1VLMA

Crystal structure of sam-dependent methyltransferase, possible histamine n-methyltransferase (tm1293) from thermotoga maritima at 2.20 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
207
Chain Sequence
HMWHIFERFVNEYERWFLVHRFAYLSELQAVKCLLPEGRGVEIGVGTGRFAVPLKIKIGVEPSERMAEIARKRGVFVLKGTAENLPLKDESFDFALMVTTICFVDDPERALKEAYRILKKGGYLIVGIVDRESFLGREYEKNKEKVFYKNARFFSTEELMDLMRKAGFEEFKVVQTLFKHPSELSEIEPVKEGYGEGAFVVIRGTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SAM-dependent methyltransferase, possible histamine N-methyltransferase (TM1293) from Thermotoga maritima at 2.20 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords SAM-dependent methyltransferase
total genus 65
structure length 207
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vlmA00
2P7IA 1OR8A 3BZBA 4EK9A 3SXJA 2PT9A 3EEYA 4MHTA 3DXZA 1MHTA 1L1EA 2BM8A 1M6EX 2PX4A 2JHPA 2N47A 2EJUA 4PGGA 5GM1A 2PXAA 3HM2A 3HVHA 1M0EA 2IH4A 4KVZA 1JG3A 3DOUA 4CKCA 2R6ZA 3A7DA 2ZVJA 5EMMA 5CCXA 2PX8A 2E5WA 4OA8A 3CVOA 3EVEA 5DPMA 5DRTA 5ICFA 1XCLA 2BR3A 2PT6A 3EPPA 1QANA 5FULA 2YXDA 4QQKA 5GWXA 5K0EA 3Q7EA 4YMHA 2V74B 2BZGA 4PINA 4R6XA 2QY6A 1D2HA 3B5IA 3ID6C 2GS9A 2P8JA 2VDWA 3AWIA 2DPMA 4LG1A 4K6MA 5EZQA 3TRKA 3KQYA 2VZ9A 5K01A 3FUUA 3S68A 2OZVA 4DCMA 3EMBA 3D2LA 3M6VA 4DQ0A 1XDZA 3JWHA 2IGTA 4QDJA 2PY6A 4R8RA 3HP7A 5C1IA 3TMAA 3MHTA 3DR5A 1KIAA 3OU6A 1RJEA 2GPYA 3P2EA 2UZ4A 3BWYA 1TW2A 4PYQA 4CXMA 4DMGA 1YZ3A 3HVIA 3EGVA 4PCLA 3HTXA 1ZGJA 4KWCA 1ZQ9A 3T0IA 5JUWA 3LDUA 3KPUA 2Z6QA 2PLWA 2G72A 3LCVB 2IPXA 2QE6A 4WXHA 5CCBA 2ORED 5HIKA 3OFJA 4PWYA 4EMSA 3HCFA 3OPNA 4CKEA 1RI1A 2NYUA 3FPHA 5LQKA 3RW9A 3E7PA 2ONZA 1G6Q1 3R0QA 4P7JA 4QDKA 3PT9A 2P7HA 2UYQA 1Z3CA 3G5TA 3LECA 5EHIA 5GINE 4RTOA 2P41A 5CVUA 5EGSA 5K0BA 2YUIA 1KP9A 2AOTA 3IEIA 2YTZA 3TKAA 3MQ2A 1JTEA 3GNLA 4KRGA 2GAFA 1O54A 2KW5A 4CTKA 1RI5A 3OU7A 4FGZA 5ICGA 1QAQA 5E9QA 5HIIA 3OE5A 1RI4A 3HVJA 1EJ6A 3E23A 3FUXA 2PWYA 5FA8A 5LQCA 4FT2A 4BP1A 4KW7A 1L3CA 2I62A 2YVLA 3BWCA 4LWOA 3KU1A 3CJRA 1EQAA 4C4AA 4V0QA 5T64A 4GQBA 4RTSA 4BLUA 2HMYB 2BH2A 1NV9A 5E1BA 4C08A 2AZTA 3GGDA 5KYGA 4QPNA 2R3SA 4XCXA 1KYWA 3HVKA 3CJTA 7MHTA 4RTQA 4PYLA 3V97A 3H2BA 4FR0A 2FK8A 3UWPA 2V7EA 3B7PA 3LPMA 4E33A 5E1OA 4CKBA 1H1DA 5HIJA 5B1SA 5DX0A 2ZTHA 4P58A 4PYKA 5DM4A 4AZSA 1RJGA 1WG8A 2A14A 1L3IA 4X41A 5KS2A 5LQUA 4RYLA 3DULA 3P8ZA 5DSTA 3MTIA 1HNNA 3C3YA 5EKXA 3LDFA 5EMKA 5P8WA 3KPVA 2VS1A 4U7PB 4OBWA 3OFKA 4POOA 1G38A 2IDKA 3EVDA 1JQEA 4A6DA 2IH2A 5DM1A 4RX1A 1I1NA 3O31A 2OBFA 1BOOA 2ZCJA 3B3JA 4KDRA 3QV2A 2UYOA 2NP7A 4X60A 2ZIFA 1G60A 3I53A 3FTEA 3P71T 1X19A 2XYRA 1KXZA 1UIRA 3G2QA 2ZZKA 3SSMA 3TR6A 3ELWA 2EX4A 5U4XA 3ER9A 2PV0A 4OBXA 1JQDA 4BLWA 2ZW9A 4ER6A 3MB5A 1NBHA 3HCEA 3E05A 3EEOA 4RTNA 3OU2A 3R9XB 1BKYA 4QVGA 2G70A 4FSDA 3ME5A 5DTMA 2OO3A 2ZULA 4HSGA 1JSZA 3A27A 3DLCA 3NTVA 5GP1A 4FSXA 2I9KA 4M38A 2H11A 3UJAA 2HNKA 1XXLA 1TW3A 2VDVE 2WK1A 5EG5A 2UYCA 4FS8A 1EG2A 3CCFA 3UA4A 5BW4A 1X1BA 4RTJA 1SUIA 1NW8A 1V39A 3ANXA 5K03A 1NW6A 3FTDA 3FUWA 3DLIA 5KVAA 1UFKA 3CC8A 5H02A 1ORIA 2AN5A 2AOUA 3UFBA 4C07A 3TFWA 3PFHA 3EVFA 3GRZA 3M6WA 3PFGA 2PJDA 3LBFA 3KPJA 1QYRA 4DF3A 5DX1A 1QAOA 3DH0A 5DTRA 3TM4A 5E1MA 5C0OE 1F38A 3CJQA 3FPJA 3LCUA 3OZTA 3R24A 1KHHA 3HNRA 1R8XA 3CKKA 4DCGA 3P9NA 4ER5A 2Y1WA 4DM3A 4E2XA 5JR3A 1DCTA 2IBSA 1VPTA 4P7FA 5HFJA 5BXYA 2BR5A 4ER7A 2IIPA 2C7RA 2OPBA 2XVAA 5EOVA 3VSEA 3A7EA 4F84A 4GC9A 2NXNA 2ZSUA 3ORHA 3LDGA 5IKMA 1DUSA 3VYWA 3L8DA 2ZFUA 2CMHA 2PX5A 3ELUA 3I58A 3X0DA 3FPGA 3JWGA 4RVGA 2AOVA 2YR0A 3AXSA 3EGIA 3GO4A 2HV9A 4FP9A 2JG3A 1WXXA 3BGVA 3FTCA 3PB3A 2QRVA 5LQAA 3KR1A 5DM2A 3QOXA 5E2BA 5C9ZA 5K0GA 2AOTB 1VQ1A 4LWPA 5K0LA 4OQDA 1G8SA 3DMHA 4BY9E 3MGGA 5EEGA 3M6XA 3KR9A 4KIFA 4OQEA 2OYRA 1BC5A 5EC8A 2XBMA 4RTRA 1WY7A 3CGGA 1XDUA 3DXYA 3P9KA 1WXWA 5ERGB 3RIEA 1PJZA 2EJTA 3OCJA 1FJXA 3FZGA 2ZBRA 4QPPA 2FYTA 5LSAA 2ZZNA 3JWJA 3KR0A 2FHPA 3ER8A 3G2OA 3G8BA 3HCBA 3EVBA 1SKMA 2JH8A 3E8SA 4WVLA 5BP7A 4RTMA 2Q41A 3G5LA 1Q0SA 3GRRA 1JG4A 1JQ3A 3TOSA 3DMGA 3EVCA 3EGEA 5FA5A 5DWQA 2GB4A 5E8JA 2PVCA 5EEHA 3GU3A 3HCAA 4MQ4A 1BHJA 4AUKA 4AZWA 4RTLA 5GIPE 4C05A 1YZHA 4HRAA 1FBNA 3PVCA 2O05A 2I6GA 4AX8A 2BR4A 1WS6A 1KPHA 1NT2A 2XVMA 4E2WA 4Y2HA 4X63A 4ER0A 3SX0A 4R6WA 3P2IA 4RTPA 5EMLA 1KPGA 1AF7A 1VIDA 2P3OA 4GC5A 5CM2Z 3DTNA 8MHTA 2IBTA 3BWBA 4PCAA 4G56A 3KQSA 2ESRA 1IY9A 3C6MA 3LGAA 5IH3A 2AOUB 3MTEA 3P97A 3C0KA 1YB2A 2B9EA 2DULA 2P1DA 2F8LA 3GDHA 2ZWAA 3NVMB 3OE4A 3UA3A 3NDJA 5F2NA 4H0NA 5LQRA 4E2YA 3FUVA 5EPEA 1I4WA 5DLYA 1YF3A 2IH5A 3TPZA 2FCAA 3EMDA 3G2MA 3P9IA 3QOWA 3HA3A 5F2OA 2VP3A 2ADMA 5KQRA 3PX3A 4R05A 2ZWVA 1R18A 4AZTA 3OZRA 5T67A 1FP2A 4GUAA 2CKDA 2NNWB 2B2CA 5E8RA 1WZNA 2ZBPA 1R74A 4GOOD 5HILA 4HTFA 3KQPA 3SM3A 2H00A 5GOZA 3SVZA 3LKDA 1NE2A 1ORHA 4CWAA 4RVFA 3DMFA 5T6BA 4YUWA 4EVIA 3KQMA 3THSA 3DXXA 4PGHA 4X61A 5CIYA 2G1PA 2B25A 2XYVA 4M7RA 1ZHFA 3UJBA 3UJ6A 5EMJA 2HR1A 4IWNA 4NECA 5GM2A 3LSTA 5E9JA 1R6AA 3A26A 1VL5A 1Y8CA 5EIFA 2OXTA 4C03A 2OB2A 3F4KA 2LD4A 2YQZA 1JTFA 5ICEA 3NVKI 2P3QA 1P91A 3ELDA 3FPFA 5FQNA 4HH4A 4RWZA 3BXOA 2AR0A 2CL5A 5K0FA 2NXJA 3KQTA 5K0JA 4MWZA 4M37A 4GF5A 3V8VA 5EIWA 4YV1A 3SR4A 4ZTBA 3T7SA 3TKYA 4E70A 4YV2A 2AVNA 2UYHA 3UJ7A 5LQNA 1AQJA 5M5BA 2O57A 3PTAA 1G8AA 5DSXA 4PYMA 3GRUA 2K4MA 4O29A 5EHGA 2OB1A 1JSXA 1N7IA 2ZZMA 3MERA 4P7KA 2P40A 4L7VA 3FPEA 1G55A 1NV8A 4MTLA 4RV9A 2GH1A 2AS0A 2ZIEA 3R6TA 3SSOA 3REOA 2GLUA 4XUEA 3NWBA 3FTFA 1RJDA 3T7RA 4OA5A 5EZSA 4UOEA 3DP7A 3UJ8A 9MHTA 2PWPA 4YUVA 3KPWA 3TQSA 4QQNA 1P1CA 3EVGA 1SVUA 3G89A 1XTPA 2AOWA 2PBFA 4HC4A 1O9HA 3SMQA 2HWKA 4GBED 1TPYA 2P3LA 3HCDA 1YFLA 3BUSA 3BWMA 5DTQA 1QZZA 1AV6A 2QRVB 4U7TB 1D2GA 3EVAA 1KPIA 3B89A 5F2KA 4PIMA 3UJ9A 3KR2A 4R8SA 4DA4A 3A4TA 1IM8A 4YV0A 4YMGA 4OX9Y 1KYZA 3LX6A 1M6YA 2XYQA 3UJCA 1MJFA 2YX1A 1EJ0A 1VLMA 3KKZA 2AN3A 1RI3A 3K0BA 5FQOA 1NBIA 3GRVA 3P2KA 4GOMD 4KIGA 5FUBA 2JHAA 1JR4A 3BGDA 3KQOA 2H1RA 10MHA 2JJQA 2ZBQA 1N7JA 3G8AA 2YXLA 4HGZA 1NKVA 1VE3A 2PKWA 3DUWA 2FPOA 2JHCA 3FUTA 3NMUF 2B3TA 1EAMA 2QYOA 2WA1A 3R3HA 4E31A 4EKGA 4A6EA 4DKJA 3KPYA 2FK7A 1UWVA 4XUDA 3G2PA 3U81A 4HTFB 4BP3A 1B42A 2PX2A 1VBFA 2EFJA 5HIMA 5CVVA 1INLA 1XJ5A 4E2ZA 2FRXA 2PSSA 5CVDA 2AVDA 4RTKA 3NWEA 3WSTA 2PXXA 3K6RA 5CVJA 2VDUE 2IDJA 3LBYA 3BKXA 2NP6A 3HA5A 3FRHA 3GWZA 5MHTA 3KQWA 3GCZA 5HEKA 3LKZA 2PXCA 5HZMA 1KR5A 3IHTA 2CWWA 4F85A 3IYLW 4EKIA 1FP1D 4PNEA 2ONYA 2OY0A 4ER3A 4Y30A 4CTJA 3TM5A 1SUSA 1R8YA 4LECA 1Q0TA 4KDCA 5DXJA 2ZIGA 2YXEA 5K8VA 4QVKA 1D2CA 2ERCA 1X1DA 4E32A 3OZSA 4GEKA 3A25A 4Z2YA 3M33A 3LHDA 3MCZA 3TLJA 1R00A 1X1CA 3NW9A 4EQZA 3PLAE 1ZG3A 2I7CA 4PYOA 3O4FA 2CMGA 3FYDA 3GXOA 4YUXA 5BW5A 1T43A 4FT4A 2O0LA 4PIPA 2PGXA 3KQVA 4GOND 2Z6AA 3CBGA 5K09A 4MIKA 5K0NA 5E1DA 1VP9A 3Q87B 4HGYA 1EIZA 1DL5A 4AZVA 3LL7A 4X1OA 5KQSA 1P1BA 3BKWA 4XUCA 4IKPA 4BLVA 2GA9A 2JH9A 1U2ZA 1RJFA 3JWIA 1YFJA 1SQFA 3VC1A 4DZRA 5DRYA 2NXEA 1XVAA 2WA2A 3MAGA 5E2AA 4RVHA 3C3PA 3SGLA 3B3GA 1SG9A 2AOXA 1I9GA 3BT7A 5HOQA 5DX8A 5K05A 5DM0A 4ISCA 3GRYA 3HA7A 3M70A 3NJRA 4JXJA 2BM9A 3FRIA 1NW7A 1NW3A 3AJDA 4IV0A 2Y1XA 5LQJA 4M36A 4B17A 3EVZA 2OKCA 4YUZA 3FYCA 1XCJA 5CVEA 3SSNA 3O7WA 2QM3A 1RI2A 3KHKA 3PX2A 3G7UA 5EKUA 5FTWA 1L9KA 2IFTA 4V0RA 3UZUA 4YUYA 2G71A 5FADA 3IV6A 4QTTB 4RVDA 1PRYA 5FHRA 3RODA 4FZVA 4ATNA 4E30A 5ICCA 1JG2A 3M4XA 1L3BA 1NW5A 4IV8A 3BGIA 5FWDA 1JG1A 3AY0A 5FCDA 1QAMA 3ERCA 3C6KA 1VP3A 5CUQA 3M6UA 1HMYA 5EVJA 2C7OA 2NXCA 3G88A 3KQQA 4HG2A 4GOLD 3UJDA 4C04A 5LR6A 4PYJA 2B78A 4RSRA 2C7PA 1F3LA 1FPQA 1O9GA 1XDSA 2G8NA 2O07A 3HEMA 3I5UA 4F86A 3UBTA 5CD1A 2C7QA 2EG5A 2Z6UA 2IP2A 4C06A 5EQJB 5D1HA 3I64A 4PONA 2ZLBA 3HCCA 5FHQA 3LCCA 3GIWA 3ELYA 1X1AA 2O06A 3PS9A 1IXKA 3B3FA 3GJYA 5G02A 4P7GA 4QTUB 1AQIA 3AXTA 2AN4A 3MCTA 5FWAA 4PYNA 5DT2A 3T7TA 2P35A 3P9CA 4PYIA 1ZGAA 5E9WA 1N2XA 3I9FA 3VC2A 5GIOE 5K0CA 5D1NA 5DXAA 1ZKDA 1P39A 1YUBA 3THRA 3NDIA 2HTEA 1SQGA
chains in the Genus database with same CATH superfamily
3JVEA 1KI9A 1MORA 2Z2KA 4F21A 1GZ3A 4CM9D 1AGXA 2PT9A 1YHNA 3GZJA 1GGFA 1MXHA 4AO7A 1E2UA 1TM4E 4EB6A 3VDRA 4ZDIA 3CW8X 3T5TA 4F6RB 2D8AA 4BPBA 5I7SA 4WKGA 1XZ8A 1VCIA 2O48X 4D81A 3N75A 2EBUA 5ILQA 2Q7DA 1N5OX 3CEAA 3ESBA 5CLQA 4ZCLA 1CQIA 3ON5A 5EMMA 1SBIA 4URFA 4KQCA 2D5BA 1LS6A 1XCLA 2BR3A 3TRFA 1KK1A 1BHSA 3DV0B 5HX7A 1WBBA 1ZCFA 2RK3A 3IDFA 4CIVA 1YKGA 1TU0A 3AUKA 1RKVA 1U0LA 2CXNA 3QXCA 4EJ0A 1SQSA 1D2HA 3FIUA 4P0QB 3CX4A 4K6MA 4WXPA 3RQSA 2EKDA 4ZWNA 1FNNA 1K7SN 3E2MA 1JECA 3CLHA 3PR2B 2IOFK 4OKIA 4EUFA 1COWD 5HFAA 4KR7A 1I6WA 1C3LA 4UQPA 5B3AA 3KTAB 1G6OA 4CHTA 4EMTA 4MPPA 2YJ6A 3JAWA 4R40A 5EINA 2HIHA 5ENVA 2PRIA 3HDTA 5CDHA 4PPYA 5IAOA 5DLQC 1U0OC 1WPGA 4Q12A 2Q62A 2QB5A 4ZYXA 4Z4FA 3U3JA 1YS2X 2QM7A 2HRQA 3OX3A 4B2LA 1YJ8A 4MUIA 5A7HA 3GA7A 1QV6A 2MJLA 1EFRD 3PC7A 4HDKA 4UEKA 4MV7A 1VE9A 1Z35A 4LZAA 4G36A 3W8FA 5JJIA 1TD1A 1T2UA 3RS0A 5FEMA 2GBLA 5F98A 1KH2A 1KAMA 2E4ZA 3FROA 3LXRA 3ZVLA 3PQCA 3MFYA 3MOIA 4K9DA 1F14A 4MK4A 1O95C 3A06A 4IQGA 1QQTA 2XNDD 3B6ZA 3QLVC 4LHYA 1K06A 4JD5A 2ZRJA 3DZ8A 3GI1A 1HA3A 2ONCA 3L1IA 4HEA6 4PPQA 5A05A 4GX1A 5ICGA 2QRHA 5HIIA 1EJ6A 3A9RA 4ZRDA 3GEDA 5H82A 3MWEA 4UMEA 2EWWA 1L3CA 2C7GA 4LFCB 3KWFA 4P2BA 3ZWOA 2GMWA 3ZZ0A 3ZJTA 1AH2A 2D2EA 1LQTA 5ERXA 3VDXA 5T64A 2AQHA 2HMYB 1E1NA 2I34A 2WDPA 5E1BA 3EIEA 2FSSA 3MLEA 3WK5A 2ZRIA 3CHYA 4R98A 4EJ6A 2RJNA 4GL4A 1UKYA 1RKQA 1UODA 3IP5A 2XUGA 1KXJA 4WOCA 4CLXA 2K7ZA 4ISBA 2I22A 3UMSA 3DE4X 3MJ4A 3UWPA 5U9CA 2V7EA 3OC6A 2HAEA 5IHXA 1VJ0A 3FVVA 5DX0A 3MD9A 1N2OA 1D9XA 4BFYA 4KQEA 2P69A 3M4NA 3FWZA 1HORA 5J63A 4ICIA 1OWMA 4IMIB 4ME6A 5FLYA 3C8HA 3I0ZA 3OCWA 3ROZA 1CS0B 3KHTA 1Z8HA 3MTIA 2GPSA 3AINA 4G65A 3CLUC 2EBWA 4MUHA 4AUEA 1ZR4A 2I4TA 1LI5A 3WFJA 4GLOA 3K2IA 5AI9A 5EMNA 4DOMA 1R27A 1V5FA 1ZGCA 4DSUA 1PVOA 1MB9A 4DXHA 4TL7A 3ZZMA 4R2IA 1OXXK 3GFGA 4DCVA 5DB4A 3GD7A 2A5LA 1U8EA 3KJIA 2CDBA 2CK3A 3HE3A 3PJEA 2AMLA 2BCGY 2VNHA 2R8PA 5DM1A 5CCDA 3PUWA 1GITA 5CJPA 4BIMA 4UQOA 5REQB 2G6BA 4L4YA 3Q5DA 1JI0A 3AW8A 5T4BA 2NP7A 1SVMA 1OVMA 3QPUA 1UJMA 4CQLB 3G2QA 4DIUA 3SXPA 2C4KA 1F5NA 3CLTC 5ECWA 5B58C 3LL4A 3GVIA 3O9ZA 4QDXA 2D2IA 3UFXA 5TS2A 4JI8B 3WBFA 4HZUA 4B8ZA 1O0SA 4TS3A 2V0CA 1DLJA 4RAOA 4DUGD 4OTZA 3N8DA 4DR1B 3WV4A 2ZRMA 1YDHA 4TRRA 2A86A 1DHTA 1L4HA 1MJNA 4PZCA 1G21E 1DIBA 4G4JA 3VPSA 4PAWA 1JYFA 3W5UA 2K2QB 1BFKA 2H59A 1BCRB 4Q9IA 3D6HA 2E82A 2XA1A 2GO1A 1Z4MA 2JW5A 3LK7A 4G1UC 5KTOA 1XCOA 2WSYB 2WOOA 3LBNA 2VHVA 1AB5A 4NBLA 5DOZA 4HQRA 3LHKA 1M5RA 3G9QA 5B4UA 2J9RA 1WF6A 2OP1A 5KHOC 2I99A 1BH2A 2X1VA 1T4CA 3GRZA 3LP8A 4W1RA 4XPZA 3DBLA 4KJXA 3K0KA 3PNMA 1CF9A 2QG4A 4NCIA 2RJOA 5DIFA 2IE0A 2XUDA 1MVNA 4OQPA 3WGLA 4UQLA 5K9ZA 4JI2B 4AMUA 2VXOA 1ZJ5A 1RAGA 3HNRA 4S1OA 1DSSG 1XLUA 1DXHA 2AUTA 2BM0A 3LUHA 4I9FA 4G1EB 1PZXA 4I1OA 3E58A 5D86A 2BR5A 1UANA 2V7XA 2YNMC 5FYQA 1QS0B 4A0RA 4F84A 2HHJA 4X7MA 3QKUA 2E4WA 4MPTA 3ZHRA 2CFTA 1J7JA 1SQ6A 1R7RA 5MDHA 2QQEA 1EE9A 3PQ4A 1VLJA 2XVZA 3RVMA 1M10A 4URZR 2JASA 5JCJD 2AG0A 4IXMA 4J0IA 1GCOA 2WW8A 3P5BA 4FP9A 2J08A 1WAMA 3GLIA 1QQAA 2ZE5A 2YZ2A 5JRJA 3FKQA 5E2BA 2W8ZA 4MUNA 3I9KA 3PP8A 1WBDA 3UMMA 4JASB 2VJDA 5F3DA 2J4FA 1Y8AA 4KN6A 3EZLA 3G5MA 3MGGA 2A7XA 3FHJA 1ABEA 4RFLA 4JFRA 3V55A 1NXSA 1VJRA 2B0JA 2P4SA 3GAMA 1A9SA 4LTNA 1E6EA 1P5ZB 2IP4A 2R1TA 1ZW6A 3PLNA 1GSHA 1WETA 1HH4A 1GAQA 1PZEA 1GRRA 3GLQA 4GLFA 4GU5A 4MICA 4QPPA 4UTOA 1AMNA 3WL6A 1CW2B 1UXGA 2LR0A 1OIWA 2NSHA 4TLMB 5CDUA 5CFPA 3AOGA 4C7OB 4JC8A 4D9BA 4LMPA 1JT9A 1RHRA 3LUGA 2RGDA 2QLNA 3PUIA 3G5LA 4MULA 2QVCA 2A88A 3I4LA 1ZUNA 2INGX 4QYSA 4WAUA 4MTCA 1EA5A 5H59A 8LDHA 1YCHA 5IZCA 5MGBA 3W34A 1DAMA 2QMZA 3EVCA 3GDWA 1XO1A 4GM4A 1JVBA 1PQYA 4MQ4A 3KL4A 4PAGA 4M53A 5DCYA 3RRMA 5JMOA 1SEVA 4HYQA 4DLTA 5K3AA 2AHOA 4AX8A 4OAQA 4KRYA 1N7GA 4K6FA 1Z15A 3SX0A 3D3WA 3LNCA 3KZCA 5LQCA 3UJPA 1Q0RA 1AF7A 1KEWA 3QE2A 3DTNA 5JYCA 3GDGA 4RZHA 5AI8A 1K0FA 3K5WA 1A8UA 3DGEC 4FYJA 3BIWA 1SG0A 1YB2A 2P1DA 2YW2A 4R1MA 2C4MA 5AVJA 3VU0A 2QMOA 3DBLB 3NDJA 3GAAA 1JQLB 1M66A 1Z68A 3GYBA 3PRJA 4HDRB 3VU9B 5F2NA 2RE8A 1JR3A 2Y9PB 1O5TA 1KSFX 2FVXA 2VUHB 4Y6RA 3W0LB 4U7GA 4YASA 4BX3A 1JDVA 5B53A 4AXBA 3EXEA 1WMSA 3RRZA 1AQNA 2ADMA 1E4EA 3A4NA 1A69A 1XLTC 3AUXA 2V7WA 4HHEA 5KQRA 1SA0A 2Y2VA 4RPJA 2A2ZA 3K9NA 1OH7A 1OX4A 4KXVA 5DNUA 3QU5A 3BEOA 1PS9A 5HQTA 3TR0A 1W4CA 4LSGA 4QHYA 2JLYA 4ACBA 4OHUA 4Q9NA 5CITA 4RVFA 1Y4AE 3DXXA 1VI5A 2PX3A 4TTPA 5T41A 3O47A 1N8TA 2GO7A 3E3OA 4M8KA 3SLRA 1TTTA 3KOOA 3IBGA 3SHFA 1G16A 1IU9A 4I4NA 1NT4A 1YT5A 4MRRA 4JNCA 4M7WA 5CH8A 2LD4A 1BH6A 4FDMA 3UKJA 2BGRA 1P91A 2UUAB 5ELMA 1TIKA 3O8OA 5FQNA 1D1SA 1IY1A 4GE3A 2X4GA 3JTMA 3G7SA 1A7AA 3IBTA 1YVUA 3JSXA 3OOWA 5EWJA 3THYA 1W49A 3QQPA 4HH0A 1IDN1 3T3PB 2A78A 3NOQA 1RADA 5DN9A 2BH9A 3GROA 4D56A 3GNTA 4EATA 1Q2XA 5LZ4A 1P7CA 4V03A 5FLXA 2PQ0A 5DJ5A 3QVGA 2ZROA 1DEKA 3OP4A 3RI3A 3WB9A 2XB2A 2BUAA 4NR0A 1FTYA 3O8QA 4PFQA 1DOHA 3I6YA 3W2IA 1ZUNB 3EIHA 2O8CA 1TVKA 2QIPA 4E5SA 4KPUA 1T5OA 1PQUA 3ZS9A 2ZIXB 3P96A 4YUVA 4EA9A 2FMTA 2ETXA 4QUKA 2PBFA 3RVPA 3KBOA 2Z3VA 4C6SA 4WGFA 3SMQA 1YASA 3JQ8B 3ZKWA 3D3WB 2QRVB 1UKZA 1D2GA 3A0UA 4U7TB 4HDMB 1DJLA 3KYJB 2VDJA 4YV0A 121PA 5BQ3A 1XF9A 4OF4A 4WCFA 1APBA 2UAGA 2P78A 1YTUA 1X74A 4CODB 2HF7A 2ZDGA 4JEHA 3WLKX 3NQ41 5EXPA 4KSBA 3K0BA 3UY4A 2ZR0A 3P2KA 1ULSA 4OHPA 5JQGB 5EWMB 4MVJD 5HP4A 3KKQA 4E5PA 1C7RA 3VFDA 3KJZA 3A4LA 1L7NA 1NKVA 1RKXA 1YRHA 4G0YA 2NADA 3CW2A 1XZGA 2OFPA 1RC8A 2HX1A 2G5PA 4BP3A 1D1TA 1I2AA 1VLHA 4D3ZA 1C7IA 5IN4A 1DFHA 1E94E 1P0PA 1YJXA 5JQGF 4KPEC 4E15A 4TYYA 1EIWA 4PO8A 4NG5A 3V4RA 1WIWA 3G02A 3NGLA 1ISIA 1M2KA 2CL7X 3OQVA 3WSTA 1XKTA 4Z49A 4LJAA 4UNSA 5CLJA 5HEKA 1AKRA 1CUZA 4BO4A 1I3NA 2CBZA 4OFZA 1ZJWA 5HZMA 4JQOA 2IIVA 1K27A 4EW6A 5FI5A 3USES 2P9EA 3QLTA 2JGIA 1H05A 1HE8B 4W1PA 4YRRA 4IZOA 1SUSA 3TM5A 4C0XA 3L7DA 2FZ4A 4ZQBA 1YA6A 3DS8A 4TMZA 1AMOA 2JCGA 2ZTVA 2QGZA 2REXB 1C9MA 1PJSA 3JWPA 5JY6A 2OQIA 2XUHA 3L8YA 1CUWA 1Q1EA 3K31A 4GEKA 2BT4A 2ZR8A 4UAUA 4GP9A 2HU2A 3ETEA 5ES4B 4QWMA 1GZDA 4CV3A 2F00A 2H1OA 4JK3A 5F5NA 1SHZA 1RYYA 2C8JA 1M7HA 2XB9A 2PWZA 2XLBA 3K92A 4WE3A 4Y0NA 4CUJA 4JEMA 1AKYA 4TMWA 5DN6A 5KNBA 1H0RA 2PD6A 5F3RA 5LQSA 1X3LA 3UC9A 2VZ8A 3IQIX 2ZAMA 4FN5A 1VJTA 2VF8A 1JKIA 1U8CB 4CU2A 5H8WA 5KQSA 3T3GA 3IKTA 2V5UA 1WDWB 3S28A 5D84A 4Z7JA 5K3FB 3BD6A 1N0WA 1VIAA 3ND6A 1C9JA 3H1BA 3E7XA 1KZYC 2MYUA 2J67A 3RRNA 3AJ9A 3ZCQA 4L0DA 2IUFA 2ECKA 3QEJA 4G0OA 1RQPA 5K8IA 4TT3D 3ADKA 1M72A 2GKGA 2NAPA 2RB4A 4PU0A 2Z4SA 2CHVA 4XKJA 4DRZA 4WZBE 1WZ2A 1XZAA 3LPNA 4PEVA 4QXQA 3NJRA 2Z9DA 3I9MA 5E4TA 3LX5A 2RAUA 1PLJA 4Z53A 2GK4A 1U8YA 4QEDA 4XA8A 1QU2A 4ZARA 1UJCA 4OYHA 3QX9A 3N8KA 5IJ9B 3MBOA 1OA1A 2JL1A 4IIDA 2DYKA 4OHVA 3O4RA 4RV5A 1A8QA 2UZ0A 1N4DA 4LJ9A 1QE0A 1R4AA 1G4HA 5TPWB 5FHRA 3RODA 2K6GA 3TO5A 5GQSA 4EMBA 4KWIA 1ZAYA 4F4HA 2C1ZA 1OLUA 5DFAA 1P77A 1VPWA 5F5XA 3A1UA 4QIHA 5HK9A 1TVCA 3FVTA 3TIXB 3AVXA 4XI9A 2I7XA 4OGLA 3CKYA 3DCYA 4UU0A 3HO8A 4HQLA 2C4HA 5CXUA 2WD9A 4Y6OA 1UPXA 3N0WA 4H4DA 4IIXA 5TQVA 4D1YA 2B78A 4EM6A 4F6CA 5BN5A 1MH1A 1O9GA 1G3RA 1CS0A 2XTJA 4GI2A 4YRIA 3UJNA 4CM8A 4LSMA 1Y6ZA 1XMIA 3G68A 1Z5OA 3ADOA 1RHKA 3QBEA 1HPLA 2UKDA 2YRFA 2QHXA 1IIBA 4YA6A 5CIWA 3STYA 3VI3B 4UNNA 1YMQA 2FDRA 5EJIA 2IYEA 1PWYE 3I6BA 5DT2A 3TGWA 4LXHA 1DAHA 4QEZA 2EGHA 3KYCA 3FNGA 2O7VA 1MA3A 5CXSA 3NANA 3JQBC 5I48A 4O4HA 3SC4A 4EG1A 2FFAA 2QSUA 3U3OA 3WX0A 3QF4A 2HTEA 1HYEA 4CQLA 1GNRA 1Z12A 3FKSD 4OH7A 4QBIA 1PHPA 1P6XA 1U63A 1E9FA 1NVMB 1U3DA 4Q7KA 2BSAA 1C0KA 2IHKA 1J2EA 2ZJZA 3BXEA 3AYZB 2A1IA 3CWCA 5GM1A 3YASA 7AT1A 3UMVA 5EMHA 4J0CA 4IVRA 4OIFA 3LVQE 1AMUA 1TXGA 1U0NA 4HB2A 2DM6A 2LTAA 1M7GA 4WNYA 4CLOA 4OA8A 3EVEA 5JI3E 1U0BB 3HUDA 3NWJA 2ZVQX 1RMTA 1BCRA 3NBQA 3ONDA 4OJYA 4I1RA 3QFSA 1OI2A 2EZTA 4DA6A 1ZI8A 4MNTA 5KNBD 3ZIAA 4I1YA 1LGYA 3T5AA 3LA8A 2OV8A 2X0RA 5J2UB 1DBSA 1OV6A 1A9RA 1MTOA 2Z58A 1R3UA 2HRDA 3BSYA 3KQYA 2ZCUA 4XFDA 4DV1B 1CZUA 2CB0A 3GELA 3FR7A 3M6VA 3C24A 1KGSA 1PUJA 3HCPA 2LCFA 3P26A 2PA3A 2Q3DA 4F8EA 5BSHA 4NJMA 2PY6A 2Z9CA 3DMYA 5CB4F 2EQAA 3ABOB 1NBMD 1VGRA 4Z7OB 5DK4A 1VFNA 4XSGA 4YPOA 4N12A 1MFPA 4DSAA 5TPWA 2FEMA 3HVIA 2BMVA 2FPXA 2IZ6A 4PAQA 2V7PA 2H1WA 2X8WA 4JLUA 5DYTA 4BKPA 2XNCA 1Z18A 4W99A 3ZVNA 4WY8A 1K5HA 1MCZA 4WLVA 4L28A 1J21A 4CKEA 5JD3A 1NLMA 1F20A 2YWXA 1CVLA 2OC4A 3E70C 3SJ7A 2HGZA 2VA9A 1W85B 3D1VA 3K1YA 3IVMA 4IZHA 1TM3E 4NV1A 4U7FA 4F4JA 5BVGB 5FWNA 3KB1A 4RPCA 1WL8A 1QOQB 2AE2A 3G5TA 4JEUA 4K1LA 1P61B 5HS6A 3VYSB 4A1FA 3E0QA 1FFBA 4XYMA 3RTCA 3O94A 1XN1A 1D04A 2AOTA 1NTOA 1MD9A 3I72A 4L2IB 4CM8B 1ENOA 1JTEA 4LHXA 2DBZA 3T7JA 3UWKA 3HBAA 3GLGA 3MPOA 2Y0BA 4YRCA 2VPYA 2C9MA 3T12A 4KBYA 3C6BA 2W2PA 1KJIA 2Y3IA 3N1UA 5GOTA 3ECAA 4E14A 4KW7A 3V8EA 3QVTA 1JT2A 4CDNA 2A58A 2C9OA 2C61A 3BWCA 1V8ZA 1OTXA 4DUGA 1JG7A 4IDGA 1UMKA 4M3NA 2RGCA 2OYSA 4ADSG 4A0SA 4DVJA 1P5FA 1V4VA 2HLDD 1JV2B 2RH4A 2ZJ7A 4DBVO 2VSXA 4JJ7A 1LVUA 3DC7A 1D8TA 1HLDA 3DBHB 3MT7A 4XCXA 4TVSA 4PYLA 2LW7A 1T1EA 1ZONA 3ITKA 3V1KA 3B7PA 4F4UA 2ZUWA 3PC6A 1H1DA 4AP6A 3BERA 3NBYC 5BWCA 1ODSA 1D2EA 4L6IA 1H8HD 2R1UA 5F78A 4CKCB 2IXDA 4H17A 2B8WA 3VX4A 1R0SA 1UMBB 3FTPA 4NARA 3R5FA 5BOSB 3S7ZA 4Y6QA 3DULA 1ZN7A 3UAYA 4W7SA 2X5NA 1REQA 4I50B 1KZ7B 1XA0A 4KH0A 1NASA 5DBEX 3UEOA 5IZCC 1K8XB 1JHAA 1OV4A 4M46A 4AAYA 3AVUA 4DLBA 4FFDA 3COSA 4NZZA 4OMCA 3EVDA 1WVIA 5C4MA 5EE0A 4P9NA 1SVKA 3G9TA 4XD2A 5NLLA 4NJMB 2B4KA 3H5WA 3EE6A 2GQ0A 3OBBA 5FOSA 1FTSA 2BBWA 4NQZA 4B32A 1NLUA 4FNOA 3TRIA 3KP1A 3VO9A 1YZTA 5C51B 1FXUA 1IRXA 3E9RA 3RS3A 3WLNA 4I36A 5ANRB 1FUIA 5AUQA 3PDUA 5FR1A 2EFDB 3GLVA 1PGQA 2V6JA 5BW6B 2X8JB 3TBFA 2O50A 3R9XB 4EI7A 2J3KA 2HEIA 3PQDA 3TX6A 4FSDA 1Z6ZA 4IO0A 4JLNA 4H3KB 3L4KA 1XTSA 1X0VA 1VSQA 5BVGA 1J00A 1SKBA 2CV0A 2V7VA 2C07A 1PEDA 4O2AF 2VDVE 2CZQA 5F1KA 4HDNA 3NUQA 4TMXA 2XDQA 2Z5VA 1TYCA 2MSNA 4IWYA 3VO8A 3UV7A 4XLTA 1WW3A 5JG7A 5BO5A 1H4VB 3ILVA 4N9WA 5BW4A 4GMGA 4M6WA 1NW8A 3AI2A 4DQVA 2GD1O 1PT6A 3FTDA 4K5QA 5KVAA 2O3SA 1BRMA 1J1UA 5AJHA 1AQYA 4DPKA 4XM2A 4M22A 5CU7A 1JR3D 2JFGA 2OCIA 2RHTA 1Z62A 2JFHA 3O4GA 2CXXA 3OETA 3PFGA 3UPTA 4LKRA 3W1VA 3IEKA 5TQ0B 1ENPA 1WOYA 2WAXA 4EKYA 5AESA 3MJRA 1QIKA 4KPGA 5KVVA 3T1TA 4ZCTA 3WJ7A 4IYJA 3P9NA 2V7UA 4JP2A 4F5ZA 1EESA 2Q50A 1TVKB 3UXEA 3DEFA 5FV4A 2ZVPX 3EGOA 5I01A 2DQSA 3INNA 2C4UA 1RAIA 4GC9A 1UUFA 4UUQA 1G8MA 3LVFO 3ORHA 1X87A 4FTWA 2F8TA 1H23A 1GCIA 5IZ4A 1YE3A 2CMHA 3BB4A 3FMIA 3GNQA 1NSTA 3AC0A 3JWGA 4H6PA 4JLOA 3UGKA 3ZTTA 1MKYA 2OP0A 3IAS1 3ZE7A 4D7AA 3T3OA 4L5IA 3HYTA 3M34A 3R6GA 1GKUB 3RUEA 2FZ5A 2CVQA 4YRDA 3K8QA 2GJ4A 4BDSA 3BE4A 1CNEA 3V8NA 2BHLA 3W9SA 3ZV6A 5CJ2A 2X3FA 5LU8A 3EF1A 3SK0A 2BZ1A 4RZSA 3RE1A 1HWYA 2IXTA 4RDIA 1EBUA 4X8MA 3TTYA 2FEPA 2CUNA 4C76A 3B53X 3DONA 4F1KA 3SYLA 2ZYSA 2QT1A 1MC5A 4MP6A 3KCQA 4RPKA 4GOXA 3KD2A 4KHPB 2OXCA 4CF7A 1U0GA 5BNZA 3K53A 3UWDA 1V5WA 3PGKA 4RD6A 4TTIA 4OLJA 5LNK6 2Q41A 4HYEA 5D3ZA 3LRTA 4JYAB 3K9BA 3S1AB 3QXSA 1F60A 5LZ5A 3NBXX 3PGXA 4U9IS 3WYGA 5L8VA 1ZVMA 2VVTA 1GL7A 4GPEA 1OBVA 3BZUA 3TUIC 1BVHA 1E3EA 2VJAA 1G63A 2J3IA 2VXCA 2W0MA 1EJBA 4MR8B 3TBKA 3VZDA 4BX2A 2ISQA 1KOJA 2QG6A 1WLSA 2HPAA 4OHRA 3DO6A 2XCSB 3STTA 3V7WA 5F4ZA 4E3ZA 5EMLA 4RLQA 2VJCA 3HKBB 3ND9A 1T8SA 1RQ7A 1QBKC 4S24A 1H8HA 3RHSA 3ZBPA 2WNSA 4PCAA 3CZRA 2UZAA 3IVRA 1IY9A 1K5GA 2VNIA 2AOUB 4TQUS 2A4MA 5DULA 1DPGA 5CPFA 3OE4A 3EY4A 4KLAA 2GYUA 4H0NA 4EUNA 2HMAA 3KQUA 4CIYA 3DWGA 3FUVA 5EPEA 5C8ZA 5CW1A 1I4WA 4Z4EA 5DHRA 3QUBA 1V95A 4BGUA 2GF9A 3QF7A 3TPZA 4MDFA 2B2NA 2WNIA 5ALLA 3IOBA 2IHBA 1W48A 3NB0A 2CNOA 5FOXA 4DLWA 2MYNA 2P4UA 2WFLA 4KACA 2WJWA 1TEVA 3GEMA 1Q21A 2O1EA 3M2PA 3WLTA 1Q1QA 5SICE 1BEUB 2JF0A 2M2IA 3ETNA 4X0EA 3SR3A 4LTDA 3T1VA 3T35A 5AKKA 2IXGA 4F8JA 1YUNA 5BSWA 3ET5A 4BLQA 4P34A 1OW3B 1P45A 4L74A 2CF5A 2YS7A 4EVIA 3HCOA 1RS0A 4RXUA 5EIBC 4LJ6A 1B00A 1GZ4A 3CZPA 4E5VA 1E7WA 2G09A 4N76A 4LDJA 4FZ5A 4ENSA 3IX7A 2P6OA 2E1RA 4WLFA 3U5TA 1W30A 2WUEA 3QWIA 5CIQA 5EKSA 4BEJA 4NU0A 4BMZA 3I2KA 2O6LA 3U26A 4AMZA 1CQZA 4NBRA 5JVDB 1GCAA 2FP4B 1ZD8A 4GF5A 4UZSA 5I8ZA 3TKYA 3DM5A 1ZCZA 3FKSA 3O8BA 1VMDA 3GT3A 1S2GA 2PE5A 1JKJA 2K4MA 1XPUA 3G0CA 3IOYA 3THOA 1M67A 1Z2DA 1KHTA 2GAIA 2ZZMA 4C0BA 1NBMA 2HBQA 4P86A 1YB5A 5FTMA 1V1RB 1G55A 1SPBS 1NV8A 3AIKA 1DUVG 4QXRA 4FYXA 4C78A 5LB4A 4XUEA 2A0UA 4DG9A 1G9TA 3HJBA 5HUQA 1FVFA 3R7FA 2C2BA 4YR9A 5J4LA 3ACBA 3CA8A 2PWPA 3H8VA 3NBAA 4YRQA 5LP6C 1PVVA 3PXXA 2YMQA 2VR1A 5TF4A 1DC6A 3MS4A 4KFRA 3VHXA 1Z5ZA 4Q3OA 4LV5B 4DMMA 3FPCA 1YJ5A 2EIHA 3M1YA 2V4MA 2HQOA 3O8LA 2Y76A 2FU5C 1YULA 3BQNB 3EN0A 3MLBA 4OAOA 3ZHSA 3O2NA 1H6AA 3M5DA 5F2EA 3B38A 5EIAA 5F2KA 2GT1A 1BJTA 2FOXA 2R8OA 1UQRA 3JU3A 4S0XA 1KY3A 3FKJA 3T38A 3WGZA 4DCOA 5CT8A 3VPBA 4C88A 3NPAA 3VR2D 2O52A 2L42A 1UMCB 3LC1O 1CZRA 3L4BC 2AJTA 4QQFA 3ZZUA 4TYMA 3MTGA 4C3ZA 2D0OB 3DFMA 4URHA 4B73A 3PICA 5B1DA 3K15A 2QJOA 1NN0A 1Y6RA 3K9HA 4IOJA 5DHSA 3S2YA 2Z8XA 1E3TA 3DEHA 2QD5A 2FPIA 4HGZA 2WEKA 1NI5A 2YJ3A 3IP1A 8ADHA 3T7DA 1PE0A 5LOVF 5LCXA 2BGJA 1SELA 1CY1A 4K9PA 2VL7A 1L7AA 4DIEA 1N0UA 4TT3A 3EZ7A 2GAAA 5EJMA 5BWBA 4ABTA 4JJEA 4KI7A 1NP7A 2Y1FA 3FRHA 1RQ2A 1W36C 1IJFA 3TF5A 4QA9A 1SUFA 3D5QA 3O1JC 4EVRA 4UM5A 1G0OA 2FZLA 4MWDA 2CV1A 1DP4A 2G06A 1NQXA 3PTZA 4JGIA 1P6QA 4ZAVA 5L3ZA 4A3SA 1AG9A 4CV0A 4XCVA 1BDIA 3L8HA 3F47A 4H77A 3UK7A 1T9GR 2VDLB 3AJEA 3WGJA 3GUCA 2BE7A 1R8YA 2ZWMA 3KS9A 3DGFC 1DKLA 1SC4A 3V1MA 2Q6OA 2YXEA 4G67A 4AD8A 4A73A 1X1DA 3C87A 3G2LA 1FU8A 5AVOA 4CNQA 1RM3A 3OF3A 3BDAA 4RDHA 4GNKA 3QWAA 1U04A 5KIAA 5FO1A 1GL6A 1GNLA 4V0NA 5LBIA 5IW8A 4JJZA 1FMJA 1FB5A 1VLZA 4RZQA 1VXOA 1JB9A 1Q14A 1OFHA 3CLVA 1SHUX 2ENWA 4GZ3A 3VISA 3MJDA 4UVGA 4EI9A 3GCDA 4U00A 3IGFA 1IE3A 1ZH4A 4LAFA 1X80B 2ZXFA 4L5CA 4X3CA 1YZQA 3DMRA 3LL7A 2ZUEA 1U8XX 3BKWA 4MKIA 2QS9A 2V6IA 4EHIA 4W5QA 4BLVA 2AG5A 4X7PA 1VI6A 2QUJA 3OZIA 3R23A 3JATB 1H5NA 3SZMA 1JHPA 1QCDA 2QAGB 1WSAA 2WYWA 3GLUA 4LQLA 5CCEA 3O3CA 4KAJA 4Y2VA 1SBQA 5A06A 2PUDA 1QR6A 1T25A 4HLCA 3F73A 1G20E 1YFZA 4NFLA 1P60A 4L2IA 4AZ0A 3DOIA 3T34A 4YDQA 1K4YA 3B1FA 4G0QA 4AJJA 1JDUA 3EDQA 4K9NA 3GFPA 4BWVA 1Y8RB 1G8PA 4RF3A 4ID3A 2POQX 5DM0A 5ENDA 1PG5A 1UKVY 3AFIA 4Y9SA 1A9YA 4RHEA 1V16B 1C29B 3I9JA 4FDAA 1DRKA 3SWWA 2VHUA 5KYVA 4WESB 4B6JA 1NUPA 1B93A 4DJFC 5EKUA 1WX1A 4GYYA 2G9VA 1ZO8A 4IILA 2ZRLA 3AWDA 4L95C 3SIWA 4EJSB 3H9QA 2RBGA 2ERYA 1KI8A 4FYWA 1THTA 1T2EA 4GMDA 4W8HA 4E30A 3SN6A 3MYYA 2Q8NA 5FWDA 1VIMA 4LVNA 1CFZA 1RYDA 2HFJA 2SKDA 2N1MA 3PHGA 4R0NA 2F6RA 3RVOA 4BRSA 5ITZB 5IF9A 1XVIA 1WCIB 4C7MA 3S81A 3L05A 4RHCA 2REQB 1GDTA 3O38A 1KZHA 4F3TA 4QPZA 1EUYA 4FHEA 3TRDA 3EG9B 1G7TA 1JJ7A 1L5WA 4F86A 5IVDA 4BUZA 1KE2A 5CD1A 2ZUUA 3DOOA 4BFCA 1GHTA 1SCJA 2ZLBA 3HCCA 1TMGE 2N9UA 1E8DA 3RREA 3HBNA 3OG9A 2X9NA 3DNFA 3C4VA 4PSKA 1N5DA 3MCTA 4PZ9A 4PYNA 4XIYA 5B6PA 5LB2A 2QPLA 4URYR 4YN3A 1X9GA 3BMOA 3VNAA 2IS1A 3EXAA 3P9CA 3EXHA 4RSHA 4D9NA 2HIMA 2GPBA 4YK7A 1KBOA 1MO2A 1AHIA 1E9SA 1NRJB 4FMPA 4OMFG 5UKDA 1K97A 5J4YA 2VP5A 3GR6A 4YJGB 3ENNA 1GUBA 1C1DA 1WO8A 3AWIA 3DZIA 3DE7X 4KIJA 2OG2A 4Z4HA 2DJ5A 1X8XA 1HNXB 5CEEA 5JC8A 4HNTA 5EE1A 4Y0VA 4AJIA 5JXWA 4HLUC 4HQFA 3HDYA 3NUGA 3C3XA 1DAPA 4L3OA 4KGDA 2NU8A 1Z5PA 3SZRA 2IU0A 4AU1A 1T6ZA 3G23A 4G2NA 4ZAWA 1RZRA 4LBZA 4RMHA 5A9RA 1ESEA 1NZJA 4I1PA 2WP0A 1SU4A 2W2QA 5C32A 4HDNB 5KZMB 1GOTA 1HE3A 2FWNA 4L4SA 2FDXA 5DRTA 3OI7A 1VPLA 3CR7A 3PNKA 5ALGA 4RY8A 1UAYA 1TTPB 2DFDA 1AS0A 2GVNA 2ONKA 3NLLA 4UUBA 4XEUA 3SF0A 4A2PA 4M86A 4KXFB 4CQNA 4ILEA 3WB2A 5KMGB 5A6SB 4FQ7A 4B74A 2VP2A 2WVAA 1ITZA 3QPVA 5DXFA 1UK7A 4YT5A 1YR2A 1GM5A 1S2OA 3ZD8A 4DCMA 3LQKA 1TUEA 5I45A 3EZNA 1FDUA 3VKVA 3B78A 5TQ0A 4G1FA 5C1IA 1FQJA 2IZ0A 1ZRSA 2H0RA 3T5MA 1YK1A 1MO4A 3BCRA 4M9ZA 4DMGA 4CL2A 1FZQA 2VDRB 1IHYA 1FEZA 5HUHA 3T0IA 1TX4B 3LDUA 2X0DA 2COKA 2PLWA 4CLRB 5ADVA 3GGOA 3U13A 1RWWA 1P5HA 2GR9A 3OCCA 3ORSA 1UXOA 4F71A 5CB4A 5HDBB 2DB3A 3KSUA 1KI1A 1D4ZA 3KZXA 2EU8A 3IQXA 5ALIA 4RIEA 2VZ0A 3R7BA 4W8GA 3PGA1 1NPTO 3R0QA 3P4UA 4L0CA 3EG9A 4NMMA 4P7JA 4EY8A 5EHIA 4GI5A 1P1KA 2VT2A 2WJYA 3NJ4A 4BO8A 5K0BA 1OKKA 4E11A 5CA0F 1P0CA 1KP9A 3EEBA 4KXXA 5IT9A 2YJNA 3DOEA 5FTJA 5G0VA 5BW8A 5ELXA 2ZSAA 1DRUA 3JQBA 1H3FA 1PYDA 1XQYA 1L6IA 1CERA 3KZMA 5JQWA 1SKYE 1VE6A 4CIXA 4P53A 3D2CA 1C3OA 1RT9A 3V3TA 2YHAA 4FT2A 1KQFA 1RQLA 2IEDA 2ZUVA 3MPUA 4WGGA 4FCTA 2QOEA 2XYGA 1D7AA 1HL7A 1ZNQO 2WE8A 3G82C 4LN1A 3TJZA 2QD1A 4B8WA 4DDUA 4MKZA 4C4AA 4P22A 3JASB 3DTVB 4EFKA 1E5VA 4O8CA 1L5SA 4YMVA 1QE5A 3CG4A 3QZUA 1F8FA 2GFIA 3H2JA 1Z37A 1GNSA 2OHFA 4QPNA 3ILHA 4ZQHA 5AJVB 4QDTA 5CX4A 3LLMA 2QR3A 3QU9A 4FR0A 3DVSX 1XZJA 5MFZA 3B6JA 3ZY6A 3D4BA 1ZM7A 3QXXA 2B1GA 1ODCA 1QHXA 1QWOA 5EXTA 1UWKA 5LMZA 4OI4A 2IS4A 5CYGA 1RJGA 1G18A 2B1RA 1TB4A 4M54A 5K6RA 1HDIA 2X4DA 3PFNA 2IEGA 4EY6A 2IEAA 2NQ2C 4WNIA 2WIFA 1KAEA 3HJRA 2UVQA 4U0JA 4WCVA 1CZNA 2DQ4A 1NU8A 2MT9A 2X22A 3UF0A 2EIXA 5L53A 1T8TA 4HNRA 2YN4A 1VZ2A 1A9PA 2HO4A 2MSDB 4A6DA 2VJBA 3F8TA 4F2WA 4BGDA 5B7NA 4KDRA 5E95A 3IBYA 1L5ZA 1WUIS 1N6RA 1E0KA 1USIA 4JBNA 2HYIC 2ZIFA 1ABFA 4DIOA 2ZTUA 5CB0A 2VK1A 2GK3A 4MVJM 4NU8X 2X5KO 3AJ8A 4OBXA 4JP5A 5H68A 4IDOA 4WXMA 4ER6A 4A8PA 3ZI0A 4CLRA 4NV3A 1SUDA 1EX6A 3WO1A 2G1KA 3WRXC 3MJSA 2CNWA 5TGZA 3NM6B 1XPJA 1GXSA 2RH5A 5FL7D 1J09A 2O1XA 1V5EA 1CUGA 2OHGA 4MGIR 4PLTA 4PLYA 3VH2A 2HPVA 3IT3A 4C20A 2UYCA 2JLWA 2IF0A 5KHAA 1PSDA 2ZJ3A 2O2CA 2ZJ0A 4NPHA 4DW8A 2FEOA 1RQRA 4HQKA 2XUZA 4LOIA 2Q29A 2JLBA 1V39A 3JR3A 4RK0A 3RQIA 3TG2A 1CZHA 1Z4JA 4CCYB 3FPKA 4BZQA 1JBQA 1LA2A 2I6FA 1QKKA 5K03A 4BFVA 4HNHA 5H02A 4LJRA 3FSGD 3ZK9A 1ORIA 4AXXA 4CM5A 5MN6A 2YVUA 1FDSA 1I7PA 3PENA 4Q19A 5A4AA 1G8JA 1FSZA 5CH3A 3VGJA 2BMFA 3LH5A 1EXDA 2B9VA 2YDXA 1NIJA 5DX1A 4CEIB 1D8AA 1KFKB 3BMCA 4FGLA 1NQ5A 3CJQA 3LQYA 1FJGB 1TA0A 2HSWA 5BSMA 1WV1A 3ZUPA 4EA6A 1DCTA 2OXIA 3VSEA 3PUZA 4FHZA 3W2GA 2DZDA 2X2PA 2A9JA 4JJAA 4D82A 3WHLA 4CMGA 2AWOA 4C2BA 1LD3A 4HN9A 1EFAA 2YFYA 4CUKA 3ZKWB 5LNK1 4GI7A 4WZAB 2QRVA 3R0IA 5FWXA 2R8EA 4C0QC 4LA4A 3NORA 4MIOA 5JXHA 1ETHA 3OD5A 1H1LB 2ZAGA 3O0DA 2GHRA 1I2CA 2JA1A 4PM4A 4R2HA 3TRHA 1J0EA 1TMYA 4IBOA 1JIQA 1I51A 3WQQA 4AMGA 1IY2A 1MA0A 1ZICA 2NSLA 4JGGA 5IXJA 1CYEA 5KX5B 5BXQC 3ZWKA 4ZHSA 4C21A 3S70A 1WY7A 3HS3A 2C5SA 3QYFA 4PTYA 1YA4A 3TLCA 3OSZA 3AZPA 1T9ZA 1G1MA 1FF9A 3A11A 4XJVA 2XAAA 4P3XA 3TQTA 2RGWA 4Y2RA 1SBHA 2VRCA 1W19A 4ODIA 3ANNA 4RHFA 4BNNA 2PANA 4BNZA 1A88A 4FCWA 4X90A 1RVV1 5LC1A 4AROA 4BVBA 1R6XA 3I9LA 3PFCA 3RT1A 5IRCD 5JZBA 1JS1X 1WE2A 2CVPA 4IQ4A 4LXTA 3D7KA 1Q3KA 3WLFA 4CU5A 4DIBA 4FOSA 4MRVA 4XPIA 3U1TA 4CCSA 1JQJC 5FAXA 5JC1A 2WYIA 1P4HA 1QWSA 1CEXA 4JYBA 1VYTA 2A6PA 4RTLA 2BMWA 1T0HB 2ST1A 3DZHA 2PUVA 3L8GA 4LI3X 4DGQA 1G21B 3X1DA 2AZ4A 4X97A 4D99A 4ECEA 2G63A 3WBBA 1WS6A 1NT2A 2ZCVA 3KD3A 3UMJA 1R66A 1CIPA 3CV3A 3HY6A 1FL9A 1KC1A 2GPAA 3IC5A 3I3SR 5I7HA 1H4QA 1ZVKA 4OQFA 2ZUSA 3LKBA 1YMUA 1MX1A 2XRMA 1DJOA 1CEQA 3KYIB 4B35A 1PFKA 1CQJA 3FE2A 3MTEA 5IH3A 3C0KA 4YXFA 3O93A 4DRXA 1GLNA 3ASVA 4DPMA 4I5FA 2JAQA 3D6VA 3EFOB 5DCLA 5C37A 2XDYA 1GPWB 4DAEA 1JNXX 3BF7A 3QX8A 4P38A 3I6QA 3A2NA 4W82A 3EMDA 3QOWA 3NAGA 1Z4LA 3AHCA 5DNDA 2VTKA 4KN9S 3V34A 1COWA 1QFXA 3BQ9A 3FJ1A 1JLLB 2DWQA 3TGPA 4KQ6A 2PUFA 3GLHE 1XG5A 3Q41A 2ZBPA 3SM3A 3WYEA 5I4IA 1QZ3A 4YI3A 2H1VA 2BRUA 3UCXA 4IIUA 3BAZA 1ESMA 2D1FA 3CNHA 3ZGVA 4YIHA 4H4CA 2OEPA 2WJ6A 4IUCS 4LMRA 2ZRKA 1DI0A 4ND1A 3KJFA 2Q5JA 3ENWA 4IWNA 4UBMA 2AN9A 4N0QA 3UUWA 4B6RA 2IK8A 3GBSA 3H7IA 1PF7E 1U2PA 1MH9A 1VL5A 3LX8A 3MMXA 3N3AC 4JT8A 3ZXSA 4BATA 1KU6A 5DHUA 4DZZA 2AJDA 3CRMA 4WVFA 1JTFA 4L27A 1R6VA 4JUCA 4LRWA 4Q3AA 4PO3X 2XV1A 1FDWA 2ATVA 1VHLA 3K7EA 1HURA 4LPKA 4ZA2A 1UZLA 1EFRA 2J6IA 3BXHA 3WFZA 4DV3B 5FLEX 1X8LA 2WB4A 1T5BA 4N7RA 4F5YA 4DDHA 1PJRA 4YV2A 2DLNA 1VG8A 3V7UA 3PEWA 2QXYA 1E3SA 2C3UA 2DKFA 2Z2YA 3PD7A 1WHTB 3JRXA 2VFAA 4JGBA 2FPMA 3HV0A 4QM6A 2BEWA 4J0HA 4D9CA 1E9AA 1SIOA 1KAOA 1YH3A 2BKEA 4HEQA 4ZO6A 1WJGA 3T0GA 3ZS8A 5CT9A 1AQLA 3H5IA 2WFZA 3EB9A 4L4XA 4CW7A 2AF4C 3C3MA 3GNSA 3AI3A 5DKFA 1VG9B 1ZJ6A 3PKJA 4HFMA 4P4TA 5D3MB 4U2GA 1GCGA 3N3BC 1ES9A 2G5CA 3O2JA 3N70A 1MQ9A 1G21A 3R7WB 3PJFA 2P9TA 2QVGA 2VPPA 3VKGA 1VJDA 3HXPA 2P9GA 3D4PA 2GXQA 3S2EA 1J06A 1J2UA 2N42A 3EVAA 3F5QA 1KL7A 1MO3A 4QTXA 3KUUA 3R4CA 1T8WA 2VJKA 3ZPXA 4OX9Y 2ZRDA 3DMNA 1C8BA 2XYQA 4YP5A 4JYZA 1O3YA 2HFKA 2KS6A 1JKFA 2PLRA 3KLOA 3NOVA 1KI6B 2QVZX 5ITVA 4JNKA 5FUBA 1E6CA 4KSYA 1MDFA 1SIBE 2CE2X 3AETB 1W88B 5L3QB 4HGQA 3W5SA 3CBQA 3KNZA 1VE3A 4EBBA 3BWEA 1M8PA 5AM5A 4BAGA 3AU8A 3W9BA 4HQ0A 1EXVA 1IOWA 4IDDA 1PR4A 1SC3A 3GBPA 5AK0A 3B1XA 2R5NA 3KQLA 3L4EA 3R77A 1UOPA 1PGPA 4Y2TA 4D8YA 3DCJA 1A7JA 1BXGB 1RXSA 4JP1A 5A4MS 4WN3A 5DEOA 3VGPA 5D6NA 4EUHA 5C7YA 1MRZA 3HEBA 4JI5B 3EUFA 5A4KA 5TIIA 4B2IA 4US2R 5IC5A 2R751 3FNHA 2IDJA 2NQ8A 2PDAA 2BKXA 1Y1QA 4L07A 5IX8A 4AT1A 4UW9A 3UW3A 3E48A 3LKZA 1C30A 2QLFA 3IHTA 2WM2A 5AYVA 3RSHA 1C14A 1HV8A 1WUKS 1DKMA 3I92A 1R88A 2VG8A 3T5GA 1E5XA 2QV7A 4L8GA 4NS4A 5TSDA 5IJ0A 3SMVA 5JAPA 3NNDA 1PBTA 2VH2A 2BTQA 4G9GA 2FVYA 4L9WA 4CR6A 4DTIA 5F9MA 3I73A 4L16A 1V3QE 3NRCA 2ZIGA 4KDCA 3X1WA 2I9PA 2O5RA 4JAVC 1D2CA 1CY7A 2BGMA 1F6WA 1AGPA 2BFEA 2P8SA 1GPNA 4K6OA 2FW1A 1GA4A 4FLFA 4JBYA 2HPHA 3A25A 3JYQA 4E5MA 4EY3A 1KMNA 3IE0A 3OZGA 3RUPA 5BN1A 3HSYA 2FZWA 2YWJA 2QXUA 2Z95A 4KXLA 3OQIA 2O8FB 4E6PA 1QDLB 4MEBA 2BKAA 4PZPA 4CQMD 5FWYB 3SPXA 3W6NA 2CDCA 2NYAA 3HYNA 5JSHA 2RD2A 1QORA 4XYLA 3IPXA 1G3MA 3JARB 4IHJB 4J4TA 1JIVA 1U1EA 3PUJA 1A2KC 4WOKA 5KTNA 1Y7HA 3HBFA 1TU4A 4D3SA 2BPOA 4H7FA 5BT9A 1L9XA 4HDSB 1ULAA 5G0TA 5KCMA 4IIHA 4RL6A 4X44A 3ZLUA 3ESQA 3P0HA 2PUTA 3EK2A 3HMKA 2DJIA 5HF6A 2VPWA 2LVBA 2R96A 2NVBA 2WVJA 3H4TA 4QUEA 3REGA 3CGWA 1F0NA 1O6GA 1K4MA 3GUZA 4BNIA 4U6SA 1ZXBA 1RTKA 3DYBA 3CXUA 4QUDA 3X2SA 3EXIB 1OFUX 2W58A 3IURA 2V5VA 3ZU4A 4BKMA 4RSMA 4CF4A 1CRQA 1Q44A 1T6YA 2IVZA 1YHYA 5EWJB 4GRDA 2R62A 3WNCA 5LQJA 3THYB 1T3LA 1UJBA 3D43A 4Q4DA 3JR7A 4G9EA 4JP8A 1P6UA 2JZNA 4RKQA 4ROSA 5CHEA 1Z28A 4ZU6X 1IOLA 3WRVA 4ED9A 1CUCA 1GSOA 5JBNA 1IFXA 1DDIA 3NM4A 4XM1A 3TLKA 1ML3A 4BEBA 4MJXA 1CHDA 3RPEA 1E2MA 1LV8A 2P9HA 1Z8NA 4BNFA 1AGRA 1JG2A 3SS9X 1GPBA 2NOAA 2LNDA 2WG0A 1JG1A 4B3DA 3QEAZ 1RYHA 5BYKA 3VKUA 3VZBA 1W5AA 3ICWA 3ZUGA 1X42A 1I4TD 3PF8A 2H9AA 1NNI1 3PPYA 1QG2A 3OKAA 3LSYA 3TMKA 2A1UA 2C2OA 3DEZA 1OB2A 4RLFA 2OM6A 2PZEA 4QU8A 5KC9A 2NVUB 5LMNB 2GN8A 2FSVC 4PV7A 3IIJA 3NHWA 5AKYA 2JFWA 2PZFA 3EA5A 4BBZA 3F96A 4JBHA 1FFHA 3I64A 2CSUA 3LIIA 5TF0A 2WM8A 5FKJA 3LCCA 4NCXA 2IUTA 1T13A 2F4NA 2JNWA 2O06A 3D3JA 4Y6LA 3CMCO 4G5GA 3D2BA 3FYUC 4PFKA 4Z6KA 2A5DA 3O84A 2YRXA 1ZK1A 2JLXA 3MIZA 3NXKA 3W6UA 4C43A 4WACA 4KPYA 2REBA 1VIYA 3CYFA 3S2IA 1EFTA 3ZJYA 4KZKA 5IFKA 2D4HA 3TZBA 5FPKA 1DC3A 1M2VB 1VLLA 1LDEA 4MUJA 3TH5A 1A5ZA 5ALNA 1C9KA 4TMYA 1GFZA 5AUPB 1JUDA 2WG1A 1L1EA 2FPGA 3NBFA 4JV5B 4IF6A 4GWKA 4QGAA 1DKNA 4KE8A 4LHSA 1LZLA 2PXAA 2SHKA 2G67A 2EF0A 4TXHA 2VQFB 4OQMA 4I1IA 3UCEA 4N41A 3DOUA 1HDYA 4DPLA 5I7FA 5CCXA 4WV3A 3G8DA 1UOQA 2R6GA 5C53B 4NKRA 2BFDA 3K9GA 1QDEA 1DARA 5GWXA 2MYPA 3H9BA 3IXLA 3IUMA 3Q7EA 5TJHA 3VV3A 3P4YA 4ETIA 1J8VA 1T0PA 3TDNA 3TRKA 1BOFA 4M89A 4UHCA 1K8YB 1HL3A 1ISGA 4MHOA 1YVDA 2XT6A 3CF2A 3GDFA 5E7QA 1JZTA 3VR6D 1T29A 3GAFA 3SBOA 2C1XA 3IEVA 4I08A 4PLGA 1SXPA 2Q9BA 2R2GA 3KAJA 2XBLA 2CVHA 4E08A 4GI3A 4G9BA 4QUBA 5DP2A 4QTYA 4UXJA 1N2GA 1EHCA 1SULA 4UUOA 1FYVA 1Z16A 4LNHA 2JJ2A 1DG3A 3OPYA 3FDIA 3CZ4A 4Q1FA 1XYVA 1LK5A 1SXJC 1MB2A 5G4LA 3ZU6A 1AUOA 4F38A 1JR2A 2GEDA 5HIKA 2DFVA 2LIPA 2Z2IA 1U1GA 2VRBA 4DIKA 1C50A 5GY7A 3UAOA 3ZE2B 1N9GB 2X0KA 2F62A 2AR9A 2FN3A 1BEZA 2PWAA 4WASA 3S1LA 1Y0BA 2GEJA 1G6Q1 3FUCA 2FW0A 4TYPA 2A1UB 2QT9A 2M6KA 2OLJA 2QMUA 2OLKA 2W70A 2G5GX 2BFOA 4OX9B 2PMDA 4GX2A 3ZWPA 3OEHA 4BB9A 2D59A 3AF1A 2FCRA 2WSIA 3PC4A 3T41A 1UBKS 4MB0A 1Q83A 1XRLA 3SSAA 3FSEA 4IG9A 1ZSYA 1EE1A 2CJWA 5K20A 2DUNA 4LY3A 1NYQA 1R5OA 1YOVB 1VRCA 1RI4A 2O0MA 3LLCA 4L4UA 3OURA 5AKEA 2PWYA 2A35A 4FKBA 1M54A 3E2IA 1UP6A 3NBZC 5IJ9A 3HADA 1II8B 4ZC1A 3KU1A 1NVDA 1Y48E 3CJRA 4MR9A 3Q7IA 4XOIA 5GVSA 2PGDA 4D46A 3N8IA 2J3HA 2PS0A 1UBUS 3U4DA 5BYAA 3W06A 3NVAA 1AOXA 2G9RA 5CYFA 4ZO9A 5K45A 2J07A 2JKZA 3GOQA 1OE0A 1CJKC 1QC5B 2C8LA 4JMLA 4OHKA 4OLHA 1BU8A 2EL9A 3TWOA 2OR3A 5JBIA 2PPVA 2HK8A 1FLAA 5E1OA 3H3FA 2EJBA 1EU1A 2GN2A 2ODQA 1BE0A 3PA6A 4AIRA 3FOWA 5BN5B 3E4DA 2Z09A 3O3MB 1GPDG 2IXAA 4X41A 4E3WA 1SK8A 1E3JA 2CHEA 2WLTA 1Q15A 4FGKA 1QIIA 3TTUA 2QTRA 3UOAB 1A76A 1X38A 4B4VA 5ITWA 4ENWA 3PC2A 4ARSA 1QRRA 3O82A 3T6KA 1ZIPA 4OBWA 1JAHA 2C5GA 1ZN8A 1G38A 2IXBA 1EYZA 2SKEA 1V7QA 3KUDA 2VHTA 3R41A 3W3AA 4BQIA 5I9IA 3CTPA 1TA4A 2PZGA 3U3ZA 5CD9A 3T1HB 5DO9A 2DR0A 5EXSA 3PNPA 5EXXA 3WKCA 3QE9Y 1J39A 3CH6A 4ZJYA 4NV0A 1UMDB 1ORVA 2H65A 1UIRA 1GADO 3BM5A 1A72A 4LZLA 4YI5A 4C87A 2FLVA 1DBWA 3O21A 4LYFA 2PV0A 4OQYA 1TKCA 4PQRA 1T8YA 1V11A 1T6NA 3GUHA 1DX9A 4JI1B 3TINA 3TQIA 4HOYA 2P9BA 1LLCA 1BXKA 1SUPA 4P4NA 4YGYA 3WMWA 1L7MA 2JVIA 2VBIA 4PLHA 1CPYA 1LBIA 3U7EB 3GFFA 3MJVA 3USZA 1B16A 1PGOA 5C46F 3R74A 5CR9A 4DR4B 4TLDA 4YCDA 4XXHA 1ZUD1 3PZBA 5LL6P 2ASVA 2FW7A 4FFSA 4RQBA 3I52A 2UYGA 4BYMA 4P32A 4O25A 4OU5A 1USGA 1FS5A 1RW4A 2XTMA 3HR7A 1H6DA 1KS9A 3H9EO 1VECA 1AKTA 4CMCA 2BSQA 4TT8A 1OYVA 4JC4A 4XDZA 4MV9A 3CW9A 4NBUA 5LFAA 1ZS9A 4DUYB 4BZXA 3M5PA 3WSWA 2EJVA 3M6WA 3U17A 4D9GA 3THWA 3W5AA 2XZOA 5CH5A 2ZBDA 3UB4A 3R75A 1YQUA 3AVPA 4DB2A 4CHGA 1A7UA 1J99A 4WLEA 3IAFA 5A2QA 5HZHA 2HCJB 4JXZA 1KI2A 3JYHA 3R24A 4UVHA 2OQ2A 5JR3A 4E2XA 4QOFA 3DW1X 2H0QA 3K9LA 4RMGA 4YGXB 2C7RA 4D8UA 4RVUA 2D2FA 3K0CA 1AA9A 1A2OA 4YJ2F 4K9KA 1KEVA 1KYVA 4PG6A 1WV0A 3OFNA 3WOHA 2O2JA 4CKEB 5K8UA 3CVVA 1FSGA 2HEGA 1VHWA 1AKUA 4FHGA 1RHUA 3P20A 1AKWA 2WKRA 4I50F 1U6IA 3I62A 1SBCA 2HV9A 2HT6A 3LGSA 4LDAA 2FZEA 3PEYA 2IITA 3KEMA 4AICA 4BX0A 5LQAA 3D6AA 3WAGA 3TE7A 4BNDA 2WMNB 4DLAA 2VK2A 3QKRA 1UH5A 2H1HA 2O8BA 3DMHA 7REQB 2I0FA 2FG7C 5IN5A 2R68A 2DVMA 5H16A 2UVDA 4X24A 1BC5A 5EC8A 3OOHA 4DWVA 1FP6A 1KI6A 2JHGA 4K03A 5KTTA 1M8KA 2DPHA 1QFZA 3DXYA 4JX9A 4YC7A 2H2FA 3ZEIA 1W88A 2ZZNA 4FU0A 3IAM6 5KHLB 3DM9B 3TXAA 3D3EA 1D1QA 3F5SA 2YIJA 3HCBA 4LGYA 5HTKA 2PZAA 5EKTA 4ZANA 2OZLB 3E8SA 3L8MA 2PQ6A 4NP6A 4BNXA 3BGSA 1IHDA 3NNSA 2C54A 4RAQA 4C4PA 1YJAA 4W5JA 1Y8ZA 4JVNA 3E1KA 1T10A 1BXGA 3N6VA 4KP7A 5FA5A 3OPXA 1GFSA 2DPYA 2OHOA 4D74A 1OBFO 2Z04A 3TLXA 5AJTA 3PSAA 1OWPA 4M9SA 4YUAA 5JVDF 2VAMA 3ONNA 3TW4A 4UVDA 1DX6A 1ZIDA 4WK0B 5JLJA 2AZXA 1GQRA 1HT0A 3R6LA 4MLDA 2M6SA 1F6DA 2P3OA 4M2LA 1BZYA 4MHSA 5CM2Z 1NYTA 1T3TA 3H1AA 5IJ0B 1MAWA 4TN5A 2LRHA 3MILA 1N6OA 3BD7A 4P3NA 3I6ZA 3GDHA 4OXKA 4KMRA 2WT4A 3HNOA 3OOJA 2W2MA 1OIXA 2E4XA 1F12A 2FFBA 2H2GA 4MW2A 3H8JA 4D42A 5CNMA 4D4MA 1GNQA 4RK5A 3D8HA 4BNMA 4E2YA 1IB6A 3AM5A 4I1UA 1ID8A 3TQCA 2GBCA 2J5RA 4MWSA 1G20A 1VJGA 2J3DA 1E1RA 2XGGA 3AIMA 3IMFA 1N1MA 4IYRA 4RK4A 4A92A 5BMVB 1JEQB 4IAOA 3KT6A 1GTVA 2Q2VA 1TIPA 2OUIA 3KVRA 3OQIB 4UHKA 5IK2A 1ENZA 5KNDH 2BFPA 3FNEA 1I7SB 3KQPA 2JFQA 3M89A 3SHQA 4XVCA 1Z22A 2RJ3A 2FPPA 3GFVA 3MUFA 3NEAA 1ZCAA 4CWAA 3LT1A 2C2GA 4U39A 3QENA 3AF6A 1KERA 5L4NA 5CBKA 1U1IA 2BF4A 3HH8A 1CVRA 1FFAA 1UDXA 4KO1S 3WDSA 3HB5X 4QHTA 1IC6A 4QDZA 3AHDA 4YMSA 1A2QA 4EEKA 5A5GA 5LD2B 5JZ9A 5HW0A 2OXTA 1ORRA 2EATA 1KVRA 1CUDA 4HS9A 2O8BB 3WICA 5HK8A 4OD0A 2V65A 3K0FA 1Y8RA 4DHEA 2CL5A 2XDAA 1JJIA 1VTKA 2ID4A 2LKDA 3K6SA 4TSFA 5DYYA 1Z0KA 2R1TB 1BNCA 2AIRA 1VSUA 3FF4A 3WWCA 3SIPA 4EENA 5FNVF 4QAJA 5K7SA 4ZT3A 1IRIA 4II3A 3QNWA 3ZYCA 4PYMA 2HQRA 5IKPA 5BSRA 2QI9C 3AUTA 3KKOA 3SHTA 4Z1MD 4WTOA 4DQLA 1HX7A 4G0MA 3NAMA 1COZA 4O4IB 1A50B 4QGGA 3NFRA 3D6UA 3UB2A 5HR5A 2I1VB 1CUSA 5AKXA 1MJ5A 1IY8A 1SG6A 5DM60 1BG6A 3LTNC 2FW6A 5SY9A 4O5AA 3TLZA 3O0TA 5DGIA 4QQNA 1SVUA 1FCJA 1FQWA 3OZBA 3GY0A 1UPUA 1JYEA 2IYTA 2Q3FA 1Z0UA 2PGOA 1O9HA 2G40A 2HWKA 3D7LA 1NQVA 4IIFA 4MDYA 1X86B 1YFLA 5A0TA 1GSIA 3NGXA 2FPUA 1Q7BA 5BPHA 5C2JB 2CUTA 2FWBA 4YR7A 3BSFA 3I76A 4X6UA 1PWEA 3ENQA 3VSDA 4D9HA 2C4VA 5CFMA 4JVMA 1UL1X 1XHEA 3TIVA 2RGNA 4AJPA 2LP4Y 4UULA 3CWQA 2XF8A 4OP1A 1EJ0A 1VLMA 4YHBA 3U49A 2VOEA 4HEHA 4MITA 3NTOA 1H42A 4LGMA 3IOCA 2WKQA 4N1AA 4QO7A 4S1NA 5JO9A 4KQIA 3K05A 4PE5B 2VPZA 5HRCA 2IHYA 1DTWA 3BRQA 4Q0MA 4RNDB 4TOIA 5T4EA 4CMBA 1U2SA 3BHMA 5I9NA 4YHHB 4BFSA 3DMTA 3JQCA 4Y6GB 1C2TA 3I2FA 3KVVA 4YJGA 5L7WA 4ARCA 2XNDA 1W73A 4W7IA 2AFHE 3EEQA 3D4IA 3D5EA 4FYHA 4X5OA 2H51A 4OI2A 4RNCA 1EX1A 1DXYA 1E77A 1UXHA 2W22A 5F73A 4PNPA 4RTKA 3N7UA 1VHDA 3E35A 3JQQA 4LDZA 4MR8A 4O5OA 4PZUA 4N3AA 2R6AA 4HLDA 4UD2A 5A3QA 1NBME 3F3SA 3RB8A 2GVZC 2HDNB 5B6JA 5I4CA 1LBHA 2W6OA 1YE5A 3EZ6A 4YJKA 2XD4A 2COUA 1YZGA 4X64B 3RUHA 1WKCA 1T4GA 1Z2AA 3KE8A 4NYIQ 4AULA 4CN9A 2W8BA 1LC0A 3K0FB 1LFAA 4XLZA 3HZOA 1NVAA 3FA2A 2R7NA 4NJOA 4OJNA 9GPBA 3K5PA 4QTZA 3VU1A 5AVTA 4QUIA 1L5NA 4DILA 3EDCA 3E27A 1K75A 2RK6A 1PO7A 1Z56C 2Q6LA 4KREA 1D2MA 3E9EA 3HN6A 3KLMX 3C7AA 1XVLA 3N2IA 3WL5A 3GEEA 1S4QA 4A8JA 1AY0A 1NNLA 2B34A 1RM5A 3G2KA 1SB9A 1VL1A 2CLSA 2R87A 1NFRA 4NBVA 5DF1A 2YWGA 3WYBA 2XQVA 4L0QA 4DLUA 2I7CA 1U2EA 1B6SA 3R0XA 2OBMA 3FYDA 2VBFA 3PGJA 4YUXA 4X1YB 4HUJA 4DNXA 2IPMA 4RJKA 5D5QA 3MRTA 3D8SA 1XJCA 1EIZA 3PDCA 2WWVD 2PMCA 3LAWA 1W581 3F7OA 2QI9F 2WV7A 5LA6F 5LLTA 2HWUA 4ZYYA 3JALA 1ACJA 2A5FA 1ZZEA 4LWZA 3J81A 1Z75A 1J2YA 4WIAA 4EFNA 4DEYA 2NXEA 3TD9A 4P5DA 1JLKA 3HLYA 4HWRA 1V25A 3ZEAA 3SC2A 1N8KA 5DX8A 1OLOA 1GDDA 1GY8A 1GPLA 1MW9X 3LT2A 1TC1A 2BM9A 4NOKA 1NW7A 3HU5A 4RJTA 1EDEA 2FP4A 2EFEB 2Y1XA 4L9RA 4P08A 1CJSA 5TMEA 3U48A 3WQBA 3NHKA 3KTDA 3EVZA 1L4YA 2A0YA 1UBTS 4BZWA 1AVTA 2E18A 1SCNE 2HZ7A 3V4ZA 5JBQA 4ZOCA 3J80A 1XD8A 4MVJA 4EI2A 1U4SA 5FADA 3AK4A 2PGLA 4NFYA 4QTTB 3UENA 3HACA 2RKBA 4HXYA 3AJRA 5C80A 5SV2A 4TLEA 1U11A 4A26A 4X8OA 5B12A 1OQAA 1AQUA 5EJ8A 1VP3A 1MMFB 2D4AA 2JIDA 3FFAA 4EJ2A 1S2NA 4XRGA 4DV2B 2HIGA 5FNZA 3VPHA 4OHBA 4D3YA 5K8CA 5CM9C 2W2XA 1I3CA 4X9XA 3NPMA 4HG2A 2O3QA 3IRVA 4O33A 1DMRA 3UBMA 3VR4H 4F9EA 1IN1A 1EFHA 3TS1A 4ZI3A 4B09A 3D5TA 4AM8A 4H7IA 5FF9A 3ISVA 1II0A 1ATIA 2JJ8A 3BTVA 5FAKA 5G4KB 2ABWA 3MTBA 3Q3GE 2BCEA 3ADBA 4DANA 3SYNA 5TX7A 3OT1A 1KNQA 4NRDA 3F1LA 3EAGA 1Q77A 1RIIA 1YQWA 3KK0A 4TX1A 3ZQJA 4N0EA 3KQKA 1FUUA 4UATA 2X0EA 1JFTA 4B40A 3RKSA 3D31A 1OASA 4H7HA 2VXYA 3OJEA 4B5LA 5JATA 3ZD7A 2E37A 1E7RA 1H93A 1UPBA 4IINA 3UV6A 1SU6A 4M8IA 2P7IA 1X8KA 5I3ZA 2R97A 4OVKA 1JJVA 1XPRA 3LW7A 2OAP1 2OCGA 4YROA 4U3JA 1LDGA 4NESA 5I9MA 4A2QA 2QVLA 1KVSA 4CTNA 1MHTA 2XZTA 4YP0A 3S40A 2QW1A 1PBNA 4GPIB 1U6JA 2P6RA 4OP2A 1TO6A 4L3VA 5BV2P 3MRSA 2DECA 3OCZA 3QEKA 1OWOA 4ZQEA 3S3TA 4QRDA 5KYTA 1BTOA 4M55A 1CRLA 5F4BA 1T1JA 4MRSA 3IP6A 3GB9A 4WY2A 3HRIA 3L0OA 1BA3A 2OESA 3I01A 1X7GA 3X1YA 1TMKA 2RI6A 3LF2A 4HL6A 1XNGA 2R1VB 3MZ0A 5DBHX 4XASA 3GEIA 3AO0B 1O1YA 2R8ZA 3EMBA 3KSMA 1W6UA 1XL1A 4HNAB 3LY5A 1OLSA 4TLLB 4WX2B 3AR6A 1JJAA 1MJHA 4OHCA 4CIWA 1IXZA 2VYVA 2G80A 3LRPA 3WK4A 2Q21A 4NYMR 4EYEA 4DHWA 2FWRA 3PK0A 3KT3A 4DXDA 3AF3A 1XAGA 4MAAA 1EK2A 5JMPA 4KEAA 1H8EA 3FZYA 3UNXA 1R0YA 1Y8QB 5IM4A 4A0QA 1XMVA 3L0YA 4PHHA 3LCVB 5EPUA 5T3UA 1ZBQA 4PWYA 4PVDA 4M21A 2VPXA 4EMSA 3HCFA 2I7TA 3I4FA 1RI1A 1RWKA 4CM3A 5HKBA 3ULKA 3W8RA 2CNLA 2AEEA 1JA0A 2LZ0A 4MPDA 2M1XA 1UZUA 1K6XA 2QEQA 2VNAA 4MYDA 4DMLA 2P5YA 1MG0A 2HJSA 4OI1A 3TKLA 3GQVA 1XRMA 1W9HA 3HB0A 4ID9A 4DABA 3KWMA 1GU0A 2FA9A 4CPDA 4L57A 4BNDB 1XHLA 1ZNXA 4FONA 2QN3A 1KTIA 2AT1A 2PUJA 2OV6A 2YBEA 2GTIA 3WNZA 3I3OA 1UWLA 4LKOA 3CLSD 2O14A 4FYPA 2YOFA 2AZDA 3G6KA 1ADYA 4L51A 3CPEA 3ILYA 3AH8A 1QAQA 1PKEA 1YV9A 3KOYA 2FW8A 3TEMA 3WDLA 3ZVMA 1GFWA 2ACVA 1RKUA 4AC9A 4D02A 3OICA 1FW6A 3W8EA 3KYCB 2W37A 4JL6A 5FOTA 4KXWA 4G1VA 2GSDA 4GAEA 4N6NA 5G0UA 1S3SA 2GEUA 1I14A 3G2NA 4ARZB 1GD1O 4D9EA 3VDMA 4V0QA 2H7YA 2NU6B 4BO2A 2EEPA 4HPXB 1EINA 4BMDA 3AMVA 4US0R 2VHXA 2V0NA 4HRYA 3I5MA 1RYZA 1GQSA 2AX4A 1T91A 1Y89A 2R3SA 5I7RA 3KWLA 1LVHA 4MS4B 1UBSB 5EVCA 3VHRA 4XSVA 4EB6B 3HBMA 1MNQA 4FDVA 4IIEA 4YCJA 5AVSA 2OCDA 4CKWB 5LYJB 4RQAA 4PG7A 4B85A 5IWAB 2PFSA 2GZDA 3AFOA 1PGNA 2HCTA 5BNIA 2D5AA 4LF6B 3RUDA 3Q5GA 4R2WA 2YYZA 3EDYA 3G9UA 2DUMA 1BJKA 4PC2A 5DSTA 5KS2A 3VI4B 5FL3A 2HWYA 3DLTA 5L3SA 4CUZA 2YV5A 1Z73A 3KPVA 2QZ9A 3R7NA 5J2UA 4UFOA 4KKVA 4ZRNA 2B61A 4FXPA 2IYRA 3OFKA 3ZGZA 5BQ5A 4IGIA 4F60A 1GZ5A 1PSWA 2BEKA 4MW4A 4RY2A 4Q1VA 3R5KA 3AM3A 5F21A 2PBRA 3RS2A 3UOGA 3FD8A 3SBXA 3WWYA 4Q18A 3TOVA 4C2UA 1SZPA 1O95D 5ALKA 2CN1A 4EFDA 3AG5A 5FTKA 4ZXPA 1QP7A 3ICOA 3ZCRA 4KO3S 4H16A 3LOPA 1Q19A 1Z4OA 3KLNA 4FM9A 1BKYA 1JFFA 5DHTA 4UARA 3LTEA 3P9XA 2ZULA 2FPPB 2F9MA 5MN4A 4J16C 2EXXA 2R6JA 3DLCA 4NVRA 3GWGA 3SC6A 3WLHA 4Q34A 2HMVA 3NHFA 4NZPA 3S2SA 4TUYF 5EG5A 3QBDA 1EG2A 2XJ9A 4JEIA 1F7VA 1L7PA 1FOEB 2PBZA 3BBPA 5B3JA 2P2GA 3G1TA 3I01M 3SOPA 2QRPA 3O8RA 1ZMRA 2IUUA 3DLIA 2DFTA 4TKMA 3H42B 1T9CA 4M1QA 9ABPA 4ARUA 3K9FC 3K6SB 2F55A 3NEYA 1WMEA 2F1JA 1QGUB 3TFWA 1UDRA 1V0JA 3D0OA 3NBKA 1Z6TA 5L3VA 1ICIA 3RVLA 1QYRA 5IH7A 1W4BA 3NCHA 5DTRA 5JNUA 2R25B 2GZ3A 4I5DA 4Z9AA 4DCSA 2AI2A 2YZKA 4WXYB 3DFZA 4MA0A 1VPTA 4B3SB 3DL0A 4FUTA 5DH9A 2CFIA 3RVJA 1WEKA 4LXUA 2O2XA 5LYJA 4CKWA 5IKMA 5JARA 4GQAA 2Y68A 3KL2A 4R1OA 3I58A 2PX5A 3QJGA 3IB6A 2GBLC <