4ZVNA 3VPBA 3DZIA 5SZHB 1NI4B 1PZNA 4ECEA 2R9VA 1INLA 3CZ5A 4S1PA 4QBHA 4HX2A 5DBGA 2WD7A 4X24A 1CUCA 4LGMA 4MLDA 4RQBA 1TIPA 4AUKA 2XUDA 2C4HA 4X71A 1XEAA 2CK3A 4WACA 4HEA1 4BMCA 1XZPA 1B6GA 1U90A 4ZHSA 5HJ5A 2Q5CA 4J7CA 3ZWOA 1SU7A 1JUDA 2OOSA 2WKQA 3KELA 5TQ0A 4LYEA 2DU8A 3SKXA 4L4YA 1K86A 4R2XA 5L3SA 1UPBA 2A94A 3A9WA 5CVCA 3G7NA 4TWJA 1N0UA 1CC1S 1LLDA 1F8GA 5HRUA 1GU1A 2N1MA 2OBLA 5BWCA 1Z5GA 1C2YA 3HBAA 2QX4A 2SCUA 3JW8A 5GM2A 4D4KA 1OHHD 2H0AA 3EZ2A 4N76A 2ENWA 4JLSA 2PX0A 3GLVA 2WYUA 1V39A 2QMZA 3OCUA 1Q0LA 3AFHA 5LMUB 2QR2A 2GJ9A 4JVOA 4HYYA 3DDUA 1QH1A 1KZHA 5IJZA 4B5KA 1DC5A 5FNVB 4KQKA 1CDEA 1TT5B 4NAUA 5DRTA 1RLJA 3UK0A 4HC4A 4ZMRA 5LL6P 1LDNA 5HKKD 4DQDA 1NF3A 1ADYA 2V7QA 1FDTA 1M9NA 4FMDF 3RIHA 3OO1A 2FPLA 2CLHB 3L84A 3G1WA 1JGTA 3UZUA 5HYVA 421PA 2OTCA 2JJ2D 2IUYA 2V0GA 2X76A 2H2AA 4MUEA 3PTZA 3ST7A 3T3OA 1N7JA 2CLLB 4MZDA 2EFDB 4OQMA 1ESDA 4AX8A 4C0AC 1GZ7A 1YR7A 4UEOA 4MHSA 5KJFA 2OG1A 2XOXA 2PRIA 2C4UA 3KOOA 3D6VA 2Y1GA 4QQ8A 4W1RA 5LQCA 1GNPA 3CV3A 1KE1A 4BVKA 2G17A 2B30A 2ZUTA 1N77A 3OQIA 5G40A 3VHXB 4DSZA 4LQ4A 4P1ZA 4P81A 4GDFA 3N8DA 1OB5A 2LWIA 2WYIA 3E8MA 1ZH6A 3ZY3A 1ZUNA 2KS6A 6PFKA 5JSHA 2GESA 2W90A 2V7VA 3NUZA 4G81A 4MYSA 4DV2B 3H5AA 4FNGA 3BK1A 5LD2C 1VECA 3TGPA 1XELA 2CUTA 3E27A 3KQSA 1EGHA 3P2OA 2CZQA 3B3JA 1H8EA 4FP9A 1LDMA 5JD3A 4I81A 2ZJOA 3C6ZA 2DSTA 3BSSA 4DMKA 1VBKA 3P9QA 1P72A 2BFCB 3VKGA 1VXRA 3EUWA 4CHGA 3RVMA 3UJ8A 3STUA 1ZS9A 1TF7A 2VT7A 1D5CA 1VJGA 2E9SA 3NJRA 5L53A 1V6CA 2I5PO 1QP8A 2PV7A 1ZIYA 5CNJA 5CT5A 2HJVA 4L5CA 3NYQA 1QIEA 1JSLA 1YQTA 2QPAA 2G3YA 1T26A 3K2QA 4Q9JA 4BBPA 4QLBA 3QXJA 1WKVA 2FPKA 3EF1A 3VU3A 3RV4A 5E2BA 1PNVA 4Y8VA 3ZWDA 5EPEA 5DNAA 2HPAA 4Q4CA 4BBJA 4LY0A 1R6VA 4BNKA 3BB1A 4Q1FA 1L4KA 2C1EA 3H5WA 3VC7A 3HNRA 4DBZA 1VP3A 1KJ9A 3RF6A 2IWHA 5AVQA 1P39A 3B1WA 1TFRA 4I0WB 1DG3A 1M76A 1DAEA 3RAPR 1G0OA 3OURA 1ZD2P 4NLLA 4XE5A 2F55A 1S2IA 2ZU0C 5IDQA 3FPLA 3WOHA 1J1UA 3LHKA 2DR0A 4KDEA 3B2QA 5CBPA 1QV7A 2X9VA 4JL8A 3Q72A 3S5JA 4EB6A 4B32A 1WMSA 3V7UA 4C7XA 3IXMA 4DEYA 5A02A 3KYBA 2IH2A 2Z4RA 4GBGA 2Z95A 2NOAA 4ENQA 5KYWB 2K6GA 2VSYA 4NZNA 4OAOA 1KDYA 1QAQA 4IDBA 5AJVB 3QOXA 2WBLC 4Y2UA 5DTEA 1FTWA 4FX2A 2YNMA 1CEXA 3KT6A 3F73A 1LEHA 3OD5A 2C7QA 4X5OA 3TECE 1BSVA 1KZGB 2FQQA 4I2VA 3SX0A 3SHFA 3ESRA 1JWBB 1FXUA 3FLEA 2Y2UA 3EF3A 2WHXA 4KQHA 3EDRA 1H22A 3I8OA 5HIIA 1ZAYA 2VPPA 1ENOA 4ZCSA 3BE8A 4X3CA 4Z51A 3A3YA 3WMXA 4ZZIA 4C9BA 4XX1A 4J4HA 2O2YA 3B5EA 2VP6A 4JLKA 5GOTA 3PFIA 5ER9A 4Q6WA 1AURA 3PEYA 3T5CA 3GELA 1L4EA 1MO5A 4IKPA 1DJQA 4L6IA 4CF5A 3HO1A 3VNAA 1IIRA 4QFDA 5U9CA 2EZ4A 3R77A 4IIYA 2WOOA 1H6DA 1NVEA 2XQKA 3TGLA 3VYRB 2GAJA 2NU7B 3COZA 2P5TB 4WLUA 2P40A 4LRTB 4AY3A 1SCAA 3QVJA 3FHOA 1XKTA 3VOAA 1UDXA 3PNYA 1N2SA 4YRBA 3FOBA 5KNDA 2QJRA 1LBTA 2BWJA 1XZQA 3HDTA 4P5PA 2IPLA 3IVCA 4GOXA 4JJ7A 5JTTA 1CUFA 3X1JA 2F43A 1I01A 2VJPA 2BFFA 2XDQA 4EY5A 5LJIA 3OZRA 5KCZA 2QVYX 3AM3A 1YR9A 1IK4A 4LYHA 4UM9B 3RCBA 4YO7A 2XB4A 1NNUA 4NNOA 2C95A 3AO0B 3GT0A 3HVIA 3WLFA 3BMNA 2IYLD 2FEPA 5K3AA 2UXDB 2KYRA 2YZ2A 5FT9A 1M75A 1E1MA 1XYVA 2JKYA 2CNDA 4URXR 1OAOA 1XZBA 1XVUA 4MWCA 3SNHA 3RPEA 2R7AA 4E07A 3MCWA 4US0R 5DM0A 4Q1AA 3AB8A 4E1VA 4PZEA 5HVNA 3EVCA 3LZCA 4EZEA 4BXOB 4IUDS 5H5JA 1W87A 3C8DA 4NZZA 5JXWA 3Q40A 3DKIA 3CR3C 3DB1A 3S99A 1RRGA 1XQWA 2QZPA 4R1UA 1FS5A 2DKOA 1WB6A 1I8TA 5F73A 3ZX4A 4B81A 4ILEA 5LP6B 5T8KC 1P74A 1MIOB 3PT5A 3QQ5A 2AOWA 2XDQB 4FS3A 2L82A 4LE2A 4RAQA 1U2GC 2I4MA 4XGRA 3STXA 3QVLA 4D74A 2FPRA 3SHTA 1P6QA 3FCSB 4G1FA 1C5KA 1Y89A 4KSBA 5AKJA 4GWGA 2IPXA 5C31A 1U7HA 3U31A 5CD9A 1OGIA 3SIRA 5K05A 3W9YA 5KZMB 1HTBA 4I55B 3KR0A 4P3YA 4F06A 1YKGA 1NQVA 2NO5A 4I5DA 4D8XA 2FN4A 2XHZA 4YCAA 3UBTA 3N58A 1TJ3A 2YV2A 3EIXA 2CE7A 4K9KA 4YP5A 3L7YA 5LWQA 5DWQA 1TKAA 3WYCA 4BMVA 4NYJR 4YLGA 4F2HA 2C78A 3QVOA 1V7PC 1V8OA 1XLVA 4TMXA 2GYYA 5BMOA 3INYA 3V4LA 1GCGA 1DFGA 1ZM2A 2JCXA 1WW3A 1Y33E 4YDSA 4ENRA 4MS1B 3ZH9B 4RTNA 3RU7A 3I2KA 1V4BA 5D7NA 5K45A 2XXAA 1QIGA 1GPDG 4PONA 1KY2A 1Z2OX 2LIPA 2R85A 2QG4A 3MELA 3RSSA 4M9SA 4F4UA 5AUPB 1GTG1 2QVZX 3LOUA 4LOIA 4WADA 4GI2A 2PZGA 3K96A 1ECJA 1DI0A 1KYZA 3DTVB 2ZT7A 5TQ2A 1UBTS 1Z5WA 1EGAA 3CRVA 3TQTA 2HIAA 4Z9XA 4G5YA 3NHMA 4K9LA 3GFPA 4NV1A 1AOXA 4RFLA 5L6MB 2GBIA 3IDFA 4HDMB 3KYDA 2FFAA 1V37A 4AF7A 3ZCXA 4A2QA 5KYWA 1KRXA 1EEHA 2CXXA 3EY9A 1USGA 4GYYA 4ZVUA 1EDBA 3PQ6A 2PUAA 4FFDA 4DLBA 1L3CA 3FKQA 3G2MA 4K81B 3RRMA 1UBLS 1LRJA 1YUNA 4PPNA 2HHJA 3QEJA 1JA0A 4Z1MA 5TQVA 2ZYDA 4B47A 2PS9A 2ZM6B 2EHJA 2NZXA 2XCQA 3DV0B 4Q3BA 4GPAA 4X93A 5J47A 6LDHA 2R1TA 2P3OA 4LFCB 1DC3A 2I7TA 1QG0A 1NDQA 3D2LA 2DG2A 2FSUA 1BOOA 4MQUA 1IEXA 3MUOA 2VA8A 3AJRA 3KZNA 3MXOA 4JLUA 4TKMA 3FD8A 1AD2A 4I5IA 2F1HA 4U1RA 1K8QA 3JCZA 4ZCMA 3AILA 3GP3A 3IA7A 1OFVA 1N8SA 4FFBB 3DTVA 4Y6RA 4MVJP 3FYUC 3NIBA 3UF0A 1T2FA 4OFZA 4J6FA 1PLJA 3DOHA 1BVHA 3ZZNA 4MGEA 4J8PA 2BHRA 3SDBA 5A4AA 3X1ZA 4PLGA 3KQHA 1JAHA 3LHFA 2PAAA 1YUBA 3PIIA 4YREA 1AKTA 3NV9A 1MW9X 2IYSA 3VKWA 2E6UX 3IUYA 2OCLA 4MPTA 3REGA 4GNKA 4MQ5A 1WM1A 4M98A 5K0SA 1NE2A 2WJJA 4Z8YA 4WK0B 2WIJA 4HYEA 2H00A 2ZIUB 4NS4A 4POAA 3K2EA 1KEZA 1DRJA 1BHSA 2B9EA 1QVWA 3IDQA 3R5JA 4TUYA 4Z9BA 1ORTA 3NNNA 3PWSA 1VL2A 2QTNA 1J90A 5BW4A 4RENA 3NU1A 5F21A 1RI5A 2CNWA 3MXTA 3PHGA 4L9AA 4YRMA 3WAGA 3ILXA 3UH0A 3V4ZA 1YBHA 1MFPA 1ZA2A 2PSDA 1KY5A 4ZRMA 4QDUA 2ERCA 1U0JA 3DDOA 1ISIA 2FFBA 1C3VA 4G89A 1N57A 3MMPA 2Q29A 2JS7A 3PNBA 4N8DA 1YRHA 2KLBA 3R5KA 4B73A 5A9SB 1M67A 4OI0A 2AJBA 2YASA 1ZJ4A 1J5PA 5HKOA 4G1VA 4OLAA 1A04A 2F17A 1C0KA 3EWAA 2OZLB 4KRGA 2F48A 1FFDA 1PL6A 1UKAA 1B14A 4NULA 2W6JA 2GKGA 4CE6A 4Z7OB 4ZKDA 4Z3OA 3MJVA 1I2ZA 5CJ2A 3OSUA 1G9SA 4GOMD 1SQGA 3O94A 5HDBB 1ODIA 3LDHA 5DTRA 3M6IA 3GMIA 5IZ4A 1CS0A 3WWCA 1MGPA 5T8KA 1ZLXA 3RG2A 3T0FA 2QY9A 3X0DA 4V1CB 4JT2A 1GNVA 2F3PA 2QTVA 2WTXA 3OG9A 1EM8B 4BMDA 2BYTA 5EAIA 4PC1A 4AK9A 1PJQA 3VNQA 2J41A 4BVHA 1GSIA 3GVPA 1L4MA 5IYZB 1I9GA 1VGVA 1Z37A 3NOQA 2BSAA 5FWDA 4AUMA 1KTVA 5BSGA 4PV7A 1SOAA 1Z34A 4XM1A 4MAAA 2DQ4A 1JE0A 4UNNA 5ESDA 4DCVA 3CZPA 4MGYR 1KFKB 1E8MA 3VAZA 1EVIA 2Q3JA 3ET4A 3H1GA 4NYIR 1F6WA 2YV4A 1ESEA 4V2UA 1I4EB 3WO1A 5KTYA 3V5NA 3GV0A 4ADSG 2R60A 4JIMA 2CNLA 3V8RA 2ZZKA 4DB4A 4L02A 3T15A 4BJ5A 4R1SA 2X7HA 3TLXA 1C30A 4M6WB 5BSKA 4GUAA 3T5BA 2GS9A 2ZSJA 2YXBA 1XA0A 1NRJB 4MVYA 3AF3A 5BN3B 3LLCA 2Q8NA 1HYBA 2AXQA 3SJ7A 1KI1A 3JD1A 4LJ6A 5BOVA 5TX7A 1Z13A 4CKZA 1Q95A 4OHOA 1GZDA 1RQRA 1XRQA 4YRQA 2VHZA 3BQ9A 4J43A 4N0EA 1O03A 3WGHA 1XIVA 1RWWA 2YMPA 4TRJA 2IY7A 2D1SA 2AC7A 4WK6A 5HIMA 4HFJA 3RVRA 3WGQA 4AXXA 3VC2A 3CH4B 1IOLA 1MX1A 1UZMA 4DZRA 4Y1GA 3THOA 1AQ6A 1TUBA 3BM5A 5GWXA 1WZIA 4BKQA 4UTPA 1K8YB 1PG2A 1U7TA 4B85A 4Y9UA 4R0VA 1HUQA 3MRXA 3KOMA 3D6JA 4QG3A 3N2GB 3QELA 2PKQO 4D26A 3GFTA 5KMGA 4CJXA 2G40A 1V5WA 5KYXA 1SVLA 2X0FA 3JRNA 3GJSA 2RHMA 2X4GA 1JDVA 3MTAA 4QWWA 1VG9B 2C97A 5CJPA 1H2ZA 2Z0MA 2JG3A 3I73A 2IPNA 4KQWA 1CUEA 2NMVA 1LS1A 2EIHA 2NU9B 4L07A 3UXEA 2RCNA 5AK5A 4BFWA 5AKIA 1NJFA 4G56A 3RJ9A 1G291 2A9VA 2DFKB 3PEVA 2BJHA 4L95C 3AK4A 5F5LA 2QN8A 4CDMA 1YCDA 3QUQA 4Z6KA 2GWRA 3L01A 3C5EA 3CA8A 3OEYA 4EW1A 2EKBA 1IOVA 1ZVQA 4KQIA 1K7EB 1FS6A 4YGYA 1XMSA 4B3BA 1DKNA 3M6AA 4URWR 5CB8A 5A62A 4ITVA 5I47A 2AOVA 4RGQA 1KSHA 2XXBA 5MFZA 4W5QA 2O48X 3TX6A 1QYDA 1AQIA 2BIFA 2CGEA 4KIGA 3FHTA 3LRPA 4REMA 2PUTA 4IH1A 4K8OA 3OTOB 1HL3A 2VF2A 1U8AA 4FHGA 3PC4A 3AEYA 2RCYA 4PGHA 3B82A 1OI7A 3OI7A 4J7XA 4XM0A 1LPOA 1V9SA 3Q12A 2HJGA 3ZWXA 4OSEA 3EEYA 3ZW8A 1WNFA 1Z7BA 3PITA 2QF7A 3RWMB 3VDQA 3EXG1 3H13A 2XAAA 3CSSA 1N2EA 4MR7B 2GFQA 5LLDA 2J09A 2XB6A 3I12A 3TB6A 1ORDA 4TXNA 3C3MA 5D00A 4G0ZA 2OFFA 3SF8B 4N49A 4K03A 4RF4A 3TRJA 4JUAA 1MTOA 3MLEA 3QUSA 4BAZA 4J2TA 3WBFA 4DXAA 2Q3EA 3BRWA 3D2CA 3L4BA 4CIBA 1G21E 2DBQA 4CM3A 1T36A 3OJXA 3HL4A 4LVCA 4P4LA 2X1MA 3CNHA 3VXKA 2JA2A 3ZY6A 4C7VA 2PS1A 4KLCA 4KAJA 3S0JA 2Q2VA 5DX1A 3V3TA 2IE0A 3ZGZA 3HWSA 1E7MA 3A27A 1SHKA 1ZZGA 3DHVA 3FOWA 4RSMA 1NAHA 1KJQA 2XKBA 4WAUA 4AN4A 4JI6B 2ZYVX 3PHHA 3VHXA 3CKYA 4NY1A 4N54A 4ZVMA 3TW8A 2XBMA 1JG6A 2HJHA 4J76A 4EW6A 3K0EA 1CUIA 3VU8A 4Z86A 4TV8B 5T6MA 1WMDA 3KOZA 2WUVA 5J4KA 1D2AA 4Q3KA 3DWGA 1CUWA 1G8SA 1RHMA 1XQVA 1R16A 3KJXA 3QITA 4G2TA 3OE5A 4KTTE 2VAWA 5B4VA 1O5TA 1MZPA 2J6BA 4BEJA 1N6PA 2FP4B 1AO0A 1C9NA 1U7DA 2R6DA 1KY3A 4INOA 2ZJ1A 3EG9B 4LE0A 4FT4A 1IQUA 2AKAB 2C0CA 1ORHA 2NV6A 2RHTA 2WB4A 2P6OA 3AINA 4XZ3A 4EBBA 3FOEC 3ZE9A 1HLGA 3ZDXB 1F48A 3OOWA 5GADl 3OEHA 3ZGXA 2HIHA 3W0LB 3F9CA 4CKEB 2VPYA 4UNRA 1BW9A 5EQJB 3E3NA 1XLUA 3OKFA 1LDBA 4U2FA 1R0RE 1YFLA 3WE7A 5JJKA 1M2VB 3HU2A 4YC7A 4O8ZA 1XRNA 4R16A 3RF7A 1LW6E 3BDVA 3GEIA 2BOVA 3CF4G 1KARA 1XJCA 2A58A 2XRMA 3UPTA 3U4QB 5B2FA 1HT2E 2OD2A 3I04A 3BD9A 3EDOA 3N5CA 3B53X 3TW8B 4LZJA 2P4HX 2M6SA 5LP6C 2JA1A 9LDBA 2ZZNA 1CF4A 4WCVA 4Q3AA 3LYHA 3SXJA 2P35A 3PI7A 1TQ8A 5BMVA 2AOXA 3P94A 3QY0A 3RWOA 3IERA 5DLEA 2DUWA 3GH3A 3FDXA 1TTPB 1CUVA 5HRCA 3MRVA 1YS7A 2ZU6A 3L77A 4OEHA 3AP3A 2FQWA 3BDAA 1W6UA 3N0RA 4W99A 4DADA 1FYWA 4JENA 1KMMA 1Q7CA 3AEKB 3HMQA 3PNOA 3W2IA 1U8YA 3BMXA 4D42A 1P0QA 2GM9A 1GTRA 4R2HA 4RY9A 3AHEA 2A4MA 2VKTA 2O0LA 5BNTA 2PUFA 3DO8A 2ZUCA 4JK3A 3V1TC 3VTKA 3ZK8A 5JYBA 3QBEA 4R6XA 1JJVA 3ZWCA 2DUNA 3M8KA 3ZQ4A 1F17A 1ZGAA 1FSFA 1RYBA 1RW4A 2P3SA 2P9FA 4YJGA 3UWPA 2D2IA 3ZOZA 3MUNA 3RG8A 2RIRA 3DOOA 3L8YA 2QYHA 2X19A 1U8TA 3IMFA 2BEVA 2RDMA 1Y3CE 3JQAD 4O8CA 4QO7A 2H9AA 5CVEA 4BFCA 5IC5A 1LJLA 3F3MA 1WQ1R 2HF7A 4OQQA 3OOSA 1N9ZA 4EG3A 1K6IA 3ZDYB 4DANA 3PUHA 2ZYUX 2OPBA 3V9PA 3ZYCA 3GZ4A 1LSJA 1AVTA 3ZYZA 6GPBA 2V3WA 4JNCA 2VQEB 2Y6VA 4KQ1A 4G0UA 3P7MA 2GBPA 4QGHA 4CMJA 2Z9DA 1YC2A 4EB6B 4ZOQI 2W6JD 3IRVA 3U4AA 4BNMA 5HJ7A 4MR8A 4EZBA 2XUFA 4P80A 2Q1UA 3U6BA 1HGXA 1PWXA 2B4RO 2JAHA 2OG2A 4TTSA 2BF7A 4P2GA 1EHYA 4YYEA 1FVXA 2EGHA 1A9PA 4NYJQ 1KYYA 2AZDA 4JJ6A 3T0GA 4CLXA 5AI8A 4HQKA 1T9ZA 1I10A 3WWOA 3LOPA 4W5HA 2DQYA 3DEYX 4I66A 5LVAA 1YS2X 4CM4B 2BTOA 3BFKA 4WLNA 1BOFA 3ESQA 2OAP1 4LZAA 2OV6A 1CQZA 2QDXA 4XYBA 1WF6A 1T13A 4DIUA 2EFGA 2QE7A 4U9UA 3E84A 1YWGO 1CEYA 2DGDA 2XVMA 1V8DA 2I2CA 3DFKA 3HLYA 3LO8A 4FN5A 1TVMA 2ECPA 3NKFA 4FFPA 5B36A 5KWSA 1BWPA 4HFNA 4MKGA 4OFBA 1NULA 3A31A 1D4OA 1M5RA 1HORA 3A6KA 3A0UA 2FMUA 3PJEA 4M0CA 1QK3A 1ANKA 3OA2A 4IRXA 4R2LA 1GFWA 5GMOA 3A11A 4CKXA 4W5RA 4DR7B 2ZYGA 1DPFA 1XBTA 4ZAZA 1NVUQ 1OC4A 3BWBA 3IQHX 1OYVA 4V2IA 1DAIA 1E1CB 1PFYA 4M83A 1USUA 5A4KA 1PBNA 3FFAA 1DBWA 1AZTA 3ESAA 3TI9A 1GRNA 1H6AA 2QJFA 5M04A 3RC2A 2NNLD 1G16A 4JI3B 3W6ZA 1AUXA 2SNIE 4KWCA 5IRCD 2B8NA 4LHVA 1JLKA 2PD4A 3MTBA 3L4BC 3HUTA 4Q01A 3U7HB 5DBHX 4PX2A 3BEOA 3MTJA 3PRKE 1T3LA 1P5RA 3DZDA 3DNMA 2CBXA 1NMQA 4JI4B 1IB0A 1VIAA 1VYUA 2BGRA 2NSLA 3W5HA 4E13A 1ZGHA 2F00A 4ZAFA 4X64B 3QEAZ 1GLVA 2ADMA 2DWQA 3ADPA 1EH5A 1VSBA 1XKQA 2OM6A 3GNSA 3PQ2A 4GRAA 2IELA 4MVJF 1HNXB 1KF0A 2C3PA 2G7ZA 4RADA 1I51A 1SZPA 4LVNA 4A8TA 2WLSA 4R05A 5DU2A 1M1XB 2ECFA 2OORA 4HEJA 3AFNA 2RD2A 4NECA 3BHJA 4B35A 2IE8A 4FOOA 4ENVA 1XD8A 3BCHA 1GA1A 5ECDA 4X66B 1WVMA 1Z0FA 2QMQA 3IAHA 1WKCA 2B2XA 2O8EB 2PD3A 2WA2A 1FLNA 5ED0A 4ZC1A 2JJMA 2W2OA 3IQFA 3JWHA 3I01A 1VL8A 4PZYA 3I6MA 2VL7A 3ILYA 4UUMA 5ALYA 4DWJA 5BNWA 3K9HA 1NM5C 3C3EA 1R64A 3CW8X 3FMFA 2NUAA 2VPXA 2O8FA 3EN0A 4RPGA 5ALEA 3JVEA 4ARVA 3O1JC 1U8XX 5LXTA 3I0NA 4FE4A 3EDQA 3L0PA 1M5UA 3RABA 2XNKA 3V8NA 4RY8A 4OCZA 1K08A 4FNMA 3LKBA 4V0SA 1A71A 2V6GA 3GQBA 4XIJA 4GLOA 1GQYA 1PTJA 3BMNB 4OFWA 5AVKA 3U7JA 1W85B 3SDSA 4EUEA 2R3SA 1V7QA 1WUKS 3Q9NA 2CZCA 4L9WA 3G79A 3HI6A 3P32A 1E4OA 1W75A 3DLIA 4Q3DA 2J0EA 4JJFA 3VUFA 2WWVD 3ODPA 4UNPA 5E2AA 4JVSB 4ZI7A 4F85A 1GZ6A 4DSAA 5A2QA 3UG7A 1TRHA 2IW1A 3ZGVA 3SSOA 1P45A 4YMVA 4ZVTA 1H05A 3WSWA 4AULA 1RKUA 4PTYA 1U0BB 1WRBA 4TYMA 3ADKA 4ND2A 3E9ZA 4HEQA 5GV8A 3RVSA 3G1TA 1JQJC 4EPXA 2W6OA 2CE2X 1J97A 2VP3A 2VR1A 5CB4B 2YS7A 4AO7A 3UW3A 4UDNA 2ONYA 3JD2A 2Y67A 4KQXA 1YVPA 1GFIA 3Q1LA 1Y9DA 1J9EA 2QTZA 2XDWA 3H9CA 1YBAA 4RHEA 5AVVA 3LCUA 7GPBA 3JASB 2QXUA 2BI7A 1V8BA 2B20A 1DDGA 3OC0A 4NRDA 4EJFA 9GPBA 1MX5A 2H1OA 1P77A 3EB9A 3PQ5A 4FC6A 5CUQA 3GRAA 4ARUA 2O5RA 3GJ3A 1NSFA 3WMWA 2B36A 4M46A 2NUTA 2NV2B 4IXDA 1GFZA 1TAQA 3EVGA 1P9RA 3X44A 2GJKA 1BX1A 5MFPA 2OCDA 1NP6A 1P6XA 3ZWAA 3OJFA 5G41A 1A2QA 2ZE8A 1PZXA 4BNNA 3AJ8A 2EW8A 3L4SO 4OXKA 5CFMA 3NVMB 4BMPB 2HPHA 1SOVA 2PYIA 3V48A 3AG5A 1RC8A 2IOYA 4F3TA 4RD0A 4XGIA 4IUYA 2GAFA 2YMMA 4G5GA 4QX6A 3C5CA 5DP2A 1N34B 5HP4A 2C57A 1ESCA 1MG0A 1Q19A 2WVJA 2Y76A 3O75A 3OZGA 5DEIA 1QP4A 1TMGE 4N1AA 4ZOLB 5JBIA 5GAJA 1YJQA 2I55A 3DR5A 3TQQA 1FB5A 2W93A 4KXUA 4PCUA 3VOTA 4EHNA 1H6BA 3BERA 3W3AA 3EQ7A 4PAQA 4IJQA 4LTMA 5GY7A 4FINA 4EO7A 2AG5A 3DT6A 3ICQB 6ABPA 1SIOA 3D3KA 2ZLBA 1MOZA 3NTRA 2C7GA 1ZD5A 5CM2Z 1QE0A 1T1IA 2BI8A 2CEAA 3AUAA 3D7MA 1EA5A 1Q20A 1WXEA 2OGWA 3MRTA 1IBRA 4QKQA 1E58A 3U5TA 2WVHA 4LZZA 4OQ4A 3A1DA 1QTRA 2IXEA 1J39A 4CG2A 3VR3A 3TOXA 1YFZA 2W22A 4KIFA 4K1XA 4V38A 5BR8B 1G98A 4RL4A 3P4UA 3D9QX 3UPDA 5FA6A 2CKDA 4URZR 2I67A 2Z6VA 4Z4QA 1B74A 2OILA 1OLUA 3S7ZA 1WXQA 5H1YA 1XROA 1OXXK 2D0IA 2IYEA 1V3VA 3N53A 1CUYA 3PJDA 4FCWA 1RAEA 2VHJA 2VDKB 4FYMA 2AK2A 1R9JA 4BMOB 1ZK3A 2WR8A 3DOUA 4ZAYA 2JI8A 1YKSA 3LKVA 4UM9D 1ZGBA 3LWDA 4M9CA 4Q47A 1QPGA 3P0FA 4JP5A 2B5OA 2ZATA 4QFCA 4BV3A 1PDVA 2YUIA 2P9GA 4L8YA 5HGJA 3D0KA 3SG0A 3A9CA 1G8HA 1PUXA 3FNEA 3EXFB 4KVGA 4BMNA 3VH1A 3WZ2A 1AMNA 3GPLA 3FCUB 4FCCA 3JVVA 5FPPA 2R44A 3BJEA 1YRLA 1OW3B 1WUHS 2V7QD 2B8TA 4PLHA 4PX5A 4JLPA 4R54A 4UXJA 4ZYXA 2A88A 4UW9A 4HFRA 3ORFA 4PTZA 4BX3A 2VS1A 4L9SA 5EE5B 4MITA 1IG3A 1IY9A 4LPKA 5B37A 4F97A 1EK2A 1ODJA 1YR6A 3QEMB 5K3EA 2IYXA 3ZCPA 5ABPA 2YQZA 5J59A 3T5PA 1EE9A 3UJ7A 4CYMA 2FDCA 1T9KA 3O4VA 1OY1A 2I2AA 5DHSA 2ATEA 2P77A 3LI2A 1F3LA 3NIDB 3WLAA 4ZEWA 4P0PB 4LRQA 4C3VA 1T8WA 1JQ5A 4L50A 5A9TA 1P9WA 3NVDA 4BLVA 5LXTB 4EKIA 2OWDA 3L46A 2NWQA 5ILOA 1BWSA 1VCNA 2C9YA 3FMIA 3QBDA 4OYYA 4BZXA 5C7YA 2Z3ZA 3RTGA 3HDQA 3ETGA 2JGFA 4YR9A 1V3QE 4F1JA 5J58A 2DUJA 4YT4A 1JIUA 1M1UA 1MOSA 4AYWA 1Y4ZA 5I7HA 1SKYE 3AY7A 3NHYA 3U16A 3ONWA 3UUFA 1CIJA 1II0A 1WW2A 2PKYX 4LFBB 4QPZA 3WP0A 2F43B 1Z18A 3DE3X 4KHPB 2IEBA 2DCUA 2EAUA 2YFQA 1NMYA 4NJMA 5JVDA 1EWVA 1W4AA 1Z4PX 2FZ5A 3K1TA 3QE9Y 3E4DA 1L5KA 2XNCA 3KYCA 3WK7A 1WW8A 4Y1RA 1FA9A 1XZGA 2C2MA 4JBWA 2YXLA 2IVZA 4HX5A 2RJOA 1TF5A 4YQYA 5JSKA 3M6VA 4U6SA 4WNAB 3WIUA 3OHPA 5B6IA 5JANA 3LQ4A 3SR3A 1KR2A 4XWAA 2P6UA 3F5MA 4M1EA 3EHDA 3VZDA 4F45A 3FJYA 1RZ3A 3QWBA 3OE7D 4BYGA 3OX2A 2LW7A 1EWQA 2PGIA 2VJKA 2WD8A 3M83A 5AFSA 4U2CA 1SUPA 2PRZA 3LDAA 3TF5A 2BHSA 2HF8A 2VP4A 3FMOB 2HCTA 1QSGA 3NHJA 4DDVA 2WQZA 3QH4A 5TS3A 1U5CA 4GD3Q 5I8PA 1Q17A 1SU4A 1WCYA 4GAEA 3QNMA 4Q12A 1IHDA 2R6ZA 4CLHA 4HVTA 2BMEA 1DKQA 1RBZA 2IYQA 5B3KA 3ID6C 2DUMA 4UZEA 1NT2A 3S2FA 2Q9AA 4RPJA 2QRGA 3P2JA 1CQWA 3KSDO 3OJLA 1GL7A 1EU1A 2VF4X 2V5VA 4GSKA 3X43A 1BFDA 1W73A 3P9ZA 1OYWA 2NUTB 5ICEA 5J5VA 2J5KA 1I7SB 4F9EA 1JWLA 4HH0A 4PWYA 4OSPA 2RH8A 2NVBA 1K66A 3H8VA 1U5BB 2C5LA 5KNCH 1SCIA 1MDBA 2RK6A 2W6ZA 1UFRA 3OPYB 1DEHA 1V16B 1XVTA 2NO9A 3D0QA 5FBLB 3WG9A 3OM9A 4PBRA 4DV0B 3FNQA 3R3SA 2A6PA 3OJEA 4UULA 4RA9A 1Q7BA 2YNMD 3TR6A 4TVBA 2JPDA 3DBLB 5B3JA 3STWA 1A9XB 2VHUA 4O4IA 2BW0A 2XH8A 4RWEA 3MG9A 3DXXA 4W6ZA 3DL0A 5LDHA 4S0ZA 3L7LA 3SZMA 4IIFA 4QATA 3IOMA 3LJKA 4BP3A 1IHXA 4KR9A 2X2FA 3WMEA 1EP1B 3SY8A 2K7ZA 1FS4A 2GXAA 4AKEA 1P4SA 3K53A 1JDTA 5JI2E 4NE9A 5GJBA 2I71A 1KO4A 3OTWA 5D86A 4YN3A 5I9SA 3ZBPA 4TMZA 3A6EA 4ER5A 4ZP1A 3NXKA 1XZEA 1YDEA 4YAWA 2CXSA 2Q6OA 3SQNA 4CPDA 2CWDA 3UA4A 1XAGA 3FBTA 4CTKA 4ENPA 1YACA 2ODAA 3ROKA 1LDGA 3EPRA 1ZK1A 1EA7A 1ZN2A 3LBHA 3MT7A 1XZKA 4LOLA 4RNCA 4TWBA 3TG2A 4WJLA 1IY1A 4U7PB 3ZGLA 4ENSA 4GR4A 4H9GA 4K3UA 4PIMA 4G4SO 4XWTA 5H80A 5H9WA 2CT8A 1NW6A 4BFUA 2GOYA 2ZE5A 5FJJA 5HMMA 5HIKA 5AM3A 5AKZA 3UQYS 1YGYA 4R9UC 2XADA 3FXAA 2F8MA 4UUOA 4W8HA 3U4DA 2FVXA 1N9KA 4LJKA 4JN6B 2AJ8A 3IMCA 4OXIA 13PKA 4D4GA 3H5OA 4LJ5A 4Q9HA 3UT6A 4MVJI 4X7MA 4PPFA 3AH8A 4ZKEA 3NYWA 1WXXA 1UUFA 3GLRA 2H1WA 1B1CA 2EATA 2HSGA 3O1IC 4HLUC 2COKA 4K1LA 3SZGA 5JTUA 1ZR4A 1BXRA 2W2LA 4RLSA 1Y6QA 3LUJA 2NYVA 3Q8WA 3TUJC 3FMPB 3EXFA 4O5AA 4ZU3A 2P6PA 2W2VA 1OH7A 2EVWX 3FDFA 4LJ4A 2J8ZA 2RSLA 2UXCB 1IDN1 1RM4A 5DCUA 2X2PA 4HN2A 4Y2SA 4C6RA 2QVGA 4OGLA 1JHQA 2CXQA 2JLQA 1IIBA 3N2NA 3WB0A 4EKYA 1VMDA 1P80A 4XGQA 4DRXB 4FE7A 4Y2JA 1XDDA 4E11A 1XK7A 4FW9A 3AF6A 1TAHA 3KOYA 5EJGA 3DZBA 1ILEA 2QUKA 3PXXA 2QM7A 2FCAA 3I3SR 4AZ0A 3TSAA 4N6GA 3KV3O 4YRSA 1FMJA 2J3QA 1RWOA 3BHNA 3AXTA 3E03A 4F4DA 7REQA 3B1XA 3MS2A 2ICAA 1SURA 1QH1B 1BCSA 2F3TA 3HB7A 1NWHA 2H8KA 5A05A 3V2IA 2XMPA 1CZUA 4BLOA 1BO6A 4G84A 4LX8A 5IEBA 4R0MA 3FF1A 4N5MA 2DR2A 2HT6A 4D9CA 4NNJA 2JGNA 3U62A 2HR1A 1VLJA 4B83A 4DQUA 7MHTA 3TNLA 1XSEA 2LIVA 4FKMA 5HILA 3KEQA 1R10A 3UK1A 3BG5A 1ZUWA 1OILA 1DQSA 4YFVA 2R96A 1BDMA 1QFJA 2BFDB 2BFCA 2VPQA 3QE3A 4IS2A 4ML3A 4QYWA 3WLEA 2BKVA 3THYB 4JHLA 4I55A 4UVGA 1E8DA 1O95A 3L3BA 3TIXB 3I9OA 2I6TA 8GPBA 4U2BA 3P4YA 2PPVA 1CUJA 1U80A 2YW2A 3ILVA 3VTFA 3GAMA 4N4AA 4BTEA 1ZW6A 2IXTA 1SBCA 1BFKA 2ZJ3A 3AU9A 2Q50A 3IKLA 3KJIA 3NDPA 4GBED 5G0WA 4KR6A 1NOJA 1KYVA 2XBLA 4PM4A 3B36A 2H29A 2J5BA 2XIQA 4FDVA 3S8EA 1X1QA 3E53A 3PDWA 3FN4A 4IV8A 2QKYA 1Z7EA 5EI5A 5G0SA 4WBNA 3I9JA 4JJEA 4I7EA 4IIJB 3TIVA 3R7AA 4BRZA 3UMFA 1QG2A 2B4QA 4JZYA 3SEQA 1XK6A 5IULC 2FW7A 5EEGA 3RHTA 4EPTA 4LRUA 2ONZA 4U63A 5E7IA 5IXJA 1M2EA 3IAUA 1PZFA 4IJMA 4HAZA 4C2BA 4Z2AA 2I1WA 1CVIA 5JT1A 3S2YA 1VA5A 4ZDKA 3LY8A 3AHJA 3CINA 4J16A 4IGKA 1CJVC 2C84A 5CAEB 3ZJ4A 2ZUFA 1XMQB 3KEOA 3HKEA 1SXJC 1YJCA 1GZ5A 2OC4A 3BL6A 2RGAA 4KXWA 1E2LA 4Q4LA 5CLJA 4K6MA 4BQIA 2PL3A 5L4SA 3BGOS 3VZQA 3OLQA 3HNOA 3EMDA 4GVXA 4WZAE 2VDNB 4B2YA 4B2PA 5FFNA 4JJIA 1QIFA 3SJCA 5EHXA 5IAKA 2EZUA 2NSDA 4OFXA 4KE8A 3SC6A 2H51A 1IU9A 1NVVR 2PFKA 4UHCA 5EE0A 4BVEA 1VYTA 3OU2A 1JG4A 5LYYA 3JATA 4YGXB 1LI4A 2A1TS 1DBSA 2A1TR 2A8YA 2HMTA 2WKRA 3FUTA 1SUWA 2O3JA 3HRHA 3OLCX 5INTA 4HZGA 1TA9A 1Q2UA 2PGAA 1R0LA 1EE2A 5KDDA 1XFAA 1QVAA 1JQAA 3QF7A 4MQFB 4MGHA 5AVYA 1CUXA 1XL0A 4QPPA 4QU5A 5AQ1A 3O8CA 2W71A 4RD3A 2PCJA 1JHMA 1THZA 5JAQA 4M9RA 1KY4A 3EGIA 3PVCA 1Q0QA 2QG9A 4DLKA 1P8AA 2JDIA 2ZJ5A 4R2KA 1N6HA 2Q8QA 3WK4A 3RSZA 1R15A 3PFNA 4QTTB 3ADOA 4CWAA 1D2NA 5G1OA 5J43A 5EIXA 4Y2XA 2QN1A 4O4HB 4Q7MB 4D46A 4JLAA 5C46F 3ACDA 2XNJA 1BX0A 3MWFA 4RGVA 3OUTA 4QUBA 4IYRA 3G0IA 3VVBA 1JU4A 2OXRA 4FUTA 3OE7A 1AUVA 4ZQHA 2ZXUA 2XRYA 4EO4A 1W4BA 3LLMA 4HQ6A 2OFWA 3LHIA 2GPJA 1TEHA 3T7CA 5JCOA 5KNLA 2HHAA 4DSTA 4LVUA 1U2RA 1RQGA 2WY2D 4BX8A 3TUZC 3USCS 1Z7YA 3P1JA 1TQ6A 3PKIA 2JH3A 2ZI5A 1FP7A 3B78A 1JEEA 3KQUA 5I8WA 1HG1A 3IAXA 1PWZA 3QVXA 4HVLA 1XB2A 3N2KB 3MTIA 4UMDA 2D1YA 1EUZA 4RNDB 3VTZA 4MPDA 4ACAA 5FWXB 4XKJA 2AFIA 1C9JA 2EJWA 2CHUA 4I19A 3RAGA 1YA8A 4GEGA 1I6MA 4X6YA 3FZEA 1Z29A 4XUEA 3B13B 4R8VA 3HDHA 1UC8A 2R8EA 3ASYA 4JYPA 4UAJA 3U9LA 2YC4C 1XMXA 4WMLA 3T3EA 3SZRA 4MB0A 2YXPX 1KYXA 1HEYA 4RA6A 3SEZA 3AGPA 1XNJA 1VE5A 4FMPA 4X9XA 5CVJA 4ZJYA 1F9AA 1S2LA 1VG1A 3AVQA 3OCYA 3PCRB 4MW5A 4RKWA 1N32B 1QNLA 3K16A 5A1JA 2FSVA 2XNDD 3C7KA 2JVJA 4ID3A 3LPDA 1NXWA 4JNKA 4GSLA 2FZ4A 1KL7A 2OGZA 3MSXA 1SPXA 4FFMA 4HB3A 3RSGA 3ADBA 3CZ9A 5JJIA 1SK9A 1U65A 5B2ZA 4DXHA 3NIFB 4NF2A 4F2GA 1Y5MA 5FHRA 4JT9A 4TOIA 4IQ4A 1SEVA 4MS4B 1T0UA 3TNJA 1QYWA 1VRWA 2MT9A 4PINA 2QRJA 1WS6A 2R1VA 2QN6A 4K26A 3CO0S 3DTNA 4BQQA 4WBNF 2O59A 1TK3A 2J4DA 2JGMA 2NZWA 3EDCA 3NTOA 4RPLA 4M0UA 2BM9A 1V25A 1YMQA 3UJPA 2MWMA 1SXHA 4NOLA 5TJ9A 2VP5A 3OZTA 1T43A 4IXWA 4M1QA 2L0XA 1RAHA 4IIXA 2DLNA 1OBVA 3OOYA 4KL8S 1RHKA 3E9CA 2QZJA 4KKXB 2Q2QA 3HB5X 2RHRA 3MB5A 4KLZA 1EE1A 2XNHA 2LRHA 3G2IA 3L6UA 1T5IA 3I4FA 5AKHA 5K0EA 5WRFA 1TUIA 2QD4A 2FUKA 1MV8A 4JUDX 2DSNA 2PBFA 1NA5A 4IJVA 4KWTA 5A5GA 1IAVA 2AG0A 5BPFA 3UFXB 1WJGA 2J33A 5K03A 4XB1A 3D1VA 5EPOA 2RE8A 2DHRA 4NP6A 5CP8A 2NYUA 2VTBA 3Q11A 1VL5A 1OJLA 2XOKA 2YHIB 3AR4A 2H1SA 3MTGA 5DNCA 4ZO6A 4D4IA 1B8NA 3FTEA 3IDZA 3OIGA 5K3FB 1H2YA 3X1YA 3HY3A 5BXYA 1NN0A 2B4YA 1XZAA 1CY0A 4L57A 3TQSA 2EV9A 1GUFA 4I1PA 1ZGGA 3AR9A 3HYTA 1OLUB 2E85A 1R8QA 2YN0A 3CURA 3NGMA 3OA0A 4P7GA 4RE6A 4FUQA 3M1LA 1AQNA 3GVCA 1JH9A 1Y4UA 3DW3X 3UWDA 4MARA 1GUZA 3KXKA 1C8BA 4HNAA 3W4JA 4CL3A 1PW7A 2WWYA 1SXQA 4Z4FA 3H3XA 4JBXA 3QVGB 4OGWA 3LY7A 3QA3E 4EMUA 1NBMA 1CR1A 3DKKA 3R8FA 8OHMA 3H42B 1QB7A 1M1ZA 4RZHA 5DYNA 2AE2A 5FWYB 4OI1A 2CB9A 2O52A 3Q3CA 3WKCA 1X9HA 1A2BA 4D97A 3BT7A 5JS2A 3UOWA 1LQUA 4C01A 4CIDA 2V4ZA 1XVLA 2BV3A 3K70B 2X6QA 1C4XA 2I6GA 3AMVA 1XQ9A 2CL5A 2V6FA 1TCCA 3DTYA 2IRWA 2QTHA 3O9MA 3H0KA 1P3JA 4M0EA 3MHTA 2P5SA 3TLGB 5B57C 1Q7EA 1D4FA 2H5IA 1JN0A 2I29A 2UUPA 3HWRA 1OFGA 5K0FA 2W5UA 2OB1A 4ZCRA 5KWIA 4JZKA 5DXFA 4BASA 1SCDA 5CVDA 3IYLW 3ONNA 1X7YA 5CA0B 4XTRA 1EVYA 1G17A 1ZK0A 3CRW1 3E1SA 3N74A 1NMZA 1VJRA 3ESCA 2H92A 2OLJA 1EJ2A 4GPIB 2X22A 3HJNA 1PU2A 4HWTA 2Q5QA 1XG5A 3LP8A 3PGA1 4G9GA 1OF1A 1YIDA 2HA2A 2XX3A 1V1JA 1CU1A 2NUBA 3TNDA 3G9ZA 4EA6A 3DZJA 3GO4A 1T8SA 4GP9A 2EIXA 4RLQA 1W36D 4IVRA 2NAPA 2W6CX 1QC5A 1S2MA 1X7GA 2IYFA 3MAJA 1I3CA 3GJ0A 4DQLA 4R7TA 3JQPA 3GP8A 2N46A 2R751 1VJCA 1YI1A 5AVOA 2QXTA 5C0OE 3PLNA 3TSWA 1NVMB 2I7XA 3TTUA 3CLUC 4EG5A 5IWAB 4D57A 3PI6A 2DE0X 1Y4DE 2JIZD 3BWXA 4C5AA 3EZ9A 4UPVA 1E6MA 5JE8A 3G2PA 4TL8A 2IU0A 4EPVA 1P1BA 4ZCTA 3MJRA 4HKTA 3VPAA 5KQLA 1W36B 1VCOA 3DFIA 1AKUA 5KDLA 3H1EA 3RVJA 1FSPA 4KXVA 1ABBA 4G9EA 2H63A 1YS6A 3B6EA 1D04A 5KYXB 1P60A 1X1DA 2G5PA 1ZDMA 2XA1A 3AEQA 2O07A 3JS5A 3TQOA 4F4FA 2ZM5A 1NV9A 1OCEA 1Z12A 2ZP1A 2EERA 1XNGA 1KI6B 4PLPA 4AJOA 4IO1A 4Z7JA 3RYIB 2CUZA 2YC2C 3EFOB 2JFBA 2JJQA 2IIBA 1WL8A 4TXLA 3DCJA 4CEIB 1XWIA 2B94A 3N6XA 4QFBA 3RYCB 1ZMBA 4UQOA 5F3DA 2FF5A 4GR9A 2F3QA 1MORA 4HN4B 4NCKA 2MTBA 2YQ4A 1NYLA 4H4CA 2CYAA 2FEOA 5D84A 2Z8YA 4DY6A 1ZZEA 4P32A 1VIDA 2G8NA 3EZLA 5JPIA 1NUSA 4WH0A 4QJBA 5IEJA 1TCAA 4Y7CA 4HDNA 1XI2A 4JUBA 5DNWA 3LHDA 1LJ8A 4ZDWA 1K9SA 4BVJA 1Z4QA 1VA4A 5AI4A 5JZ9A 3JY6A 2OQVA 2X7JA 4HGZA 4RVUA 1CVRA 2VN8A 1KOLA 4Q9KA 3WK8A 2FKAA 5A04A 3RC8A 3PIRA 4NMMA 5CCBA 3TSZA 3LVFO 3L04A 5B1HA 4J91A 3UXYA 2R8BA 2I78A 5H70A 4NV0A 2C82A 4CUKA 2AQIA 3TD9A 4BNWA 5KYVA 3D02A 4EJ0A 1Y5LA 2J3DA 2X5JO 5EXDA 5CG2A 2G82A 1YZLA 2ZUBA 1CEEA 1C3OA 1RI3A 1E1LA 3N2GA 2WF5A 5CEFA 3A2NA 2PK3A 1XU4A 1IBKB 4UHKA 1UKEA 1UQRA 2VNHA 5EIHA 5IP5A 2ISQA 2QX6A 3IRUA 4F3RA 1P81A 4GKBA 4DMUB 3URKA 3QU7A 3WRYA 1ZKMA 1PT6A 2ZKLA 3GRFA 4CN9A 2JW5A 2VP2A 2G67A 3ZKWA 1KAEA 1Z7WA 3Q7RA 1WDMA 1J70A 2H7YA 1MGOA 3OU7A 1W9HA 1S4MA 1Q14A 4R1NA 2AGVA 5E4JA 2DPGA 3MD9A 1KIAA 2HWKA 3OKPA 4RK5A 3RUPA 1OX4A 1QH0A 3RFTA 1VIVA 3CJTA 5FA5A 5EGSA 3GXOA 2C2XA 5I9BA 5B3JC 2JIRA 2P0EA 5AOCA 4WY5A 5TT0A 3DVLA 2ZSEA 4EG6A 3KYJB 4FOPA 1ZJ6A 1G8AA 1X1BA 2IF2A 1FFGA 4WZBE 4NPHA 4YXWD 1M2GA 3IPXA 4DLLA 1WU8A 4IOMA 2C2WA 2ZI4A 5HR5A 1GITA 3Q15C 5IH7A 3IE2A 1Z6AA 3E0XA 2NQ2C 1CSEE 1P7PA 2IUSA 2HYDA 2O1SA 2QN2A 2QVXX 2VRCA 2YZKA 4JKYA 4QNRA 1QP7A 1BQ3A 3SQOA 4MVJA 2VTDA 2ADOA 2ACEA 3R1IA 4R3NA 4F8EA 2O1EA 2XNSA 2JZCA 4QE3A 4RMHA 3FRIA 3RUHA 4I5FA 2G0TA 2QENA 5D3MA 4PF1A 3AR2A 1QIDA 4PQGA 2QNIA 4PXAA 1W4ZA 1JMYA 2O7NA 3C4QA 1YL6A 3UYLA 2VFAA 4M36A 2Z3VA 4X60A 5IF9A 3TQFA 4DZZA 2XE6A 2G36A 2IZ7A 1QTQA 3C3YA 3EXG2 1AS0A 1E77A 5ECWA 2Q6KA 4YQZA 3T94A 5B4UA 4Z4HA 1EGVB 1CB0A 1SCBA 1LQTA 3R23A 4HD8A 4IEEA 3NCHA 1ODCA 3T5MA 3UJDA 3DBRB 3UK2A 4N7MA 4QASA 2QM8A 4QXAA 5KCMA 3W7AA 4B0PA 4B80A 1R5BA 5B1SA 1XPUA 1J23A 2DBVO 2I2XB 4IWNA 3O0DA 4EH1A 2IVFA 1TCUA 4MRMA 3VX4A 4CLDA 4KFRA 4YAOA 1FYDA 3EQ6A 4ER6A 5IFLA 5F52A 4OMFG 4EVRA 1T6BY 4FONA 5JO0A 1TM4E 721PA 2Q0QA 3TLJA 1MAWA 2GCNA 4BKOA 4YB8A 4LJ8A 2WUDA 3UCFA 1RRMA 3KFXA 4F5YA 1J2EA 3B8EA 1JHUA 2P68A 4ARSA 5K6AA 5DASA 3VR6D 3L5OA 4HAUA 1RNLA 4WEQA 3D7RA 3SYLA 1R0BA 2WWWA 4FBMA 1DOHA 5HQ3A 3SIPA 2Q2OA 1VM6A 4QJIA 1FU4A 3HCBA 4PLCA 1ZSNA 2QW0X 1RM5A 1DQZA 1C7JA 1YCFA 2W11A 4JQYA 3RQIA 4AMYA 3B9BA 3IIJA 1FSGA 2DFNA 3KD2A 3QQPA 1U9JA 1UJBA 4MYCA 4P4UA 4PLTA 4UHHA 4CV1A 1JHPA 4EPWA 1VL0A 1KI4A 2A5FA 3FYUA 4GI3A 3V1NA 3ZY5A 3KU1A 3WSTA 2GTHA 1BCSB 1KH1A 1UFOA 1E4YA 3KB1A 1BKSB 1HH4A 4MO9A 1CQXA 2P11A 1ZVMA 5FYQA 4CBVA 2O57A 1ZWLA 5T6BA 3ZJ5A 3O8OB 4FFBA 2IF0A 1OTXA 2RAFA 3AUUA 1X1SA 3VVLA 1O94C 3DBIA 3HFRA 4OLFA 3AKDA 4U2EA 1OHHA 1QTIA 4EELA 5CIQA 3NHLA 1UMBB 2QRUA 2GN4A 4D81A 1J33A 2OGTA 2RGCA 3B1JA 3OLWA 1JR3E 2IX9A 1XTTA 3ROMA 4JI7B 1M34A 3GIWA 4TL6A 4AXBA 4PHCA 1S02A 1VLVA 5F1YA 1U3TA 4I1RA 1O5IA 3LX8A 3QVUA 3R5TA 4JH0A 2CV0A 1FUUA 2AZ4A 1FXWA 1CZNA 4NEHB 2ZSHA 2CJFA 3LY5A 2QQGA 4D1YA 4S24A 3H18A 4UBKA 1CY2A 4HG2A 4ISCA 5D3MB 4D3SA 3DNFA 2ISSD 3E9DA 4LDRA 4P3PA 1V3UA 2QGNA 6ADHA 1N2CB 3KB8A 3MEQA 3QOFA 3E70C 3E15A 3PEEA 1EFKA 1VMKA 5A4MS 3OZUA 5BMVF 2C2KA 4EGCB 2B4TO 2PM8A 3VR0A 1IC6A 1HF3A 4INZA 1OPRA 1QHIA 3A1NA 3G5LA 2W00A 2P2GA 5EKDA 1K6JA 5JAPA 4PVCA 4B3DA 1H94A 2P7HA 3D6TB 3JVUA 5JMTA 3LYAA 1WG8A 3K3PA 3BB4A 1TC2A 3JQ7B 1C7QA 4PYMA 1UMBA 2IHYA 4A03A 2Q5OA 5HUQA 1C1DA 1LBEA 1EBBA 3P2IA 4QDOA 5LSAA 2G08A 2Q1XA 3E1KA 1G5TA 2C0PA 1BDHA 1U2DA 2CVHA 2ES4A 4EYQA 1G5PA 3GDGA 5AVXA 5CXXA 2ZB4A 4E1BA 1AKNA 1OGYA 2FSHA 3E8SA 3EJWA 5JAMA 1B73A 3KFVA 4OQZA 1G8MA 1MNAA 3HYCA 1WLSA 5ERXA 1A50B 4QRHA 2CMHA 5BUSA 4R9NA 1P2FA 1Q2XA 1FVOA 2BHTA 5FAKA 2JVIA 2Q7XA 4I6EA 1WPXA 4EL0A 4ESVA 5FHQA 3KSAC 3CZRA 4PBTA 1YZKA 4B34A 3EDMA 3PF8A 1L8OA 1RPZA 4K2HA 4JYAB 4JOBA 1PJ8A 4ECAA 4J0FA 4JVNA 4CLOA 3NAMA 4Y9DA 5FBHA 2G8LA 2NNWB 2WTBA 1IZZA 1Z2EA 2FRDA 3DEHA 2FF7A 4FLFA 3AW9A 4QDKA 5BP7A 5EIFA 4Z7QB 1GXSA 1R3DA 4OP2A 5ES4B 3CLVA 4CTMA 3LNTA 4M37A 2WSMA 3VNUA 4D4LA 2A57A 2C61A 1THGA 4K9QA 5BVGB 5M34A 1YC5A 5K8UA 3ELBA 3D7LA 4IQGA 4H27A 3IESA 5BSUA 2EXXA 5DM70 1MPTA 3JALB 4JVLA 4G4IA 3F5DA 2JLYA 1BE0A 1C50A 4EFMA 3PPXA 4IJ6A 3WQRA 4S04A 3GD5A 3DUFB 2ID4A 1RC0A 1EQUA 4J4BA 2LVBA 4FSXA 3G8DA 1BW9B 1D2GA 3BGDA 3K15A 3V6LA 1FUYB 4QBFA 1E4VA 2WTUA 3WRYC 4M8IA 1PL7A 3BH0A 3QVMA 1BS2A 1CZHA 4BVAA 2PANA 1RRCA 3MIIA 2VF5X 3SD7A 1E2DA 2IHUA 4NONA 1GTL1 1ZWKA 4EW2A 1EIWA 3NHAA 1NG1A 3GK3A 3B2NA 4CCSA 4HLCA 1MCZA 2X2OA 2ZTMA 4RTMA 4JAVC 3IPAA 5CX4A 2PBZA 3PIDA 5ALMA 1U99A 4D9FA 8AT1A 3S2UA 5FWNA 1OE0A 2X5OA 4D0SA 2CC2A 5K3DA 4EG0A 1XNHA 2O2SA 4GOND 1F2DA 5DTIA 4CGYA 3PUVA 3JYNA 3BEDA 4DPKA 4HAWA 2DAPA 7MDHA 4RVNA 5GJCA 3HSYA 3LLSA 5ALLA 3RTDA 4E2FA 1QRUA 3V2GA 2BZGA 2BP7A 1Q91A 1Y4AE 2QAGC 1LJUA 3K6RA 3EISA 3CS3A 1N6KA 1JEAA 2D5CA 4DV7B 3EIHA 3ABIA 1KK0A 1MJ5A 1UAGA 2BUBA 3L7AA 5IHPA 2K7FA 4RKFA 1UXHA 2AKYA 3M3PA 5DDIP 4IWXA 1UEJA 1E59A 1OZ0A 2UKDA 4IOJA 1YGPA 5CW1A 4BFSA 4R41A 4Y30A 1E5VA 1Y48E 2XQFA 4IFTA 4YXWA 4PHHA 1ISHA 3BULA 1Z75A 3IMKA 3RK4A 1Z6GA 4FGSA 2X41A 2QRMA 1IRXA 1J9ZA 3F6RA 2GHRA 3DE5X 4X94A 1T9GS 5CLIA 4CQMB 1E0AA 2QTVB 2ZKIA 2Z83A 4E5YA 3IE1A 3CLSD 3LDUA 2HK8A 4EYKA 2ZJ8A 5C7OO 5KKNB 4EECA 4QM6A 3RC7A 1ADFA 4H7DA 2NUAB 1WBJB 2FSGA 1UIRA 1UKYA 3B60A 3F1KA 3HVHA 1TEVA 4K88A 1H1TA 4DPLA 4ZJUA 1OROA 4JWKA 1TM2A 5CLQA 3BX1A 3Q9LA 3GAFA 2ZTVA 1QO0A 3EA0A 3S44A 1G60A 4ZN6A 1STOA 4N0MA 3H05A 2WWXA 4MQEA 4JI1B 2ZI6A 2WHPA 4W82A 2R7LA 3JWGA 3KDPA 4KXNA 3ER8A 1QCYA 2II6A 3QOWA 5K51A 4E46A 4RDXA 1R6AA 3HEAA 4JS0A 1PX0A 1F9EA 2C9DA 2QQEA 1WQ3A 2YKGA 1RRVA 3S28A 2QK4A 3KOUA 4DCCA 3JRXA 4J0IA 2D74A 2XHEA 3L8CA 4N5IX 2HIGA 1QHSA 3H4IA 4JQZA 2GRJA 1UQUA 4MMZB 1G8JA 4IXTA 1D0VA 3SBDA 3T7JA 4DJEC 1TM3E 2R00A 4UQLA 3EBOA 1N5OX 1GM5A 3WWEA 3HADA 5F23A 4KWEA 5EPUA 2W4IA 1B0ZA 4L4XA 3R5HA 1QGAA 4YCDA 3OCVA 4V0LA 1IN5A 3L6OO 3QMWA 4LYGA 1UPUA 1YXMA 2ZQZA 1G4HA 4P54A 2HLNA 4MX8A 1O5OA 4H1VA 2BCGY 3PBKA 3NBQA 5JJBA 1UOQA 3D5TA 1U0EA 5JMWA 3BIJA 4G63A 3UC9A 1Y1QA 1IXYA 1PV2A 3SQWA 3G13A 3GWGA 5CHEA 1JT2A 3O8LA 3C1OA 2GMWA 2V45A 3HLTA 3PNKA 4FZVA 3KE8A 4RA6B 1C81A 4MJXA 2CMFA 3DULA 1AKQA 1RBMA 1I5EA 2VBCA 3GRPA 3A25A 4H0FA 2CDCA 1LY1A 4X3PA 1N5RA 5HKKA 1SWVA 4KVZA 1FL9A 5D01A 3M6LA 2YYYA 5LN1A 1SMKA 2X4IA 4MVJH 4Z0TA 1VMIA 2EQAA 2IQ5A 2SHKA 1I30A 4JOCA 3U44A 2DLCX 3PXAA 3VJLA 4MRSA 4KFTA 3AUFA 1R7RA 3U7QA 1UCFA 2ORYA 1B0UA 1HOXA 1FLDA 2DQZA 4UVEA 1LZKA 2CXPA 5JC8A 3BA6A 4FZ3A 1BGWA 3CW9A 4JA0A 4BLQA 1JDJA 5CB4F 5EKTA 1C3LA 4HDRB 2ZR7A 3QPVA 1LLUA 3EWSA 1MIOA 1JT9A 5ALPA 1DFHA 1UFKA 1RBYA 2C29D 3GLKA 1AF4A 4E7PA 3VPCA 4DPMA 2PKRA 3O2QB 1YZQA 1YJBA 1HNNA 2FK7A 2F9LA 3ABZA 3HB0A 3HKEB 4KR0A 5JFOA 3K0SA 3MWKA 4IPTA 4Q93A 3ECSA 3OLXA 3A1UA 1TU4A 1US8A 4JQCA 4M8NE 4NG4A 5BVHA 3OIYA 2Y0CA 3L1UA 3EC2A 4LXTA 5J23A 1WXFA 3RR2A 1XWFA 2NM0A 4TWZA 1P5JA 2GCGA 4DCUA 2O54A 2LTAA 1GPLA 4O1HA 1XP5A 2IS1A 4Y2YA 1SVUA 2D1QA 3U3OA 1H2BA 1F1JA 2AQKA 4CFYA 1CV2A 3BBLA 2BKLA 2EKZA 2ZPTX 3BYZA 1C4KA 3Q0TA 5CJJA 5EUMA 4EMSA 4X91A 3IR6A 3GN1A 1ETUA 1CNFA 1HT1E 1NOIA 2R6AA 2XW6A 4FHZA 5LBIA 3X3HA 5BWOA 2GK6A 2WW8A 2H9YA 3DS8A 4OHZA 5CVTA 3QF4A 4WWHA 1W96A 2VVTA 3EARA 1N6IA 2EYUA 1GGJA 3IHWA 4L74A 1SVNA 4LZLA 1QOZA 1REQA 3ND7A 1DIHA 3OKCA 1BS9A 1SOWA 1RP7A 1UXGA 3FYTA 2QVCA 2WNSA 5AD1A 3GEPA 2O8NA 1MRSA 2R00C 1M33A 2ZROA 3OP1A 4CLEA 5T3UA 2H07A 2HA0A 3E2IA 3K0AA 1KDTA 3LFTA 1XJWA 3EXHA 2XCSB 3THYA 4GI5A 2D0PB 3GDOA 3IP7A 5EIBD 3UG6A 3AWDA 2V03A 1WHSA 3BCSA 5ALUA 3RNOA 1U0TA 2NO1A 1FRNA 1WMEA 4GMDA 3IJ5A 3L9WA 1E5QA 5JSQA 5AK4A 2PUEA 3VZPA 3LF2A 4EG8A 3U3XA 4H4EA 1FYVA 3IQDB 4JWTA 4MCHA 4Q3OA 1V95A 3LU1A 2RKBA 3TCKA 2Q99A 2X0RA 3EZNA 1CNEA 4RVSA 1ZIPA 3VDNB 2OCGA 4ND6A 4A9AA 3C41J 5JSYA 2FK8A 3GBVA 1E3WB 4OUDB 4B17A 4IDEA 3KJZA 3VYSB 5IFKA 3GU3A 1ML3A 4L8GA 1Y8AA 1H2HA 2QUBA 5A0VA 2M9MA 4CFZA 3D3NA 4KBYA 3SS7X 1A0OA 3I2GA 1ABFA 1NQTA 3O95A 2GZ1A 4JMPA 5AKXA 3KQLA 3CW2A 1BQEA 2V3VA 4B7AA 3KUCA 3PGLA 3SPXA 2VZ9A 1EVZA 4F71A 4DDHA 2ZI7A 4LMAA 3WB9A 4DKJA 4Q21A 4ZXPA 2GM3A 3IAFA 3K9LA 1GNLA 4CMGA 5ED4A 3F78A 4QUKA 3DWEX 4UHDA 4EHBA 1W93A 1NBEA 1XKXA 4PC6A 3KETA 1DGQA 3ROXA 1BXRB 2QSUA 1JAZA 4P84A 2JBHA 1E2PA 1SAYA 4UEKA 4JSTA 1Z2DA 1WDWB 1XXHA 2IYPA 4K9OA 3WYDA 2AYXA 4AAYA 1I9CA 1V7CA 1C0IA 3I6YA 1CUZA 3EW9A 3A14A 2ON6A 2SKDA 4Y1RB 4LS3A 5AUQA 1RMYA 3RTBA 3B85A 3WDSA 3UGQA 1YS1X 3RREA 3WI7A 2J1LA 1YRYE 4OMDA 3M2TA 4LY3A 2WLTA 3EAQA 4BC1A 2O0JA 4BJ6A 2POCA 3PL5A 2R1VB 1P73A 2Z2XA 2VJNA 3D2BA 4I8IA 4XJSA 4DYDA 121PA 5IM5A 4RIEA 1T0HB 3ZXSA 4OGGA 3T3GA 2X6TA 1VHTA 2CBGA 1DL5A 1C2TA 2GZSA 3FJ1A 3U6KA 2FSSA 4I36A 1GQOA 1JKFA 2HOQA 1JLMA 5BSVA 2JKZA 4YUYA 3C3JA 1OIXA 3KHUA