1VLMA

Crystal structure of sam-dependent methyltransferase, possible histamine n-methyltransferase (tm1293) from thermotoga maritima at 2.20 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
208
structure length
207
Chain Sequence
HMWHIFERFVNEYERWFLVHRFAYLSELQAVKCLLPEGRGVEIGVGTGRFAVPLKIKIGVEPSERMAEIARKRGVFVLKGTAENLPLKDESFDFALMVTTICFVDDPERALKEAYRILKKGGYLIVGIVDRESFLGREYEKNKEKVFYKNARFFSTEELMDLMRKAGFEEFKVVQTLFKHPSELSEIEPVKEGYGEGAFVVIRGTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAM-dependent methyltransferase
publication title Crystal structure of SAM-dependent methyltransferase, possible histamine N-methyltransferase (TM1293) from Thermotoga maritima at 2.20 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 65
structure length 207
sequence length 208
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08241 Methyltransf_11 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1vlmA00
5CVUA 1P1BA 1N2XA 3JWIA 2OY0A 5IH3A 3DUWA 1F3LA 1P1CA 3FPHA 3G5TA 4H0NA 1ZQ9A 2YR0A 3G89A 4HSGA 2FK8A 3AY0A 3PB3A 3SSNA 3DLIA 4GQBA 4RTMA 3OU7A 5K0CA 1X19A 5K0LA 3EVEA 2HV9A 5E9JA 4Z2YA 4F86A 1P39A 4R8RA 1QANA 1YB2A 5KVAA 5GM1A 5K0GA 4BLVA 1DCTA 3NWBA 1JSZA 2AOUB 5EQJB 3NVMB 5CD1A 1KIAA 2IDKA 2IH4A 5HIKA 2AOTB 3S68A 1XDZA 2PT9A 4BY9E 3I5UA 2AN3A 2AN5A 2GS9A 4R8SA 2ADMA 4RTSA 1AQIA 3HNRA 4KIGA 4RX1A 1R74A 2PGXA 5U4XA 5LSAA 5EEHA 1MHTA 3MAGA 1XTPA 3PFHA 1SQGA 4E2ZA 5ICEA 4KWCA 3EGEA 2R3SA 3C6MA 3UJBA 1SUSA 4OQDA 2NXEA 1SKMA 1JG4A 2DULA 2ERCA 3A25A 4GOMD 4PGHA 3GRVA 4U7TB 1N7IA 4DCGA 2P3OA 3OPNA 3UJAA 1G38A 3CJTA 5EZQA 4OBXA 2JHCA 3UJDA 3GJYA 2PJDA 1RJFA 2PWYA 3KR2A 2I7CA 3M4XA 4QDJA 5F2OA 5T6BA 2IH5A 3UJ6A 2K4MA 5FQOA 1PJZA 3MGGA 4AZWA 3FPGA 4QQNA 2P7HA 1EJ6A 5CM2Z 1KP9A 4RTLA 4DF3A 3R0QA 4CXMA 5EHIA 5CUQA 1EG2A 1JQEA 2XYVA 4L7VA 3SXJA 3ORHA 3UJ8A 3LDFA 3LCUA 2EFJA 2NNWB 2FYTA 1H1DA 2ONZA 2PY6A 3CJRA 1X1DA 2ORED 2VS1A 3FRHA 3KQPA 1XJ5A 3KPUA 3DH0A 2AN4A 3DXXA 4GOOD 5KYGA 3UBTA 3MHTA 2IGTA 5FWAA 2Z6QA 1ZG3A 1G55A 4XUEA 3T7TA 5K0EA 2FRXA 4PYIA 5HILA 2IDJA 1L3CA 3DULA 5EKXA 1G60A 3GWZA 3A26A 3BGIA 3EVCA 1JTFA 4FT4A 4CWAA 1ZKDA 2ESRA 2UYOA 3NVKI 3EMDA 3UA4A 4IKPA 4LECA 3BZBA 1JG1A 4GC9A 4RTRA 4DA4A 4O29A 3EVZA 4QQKA 4E2YA 4RWZA 4AZSA 1R8XA 3C0KA 5EMLA 3THRA 5K0JA 3ER8A 3FRIA 3HEMA 2PKWA 2QRVA 5EZSA 2EJUA 3KR9A 3BUSA 3TLJA 3ER9A 1I4WA 3EEOA 2VDUE 1NT2A 4HC4A 4ZTBA 5HOQA 2AVNA 3UFBA 3CKKA 3G5LA 4DMGA 2FPOA 2N47A 4QPPA 2P35A 1QAQA 3BGDA 5DWQA 2JG3A 1T43A 4FSDA 4E70A 2P8JA 4HRAA 2VZ9A 2AVDA 4F85A 1D2CA 4HH4A 2JHPA 3AXTA 4P7JA 3P2KA 4E31A 3Q7EA 1UFKA 1WS6A 2G70A 4FT2A 3HVIA 2OYRA 3DMGA 4ER3A 1B42A 2IPXA 3H2BA 2XVMA 3OE5A 5FCDA 2UYQA 5FQNA 4RTKA 3JWGA 2ZZNA 4RVDA 4A6DA 3B3JA 2C7RA 5HIMA 3ME5A 3DMFA 3FTEA 2IFTA 3G2MA 5DX1A 2BR4A 5DRYA 3QOWA 3KR1A 3DXYA 3ID6C 3P2IA 3B5IA 4E2WA 2ZZMA 1YFLA 3A7EA 3Q87B 1RJGA 2HTEA 4X63A 3UJ9A 2ZLBA 3DR5A 5E1DA 1KR5A 2O0LA 5DX8A 4EKGA 5LQAA 4Y30A 2BH2A 1X1AA 2OO3A 3PX2A 1RI4A 3A7DA 4BP1A 3I58A 2PSSA 4ISCA 4E2XA 1INLA 1IM8A 4WXHA 5EC8A 1D2GA 1Q0TA 4P7KA 3ERCA 2OB2A 3OFKA 4XUCA 3G8BA 4OQEA 3TFWA 3C3PA 4QVKA 1DL5A 1WZNA 3CBGA 2C7PA 4AX8A 5F2KA 4RTQA 2JH8A 1RI3A 3DOUA 3HA7A 2AR0A 4GOND 5BW5A 1L3IA 3T0IA 4UOEA 3HA5A 2I6GA 4P7GA 3TMAA 1VIDA 3IHTA 5DM4A 5E1MA 5EPEA 3SX0A 5CVJA 2ZZKA 3HCBA 3T7SA 3G2OA 4X1OA 5CVVA 5K01A 4EK9A 1SG9A 1EIZA 2QE6A 5EOVA 4HGZA 4LWOA 1O9HA 2ONYA 4KIFA 4EMSA 4PNEA 1NW3A 3A27A 5EGSA 3SGLA 5MHTA 5LQUA 3KR0A 2KW5A 5DRTA 3M6WA 3A4TA 3M6XA 5FHQA 3GNLA 3UJ7A 4F84A 1BKYA 2H1RA 3G8AA 1OR8A 3KQTA 4RTOA 5GINE 2B25A 2OB1A 2YVLA 4G56A 4LG1A 4PGGA 2A14A 5GM2A 2ZIEA 2NXCA 3GO4A 1MJFA 5JR3A 1VQ1A 2GH1A 1JG2A 3B3FA 5K0NA 2CMGA 3GRYA 1M6EX 1M0EA 4OX9Y 2OBFA 1YFJA 1X1CA 3GRUA 1KYZA 4PONA 4QTUB 3ELWA 4ER0A 2QY6A 1QZZA 4GBED 1XDSA 2JH9A 3AWIA 2GB4A 3DLCA 4IV8A 3K0BA 2V74B 3HM2A 5BW4A 2AS0A 4X41A 3E7PA 3BKXA 3LDGA 5GIOE 4FR0A 3GCZA 3DP7A 4PWYA 3HTXA 2YUIA 5CCXA 4M36A 3DMHA 3HCDA 1HMYA 3EVBA 5E1OA 3IV6A 4QPNA 2B9EA 3RW9A 1L9KA 3TKAA 2G8NA 3FPFA 3LGAA 4XCXA 3KPYA 4KDCA 2EJTA 1NW8A 4PIMA 3CVOA 4RTNA 1SVUA 1UIRA 2Z6AA 2XYQA 5LR6A 3R24A 2G71A 2LD4A 2VDVE 2XVAA 5BXYA 5E1BA 5ICCA 5FULA 1L3BA 3U81A 3FPEA 1DUSA 2JJQA 4RVFA 5D1HA 2ZW9A 3UJCA 3FYCA 2FHPA 5DSTA 5E8RA 4C04A 4C08A 1WXWA 3EGIA 3OFJA 10MHA 5FWDA 2OZVA 2B3TA 3UA3A 2BM8A 2PXAA 3MTIA 5KQRA 2BR5A 2AOXA 4FZVA 2HNKA 3IYLW 1YUBA 3TM4A 4WVLA 3TPZA 4YV2A 4ER6A 3O4FA 5CIYA 2ZCJA 4PCAA 2AOVA 2H11A 3AJDA 3KPWA 4ER7A 2B2CA 2PT6A 5DM0A 2OPBA 4MQ4A 2FCAA 2B78A 4EKIA 5E9WA 2NXJA 4CKBA 3CJQA 2O57A 3O7WA 4IV0A 4PYJA 5FUBA 3D2LA 4PYOA 3I9FA 2JHAA 5DPMA 3JWHA 2I9KA 2P7IA 3QV2A 1VPTA 4HTFB 4BLWA 4X60A 5DM2A 1NW7A 3HCEA 4LWPA 4DZRA 2C7QA 1XCLA 5T67A 3P71T 2O06A 2PBFA 4KW7A 1Q0SA 1ORHA 3LKDA 4DQ0A 1VP9A 1IY9A 5DTMA 3LBFA 5P8WA 5C9ZA 2YTZA 2EX4A 4C03A 5EKUA 5HIIA 4MWZA 5FA5A 3FYDA 3JWJA 3ELUA 2XBMA 3V97A 5K09A 4HG2A 3LL7A 5F2NA 2OKCA 1TW2A 3MCZA 4PYMA 4CKEA 2ZBPA 5HZMA 3GDHA 3G88A 3PT9A 3L8DA 2HWKA 3AXSA 3SMQA 3I64A 5DT2A 2QRVB 3KKZA 3OE4A 3P2EA 4K6MA 4V0RA 3TR6A 1TW3A 1FP1D 2AZTA 3PTAA 2IBTA 1O9GA 2I62A 5LQRA 4RYLA 3C3YA 3EEYA 5K0BA 2YXLA 1I1NA 3PVCA 1YZ3A 3DXZA 1D2HA 2V7EA 3FTCA 8MHTA 5EMKA 4BLUA 4M37A 5FADA 1M6YA 5DTRA 3LHDA 1NW5A 1R00A 2P3LA 5E2AA 3KU1A 4C05A 1VBFA 5DX0A 1X1BA 2BR3A 3M6VA 3NW9A 1KPGA 3G2PA 1EQAA 2GA9A 3OZSA 4P7FA 3E8SA 3R3HA 4CTJA 5M5BA 1YF3A 2HR1A 5E9QA 3PLAE 3O31A 5EEGA 2BZGA 2YXDA 1KXZA 4YV1A 1TPYA 2CMHA 1RJEA 2AOUA 3GIWA 2R6ZA 1O54A 2AOTA 4PINA 5ICGA 2CL5A 1WY7A 5E2BA 5G02A 1RI5A 3E05A 5CVEA 3M33A 3OZTA 3EGVA 4FP9A 4E33A 3FZGA 3VSEA 5CCBA 3R9XB 3BWMA 1NBHA 5EMMA 3F4KA 3MCTA 1VLMA 3EVDA 2PXCA 3GRZA 5D1NA 3OU2A 3FUXA 4HGYA 2P3QA 3PFGA 4PIPA 5EMJA 4KVZA 2O05A 3HVHA 2ZSUA 3CC8A 3LCVB 3SM3A 5IKMA 5DXJA 3SR4A 4RTPA 2PVCA 2NP6A 1AF7A 3LX6A 4R05A 2IH2A 4GOLD 1HNNA 5C1IA 3P9NA 5HEKA 3NDIA 5K8VA 1KPIA 4OA5A 4M38A 2ZWVA 1WG8A 3GRRA 3B7PA 4PYLA 3R6TA 3P9CA 5EHGA 2PX8A 3WSTA 4XUDA 2IP2A 3M70A 5K03A 5HFJA 3RIEA 2AOWA 3I53A 3PX3A 4JXJA 2PX5A 5ERGB 4POOA 5FHRA 2WA1A 1NBIA 5KS2A 1UWVA 3B3GA 1VL5A 3FUTA 1FPQA 1IXKA 1XDUA 2P41A 3BWYA 3LECA 5H02A 4OA8A 3X0DA 4ATNA 3E23A 3FUVA 3OU6A 4FGZA 3P9KA 4DM3A 3KPVA 3BT7A 1BC5A 2Y1WA 4RVHA 3KQOA 5GOZA 3MQ2A 5GIPE 1NW6A 4ER5A 4YUYA 3B89A 3OCJA 2NP7A 2IBSA 5ICFA 3LSTA 3LPMA 4PYQA 1R6AA 2ZIGA 1KYWA 3FPJA 1NV8A 2Z6UA 3NMUF 3MTEA 3HVJA 4YUZA 3M6UA 1QAMA 3P9IA 4R6XA 4YUWA 7MHTA 3HP7A 3ANXA 1FP2A 1SQFA 1V39A 5DM1A 3TM5A 2PV0A 4QDKA 3EVAA 5GP1A 4GC5A 3SSMA 2Y1XA 1FJXA 4PYNA 4A6EA 3RODA 3BGVA 4C4AA 3NTVA 2WA2A 2Q41A 1YZHA 4Y2HA 5DLYA 1G6Q1 2PX2A 2YXEA 4AZVA 3NJRA 5KQSA 2EG5A 1ORIA 2YX1A 3KQVA 2G72A 3FTFA 4U7PB 3HCCA 1N7JA 2PX4A 2GPYA 2VP3A 2ZVJA 3CGGA 4KRGA 4HTFA 1NV9A 3QOXA 1F38A 2YQZA 3KQSA 5EG5A 5LQNA 4RSRA 4P58A 3BWCA 4DKJA 4PCLA 1XVAA 1XXLA 2ZBQA 3PS9A 2XYRA 2ZBRA 4B17A 3ELYA 1P91A 3NWEA 2QYOA 4DCMA 3HVKA 3DTNA 5DXAA 1JSXA 2ZIFA 3MB5A 1EAMA 1EJ0A 4V0QA 4RTJA 4R6WA 3C6KA 2C7OA 1JG3A 1Y8CA 3TQSA 3P8ZA 5E8JA 2PXXA 3KQWA 2CWWA 3G2QA 4EQZA 3KQMA 3THSA 3G7UA 1ZGAA 3VC2A 1BHJA 3KHKA 2P1DA 3CCFA 3FUUA 3EPPA 3GU3A 4FS8A 1R18A 4OBWA 4AUKA 1PRYA 2F8LA 3HA3A 4C07A 3T7RA 1JQ3A 3NDJA 3UWPA 1NE2A 4E30A 1ZGJA 4KDRA 4BP3A 1L1EA 3BKWA 2UZ4A 2PWPA 3KQYA 3LKZA 4QVGA 3TKYA 3VYWA 4YV0A 2NXNA 1U2ZA 4GF5A 2P40A 5JUWA 4CKCA 1KPHA 1NKVA 2ZULA 5B1SA 4EVIA 1RJDA 3KQQA 3BXOA 2E5WA 3MERA 4GUAA 3SVZA 5LQJA 2NYUA 2PLWA 5EIWA 4NECA 3HCFA 1Z3CA 3EMBA 4GEKA 3EVGA 2UYHA 1BOOA 3KPJA 2FK7A 5CVDA 4MTLA 4QTTB 5GWXA 2HMYB 1SUIA 1XCJA 2WK1A 2GAFA 3K6RA 3REOA 5FA8A 2DPMA 3SSOA 4YMHA 1QAOA 4IWNA 5DTQA 1AQJA 2ZTHA 4RVGA 2IIPA 3BWBA 1JR4A 2QM3A 4RV9A 5C0OE 3TRKA 4C06A 1G8AA 3VC1A 5FTWA 5T64A 5BP7A 1JQDA 5K0FA 5LQCA 2UYCA 1QYRA 1AV6A 2GLUA 4MIKA 3UZUA 3GXOA 9MHTA 1RI1A 2CKDA 4PYKA 1G8SA 4M7RA 3LBYA 3V8VA 1RI2A 4X61A 4FSXA 4YUVA 1I9GA 5EIFA 3LDUA 1WXXA 2H00A 3GGDA 3HCAA 3FTDA 2VDWA 2ZFUA 5K05A 1KHHA 5EVJA 3TOSA 3OZRA 1JTEA 4E32A 4YMGA 3IEIA 5DSXA 1FBNA 3LCCA 4MHTA 1VE3A 1VP3A 2ZWAA 4YUXA 4CTKA 3EVFA 3P97A 1ZHFA 2O07A 3ELDA 3FUWA 2OXTA 5LQKA 2G1PA 5HIJA 4AZTA 2BM9A 1R8YA
chains in the Genus database with same CATH superfamily
5CVUA 3TLBA 3DMYA 4V3BA 1CRPA 1XRQA 1E2JA 3LF2A 2CYAA 4OAQA 4MLPA 5CAEB 3R74A 2XCUA 4GFDA 2F4VB 2Q0SA 1CVRA 3BXGA 1E7WA 4K46A 2WM9B 1A8QA 5E9JA 3BBLA 3KV1A 1NI4B 1QO9A 4KXMA 5D3QA 3ETHA 2A67A 1YB2A 2CSUA 4GGPA 5GM1A 5JD4A 1KYTA 1T36B 1JSZA 4KQCA 5JTTA 4F06A 2CJPA 4OJTA 5D7NA 1J2EA 1QFZA 1OZGA 2WD8A 3JR7A 3B3QA 2UV8A 4O33A 7REQB 2AC2A 1X9HA 2IZ1A 2CLEB 5EEHA 4BNWA 1N9GB 3ILVA 3LTEA 4ZREA 5DNAA 4KQ2A 3AERA 1K4KA 2NXEA 2NU9B 1TQ6A 3LPAA 2DULA 3WB9A 3W6PA 3WL5A 1JFFA 2PXHA 1L6IA 1ZIOA 2ERCA 4XIFA 4C5BA 1N6RA 1JQ5A 4IXWA 4TN5A 3KV3O 1R4AA 3PLRA 2G77B 5BRNA 2JHCA 3GLRA 5JWRA 2J5QA 3BREA 4QDJA 3W06A 4HMPA 4JB2A 5J5AA 2ZDQA 3MJVA 2XHEA 3D4IA 3LX5A 4DQUA 2OOSA 3BJZA 4TMXA 1AHPA 1KK2A 1TLLA 3PNOA 4P1ZA 1GQSA 2A57A 2BLLA 1RRKA 3T1NA 3VU8A 5D7BA 2C4UA 2WR8A 3ORHA 3RYFA 1FC0A 4B3MB 5JSHA 1Y8AA 1ECLA 2P65A 1BFDA 3O6VA 1N0WA 2DB3A 4ZVNA 2FFRA 1IB6A 2XADA 3DXXA 5CW1A 5J2UB 3ZI0A 4D8YA 5BN4A 5IASA 2DGDA 3RH0A 1Y7LA 3DFFA 3VX4A 1ZJWA 1EFDN 4H3KB 4I9HA 1SUWA 2Q7XA 1L3CA 1OHHA 2DUMA 5C8YB 1WUKS 1U0BB 3AVQA 5KVVA 4C2TA 2EFYA 2QSUA 4CFZA 3G5UA 4KO8A 2Z04A 5JAOA 1UPUA 3GROA 1JFTA 2XMSA 3ORFA 2VLIA 2X0FA 3OIDA 1B0ZA 3K70C 3BFVA 3P4YA 4ARSA 4QQKA 1YS2X 2GHRA 3C0KA 3GOHA 2R6CA 3HYTA 1AKVA 1OFHA 1WDMA 1RE0A 3ONFA 1BS9A 5F98A 1WKBA 1L8AA 1E63A 2D7DA 4M9UA 1WZCA 4OAPA 2IU3A 2ZYUX 3JD1A 1QFMA 1E1KA 4YIHA 2O1EA 1TFUA 4ALLA 4L4ZA 4CL3A 4G0MA 5ADVA 1H4SA 3MPUA 2F59A 2EL9A 3MS7A 3DQPA 1OYWA 4XCQA 2G82A 2OD9A 4MRSA 3DHNA 1H6BA 1FEZA 2HU5A 4H35A 3M49A 5A1JA 4PNZA 1IG3A 2X2FA 1KJNA 2QM7A 3H2BA 4IIHA 2PUGA 4D8VA 1YO6A 1RCUA 2A5DA 4LZLA 1DKOA 1A95A 2VUIB 4O63O 1CJSA 4MI3A 1L2TA 4J75A 5HIMA 1WPXA 5SY4A 1G8GA 2B1IA 5IKPA 1UMKA 5JEEA 4MMZB 4KGVA 4Q3KA 3ZD9A 3ZJ5A 3MRVA 5F12A 2PUFA 1Q0QA 3PC3A 3P2IA 4ESVA 3GLHA 1VE6A 1HQKA 4D8UA 1FNSA 1E7QA 1DX4A 1W36D 4JYZA 1A27A 2PQ2A 3E9MA 3EA4A 3IESA 1GLNA 1T3ZA 2ZXUA 2EGGA 1JR3A 2ZJFA 4O8CA 4W99A 4D8TA 3LK6A 3UC5A 1H9CA 4UHKA 2HK9A 1SVOA 4BP1A 4JC8A 2G08A 4TSRA 2QZPA 1VL8A 2IVZA 5EGNA 1Q0TA 2VHCA 4QZVA 2EC5A 3HUUA 2ZUTA 1RHKA 2M6SA 2CZGA 5JYBA 4YACA 3KXDA 5AW2A 1PR1A 1R5NA 1YB5A 5B3KA 1UBHS 3EAGA 4D5GA 3S27A 2I4RA 4AX8A 1TM3E 5F2KA 1AH2A 4C0HA 3HA7A 3OUTA 1WB4A 3C3CA 1NSFA 3EGCA 5EWLA 1DJLA 1I6MA 3OF2A 3CF6R 1VIDA 4JA0A 4I50F 1ZM9A 1G66A 4G0YA 1PIWA 1ZD4A 4DCPA 1E4EA 1JEEA 1RAFA 3NAMA 4DWVA 3H1EA 4R0MA 1BKSB 4HXYA 1SD5A 3X1XA 2O19A 3A27A 3QHPA 4F97A 1QO0A 4ZVQA 3T7JA 3KCNA 4V03A 4CMIB 1BXGB 3M6WA 2P5SA 4CQLA 3TG2A 4W5RA 1FLVA 1Y7TA 3W7BA 1EUCB 2QX9A 3SFVA 2PDAA 4NS1A 1HG0A 1NP6A 1CB7A 2VDMB 3OOJA 1B74A 4G56A 3CRRA 4I1RA 4ZIRA 2NXCA 4AX4A 1KU0A 1TT7A 1JRLA 1UR5A 3AEXA 1W0JD 2II6A 1E6LA 1PJTA 4UBNA 3SIXA 5BN5B 4BFVA 4HPXB 1CV2A 1H69A 3URKA 1ZVQA 3OA0A 5AI5A 1ABFA 3V1NA 5KX5F 1T9GS 2YW9A 1JHYA 5SY9A 3DLCA 5BW4A 4HGQA 4RYDA 3AV3A 3ZZTA 2P2LA 1CQJA 4JJ4A 4A16A 2DCUA 2XWPA 3I05A 4DV2B 4RBNA 3H4VA 4WN9B 3GOQA 2QYHA 2VZLA 1F8YA 2A5FA 4KL8S 5IDWA 1FBTA 1W2WB 5FWNA 4P93A 1F2UA 2JIPA 2IZZA 4WGFA 4EUEA 4AMVA 1XZDA 2X1VA 3BCSA 821PA 3CMMA 1N1GA 2AI1A 5EFOA 2AFIA 2PS9A 2PN1A 4OGWA 4OP2A 3T5MA 4LPKA 1DKQA 1ORDA 1TMOA 4PTZA 3DZJA 1JYSA 1BMFD 1GCOA 4E7OA 2H2HA 2C83A 3E5NA 2OCLA 3KZKA 4NNPA 3QV1A 5FYQA 5DP1A 2JCSA 1VHWA 4H6WA 3BORA 4DZZA 1U8FO 5ESXA 1BE1A 3E7XA 4DAOA 1DCKA 3OC6A 5DSTA 1DVRA 3IAS6 4K9NA 4RCVA 4MUJA 4HWOA 4EI9A 1R50A 3OX4A 4CHGA 3AZOA 1U9YA 1UXKA 3KBOA 4DDUA 2W6CX 3DV2A 1E2DA 1VBKA 3V6MA 1PGNA 2AJ8A 1U8YA 2LE0A 2IOHA 2PUJA 4KV9A 4WVLA 4YAKA 4M98A 4D98A 2G76A 2AEJA 5DDIP 2YIDA 3AKDA 1QG2A 1TRKA 2A0YA 2DKNA 4MYCA 4C4RA 5AM3A 4WESA 3IELA 1OPRA 1YHZA 3AFIA 4GSYA 3ULKA 4CKBA 4F9GA 5KYWA 4AY2A 2CXTA 1T8TA 5DMHA 2UYGA 2ZRDA 3KELA 1H0HA 1Y4ZA 3GT3A 3WQHA 2WAAA 3OHPA 2VUTA 1V6SA 4NFSA 5FEUA 1U0LA 7ADHA 2CYCA 2MINA 1AA9A 1Q19A 2PA0A 1UBLS 4ND7A 3VR4H 4DZRA 5T67A 1BEZA 3FNFA 2Q21A 3KHTA 1N2CB 3DMTA 2YV3A 4DJJA 4J03A 3RYHB 4EARA 1A96A 1ZISA 1G9XA 1LDMA 2Z2KA 4M53A 1J90A 4MGHA 2CLHB 2ZRKA 5EKUA 4JJEA 3S2EA 1Y6FA 1MEJA 2FQWA 2PBZA 2W6NA 3OT4A 4JZYA 4Q7MB 3GVPA 3V97A 5K09A 3ZGZA 2HX1A 1XZFA 2ZE6A 4KR3A 1XA4A 1SHUX 3JAWA 2XXAA 3SNHA 3N2NA 3AXSA 3BE4A 3CEPB 1T4CA 3E70C 3PGLA 4P4NA 5EP1A 5CFPA 2HUNA 3AJ8A 3TR6A 3U13A 1ZCBA 1YGPA 2AZMA 1I0IA 1U9ZA 4XWYA 1XNJA 4BJ3A 4DLLA 2HBYA 3H9JA 3FVTA 4UVIA 1PYOA 2JIOA 2H48A 1KP2A 4Y1GA 4DJEC 4XYBA 3IRVA 3PVCA 1GUFA 3FYUA 4ZI2A 4FFVA 1Y80A 4JX8A 4FFRA 1M6YA 1E9AA 3E3MA 4J0JA 1T5DX 4UW9A 3SXUB 5A9RA 2DQ4A 3A2KA 1LWNA 1AOXA 4WZBA 3OQBA 3UJNA 2I4IA 2DE0X 2GHIA 2VJLA 3CLRC 2JRCA 3SEAA 1U3TA 4EEXA 3DBLB 1IPFA 1DDIA 3I3OA 1RQLA 1OGIA 1M34E 1WHSA 4CRWB 3DLHA 3NHLA 4Q3EA 4U02A 4Z0HO 3R9KA 1RU3A 2DLNA 1ZY2A 3D8HA 2XNHA 1Y98A 4EW3A 1H8HD 2YH2A 4WNCA 4ZOAA 4DLBA 2PUBA 2OHIA 3U4DA 1NBHA 5EMMA 3CBQA 5I7SA 5IAKA 1K0UA 4CN9A 1XQ1A 3FMPB 3HXTA 1E3QA 3HDVA 4MK4A 2H7CA 3N75A 3DD5A 1WD7A 2L17A 3K6SA 3ZS9A 3ETCA 1HFEL 2BHRA 3CC8A 3LCVB 4RZHA 4DR5B 1LGYA 1YL6A 2QZ9A 4J94A 1W2GA 1P7PA 1N2GA 3QFTA 3ZTYA 2WTUA 2QG6A 1UBNA 1CR2A 3DFMA 2XSZA 3L8ZA 3LQQA 5JCJA 2FI1A 4DIKA 4FNMA 1MAUA 4ABTA 4FDMA 3BTOA 3W5IA 5TMDA 5EHGA 1NQOA 2QUHA 2VSFA 3NAGA 3WSTA 3QX3A 1K75A 1R6BX 4KX3A 2NZYA 4EHJA 3ND8A 1KQGA 1Y4DE 3K0KA 2CUTA 3X2SA 2F1OA 2FWRA 2QI9C 4I4TF 1O5OA 4JN6B 4KN5A 2WA1A 2I5PO 5FKJA 4YO7A 2QAJA 1NLMA 1MO6A 5D6OA 4CTJA 4F3RA 4DGQA 2C04A 1FFAA 1V35A 1JSLA 3AUUA 3UV6A 1SCJA 3PXUA 1JZQA 3Q0EA 5AJWA 1QBGA 5ALJA 4Z0NA 3RT9A 4RFSA 1TYZA 2Q5QA 1CKEA 3KQOA 3PC8A 1WDWB 1KZHA 4MUIA 3TH5A 1SIBE 2ACKA 2FZKA 4B3BA 1E3EA 3S7TA 2BFAA 3NLLA 4LW8A 4LRUA 5JPCA 3H2JA 1MIOA 1YVUA 3NHKA 4DBLC 1FQOA 3I23A 4JVMA 2ZATA 4G23A 2BUCA 4ZO6A 2RHMA 2ZSDA 3KQKA 4WLUA 4YUZA 1G19A 5AESA 1IONA 1SEPA 1TZJA 5EWMB 3OQOA 3COWA 3UFXA 2E4YA 2ZWIA 4RHXA 5CLGA 3VO2A 1Z47A 3E53A 1MVOA 3EQ2A 4GC5A 3VTKA 5I7VA 4IILA 2I7VA 1WMEA 2LVBA 3DBVO 4B3GA 4BPRA 3Q11A 4XD2A 5ENDA 5IU6A 1BDHA 1LH0A 3KEOA 4TKZA 5H5JA 1TM1E 2YX1A 3EEQA 2GM9A 1E62A 4G5XA 5AOVA 5G0VA 3AOEA 2VP3A 3ET5A 4G1FA 3MTGA 3QOXA 3E4CA 4FYPA 2YCBA 1SZCA 5JSYA 2OV1A 4F46A 1GPUA 5LQNA 4MHOA 3A3OA 4MB0A 3OZBA 3BDVA 2A9JA 3WLRA 1E58A 4ECEA 4Q3NA 1RVV1 1UWKA 5JDCC 4ARAA 1JFVA 4G8CA 4N0PA 1IC6A 1JSXA 1UK9A 1UJNA 2QF7A 2YHUA 3T5PA 3K1YA 3OZWA 3BG5A 1TVCA 4M46A 3RYIA 5H82A 1WSDA 2E1RA 5E6SA 1YB7A 1YR7A 1P72A 1P33A 1F0NA 2Q4DA 3ETEA 4QVIA 3W77A 1SHKA 1ZRHA 2SECE 1SUCA 2OAEA 4AN0A 4AUKA 5HZGA 3QWAA 1TNDA 4BLRA 5EQTA 2F1RA 1PEAA 4N0EA 4BP3A 2PWPA 2H85A 4A23A 4HEQA 4XI9A 3EF3A 3WLIA 5AKLA 2O2XA 3V1YA 2E5FA 1ISFA 1ISJA 3FLMA 4O2AF 4C3ZA 3LCRA 3EB9A 4J9VA 3F74A 1IQUA 4G2TA 1EX6A 3EVNA 3IEXA 3MERA 2E5WA 3INRA 4QIHA 3SVZA 4D3YA 3BIJA 1MW9X 1EDBA 2JJMA 3QUBA 4HB3A 2AG5A 5I3ZA 3ZDQA 5LCXA 2KPOA 5A05A 5B4TA 3W5AA 2GAJA 3AW8A 1ZYUA 5HKKD 1EXWA 4ZO9A 2HMYB 3L79A 1ULSA 1SUIA 2WD7A 3F6SA 2VJPA 2H07A 2QGFA 4NYMR 3RB8A 3UMCA 1XPOA 2W0SA 2YVUA 3N2EA 3D31A 3GVXA 1D6NA 4GRDA 4PBTA 5T4EA 3TIGA 4YASA 2IYRA 3F67A 2BGMA 3PYMA 1DADA 1E2NA 1O6BA 1FRQA 1E5XA 1LUAA 3KSZO 3M6LA 2GDZA 1WZEA 4O4JF 3TSYA 4D45A 4WSOA 2VPQA 1XPRA 4LDPA 2BFWA 3AEQA 1R0YA 4WTOA 3RFCA 1E5TA 2RGGA 4INAA 1ML3A 2CNWD 1XDDA 1M7BA 2GLUA 4D3SA 4RABA 1A72A 5JNLA 1D1SA 3GA7A 2QN3A 1TM7E 4TPKA 4DMFA 3LBYA 1K88A 8AT1A 2ZCVA 1RM3A 3D1VA 1NONA 1EVJA 2CLMB 1XT6A 2QE7D 3TD6A 1LZLA 4EHFA 4ID3A 1ESNA 3A1UA 5ENVA 1JS1X 2FZVA 3S7ZA 3PUYA 5CU7A 5KMGB 1H6CA 1HGXA 3CFYA 3HKEA 2CLIB 4DARA 5EIAA 1VE3A 4TWJA 2XQJA 3EVFA 3JQQA 3PPVA 3RBZA 3HO8A 4I55F 2J4CA 5LLSA 3BL8A 2Y77A 1OI2A 1P1BA 1C3OB 2Z5LA 4DNXA 1I1OA 1X94A 1YRLA 3DUWA 1X1QA 2ZAMA 2A33A 1X7YA 2CYBA 3G49A 4I19A 3OIWA 3KLMX 3PB3A 4PAWA 4OSOA 1BS2A 3DM5A 3GT7A 3T61A 4FDVA 4B4VA 5CB4B 2Z58A 1JU9A 3TS1A 3NWBA 1RP1A 4UQPA 2IH4A 4URFA 1A2BA 4QFCA 4YECA 4HQ0A 1F2DA 1I2DA 2HN9A 2OO5C 4RY0A 3DJFA 3FPCA 2ZU6A 1DZIA 2VYCA 1R74A 2IEGA 3GMSA 4RX1A 4F3NA 5FWYA 3MAGA 3VPFA 2VAXA 1A9YA 1ATZA 2WJIA 4L4SA 4XJVA 3I4CA 4J1NA 4LMPA 2FZEA 4X1YB 4MEJA 3MAJA 4FLMA 2ECQA 4OQNA 3QA3E 3DE6X 2Q8PA 4M1TA 5KYVA 4GX5A 1MRZA 1Q1NA 2M6RA 4AKTA 1XMXA 4KO4S 3OIVA 4LOLA 1QSGA 3K0AB 1OQAA 3DOOA 3KEFA 4OBXA 3ZK8A 3TVTA 4PR3A 1SOWA 3LPDA 4IFTA 3D6TB 4BTLA 5JSQA 2Y0PA 2AR7A 2PWBA 1K9SA 4CMKA 2OHGA 4D9FA 5JDIA 2R8BA 2WMDA 5KYNA 1WY5A 2GYWA 3O21A 4KU4A 5MFZA 2JFYA 1FMCA 2C9CA 3KKOA 2J87A 3U4IA 3J80A 4M0LA 3BH0A 3PRYA 4E09A 5CVTA 2FOLA 4X85A 2YOFA 4GPTA 1ULTA 3LAWA 4BVAA 2VPPA 4LYFA 4C7OB 1BYUA 2QPLA 3KQPA 3RSCA 5KTKA 1XJ5A 4I1VA 5CFMA 1N75A 3CRZA 2B61A 2DKOA 5FWAA 1N8TA 1IY2A 1WHTB 3OHSX 4FFWA 1G55A 4DIDA 1I7QB 1YDFA 4R0VA 2D0DA 5HCNA 4GVLA 1B00A 3T3EA 5CW2A 4H18A 4JJZA 1QQAA 2I6FA 2A30A 1U2SA 2P9ZA 3NUZA 2JH3A 4I4CA 4X71A 3VSBA 6YASA 5D3KA 2A94A 2H4HA 3AF1A 4AJ1A 1QH1A 4JNCA 3V7WA 4YPVA 4D9KA 3CE9A 4AIIA 4EA7A 3V6LA 3WHPA 1SR8A 5G0SA 1K7EB 3THRA 2PV7A 1ZMXA 4LZJA 5H16A 4QGSA 5BURA 4PPFA 1XTUA 3ZR4B 5CB0A 3LBNA 5HGXA 1DJQA 3HWSA 5DJ5A 2FVXA 3KKKA 4HC4A 3DNMA 4G97A 2BLNA 4TWAA 2EDAA 1T5OA 2JG3A 3BGDA 5EJ8A 3NHMA 2JFNA 1HTBA 2JGMA 2ZS9A 1DO0A 2ZIAA 2H6EA 3C74A 1CJVC 4LRSB 1CC1S 1E3LA 4JYPA 4D9MA 4F85A 3IUEA 3W6OA 1PW7A 2F9FA 3ND9A 3HVIA 3OIUA 4Q9JA 3RVQA 2QG9A 4IHKA 3K32A 3WRYA 1KQNA 4IXMA 1QGUB 1T35A 3B3JA 2WT8A 1DG9A 3TD2A 5I7EA 1L7QA 3HEBA 3RRXA 2HA6A 1I1QB 4FKBA 1TJYA 4MR8A 2R6FA 3IP6A 1RIFA 4R2KA 4LVCA 3AI3A 5EE3A 3UWSA 1MJGM 1UKYA 3N74A 4QNMA 3KKNA 3VNAA 3GEGA 5A3JA 4ITVA 2Y27A 2CUNA 2WTNA 1NVMB 1SPBS 2YCLA 3A1SA 3LQYA 3Q87B 4OHCA 4ZEXA 3UJ9A 2VJMB 1QRAA 3VR5A 4FQ5A 3WWDA 1LJ8A 1XJWA 5DX8A 5LQAA 2CXRA 4AYWA 1X1AA 5L4LA 4O08A 2QTMA 3RRYA 3ZCPA 3GZTB 1IM8A 2EHDA 3W2GA 2UDPA 4C7MA 4QUGA 3OQVA 3AUKA 2WU1A 3L7KA 2OCPA 3NEAA 2G3YA 5E3JA 3ZHQA 2C7PA 3EZ9A 1LTKA 2AR0A 2YXNA 4YRSA 3T0IA 1CQXA 3IAAA 4HVAA 3DB2A 1FVXA 2I8LA 1KOGA 5KCZA 4CG0A 4NBRA 1N57A 1JDBC 1N8KA 2COKA 2C2BA 2IHJA 3L7IA 4HRXA 4MKZA 4AF8A 4R5HA 1FMTA 4LI0A 3UH1A 3NIDB 1XBTA 2E3JA 1V3VA 3RVOA 1AUPA 3ZX4A 3K16A 3LFTA 1WJGA 1UMDA 2KBEA 4TRMA 4ZARA 1J8FA 1E8NA 3PUXA 4YJ3F 4AUMA 5LP6C 4CPDA 5IBRA 2JD1A 4HNUA 4IIDA 3G8AA 3I42A 1C3EA 1RMTA 3PR2B 3VDRA 3DLAA 1NL3A 1WMBA 4G5HA 4MW5A 5LWHA 4LMAA 3MOGA 3CLUC 2M9MA 1ICIA 5AKHA 2VQSA 3LT1A 2XZPA 2YDXA 3UG6A 4S1VA 4XB1A 4TWIA 1H9AA 1X1CA 2BKEA 2C7GA 3VO9A 1B73A 1JH8A 1Z0AA 1C7ZA 3AFHA 2JLXA 2O8CA 4LTDA 5CK5A 1R27A 3AHDA 5CH8A 2AS0A 2B36A 4TXLA 3QBEA 4AB1A 5F73A 1ZK0A 4RK1A 4RZUA 3GZNB 1FVOA 3KKQA 1ZLYA 1HMYA 2D1YA 1PJ3A 3EVBA 4Z86A 1WL8A 3ZD6A 2AJCA 1QP8A 1SRRA 4QPNA 3DFKA 4CQMD 3GJRA 5AW9A 3L4SO 3W6UA 4CTMA 1IK6A 1VC2A 1WSWA 2J7KA 3DNFA 3EFBA 3FHJA 4MKRA 4BX9A 4Z3DA 1YE3A 4MV4A 4PQYA 3V46A 3QF7A 4A36A 3ZE2B 2ZSHA 5AHRA 2O8DA 2IYFA 3OD5A 1FU4A 4O3FA 3V4VB 1HSZA 1Y7HA 2X0NA 2H4XA 1SOAA 1ZN9A 4C04A 2FWPA 4ZT7A 4CLOB 2AQIA 4G41A 1L7AA 1R5OA 2KE5A 4M54A 1O97C 2B3TA 2HLDD 3VTAA 1VI6A 5A3RA 3HXQA 4L15A 2JCVA 3UKOA 4YJHB 4HQKA 2W48A 3RTDA 5HK9A 5ITZB 2INGX 1S9DA 2QW8A 4Z8XA 4F3TA 2Q2VA 4YV2A 4O4HF 3K73O 2ZBVA 1PBNA 4EF6A 1MEOA 2WG2A 2FMXA 3R3YA 4QXQA 1WDTA 3HYRA 2GN1A 4PLFA 5DULA 5FR1A 2R86A 3QBDA 1VLVA 3NH6A 3V4LA 3UOAB 2F2TA 2XB4A 3JWHA 3IQIX 1VPTA 1UC4B 2H1WA 1XCLA 2H57A 2QN8A 1CHDA 1JZSA 2B2XA 3Q6NA 4QDTA 1GTZA 3A1CA 1B1CA 1NF9A 1YDWA 2TMYA 1K0FA 3I01A 3LBFA 3V8NA 4YCMA 4JJKA 3QLUC 4OX9B 2C77A 1PFVA 2NO4A 4OXNA 2VHYA 2G1UA 2WZQA 1E2MA 3R6DA 3KQNA 2VJBA 2FPXA 2AQ8A 5JC1A 3IE1A 3PD0A 2EZ8A 1IJBA 3UT0A 3WRXA 1T9CA 4QOEA 3I64A 2QRVB 3OE4A 2CB0A 3IKLA 4IDNA 3EEIA 1T9DA 1XN1A 3C45A 4IIEA 4XDYA 1RHJA 1YDEA 2IKSA 3K1AB 5JQWA 4IH9A 2I91A 3O3CA 3R7LA 3BD9A 1DTSA 3RROA 5KOHB 4OK3A 3C3YA 3EEYA 4ZCRA 3OETA 5A6VA 2GBGA 5J1SB 1G20E 3QVGA 4OQLA 4IVPA 3PDIB 2PTHA 4IO0A 4F4JA 1KAGA 2PMEA 1MJ5A 4GM1A 5JCXA 1R00A 4MVJF 3UUGA 4CIBA 4R81A 3IA7A 1AB5A 5AJXA 3NCHA 2GNPA 3R7FA 4FKZA 3IVMA 2GEDA 3LY5A 4BGEA 2P4EA 3PFIA 1AK9A 4KZPA 1L5LA 1L7DA 4LX0A 4CBVA 5AIBA 4Q1FA 3K70D 2ONCA 5GONB 2AW3A 1S96A 3FDIA 2O3UA 1S2DA 3D0RA 2VNAA 2ZRBA 5DGIA 2QD4A 4EPWA 3UMYA 1YBHA 3ZHSA 1Q3HA 1SKYE 2QW1A 1F0PA 3GARA 2PJZA 4IIJF 4PC3A 3VGJA 3KO8A 1YQQA 3D5EA 4FKMA 4C14A 3I9KA 1TKRA 4OIFA 4URVR 3SEFA 2ODTX 4B3SB 2CFCA 1UEXC 2PYDA 3AM4A 1VDZA 2MSCB 1OJLA 4S35A 4WT7A 1X38A 4YWHA 3L0ZA 1VSQA 1K5PA 4X1KB 3SM3A 1XF9A 3IH5A 4QUKA 1T2NA 4BMZA 4AY3A 4YRGA 4BWGA 1AXRA 1CERA 3SF0A 3L43A 4MZDA 3OQIB 1SULA 3NG1A 4L02A 1D07A 4JHLA 5M04A 4BXOB 3LSYA 2PQMA 2HFJA 2PX8A 4I8IA 3RV3A 3MUEA 4BZZA 1CF9A 3L0DA 2JLZA 2NVUA 1GYRA 1F4PA 4TQAA 2CHEA 3PX3A 4XQ0A 2PX5A 3L9WA 4KXUA 5B1EA 5ANRB 1Q0ZA 2GPJA 1NRJB 4RHYA 2MYNA 3KPVA 4BGIA 3FA2A 2YZ2A 4HFNA 2YASA 4LE0A 4ER5A 1G6HA 2IBSA 1PZNA 1DIBA 3MCWA 4FPXA 1GTSA 1P2SA 3BSFA 3LPMA 4BNDB 1RPTA 3JPYA 3FGZA 1JDTA 1PEYA 4TUYB 3ENNA 3ADKA 2EZ9A 3HL4A 4QYXA 1MJNA 1NOJA 1UDRA 2RGRA 3ZU2A 5EJ4A 1Y9ZA 4MRMA 4YCDA 3QXSA 4TV8B 5G3YA 2B69A 1L7VC 1V39A 1EM6A 2LR0A 2X3YA 3V4PB 5J5VA 1IPHA 2MDTA 3FROA 3NM4A 1NN5A 1DO8A 2FR1A 4LYYA 4AP6A 3NYQA 1YZFA 3G7SA 2HC9A 4F71A 4RANA 2C78A 3K92A 2RB4A 2I71A 2YV1A 4EMBA 3EXAA 4LF6B 3X1YA 5K8TA 3R7AA 3ZU4A 4HZGA 2R0QC 4FXOA 3VO8A 4DCVA 3QY0A 5HUHA 1JXQA 1NE7A 4OATA 1LBSA 1JDZA 4IGFA 4RSRA 3A2NA 1XRMA 1P7WA 1DELA 1ZZEA 3Q10A 1K27A 3B1KA 4KYIB 3PS9A 2B99A 3AV0B 3WV4A 3MJHA 1JEQA 1QMGA 3AETA 3I5MA 1HLDA 3PQEA 2PUCA 1TCBA 1Z0JA 2CFSA 1W75A 5EIHA 4Z4QA 1EAMA 3QXGA 1Y8ZA 3C6KA 1RNLA 2GPTA 3KYDA 4LY9A 3DDHA 3S2YA 5HP4A 2IY8A 3G2QA 4AKHA 3OX1A 1ZGGA 2BZSA 3JQFC 4LOKA 4WLOA 4F4UA 3SZOA 2AXPA 1ZNQO 1XNHA 2FFJA 4RPLA 2Y99A 1R18A 3TYXA 3CO0S 4IHJA 1P29A 2CMFA 3QJYA 5BSEA 2QKYA 3T7RA 1G3QA 2X4GA 3Q7IA 4LDJA 4PXSA 3BA6A 2DR2A 4MUMA 4Q4DA 3X44A 1WIWA 2XWJI 1ECFA 2GYYA 1S3FA 3D7MA 4UDXX 1Q74A 3WYNA 1AY0A 5C52B 2XCSB 1O08A 3CV3A 4Q9LA 1OI4A 2VHXA 3OKCA 4JQCA 5SV2A 1Z4LA 3TNYA 1YJ5A 5CT9A 4AG3A 5LP6B 5TIIA 2G0NA 3ANMA 4KJZA 3L8MA 3PL1A 3UMVA 4Z49A 2X8WA 4TMTA 1FF9A 1U0GA 3K0HA 1TUBA 1VGVA 1T1RA 1UT6A 4JP5A 5IC4A 5JCOC 1T9AA 1B6TA 3GFFA 4L4RA 4YRPA 4IP0A 4F12A 4YCSA 5ADUS 4R1LA 1FFSA 2B37A 3K6RA 1ODIA 3T7KA 1FQJA 3VU3A 2P5TB 4MO9A 2DPMA 2H2AA 4PSAA 4XB2A 1Y4UA 3RVNA 3M83A 1JJIA 3ADOA 1ZVJA 2Z4RA 3MFQA 1Y3BE 3AMVA 2ECOA 5FPHA 1DJOA 4HLQB 2W6PA 3I4LA 3JQ8B 1L5NA 4PHHA 1K98A 3W4JA 4D79A 4NBUA 2BTEA 5IP5A 1KY3A 2HK6A 3QLJA 3ZE9A 2ODAA 3PT5A 1GFWA 1NUQA 3NTUA 1GDTA 1AK2A 4KQMA 4YO8A 1IM5A 4BO2A 3EC2A 3HFJA 2FSSA 1SQ5A 1IG0A 3L7JA 5TV2A 3WQSB 5GJCA 5IJWA 1DFIA 4HWRA 4BNJA 2B8JA 4Q39A 5E4TA 3ELDA 5JHHB 5LQKA 1ZD9A 4OJYA 5EKSA 5JCZA 2OY0A 1R88A 3E6AA 3G5TA 4MAMA 1NPYA 1Q17A 1HE8B 2IF0A 3C2QA 4UQOA 4XWOA 3ETDA 1AMUA 5K0CA 4LGCA 4UTOA 5BOVA 2G1KA 1KEPA 2XWBF 4F86A 1OASA 1C9KA 1QH9A 2ZWMA 1QYIA 3DOHA 5DF1A 1DCTA 4BLVA 3DYVA 2BBSA 3RIGA 2PT9A 3S1LA 4IGIA 2LXNA 1TCAA 3F46A 1R0LA 1GCGA 1ZMRA 1SMKA 2G8LA 4H77A 4WECA 3WQQA 4PG8A 1PV4A 5KQLA 4N5NA 1P80A 2YWCA 3HNRA 3N58A 1R10A 1VG8A 3GI1A 4IGKA 3ZY4A 3W6ZA 4PLGA 3NBZC 4Q93A 3PFHA 3IAXA 4GMHA 3V7FA 2VHEA 1H94A 1YK0A 1Z6XA 3K8OE 5KTOA 5AVXA 3ZG6A 4PPYA 1CS0B 1ZMBA 2VP4A 4FWBA 4NLLA 3HBAA 4E07A 4HNRA 2P4UA 1NULA 3SZMA 3FMGA 3DO6A 1Z2DA 2JCBA 2ZQ5A 3P2JA 2BKVA 5FPPA 1YZTA 2GNOA 2Y1CA 4XYGA 5REQB 1PYDA 1SWVA 3PGJA 4IAOA 3CLRD 1P77A 2CV2A 4KMMA 4KXLA 2NO7A 3STXA 2D8AA 1K7SN 1JGTA 3WMWA 2O7VA 3R0QA 3CXUA 4U2GA 3UMRA 1DMSA 2IPAB 2VRCA 3EGDB 3N0RA 1ZL0A 1P1KA 1U98A 3OEHA 3PUKA 4M0DA 2NNWB 4I46A 1AKQA 1US8A 4CF4A 1WB9A 1JR6A 4G09A 4F4IA 3WLFA 3EK2A 2YV4A 1SXQA 3IBGA 3W05A 4AJLA 1ENPA 2SHKA 3TK1A 3H4IA 4DRXB 4KPEC 1Y5LA 1TU4A 3BD8A 3RSGA 3V7YA 4ZD6A 4DJTA 1Z15A 3C5VA 4C3OB 1OA0A 3TE6A 5KPJA 2LZ0A 3H8SA 3PTLA 4M8SA 5JSZB 2WP8J 1PP4A 3JVIA 1ZKDA 3CTMA 4P2BA 1MORA 3ZQJA 3MGCA 3RTEA 1HF3A 1N0VC 1LPNA 4EJSB 2QNIA 3CVVA 2WNIA 1R8XA 5K0JA 2IYZA 1ITZA 3QBVA 4HZUA 5E6RB 1EWKA 2IUEA 3OA2A 1UK8A 1JSCA 1CE8B 1TZCA 2X1MA 3LYHA 2FRVA 3OQJA 1I4WA 1R4NB 2ABWA 1E7YA 4GPIB 3AB3A 1A71A 3BCUA 3OKFA 2PA3A 4LJLA 2XYPA 3CR8A 1AS3A 4JLMA 4PVCA 5LOVA 3CVYA 2J48A 3CPHA 4BB0A 1R6VA 2P8JA 5CA1A 1T1EA 5JSFA 3M34A 3GBVA 5C7OO 4PLHA 2VJDA 1AK1A 3DL2A 1UIMA 1X7WA 4U5XA 3U3ZA 4I3FA 4FYVA 3H5OA 1GIAA 3BHNA 3DMGA 1G5TA 1UP4A 3HRIA 3HQ4O 4NMWA 4YRFA 2AC7A 4JDUA 1GZ5A 3OF5A 1KY5A 2JBAA 3GQBB 3OJEA 5C1PA 3TSAA 4A6DA 4E11A 3OLCX 4P5PA 3K0EA 1POWA 4J7UA 3FTEA 4LMRA 1DLIA 3BWXA 2IS4A 1I8TA 3EZ6A 1A8UA 5DRYA 1L4UA 4GECA 1VIAA 2NUAB 3ESXA 1XOIA 3P2YA 4KN8A 4G5OA 5ED0A 4A73A 3BTSA 3SZRA 1AO0A 2Q45A 3NTOA 4LEIA 2FV8A 5LZ2A 4BNZA 5JLAA 2C5AA 1WR8A 4PLTA 2XQFA 4LXQA 1WUYA 2GCIA 4JQYA 2NZUG 1KJWA 2X76A 3A7DA 2Z5GA 4L16A 1NQWA 1K3TA 4FCCA 4LZPA 2R9VA 4MWSA 3DDSA 1WABA 4LQ4A 1J8QA 1JHVA 1PG2A 1AB6A 4OQEA 2GBIA 4YRDA 1LF5A 1R3UA 2JLBA 1KI6B 1Z6ZA 3C3PA 3TFWA 3OG9A 4GMFA 1H1TA 2AFHE 1ONSA 2BGIA 2LPMA 3PGXA 4YEDA 3AM5A 5EP3A 8LDHA 3JWEA 4E08A 2FTKE 2ICAA 1ZFNA 2B9VA 2O2CA 3DOUA 1K8YB 3PDJA 2JD2A 2PG3A 1L3IA 3C3DA 4GOND 3L04A 1E3JA 3IT2A 2C9ZA 3ABOB 5FOUA 1YB4A 2F8MA 1ZJYA 3BD6A 3NC4A 2QAGC 5IVDA 3TMAA 4DCOA 4JT2A 4F9FA 2YOGA 2FPPB 2G5CA 2PHZA 3A6FA 1CEQA 3WYGA 1NF3A 1ST2A 1TMGE 3Q3GE 1GV0A 4BJ6A 1Z7YA 2YYSA 2Q1XA 4B74A 2HJSA 1XTZA 3F6PA 4LOJA 5B7GA 4N12A 4EZIA 3SR0A 2B92A 3KG2A 2XGJA 4HFMA 5EE9A 1NMQA 3LLUA 5LXTF 2MHCA 2NTVA 2QEQA 4PGGA 1ZEMA 2WLTA 3F9IA 2UU9B 4TZ6A 1GT91 3JASB 2PX6A 1DI0A 3HXKA 3GFOA 3L93A 1K5DA 3N6XA 3RC9A 2X5KO 3QE3A 1TI7A 1PL7A 2XTMA 3ESRA 5ERXA 3SC2B 1K7CA 1LLFA 1YAHA 4B3RB 1RQNA 4J3JA 1BG6A 1G5RA 4PG7A 4TL7A 3MN1A 5IDVA 4E5MA 2H8GA 2QU8A 3LVBA 1R0BA 4JUIA 2X5JO 3KIPA 3WNBA 3RJTA 4AXBA 3K0BA 2V74B 3UW3A 1L5VA 1IWBB 1WKVA 1Y3FE 1MC5A 1G21B 2YHBA 3H05A 3LDGA 5CLQA 3S2GA 2PLNA 2YRFA 4KNVA 5CBKA 2QRMA 3GLFB 2V45A 2IE8A 4QM7A 5KHOC 5E1OA 4NE7A 3PSHA 2FY8A 4YGYA 4LJ9A 1UKBA 721PA 3T6KA 5K6AA 2CL7X 5NULA 3PWSA 4EVQA 1CEYA 1D09A 3P20A 5AW3A 4MRRA 2NAFA 3ST7A 3DBRA 3JQBC 4CLRB 3LQ2A 2CT8A 4FOTA 3KQLA 1BXZA 1KYXA 2D5CA 5KI6A 1O87A 3LUGA 1E3IA 1WNFA 3WZLA 3KSBC 3EUFA 3GLQA 2V0GA 1NRWA 1XQYA 2BWJA 3DZBA 3CPJB 5TSDA 2XCTB 3OFJA 1B93A 2IEAA 4HQOA 2GTPA 2JB9A 1T9HA 1Q7BA 2WZBA 3PPWA 4OLFA 1QVWA 4RD0A 2F4NA 2QVZX 3G79A 4KH1A 2J3LA 5EZ6B 5FJIA 3RS8A 1TYEB 3KKMA 4O1HA 1YVDA 1PSDA 4P33A 1RXYA 3IBTA 3OWHA 1VG9B 1DAOA 2DWPA 3CVXA 1E2EA 3SLKA 2W6OA 2Q5CA 3FDZA 3GLTA 2O57A 5KNBA 2DBQA 1YB6A 3AY6A 1YI1A 5L9AA 2NO6A 3LUAA 3VH1A 4DA9A 2NUTA 2QZ4A 4P38A 4AY4A 2ZI3A 3H4MA 1E1NA 3CE6A 2WHQA 3AI2A 3BMQA 1AKMA 3EFEA 3X1WA 4D3DA 3I2HA 4L95C 2VSNA 3OPVA 2XYGA 3VTFA 1TVEA 1V8BA 2GHTA 4WCFC 4A0QA 4AAYA 4Y9DA 5A3QA 1BVUA 2X9LA 2WU3A 3AG5A 4GAEA 1PFQA 4US1R 4P4SB 4PZCA 4MGEA 4IRMA 3LL7A 3U3MA 1DJMA 5E9AA 2XOXA 1HE4A 2VRBA 2ZBPA 2PUHA 3GVIA 3PEEA 3DR3A 4DEYA 2I0FA 3FGNA 2FP4B 4JODA 4U2KA 3WK8A 4JI4B 4K40A 4Q21A 1U28A 3P2EA 5AM2A 1U2GA 1JF8A 2R4TA 1TW3A 4LGVA 2YWJA 4ZAVA 4EQ6A 2B6NA 2QJOA 4MPPA 3RC2A 2R8YA 3CX7A 3VPCA 4BJ5A 1BTOA 4BKUA 3OECA 5G4KA 5ETJA 3E84A 5A9TA 3T1OA 2AHRA 1X2BA 1EX1A 1JVBA 3M3DA 1PHRA 4CJXA 4CFSA 1EFTA 2HQOA 2PSEA 2C4TA 3HFGA 2SKDA 3WWZA 5DTRA 3JQ9A 3FDJA 2YJNA 1QGOA 1NI3A 3V00A 1AGNA 2ZAIA 3NHFA 4URXR 5CAEA 1P19A 4NBLA 4L9WA 4V39A 4EHAA 5K5EA 3GLVA 3W5HA 4B2IA 2WVGA 1G8MA 3D6MA 3QUTA 1YL7A 3C4VA 3KXIA 3HUDA 3P9XA 3OCXA 3EGOA 5DGXA 4AJNA 1RJ9A 1Q5PA 4ZTZB 3ZUPA 3GIWA 3AJ9A 3AHGA 1X7DA 1YJQA 5COAA 4PLWA 1E1RD 3WL8A 2IS6A 1H8ED 4CM4B 4H7EA 4C2UA 3LVFO 1RYHA 1VMAA 5BWNA 2ATXA 2OV3A 1PV1A 3WL4A 5JD3A 5K0ZA 2XRZA 1JEAA 4QXPA 3VQTA 5CP8A 4P5DA 3BEDA 1G2IA 1UPTA 2TS1A 2QLJA 3E3NA 1Q1AA 2Q6IA 4QG7A 4IMPA 3USCS 1C50A 3T1TA 1VECA 4EF5A 4CG3A 4KREA 1K8RA 1C9NA 3GYGA 4BIIA 5BN1A 4AVYA 1T2DA 4R05A 5LZ7A 1AZSC 4AECA 4GOLD 5JJBA 4XDZA 2PUEA 1HC7A 3P9NA 2BP7B 2FPMA 2Q50A 1P2VA 3FFXA 3U7IA 1LLUA 1RAGA 2A9OA 1Q14A 2UZ1B 2Y6VA 3RKUA 1CJTC 4RXUA 1FZTA 3EPRA 4LXGA 4RD4A 4XUGB 3TINA 1NMZA 3VYTB 3QU7A 3P9CA 1E1QD 1IBCA 5DHAA 4N41A 3H1AA 3RM3A 4G0XA 3FUCA 2NN3C 1X7ZB 3KAJA 1Z2AA 5ERGB 1NBIA 1PF7E 4XDHA 1A5AB 2ZYAA 1VL5A 2YWGA 2IOYA 4UVGA 4B83A 4CV1A 3AIMA 4FZRA 3HBLA 4G5GA 1PR9A 1DNPA 2PSHA 3KC2A 1DWPA 3MQ2A 4UHDA 2DBYA 5CFRA 5C8YA 5BPFA 4IXDA 5ICFA 2JDID 1XQXA 2V6MA 4GXNA 4ZC1A 1T8UA 5J63A 2Z6UA 2C5FA 3GRPA 1HFKA 3KQUA 4JSTA 1W1UA 1L4GA 5EY5B 2CSXA 4YUWA 3NBXX 1NJ2A 3KFXA 1X80B 5T4HA 4RHEA 1MTZA 3HJAA 1XZHA 4A7PA 2HXYA 3N5CA 3T9BA 2GRJA 1RPAA 1ZKMA 4CCWA 1II0A 1F5NA 4HVLA 3BZWA 4ZXPA 5J1TB 1GAQA 3HB1A 4HPJB 3GCGA 4HNTA 2P4HX 5FDFA 1GAXA 2BEKA 5DLYA 1T4BA 3ZGYA 1QGZA 2WPNA 1W59A 3DOJA 2FB9A 2C0QA 1T5TA 1KI7A 1NF8A 1RLOA 3G0GA 1DBPA 1A9XB 3MLAA 2HA7A 2FSFA 4JWTA 4KRGA 5K3EA 4JP2A 2EX1A 4INPA 2P6RA 5DNUA 3AEUA 1M10A 2V7UA 3Q0TA 4NESA 4PCLA 3EXG2 4EYKA 1WBJB 5HF6A 1Z7GA 1Z6PA 2Q3FA 2QYOA 3WP0A 1UBKS 2ECKA 5EQFA 4E4TA 3LQKA 1M2WA 3ZCXA 2JJ1A 1HDGO 1GO2A 1S2OA 1TU3A 3L07A 3QEJA 2O2HA 3CLUD 4RZ3A 4WOCA 4NENA 5I5EA 3L82B 4CFYA 3KQWA 2CWWA 5FRDA 4EQZA 3IR6A 1P1FA 1LVHA 2VKQA 1QP4A 2V6FA 1DJPA 3EPPA 3QFRA 2GVDC 4WK0B 4C07A 5EUBA 2XGMA 2X8JA 2VYND 2WT9A 4U2DA 2QAGB 2WNHA 5COBA 1ZGJA 1FP4A 3I0MA 5AJUA 4BFLA 2A1TS 4EP1A 1EFRA 4HJRA 4A8JA 1NVVQ 2B83A 5JO0A 4QVGA 2CCGA 4FGJA 1DIHA 4N6GA 3UW1A 3KWFA 4BBPA 3G0OA 5JUWA 2JAWA 1M1ZA 3NWPA 4BB9A 2IY9A 1KOLA 4M83A 1CSEE 5CM8B 3R5FA 5HBRA 3UUFA 3BXOA 2FSVC 2BN4A 2X3UA 3TCXB 4D4KA 4MWGA 1ARZA 1V5FA 1L5SA 2UVDA 3JD3A 3RU3A 4HAOA 3TAXA 3KPJA 1KDRA 4PPQA 4DWJA 2QR2A 1WXIA 1ZICA 4MTLA 4JASB 5CVDA 3VHXA 4ALIA 3BL6A 1EU1A 5CXQA 3UB2A 1O6FA 3KKEA 4IINA 2HDOA 4O4IF 3WS7A 2QLBA 4Y67A 5F3WB 5HRUA 1SKBA 2Q29A 2FVYA 2R5FA 1Z7EA 2IZ7A 2I3GA 2VJAA 3FAKA 2ZTHA 3M6MD 3MT7A 3UYLA 3SVTA 3AFNA 1VMIA 2PMWB 2PWAA 1O97D 4CMIA 3H2SA 1BXGA 3INNA 5T64A 2CBZA 3IQGX 4QU9A 1EUCA 4URWR 1BRTA 3BBPA 3G68A 4I50B 1NF2A 3AUFA 4Z53A 1O94C 4KR7A 1FK8A 2D0PB 4KQKA 2KHZA 4R2LA 3N0VA 5EIFA 2HCRA 5HR5A 2H00A 4NAUA 2RI0A 4BIMA 1J7KA 5DK4A 5IF3A 5JQGA 1IBMB 2FUG1 2Q9UA 1I4EB 1UOQA 1CZRA 1ZEJA 1Y37A 4JLSA 5BN5A 2ZE7A 5LA6F 2QZJA 4MVXA 5JYCA 1VYTA 4UTPA 3CH4B 5EUCA 3ZY3A 4BLPA 2OR3A 4M7PA 3T5DA 1U5BA 4K87A 3I76A 4LHXA 4EI2A 4RJ2A 1N2XA 5IH3A 1EZZA 1U3WA 3BK2A 3HKDA 4DNPA 1P8JA 1QRDA 4XQGA 2Q0QA 3W8FA 2AH5A 2W6ZA 2XOKA 2CD9A 1NVEA 1RZRA 4U7GA 3FFAA 1GCIA 4Z2YA 1N0UA 2OLEA 1HK7A 1Z2EA 4NG5A 4HS9A 5BVGB 3L4JA 5EQJB 1SBCA 1PFWA 3DPSA 5LUBA 1EWYA 1IJEA 4B1FA 2X8LA 3MS4A 2ZYHA 3MBOA 2AN3A 4IDEA 5EIXA 3A31A 3K09A 3QQ5A 1AZWA 4H3VA 5G40A 3T5TA 4QOSA 4F8EA 4QDXA 1UM9B 4G5YA 3VR4D 4AO7A 3PIRA 1L4YA 1MHTA 5CLHA 3S8MA 4PLCA 5KC8A 1U63A 1H2HA 3SJUA 4OQDA 3Q1KA 4PBSA 2WWHA 2I2BA 4UQLA 2QP9X 1J21A 4GDMA 4PZYA 4B81A 1RBZA 1E0SA 1TF2A 3AVPA 5M3BA 3TPFA 5TQJA 3H75A 2QL9A 3DC2A 2QLFA 1DC5A 4ZO8A 4EKIA 2CXOA 3K0SA 4DM7A 4JC5A 4C7XA 2DLCX 4TGLA 5LQMA 4JD5A 2JIRA 5KDOA 2Y1GA 3GUZA 1A7AA 5CDGA 4JLVA 4DF3A 1J5PA 4II7A 1T9GR 5PNTA 3BJRA 4L7VA 3DA8A 3N2LA 1YBVA 3FOWA 4ZU3A 5CJJA 2J32A 1NXOA 2A5JA 4IQ0A 3LCUA 5J4YA 3RUEA 1GVNB 3BTVA 3C4JA 2CVZA 4FDTA 2M1XA 2SNIE 3MHTA 3ZBQA 3AGQA 1YJBA 1UUFA 2FRXA 4R1TA 5H68A 1HT1E 4J0IA 4BVBA 4CQMB 3DEJA 4EUNA 2CXXA 2EBWA 1CF4A 2W6QA 1PYGA 1Z6AA 3B1WA 3QVLA 2HMVA 3UM9A 4D6PA 3SI7A 2YHSA 2QN1A 1NATA 3UAVA 1HT3A 4E5VA 2Y92A 3PIDA 5CYOA 3WWOA 1QYWA 1CEEA 4BZQA 2OCAA 2I4TA 5B7QA 3SE0A 9ABPA 4LBWA 3U5ZB 1E2UA 1PGPA 1IOWA 1M8PA 1RHQA 4DDHA 3SYMA 1BYIA 3V2GA 4CT5A 4DB4A 1BGVA 1Q1ZA 4O0MA 5LZ8A 1PJBA 2DJ5A 2WABA 1GSIA 4YH1A 5SYNA 1UAYA 3HWRA 4ZEMA 1MPXA 2H2FA 3ZI7A 4ZZ3A 5KJ6A 1BX0A 3QVOA 4FSDA 1EVIA 3OPXA 5DW0A 1BCSA 5AOCA 4B9EA 5ILQA 2BTQB 3RK1A 1ZUIA 3FCEA 1KK1A 3T5GA 4CDMA 5JROA 3W5DA 3ROXA 5K8JB 3SCZA 4YXWD 2IPNA 1W46A 1AO3A 1E7MA 4PHTA 1LVUA 1LSJA 4LX8A 1KJQA 2OGZA 3GNTA 3HMKA 1TQ2A 4PS1A 1F1BA 2E49A 4AYXA 4BVHA 1TKAA 2BI8A 1SB8A 1WB6A 1THTA 1ISPA 2JFHA 3KLNA 5L3ZA 3K0CA 4MKHA 5CVCA 2WJVA 1TZ2A 4IDGA 4DUGD 4MS1B 1ZW1A 3WAGA 1Y7IA 3GRFA 3PEVA 3A6LA 2WOJA 1OU4A 4PX5A 3DE2X 1MAWA 4UU7A 2GA8A 3VZQA 3VDQA 1I0LA 1XDWA 4HZIA 4HWTA 3V3TA 4HCJA 4HV4A 4Y6PA 2HEGA 3M9WA 3TDMA 3ZK9A 3U7FB 3IBSA 4H7KA 3NP7A 4LBYA 4BVKA 1QCCA 3U2QA 2BH2A 3G3EA 3IJ5A 2OA0A 1RE1A 2OO3A 2PX0A 4RDHA 3RHZA 5BORA 2IS2A 1UBEA 2EWMA 3VA7A 2OC9A 4M0MA 3EY4A 4HI0E 3EXFB 1EGAA 2V8BA 2CBGA 3G8BA 3I2JA 2WYVA 4FI3F 4I6EA 1CUEA 1VKHA 2Q9CA 3EHEA 4JI8B 5HMMA 3SZGA 3COVA 1N8NA 4F6CA 3KHSA 1FFGA 4K6HA 1G5PA 1DOHA 1QLJA 3RS0A 5IYZA 4KPYA 3ZGOA 2FSGA 2GARA 2VF2A 3VKVA 4A91A 1RT9A 3P9SA 4BCDA 4C7BA 1ZI9A 3MINB 4OHYA 1JLSA 2QE6A 3PXEA 3BC1A 2GPBA 1EIWA 2FUG6 2JEZA 4MQUA 1RQRA 3WV5A 5MHTA 1G6OA 5ECGC 4ZAGA 1L5GB 4RADA 4MITA 4TXNA 1MMFB 1VRVA 4I4TB 4B0OA 4PO3X 2FN3A 3ITNA 5B1IA 5DMXA 2QLMA 3B52X 4ML3A 3EWNA 2CVOA 2ZIEA 4RVCA 1P8AA 4WKPA 4MWEA 5A1TA 1S4MA 1KVQA 3NBYC 1JG2A 4DR2B 1A1VA 3EFOB 4G24A 4R8VA 5K0NA 4C0LA 1X3LA 2ZPUA 5JHGB 3QPWA 5DISB 3CGWA 4GI5A 1ZPDA 2JFUA 2C98A 5JADA 3W9UA 4EPRA 1PU2A 4L0QA 1P2BA 1QG4A 4OFXA 3RQIA 4MAFA 2VCHA 2BHLA 3TUZC 2HK8A 4RD3A 5AI0A 1TJ4A 2HMUA 4NQZA 3E7PA 3PHIA 4B43A 4BEVA 2VOEA 5JE8A 3JD2A 4DIBA 1BDIA 1A5ZA 2WSYB 2O9JA 1JYEA 3LC7O 5KJEA 4ND2A 3ADCA 5FTNA 1THMA 2JEOA 4F5EA 3ANSA 2ZROA 3RLIA 2HGZA 2ERYA 2B4TO 3D4BA 1A9TA 2R66A 4XGRA 1EHYA 2AL7A 3U3OA 1V95A 2ES4A 2GUWA 2OV4A 3AY3A 3LBIA 2G8NA 2JARA 4EG3A 4YI5A 5JT1A 2EJTA 4AO6A 1DQZA 3DBOB 1KIFA 2D5LA 3HP4A 4MIOA 1SVUA 1O0BA 4FWIB 1Y3DE 2XYQA 1KO4A 1ZGZA 2LCFA 5E1BA 4OG2A 3WIOA 2C9BA 3UJCA 1U0RA 3WYAA 1HY3A 5ALLA 4PR0A 4CN8A 1PFUA 1PZFA 1WVIA 4JT8A 3UA3A 5JPIA 3QEKA 4HBZA 2GKOA 3BF8A 2R8EA 5IKMA 4XX0B 3TNDA 2RG7A 4CM6A 4UBOA 1OZHA 2QVXX 2R7MA 2HNKA 5TLSA 2P6NA 4Q18A 4PCVA 2WRZA 1J1IA 3F5MA 4ITUA 2PKCA 4RPJA 2RBKA 5HG0A 1K86A 1IVYA 2H11A 1JMVA 2I6TA 3RUAA 2B2CA 3MXOA 4LK2A 2I55A 2OPBA 3PRKE 1USGA 4HLDA 4L0MA 4Y2UA 1K63A 3ABIA 1YTLA 3DDWA 4FX5A 4BHTA 3NWOA 1QIDA 3GJ4A 3NX4A 4UHEA 1WBDA 4AK9A 3TDNA 5DYWA 1MLDA 3N8KA 3N76A 5JFTA 3QVVA 4YPFA 3VYSB 2QDXA 4KLCA 1XCGB 4KI7A 2J59A 3O91A 4IWYA 1GT6A 3HCEA 1PQYA 3J81A 3RU2A 2A0XA 4IDOA 2A3RA 3D8NA 1B8UA 3O38A 4N7JA 3L9XA 1I7DA 3PZBA 2PFKA 4QYMA 4W6ZA 5J58A 2BFEB 2VHQA 4EAQA 2XHZA 3IIEA 4ZT4A 5FUMA 4PQFA 2B4KA 1K8XB 5GJVC 1PK8A 1TL7C 1RC0A 2L82A 2BYTA 2C3UA 4U2CA 2BMDA 4XASA 1KKUA 1WQ4A 4H31A 1DEXA 2OBMA 4PZLA 1U94A 1DX6A 1LXCA 3IPXA 1C80A 1U1IA 2WAXA 4EI7A 3IUYA 4AKGA 2IYLD 4ECAA 3BICA 3VVCA 1BJTA 2F3QA 5H3CA 1CUUA 1Z2OX 3A0UA 4IYRA 2V7QD 1GRVA 2C84A 2GFIA 4X8HA 5KMGA 5EP4A 1CY6A 5YASA 1FY2A 5K1ZA 1XAIA 3GQVA 1I1NA 4G8BA 5K8UA 3DXZA 1MQ8B 5E4JA 4MV6A 1MGPA 2YRXA 3DB1A 5CTAA 1OBFO 1XUOA 2B8EA 2QRQA 5UKDA 1YQGA 1TXGA 5E2AA 5F77A 1SCNE 1T3TA 2PZJA 3WP1B 5EIEA 1BEUB 4BQOA 2CK3D 5FOQA 3ZWAA 3U3RA 5M5BA 1ZXXA 2G6BA 3VKGA 3OOYA 1W0KD 3LK7A 4OB7A 5L8VA 4YJ2F 3K0FA 1YL5A 2AJBA 2PZBA 5CB4A 4G4JA 1MKYA 1TPYA 4I55B 4N54A 2G7MC 3UK7A 1OOEA 3RFUA 1DXYA 1NYQA 2R5NA 1E77A 4GNKA 4KE7A 5H3HA 3TQRA 3JARB 5ALQA 3BIOA 3CH7A 2OCXA 3JR3A 2FUEA 3HHEA 4PZEA 3KVNA 5DCUA 4DPLA 3TNLA 2WWVD 1NJ6A 1RKBA 5LBUA 3BWMA 3QP9A 5CDHA 1HOXA 3F4KA 3MCTA 2YW2A 2BI7A 4ZJPA 1C0KA 1BA2A 3DDZX 4EYEA 5D1NA 1EWVA 1JDUA 3FUXA 5JALA 3A10A 1C3XA 2E4VA 2XODA 1Q22A 2RI6A 3LUDA 2W8BB 2VQDA 2YV5A 2PVCA 3STHA 1QHGA 2HCBA 3K0AA 1CUZA 1T3HA 5AKJA 3W2HA 4Z7OB 1BDJA 3RVPA 2AZXA 3VHLB 3QELA 1L5FA 2BBOA 2CZQA 2W2TA 3ITEA 4QAJA 5D3ZA 3OSUA 1W96A 2FFQA 1JBKA 4KYTA 4NHEA 3DMDA 3WLHA 1XRLA 1PT7A 5BNZA 4JXJA 4BE4A 4B6EA 2O2EA 2OT3B 2AN9A 3PDWA 4I4NA 1GXSB 3DFUA 1VKNA 3G2KA 4PC6A 1G1AA 1EGMB 3JPWA 2XUPA 3ZDAA 1UJ6A 2VRWA 1NNEA 3ZHZA 3AESA 3VR5H 1I51A 3CW2A 3T3HA 1FSPA 3LGXA 1EDDA 1TQHA 3DHEA 4KE9A 2RHTA 4QPJC 3RASA 3QE9Y 1OVMA 5KVQA 2DPHA 3FOEC 4M7WA 5AVRA 4K26A 2PSDA 3MWKA 1XEWY 1W30A 2M98A 2HYDA 3H1BA 2IEIA 3SE7A 2NU8A 3ZBTA 1KRXA 2IHBA 1Y8RA 1WSAA 5C34B 3L8HA 2XDYA 5DM1A 2BGJA 3A1DA 4ZYXA 4P4UA 3ZE8A 3ZZMA 2R68A 2CBXA 1L8OA 2RGUA 2VFAA 2BFCB 3G1WA 4PXYA 3WWEA 1F7UA 3RODA 4QXRA 4LJ8A 1YZHA 1ZJ4A 5DWDA 1G6Q1 3V2HA 1M75A 1N3YA 4X20B 3ROGA 3FTQA 1XRRA 4D9GA 1GQRA 4G86A 2C3OA 5JY1A 3OZEA 2XMCA 1F5SA 2P9BA 3K9NA 1P2UA 4EGJA 5A04A 5AHXA 4BO4A 1Z12A 3RJ5A 3MJRA 4R40A 5DWVA 2WYHA 1Z2CA 3E0XA 1A8IA 3DM9B 1AN0A 1J9EA 2C88A 4J0EA 4M9XA 4V0QA 1QGUA 3EHDA 4B6PA 4QLAA 3FOFC 3RRZA 4GWKA 4K9RA 2HMAA 2EBUA 3OLQA 5L95A 3EXG1 1UAAA 5KNDA 2PL3A 3P8ZA 5E8JA 4CEHA 3LFHA 4KPUB 3PFKA 2QT0A 2XZTA 5DBHX 2GEBA 2JJ2D 4HSEA 3UJHA 2YXBA 1ZGAA 2QM8A 5FH9A 5H4GA 2YFHA 4L72A 3RSSA 3O8LA 4Y0AA 3WKBA 1JJVA 2XEXA 4DUZB 1QHSA 3VNVA 4N3AA 4S2EA 3R8CA 3KVYA 4O8ZA 2B20A 4W7HA 4UAGA 1G9TA 1NUTA 2DR0A 4OK5A 2VJMA 3GP5A 1OI3A 1SC3A 4RA6B 1EFVB 4YAUA 2H9YA 3PEWA 1U2ZA 1Z0DA 1XAJA 2P40A 1P1HA 5KB3A 2PO7A 3ZDBA 4RKFA 1R3DA 2RAFA 1KPHA 5FYDA 1RCTE 1Z8DA 2X6QA 4LOIA 4GZ3A 4BRWA 4DT1B 3T9CA 5BWLA 5P21A 5LMCA 4RPCA 5IG2A 3WA7A 4DB2A 4LRWA 3OAAD 3AKZA 1FE8A 4BX0A 2BMVA 4JVOA 4WFKA 4HWSA 1CJMA 2QTAA 3WQRA 2V7BA 1M6VB 1PI3A 2DBVO 3HJTA 3TIVA 1BOOA 4UE2A 2F7SA 4LMBA 1UBSB 3MBIA 4EJ6A 1ORRA 3SR3A 5JXWA 1LSSA 5TF0A 1Y1PA 1VMDA 2JC3A 4MEBA 2VP9A 3IEMA 2Q8QA 4NFYA 1N6NA 4GRIA 3ZHVA 2V3VA 4EEKA 3DQQA 2OHVA 1ZNXA 2E37A 3KFLA 3SSOA 1YR1A 2IYTA 5IVIA 3ADPA 4RLSA 1NSTA 1KKMA 4RVGA 3T3PB 4DLWA 4BEBA 1P81A 2YHIA 3P19A 4PC2A 1PK9A 3H16A 2VYQA 2UYCA 5FF9A 2P4SA 4DC1A 2GYUA 2HZ7A 4G67A 2PU5A 3D8BA 1Z3IX 1WU7A 2GK4A 2H0QA 4IKEA 1Z2PX 3V8VA 1RI2A 4NI5A 1UJCA 1UC8A 2OSBA 5DM70 1BWSA 3N59A 4CM9D 5JDCA 4OQZA 5K0SA 1ZP6A 4QU0A 1KNXA 2GETA 4H1HA 4YCCA 3ZGLA 4J4BA 1ULZA 4N49A 1E7RA 1FBNA 4GXRA 2W2OA 3CLSC 1CQIA 4PY2A 3JU3A 4GGOA 4CTKA 3AKYA 1RM0A 3PFBA 4L9AA 3CZ4A 1ZHFA 1P2DA 2N42A 3PXDA 4IIGA 4HNHA 4WBNF 3M4JA 4ALMA 4S1PA 1RVDA 2V7VA 4KR6A 1NNSA 1BVYF 3BRWD 1HEIA 1FVHA 3D2CA 2E9SA 3OEED 4KMRA 3T0FA 5HWSA 4ZHQA 4L28A 1S2MA 5IUNC 1PX2A 3BB4A 3OU7A 5K0LA 5JBNA 3GIDA 4ZZ1A 4NYMQ 1C9DB 1MB3A 1E92A 2E6KA 4O5OA 4YP7A 2YN0A 4FX2A 2GT1A 4YROA 4H0FA 5EHXA 1BHO1 4CIDA 1NBEA 1A8SA 3I5UA 4XKJA 1RYEA 2AN5A 4DSNA 3SQMA 2AMFA 1KARA 3OCCA 4NNJA 1QHFA 2LKDA 5EJ6A 2IJGX 1QV7A 3LA8A 2UZ3A 4BCBA 5KYYB 5U4XA 5LSAA 2RHJA 1MX1A 3R7NA 5BSHA 1XV5A 1JE1A 1USWA 4KWCA 3EGEA 5AMXA 2X77A 4JL8A 2R6AA 1VSBA 1JEDA 2VXYA 1SKMA 3G6WA 2XKAA 4LDNA 4WZAE 2J5XA 4CLOA 4KAAA 1G59A 4MP6A 1G38A 1U02A 2CDAA 4GLFA 5ALUA 3PCTA 3KHUA 3OWXA 3RYCA 3QWHA 2BFBA 2PJDA 2W4MA 4X1IB 4PE5B 3GGPA 2PNJA 1OTYA 4MUNA 3MGGA 5F5NA 5FBKA 3R7WB 2OQRA 4BLSA 3UK6A 4RV5A 5DLQC 1RACA 4BFZA 2GN9A 5EINA 3OE7D 3ZPXA 5CURA 1AC5A 4TOIA 5TRTA 3NEPX 2J1LA 4RD6A 5FUXA 3WIDA 4WOKA 2VS1A 1P45A 2X5XA 4PLYA 5FI0B 3WGZA 1X7XB 1JQBA 4O4HB 1UC9A 2OENG 3M5DA 2ZAGA 3ORQA 4GOOD 1VLZA 2Z2ZA 4V0OA 3U7HB 4MWCA 2VSOA 1ZGBA 3V7UA 2IDJA 4A2CA 3LJKA 4GLLA 4UNRA 2YBDA 3IQDB 3X1JA 4JROA 3W9YA 3HDTA 5BUCA 3PJRA 2ZU0C 2JAPA 2BFDB 4HX2A 2ESRA 3UA4A 1MG0A 2P2GA 3L5KA 2I6SA 3UT5B 3QVTA 4GC9A 1L8XA 1OF1A 1SPXA 1CD5A 3BCHA 4M89A 1ZITA 2MYTA 3F90A 4NK4A 4IUYA 2W70A 2GN2A 4REMA 2QRVA 1Z25A 4L2IB 3I0NA 5CNMA 2CDCA 1F12A 1OC2A 1E2IA 1P9OA 1PLJA 1HRDA 2CVPA 2HIGA 1G17A 4TTJA 3COZA 4DIFA 3HSSA 4ZTBA 5B6PA 3OFVA 1FUKA 3KAPA 1B2LA 4DMGA 3NWJA 1GRCA 3U6KA 1CZOA 16PKA 1E98A 1PR2A 3R6WA 1VCIA 1EGQA 1GPNA 4IIUA 1Y0BA 4XD7A 5A4IS 1QRSA 3PDIA 4DMHA 1NURA 3JQAD 4C0XA 1YI8A 1P62B 4ZOLF 5LYYA 3LZCA 2IOFK 5MN4A 2V9PA 4IIBA 1IZ8A 1N6HA 1R37A 2VIIA 1TB4A 2G0TA 3L8GA 4MLZA 1E3MA 2P9HA 5JTUA 2AXNA 3B82A 4OSPA 3JWGA 3O73A 1NM5C 4CM3A 1CULC 3ABSB 4CMGA 1TT5A 1MAAA 1XVTA 4UM8B 5DX1A 3FGPA 1TD1A 2IYPA 4NBVA 1QOQB 3F5DA 1Z6YA 2ZVQX 2GM5A 5B7PA 4JBXA 3J7TA 3TTWA 1XVLA 3KZXA 3LQRA 1F4LA 5H70A 4BJHB 1ZBDA 2DKFA 4Q4HB 2ZUUA 1NXSA 1SQ6A 1NUAA 2ZTUA 5CCEA 4REQB 2IDZA 2BV3A 3EDOA 2JANA 4NCHA 3PC8C 4DRYA 3TSCA 3I6QA 4YI3A 1H23A 4FK8A 4X1KA 4MQ6A 4ZHSA 1YR9A 4UEQA 4IIJB 1LBQA 2UZIR 4JWKA 1JAZA 3TTSA 4EZBA 5CLFA 3D7RA 3QJGA 1CBUA 1LCIA 1O58A 3O75A 4L76A 4LHWA 3ZDDA 1ADFA 1JMKC 4RU1A 4FCVA 5M2QA 1D1TA 1ODLA 2ERXA 7GPBA 4AURA 3MJCA 5JAZA 4L1KA 1JZTA 4FE7A 1E8MA 2I1VB 3JYPA 3L7DA 5HGJA 5EP2A 1VKRA 1G4UR 4FZ5A 3QBJA 2AIRA 2NU7A 4OOEA 4V1CB 5E4FA 4ROSA 2PZMA 2IA5A 1QTIA 3AUAA 4L4UA 1H8EA 1YGYA 2GJKA 5SZJA 3HP1A 1DRVA 3VSDA 1RM4A 3ABZA 3AR9A 3FXAA 3GUCA 1XMSA 4OQFA 1M5RA 1D03A 1B1AA 1UMBA 2GESA 2GTHA 3OX3A 5JMTA 3DHVA 1NRXA 3FJ1A 3W3AA 4H1UA 4NZPA 3WDSA 3GVHA 3TJMA 2HF8A 4KFUA 3FHCB 3IAFA 3EDCA 2CMKA 2EWWA 4TUYA 2JL1A 1CNEA 2PEYA 3IXQA 3K71B 4EYSA 1T9KA 2F43B 4E88A 3ZHOA 2QLNA 3B51X 2GH1A 4TV8A 1B6RA 4E12A 1B7GO 4LQDA 1M0EA 5K3SA 4PAOA 5AP9A 3TX2A 3CUUA 2QZZA 1VL2A 3N2YA 1L1FA 1N33B 2HT1A 2H54A 1O2DA 4ER0A 4TVOA 5IJ0B 3AZQA 4GYJA 4C0BA 4MW1A 1EWTA 3OC0A 3IOYA 3OQNA 1VTKA 1GQFA 1ZNWA 4MUYA 3U62A 3C85A 1I5RA 4JAVC 4ETNA 1UT8A 2EARA 1IZ9A 1J42A 4PWYA 3PJFA 4H6VA 1FS4A 1S0UA 2FPIB 2RJNA 2WAYA 3IS3A 2FMUA 4NOKA 3SX2A 3TAHA 5ELMA 1LV7A 4W5QA 1FTWA 1MDFA 3IJPA 5EMHA 1J2YA 3MZ0A 4BFTA 3WWYA 4UTXA 2ZJ6A 4N3GA 2ACWA 2GX6A 3UAOA 2APJA 3RYCB 2V7TA 1X8JA 3A1WA 1QVRA 3OPMA 4GKAA 4JJFA 4BC1A 3D3QA 2Q5IA 2Z6AA 2J5KA 2D5BA 4W8HA 3ZIUA 2LD4A 4MSUA 1Q3KA 2D1FA 2EATA 2SKEA 3EIUA 4XLTA 4DY6A 1LTQA 2IOQA 1FLAA 2MSEB 4RMHA 1L3BA 2DPLA 3LMKA 4YRJA 1SVSA 3FOZA 3AHHA 4JYBA 3HUFA 4PC1A 1RABA 5JS7A 1EFHA 2MOKA 2QGNA 5FL7D 1I3OA 3DBHB 2PLFA 2ZJZA 2NTNA 3IIKA 1A7JA 2P2DA 3BA1A 1C4OA 3IYLW 5JZ9A 3D3NA 3L0YA 4H6PA 3TM4A 1Q0RA 1U2RA 4ZAZA 5J3JA 2C5GA 1Z4PX 5LP6A 2A0FA 3BGWA 3DT9A 2AMYA 4EMTA 5G0TA 1LNZA 4ENTA 1Q6ZA 5LZ5A 3IXLA 2X0JA 2QVLA 3VBCA 1ZD8A 3VPGA 2VPYA 4RC9A 2NPFA 4PYJA 4KIUA 1XEXB 5DPMA 2XWSA 4S0XA 3HDHA 4U4AA 3QV2A 1IAVA 5AHOA 1PGQA 3FG9A 4EVRA 1OTXA 2BDTA 1WD5A 4LWPA 1B16A 3OESA 3WFZA 2JEYA 3GFTA 1IIBA 2O06A 4WZ6A 4YBZA 3LKDA 4DQ0A 1QG0A 1NVTA 1RXIA 3COSA 2AXEA 3DMNA 1IY9A 2ZYSA 3RVMA 4MAAA 1PDWA 4HY3A 5C9ZA 2O8BB