1VLMA

Crystal structure of sam-dependent methyltransferase, possible histamine n-methyltransferase (tm1293) from thermotoga maritima at 2.20 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
207
Chain Sequence
HMWHIFERFVNEYERWFLVHRFAYLSELQAVKCLLPEGRGVEIGVGTGRFAVPLKIKIGVEPSERMAEIARKRGVFVLKGTAENLPLKDESFDFALMVTTICFVDDPERALKEAYRILKKGGYLIVGIVDRESFLGREYEKNKEKVFYKNARFFSTEELMDLMRKAGFEEFKVVQTLFKHPSELSEIEPVKEGYGEGAFVVIRGTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Crystal structure of SAM-dependent methyltransferase, possible histamine N-methyltransferase (TM1293) from Thermotoga maritima at 2.20 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 65
structure length 207
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vlmA00
5ICCA 1ZGJA 1DL5A 2OY0A 3G2PA 5EIFA 5DSXA 4RTNA 2NXNA 4GOND 3ELWA 4MQ4A 1DCTA 5K0GA 2IH5A 1JG1A 1VP9A 4C4AA 4Y30A 3KPWA 2PT9A 1JQDA 2ZVJA 3LCCA 1N7JA 4U7PB 3UA4A 4OA8A 4E2YA 5DRTA 5EMKA 3SSNA 3DLIA 3PX2A 5DXAA 3EPPA 3QOWA 5DRYA 1VLMA 1JSXA 3T0IA 3C3YA 4Z2YA 2BZGA 3OZTA 3UJDA 1G6Q1 2XYRA 5ICEA 3MB5A 1RJEA 4HGZA 2FK8A 3FRIA 3QV2A 3NMUF 3SSMA 2PX8A 5KVAA 4G56A 2UYQA 2P3QA 1NE2A 3FUVA 4GOLD 5K0BA 4RTQA 1SQFA 3M6WA 3P9KA 4WVLA 5EEGA 3PVCA 4C03A 2FYTA 3GRYA 3ORHA 5CVUA 2EJUA 5CUQA 2BM9A 4AZSA 1EJ6A 1DUSA 3LHDA 3EVDA 3FTCA 1KPIA 3LSTA 3MTIA 2JG3A 1KP9A 2NXCA 2FK7A 3BGDA 4HTFA 5E1MA 2HR1A 1Z3CA 3HCAA 3TQSA 3PLAE 4RSRA 2BM8A 4AZVA 1KYWA 2HV9A 2OXTA 1QAOA 1R8XA 4RYLA 1KXZA 5GOZA 1RI3A 3O7WA 2AN5A 5D1NA 2O57A 2NXJA 3IHTA 3HCFA 3Q87B 4CKBA 4QVKA 1ZQ9A 4RX1A 5DM1A 5E8RA 3GDHA 1JQEA 2H1RA 4ISCA 3T7RA 5E9QA 3BWBA 3LBFA 3EVCA 1RI4A 3KR0A 5KYGA 4AX8A 5HILA 2AOUA 4C08A 4DM3A 2ZIEA 4NECA 3HVHA 2HWKA 5E1OA 1Y8CA 1MJFA 4WXHA 3I64A 1JTFA 3GNLA 4FP9A 3MQ2A 4C04A 4RTLA 1ZKDA 3GRRA 5LQNA 3P97A 2ZLBA 3I5UA 1I1NA 1ORHA 4XUCA 3PS9A 5F2NA 2R3SA 2IPXA 4EMSA 1IY9A 1G8AA 4BLWA 2FCAA 5BXYA 2LD4A 3MHTA 1R18A 2QRVA 2YTZA 2YQZA 3A7DA 4YUWA 2C7OA 4OX9Y 9MHTA 4DCGA 4GQBA 1B42A 2PXCA 3G2OA 5E1BA 4A6DA 3FTEA 5DT2A 3LCVB 3KPUA 3L8DA 1YUBA 1M0EA 3V8VA 1ZHFA 2QM3A 3CKKA 3HVIA 2CMHA 3IEIA 4Y2HA 2I9KA 2NXEA 3FPGA 3OFJA 2AOUB 1U2ZA 2B78A 2AOTA 2GLUA 5HIMA 1RJDA 5P8WA 4O29A 5FA8A 2B3TA 2OKCA 1PJZA 3EVGA 1KR5A 1NW5A 3MERA 4QDJA 3C0KA 1D2HA 2H11A 2O07A 4FSXA 3ELUA 5CIYA 5MHTA 3BT7A 5EG5A 3CVOA 3GRVA 5FHQA 3B5IA 5FULA 5K0CA 4HSGA 5LSAA 3KKZA 4F85A 3NW9A 1G8SA 1JSZA 1N7IA 2PVCA 2WA2A 5EC8A 1FJXA 4C05A 7MHTA 5FUBA 1D2CA 2Z6QA 4RTJA 4C07A 3JWHA 5CCBA 2PJDA 10MHA 2GB4A 3GXOA 4E31A 4R6WA 2XVMA 3G2QA 4KVZA 2I7CA 5DM4A 5EEHA 2IP2A 3E05A 4UOEA 2ZZMA 1HMYA 5D1HA 3B7PA 3EVBA 3SMQA 2ZW9A 3KU1A 2EFJA 1INLA 4FZVA 4RTPA 3FTFA 1KPHA 2JHCA 2QY6A 3BZBA 3SSOA 1R6AA 2OZVA 1XCJA 3EVZA 2ZWVA 2PT6A 4V0RA 2PKWA 1VQ1A 1WG8A 5CVVA 5EMLA 5ICGA 5EQJB 2PGXA 1Q0SA 3R3HA 4EKIA 5DXJA 3SR4A 4QTTB 3HTXA 1XDSA 1NBIA 1PRYA 2R6ZA 3G5LA 4GEKA 4HC4A 1QAQA 3KQPA 5DX1A 3SM3A 4E2WA 5DM2A 3TM4A 5CD1A 3PT9A 4MTLA 4OQDA 4RVGA 3HNRA 2EX4A 1RJFA 2ZIGA 3B3GA 1AF7A 2ONZA 1JTEA 3C6KA 4GUAA 3P9NA 4P7FA 5E2AA 4ATNA 4POOA 5M5BA 3TFWA 2OB1A 2NNWB 4P7GA 3NJRA 3FZGA 5EHGA 5HEKA 5E2BA 2BR3A 4CXMA 3DOUA 3TRKA 3NDJA 4ER5A 2YXLA 3EVAA 4DA4A 2I6GA 2P35A 1SG9A 3A25A 5LQJA 1YF3A 2VDUE 3QOXA 4YUVA 4AZTA 4CTKA 1VE3A 2ERCA 4KDCA 4R05A 5K0NA 1EIZA 3CJRA 4OQEA 4PYLA 4PWYA 2XBMA 1FP2A 1L3IA 3KQSA 1X1CA 2QYOA 2YXEA 5E8JA 3TR6A 4CKEA 4E2ZA 3EGVA 2UYOA 3VC2A 3MCZA 4HGYA 2JHAA 5EMMA 5HIJA 1P39A 4PINA 3BWCA 4RVFA 1ORIA 1T43A 4PYQA 1NT2A 4PCLA 4QPNA 4V0QA 1VBFA 5DWQA 3GWZA 3V97A 1AQJA 2YR0A 2HTEA 2F8LA 3KR1A 5C9ZA 1KYZA 2PY6A 1QAMA 1G55A 2AS0A 5FTWA 4P7JA 3SXJA 3GU3A 1YFLA 3FUXA 3LX6A 5E9WA 3UJ8A 1R00A 3LCUA 1UWVA 2PWYA 2PX4A 2V74B 3R24A 5K0LA 1X1DA 3OZRA 1YFJA 1YZ3A 1X1AA 5GWXA 3UFBA 5EVJA 2AR0A 5DX0A 1L3BA 5GIOE 3GCZA 1P1CA 1BHJA 3HA3A 5GINE 3I9FA 2E5WA 1M6YA 4X1OA 3ER8A 1JG4A 2PLWA 4KW7A 1XVAA 4QVGA 2FPOA 5DX8A 2GH1A 3M6XA 3HCBA 2DULA 5LQUA 3CJTA 3DULA 4BLVA 5IKMA 2NYUA 2PWPA 3BGIA 2WA1A 5T64A 2OO3A 3IV6A 1D2GA 1XDUA 3JWIA 4OBXA 3U81A 3DUWA 5BW4A 2JH9A 4F86A 2AVDA 1NW8A 3IYLW 3NVMB 4PONA 1WXXA 1NW7A 3HEMA 4AUKA 2O0LA 4HTFB 5HZMA 4XUDA 1VP3A 5HOQA 5EZQA 1M6EX 3FPFA 3THRA 1EJ0A 1SVUA 2QE6A 2ZZKA 1JQ3A 3AWIA 3DMFA 1O9HA 3KQWA 4GC5A 4GOMD 4RVHA 5EKUA 3M33A 5H02A 3EVFA 4L7VA 2JH8A 3KR9A 3NDIA 3OE4A 2OYRA 3OZSA 5ERGB 4EK9A 5CCXA 2K4MA 5HIKA 1OR8A 5EGSA 4RTSA 3AY0A 2IDKA 3NVKI 1YZHA 3DXYA 5E9JA 3LL7A 3UBTA 3AXTA 3RW9A 4PNEA 3VC1A 2EG5A 5U4XA 3M4XA 2VDWA 2V7EA 3G89A 3HCCA 1UFKA 2KW5A 3GJYA 1O9GA 4M7RA 2VZ9A 4PIPA 4PGHA 3CBGA 3OU6A 3P71T 1BC5A 1WXWA 3MAGA 2ZBQA 4MWZA 4PIMA 2P41A 1R74A 1VIDA 2IBTA 1L3CA 2OBFA 2B9EA 3NWEA 5CVEA 4YMHA 3DMHA 3M6UA 2ESRA 3O4FA 2GS9A 2QRVB 2IGTA 4AZWA 5DLYA 3FPHA 1NW6A 4JXJA 1NBHA 5FADA 2C7RA 3P9IA 5F2KA 2YVLA 4DZRA 2N47A 2P3LA 3ER9A 3KPJA 3OPNA 4KIGA 3R9XB 5CVJA 3FRHA 4QPPA 5KS2A 4BP1A 2AN4A 2AOTB 3E8SA 4RWZA 3HVKA 3BUSA 5GM2A 5K01A 5GIPE 3K0BA 2OB2A 2IH2A 2PX5A 3I58A 5DTQA 3UA3A 1VL5A 2ZFUA 1FP1D 2YXDA 5DM0A 4CTJA 1QZZA 5K0JA 2IH4A 5T6BA 1JR4A 3SVZA 3DR5A 4IKPA 4X63A 5G02A 4PYIA 2Q41A 3WSTA 3LKZA 3CGGA 4GBED 4KIFA 2PBFA 3ANXA 4FR0A 2PSSA 2ZWAA 4U7TB 3E23A 4RTRA 2GPYA 3LBYA 3SGLA 4R8RA 1Q0TA 1RI5A 3NWBA 2G70A 3UZUA 4R6XA 4PYKA 3REOA 2ZSUA 2WK1A 4M36A 2AVNA 3G5TA 1X1BA 4DMGA 4ER6A 3BWYA 2Y1XA 3GRZA 2G72A 2HMYB 5T67A 3P9CA 2XYVA 4K6MA 2UYHA 3KQTA 4P58A 1I9GA 3G88A 3OCJA 3ELYA 4B17A 3EMDA 3TLJA 2I62A 3KQVA 2ZULA 2YX1A 1QANA 3LDUA 5FWDA 5EKXA 3HCEA 4LG1A 5LQCA 4FT4A 4A6EA 3C6MA 3EEYA 2G1PA 3H2BA 3TKYA 3Q7EA 3TPZA 2H00A 1NV9A 4XUEA 2A14A 3KQQA 3KQMA 1YB2A 2CL5A 3CJQA 3HA5A 3K6RA 1AV6A 3HA7A 1ZGAA 3ELDA 4YMGA 4MHTA 2YUIA 4R8SA 3G8AA 1RJGA 1V39A 2GA9A 3LDFA 1XTPA 1TPYA 3B3FA 5GM1A 4M38A 4E70A 4BY9E 1XXLA 2JJQA 3MCTA 3P2IA 5FQNA 4ER7A 3UJBA 2IBSA 3ID6C 3FPJA 3LPMA 5BW5A 3GGDA 5KQRA 4PYNA 1SQGA 1WS6A 3PFGA 1EAMA 3PFHA 3LDGA 4LECA 1MHTA 3HCDA 3UWPA 3I53A 2C7PA 1XDZA 2AZTA 4RTKA 4FT2A 5HIIA 5K0EA 1SKMA 3G8BA 2BH2A 2XVAA 5C0OE 1F38A 5B1SA 4YUYA 5LQAA 3HP7A 3HVJA 4CKCA 2VP3A 3A4TA 1NW3A 4FGZA 4ER0A 2BR5A 2IDJA 5EZSA 5JR3A 3MGGA 3DP7A 3JWGA 3DLCA 4CWAA 3G7UA 2P7HA 3KR2A 3OU2A 3BXOA 5K05A 2CKDA 2UZ4A 3X0DA 1I4WA 2P8JA 3SX0A 3FYDA 4GF5A 3S68A 3BKXA 4EVIA 1KHHA 2B25A 1RI2A 3UJCA 1AQIA 3GO4A 3AXSA 3PX3A 4GOOD 4RVDA 4X60A 5DTMA 3TM5A 5DPMA 2P40A 2G71A 1TW3A 2AOXA 3F4KA 1ZG3A 3AJDA 3DXZA 4GC9A 1BOOA 2VDVE 5K8VA 1UIRA 1NV8A 2PX2A 1HNNA 4QTUB 3THSA 2CMGA 3KHKA 4KRGA 4DQ0A 3ME5A 2DPMA 4FS8A 2VS1A 1O54A 3UJ6A 3ERCA 3T7TA 1IXKA 4YV1A 1R8YA 3KPVA 2EJTA 2Z6UA 4KDRA 2HNKA 1WY7A 4QDKA 3RODA 4RTOA 3PTAA 1L9KA 3MTEA 1NKVA 2ORED 2CWWA 3HM2A 3O31A 4X41A 4ZTBA 5K03A 5KQSA 2Y1WA 2ZCJA 4E33A 2B2CA 4BLUA 4EQZA 1BKYA 1FPQA 2G8NA 3EMBA 3PB3A 5C1IA 3RIEA 1SUSA 4OBWA 3KQYA 5BP7A 3TMAA 4DKJA 2Z6AA 4DF3A 4LWPA 5EIWA 5IH3A 2AN3A 1EG2A 1JG3A 3GRUA 4PYJA 2P3OA 3VYWA 1XJ5A 2UYCA 2AOWA 1H1DA 5FQOA 1G38A 5FHRA 4YUXA 1IM8A 2IFTA 3A26A 4H0NA 1VPTA 4YUZA 1G60A 2PXAA 3FPEA 4IV8A 2ZTHA 1L1EA 4QQNA 1TW2A 5DTRA 5DSTA 3B3JA 1P91A 4PGGA 5FA5A 1FBNA 3UJAA 4KWCA 3R0QA 4XCXA 5CVDA 3T7SA 1JG2A 4P7KA 3LGAA 3FUTA 1N2XA 4HH4A 4YV0A 3M70A 3OFKA 4DCMA 4PYMA 3M6VA 4OA5A 3EVEA 5HFJA 1P1BA 2O06A 2XYQA 3DH0A 4RV9A 1SUIA 2ZIFA 1EQAA 1QYRA 5EPEA 4BP3A 4E30A 4ER3A 5LR6A 3EEOA 3A7EA 3KPYA 3FTDA 4HRAA 2PV0A 5K09A 2C7QA 4QQKA 5CM2Z 5EMJA 3E7PA 2AOVA 1KIAA 1X19A 3A27A 3D2LA 3GIWA 3P2KA 4M37A 1F3LA 3DMGA 3R6TA 5GP1A 2IIPA 3P2EA 4F84A 2GAFA 5LQKA 5EHIA 5FWAA 4HG2A 2O05A 2PXXA 4FSDA 4LWOA 5K0FA 8MHTA 4IV0A 3UJ7A 3OE5A 3BWMA 5F2OA 5FCDA 2FRXA 3JWJA 3CC8A 3KQOA 3G2MA 4X61A 2NP7A 2BR4A 5JUWA 5E1DA 4IWNA 4PYOA 1XCLA 3TKAA 2NP6A 2JHPA 3DXXA 5EOVA 3UJ9A 3EGIA 3VSEA 4EKGA 2ADMA 2P7IA 4RTMA 1WZNA 2ZBRA 3FYCA 3FUUA 3LKDA 2P1DA 3EGEA 3TOSA 3C3PA 2ZBPA 3NTVA 1KPGA 1RI1A 2OPBA 3LECA 4MIKA 4C06A 3FUWA 3BKWA 4E32A 3BGVA 4YV2A 3B89A 5LQRA 5ICFA 3P8ZA 2ZZNA 4PCAA 4E2XA 3OU7A 3CCFA 3DTNA 2ONYA 2FHPA
chains in the Genus database with same CATH superfamily
2J9GA 5ICCA 4Q4HA 3K2EA 4M1TA 4WPGA 4ZCLA 3STYA 5B3KA 2OEPA 5LVAA 1I7LA 5JPDA 1EWRA 3D43A 2J46A 3OQVA 1RWMA 1SC3A 3C7KA 2W2TA 3QUCA 3QVGB 2VUSA 5FOUA 4JYCA 4QAQA 5BQ5A 4ALKA 2MSEB 4B83A 1UOOA 4BNUA 4B3IA 2NAFA 4JGGA 3OQ6A 5DGHA 4E2YA 1QORA 4Q9KA 3MIIA 3T0IA 3KG2A 5IPFA 3SFVA 3TAHA 4C2BA 4IRXA 5EESA 4IQ8A 1P60A 5H80A 4D8VA 3KZNA 4FWBA 4GYJA 4MPTA 4LXTA 4EARA 3BTVA 4MEBA 3TINA 1Z0KA 5EHXA 3ZW7A 4UDXX 4ABYA 2BAGA 1DINA 1BEEA 3W04A 2ZRIA 1Y3BE 1UOPA 2QWXA 4GOLD 3WL7A 1LU9A 1TK9A 2BHRA 3EG9B 2IXTA 2QGZA 4IWXA 4NVRA 1E2QA 4PLHA 3R8FA 4MUIA 1ZN9A 3UPTA 4L9AA 3CEAA 4AECA 3NDRA 4QUJA 3ASYA 1HDOA 1C9JA 1I32A 2POCA 2I33A 1A5BB 2VNIA 4MI6A 3TEFA 3VZQA 4EJ6A 3K7EA 1T4MA 3I2GA 1KP9A 4OJYA 2G8LA 3WLHA 1EPUA 4IOKA 3U7QB 3HCAA 2OQ2A 2RHWA 5DTJA 2BM8A 2WJPA 2NT3A 1CZOA 1K6JA 2R6DA 3AZOA 3HU1A 5TDHA 3ZJ5A 4BLOA 1A8IA 4AS1A 4UBKA 1KXZA 1YR2A 4N01A 2MDTA 4BGIA 1H1LB 5JAMA 1JRLA 4ZJYA 1ZESA 4NCIA 2J7KA 3SIRA 3VMMA 1BA3A 1RCFA 1F06A 2FSVA 2NUBA 3AHDA 4O2AA 4BYGA 2GETA 3L1HA 1JZTA 3FB1A 3MW8A 4U3JA 5D2CA 4DNOA 3R7NA 2WUWE 3S44A 1QRUA 2HWKA 4AJIA 3ZU4A 5JNUA 3OQOA 3E9RA 2IK8A 3MWGA 4CQMD 3G6WA 3ZGVA 2QU7A 3R5KA 2BMFA 4DZZA 1KBQA 2WM2A 4AMGA 1YUNA 1T3ZA 1Y1TA 3GRRA 3FDZA 3C87A 5BSFA 5JYEA 3TLXA 5JQGB 1NULA 3SCZA 1ODTC 3LRTA 2FFAA 4XGKA 1H2HA 1AS2A 3GFTA 1RQGA 4IKEA 4WKBA 3PC6A 1YZTA 5AM4A 1PZHA 4G1BA 4EMUA 3IAEA 2I6SA 1ZHFA 1HZZA 3HVIA 3PC4A 2FG6C 2NUPA 1NM5C 3F73A 4EG8A 3TTSA 1GUYA 1G7TA 1WB6A 1SB8A 4NXMB 1TGYA 3FYUA 4P08A 4WCDA 3ZGNA 4Y18A 1EEHA 2OKCA 3SS9X 4FZRA 4OSPA 4ZAFA 2ZI6A 3RIHA 3ZIAA 1R6XA 1UXKA 4XH9B 4FSXA 4HS9A 3OQBA 5JZSA 1ECGA 4LQ4A 3JD1A 4QO8A 3V1YA 4HWTA 4LGYA 5A3QA 4IUYA 5EZYB 1W76A 4JL6A 1G8SA 5KINB 2OLKA 3JVIA 2R6CA 4IXTA 4WL0A 3K0CC 4B3RB 1YJAA 5AW7A 1NVKA 1Z2PX 4NBLA 1E99A 4R8KA 4BDTA 3VSAA 3O3MB 1P5FA 4UUBA 2IEAA 4GX5A 4LOJA 4F2DA 1KORA 5DGIA 2P69A 2B0JA 1A5SB 4FCCA 4NDAA 1L7XA 2R87A 5CJJA 3CVVA 1U98A 1DQNA 2NSLA 1T3SA 3L93A 1EWQA 4TKVA 1JPUA 1B7GO 1RLTA 3QIVA 3TEMA 2HN9A 3IKJA 5CIQA 1L7RA 3MMSA 3FTFA 1UFRA 2WLTA 3F4BA 3C7AA 5ELMA 2JHCA 3TZ6A 3UXEA 3V7YA 3ZQJA 4X6XA 4BAZA 1UKBA 1POXA 3WGIA 1XCJA 4QUKA 3VNSA 2RARA 1BMDA 1DEOA 3IP1A 4JXKA 4DDHA 4UVDA 1VQ1A 1WG8A 1NYRA 4M7WA 4OGKA 1YJXA 4BVJA 4EFNA 5ICGA 3GMDA 1PVOA 2BSAA 4MVJH 1IULA 3K94A 4OSEA 3RS2A 1MRZA 2JB9A 2O8NA 4MWDA 3WIEA 3WK5A 2PVPA 2EX1A 2XMSA 4J43A 5CB0A 4YCNA 2CVQA 3EUAA 3GFFA 3QPVA 1WBDA 4MVCA 3GT7A 1QAQA 1X8JA 3SM3A 4EY5A 2QS9A 4ZO8A 1FC0A 3DT9A 1QFXA 4GDMA 4GMFA 1RJ9B 4D9EA 5IJ9B 5G2OA 3F2IA 1UPXA 2NVUA 3PPWA 2C29D 4QAJA 1TC2A 3HN2A 3LV8A 3PE3A 5SZHB 1JKXA 1G2OA 2P9YA 2ZTSA 4REMA 2VXYA 3FN4A 4UFNA 4EPXA 2DUMA 5JZMA 1SBYA 5EHGA 1LK0A 3LOUA 1RHRA 1HG0A 3DTVA 4UU8A 2ES4A 3HR8A 4XQCA 5E2BA 1QVRA 3NDJA 5ISMA 3G6KA 1GCGA 2I6GA 3NXKA 5A5GA 1HT3A 4AXBA 5KNDA 1SZDA 5DMXA 4FS3A 2QTAA 4ZOQI 3WL5A 1THMA 2NU8B 4M8IA 1JKFA 4J16C 4LDNA 4DRXB 3OQNA 3IPAA 1MDFA 2AX4A 2QYOA 1U2SA 3OKPA 3FTPA 3K96A 1MABB 3EGVA 4DPLA 1C7IA 3JQ8A 5ALTA 1W4CA 3R7WA 2BGTA 2C5LA 1KKMA 3FJYA 4BO7A 3LO5A 4GP9A 1XOIA 3DT8A 1DKPA 3EEFA 3ESZA 4TZ0A 2PR7A 3IEXA 4HN9A 4FCWA 1M54A 2PY6A 1CJVC 1DDOA 1FFYA 2Z9DA 3EQ9A 3TQFA 5EJ4A 1PWZA 3VHRA 4NL4H 2B69A 2W6JD 4X54A 4UU1A 4RK1A 4OHFA 5IAOA 3DWFA 3HR7A 4H27A 3PHHA 2AKAB 1QV9A 4DC1A 4EP1A 5KOJB 1L4HA 4JLOA 4LCBA 4KPGA 2FUKA 1EFDN 5HF5A 3GJSA 3KTOA 5KC9A 1PFQA 2FWNA 2X3FA 3BIXA 4YHBA 1N1EA 4WOKA 4EI8A 3KSMA 2F9FA 3CE6A 1EFCA 3TCNA 3X2FA 2JIZA 2WVHA 4ZTZB 1FX1A 1YRAA 4JVSB 5AOVA 4Y0NA 5K0TA 4UQLA 2WU4A 2WA1A 2OCGA 3TOCA 4BMPB 1MOQA 1RCTE 3VR3A 1HLGA 1KI9A 3JQ9A 1SXHA 4F86A 3OX1A 1V71A 4B2IA 5EJGA 3THWB 3R0JA 1YS9A 3G0BA 4AK9A 4BS9A 2FUG1 2FMKA 1SBCA 1VP3A 4B4OA 2XNSA 3MUOA 4TM8A 4UBMA 1QHEA 3THRA 3ZNQA 5AUNB 2QXUA 1U0SY 2C3PA 2QE6A 2Z83A 2W7TA 3BXGA 3DMFA 2BFCB 4G86A 3S1AA 3VKVA 1RVV1 1RU3A 3NHUA 5JZ9A 2VDPB 4UASA 2DKNA 5E4YA 4BRWA 3AEKA 2NO6A 3H8WA 1NSFA 3LSYA 3OIYA 4HGOA 2ID7A 5AK0A 4RTSA 3D4IA 1QIJA 4NG5A 4AAYA 2VBFA 1KU0A 3VTAA 1VIYA 2GZHA 3SF0A 4X85A 3ADCA 1A1VA 2XKJE 3AOGA 4DQLA 3NAZA 1TM4E 4I6GA 1Z17A 3ZXSA 2V7EA 1UFKA 3DE1X 5A9TA 4Q7MB 3LPNA 2R7AA 1N6HA 3P94A 1KAEA 1LBSA 2OZPA 4NDNE 3WL3A 2ZR0A 2OQRA 2XGOA 4K9PA 2ZBQA 3LDAA 1U3VA 3WFJA 4PIMA 4ALLA 4IIJF 1D8TA 3DTTA 5JRDS 4QQ8A 3H2GA 4HQLA 2OBFA 4G0MA 3NIWA 5A4FS 3DMHA 1L5OA 3I9NA 1VMDA 4KQ9A 2A3RA 2AC2A 4EO9A 4GO1A 4CMHA 1GPLA 5JDIA 1OLXA 3KAPA 4J0HA 1HEYA 2OGUA 5ALFA 1CY1A 4XW2A 1X8XA 3TLCA 2WWIA 3JRXA 1T5IA 1CPYA 2NZYA 3D59A 2G09A 3QLEA 1JEJA 4HVAA 5KS2A 5L3SA 4RWZA 2X4IA 2H29A 4GPBA 3HE3A 3WG9A 3K1ZA 3DDWA 3UA3A 1T6XA 1UK8A 2Y68A 4KGZA 3QKIA 2FNAA 1XB2A 1MOSA 1U8YA 3R0VA 2WUFA 4ZGBA 1J9EA 2F67A 3D8RA 3AF3A 4FBLA 1SCUA 3DR5A 3WGMA 1NWCA 2IXDA 4KI0A 2Z2JA 4J0JA 1YZFA 3TG2A 3KXKA 1IAVA 4NYMQ 1CY7A 2Y6VA 1VHQA 1WPGA 2O5VA 1G8GA 2RKOA 1L4NA 3FX2A 4FINA 2GDJA 1T0BA 1XMIA 2B34A 5AKEA 5CFRA 2H54A 5IF9A 1BZYA 4R8RA 3EZ6A 2WMDA 2WDZA 4NBRA 3TBFA 4WBNB 1QGUA 4YHHB 1LWNA 3C5CA 2A0XA 5JJLA 1G21A 5FJIA 2W00A 2Y1XA 2HSZA 2IODA 2QD2A 3I1YA 1JWLA 3P9CA 2HA2A 3ZXYA 1TTPB 4ID9A 2FN4A 4AI6A 1BHQ1 1MV5A 2IHZA 3ELYA 1NOJA 3PNVA 1J70A 1ELOA 2ZULA 3K9HA 3WBFA 1DC3A 1LDMA 3OFND 4KPUA 1PWHA 3X1XA 3ESAA 3CA8A 4O4IF 2G1PA 2XOEA 3D8HA 5AI5A 1PR1A 1T2AA 3HJGA 1Z6PA 3L0CA 4F12A 3BCSA 2OXRA 3L01A 3PJFA 4L6AA 3KQMA 1QHIA 3AI2A 4NYJR 5FLYA 1QGZA 2QE7A 1NW4A 1WB9A 4B6GA 3CO5A 5CHEA 1RRPA 4OCZA 5EWMB 1HDCA 4R8SA 5TSDA 3OEED 4GX2A 1EK1A 3UMYA 3UMSA 3CLSC 4RVNA 3LLCA 3RJTA 5FOQA 2BKVA 2MYPA 3NASA 4ESHA 4JBWA 2QTZA 1H2AS 1IBSA 4O6VA 4WESB 4CLOA 2ICAA 1YS7A 4S04A 3RYIA 3K9QO 1ZGBA 2RBEA 3BXXA 3EA0A 4LECA 1Q11A 2A57A 2AQHA 1RWVA 3BILA 3IDSA 2NTYC 4PX2A 4II2A 4RTKA 2AZTA 1YDGA 2E49A 1HZJA 2V6MA 3WJ7A 3ZU5A 2P77A 3QW2A 4BVKA 3HP7A 3P2JA 4CKCA 4I4NA 5E3IA 2VP3A 1YJQA 2R6GA 1KHTA 2NIPA 3D5QA 4CM7A 1SB9A 2QNRA 1J99A 2R5FA 4B84A 4OUDA 3D02A 1R0RE 2QSZA 3EX7C 1YAHA 4GQAA 2P7HA 1NSYA 1NBOA 5A4AA 2NM0A 5EWJB 3KO8A 5K05A 4Q6WA 2J30A 1E5TA 2O1XA 1H8HA 3INGA 2CLOB 3CYFA 3S5UA 2B25A 3QPAA 3CRMA 3KEOA 4XQEA 4I3HA 2WAXA 1I5OA 5GVRA 4LYFA 5GONB 2D62A 3AIOA 2X2OA 3CZ9A 4ILKA 3AVTA 5B36A 3LP5A 1YVRA 1DBWA 2G71A 2ZUBA 1VPWA 3HCRA 3R74A 1L4EA 4G0UA 3PCRB 2R44A 2CNKA 3NKFA 2IRWA 3KWLA 4H7JA 5DLPA 1J20A 3GLTA 2NT4A 3MTQA 3OLZA 5JYCA 4ZCTA 3EXHC 5I9BA 5JH7F 1NSTA 3WLFA 3TTYA 3O4JA 1JN0A 4TWJA 4BN4A 5F98A 2XMGA 2P8SA 1H2FA 2W43A 4LDRA 4TRJA 4QBHA 4XIYA 5AHWA 1KTVA 5KQSA 4BFWA 2HFJA 4M0LA 5EE5B 4ENQA 4FZ3A 4MS1B 1G6OA 1P2VA 2ODNA 4EL0A 2GEUA 1SUSA 1YB7A 2PMBA 4JLBA 4B32A 3W5AA 2O9JA 1P1KA 4LOKA 1SOWA 4TKMA 4DB2A 5ALJA 1D9XA 3DB1A 1LJUA 1UMBB 5IBRA 3RHSA 4BOYA 2QZSA 1T2VA 3GDOA 3L7MA 3PGLA 4I1PA 2WHEA 3RK0A 1CS0B 1TXGA 4YUZA 4X91A 3IKTA 1VI5A 3FPEA 3D6NB 1W30A 4ZYYA 4YJKA 1TADA 4EB6A 1KZ4A 3KVRA 4LZOA 3T7SA 4G0PA 5LLDA 3P1JA 1QX4A 5HKBA 3KDSE 4X97A 3LLMA 4ES6A 2Q6TA 3H1BA 2QMYA 5D87A 5KOHB 2W2XA 4CKYA 3KU4A 1CRQA 2IGBA 2RGAA 2QRMA 3ZDXB 4DV2B 4LN1A 3TNDA 3DOFA 4L76A 4DR2B 5E6UB 1XRNA 3NCTA 4DLZA 4P4SB 2JLZA 3CE9A 1PD1A 1ZH6A 5JCXA 4P32A 3KCQA 1P8JA 4OD0A 1TB4A 3PK0A 1IMJA 1LBIA 2V4ZA 1GVNB 5FUYA 2FWIA 5B58T 3TO5A 4M0DA 2G5PA 4UAGA 4RGVA 4TMFA 1QBGA 2AD1A 4TTSA 4WXEA 3OF3A 4FSDA 4LWOA 3O90A 2JAPA 2XTJA 2ZRNA 3GARA 1TU3A 5DU2A 5F2OA 5G1PA 5LA6B 2FRXA 4MRSA 3OICA 4OHCA 1M34B 3HPQA 1L7MA 3K4PA 1SBHA 1M66A 2Q1WA 2VO1A 3A2LA 3F6PA 2WQ6A 2ZUFA 5ITSA 1IQRA 3TB4A 4DNFA 3ZE6A 2ECOA 1MNAA 4TROA 1ZH8A 3T7CA 2EBFX 3MUNA 3R0XA 1M33A 1YMUA 1ZO8A 2AMFA 1XZAA 2V3WA 4QU9A 2EWVA 4O4JA 2J07A 5JVDF 4UARA 2O2XA 3WQHA 4BNIA 1FP6A 4I66A 3EGEA 4BMSA 2CXNA 3HZOA 5B3AA 3FF4A 1YVPA 5BURA 1AKWA 1GG5A 4UE3S 3NTUA 3THXB 1R6DA 1ULZA 5JC1A 3MJDA 1U7UA 1D5CA 1OTYA 2QUHA 3F9CA 5TX7A 1JE0A 1PEAA 1PJRA 4ZHQF 4E2XA 2EQBA 2WJ3A 4MAAA 3ISTA 1KO7A 1R8JA 2FHPA 3IKMB 4Q4LA 4L08A 2A9JA 1SCJA 3LXXA 3NAQA 5EIFA 4L57A 5K3AA 1D4ZA 1T8WA 1WKVA 3HO6A 1QE0A 4DQDA 4MR9A 3DO5A 3D1VA 4PVCA 1A77A 3A0RB 1DHRA 5K0GA 4C7OA 2XA9A 4Y30A 3K71B 3H3FA 5JZOA 1L2TA 4MKFA 3R76A 3UA4A 1D6MA 3W2HA 2WB4A 1KSGA 5DRTA 5EMKA 5DXAA 3RRYA 4Q9LA 4J6FA 4NU0A 1IB0A 2HXGA 4H7FA 1B6TA 1UZNA 1FJGB 3GGPA 4PLPA 4AURA 4GSLA 4MHOA 1OXVA 4B2PA 3QVVA 3U4CA 4BJ5A 2YIJA 4GX1A 2E6KA 2IU6A 4JX8A 3W5CA 3SSMA 1QYCA 2GASA 3H3JA 1YI0A 1MRSA 2A78A 4M1YA 4QL3A 4U7GA 3QA3E 3Q1KA 2UXCB 1OZ0A 1PFYA 4JC4A 3WTCA 1YGPA 3PNPA 4BCDA 3PVCA 1BU5A 3RHZA 1DE0A 4MV6A 1EX1A 1H9AA 4O2BF 4E2FA 2ZSDA 3FTCA 1J0BA 1KGSA 2EYQA 2HLNA 3GGOA 1RZVA 2D5AA 4CNQA 2UV8A 2QMOA 2AUMA 4I8DA 4CF5A 1M5UA 1Z75A 3WLAA 4P7BA 1NNEA 1N1GA 2HV9A 4M9UA 1VIVA 4DMKA 1SMKA 1XVLA 4F2HA 1O5TA 4ZQHA 3Q8MA 3P5BA 4ZZ3A 1CJBA 1JDBC 3A1FA 4LGCA 2RCNA 1IK4A 4RQTA 3JTMA 4RJIA 4OHOA 4OB6A 4CR6A 2J33A 3C41J 1TVCA 2BMWA 4K26A 1KEVA 2AD5A 4NMWA 5E1OA 3H5WA 3TLKA 5F1KA 5JAUA 2VF7A 1I4TD 1H3NA 4J1TC 1K9SA 1P0PA 1E1CA 2R4QA 3MOGA 5AM5A 4HEJA 1R6TA 2C5GA 1MAWA 1DEHA 1JKIA 1ODIA 2X5KO 4HYYA 4TRRA 3VOAA 4A0RA 5KYTA 3WHIA 3KXDA 1JYFA 1K92A 3KYDB 5KWVA 3IC5A 1W47A 2FCAA 2W98A 2WT4A 5DEOA 1CY6A 5EE3A 3EZLA 1GU1A 1TJYA 1T6ZA 1N4AA 5KTTA 2AFIE 4XSGA 3VZPA 1E20A 1K5GA 3EMVA 4I1VA 4ON9A 4YLEA 3TLZA 2VPIA 3ST7A 3ZU2A 1U2TA 1DEXA 4Z8YA 3REFA 4UDOA 4Q18A 3NEPX 2B83A 4O29A 4L51A 1G2QA 4UVIA 1PJZA 2BEKA 3PQ7A 3OJWA 3WGJA 4C0JA 3BQNB 3BTUA 5JNRA 3HJBA 1GZ7A 1G8FA 2WSMA 1WCIA 2ZUDA 3NH9A 5ALDA 5K0CA 2O3UA 2Q2QA 4NMHA 4KXYA 3ZHSA 4GSYA 1NN0A 3SF8A 1TT5B 3WAKA 3KQNA 3EH1A 2Q4BA 5FNVA 4RZXA 3H5LA 3HB0A 5H82A 5JCOA 1RS0A 4NE7A 3U16A 2R1ZA 2WU3A 2QXYA 5CCBA 10MHA 5JI3E 1EA5A 5I7FA 6NULA 1QE3A 3B7PA 5CK4A 4PN7A 1C1HA 3W8FA 3RJ5A 3R41A 4RXUA 4ND7A 5JO9A 3WNVA 3LQQA 2XITA 2GCOA 3IMEA 4E5DA 5TJHA 4ENTA 5AUOB 5HR5A 1CEYA 1EXWA 1PZXA 4LK3A 4XWGA 1F4LA 1N3IA 3L9XA 4V0RA 1VKZA 1M5TA 4PLFA 2EFGA 1SH7A 1J4AA 3I1FA 2FDXA 1SOMA 2QRPA 1TNDA 4FGJA 4QICA 4Y1RA 3SYTA 4G89A 1CE8A 4D3ZA 4PQEA 5CLQA 3U40A 1D03A 2XKBA 4A5SA 2R6ZA 3KX2A 3ONVA 3WLEA 1FTWA 4IJ5A 4HC4A 5HQTA 5F3DA 4HNRA 2X8JA 4YVFA 2V7QA 4CBVA 4M22A 4U2BA 3AOEA 3K1AB 3LC7O 3U4GA 2O2JA 1NNUA 2ZYIA 1JTEA 4DMLA 3O8QB 4I1UA 4RCZA 4HMPA 4GGMX 1XD9A 5DGTA 7AT1A 2A9KA 2DHEA 5CLJA 2EP8A 1TKAA 2DPHA 4QUAA 1YDHA 4RL6A 1Y1LA 3TMKA 4IIEA 4DXHA 3CNQS 2ATCA 4Z3DA 5I9LA 1D2AA 2AE1A 1EZZA 1KI4A 1T3HA 2WF7A 3AEUA 3C24A 3ITEA 3JD2A 4TS9A 3SN6A 1NDHA 3U81A 5M04A 4G8JA 2ZDQA 1TFRA 3EW9A 3IKVA 1VE7A 1S96A 3QVOA 2EGHA 1VXOA 2AXQA 2OUKA 3SZRA 1NLFA 1OXBB 3VU9B 2ZT6A 4RD4A 4C3VA 3OMLA 2H4XA 1Z68A 2A1TS 2JW5A 1L3IA 3QVXA 3O95A 1JIVA 1XZEA 2DWUA 1GZ3A 1BS2A 2JHAA 4GMXA 4R8MA 2WIFA 4GPEA 4D6PA 3IIKA 5D5PA 4MPJA 3NBKA 1PJTA 4PC7A 1V3UA 4LV6A 3CRVA 4I19A 4JBXA 3NHSA 2E4WA 3HKCB 2PKYX 4FMCF 4TN5A 1IXYA 1XRRA 2Q50A 2SCUA 5KYUA 2VHYA 4DARA 3OKAA 5A6SB 1GOTA 3D3WB 3O5AA 2WWFA 3AQIA 1M1NB 5I01A 5T3UA 4LZLA 4R2MA 1XQXA 1J0XO 4LI3X 4NU5A 1MVLA 4HT3B 1FRNA 4V0NA 1ISHA 1HORA 3IIEA 3QTLA 4ZOLA 1E6LA 1X0XA 4AROA 2V9CA 2B4RO 3ABSB 3MBIA 1U5BB 1FEZA 3PV0A 4AG3A 5CFNA 1KI2A 1IY1A 1X1RA 2V7VA 3GQVA 4N5DA 5LQUA 1ARZA 1HG1A 2C88A 4KMMA 2WMOB 3A2MA 1U04A 4BFLA 2O7QA 2JH9A 2OBMA 4YBRA 1BGVA 4U7FA 4V38A 1K08A 4C14A 4AICA 4F4FA 3PWSA 3COJA 1A4XA 1NW8A 1P7WA 3M5DA 1WXEA 3K2IA 5GJCA 4IY1A 1WXXA 3Q5DA 3HCWA 1GPUA 1UBUS 2C9ZA 4DIUA 1KEWA 1WSWA 3K8YA 3O7MA 1JQ3A 4QIHA 5T57A 3B36A 1W59A 1HQDA 2G5CA 4OKSA 3KJXA 2JLWA 2DFKB 2G9UA 4QU8A 4AFNA 4BL5A 1VJDA 2IUEA 5JD3A 2X0EA 3HVRA 3UYLA 4V2UA 4YJ2B 1TMGE 3RLIA 5HIKA 5GMOA 2A0UA 2I3BA 4NBKA 3AY0A 2X2EA 4W63A 4DV7B 4UEWA 4GXQA 2NZUG 3B1ZA 2V6BA 2WHYA 5D8DA 1KOFA 4AF6A 3OQIA 3BMXA 4ROTA 1USKA 3GRPA 1LLCA 5JROA 1E3JA 3DOHA 1GN9A 1X94A 3H1EA 4HQKA 2BFFB 2BKUA 4M7RA 2PZFA 4H0CA 4PIPA 3T5BA 4ZAWA 4EQ6B 5KYWA 2MJLA 4IDNA 3U19A 3WWPA 3IOBA 3D6MA 4XA8A 4XDHA 3ZCSA 2I7TA 2GUGA 2YZKA 3BB1A 3LVRE 3RCBA 5EHZA 5IRCD 3EGWA 3Q6MA 4MUMA 1XEXB 3D4NA 2G6TA 1VB3A 5FOVA 2OZEA 3RGWS 4EI7A 2R00C 4PV7A 1N78A 2SHKA 3NXSA 5D5QA 2XWQA 3IE2A 3IQIX 2UZ0A 2WZDA 4OHVA 3ZS8A 4WJLA 4PZCA 1C7EA 2AI2A 2O2CA 3MGCA 3N8DA 2ZVQX 2ORYA 2R2GA 2BGKA 3QVTA 3HYNA 5BV8A 1VL5A 3HQ4O 2CXUA 3BEOA 1E6MA 3FETA 5KJEA 2V1UA 3DQPA 4J3JA 2Q9BA 4ND3A 1BOFA 3PXBA 2WTUA 3JALA 3CZAA 5CYPA 4E4TA 4ENPA 1ZRMA 2PUWA 2WSIA 4NYMR 2ZRCA 5D85A 4DUZB 1J2TA 4JCOA 2WHPA 2CNBA 4F04A 4KIFA 1NVGA 2QTFA 2RKBA 2VAPA 5DOZA 2HHLA 3IO5A 1HI9A 1MOPA 5KWIA 3USES 2I2DA 3BOSA 4Q02A 2RGDA 3T3IA 4HPJB 3F90A 2W71A 4Q1EA 1YE3A 4HFNA 4ZPXA 3UZUA 1CEXA 3L6DA 4S05A 2YV3A 3BTOA 3LCRA 1ISSA 2YWCA 3OX2A 4JS0A 1DT3A 1FL9A 2HRBA 3AGQA 3O0TA 4RKWA 1ABFA 4OTZA 1ISRA 3Q9NA 1SVIA 5HF8A 3W5VA 1V8DA 4B47A 2EVWX 3KQTA 3ECAA 4XM2A 1C4OA 4N0QA 4B17A 4BNJA 1ULBA 2WG1A 2QX9A 1ZPDA 3LDUA 3OPMA 5FWDA 5LIRA 2JIQA 2WQZA 3CX7A 1PV2A 1WZCA 1Y5NA 3O84A 3W8RA 4ARUA 4LE1A 4MW0A 4B82A 1E58A 1UEIA 2D0DA 2IZOA 3C6MA 4KQ6A 5IULC 3URMA 2HO5A 1AHNA 2KHZA 1S3GA 3LUPA 4LNHA 2NYVA 1TYBE 5E7QA 1PJ8A 2ZWOA 1ISIA 5F35A 1D9ZA 3RFVA 3UFXA 5D3KA 5IXJA 1PQUA 2A14A 3PGA1 1GN8A 1JKJB 4QUBA 4EHDA 1YB2A 3QLVC 1KFBB 4L0MA 1GCAA 3EOBI 4UQOA 5EVCA 3WGQA 4D9IA 4TGLA 5AHRA 2XKKA 3B1FA 4JSYA 3TH5A 2AH5A 4WXMA 1E94E 2E4ZA 1ORTA 1ZUWA 4FFRA 4JIMA 2IHNA 4B9EA 1V16B 2G08A 3LYHA 3Q9SA 3U7HB 4M38A 3RS5A 4IUBS 1XXLA 2PBZA 1WU8A 3BPSA 1CUXA 1XCGB 4L15A 3VNBA 1J42A 1PSZA 2GBLC 4MUJA 4RV5A 4LISA 2BJWA 3FM9A 4ZDIA 5ADVA 2QLFA 3FBWA 3GDWA 5FD8A 5KHLB 1V37A 1Y63A 4G9GA 4LXHA 4CM4A 1Z74A 2M6LA 3B1VA 1F48A 3WKBA 1XZFA 5HX7A 4NAVA 4C2TA 4XB1A 3VSBA 1XDZA 3TD9A 3E84A 2BH2A 3N6XA 3K9GA 3ZHYA 4GE3A 3EQ8A 1F38A 1QK3A 4LWQA 3JQGB 4QPDA 5CVCA 2OBNA 4HUQB 4A91A 4NZPA 4ER0A 1UZMA 2FF7A 5FUQA 1Y7IA 1OGYA 1C7RA 5KB3A 5HF9A 1MVOA 2ADFA 1G8YA 4PCVA 2QL5A 1XD2A 3R3UA 5EERA 4XOUA 4Z99A 4PLCA 5JMWA 3VKGA 4CLEA 2VP6A 3M3HA 3Q11A 3SEAA 1Q7TA 2HL6A 3V2HA 4L2IA 2YJ3A 5LQDA 3RG2A 4L8LA 4DJDC 4AKHA 3H9GA 3SMVA 1KDTA 4FXOA 3FA2A 5K2OA 3A4VA 2I4IA 2R00A 1TJ5A 3GRFA 4GRIA 5BWCA 2FWBA 1VFNA 2KBEA 3GLHE 4QRDA 5JZVA 3I6BA 4RF2A 4UDYX 3LF1A 3PLRA 1KEEB 1FSFA 2VK2A 2VK8A 3HLTA 2OFXA 4JMLA 2VP0A 3TPCA 4BWVA 2R5WA 4KLAA 1H5UA 3K09C 4JBGA 5TT1A 3JQRA 4BV2A 4DC0A 1NTOA 4XVCA 3LYAA 1EXMA 1ZFNA 1PL6A 4IH1A 4L28A 2W8ZA 2ZCUA 3Q72A 1VJ0A 2C98A 3FOBA 3WY9A 4F9TA 2A67A 5C46F 2I87A 2OLJA 4X24A 4E07A 3PHLA 3PTAA 2PUBA 1JWAB 2ZCJA 1ZGHA 2R2AA 1MF7A 4X41A 5DP1A 2X1LA 2Y1WA 4BLQA 5AVSA 2IL1A 1ADBA 4UUQA 1BKYA 3HWSA 3S99A 9ATCA 5EHNA 1ORVA 2IZ7A 3B5EA 3PNLA 3ZTYA 2AN3A 3ICCA 3JSAA 4NJMB 1R5BA 2E4YA 4TWBA 4XX1A 5H70A 4RORA 2ISQA 4RPGA 4OMUA 3SR0A 4P3OA 3RGGA 3VAZA 1KZ9A 4FK8A 3G85A 8OHMA 4RA9B 4C4YA 3NRCA 2YFHA 2PXAA 4DG9A 1R0XA 2XEXA 4X5OA 4CL3A 2WFAA 2CEAA 3C8ZA 1GGEA 3R0QA 1OIXA 3WDKA 1I2ZA 4P7KA 4TXNA 4C01A 1WF6A 2E37A 1A4IA 4ZCRA 1D1QA 2WG2A 1RM5A 1CX9B 1A72A 3TNYA 1P1BA 2X8AA 1XQVA 1OFHA 2WIKA 2ZIFA 1XDWA 1K8QA 1N2HA 4ER3A 5J58A 1FIUA 5EUBA 4HB2A 2QQ0A 3GPBA 4I3FA 4UTPA 1FNCA 5K6AA 1MJ5A 1PX2A 1VKRA 1W1IA 4OGFA 4UVGA 3BORA 3S4YA 1B6GA 1ESDA 4JI6B 2NU7A 3WWYA 4LF8B 2JA1A 4TMXA 1P75A 4HX5A 5I3ZA 4LYDA 3DWEX 4BN0A 4K2AA 1AMOA 1VB5A 1C9KA 5REQA 4MRMB 3EXIB 3GCDA 5FWAA 4KODA 1T1SA 2PRKA 1Z0IA 3CUSA 3KRTA 4AJPA 1A9PA 4Q7QA 5LP6F 3USCS 2Q46A 4P5EA 5EKSA 5ALZA 1REQB 4EECA 4X93A 3CXRA 4Y1EA 2GBLA 4LRYA 4MROA 1RZRD 3CH7A 4Q01A 4ZI7A 2MU1A 4QYMA 4Q7LA 4QNNA 2XNKA 2IA5A 3OA2A 4KKXB 5E1DA 4MUBA 3ZJUA 2BY4A 3MJVA 4N0DA 1PGNA 1BFUA 2JFHA 3NU1A 4YP6A 4ZV9A 3VYUB 5KOIA 1UXGA 3FKQA 4B3FX 1N2SA 1OQAA 4BBPA 4MGYR 2ZTUA 2L19A 3PEEA 5J63A 4KXMA 5CXQA 3IQFA 4K81B 1DVRA 3LK6A 4WW0A 3MCAA 4QXRA 3IEMA 4FYHA 3M0EA 5DOVA 1Y5MA 5BSHA 4CEJB 1FCJA 3NC1C 2Z8YA 4CG0A 1W0CA 5CB4A 4FEGA 1M1YB 2WJHA 3BCRA 2P30A 4OLHA 1O89A 1RYFA 4IVNA 3G2PA 2GD6A 1ML4A 4I5IA 2QRZA 3IUYA 3KV1A 3QMMA 5ESXA 4CIBA 4X66B 5COAA 5BT9A 2QX8A 3MS7A 4PRKA 2AG5A 5MGNA 1U7DA 3ZDDA 1N3YA 4JI0B 1MX9A 1JHDA 3PKJA 4F4DA 1PGPA 3EPPA 1U9ZA 3GT3A 1X7XA 4KO1S 4S1OA 1EUYA 2WKRA 3PXXA 1H8ED 2H31A 4FMPA 1OKKA 4NENB 5I48A 1CZRA 3HSKA 3ZU6A 4YRKA 5ICEA 4BMVA 3OTWA 4HGZA 4U1RA 5LBIA 3GA5A 2YNMA 2PX8A 4O4LA 1OAOA 4MI3A 3GJZA 1NQWA 1U0TA 3P9RA 4JP5A 1NVXQ 2XCQA 4HI0E 1NMYA 3ORHA 1YBMA 4WDRA 3I9V1 3TTVA 2GI4A 1LX7A 3KB6A 3LO8A 5PGMA 3DEAA 4JUFA 3E9NA 4S2EA 3AKZA 3ITKA 1MAUA 1QRDA 2IU3A 2XTNA 4O4HA 5D86A 2C54A 3HJAA 5C5IA 1MQ9A 2TMKA 5L3RA 2I6FA 3ZGYA 2WKQA 2J5RA 2AWNA 1VIAA 4ALMA 5F3WB 2CHFA 1RI3A 3ZIUA 1NURA 2AN5A 3R09A 3FSEA 3B13B 3L0DA 3NT4A 3SC4A 1P7CA 1Y1RA 1K8YB 1ZQ9A 2QF7A 3PIRA 1E2NA 4CTNA 5B4VA 3LX4A 4KG7A 3IAAA 2Y93A 3IQXA 1PSDA 4Q4CA 4L8YA 3RS4A 2JIMA 4Y2XA 5SZJA 3SHOA 2ZR8A 1T1JA 5DHFA 1L7QA 2F55A 2BEUA 4RVUA 4ERNA 1T3LA 2PSHA 1JTFA 1HRDA 2Q4DA 3SYRA 1EQUA 1ZYUA 5A04A 1Z07A 1U99A 2WDPA 3SM9A 3FFTA 1D07A 1UMKA 2Z9BA 1I1NA 3JYPA 1WQ3A 2ARKA 3VJLA 3P45A 4ZJUA 4E5MA 2J0SA 3ROEA 2VJCA 4HAXA 3V1UA 1Z2AA 2YQZA 2YS6A 1PP4A 5TR9A 1U5AA 1YJ8A 1YOBA 2W6PA 1QFJA 4TYMA 4YJGA 4PRYA 3G2OA 4MRVA 5EWLB 4A6DA 2W6IA 3LCVB 2ZJYA 3WZMA 2XR1A 2J1LA 5AVVA 2Y1EA 2B9VA 1ZOPA 1YNSA 3OFJA 1US8A 1XMQB 2G1JA 4YP1A 1DAOA 1V7CA 2V0CA 2YYSA 3B8EA 4Q4AB 1IY0A 3EVGA 1NW5A 2OXEA 3MERA 1MP0A 3QWBA 4N7JA 4BN5A 4R2HA 1DXHA 4DMCA 5DHSA 3KSAC 2VPTA 2QD3A 1OLSB 5CLLA 3QVLA 3KKZA 4NAHA 4IHQA 3CF4G 2AR7A 4I1SA 1EDZA 2NQ8A 2R6AA 1RZUA 3THYB 7MHTA 1AOXA 5FWXB 4GM1A 2XNCA 4B7AA 4F11A 1ZVMA 3CMCO 1AMNA 2XVYA 3CLRC 4COKA 1RHMA 4QFBA 2L0XA 2OV3A 5FTLA 4MV8A 1SEPA 2X4GA 2ZW9A 5LN1A 3KU1A 3UV6A 3G8YA 1V1MB 5I7EA 1UZAA 4JITA 4S12A 3P0FA 4NHEA 3QEAZ 3PXEA 3R3YA 1VZ2A 1XEWY 3RT7A 5CNIA 1K3TA 2GK7A 5JEEA 2RIRA 3ULKA 4UPVA 1U11A 3BMCB 3S2FA 1YACA 2E4XA 2QNIA 5DW3A 4G8BA 4OG2A 1PZEA 4ZU3A 3R8XA 4UXHA 4DEVA 1O0CA 3T7KA 3PI7A 1YZLA 3DV2A 5LWHA 2EX0A 1W0KA 4EKIA 4B71A 2G36A 1PEYA 4A3SA 3R6WA 2D7CA 5JQGF 2Q9CA 4L9SA 3NLLA 2IYRA 3MLAA 3IP9A 2FEXA 5DNVA 8ABPA 1S5PA 2HRRA 2AC4A 1YZYA 2OXFA 2ZSJA 4EG7A 3AVPA 2C20A 2A2ZA 3HI4A 2ONZA 2X9QA 2WKSA 2JFPA 4YMWA 5E2AA 1AKYA 2PGOA 4JI1B 4XX0A 1AHIA 1TCUA 1FDRA 4IQGA 5B30A 5BN3A 3OZUA 2C04A 3OCXA 3TQQA 3OPYA 4BMZA 3HBLA 3DOUA 4OK3A 2OSVA 1ZBQA 5EZYF 4Z6KA 4PSAA 3PG5A 2JCYA 5JYBA 3NUQA 2CBXA 4GR4A 4WFQA 5FBLB 5JFGA 1HKUA 2VLIA 4M1WA 5I4KA 5LB2A 1AKUA 3C8MA 3AFNA 1B2RA 4E5YA 5I9TA 3WB9A 2C0CA 1WE2A 4MQ6A 1JU4A 2Z57A 4MMXB 1VTKA 3ADPA 2PUJA 1DSSG 3PUJA 1R27A 3HACA 2ECKA 1XG5A 3F1KA 4KP7A 4LZPA 4P35A 4BVFA 5HIJA 5KIAA 3NBFA 1RXYA 2O2SA 1WV1A 1CS4C 3CRW1 3EA5A 1C30B 2CVPA 3MMNA 1W36C 1G2IA 5KHOC 4TYNA 1ZD4A 2I9PA 3QU7A 1ORDA 1P1HA 2DM6A 3GXBA 4CGZA 1A0OA 1ACJA 3OF2A 3WO1A 4ZARA 4JVNA 5FB3A 3FUXA 4LIPD 3IEVA 4IG4A 5EIAA 3LCUA 4TV9A 4C3OB 4INJA 3ENNA 1S01A 4DLTA 5FPPA 3COVA 2HSDA 1FYFA 2HTFA 2LGJA 4GRAA 4PCUA 4QXAA 4QM7A 3U0BA 2IS6A 5K4HA 3U4QB 3VA7A 2VKQA 1MB0A 3R5HA 3W5BA 1GDDA 1MNQA 3FSGA 1RAFA 1THZA 4G9BA 3F6CA 2PLWA 3K0AA 3SYKA 3H0KA 1OYWA 2D4AA 4WZBB 3HY3A 3DYIA 2DULA 2QSYA 2R8RA 3N8IA 4CIXA 3GJRA 3IA2A 1CQIB 1UPTA 2SBTA 1U7PA 1ZCZA 5DEIA 2CHVA 1PR2A 1KI1A 1UKVY 3EARA 4L3WA 1M6HA 3DBRA 2X23A 3WRVA 4EBBA 2FSSA 2RB4A 3FKSD 2I29A 4K88A 3UMGA 5TARA 3BRSA 4EF5A 5BV0A 5EP4A 2FPIB 3QE3A 3WJ2A 4RY0A 1KIMA 2OMEA 1FE8A 1UODA 1PNQA 3S6JA 4WOPA 1BDIA 2O7RA 4HTFB 1BKSB 2RH8A 5HZMA 1WHSA 5HOQA 1CJTC 1J6UA 5JAPA 4XM0A 3RSHA 5JNVA 4BP1A 4KR2A 3B70A 3FCEA 1GLVA 3RYHA 2ZM6B 1FUKA 4HEA1 1NG1A 1P2GA 4MWGA 2O3SA 1ZMRA 4EK9A 3CZMA 3A05A 2OV2A 5BN4B 3ZJ4A 3RM3A 2W2VA 2ZYDA 5B37A 4C4TA 2PFKA 4DJ5X 1FFXB 3AESA 1WVMA 2VP4A 2QZPA 2BL4A 3AY3A 3D1JA 4N5IX 1PK7A 1EX7A 2YOGA 3JVEA 1OFVA 2PKEA 4LY0A 1LSOA 3KSZO 4Q82A 5D7NA 4J7CA 2G0AA 2FQ1A 2D2IA 4LQDA 3S2ZA 1VBNA 3FAKA 1C0KA 4CL2A 2HSGA 1P8AA 2VBGA 5U4XA 1MXFA 3OT4A 3VPFA 3WIDA 3V9AA 4F7WA 1V8ZA 1FK8A 4YJHB 4AN0A 3CH4B 3OU6A 1SK9A 5BN5A 3N7UA 2ZPUA 2VT7A 3R7LA 2OGSA 1WWKA 5BQOA 1IM5A 3ROFA 2VHUA 1JHYA 2DSNA 2JVIA 3NJ8A 5FWYB 1VYHA 2C9BA 4J0DA 5AYVA 3EH2A 4QEDA 1NMSA 1ZK3A 2AI1A 4JK3A 4JOSA 4A82A 1QH8A 5DLYA 5C1OA 2GBIA 2MYTA 2N47A 1GTRA 3VSDA 1PZNA 3KPJA 4OFZA 3UJNA 5FYQA 1ZK4A 2J3JA 1Z45A 2AHRA 2LE0A 5JHHB 3AR9A 2Q6IA 4ZIRB 3JX9A 2UU9B 3PNQA 1NBMA 2VHJA 4KH1A 2RB5A 1PR5A 2VUIB 4LTMA 1CYEA 2D2EA 3M4NA 4ZA2A 4EVQA 2FZCA 5B2FA 1J07A 4IAOA 5K0JA 2WTMA 3E81A 4XSVA 4MULA 5T6BA 5BVGA 4N41A 1TEHA 4N5NA 5JATA 4KRXA 5HTKA 3ZDYB 2IOQA 3AUYA 5IAJA 3U7RA 4D4MA 5A0VA 3MZ0A 3I45A 4E94A 3CGGA 2J08A 4JCCA 5FTJA 3QSYA 1BXGB 4W5NA 1MC1A 2EW1A 2H2FA 4FHCA 3SGLA 5B3LA 2RCYA 1GARA 4MR7B 1HTBA 2C7VA 4K46A 4JU9A 1ZU4A 5HBGA 2OPHA 4CTOA 4EAAA 3GA7A 1TMKA 2B21A 1X7HA 1JFFA 1C7QA 1TQ4A 2IY7A 4YCJA 3BWYA 3H5TA 1U3GA 1UJCA 1P7ZA 2OP0A 5ECGC 5IYZB 5K0ZA 4P86A 5FLXA 4P4LA 3RIXA 4EYEA 1NONA 3TFOA 5IASA 4ZP1A 3AFGA 2O8VA 2Q3HA 3BA6A 1O8BA 3I2FA 4Q4JA 4OI4A 1T6NA 4PVDA 1KYIA 5H3LA 4DADA 4JI4B 2H8KA 2F1JA 4K87A 5LOVA 2LCQA 4RS4A 1DFGA 1PW5A 4A6EA 3EEYA 1RQRA 1DC4A 1UIMA 4D9BA 1EWTA 1L6IA 3Q7EA 4YRZA 3HLYA 2BELA 3RRMA 2JATA 2MSLA 2DWOA 3FLMA 1AA6A 3KQQA 1SUWA 3G1UA 2CL5A 1T36A 2D1FA 1V9CA 4ALJA 1CYDA 5HKLA 1J90A 4ZQCB 2XMBA 4K28A 4CCSA 1CTQA 1A9ZA 5IMBA 2H5IA 4BBJA 3IKLA 3RVLA 1LGYA 1KP2A 3T4PA 1XTJA 3WL6A 4BY9E 2QAGC 4ER7A 3IAS6 3RYFB 2W6MA 2J59A 3EFOA 1E2KA 2LRHA 5G0TA 2GD2A 3WSVA 5IT0A 1EXNA 3IPXA 3ZY5A 5CFLA 4JXZA 5KQRA 5C5DA 4FYVA 1DAKA 1V41E 3LDGA 2F8TA 4N8EA 3UK0A 4MKIA 5AHXA 1PNTA 5C4MA 3BRCA 4JA0A 5HBRA 1WXGA 3ZD8A 3BMOA 3GN1A 1I2BA 5C80A 3LHIA 4I8IA 3HXPA 6Q21A 4KL8S 2DFPA 4WEQA 1OV6A 4HY3A 3DP7A 1S8NA 2N9UA 2QIPA 4X6YA 1J2UA 3G7UA 5G1OA 3IT1A 3H9QA 3I32A 4ZU6X 1ATIA 1RHKA 1T8PA 4DLNA 3PYXA 4ASUA 4YK7A 2P9BA 4AQDA 3FPLA 1KHHA 1UPFA 5BV2P 1OB2A 1I0LA 4RVDA 2FJPA 4ZVUA 3RYCB 1C0EA 3TM5A 1BHO1 3AHJA 3GQBA 1ZMBA 3SIPA 4M0MA 3QM1A 4F97A 1X80B 2UVPB 1ACMA 2FMXA 2FU5C 5IANA 4NBNA 3BXEA 3VPGA 1GWNA 1YVUA 1ZJZA 2XGMA 3EIEA 1BOOA 1ZR2A 1XF9A 2WHXA 3SHWA 1GG9A 2Q6VA 4UZSA 2D3WA 1H9CA 4YJDA 3FNEA 1YR7A 4NS4A 4TXJA 2F1OA 1L5GB 3PXDA 2EFHB 2EJCA 2F9LA 1V45E 3AJ9A 1WY7A 3A6EA 3ICVA 3M5WA 5C53B 3LCMA 4WXYB 2YIMA 2ZJFA 3ROMA 1W4BA 1CD5A 4OFXA 4A0FA 5LUBA 4CMIB 2JLVA 3VGJA 3A4LA 2XB9A 1E61A 2J87A 1VPVA 2VPWA 1BA2A 2QMEA 3DAYA 3PB3A 5ALQA 3QG5A 4QHTA 2CLMB 3QVKA 1GY8A 2HYIC 2J3IA 1I1HA 5T7BA 3DT6A 2M9MA 4H3HB 4P5DA 1X70A 3NS7A 1J0DA 1D7OA 1J8MF 3ZXUB 1H1DA 1E3WA 3NH6A 3EPLA 1UP7A 1N9GB 4YRBA 5EPUA 4HH3C 4X1KA 3RTGA 3L4SO 4GOXA 3I73A 4Q24A 4E6PA 3ZNPA 2O6LA 3GUZA 1EIWA 1G20B 1V1RA 2WBLC 4FZ5A 3DV0A 2XWJI 1MAVA 4YRJA 5LZ9A 4WACA 4CQMA 4FC6A 1RLMA 4QU5A 1W4LA 5EJ9A 5F1PA 2DXIA 4O1IA 3HJFA 4G0WA 4OHWA 2QRUA 1V11B 2QMQA 4JC8A 5ES4B 1U0GA 4RV9A 3UG6A 4X3PA 2JLUA 3EEOA 3AJEA 2BHLA 1M2WA 2B6HA 2Q4RA 3S29A 2VDKB 2X19A 2ZR7A 1XEFA 3E7XA 3QSGA 4K9QA 4D0NA 4QBTA 3AUXA 3G2NA 4L02A 3GVHA 4LJLA 5DH9A 3TRDA 3SNHA 1I3CA 1FYVA 3QXJA 3SFZA 3U3DA 1GGVA 2B7CA 2GARA 3LWNA 2JLBA 3RRZA 2VQ3A 4BNDA 3L6UA 5GP1A 3MYYA 3PICA 4YONB 3TTXA 2G28A 3EUWA 3P2EA 4CRWB 3GLFA 1Q1GA 1XF1A 2HIGA 2PS1A 5T41A 3MGBA 3E9MA 1QV6A 4UATA 3EN0A 4L7QA 4ZVSA 4RHXA 3KK0A 4MR8A 4Z0TA 1NRWA 3OE5A 4C7XA 3OEHD 1D2RA 1TRKA 1YRLA 2QP4A 3ZLJA 3OOYA 2YIDA 3G2MA 3SHTA 1YKSA 2OORA 3WWEA 1NX9A 4LJ8A 1K7XB 4YCDA 4A10A 4C4RA 2WTEA 1RWBA 1AKQA 4K3VA 3H1PA 3WQSB 4NH4A 4ZV7A 2Z5GA 3DPUA 3U2QA 1NX6A 1NUQA 2GPWA 2ADMA 4KUGA 3ZWMA 1EZ1A 4P92A 4BTEA 1XP5A 2B5WA 3FYCA 3NT2A 1HQYE 1E7RA 1JLMA 2WWRA 3TOSA 2B8WA 4QJ3A 5LDHA 1HC7A 3WK4A 4J2TA 3LXUX 4W7HA 4ZICA 3FUWA 1W5TA 2OESA 2VZLA 2YQ4A 4LDPA 4EZBA 2XGJA 3ASZA 1Q1AA 2JCBA 3OU7A 3KFXA 2PH7A 3CCFA 3OESA 2Q2WA 4KBYA 4L5CA 4OL0A 3TSWA 4M4SA 2CJWA 2ZPAA 1Y6RA 3O91A 1MCZA 4EGFA 4EY6A 2E18A 5BOSA 3ESBA 5FF9A 2HCTA 2MHCA 5HXAA 1KK2A 5ER9A 4QBFA 1JJFA 3QX7A 3IMGA 2POQX 3E2MA 1UK6A 3LHKA 3WOHA 3KXPA 1UMCA 4J6EA 5DRYA 1PLLA 1PR3A 1E4OA 1SUAA 5J59A 3W2TA 5JSHA 4EATA 5HIAA 4DVJA 1MB4A 3MB5A 4E46A 1RJEA 4D9MA 1EUZA 7ADHA 5KYYA 3FTQA 3GT4A 2FMTA 2O0JA 1JHAA 1NXTA 2XGGA 3KEQA 1CUJA 4RVSA 3W5DA 4BUCA 1L5HB 2P3QA 4NBWA 3MMXA 4W7IA 3NBZC 1I8TA 1T9KA 1EFVA 3WNZA 4BO8A 3G9TA 1YV9A 2F43B 2GPSA 5F7ZA 3GEPA 5AJVB 3EXEB 4EVSA 4F3KA 4QGBA 1J49A 1UEXC 1QDUA 3K30A 5ELLA 3TQSA 1G5RA 3DEZA 3F0TA 1C1DB 3K5IA 4J7UA 5A7FA 4YJFB 1T5SA 3V8RA 1XRLA 2AN1A 5GOZA 5LNK1 2OXIA 3Q5EA 5D1NA 1KH3A 1I5RA 3DL2A 4CKBA 4CDNA 4QVKA 4RX1A 2QOEA 3GDHA 1C81A 3MT0A 2X0IA 5KYGA 2F7SA 3ZVLA 3O8DA 4GR5A 1CY2A 3FCOA 1RBQA 5K8CA 3M81A 3HVHA 2W6JA 1XRPA 3OPQA 1GGKA 4BMOB 1VE6A 2DPXA 4AYWA 3IDFA 2R62A 4W5WA 3TX6A 3BMQA 4HH0A 3TYXA 4ZYWA 5BPHA 5FPHA 5C81A 4L0QA 3BA1A 2XA1A 1HL3A 1KZGB 3ETLA 1B16A 3C43A 4M9RA 4XUCA 1B0AA 2XX3A 3I6MA 4YRNA 3UTCA 1QZTA 4P2BA 4YCLA 1G8AA 2EV9A 2HNBA 4BLWA 1CDDA 4Z9YA 4C0SA 2AN9A 3JZAA 4RDHA 1QCYA 3WADA 2B7LA 1BU8A 1KEZA 3C5VA 3KPUA 2P4SA 1KEKA 4XTCS 2WFMA 4X1YB 2AOUB 5CLIA 1IFXA 2B78A 1ZHOA 4OHBA 1V4BA 1KH1A 2JFGA 3VX4A 1QHYA 3T7AA 3L0ZA 3VH2A 3C6YA 3HLKA 1JDUA 4MYHA 5J2UF 2HUPA 4XQ9A 1T3GA 1C3OB 2WD7B 3BE5A 4JHLA 1K7CA 2BFDB 4RHEA 2BGLA 3VYVA 3DE4X 3OTOB 2Y76A 4LXQA 4PHHA 2WIJA 4YAKA 4EUSA 4R54A 4TT8A 2B1QA 5FUBA 1DBQA 2C5FA 1EUDA 2Z58A 1CNFA 1ANKA 1FNDA 2MIIA 3IVAA 4IS2A 4Q15A 4UOQA 3UC5A 3VOTA 1H65A 3CGWA 4PTZA 2JLYA 3UKDA 5E7MA 4BFVA 1EQ2A 4HJRA 3STHA 3B1XA 4PZEA 3NP9A 1AZWA 1XRMA 3I28A 3WS7A 3VM6A 4K9MA 5JISA 1S3SA 3EZ9A 4MQEB 3UAVA 3HBFA 1QK4A 1W5FA 4LBVA 2ZJ7A 4YN3A 4MICA 5G0WA 2GXSA 4B3TB 2PKWA 5HUHA 2R8BA 3P9QA 4WOCA 5G4LA 1MMFB 3ENWA 1JQBA 2FP3A 4BO5A 1GAEO 1Q21A 4BNGA 4L4XA 4MIOA 1XEAA 3NHAA 3B2NA 3BD7A 1Z39A 2BMDA 1L4GA 2ZKLA 1I51A 2VYVD 1J2JA 3EASA 3D5TA 4ASUD 1L8QA 1N7HA 1VFPA 1YZGA 4INPA 4AW9A 1CW2B 4TL7A 3RSFA 1ZNXA 5EJIA 2B8NA 3OIUA 1TAQA 2YYAA 1OC2A 3LDHA 1FU7A 3WSTA 2PZMA 2I2XB 1Z0FA 2WM3A 4IFEA 4LYJA 1YMVA 2HJWA 3CZ5A 3H7AA 2PYIA 4JLPA 3N2IA 3BCUA 1SNYA 5DI9A 3T9EA 2ZROA 2NNWB 4UJ3A 5GTDA 3A2KA 1XTQA 2ERYA 2ZIZA 3ACDA 4GZLA 2J3MA 4AZ0A 4ARIA 2J32A 1YBVA 4D42A 2O8EB 2ZRFA 3FG9A 2YXLA 2DZDA 4E4YA 2Q5LA 2VJBA 2X77A 3N2GB 2VDUE 3MJ4A 2C3UA 5IM4A 1I2DA 4A5OA 1I7DA 4LW8A 1SQ6A 1NLUA 1UBOS 2CZCA 2D2FA 2NAPA 2VHZA 2W11A 3M1YA 4KDCA 1UBCA 4LZJA 4R05A 3ZCXA 2R6FA 4BE4A 2X9NA 3I4LA 5BR4A 2RAFA 1CUHA 4G0ZA 1X2EA 2QN8A 1Z88A 1NVWQ 1X7YA 1XAIA 1SPXA 1W8IA 3PHJA 4K6CA 4MP6A 5I9MA 4YUAA 4MAMA 3U49A 3HDHA 3NI2A 4N3GA 3SXUA 1HGXA 4BX3A 3L1IA 1G55A 1GNQA 3E70C 1O95D 4Z9AA 4NMLA 1H6BA 3U9SA 1R00A 4D4IA 3KQKA 3L4BC 3OFNA 3NANA 3C97A 3JQCA 4IDQA 2WU8A 4ZJPA 3S2YA 2DRIA 3NBUA 3UFBA 4I5GA 5AW6A 1GTG1 2G77B 5J43A 4QM6A 4E5SA 4DAOA 3HA3A 1Q1ZA 4QBIA 4IGAA 2YWBA 3LC2O 4BWFB 2YMPA 4LZNA 4X1OA 2PZ8A 1FMCA 3WXMA 1YH3A 4GPTA 1IN5A 1ZK1A 1ZXBA 1S9HA 5ADHA 3GLUA 3OEEA 4LSGA 5ALUA 2P65A 4YXWD 2R97A 1GP2A 4RV4A 1SELA 1I3KA 2A9OA 2JIPA 1IBRA 3S2SA 3IV9A 1C14A 5LMNB 1Z0DA 4MH0R 1MN6A 1J8QA 3AI3A 3OZIA 5EHQA 4KNVA 3GOQA 3OTIA 3ZC3A 2EZ4A 3SICE 5IN4A 3HFGA 3VR0A 4E03A 1PYOA 1NW7A 1P45A 1WKCA 2IT1A 4UJ5A 4ND6A 4P0QB 1J22A 1PL8A 4J9UE 4UM8B 3ZE0B 3S8YA 4GECA 4QHYA 5CT5A 1T15A 1K1EA 3V1TC 1O4WA 3MLEA 3QH4A 4G09A 3AETB 1LLFA 1JI0A 2GZDA 3PUIA 5H02A 1RLJA 1W7AA 1T1EA 1PBTA 3L1UA 3NDIA 4GVPA 4EW1A 4IIFA 4Q7JB 1HBJA 1WMDA 2VXCA 4F3NA 2BDTA 1G66A 1O58A 1QZXA 2VQ6A 3BF8A 4HDOB 3VDNB 3RNOA 3ZX4A 3LL7A 4TMWA 5IWCA 2C97A 4KOAA 3P4YA 3UBTA 2XT9A 4M8KA 3NBMA 3ILHA 1OVMA 4G5FA 4R8LA 2CLIB 3NFRA 3FOWA 5LP6C 5E0OA 1CDEA 3K31A 2LKCA 4HMOA 4YRQA 3FIUA 4B4UA 2V3CC 3CNEA 3VYSB 2BKXA 4PPGA 2P5TB 2M2IA 4HK4A 2CNOA 4KVFA 2PO5A 2OVFA 1VLHA 2Z2ZA 3S2UA 4ZT4A 3OECA 2I2BA 2NZXA 2LP4Y 3AZPA 2JRLA 4KYIB 4OK6A 4QE3A 4XVHA 4XIFA 3TW0A 1BRMA 1PZGA 1S2NA 2IBTA 1WBBA 1R6VA 4LHXA 2XUOA 2A5LA 1EFPA 4TZKA 3JW8A 2QRVB 4OJNA 2VZEA 1KH2A 5BMVB 2C7RA 4EYKA 2O54A 1WUJS 1WLYA 2Z0MA 4KJXA 2ZB3A 3T7IA 2OGZA 5CVJA 2AOTB 3SEFA 3BDIA 3HVKA 2IH2A 5JDCA 3EQ2A 1LQ2A 4YJ3B 3ZOZA 4BFXA 1RRFA 2J9XB 3FH0A 1QCDA 1RXEA 1DTSA 2BKEA 2I8LA 5TRTA 3L7JA 3IO3A 3QMWA 2VHVA 4BHTA 2IH4A 3GX1A 1X3LA 1K68A 2VUUA 1ZY2A 2IUSA 1W9HA 1ZI9A 2JAXA 3F5MA 3GP5A 3OZDA 2R85A 4NOKA 4JI3B 1DI0A 3PPVA 3UK7A 4CMBA 3LC1O 1TO1E 4GZMA 5BVHA 4DEYA 2PEYA 3Q10A 2QW8A 4OH1A 4CNBA 1JMVA 3FMGA 2J0UB 4CKWB 1ZBDA 1ULSA 3ABRB 4MB6A 4YJ2F 4I1IA 3H83A 2ODEA 3A1CA 1SUFA 1BO6A 4C9BA 3SHVA 4PG6A 4MW2A 3T99A 2IHKA 4RCYA 3ZLTA 4ER6A 1M1UA 1P0IA 2X0JA 1GT6A 2Q3BA 3N8KA 1FLVA 3MELA 2UYHA 3Q6NA 1MU0A 4HZUB 2WW8A 1R0LA 1GUDA 2WJZB 1KRHA 2FWRA 2YYZA 1A9QA 2C8VA 3E4DA 3G13A 2BJHA 1SBZA 3B3QA 2FSIA 4JFAA 2E5LB 4G5QA 1SBTA 1MJNA 3NT5A 3U3JA 4TTQA 4CTMA 1SKQA 4S1WA 2DFLA 5BSWA 3FKJA 4R9NA 1AKNA 1EP9A 1NV9A 2FH5B 1MB3A 4HN4B 5IUNC 1P77A 3OWXA 4BC0A 4V0SA 1KI8A 3ELDA 1E96A 5CAEB 4K40A 1A8SA 5F12A 2OGTA 3FCXA 3NFYA 2C4VA 1JQKA 1FXWF 2JFFA 2PHZA 3RRBA 2I2AA 1RKXA 3GC6A 3N2KB 4EI2A 5AVTA 2I1QA 1NBWB 4XDGA 2GA8A 1F2UA 2QPOA 1WR8A 1J21A 2F00A 3SHFA 1X1SA 2VC2B 3QFTA 2IXBA 5IVHA 2C58A 4F6CA 1AG9A 2OLEA 4A8HA 3IIMA 3DAOA 2BTOA 1VG1A 1U7XA 2CYCA 3LM8A 3ADKA 2IWRA 2HJ9A 2IUYA 3MWYW 3O74A 3RBAA 3TGLA 3UWPA 2UVQA 1JSRA 2JCVA 2R8PA 4Q3AA 3UWKA 1SKMA 5ALSA 1E89A 1VHJA 4CKXA 5CA0B 2KYRA 3OQMA 2GILA 4E15A 2XTZA 1BCRA 2XCIA 1HURA 1WCYA 3O2NA 4L3OA 3STVA 4GGOA 3VPDA 4F3RA 2JBHA 3C4VA 3G49A 4IF6A 2IS4A 6AT1A 1SD2A 4JWKA 1DKRA 1YKFA 2JGIA 3OU2A 3N0TA 1B2LA 3QQPA 4TLAA 3RD5A 2FE4A 2VAMA 2H2DA 4K0RA 4UAVA 2FZLA 4PE5B 4JJ6A 1RI2A 4B3GA 4LCEA 2YN2A 3M49A 3GCWA 4TQUS 1NUPA 4QRHA 1XN1A 4KQ1A 1E5LA 2VLBA 3ZD7A 3NTQA 3EXHB 1PJBA 5FPTA 3KALA 1O08A 2FW0A 4I55F 3W3AD 2FMIA 1AK1A 4G84A 4C3ZA 4PHCA 4HV4A 4M7PA 1G5PA 1HMPA 3E4CA 1H2ZA 5JWHA 4NS1A 2DPMA 2YVUA 3Q3JB 2HX1A 5DBGA 1KMCA 3NEAA 5BN1A 2OM2A 2HWWA 4HDSA 1SBQA 1Z4LA 5KTSA 4P3KA 1MO5A 1CR6A 2R8OA 2CDNA 4WZZA 3SU8A 2X7JA 3WYFA 3D3NA 2SKCA 3D4PA 1AXRA 3KYCA 1FPQA 3NKVA 1H23A 3OHSX 4FC7A 4MI1A 3U31A 3Q3CA 1HTWA 2H1SA 1J1IA 4BJ1A 4UNIA 4JC0A 2FZKA 3L1VA 1JG3A 3AFHA 4BV9A 1TEVA 1GPKA 3F98A 4TRMA 2PKQP 1C3VA 2C2HA 4XVQA 2VIIA 3B6EA 3JARB 1G60A 4BBAA 4LF5B 2WUVA 3PUZA 3ABQB 3QU2A 2GKSA 5CYGA 2YDYA 1OBFO 1R50A 2GVNA 4TMZA 3JSXA 4XCXA 3GUYA 4FFNA 4H7PA 1HWYA 1LDBA 4X20B 2KMLA 4ZD6A 3PGVA 4HYQA 2GFHA 4DCMA 1EZ4A 1RE1A 3ZHXA 2NUAA 3EVEA 3L82B 1EJ2A 4WNAB 3T41A 4UTNA 1T9HA 1ZWLA 3ESDA 2QZZA 2Y1DA 1F7VA 5ILGA 1NMZA 1VLQA 4C1BA 1O7JA 5H8WA 1DIAA 5KTPA 1V5IA 4BLRA 1WXIA 1Q16A 3I0ZA 2YFKA 5KSWB 4B0PA 1TCBA 4JQYA 4LHYA 2AOVA 4IQ0A 4MW6A 4LWZA 3JQAB 3WGVA 1Y4DE 1RAIA 2Q3JA 1C0LA 3KJIA 2IP4A 2TS1A 4U6SA 1F5NA 1FLNA 8MHTA 3LPDA 1CT9A 1QIMA 3H2JA 1GKKA 1XVVA 2ZR9A 4JLVA 3PGKA 3I2HA 4O33A 3DYVA 3UJ7A 2ZS8A 3B9BA 4KQXA 1W88B 3KSRA 1C50A 2AG6A 1IHOA 4EB0A 5E2IA 2BR4A 1M6VA 3SS7X 4F4HA 2H1OA 2O1SA 3QJ5A 4GNKA 1QS0B 4BCBA 3EGXB 3HJTA 4PYOA 4RMHA 1Y3HA 3O4HA 4IHAA 1K6XA 3QVGA 1NI5A 3TKAA 4CFYA 1CQXA 3HCOA 4A2CA 1X7GA 4WOJA 1SUBA 1QQ7A 2B5VA 3EHDA 1IWBB 5BQXA 2JAQA 4JFRA 1AS0A 4M1MA 3VPCA 4OGGA 5LU8A 3AF5A 3R0ZA 4XWKA 5IDYA 2GYYA 1CVLA 5KSPA 1QVAA 1TCVA 4XZ3A 2L2QA 3BKWA 3U0VA 5IJ0B 1K5PA 3V4FA 1WSBA 3IAUA 3KL2A 3SDBA 3NM6B 1RYYA 3WWOA 5EQDA 3EG9A 4XPIB 3OFSA 4A36A 2F3RA 4M0CA 2VXOA 2YJ6A 1WV0A 2ECPA 2PXHA 3LI2A 3PBKA 4CCYB 1JG1A 1X3SA 2CJPA 4I9HA 3S3TA 4EJSB 1IN4A 3DSRA 1V96A 1LLUA 4MINA 1W87A 3PSHA 4EB3A 3G0OA 4IXMA 2WF8A 1CLUA 2XF8A 1EVEA 3KV3O 5BYBA 5C32A 2IJGX 1JSXA 2P2CA 3AP1A 3MOSA 5C7IO 4U0KA 2IYNA 3BK7A 2I80A 3I01A 1VRVA 3ZEAA 2DHQA 1IQ0A 2W6CX 2XYRA 2NTJA 2OO7A 4UTXA 4ZC1A 1QRTA 3DF7A 4ZYLA 1OJLA 2H08A 4XEHA 3VR4H 4A23A 1OASA 3E0QA 2OBBA 1CB7A 2DBRA 3KBOA 4W7SA 4BU0A 4D99A 3M6WA 2H0RA 4EHBA 2I76A 1SVMA 4AY4A 1U0OC 4WX2B 4BGEA 4BFTA 4C03A 3EPJA 3PIIA 4MJ7A 3LWDA 2AGVA 3PF8A 5FUMA 8GPBA 1FRVA 5LYJB 1JP7A 3SI7A 4ZDKA 2NU6A 3AHFA 2ANCA 3CX8A 1PG2A 2IYSA 5ALKA 2A7QA 2X3UA 3PGJA 4HQ6A 4N0PA 3SZGA 4IDPA 5KEIA 1P0FA 2DX7A 1L5NA 1J8VA 5LQMA 2RC6A 5DNUA 1FDOA 3GZ4A 2CDCA 3Q12A 4JU8A 1BDMA 4MUYA 5HFAA 1ZRSA 2G7ZA 2C8JA 1YZKA 1DADA 1D7AA 1DXQA 1EMDA 3NM4A 1M74A 3UK2A 1VGVA 2NZ2A 5KQMA 4TV8B 2YJZA 4TM7A 4UMFA 4H3SA 3KR0A 4FYMA 1M76A 1NR7A 2CUZA 5C8XA 1H6AA 5TMDA 2HCFA 5EXPA 3HO1A 3RKSA 2GOYA 5CJ2A 4L73A 2XOKD 3T9AA 2B35A 4G5OA 5FBRB 3F5SA 3D4LA 3OM9A 5EAIA 2XUHA 3PS9A 1AK9A 3AIMA 4FYPA 4EMSA 3T06B 1L5YA 3MWKA 1YR3A 3AP2A 3S28A 1Z6QA 2QT9A 2C7OA 4NCHA 1L5KA 1BD4A 3MG9A 2PXCA 4B9AA 4Q1DA 2PU5A 5DT2A 4QYIB 1ISFA 1M0EA 1XLUA 4PAQA 4DCUA 1U1GA 3KVNA 5ALHA 3VR5D 1CRPA 3O1HB 2DU8A 3OKCA 3SS8A 4TLDA 1RTKA 1OA0A 4FD2A 1ENZA 1ADJA 4Q00A 2XWBF 3EOAI 4FD3A 2G9RA 4XWAA 4PX9A 3U3KA 3ZTTA 5HKOA 3DLTA 4QKQA 1H3EA 2ODBA 4TKLA 2Y1OA 5FHQA 5FULA 1G3RA 2VK4A 3FWHA 3ZHRA 1TJ4A 4Q9HA 4F85A 1LZLA 2WA2A 3ZR4B 2G06A 2Q9UA 1ZINA 4KLRA 3KZOA 1U2PA 1H4SA 2WJ6A 4AP6A 4YAIA 2E3JA 3TKLA 4CCAA 1JHQA 4ARZB 2GB4A 3GH1A 4KVZA 3EGDB 5KAMA 3SYMA 4O2RA 3D6UA 4DBLE 3BZWA 1RJ9A 5AKJA 3ND9A 3NETA 5IJ9A 2Q27A 2XB8A 4O02B 1N5JA 4RTPA 4DPMA 3A3YA 1QO0D 2Z5VA 3F3SA 3SSOA 1UCFA 1LK7A 3CBQA 3FWPA 2PGDA 3UB2A 4CM8B 3OOHA 4HF7A 2HJGA 4F1KA 2CCKA 3U1TA 3A06A 4RFLA 1KL7A 1T0JB 3RNLA 3KQLA 2B2XA 2IEIA 4H6PA 2D2VA 2JHFA 1G5FA 1SXPA 1G19A 2Q3CA 4H08A 2V1XA 3TLGB 1RP7A 4ZOEA 2ZWPA 4P3NA 1OD6A 2WAOA 3HTXA 1GRRA 3R5FA 4U9HS 1EK0A 2JGFA 4HWOA 1XA0A 2QTNA 4NEHB 3RE1A 1W4ZA 3ETEA 1FRQA 2FQXA 4JB2A 2Q0SA 1MABA 2Y2VA 4EH1A 1A50B 4RVGA 4YP9A 2D8AA 1LS1A 3GEHA 1AN9A 2GLTA 2X0NA 3ZWNA 4J0IA 4Y0AA 3TFWA 2XNJA 1SHTX 1XRQA 1R6BX 2BKLA 2D0PB 1XPRA 2AZXA 3BMNB 4XYLA 3D7MA 3W77A 3W5HA 1R4NB 3NV9A 1TLFA 1GUAA 1YAJA 2FKNA 2B4QA 5F1OA 3TRKA 5CBPB 2J5KA 1EBBA 1NTRA 5H68A 4PSUA 1DZ3A 1T2NA 2ZIVB 1ZD1A 4EPTA 4UPEA 3E7WA 3B12A 4ZT5A 4KSCA 1HUQA 3T12A 3C2QA 3MJTA 5JT1A 1E3IA 2A1UB 2JAWA 2VNAA 4EPYA 5B7QA 4J0GA 1MXHA 5IZ4A 3CVXA 4GYYA 3EJWA 2ONJA 2A4MA 1PKXA 2C0PA 2NGRA 3OCCA 5JEDA