5K8CA

X-ray structure of kdnb, 3-deoxy-alpha-d-manno-octulosonate 8-oxidase, from shewanella oneidensis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
358
structure length
358
Chain Sequence
GHMSFKNFKVVEKMIFGRGSFVQLDDVLAAQRKADDDFVVFLVDDVHQGKPLEARIPVKAQDLLIWVNVDEEPSTIQIDALTEQVQAFNGKLPVSVVGLGGGSTMDVAKAVSLMLTNPGGSAMYQGWDLIKKPAVHHIGIPTISGTGAEASRTAVLCGPVRKLGLNSDYTVFDQIIMDSELIDGVETDQWFYTGMDCYIHCVESLEGTFLNEFSKAYAEKAMDLCRQVYLEDHPEKDDKLMMASFMGGMSIAYSQVGACHAVSYGLSYILGYHHGIGNCIAFDVLEEFYPEGVAEFRLMMKKHNITLPKNICKDLPDETIAKMVAVTKSMGPLWANVYGPTWEEKVTDEMLTALFRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of KdnB and KdnA from Shewanella oneidensis: Key Enzymes in the Formation of 8-Amino-3,8-Dideoxy-d-Manno-Octulosonic Acid.
pubmed doi rcsb
source organism Shewanella oneidensis (strain mr-1)
molecule tags Transferase
molecule keywords 3-deoxy-alpha-D-manno-octulosonate 8-oxidase
total genus 134
structure length 358
sequence length 358
ec nomenclature ec 1.1.3.48: 3-deoxy-alpha-D-manno-octulosonate 8-oxidase.
pdb deposition date 2016-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00465 Fe-ADH Iron-containing alcohol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 5k8cA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k8cA01
3W5SA 1O2DA 1VHDA 1XAHA 5K8CA 1TA9A 3JZDA 3OKFA 4P53A 1SG6A 5BR4A 3OWOA 4RFLA 4FR2A 1NRXA 3IV7A 3ZOKA 2BI4A 3UHJA 4MCAA 4RGVA 1XAJA 1XAGA 5FB3A 1RRMA 1OJ7A 1UJNA 2D2XA 3BFJA 3QBEA 5HVNA 1NVDA 1NVBA 1JQAA 1DQSA 1XAIA 5EKSA 2GRUA 3HL0A 1XALA 3CE9A 4QGSA 1NUAA 1NVFA 1KQ3A 3CLHA 4RGQA 1JQ5A 1JPUA 3ZDRA 1NVEA 3QBDA 1NR5A 1NVAA 3RF7A 3OX4A 2BL4A 1VLJA
chains in the Genus database with same CATH superfamily
5DLYA 4H4EA 4R8KA 2BBTA 5CW1A 1U8ZA 1P6QA 4RDHA 2RJ3A 1IJEA 4HWTA 5SYAA 1E1QD 2GN0A 3UKJA 5EP1A 3H2ZA 3KPVA 5B2FA 3VVBA 4B4UA 2X76A 5KYXA 4D9GA 1IBLB 2B8JA 3CS3A 4WLFA 5C0OE 5CDYA 1LDNA 4F5ZA 1DELA 4HPXB 5FPQA 1DJOA 1VPEA 3A1WA 2PX2A 1K7XB 3HDVA 2JF0A 3VR4H 3LCMA 5DYNA 4F46A 1X0VA 1LSJA 1WTAA 1N2JA 2HI0A 2I6FA 5DP1A 2KI5A 1SG9A 4DPLA 4ER3A 5I7OA 1J0EA 4JB3A 1E7YA 1GUFA 2QE7D 2CHVA 2ST1A 3BF7A 3KU1A 4FILA 5B6IA 3A4LA 5ENZA 1CF2O 1KAHA 5BSVA 5DLQC 2C94A 4L22A 5TQ0A 4JB2A 1HM5A 4HBZA 1L4LA 1L1QA 2EFYA 3VNRA 1SCJA 5JIBA 2FK7A 3F74A 3NTLA 4QYXA 3SVTA 4LXTA 4QO8A 3NPAA 3T5GA 1ODFA 1ZUWA 5FL7D 3HN2A 3ESQA 5ADWA 4NS4A 3L7YA 4RA6B 1F20A 3GT4A 2H2IA 2AC2A 4IDHA 1EWQA 3RSOA 2K7FA 1CJSA 3ISJA 5CDFE 4OHPA 4RSHA 1DAIA 4MW5A 4XR4A 4HZGA 1G2OA 1UBGA 2P69A 2Q9AA 3GK3A 3OO1A 5CXSA 3BDIA 3FKJA 2XF8A 1TUBB 3FRJA 1VDMA 2XA2A 3RIHA 2QP3A 3LXXA 4IWXA 4Q9LA 4BJ6A 3V46A 4C3OB 4YP7A 1NLZA 5FHQA 3F1LA 2XE7A 2QG4A 5IC5A 1GN9A 5AIBA 3EARA 3KXLA 4WMLA 4D4KA 1YR3A 1FS5A 1GFWA 2Y68A 2D7JA 1NUUA 3L49A 2FSVA 1RTTA 2R7AA 2IHYA 2GPAA 2O2ZA 3MB8A 1FS6A 4K9LA 1JAZA 2H8GA 1XVAA 1Q0QA 3HBJA 1RZUA 3P9XA 4XH9B 5JG7A 3SICE 3HUEA 4ZJUA 1E2MA 1P8JA 5LKRA 1BQ4A 3U7IA 2O5VA 1Z7WA 3IOEA 2LUOA 5G02A 1JPUA 4ALJA 4UM5A 2O6HA 3G1WA 1F4VA 1XTUA 1N2SA 1PKEA 2O8BB 4FYXA 2XMCA 1ONBA 3GJ7A 1G63A 1R0LA 4CQLA 3SJAA 2ON6A 3OE5A 2DBYA 2FPXA 3FBGA 4S0ZA 4WESB 4DSOA 1XZEA 4Z1MD 5LA6F 5AW5A 1WTCA 3NPMA 1X8KA 3LWNA 2CNBA 4JDUA 4NPAA 3B9QA 4XFDA 4G5SA 4I14A 3HCAA 1PD0A 4DANA 2O8EB 1K89A 2WOJA 4MGZR 2L17A 4WSOA 3TFWA 2WZQA 5CB8A 1KPIA 1NT4A 1HNXB 4PAWA 4YGYA 2FWBA 4EHDA 3IIEA 4LYDA 4EG7A 3HYLA 4MGIR 4OAPA 4P38A 4QUGA 4WBNA 1R8YA 4OXYA 4BGIA 5JNTA 2JGLA 4U3JB 3P71T 2FPIA 3A28A 1J2RA 3ZKAA 4IY1A 1WKCA 1XPJA 3LLVA 2ILVA 2FF7A 4J75A 3LUPA 4O4HB 3KBOA 4YMWA 2C9CA 1ULAA 4MHOA 5FI0B 5EHIA 1TO6A 3FZYA 4OHUA 3WLRA 3GAMA 1SIOA 2R6AA 4L72A 3OTHA 4ER6A 4TS3A 2OR3A 3RSSA 1ND5A 2PLAA 4RFVA 3VR5H 2HCRA 4B6QA 3VTKA 1ULZA 4B80A 1RI1A 3ZS8A 1TCCA 2ZRGA 5FJIA 1GCOA 1G5IA 2ZI9A 2QX8A 3SSMA 2PV0A 4C6TB 4F8YA 2NP7A 1HY3A 4LDNA 3GJ0A 1E2NA 2PR2A 3KLMX 1BFKA 3PZRA 3EFOA 3PPXA 4LJ5A 3RU3A 3X0DA 3ZV6A 5J4KA 4DV5B 3DFUA 1V5EA 3WV4A 4HMOA 1EGQA 3ZX5A 3R77A 3OCVA 4ENWA 2DRIA 2Q6IA 4LDQA 4PICA 4F6RB 1LDEA 2VVTA 3OU2A 2XE4A 3EPKA 2O8NA 5CX1A 2CXQA 1Q14A 1RJ9B 4EB8A 4XWAA 3LTEA 3JZDA 5AM1A 4B3FX 1OU4A 4YQEA 4FD3A 3NDPA 4OPMA 3OCWA 4NESA 3LGAA 2VDMB 1H2ZA 4F0JA 3R7WA 4MQUA 1KPGA 4CGZA 2C2OA 3TNFA 4DBLC 5LZ2A 3P0HA 2RGAA 2KB0A 1BEEA 1UZLA 1B41A 1K7CA 1NBWB 4DTCA 1VJRA 2KLHA 3V1TC 3CF0A 1BVYF 4I55B 4U7TB 4RL6A 5ITZB 4ZVKA 4A0FA 3GHYA 3ABQB 4O08A 5K99A 1THTA 1LDMA 4PPGA 1HLGA 4LMBA 4BO0A 2A9VA 3N2LA 4BLUA 2FTKE 5FAKA 2Q2WA 3WXMA 3AVWA 1TYDE 1V48A 1WD7A 1L7EA 2FLWA 2GN2A 1PBTA 2YL2A 3G13A 4NF2A 4R2IA 3ZQ6A 4ZAXA 5DGCA 1U2RA 2QLTA 5DI3B 1GPBA 2A9QA 2RK4A 4Y18A 3RVKA 1LPNA 3O93A 1FRVA 1A71A 1LBQA 1GFSA 3HADA 3ZHQA 1YVPA 1QDUA 4JT8A 2CWWA 2W93A 4IQ8A 4EQ6A 1E2JA 1E5QA 3EC2A 1D2AA 3TSAA 2DAPA 1C2TA 4MV5A 2NZWA 3SQXA 4QTZA 3VXKA 3SN6A 3O2SB 2BTEA 3C39A 5H7XA 5GQSA 1Y34E 2D2VA 1ZN8A 2G77B 2QMUA 4IIDA 4RUKA 3P2YA 5TPWB 5TRTA 2OCIA 1OVGA 1RIIA 1CUEA 1Y7HA 4KDRA 1V26A 4Q02A 4G41A 2OHHA 2OESA 1ISPA 4ZKEA 2VNSA 5GIPE 1NZJA 3HSYA 2JC3A 4RZQA 1J0XO 3TDKA 2IXTA 5U4XA 3ETLA 4CLOA 2XXAA 4G5GA 2G1JA 2YWFA 4DEYA 1PNOA 1MC5A 1TJ5A 4GEGA 2CJFA 1JDTA 4D74A 4M8NE 4IILA 1DBRA 1F2DA 2AL7A 1ESZA 2R6R1 4MR9A 2QJRA 4UREA 3RKSA 4FCWA 1K7YA 2Y99A 3PTLA 2FFBA 2VJLA 1X1AA 3NTUA 5LVAA 2BDUA 2B1JA 5JO0A 3VTFA 1H3NA 1ZBQA 3STXA 3NWJA 1J9GA 2VDNB 3UWDA 5GZ3A 4PLYA 1VXOA 2P27A 1U2ZA 4MJ3A 3ZJVA 2CJYA 3AI7A 1JX6A 1OI2A 1ZUNA 4PYMA 2HR1A 1EP2B 1R0YA 5TS3A 5J2UA 4J0KA 1JHAA 1I0IA 4RCVA 2YJ4A 3QBVA 3IPCA 3P9IA 2IIVA 2Y92A 3WE7A 4C04A 1KZHA 4QUHA 2OXCA 1H0RA 3WNZA 1Z16A 3G85A 4P54A 4XR9A 4Q5IA 4A8JC 2QD5A 3O38A 2BHNA 4J4HA 3JPWA 4L4ZA 1K0FA 1ISJA 2XYRA 3D8SA 4LISA 5LB4A 4FYKA 4GH5A 4CCAA 5AQ1A 1RZ3A 2J3EA 5CB4A 5I7UA 3JQ9A 3JWJA 3KZXA 3ZHSA 2UUCB 2UZ1A 1OI3A 1BN6A 3VR1A 3ZCPA 4IMPA 4FYMA 4BLWA 4B7AA 5EG5A 2L2QA 4G6ZA 1KDPA 3ZNOA 5J4VA 4OXKA 1NW5A 2AA3A 3NV7A 4LGCA 2CVQA 4L28A 4XX0A 1I80A 3M3HA 3QVJA 5I9IA 1M34A 1YU6A 1I32A 2H7CA 3PXEA 4II2A 4YRMA 1IJBA 3WTCA 2C83A 3GLRA 4Q39A 1FDTA 4MDHA 3TX2A 4EMTA 5F23A 3FIUA 3L7MA 4BAUA 2FUCA 5IPFA 1ZUNB 2Q5CA 2Z83A 1U1GA 3DF9A 3OT1A 3QWIA 4K3UA 4S3MA 2QYSA 1KJZA 4HX5A 4TLAA 4AX8A 5C51B 1FA9A 3CT6A 4F60A 2ANCA 4B44A 1MHTA 4G0NA 4IFTA 1TC1A 3B1KA 3UOGA 2QRLA 4YUWA 4ZC8A 2QRHA 1TU0A 3A26A 1BWRA 5CFOA 1EI9A 2VO1A 4X7PA 1W76A 1DT5A 4XM0A 4K6OA 2OFFA 1EXMA 3JTMA 4C43A 4U2GA 1F8FA 1T1JA 2Q1YA 2LD4A 4YJ2B 1THMA 5AKIA 2IYXA 3S1AB 3DKVA 3U62A 4DADA 1QX4A 4EITA 4KE6A 1KO8A 4S2EA 3UHAA 3UJAA 1Z6AA 3FOAA 3TIIA 3CVXA 1L5HB 1G0NA 2HFJA 4EFMA 1G64A 2Q5IA 5LQDA 4OLAA 3B82A 2BR5A 1GAQA 3ASYA 3WL3A 1CRPA 1E99A 1XDBA 2NT4A 3KJIA 4ZAVA 1ZOIA 2IYQA 4IINA 3OEED 4MR9B 4XW2A 6AT1A 5K6AA 1FU7A 1RZRD 5JNWA 4A2WA 1PIWA 1KEKA 1ZVVA 3VI4B 1K4KA 4FHFA 4P4SA 4B75A 3FGPA 2DHEA 3O92A 2L0XA 3FCXA 3M6LA 4N12A 4MI1A 3KHSA 4UM9B 4L0QA 4XLZA 2WSLA 4LF5B 4AIIA 1GKYA 1JLHA 2P1DA 2ZIAA 3DEZA 3RG2A 4AJLA 4N65A 4BNZA 2XQGA 1AGXA 3OIUA 3FLEA 4ACBA 2F1IA 1E2UA 2RIRA 3TINA 3ZWOA 1DXHA 1KR2A 3OFJA 1E4YA 2JIZA 1WHTA 2YH2A 2JIPA 5JAUA 3C24A 4O2AB 1QHFA 3IERA 2CHEA 1ZNXA 5CYPA 1IG3A 5DPMA 1VB5A 1GKLA 3PTZA 4C0QC 821PA 1PL6A 1U0GA 1UWKA 1ZA1A 5IJAA 3RVMA 4GI1A 4YAKA 5B3LA 2HW8A 2WHPB 2JIMA 2ADOA 2VBFA 5GM1A 1KJWA 2BY4A 5DTIA 5A1TA 1EMDA 2Q6KA 2QPTA 2QXUA 1XHEA 2ZYGA 2J46A 4AYWA 5KO2A 3LZCA 4PIPA 1Z4NA 4R1PA 2CXSA 4DR2B 4K1LA 3JAKB 2J3KA 3ESRA 3MS2A 4PQRA 1UJMA 1XDUA 3W5CA 1A9SA 1C2YA 1E9EA 5LLDA 3O4HA 1U2PA 1N32B 4Y6SA 5HQ3A 2NV0A 4FFDA 4OFBA 1V7ZA 1UFRA 2C5BA 4MI6A 4LY6A 3WHIA 1SXIA 4BLTA 1B0ZA 2I6QA 3N8DA 3NTVA 4I9FA 4MPJA 3FW1A 1KEUA 3JTEA 3PV0A 2A1UA 2W90A 3G0DA 2E7ZA 2PKXA 3HKDA 1XN1A 1KAMA 5D6NA 1NBME 3FE2A 1KMQA 1KYVA 4EI7A 4NXNB 4YTEA 4RU1A 2FN8A 3S68A 1WDKA 1T1EA 4L51A 3L1UA 3G2QA 3OICA 3B6JA 3DBLA 3ANLA 5EQFA 4BY9E 3JQFC 4C4XA 4CQNA 4URHA 2WICA 1XRJA 1O9BA 5IARA 4C7OB 3SXUA 5IH3A 3JU3A 4Q4AA 4ZT5A 4P36A 2NZUG 3RYFA 3H3XA 1NBHA 1USWA 3EMVA 3VR2A 3T3MB 1M6WA 4F5EA 5HFAA 2B1QA 1ZP6A 2ODEA 3GVPA 5LZ4A 2HH9A 1FMFA 4A10A 5TQ2A 1RWWA 4WZAB 1R5NA 5KOHA 2XDAA 4W1QA 1L4NA 4YV7A 1JIJA 3O4JA 1BRMA 4K7JA 2NXCA 3UBTA 3PFCA 1P62B 2GAIA 2DVMA 3LOPA 2XCTB 2ZOSA 3QKIA 4RTMA 2DOKA 4HDKA 2ZQ5A 2BEUB 4EH1A 2QL9A 2OAGA 3ANYB 1I7DA 2PL5A 4ECEA 2PZFA 5DN6D 5IASA 4UUPA 4HQNA 3U49A 2OO5A 1JKXA 1UK9A 2BR4A 3LT0A 2I2CA 4UTNA 4BJ5A 1EFVA 2HAEA 3RU2A 4HH4A 2AYZA 1N75A 5BN4B 1RJDA 5ICEA 3BHMA 3WGKA 3BVPA 1KARA 3D3WB 2P6RA 3IP5A 3C6YA 3DB2A 2YZNA 3PQFA 3K0CA 3ROPA 1SVLA 4YJ2F 1NOJA 3IQZA 3CBQA 4D8TA 1TCVA 5IFKA 4KGZA 1UDRA 3OOWA 3W77A 1IWBB 1PLLA 2L82A 3CBGA 2JFFA 4QDTA 3VAAA 3K5WA 4KNWA 1PJCA 2PNJA 4AL4A 4AMYA 2DFLA 4NNJA 3U7HB 4ESEA 5J5AA 1VSBA 3W5UA 3LZ6A 1G291 3GELA 1NUQA 4CGYA 5EGNA 2ZSKA 2KM1A 4UZFA 4YAWA 1GAXA 4NZNA 4R1LA 1DCTA 4E4RA 3MWJA 3PXAA 3PQ2A 2RHTA 5INTA 1TCUA 1XZHA 2PO7A 1N5KA 3HY3A 4KLZA 4KRFA 1W52X 1P1BA 4RVUA 5KYWB 3IMGA 4K26A 2VTBA 1GVNB 1T4MA 2J9FA 3C3AA 3I9V6 4DCUA 5JSHA 5GOZA 4IF6A 1M5TA 4L73A 2O50A 5EA2A 4GU5A 2WG2A 3VPGA 1ORRA 1AUQA 1XRRA 1A77A 2ZR7A 3LC2O 4QQNA 5DOVA 3TM5A 3SY8A 4AUEA 4DSUA 1MRNA 1NV9A 4DEVA 2PQ6A 1RXEA 3O73A 4UD2A 3PTAA 1M33A 3DZDA 3TRDA 3R8CA 4Z4FA 5PNTA 3ILSA 3L07A 1MFPA 3TRFA 3E70C 5BV2P 3UMMA 4NTZA 1MMFB 4LSMA 4D9IA 3G68A 4ZC1A 2Q6VA 3OU7A 2QTMA 3PQ6A 4PNHA 3VV2A 3L7BA 2V7BA 1RXCA 5EIWA 1W94A 3DE4X 2AZMA 1ECCA 1XQ9A 1T43A 2FFQA 1V0JA 3O4IA 4AS2A 3NBZC 1JIQA 1LK0A 2O7NA 2R8EA 2Y9MB 4JBIA 4CM9D 2TMYA 4L5JA 1HDOA 1DIGA 2A8YA 2ZJ1A 2UYCA 3EZFA 4EF5A 1ZR4A 1U7XA 2REXB 2XQVA 4HDQB 3RADC 1HEUA 1JIUA 5HJ7A 2ZSIA 4OQXA 4C78A 3JQPA 3QBEA 2A5LA 4AJEA 4ITRC 1LU9A 5JZMA 1EFRA 3LLSA 4YO8A 2Z3WA 1G9TA 2ZTUA 3P27A 4LV8B 2W8ZA 3RTGA 1SXQA 1DAMA 2HMVA 1QP4A 1PE0A 2AXNA 3FYUA 1KMIY 3LVQE 2BL4A 3ICCA 4KQJA 2D00A 3WAJA 2WJZB 4BGVA 1C7RA 5IC6A 4D6PA 4GQAA 5J1SB 1XYGA 4H6PA 1T6YA 3E1GA 3OWOA 3BMOA 3GRKA 4CQMB 3HK2A 2QXTA 1N1GA 5D5QA 1BD4A 4XFJA 4IRXA 4WK6A 2NVWA 1JFFA 4FZRA 1I01A 3URMA 3WYNA 4BX0A 4AUKA 2WDZA 3K9LA 4AG5A 2GK3A 4IICA 2JAXA 2H18A 3CF2A 5DTEA 3K0AB 1Y8RA 5AK5A 2GKGA 4LQ4A 4MS1A 3SK0A 1CIVA 5IKOA 2G06A 4KWTA 3AI2A 4QEKA 3X1XA 4DUPA 3PEEA 2Y27A 4HRAA 1E5TA 4W7IA 1GQSA 1O97D 3PX2A 4YP6A 3IGFA 4CLEA 1SZPA 3WB0A 1WO8A 1AS2A 4LWQA 2O2GA 4LF7B 5F3WB 3MIZA 3P94A 4K87A 1JDBB 2N9UA 3RO7A 3ER8A 1LLUA 4CKEA 4ZT6A 2FMTA 5CVCA 1AA9A 1LW7A 1YXMA 3LPAA 4MRRA 4JFRA 3RODA 2UXDB 2Q0SA 4XVQA 3KOWA 4RWEA 4HSEA 4ZMBA 1E2QA 1GSOA 1ZRSA 4MQLA 4TKMA 3E7PA 3AIKA 3S27A 1YI0A 1ZD2P 2OV8A 4CKBB 5BT8A 4AKTA 5J23A 3GA0A 4A3SA 4JITA 1HR0B 4URVR 2G88A 4B6RA 3VNBA 5K3OA 1GTG1 1APBA 4AXXA 5G53C 5NULA 4I50F 3CH4B 4DNOA 5EPUA 4ZGWA 5JD6A 4Q3EA 1H2HA 1JT9A 1O1YA 1QS0B 2A9PA 4JB8A 4DV0B 1S89A 1T25A 1B6TA 1YCFA 2ZCUA 2FHPA 3ONFA 5BWCA 1Q95A 1LK5A 2Q9BA 1S9HA 4ZDWA 3D4NA 1G3MA 2UUAB 1GG5A 4LXQA 5EEGA 1FYWA 5M04A 3RK1A 3ZDDA 4CT0A 2ID9A 1VI2A 4I4NA 1KYWA 3MWDB 4K1XA 1E8DA 5BVHB 1ODTC 5KTKA 1NASA 2I6SA 1G6Q1 2BRUA 3QVSA 5FBWB 1X7GA 5LC1A 3FMPB 4GT1A 5BYKA 1FJHA 3RBZA 1TK3A 2IXAA 1I1QB 4NCXA 2EU8A 4Z7OB 2CGEA 2Q5FA 3HU3A 3AUFA 3B60A 1YB4A 3KE9A 4LSZA 4M46A 5A3QA 1JGTA 3UWKA 3F3SA 2BHLA 1RKBA 4YAJA 4Z9FA 2PMWB 3TQFA 4GL4A 3LDUA 5IJZA 1OLSA 1PX2A 3E3OA 1KSHA 3WRYC 2C82A 4ESHA 3ADCA 5F12A 5IXYA 3K70B 4DR6B 1QIEA 5C8VA 5TPZA 4B76A 4BNHA 2OEPA 3C8ZA 4TQUS 5DHPA 2HK9A 3AUAA 3BTSA 1QP8A 1ZS9A 2E55A 2G0NA 3LIIA 3NHMA 3K4QA 3OZGA 5CUQA 3MS7A 1XK6A 2WA2A 1G3QA 3H5RA 2ZIGA 1B14A 4GDMA 4JYAB 3JD0A 4TT3A 1KI9A 2Q5HA 1YH3A 2OBBA 3EWSA 3R0QA 1XCGB 4HUJA 2G9RA 4IXNA 4JKYA 4M0PA 4AZTA 3AXSA 4Q82A 4D8WA 2WWRA 1CUBA 1ZD1A 1HYHA 2GCPA 2GEKA 2PCLA 3GEPA 6CHYA 2WNSA 3I39X 4PCVA 4Q1EA 3KEGA 1KFEB 4P4LA 1QKKA 5U1PA 3C6KA 2RAFA 4KYTA 1KYQA 1EQ2A 1MX3A 3M9WA 3T15A 1ZMBA 3H1TA 3JAWA 3M6XA 3Q7SA 2B21A 2Z2YA 1V16B 1ZM7A 2ZYAA 3QE0A 4GBGA 2WT8A 4JU9A 4L5IA 4L6AA 3IVXA 2DHDA 4GUAA 3W2IA 1JALA 2Q6OA 2XMGA 2QAJA 3G8YA 1X1TA 3EK2A 4UNSA 3SLKA 1Z5PA 1SKBA 1Y7LA 3LUAA 5CA0F 5LU8A 3K0FB 4EAQA 3BH6A 4LJYA 4XUDA 5EKUA 5TMBA 4NU5A 3OQBA 5JZSA 1WRBA 3HJTA 1BG6A 1AQJA 3LDAA 4URWR 1WHSB 4NL4H 3S1SA 3G9XA 5IAOA 3OEHD 2XUGA 3FFBA 3ZLUA 3ASVA 3RVLA 3RSLA 1E64A 4KDCA 1W1IA 1L5KA 1KJ9A 1CY1A 3FAKA 4FUTA 2CCGA 3CRMA 3DKRA 4G0OA 3NAQA 2AVNA 1WIWA 1UM8A 3VYTB 4FI3C 3PNSA 4DJFC 1Z2AA 4MYTA 4A0QA 1E6CA 1JFRA 1S5PA 5I9SA 1XZGA 2EQAA 3GL9A 2SKCA 2GJ4A 2I4MA 1K6IA 4QGFA 2ZAOA 4F4FA 1FJ2A 3VBEA 2AQKA 3AR7A 4JWTA 5JEDA 2ZSBA 1R5OA 1AY0A 3MW8A 3PR2B 4Q7JB 2ZUEA 1MG0A 2X7HA 5BQXA 4L9RA 3FHOA 2PAAA 3KQTA 5GONB 4OL9A 2EBFX 1YQTA 3KYCB 3M6VA 4XVHA 4B71A 1VHWA 2BGKA 2WSBA 4BU1A 4N6GA 1QMPA 3OURA 3BMCB 4FE7A 1RWQA 4KQFA 3LM8A 3BKWA 4NENB 4PN7A 5JSFA 5KX5A 1L6RA 2IQIA 1SA0B 2MR6A 2YNMD 3AJAA 4FU0A 4WOBA 1ZVQA 4EG6A 1W93A 4DMMA 5PGMA 3L7CA 1SKAA 2EBWA 4LRYA 1OAKA 5DHSA 2FUEA 3U7QB 3U17A 4CNQA 4TZ6A 5HFJA 1JJIA 1GZDA 2B4KA 3BN3A 4HNAA 5EWLB 3EQ9A 2FZ5A 1NU6A 2GHRA 3D5TA 4J1QA 5B5SA 4KDEA 4WECA 4R7ZA 1VJTA 2PIDA 3AFIA 1TM4E 5T4EA 2XV1A 3SEAA 3WDLA 5IJ9A 2R60A 4MA0A 2QUJA 3KV1A 5F7JA 4JROA 1EJ6A 3IYLW 3OQIB 1DNPA 2CMFA 3QVGB 1E0AA 4WFIA 3WLMA 4W5JA 4D3FA 5B3AA 4ZICA 3BGDA 3HV2A 2JGAA 1IXKA 2XZPA 2JDID 4UFOA 3SBEA 3EXFA 3TBKA 3I01A 3LL4A 1U8TA 4BFVA 3QJGA 3DB1A 4FN4A 4CEJA 1GO2A 1U94A 2GERA 1Y5RA 3NONA 1H1DA 2ZWVA 5BWMA 3ZWBA 1USVA 2QM7A 2GM5A 3OZBA 1VYVA 3L0IB 4ZU6X 2RHWA 3JD4A 1QTQA 3IAEA 1NAHA 3ED1A 3O3MB 3ITNA 5AI0A 5DSTA 2GBLA 4DCTA 1EK2A 2HO4A 2DHCA 2ZJZA 3NGXA 3ZWPA 5K4AA 2FVXA 1Q1BA 2V54A 3IT0A 1A9ZA 3UK2A 3VOSA 3WYBA 3M33A 3PQ4A 3WYCA 2PLWA 2FLKA 4UU7A 1W4CA 2GD0A 1V2HE 2XH8A 1NNUA 2HKIA 3B51X 4U7WA 1P5FA 4N3NA 3KQPA 4M9UA 3I2GA 4TWIA 3T5BA 3LD9A 1R0ZA 2FI1A 1ISMA 5EXTA 4LWOA 8LDHA 1BMDA 3E22B 3RLIA 1OFGA 4Q9HA 5C8YA 1NW3A 3SC6A 2ZJYA 2AHOA 2G9UA 1HDRA 1DQRA 3L9XA 1C3OB 2RGUA 5CVUA 3TOSA 5KYTA 4MAFA 2EATA 1ODLA 4CODB 1VKRA 3GLHE 3SJ7A 4AJIA 4DDUA 2ZWPA 4W4TA 2FPGB 1G7TA 4EMUA 1B74A 2K2WA 2YHUA 3LWBA 1MC4A 4KP7A 4OGGA 1HL7A 4QJ4A 5AKKA 4AMGA 4B35A 4D4LA 4QECA 2MSLA 3KKZA 4Q05A 2BPOA 1QVAA 1WXGA 2WWWA 2Z1MA 3DWEX 4QFMA 4FGSA 4NCNA 4B17A 1LQTA 1UEIA 4RJIA 4BEWA 3UMYA 2XD4A 1DHRA 1RKVA 1E1RA 3D4IA 4GKVA 2R68A 1DCMA 4FMPA 3HZRA 5AI4A 4MIEA 2PX4A 4ZVVA 4CR7A 2GEBA 3RFXA 2Y66A 4RKYA 4EHIA 5IXJA 1P77A 3T6KA 3W8EA 5AM2A 2ONCA 2PPLA 2XNDA 1HLDA 4MUMA 4CHTA 1QH0A 3ORRA 1D0SA 2O06A 4GPAA 2QW1A 4WINA 1CLUA 5KAPA 1I24A 3FWZA 1JH8A 2B82A 4XDHA 3FTPA 2PE5A 4CUZA 3IVMA 2IGBA 3OA2A 1ZN7A 2FY8A 1EHIA 4AG3A 2J08A 1N3BA 1MLDA 1QC5B 2F9FA 4CT5A 1EXNA 3LKBA 4TWRA 5BW6B 3F8WA 5ALDA 4CIBA 3DDCA 3NRCA 1D9ZA 3V8MA 2PH7A 3HPQA 4M49A 5D3MB 3D4PA 4QLBA 4FDLA 3SQOA 4PQFA 3SF8B 4RKWA 1KK1A 4C3ZA 4CEHB 5A62A 2PEYA 4GDFA 3U3OA 3B9PA 3R5FA 1JEDA 4WH0A 1UKAA 1X92A 3DTVA 3IAM6 4DNPA 2FWMX 1UFOA 4YAIA 3U4DA 3CT4A 3T9EA 4IGEA 1RYDA 3W7VA 4PQGA 2IPOA 3CKKA 3RABA 4E6EA 1E0JA 2JLSA 2JI9A 1J1UA 4HF7A 5IKEA 2VXCA 2WJIA 4URFA 4TOIA 5C34B 4B43A 4KOEC 3AR2A 1UUFA 1OWMA 4DARA 5KMGB 4L50A 4OIFA 1JG1A 4R2LA 3TGLA 2C58A 2WMNB 4EHFA 5IT9A 2EG9A 2MJLA 2NTNA 3M4NA 1L5HA 3T7AA 2O3TA 3ZU6A 5HKKA 3SZLA 4ICIA 3NVAA 3ZK8A 3JYNA 2CFRA 1AUPA 2VZLA 2XGGA 3SYMA 5A4JA 3FPAA 4M54A 2OAQ1 2ALJA 1BE8A 2YVQA 4GNRA 3RTCA 2EDAA 4Z8YA 5LD2C 4N54A 4CMAA 2JIOA 3B3JA 4RQAA 2ZSFA 4MVXA 2KWIA 2G63A 1FLAA 1PR4A 1XZCA 2HA7A 4RWZA 2JI4A 4TN5A 2IXBA 3RFVA 3RIXA 4UMDA 4EJMA 4EYEA 5F7ZA 4FZJA 1SK9A 4LRSB 1IU9A 1RYNA 4DAEA 5KMGA 2C4HA 5AKEA 3RRYA 3FTQA 5IABA 2A7XA 1XLTC 1B0PA 1P73A 2XNDD 4PHFA 1IAVA 3D43A 1OXTA 4KXQA 4LYFA 2WT9A 3VYSB 5CNMA 4EAAA 4UHBA 3OH8A 2DETA 1YBFA 4L5YA 3COJA 1D9XA 1E5VA 3C3DA 4ZANA 3WJ1A 3WKEA 1V41E 3DV2A 2Q0QA 1Z28A 5MN6A 2CT8A 1Z63A 4K9RA 4NICA 4LHSA 3PC7A 5BW8A 4BVKA 3SBOA 3ZY2A 1G8HA 1WCWA 2RFLA 5CTAA 3NJ4A 4B5KA 3P0IA 2K6GA 5EJMA 1KMMA 1DWQA 4FXPA 3CLTC 1N2CA 4EKDA 4HWSA 2P91A 4GICA 1QF7A 3G0GA 3M70A 4ZHQB 5IANA 4JVLA 3DNFA 2O54A 1UJ4A 5BXYA 4O33A 2RJNA 2E4XA 3C1TA 4UHJA 2DGDA 2CDRA 2Q45A 3PWZA 5JLAA 3EEIA 5JFOA 3H3FA 1GN8A 2YWXA 2DTXA 3KKNA 3TR5A 4OYLA 2FKNA 1XZJA 1PTJC 3SGLA 4H1UA 3VR2D 5CEFA 1UPXA 2QZ9A 2ZDHA 1GFIA 2V3CC 1IHUA 1D2HA 2ZUDA 2OOSA 2Z98A 4IHJF 2FQWA 1DBVO 4KAAA 3C15C 1CB0A 4OJMX 3TIVA 5JHHB 1VFPA 3AERB 1O5OA 4JA2A 4FFBB 1O8BA 3HB4X 2F59A 4EKYA 1AK1A 2F62A 3EISA 4IDBA 4OO3A 4CKCB 2Q4TA 1KY5A 4XIJA 1NVGA 1PYDA 5JCJD 5ECDA 5FQOA 1C7JA 1SKYB 3PITA 3TUJC 1P0IA 3PDIA 3I6YA 5H68A 1C80A 3H0KA 3WWPA 1OD6A 2A0KA 1CDEA 2Q2VA 4TWAA 4YRTA 1CS0A 3EH1A 3EQZA 2YMMA 1DJLA 4UOEA 2AXPA 3AOEA 3WYAA 3H2JA 3QV2A 3MF4A 3OCZA 4M1WA 1E1YA 3PJEA 4E30A 4KN8A 5KQPA 1XNHA 2C61A 2ZU0C 4UUBA 1W75A 5CFZA 4B3MB 3AG6A 3GBSA 3N70A 2QRPA 2AC7A 3EGOA 4Y9UA 1I2ZA 2XTZA 1OXUA 2ZTVA 4J9UE 4R2WA 2VHXA 3VJRA 4A0GA 2R85A 3OPXA 3TECE 1OI7A 1DAGA 2W4QA 2BE9A 3I30X 2IRWA 4OBXA 1RP1A 4DFDA 4DT1A 1ZHOA 1UMDA 2PZLA 3F90A 1Y33E 3R1IA 3UAGA 2PU7A 1KMCA 1T36A 3PFGA 5LMUB 1PR2A 5EL0A 4G5RA 1LX6A 3GZTB 4H3KB 1X1BA 4W1RA 3MGKA 1ZISA 2OHFA 1HEIA 1EB9A 1A7KA 1OASA 2EJCA 4JQOA 5KC9A 1FRFS 1KVSA 3HCWA 3N58A 1ZGZA 4KIJA 4ZD6A 2WIGA 4EYQA 4LQLA 4Z1MA 1Z4QA 2QQ0A 3H6KA 3WWDA 5K0CA 1DC3A 4TM8A 5DBGA 1Z4IA 3P9ZA 4YJHA 1P4HA 4CL2A 1GY8A 2WPDD 3EDCA 5E6SB 3JYQA 2EAUA 2Q46A 4WLVA 3TL6A 3NHJA 4Y9RA 3PNQA 3ANSA 2DM6A 4FINA 3SSAA 3L4KA 3QVUA 4TV9B 2BYTA 2A0UA 4FCCA 3GMIA 2GNOA 2HNAA 4BFXA 3LAWA 2BUBA 1EFVB 3W6UA 2FSGA 5BMOA 4M38A 4UDXX 1TUEA 3Q72A 4P34A 1DKLA 3A1CA 1BCRA 4REQB 1OXMA 1OY1A 2HLHA 4R9UC 4Y2VA 5D3KA 1SZJG 1OFTA 2F3SA 2LCFA 1WV0A 2BWJA 2FB9A 2RK3A 4YJHB 3LVRE 2HSWA 5IMBA 1D4OA 3JVUA 4F6RA 3A1SA 1T29A 3BWDD 4R8RA 3NGMA 3PWTA 4M2LA 3SE7A 4W5TA 3HCRA 4GL2A 1U9YA 3PK0A 1N5IA 2GAFA 3AQ4A 3H4TA 1KJNA 1QHNA 3T52A 5JZOA 2A6PA 1BWQA 2EJWA 3H5TA 3UA4A 3TG2A 1FPQA 5F51A 1O95D 1Q7RA 3ZK9A 2Y6VA 1Q22A 3FCCA 1Z5WA 1ORWA 4NE7A 5H9VA 1R4NB 4YCLA 2D74A 5E4FA 3WLQA 1AS3A 1USGA 1RI3A 2B6NA 1SA0A 3AJDA 5JYEA 4FUQA 2BEKA 2HJHA 2ONZA 1R8SA 1AE1A 3FPLA 3GDGA 1N9GA 3IEUA 2CF6A 1RWPA 1Z74A 1ZNQO 3FYCA 3CRW1 3ZWVA 2B30A 3L7OA 5BRJA 2GAAA 1YZNA 1DLIA 4Q21A 1NT2A 4NPCA 3IPRA 4WKGA 5CG1A 3PSHA 1QHHB 3DC2A 1ZGHA 1W8DA 2M1ZA 3JD2A 4P0QB 2R62A 2WUWE 4QG7A 5EAIA 4YRRA 4CMEA 2IYLD 2HMSA 4A5SA 4DCMA 4U8GA 2BGJA 3LMKA 3NUZA 1LDGA 4V24A 5H02A 3BBPA 1GR1A 1M9NA 2UYGA 1R64A 4DCJA 3OTOB 3RYTC 1VKZA 3PICA 1RC1A 1TUBA 1QQAA 3A05A 1WMBA 2OSVA 4RK0A 3W5HA 4B32A 3O8NA 1P44A 4PZDA 4ZYXA 5ES3A 3UAOA 2H6EA 2P7HA 4HFMA 4DVGA 2PZEA 2GBCA 2BH9A 2ZJ2A 3IILA 3VX4A 2PT5A 2VPPA 4HJXA 2I1LA 1PTKA 4YGXB 1WB6A 1SRRA 1ZK2A 1DC5A 1XZDA 2QG9A 3D0OA 3MJTA 2YWJA 2OL4A 5FUWA 2D2EA 5CG2A 4ZN6A 1ZD5A 2JH9A 1PHRA 5JC8A 2ENWA 4IG9A 2HNKA 1HH4A 4NE2A 4X95A 4XPZA 3QI7A 4DB4A 4TM7A 3TW8B 1AX9A 2Q0XA 1W2HA 1I2MA 2VI5A 1CUJA 2GM9A 1VG9B 5CHEA 1A4XA 4ZVOA 3E4DA 3Q5EA 2R86A 5T57A 3RCBA 5T6BA 3T7DA 5B1YA 3BX1A 2V1UA 2C1ZA 1PGPA 2W0MA 2IJGX 4YCDA 4ALLA 4TL7A 3CNEA 3UF0A 3G2PA 2IYAA 1EK5A 3T4UA 4I0WB 3SC3A 1OMOA 4ZEXA 1EEXB 2A0YA 3KTAA 1PNVA 2HMUA 2J5BA 1G21E 2E1PA 1N6NA 4KQ1A 3P9YA 2XCUA 2IZ5A 4X8LA 4A6XA 4OI0A 3A32A 2BDEA 2NSHA 4Q34A 4IIJF 3WP0A 3B6MA 2HIGA 3TW6A 1QB7A 4DCGA 4G36A 5K9ZA 3HVHA 2O2IA 1LI7A 3CPEA 3ENKA 4RHXA 4Q4LA 4TMYA 3RQSA 3ZW8A 3U44A 1RQNA 1D8TA 1KR5A 2CHUA 2CLEB 1S6YA 3EVZA 4BGEA 3SJBA 4EA8A 4MVJI 3MJRA 3DGFC 5C7IO 1M75A 3LXMA 1O6FA 4QULA 3JD1A 5LOVF 4ZU3A 1T2FA 1TEVA 2J33A 1FBTA 3NHYA 4LXUA 1ZLYA 1B93A 1XL0A 1BC5A 3EC7A 4PXAA 4J16C 4CDGA 3LUBA 4GSLA 4Q7KA 4OA8A 4D3XA 4ZGGA 1Q0PA 2VL7A 3QKRA 3DP9A 5TQJA 2H1IA 1U8UA 1ISFA 5F4BA 1L8XA 1QE5A 4V0QA 1M1YA 4E5VA 3BL5A 2KBFA 1JIVA 3F6EX 4KK3A 1AQNA 2SBTA 1CUGA 1F8GA 2V4MA 3ILHA 1P45A 4AKSA 2AG6A 4YDQA 3B9BA 1ZN2A 1N2ZA 1QBKC 3CZ9A 3HFGA 4Q9DA 5I9TA 3RTBA 2JCBA 2REBA 4R7GA 3CW9A 3ZVLA 5TJHA 1JDSA 4NZMA 5AW4A 1OPRA 4NYJQ 2FSSA 1NYLA 2D1SA 5HF6A 3IOMA 4LJLA 1HT0A 5KPDA 1EFCA 4B1FA 1YDWA 4I5FA 3VR3D 2OY0A 3WL5A 1SFRA 4N5IX 2YZKA 3KSBC 1UM9B 2R11A 1G21B 5BN5B 1BYIA 1EYZA 4G9BA 2Z5LA 2DKFA 2VRBA 2Y71A 1PJ2A 4O2RA 2NUPB 3HSKA 2ZIWB 1H2XA 1S2IA 2OO7A 4C88A 1PS0A 3MWYW 3WWYA 3I9JA 4EW2A 2NU7A 2R751 1P74A 1LI5A 3BCRA 2GWRA 1U1EA 2ZIXA 4K5QA 4NCJA 4RH1A 4LJ6A 4AJOA 3AFGA 4C07A 3OX4A 1I2CA 3PC8C 4DILA 3EAGA 2CL7X 3NJRA 3F4LA 1D2NA 4MX8A 3V7UA 1BN7A 1SKYE 3R3SA 3WRXA 5T8KA 2NUBA 2QZZA 3R5XA 3SZMA 4JJ8A 3IA2A 3NBXX 1VIDA 4HX9A 3ZQUA 4YWHA 1IZ9A 2XDQA 1JR3E 3QPBA 3LBFA 3A4MA 2BFAA 3L40A 3LF2A 4KQIA 1CR1A 4BBZA 1QVZA 3BFPA 4B3GA 1WZ2A 1C81A 4J2OA 4CCYB 2NXNA 2BMDA 2P3OA 1LQUA 2LXNA 3AY0A 4KWHA 2RIPA 4TXMA 2OXIA 3LY9A 3T9CA 1ACMA 5IJ0A 1O96B 2NUAB 1ZHFA 2BTQB 4M37A 1XJ5A 4LF8B 1X15A 2A59A 3EF3A 3MBIA 1HFJA 4YECA 3VC2A 3SQMA 4BNGA 4QU9A 3I42A 2UZ3A 1GPNA 4H1TA 2PH1A 1PEYA 1HF3A 3GZNB 4A8TA 2HU7A 3Q40A 5EZSA 2WD7B 3NNDA 4GXNA 4D6XA 2IUEA 1B15A 1TJ3A 3V9AA 2R5FA 1LSUA 1Y3AA 3UW1A 3PHBE 4LJ8A 4ATNA 2O59A 2Q5QA 2VDRB 4MK4A 1PVVA 2HJRA 1UODA 4WKNA 1T5DX 3ZD9A 2OQIA 1XR3A 3C8MA 1PZNA 2D2FA 3EX7C 2BSXA 3L92A 2F3TA 5JH7B 4F5YA 2XHZA 1U1IA 1JI0A 1QV6A 4MQ6A 2D2IA 4DLPA 1QIFA 2JIZD 1GGNA 4CMKA 4A2QA 3WLTA 2EKDA 1XQ1A 1AXRA 4ZEWA 3KQSA 1KDTA 3EXG1 1UFKA 2WJPA 2E4ZA 4GGMX 5DZSA 1NE2A 3E3MA 4MW1A 4K9PA 4OSPA 3CNNA 3BF8A 3DXYA 3OBIA 3SNKA 4IJ6A 4TTVA 4C2BA 5BNZA 2DCMA 5JPCA 3IVGA 2XRYA 2B9EA 3TFQA 1KPHA 4BE4A 2MR5A 3IPYA 4X3CA 1XEAA 1DQNA 5CDSA 4UTPA 1ZJYA 1H1LB 3V80A 4XLTA 2Z0MA 5ICFA 4C76A 1JQKA 4DC9A 2QU8A 2E4WA 2B8EA 4WLOA 4O5OA 3SX4A 3T8YA 3EPRA 3VDMA 1BHO1 3E6AA 3EMBA 3U5TA 4BATA 1YR9A 4QGAA 4U2FA 2X1MA 3UVEA 2PMDA 4WDQA 1E1CA 1NVKA 5HQJA 2PUCA 4YV2A 1SQ6A 4O2BB 3I6QA 3EULA 2EYUA 4FJ1A 2MYNA 4C1NA 4CI0B 3DJYA 4X91A 2P2DA 4OH7A 1RRKA 4HK4A 3WGGA 4DLWA 3AHJA 3U7JA 1W4LA 3BRWA 5A3JA 3KFXA 3MIIA 2PGAA 4G4SO 1N0WA 3CLVA 4Q4JB 4GP9A 3FKSD 5E6UA 3TLXA 5C2JB 3MTEA 4FR5A 5IF9A 3EVCA 4FVTA 2P6MA 2XDWA 1NIPA 1CHDA 4L9AA 2F8MA 3ZDFA 4LXIA 5CCEA 5KNDH 5EE0A 2I7XA 3DLCA 1FDRA 1PR9A 3SX2A 1C14A 4HDSA 4B6GA 2Q1WA 4GHWA 1G3IA 2PUJA 2RGNA 2PLFA 5ETJA 3KBBA 2C7QA 2G72A 2XD9A 1H3FA 2WAAA 5HTKA 5HKLA 3MLAA 5HFNA 4I9HA 4YCCA 4L5BA 3ID6C 4PLFA 3E7FA 4PZ9A 5DULA 3EPPA 5KWSA 3MGBA 3UJNA 2J30A 3VSBA 2UDPA 3KXIA 2HHLA 2Z4SA 1TLTA 1XDZA 1NW6A 2J1LA 2UYOA 3QUSA 4GG1A 4JH0A 4LC1A 1EGAA 4DUGD 4ZARA 1H66A 3C7CB 3OKPA 2I3GA 2VHEA 3BH0A 3HR7A 3GXOA 3IKLA 4ROSA 4BNXA 2CHFA 5K51A 3DV0B 2BRUC 3EA5A 3COPA 3WADA 3GEHA 4RGVA 3GZJA 5K0BA 1JVSA 2ODTX 1VE6A 1B1AA 3DZKA 3ZHRA 1WLSA 1NJ5A 3REQA 3EZ7A 2EKQA 5IVIA 4RIFA 4TV9A 4ZODA 3L0DA 1C3JA 2WIFA 1WB9A 1JEQB 3EXEA 1S3SA 3HPRA 1JP7A 1UMKA 3COWA 5JNSA 1YRAA 3PD0A 2EC5A 6ABPA 4D56A 1OWOA 3DNPA 3KUDA 4HVCA 2YNMC 1Z6GA 4ZVUA 1J2EA 4RHTA 3FUCA 4OA5A 3BZBA 2GFHA 5REQB 1RABA 2NU8B 1FFGA 1P9WA 5FR2A 4IXTA 3V1YA 3VO1A 3IUBA 4CIYA 1H94A 4PG7A 3BWYA 1H1TA 2PGNA 1N8SA 4WESA 3U2QA 4Z1OA 3KYCA 3QVTA 3QX7A 4HNAB 3AP1A 3C70A 3I9MA 4G0WA 3VU1A 4BC1A 3ZE7A 4OB6A 4HDCA 4D4GA 3G9QA 2VJKA 1MABB 2DHRA 2ZWMA 4M7WA 1DADA 3V3KA 1CNMA 4IKPA 4BDSA 3FWPA 3DFMA 4EFLA 2GPTA 4F93B 1OXKB 2IHJA 4B4KA 2XZLA 3VYUB 1AXEA 3NAGA 1VGVA 1G60A 1Z36A 4KJZA 4MSUA 1TA4A 2SKEA 2GJ9A 3G5TA 5GVSA 1GM5A 3WGTA 3CVVA 2O8FA 3LSYA 1T10A 3KYIB 3CZAA 5JWRA 2WVGA 3U7FB 2GMWA 1KGDA 2ZTLA 4LTMA 1Q2UA 4U5QA 2CLCX 3P9SA 2H4WA 4TWZA 4J3NA 1QFMA 1N3YA 2AG0A 3IMEA 3L04A 1RVV1 3G2JA 4BV2A 2IK8A 3QVLA 2NV2B 2JFXA 1V1JA 3IQWA 4M83A 5E4TA 1EBUA 1ZU4A 1FTSA 3AR3A 4FLMA 3MJ4A 4DC0A 3O03A 5B64A 3DOFA 3ZLJA 2H4FA 1PLKA 3UXMA 4W9MC 1KEVA 1PV1A 4Z9XA 1JFSA 1XYVA 1T2NA 4F04A 3KNZA 2O8BA 2BMEA 2VF7A 5HP4A 2AB0A 4GOLD 3ZZMA 2QTBA 3LO5A 4RDCA 5FD8A 3AESA 3PA8A 1SUCA 3KVYA 1GAWA 2GYWA 3WZ2A 1JHVA 4BJHB 3NFRA 4HLNA 4TS1A 3YASA 3BJIC 3CWZA 4LWPA 4TXLA 5E2AA 5AUNB 1Y6QA 2G28A 2WIBA 4OMFG 1Z47A 3GGSA 4IJUA 2BISA 1JEJA 2J5KA 4P4SB 3P4UA 3W5IA 2R8YA 3QKTA 1BROA 1BQ3A 1KMHB 4HZUA 3N2ZB 5EWMA 2H85A 3LUJA 5TVGA 3ROGA 3RWOA 1K86A 3WNVA 3X1WA 4CMHA 2X9QA 3BWCA 4YFYA 1IRXA 3F5FA 2OO3A 3SIRA 1NAIA 4DSAA 2NZYA 4BKQA 1GTZA 5KHOC 1CVIA 3BG5A 3D8UA 3B70A 2HHAA 3BIJA 1ZD4A 3FMOB 3FOWA 5FDFA 4YQFA 3KJGA 1DWOA 4DMUB 4MV3A 5FUBA 1ZPDA 4W7SA 2HLDD 4IMRA 3JRWA 4CCWA 3GLTA 4BS9A 3CLSC 4HWPA 4N01A 4QUBA 5EQTA 1RT9A 4ENRA 1R8QA 1Z12A 3W79A 2GEFA 3FNFA 3WDKA 4ZZIA 3MRTA 4LEIA 2E5WA 1O58A 2JLAA 2WE7A 5K1ZA 4MOWA 3OEEA 3WO1A 3IPXA 2O1SA 4DJ5X 2UZIR 2H1CA 3U0VA 3TNJA 2IPAB 1RPJA 1T9AA 3GLGE 1ADFA 1MD9A 2QY9A 2XDYA 4QPJC 4ZHQA 2YY6A 2CNKA 2Q0HA 5DYWA 3CWQA 4B45A 1BZYA 4CG3A 2FCRA 3SDZA 5A71A 3OPVA 1RHUA 2A78A 3UH0A 4JVOA 1XDGA 9ATCA 5BSMA 1SUFA 3HCNA 2FDRA 2GO7A 4J29A 1R6AA 4HYTA 5CDHA 2Y1DA 1TO2E 1JUDA 2QN6A 4RHFA 4ML3A 3LYHA 1U4NA 5C1OA 3FKQA 2JIQA 3U6BA 3VPHA 5TJ9A 4YLYA 3COZA 3I4FA 2YS6A 1SCUA 2ZTHA 3F97A 3L7IA 4WE3A 5ITVA 3IXLA 5TGDA 5DM70 1JWBB 2PX6A 3HCPA 3Q9LA 2PUAA 5EMJA 1IY0A 3TLEA 3DWIA 2BFCA 3QG1A 1QH8A 3PR1A 4LECA 1WVMA 2UXCB 1J4AA 3QPWA 4JNCA 1FNNA 4BP8A 1E9BA 5KWEA 4AXBA 3LVBA 1NBMD 4LVCA 1GA4A 1YZVA 4IIYA 3A06A 1XZIA 1Z6ZA 3G89A 3LX5A 5E95A 3A4IA 2FHSA 3KQQA 3AF1A 1P39A 1SOMA 3OD1A 4O1IA 3N2EA 1LPBB 3VH4A 3MWGA 3PRHA 2NP6A 1R0CA 2WWHA 3AXTA 2I9KA 3TQTA 1MAHA 1U7ZA 2HC9A 1BX0A 2GRUA 3Q7RA 3K6SA 2BFCB 1JR6A 4FI3F 4MTLA 4LHXA 1ZW6A 4PRZA 4YB8A 4FHGA 1SCUB 1DG3A 3O2NA 1OYOA 3U4IA 1TD9A 2O2SA 4R41A 1P5RA 2YXDA 2AT1A 1TZCA 3O4GA 4E12A 5GPBA 3O0TA 1R9NA 1BDJA 3KT8A 1AMOA 5CXUA 2G09A 3NASA 3ZWMA 3RIGA 3PWSA 1ISIA 2AFRA 2JL1A 3PKZA 2PFSA 4TQGA 3I73A 4EHNA 16PKA 5KC8A 5KNBA 4X92A 4EPWA 2V3VA 3RVDA 1QGUB 2CL5A 4DIUA 4ENVA 5JD5A 5BMVF 4ETWA 4CHGA 5JCJA 5BSUA 1SBYA 2CVZA 2HWXA 2QAIA 2NUTB 3P0RA 4TTIA 3QPDA 1XPUA 1JFFB 3NFYA 2P4HX 3B20A 2WU1A 3QSGA 3KR0A 3TMKA 3CVOA 3KKQA 1MP0A 3OMWA 2G6BA 2IE0A 3GJ8A 1SELA 4A6PA 1TTTA 2OFOA 5H59A 1IXYA 3MTGA 1JW9B 3E2IA 5H80A 1SIWA 2P30A 1KTIA 4X64B 3CYFA 4RIGA 2DQKA 3WBJA 2XX3A 3VOTA 1A9RA 1E58A 4FHCA 2VH1A 1Y7IA 4HZIA 3ZI0A 1R8JA 1HFEL 4UAGA 5JU6A 2DBRA 2IOFA 1NATA 4H4DA 1ACLA 4KYIB 7GPBA 1ZKMA 1O57A 3ZJTA 2CB0A 5K8JB 2IC5A 4I6EA 4L02A 4MYSA 1T2CA 1UDAA 3I64A 4KZPA 3V6MA 3T4EA 4ASUA 4KO2S 2QYHA 2VAVA 4ZO4A 3G8CA 5KNCD 4KFUA 4ETMA 1IHYA 2AS0A 2E37A 2F90A 1HTWA 3O7WA 3R23A 3VSDA 3DM5A 4DJTA 3B3GA 2HUNA 1OGYA 4UHFA 4PS0A 1N7IA 1TQ4A 3HB5X 1WX1A 3DL7A 1D2CA 3L7AA 4HG2A 4QGGA 3PIRA 3WQHA 4DA0A 2FFAA 521PA 5BN4A 2YMQA 3L4SO 4XTCS 5FOSA 5AXBA 5JMPA 1Y37A 4AECA 1AMUA 1JH9A 5I9MA 1NJ6A 4UATA 1NY5A 1T91A 3P1JA 2OMEA 4KI0A 2BR3A 4JZKA 4NEHB 3K53A 2ET6A 2UUPA 1Q1ZA 3ETEA 3BK1A 1V71A 4PO3X 1BMFA 3LFTA 3VHQA 1QV9A 3N8GA 1CT9A 4CDRA 1VHJA 2D7CA 4FNGA 2DBVO 3E3NA 1LH0A 4J94A 4PZPA 4W6ZA 1ANKA 2ZYHA 4RVSA 1GPYA 3ZBQA 3ENVA 2QPOA 1G20E 1GZ5A 1UJ2A 4LVNA 3S3TA 4M21A 4J2TA 1L8OA 4HB2A 4PANA 5YASA 1KAEA 2J5QA 3P45A 3AHGA 3H1AA 1W9HA 4R0NA 3GH3A 1NVXQ 2RGXA 4BB6A 4LGMA 1YDHA 1DJPA 4U9IS 4U2KA 4NJMA 3GOHA 4RKEA 2VTVA 2JB9A 2O48X 5JJBA 2XMDA 3AKZA 4EMSA 3SXUB 4JJ6A 3OKAA 3THXB 5IBCA 3GD5A 2FW0A 1OBVA 3A0UA 4QUDA 3JY6A 5D51S 2XITA 1MH1A 2WQ6A 1DTWA 1H93A 5DWQA 3ZHZA 4MKFA 5JTTA 2QPAA 1FDWA 3PLAE 2RJOA 2R84A 3A1TA 2W6ID 3DF7A 3F4KA 3AC0A 1RBMA 3ZVMA 3QLVA 4MV6A 2PX8A 3A37A 4JLDA 2MOKA 4MWTA 5TGTA 4CF7A 3DCJA 3K09A 4OMDA 3NMUF 4RZ2A 1XWWA 1C4XA 2QVYX 1FNDA 3Q5GA 1QAMA 3DEKA 1YZHA 1BXGB 1RLIA 4FEGA 5A05A 4LNUB 5T64A 1QRAA 4EELA 2VDLB 4C2TA 4XB6B 1HRKA 3AR9A 2HQRA 2REQA 5JECA 3AW9A 3SHQA 3MFYA 1FTYA 5IAKA 1NFQA 3U9SA 4DOMA 5IYZA 4D4MA 2WWVD 1N4DA 1DKRA 1ZGAA 4AMBA 1JR4A 4GQIA 3P2KA 4RD0A 4DKJA 2FJUA 1WMFA 5HK9A 3NALA 1T5IA 3BMQB 2Q3BA 2YW2A 2C3UA 1PKXA 2AZ4A 2PYZA 3JZAA 3WGOA 2NU9A 4BGDA 5EWLA 4BO7A 1RDFA 3N5CA 4QOJA 4P3PA 1YQ9A 4O2AA 4KO8A 2AGVA 4QIHA 2HTFA 2ZEJA 2KHZA 2YHSA 3KKLA 3K2IA 5I7HA 5U4QA 5LOVB 3GF4A 4YDRA 1WU7A 4HEHA 3HEBA 4HCJA 4OI4A 1O5IA 1UPCA 1VYTA 2ZGVA 3CVJA 3DD1A 1W25A 1C9JA 5EIFA 2YMLA 2CZGA 1CFJA 3EXHC 3FPFA 3DP7A 3P97A 4ISBA 1L1EA 5B3JC 5EE1A 3IESA 2P3QA 1WVIA 1NSFA 3RC3A 4M1YA 4PYNA 3S29A 1P3Y1 3WFJA 1PQPA 5FUXA 3PFKA 3FWKA 3M82A 1N9KA 1HE8B 2IY7A 3JALA 5B37A 4YMVA 3IIMA 1A3CA 1NQVA 1UR5A 4G4JA 4HPWA 4D1YA 2PD6A 1T3LA 4N0MA 2X9LA 3SM3A 3LX4A 3VC3A 4F6LA 4LFBB 2AYYA 2D1TA 1RAAA 4JUBA 3HP7A 4L27A 4EG5A 2H06A 1GAEO 3WZMA 1KJJA 4RSGA 4HEA1 3ZHOA 3N8NA 2F64A 1Y98A 4J03A 3C7KA 5BUQA 2WV9A 1CF9A 5ILQA 2C8VA 3DT6A 3OZEA 1PGQA 3PNMA 4NY1A 3PC8A 3UNXA 4KPUB 4W63A 3RIMA 5MFPA 5BR8B 4RQTA 4ZZ0A 4AYXA 2XQFA 1WCIA 3CEJA 1D6NA 1HDYA 4UAUA 1N2CE 1CERA 1DMSA 1SGWA 1VZ2A 3W4JA 3DCNA 5E6UB 3CVWA 3FOCA 1IVSA 2DFTA 3V8PA 1QV7A 3R7SA 3H5OA 3DAOA 6REQB 5CPBA 3GQBA 4XIIA 1R15A 2BKLA 4KR7A 1I7PA 2Y1XA 1E6UA 3GAAA 2GK4A 3K0CC 1J7JA 2TSYB 1U3CA 1NF8A 4TGLA 4ALIA 1HYGA 4LI3X 3QLUA 2QSYA 3ZCTA 2R6CA 2GJ8A 3Q12A 1JFTA 5KTYA 2NGRA 1KH1A 4D45A 2FSPA 4LX0A 3WLFA 4E5DA 1TVKA 2P6OA 2WTMA 1ZINA 1YS4A 5I7WA 3A6ZA 1FFHA 3PHIA 1Q83A 5GWXA 3RRJA 3L7KA 3T5AA 2CVHA 1MB4A 4O4JF 3WHKA 3HGTA 5DXAA 3OWHA 3DW3X 3V97A 1P1CA 3ROTA 1XNRB 2PWZA 2XUZA 4Y3UA 2D1QA 1IATA 2Q6LA 3WYDA 1UBHS 1W4ZA 2NNWB 2W48A 2IYNA 2O2DA 4N5LA 2OT3B 2PRKA 4QT4A 1EM8A 3KE8A 4E09A 5CCDA 3LL7A 3M6UA 3D6NB 1PGJA 4RY8A 3RC1A 4TPKA 4BNLA 3ESBA 4MMYB 4NQZA 1RKQA 3K5IA 4H18A 3DEJA 1SKQA 5IBPA 2RC5A 1YL7A 4I6GA 1GGFA 4LF4B 1TUGA 5CJPA 2XCLA 4Y9DA 4D7AA 4UBNA 1ZGBA 5ULLA 5IYZF 3TYXA 2ZB8A 4CV0A 1NVAA 1RTKA 4QKQA 1Z5OA 1IPHA 1JKJA 1GQRA 1KI2A 2G0TA 3CGWA 4L16A 2HMAA 3NDJA 1AH2A 3WSTA 3GI1A 4NBSA 4KK4A 3JW8A 3M1YA 3HJFA 3FRHA 3N3AC 3U4MA 5FEUA 5JAPA 1Q1GA 1P7WA 1U0OC 4OJYA 4PNZA 4GI5A 5AVQA 2BM9A 5LWHA 1E62A 3GT3A 3J7AC 1W85A 3IUSA 4NOMA 3S28A 3TCXB 1DAFA 4R1OA 2HJSA 2ZJAA 3EGCA 1C4WA 2YN0A 1WZNA 1Z56C 5AHOA 1OWNA 4GLLA 2FN3A 4BJ1A 2Y0BA 4LZLA 3UKOA 1DC4A 1VRVA 2KS6A 2Q49A 4EVSA 4CV2A 2WUEA 1UBLS 3I5AA 4RW0A 5HRCA 1WBBA 2ABWA 3D6VA 3E1KA 4BBAA 2JJYA 4RORA 1X9GA 2DMRA 5J5VA 3V2GA 2GPNA 3PHLA 3LFHA 4X9XA 2CKDA 1ONSA 4W9RA 4YALA 5B53A 3L4EA 4ZJPA 2QN9A 5KYYB 2WLSA 4AP5A 1WG8A 3GJ3A 3SU8A 1JWAB 2OCDA 3O8RA 3QLEA 2EEPA 1UIMA 2PDAA 1QHXA 3WB1A 4AC9A 3SS7X 5CJ2A 4HD8A 3DLAA 2DFPA 2A1TS 3LT5A 5E3JA 2N75A 1PW5A 3W3AA 4RCYA 3UCFA 1EKXA 5M3BA 3RSCA 4RH3A 4HVLA 2FQYA 4GR4A 2WINI 2UZ4A 2G1PA 5ITWA 4DDMA 3ZV3A 4ZTUB 5TQVA 2O19A 4K9SA 4MLDA 5A9TA 5ILGA 4H7KA 4JYBA 1BXKA 3FHJA 1P9RA 2WIJA 2YYSA 3IT1A 4UVGA 1I4DD 1XPRA 4P7FA 4G0YA 1BWSA 5SY6A 3SQDA 4IZIA 4L6IA 2JW5A 2V6IA 4J1SA 3PE4A 4RACA 4E1VA 2DULA 1H8EA 3CEAA 5K0SA 4S04A 5L7TA 1YQGA 1ZM9A 1RACA 2FN7A 2Q3LA 1JZQA 4KFSA 4MLPA 4LDAA 4MWBA 1JQ3A 2IPNA 3HCEA 1RWBA 1S9DA 1DX9A 1M7BA 2GZDA 4A0RA 4W5RA 3ICEA 1B00A 5JTUA 3DL2A 2QJTA 1J42A 1NYRA 2RONA 5EVCA 4L74A 4RETA 1DCFA 5DTMA 2YX1A 3KYDB 2VRNA 3GRFA 4N3GA 5KTOA 5HCNA 2R6GA 4G0XA 4O02B 2E82A 3AEUA 4XXHA 4AY5A 3K2QA 1XTQA 4R8VA 2JAOA 4RFSA 3ZH2A 3WYFA 4FDMA 5LOVA 2P2YA 4B82A 4D8UA 1I5RA 2R97A 1X6VA 1SHKA 4K86A 5DIFA 3WK9A 4AVYA 1X70A 1JG2A 3FPCA 2O3SA 2EZ8A 2B0JA 2R8PA 2O4CA 2H92A 2WYUA 3D0RA 3MCAA 5AOVA 5FYQA 3AB7A 4WVFA 2GXQA 4OK5A 2G76A 1M8PA 2AWOA 2LZ0A 2QTNA 2WYVA 3K1TA 3Q1KA 3ZWYA 2WHEA 4CR8A 4PIVA 4UBIA 4BHTA 1MVNA 2JHCA 3HYSA 4BWGA 4NYIQ 2YHIB 2C00A 3TEMA 3H86A 3CC8A 3LLMA 2FR8C 1PS9A 1MTZA 4KJXA 1SHZA 2AFIA 3PI7A 4ZI5A 1EUQA 4P98A 4B74A 3BULA 1FRQA 5H0IA 3HYNA 3GCWA 1KOJA 3A6GA 2WUVA 1NN1A 2AN4A 3MYRA 2P9GA 3RUHA 2BJHA 3NIFB 4N7RA 2I66A 4X6UA 2BGIA 4D9EA 2JCVA 4RA9B 1FDSA 4POAA 3AKDA 3DDOA 4R7TA 1TM7E 3IX7A 4BO9A 1RCTE 4LE1A 4E2XA 1IBSA 2DBZA 2TECE 5DTRA 3SHTA 5JASA 3KK0A 2H1VA 3UPTA 3UMFA 4XVRA 1QPZA 3SZUA 1V6SA 1VIMA 2OKCA 2BGTA 1CUVA 1T4CA 4PWYA 4ZO7A 5H5JA 2Q7OE 2ZUCA 3ADDA 1H8HD 5LMZA 5G3ZA 1YRBA 5BQFA 3H2SA 1SB9A 4WLNA 2QLBA 1P7CA 3MWDA 4K28A 1WXDA 4EA6A 2JPDA 5JQWA 4IXMA 1PFKA 1RYMA 4TYWA 2O20A 1CUFA 4CI9A 2VF2A 4IMJB 2F6RA 1E3QA 2FPPB 3UOWA 3GUHA 2IV7A 4K46A 1E20A 4IYJA 5IVHA 3VDXA 2F9LA 4U00A 1RJ9A 1DAHA 1XD9A 1JHOA 2KPOA 3EDRA 4NBRA 4XWGA 2R4QA 3F98A 3FSJX 4ARAA 4C0SA 5CYGA 3LJKA 1QIMA 5JD4A 2I3AA 3BMXA 4YCNA 1W5SA 4GECA 4R1MA 3ICOA 2XBLA 3RVSA 1B7GO 1QTNA 2IIPA 2G9QA 2BJVA 1R37A 1KK0A 1RE1A 2IEGA 1J25A 2Q3MA 3AHEA 3IJPA 3O1IC 4ZHQF 1SG0A 3EEQA 3QU2A 4CLHA 4D0LB 1G20A 1GZSA 5EYPB 1PJTA 4GO1A 1OLUA 2WI8A 1CR2A 3DLIA 3GCGA 3CNOA 1C3EA 1YKSA 4G3XA 3REGA 1J07A 5AESA 5KYKA 5JI2E 2AOTB 3T9BA 2Q5EA 4MW4A 3QUCA 2QGFA 1ZEMA 1IEWA 1F4PA 4HEJA 1L4FA 4ACAA 3EASA 5JWHA 3AVXA 4MYDA 2FMFA 3S40A 4G8DA 2OK8A 1T3HA 3WMRA 4EENA 4RK1A 1YZFA 1PV2A 1E6WA 3K8QA 3LU1A 1M2VA 3ECSA 2M1XA 1FMLA 3G9TA 1A04A 3OG9A 3KLOA 4ND4A 1FZTA 2J67A 4BNMA 2JKYA 1WXXA 5ALKA 5KOIA 4A73A 4ZTZB 3H99A 1SCQA 5L53A 4DQDA 1P3JA 3PT5A 1E2KA 1V8FA 3U60B 4EY7A 2QLJA 5DBEX 2QBYB 1T2UA 3K32A 2L69A 3TI7A 4H7FA 3SHVA 4DNXA 3T35A 1MV5A 1CEXA 4OHVA 3RSHA 1KRHA 4KKXB 1PEKE 3DE2X 2IH4A 4LOIA 4OGWA 2YRFA 1P60A 2C9OA 1ID8A 1FTWA 3U39A 5DV9A 1T36B 2VP5A 4WXMA 3W8RA 4CLDA 3HBAA 1QSGA 1XB2A 2VF8A 2M6KA 3SWWA 2JI6A 1W2WB 4XJTA 1ZNYA 1S1CA 3E9RA 3FCAA 4G25A 1E3DA 2I7DA 4PHGA 4PPQA 5ALQA 2D7DA 4RVGA 3WQSB 1I8TA 1ZUIA 4HVTA 1RKXA 4XFKA 4YP9A 3KKOA 3NHAA 3OTQA 3WK8A 4UPVA 4ZVMA 1F0KA 3ZU2A 4O0MA 1WPRA 3O95A 4UVHA 1YFJA 4QUIA 1FFEA 1KBZA 3DEYX 3ZGOA 1XLTA 3FFTA 1CQIA 3GFRA 4NAUA 2YJ5A 4BLRA 1M2WA 4EDFA 5JJCA 1DO0A 5HDBB 5CCXA 4EHHA 1DXYA 1YCGA 3JQ9C 1T1IA 2JBHA 2IOFK 3TE7A 3HBNA 1QUFA 4IEIA 3U9TA 4D6YA 1L2TA 2OP1A 2P8JA 4QUJA 1LBSA 1NVVR 5A06A 4B3SB 3TD2A 4EECA 3IJ5A 4MKIA 4RF5A 5AVXA 1Q11A 3IOYA 2LP4Y 4FFBA 3PC4A 1H5QA 1ND6A 4M53A 3IOBA 2GA9A 3O90A 4AD8A 3GPIA 4AMVA 4DG5A 1Q91A 5F2NA 3UAZA 4ZAFA 4IUYA 3MWLA 2H54A 1G6KA 4K2AA 4A8JA 1TI7A 2PJDA 5JS8A 1L8LA 1OH7A 5BSFA 5FFMA 2CXOA 2WJVA 2XTAA 1HNWB 1F0NA 1F1JA 2HLDA 2GK6A 4X84A 2B0CA 2YW9A 4DPMA 3MSXA 2BCJQ 3JRNA 1ESEA 2IU0A 3RHFA 2GCOA 5B7PA 1VYUA 1OXSC 4CM7A 3AKCA 2XVAA 4DDKA 1FLVA 3OPMA 2WKSA 1Q15A 4YI3A 1T9BA 2XNCA 3RIEA 4B5LA 1KJ8A 3KQVA 1HYEA 3ICWA 1CUCA 1FP4B 1H2YA 2JKVA 4TLDA 4X44A 3SR4A 4C7XA 3IV9A 3SSNA 5MHTA 3P7MA 4LJ9A 3OA0A 2R7NA 2Z4RA 2AJ8A 2OE2A 4ZQIA 5EHZA 4Q9NA 4XB1A 2EJVA 3BXZA 4GM4A 4QE3A 1X8XA 3UB4A 3RS8A 4EG4A 4NV3A 2ENUA 5BQ3A 3OY7A 1IZ8A 2ID8A 3GN1A 1TF5A 1A9TA 5CA1F 7ABPA 4FNOA 1Q0LA 1GPMA 3WR5A 2DZDA 2W37A 3DVRX 4BLOA 3KKPA 3N2KB 4INOA 2BF4A 1KIMA 5K3EA 1V95A 2W2QA 2AN3A 2ZRHA 5CFMA 3JSAA 5LJLA 1TVMA 4LZPA 3HU1A 2ZJ8A 5FCDA 4C3UA 4EBFA 4DRYA 2PUFA 3GQVA 2XMZA 1SXJE 3KL2A 5EJ6A 2YYYA 4E2ZA 1QH9A 3ZE2B 4UMEA 1ISRA 4BNKA 2MTBA 4X1YB 1CEQA 2YXBA 4LG1A 4A6EA 1BS2A 3DAPA 3KLPX 2V6GA 3KWJA 2WB2A 1VE1A 2V7EA 1I7LA 1P2DA 4CKEB 1D5WA 1VCNA 4MUFA 4QA9A 1ZSVA 5DLPA 5H3LA 4CKWB 1YS6A 3NJ8A 5BY2A 1QDEA 2H4JA 3PQ7A 5GP1A 4BP3A 4HNTA 3VDNB 1P1KA 4QBGB 5C1DA 5IKPA 3M5PA 3NHKA 4DKXA 2OVBA 1VECA 3QFSA 4GQBA 4NKRA 3CX4A 5EERA 3IVRA 4BASA 3D6AA 5KSYA 3I0MA 1L5OA 1ZESA 3Q98A 4U6NA 4FYHA 5I45A 2FW8A 4B3JA 4OI2A 2QOEA 1ONNA 2OWDA 1AKUA 1B0AA 4ZCRA 2Q2NA 3V00A 3WB9A 5ADVA 2C4MA 1CULC 1EPUA 1Z33A 3K1AA 3OP1A 1CRQA 4N8SA 4REOA 4U7JA 1TXGA 1EWKA 3HUDA 2MSWA 1ENPA 2ANBA 1JJVA 3MM4A 4Y30A 1BHJA 4P83A 5DJ5A 3PQDA 4CKBA 4DLZA 2HWYA 4GMKA 3IV6A 4OUDA 4LC9A 2ID4A 4CEIB 2VUSA 4Y98A 3PGKA 4GPEA 4HNGA 1LZLA 2UVPA 5FNVA 3F3KA 3GQBB 4PONA 4RV9A 3OFSA 3CCFA 2G67A 3RS9A 1KEEA 2D6FA 1T8RA 1Y8QB 5JAOA 1VHLA 3VPSA 2JFOA 4OYHA 1MTOA 1RXYA 2QRNA 2C2XA 2F48A 4PZ0A 3OHMA 4BNTA 1NFRA 1XNQB 4TVOA 4CMIA 1WDTA 3TJMA 2HSGA 3LXRA 1XJ0A 2OFPA 1QGZA 3OZXA 2J3JA 1VOTA 1YMUA 1GGVA 1E79D 2P2LA 2VIIA 3KR2A 1GZ3A 1TZMA 4HFJA 3KELA 4PCAA 3MT7A 1RXUA 3RPEA 2HSZA 2E4YA 4QM6A 2R9VA 4PLZA 5K0TA 2RI1A 4RPCA 4NLLA 4BZPA 3O2JA 1YB6A 3Q7TA 5CVDA 2NZ8A 5LYYA 5CB4F 3DL0A 1JLMA 3OCCA 3CEHA 5FFFA 5L6MB 3RBAA 1PP4A 1U8AA 1VJCA 3LUHA 2H2GA 3L7JA 3JALB 4CQMD 5LXTA 1Y89A 3RYIB 1L4YA 1F48A 4IIJA 2J6HA 2WRZA 3V4VB 4DEXA 3SR3A 3I5XA 2PGDA 3RB8A 4DHEA 1ACJA 1V3VA 2A1TR 2WFLB 1KY3A 1E1RD 1QKJA 1P29A 2WSSA 3FB4A 3TLCA 3L4BC 3ZLTA 3FNGA 1H2FA 3GHHA 3PCRB 4ZCSA 3Q8LA 4EDHA 3C3CA 3O0DA 2X42A 3NBQA 2RCYA 1AZWA 3AX6A 1DRWA 4XGRA 4C0LA 3SXJA 1D2RA 1JRLA 2ERCA 2NO5A 3RSFA 4I1VA 4RHCA 3RKUA 4N9QA 1GNPA 4FQ7A 3ZHYA 3PFFA 4EJ6A 5T41A 2AKYA 2W6OA 4KRYA 1H8HA 2H4XA 3TW0A 4E07A 1CQIB 1NQUA 4LJ4A 2X1HA 4WD3A 3UMSA 3HDHA 1CY7A 2BKVA 4JLVA 1N6LA 4Z7JA 1EHCA 4HH0A 3Q15C 2I87A 4KXMA 3FTEA 1YJXA 1XNJA 4E22A 2J5RA 2R96A 3F5SA 3IT3A 3ZDBA 2ZVDA 2ZZKA 3WK4A 2DYKA 4X97A 1RYYA 4Z4HA 2HYIC 1Z8FA 4QD3A 1OLUB 4I1OA 1VLVA 3VISA 3B8HA 3R7WB 4H3SA 2YY7A 5EP2A 4YAOA 3A2LA 5C35A 1ZH4A 5F7OA 2A3RA 2D54A 2YHAA 4TMZA 4UTOA 3VKFA 3R3ZA 4H4CA 1FX1A 4P3XA 3IJRA 3UT6A 2XEDA 5AWFC 1NRIA 5DM1A 1NW4A 5ALMA 2BEWA 2D5IA 2EF0A 1IHOA 1P7YA 2XAAA 2H07A 3B1XA 4P3KA 1FLNA 1UPTA 4XVUA 3F6SA 1SVKA 1C41A 5BQ5A 4B4VA 1SCBA 4OEHA 3FSGA 4WTOA 2ADMA 2ZP1A 5LZ5A 3ZGVA 4CCSA 3E8SA 4KXNA 5IK2A 2WTXA 3WL4A 1S0UA 1SVSA 4LBZA 1U2EA 4NBVA 1LDBA 4OXRA 4RD4A 2NZJA 3UC9A 3UQYS 4XYMA 1O97C 1VMAA 2QJOA 4G63A 4P4GA 4JI5B 2DKOA 1DXQA 3AEYA 1RYEA 2QLNA 4PR3A 2QUAA 4PAMA 4M0UA 3WLAA 4CIVA 1T2EA 5KTNA 1K7FB 1XX6A 4HNQA 5F9HA 1Z5GA 4OXXA 3AO0B 4GW3A 5EZYB 3RU7A 3USCS 5TGZA 1SBQA 4X1OA 3V4LA 1ATIA 3UXYA 4QZVA 4DWWA 3WGIA 3LYLA 1RAFA 3PX3A 5ALYA 1JKFA 3JZMA 3VPDA 5K3BA 3SHFA 3QV1A 4GC9A 4IQ0A 3HWWA 3BILA 3WOVA 2R1VB 1T15A 4EHJA 1H1LA 4L4SA 1CG6A 3IODA 4JDPA 4Z0TA 1YQEA 1WB4A 3HWSA 1HOTA 5FTJA 2ZJ4A 1J24A 1PWZA 4FMBB 3F2IA 4ZQGA 3ZWNA 5KDOA 5FOXA 1P0PA 4YAEA 4QNMA 2QQFA 2ODPA 2H9IA 3PRJA 4G1MB 2FW1A 2JAQA 2FFJA 3EUAA 3KU4A 1XU9A 3DWGA 5DTJA 4Q01A 1DX6A 1TVEA 3KCNA 1FPMA 3OWXA 5D7BA 1RMQA 1N5DA 3LA6A 4FYYA 4ZPXA 1OC2A 1U1DA 3NZEA 1F6WA 3KXPA 1XQVA 2QK4A 5HF8A 5KU1A 2HK7A 3QJYA 4NCBA 2G08A 3KKMA 4MV7A 4PYRA 4RJ2A 3TL2A 3CX8A 1FNSA 5JADA 3D0KA 3B3FA 3P5BA 3H4VA 3HB0A 4RY2A 3BERA 5JAZA 2E3JA 1SG6A 3EHEA 4Q4JA 4C6SA 3M1AA 2P9QA 3OM8A 1JHRA 1X14A 4UM9D 2C8LA 1JHZA 4KQCA 2CL0X 1T6ZA 1ZIXA 3X1JA 5JNLA 1XDWA 3I05A 5GGYA 5DOZA 4D25A 3DMRA 3KCQA 4WBNF 5C7OO 2VJDA 4XRRA 4PLHA 1E1CB 4YC7A 4EJSA 2C5LA 3A2KA 2AR7A 3MOIA 3EQ7A 1DKUA 2QVCA 1YQXA 3ENQA 3GAFA 4HRYA 2XMSA 3ROQA 1T34A 2FRDC 5JXJA 3GVIA 3ISVA 3BL8A 1XMXA 2MINA 3HWRA 4RJJA 2HXGA 2YXPX 3SEFA 1KVTA 1PEAA 1MX1A 1NVTA 4WY2A 4NG4A 4CL3A 2B35A 2OZPA 3FDZB 1R9GA 5F2KA 3TSOA 2FKAA 1O95A 1QZTA 2FZLA 4B73A 5HUQA 3DKPA 1VJDA 2AZTA 2OXRA 2VYCA 3VR4D 3SQWA 3QYJA 1V11B 2XIJA 2D5LA 3TJZA 4KSYA 4PGFA 3UJ8A 5J43A 1JIIA 1GUAA 2FW7A 4M6WB 2VZ8A 1C9EA 1YKGA 2EKLA 4L8VA 3WWZA 2O5EA 1O94C 1Y80A 1HYBA 3VMMA 2ZE8A 5EIBC 1WU8A 4HNRA 1Y3CE 3AEUB 2AJCA 1H6AA 3DO5A 2MSNA 4RZHA 1SVOA 4JY7A 1YS2X 3VRHA 1N36B 5DHUA 3RVOA 1HSOA 3LKDA 4Y2TA 2RGNC 1U3FA 3IDAA 1SC1A 4FTWA 4LZJA 1GV0A 1YJQA 3THRA 3C14C 2JRLA 3NYQA 2OHIA 1C7QA 4E88A 2B34A 1IN1A 4LOJA 3A7DA 5FV4A 1OGIA 2X8LA 1SOVA 1VG8A 1W49A 4KU4A 3VZPA 1E2LA 2PX0A 3I53A 3MJDA 5CAEA 1JA0A 2B1RA 3LQYA 4KXFB 4Z8XA 4ARUA 1D4ZA 4M3NA 5FOWA 5JQGB 4XAQA 1JG4A 1SWWA 1W2GA 1Z5ZA 3ABIA 4XIYA 3X2SA 1Y4UA 1THZA 1E1NA 2QIOA 1MJGA 1NC3A 2FV8A 3HR8A 4BP1A 3RRZA 3UFXB 1XMQB 2A0FA 4KR3A 1OAOA 4UFPA 1GG8A 4JI3B 4RX1A 3K9CA 4XKJA 4DA9A 2W2OA 1X3SA 2ZYTX 4OHZA 1LS1A 2WF9A 2NIPA 2Q99A 3VX3A 2VP9A 3ADOA 4FCTA 4FFPA 3FNEA 4F2WA 2J0VA 3R6GA 3OQ6A 3DQPA 3NH6A 4NR0A 4N76A 2NSLA 3OQJA 4JQCA 5KAMA 1UPUA 3T38A 3TLGA 2ZM6B 5EZ5A 3DDHA 4LTNA 2XUJA 4PSVA 3GIWA 4LRUA 4YP0A 4EIWA 1G18A 4MUAA 1OX4A 4RD1A 4HRXA 5GZ6A 5BO5A 4QARA 3S55A 4HDRA 5C8DA 4KL8S 2NXWA 5B57C 2J9RA 4P5EA 4KHZA 4AP9A 1QLHA 1JWLA 1U0BB 5JJKA 2I67A 1NJSA 1C9MA 3NWPA 4DWVA 1R5JA 3R74A 1MR3F 2ZUWA 3E5HA 2FPUA 5DCYA 5HEKA 4BMCA 4IHQA 4IQFA 4Q3LA 4UMVA 4UHKA 1XF9A 2MIIA 4IG4A 1T9DA 4EVQA 5KVCA 3PGXA 2GM3A 2GJSA 1HQKA 1N5JA 2O0HA 2VDPB 1DDGA 2JFYA 2X2OA 3ROFA 3UFXA 2GKSA 3SX0A 3PUYA 4A2CA 3M6AA 4L57A 4QHYA 4G85A 3T5TA 4TQAA 3U4CA 1QE3A 4QICA 1XZMA 4QUKA 4YA6A 5FEMA 1GNSA 1XA0A 2QTVA 4YR7A 5D01A 5L3SB 2PKRA 5F64A 3JVIA 1H0KA 1GUYA 3DEIA 1TW3A 5IH7A 5HS4A 1ZMRA 4YY3B 4R69A 4A15A 4D4IA 2Z5VA 4TWBA 4MJXA 4YRKA 3LKVA 5A5EA 1A8QA 4IGAA 3BMNB 2QS9A 1M0WA 3EAFA 4XM2A 2DLNA 2WHXA 4FBLA 2WY2D 2YRWA 1ZQ1A 3IAS6 1SXGA 4WFKA 1G16A 5LDGA 2DTDA 3GIDA 4JJGA 4MV1A 3U7RA 2ONJA 3CU5A 5EN4A 2FXVA 1VPDA 2CYBA 3E4CA 5D5HA 1Y81A 1YIDA 2XB4A 4B8ZA 1ZMTA 3OUTA 5A2QA 4PAGA 3AETA 4QDXA 3KFLA 2Z95A 3IIIA 1C7EA 1SNYA 3HXQA 1WOYA 4IRUB 3FTFA 2IP4A 5K3FB 4AJ9A 1C4KA 4LYEA 2DPGA 4C0WA 2C4TA 2CJXA 1LZKA 1T35A 4JA0A 4EX6A 4EPVA 1FE8A 3HV0A 1DBSA 1GT6A 3L5KA 2FEKA 1MAWA 3ZCUA 1LS6A 1VL0A 3SMVA 3OPQA 1QYWA 3M81A 1E5DA 1EUDB 4OHBA 4B2PA 2Z4TA 3MINB 1N7JA 3OIWA 1I3OA 2B9VA 4KN9S 1Y6RA 2CK3A 2PUWA 1D1PA 5IFLA 4G01B 5G2OA 3ACBA 3IUMA 2IV3A 3HCOA 4DV1B 4B09A 2A4MA 2WJYA 3KQYA 2FPKA 5M34A 3MJHA 1EDBA 2R44A 2ZR8A 3KALA 4KXXA 1Z7GA 3WQBA 2IT1A 4BAGA 1JPNA 2Q3EA 1GYPA 4WXYB 4QX6A 4FJ0A 3H05A 2YQZA 5JAQA 4JWKA 4PVCA 4ZFNA 5CA1A 1NVVQ 2FETA 2RARA 3UCXA 3Q7QA 1NN5A 1ZLXA 1F6DA 2RGWA 2WPDA 2XVYA 3CZMA 2W4IA 2WVJA 4YEDA 1EX9A 3SXPA 2ZBGA 5BUSA 3PNPA 1K2VN 3AGQA 4IH1A 4WV3A 3EIUA 1TJPB 3UB3A 4ITUA 1A72A 1PR6A 3G2OA 3A58B 4JI4B 3FR7A 1YJBA 2P1RA 1DIRA 2E9SA 2H63A 2PZAA 3E48A 3E9ZA 3EGVA 2P4EA 4FNAA 2L19A 5DW0A 5G4LA 2CMKA 4GLFA 1A8HA 1P6UA 2QMHA 2BBWA 3EVNA 1ZC3A 1RJGA 3QA3E 4RV4A 4WXHA 3VUEA 1Z06A 3E53A 4MS3A 4D9KA 3W0LB 1Y6JA 1I6KA 3U44B 3P0FA 4X00A 3IAUA 3DLTA 2Z30A 4P86A 1UOPA 1TRHA 4WOCA 5B1EA 1CJKC 3OT5A 2QX9A 3BDAA 3GDFA 3D5EA 4F91B 1KWKA 1PD1A 4QAJA 4ZK6A 2H2HA 2OGZA 1Q57A 5KWVA 3F73A 1PJRA 2VQ3A 5CLLA 5AM4A 1CEYA 1HG0A 1LA2A 4YI5A 3DE3X 1XZAA 1RU3A 5BYBA 2XJ9A 5KOJA 1DMRA 1V96A 2G83A 2HA6A 4AY2A 1N9GB 4GI3A 4KMRA 4ZWNA 1N0VC 4WRRA 1LY1A 2LV8A 3GRVA 4H16A 2NTVA 1JG6A 5DE3A 2W6JD 1NR1A 2VTKA 4Q4DA 2PV7A 2AMYA 5AKYA 2QHXA 3WAGA 1ZCBA 3AUXA 2A9JA 2BM1A 2H31A 4Y2GA 1LVUA 5K8CA 3GXBA 2PBZA 3OM9A 3NAMA 4I8DA 1GL9B 2PMBA 5DX0A 2AF3C 4E5PA 4F8JA 4YUAA 2JGMA 4OLBA 2WMOB 5IN5A 1NR7A 4I50B 2BDTA 2NTYC 3TSCA 1F51E 3MJEA 2NADA 3DUWA 5DM2A 1ZBDA 3AT1A 4JT2A 4QFDA 2RAVA 2HF7A 4QNRA 3JQ7A 1WXHA 3DBVO 1AO3A 3T34A 3A10A 4BRWA 2HHHB 4WPGA 4HGNA 4B46A 1NVBA 1TYAE 1OUMA 2E85A 4LTDA 1Z8HA 3LBIA 1OXXK 4TVBA 2ZIVB 2GCIA 4I4IA 1M1NA 1XTBA 2WF7A 3K9BA 4QC2A 3EDYA 5DEIA 3ZDAA 1M7GA 1XRMA 2YCBA 3M2PA 4J1TC 5K0EA 4XDZA 4AWAA 2JFNA 4ZZ2A 3PE3A 1YIAA 4P7KA 4U3JA 3S8EA 1Y0BA 1HE3A 2RHOA 3OIGA 4W1SA 3ZCSA 1YDEA