5K8CA

X-ray structure of kdnb, 3-deoxy-alpha-d-manno-octulosonate 8-oxidase, from shewanella oneidensis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
358
structure length
358
Chain Sequence
GHMSFKNFKVVEKMIFGRGSFVQLDDVLAAQRKADDDFVVFLVDDVHQGKPLEARIPVKAQDLLIWVNVDEEPSTIQIDALTEQVQAFNGKLPVSVVGLGGGSTMDVAKAVSLMLTNPGGSAMYQGWDLIKKPAVHHIGIPTISGTGAEASRTAVLCGPVRKLGLNSDYTVFDQIIMDSELIDGVETDQWFYTGMDCYIHCVESLEGTFLNEFSKAYAEKAMDLCRQVYLEDHPEKDDKLMMASFMGGMSIAYSQVGACHAVSYGLSYILGYHHGIGNCIAFDVLEEFYPEGVAEFRLMMKKHNITLPKNICKDLPDETIAKMVAVTKSMGPLWANVYGPTWEEKVTDEMLTALFRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-deoxy-alpha-D-manno-octulosonate 8-oxidase
publication title Structures of KdnB and KdnA from Shewanella oneidensis: Key Enzymes in the Formation of 8-Amino-3,8-Dideoxy-d-Manno-Octulosonic Acid.
pubmed doi rcsb
source organism Shewanella oneidensis (strain mr-1)
molecule tags Transferase
total genus 134
structure length 358
sequence length 358
ec nomenclature ec 1.1.3.48: 3-deoxy-alpha-D-manno-octulosonate 8-oxidase.
pdb deposition date 2016-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00465 Fe-ADH Iron-containing alcohol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 5k8cA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k8cA01
3CLHA 3UHJA 1XAHA 1VLJA 1JPUA 1NUAA 3QBEA 1VHDA 1XAIA 3OX4A 5HVNA 2GRUA 1OJ7A 1NVEA 3OWOA 5FB3A 2BI4A 3ZDRA 5BR4A 1XAJA 3BFJA 3QBDA 1KQ3A 2D2XA 4RGVA 5K8CA 1JQ5A 1XALA 1NR5A 1NVAA 5EKSA 1XAGA 3W5SA 3RF7A 2BL4A 1JQAA 1NVDA 3HL0A 4FR2A 4P53A 1SG6A 3IV7A 4RFLA 1UJNA 4RGQA 4MCAA 1O2DA 3OKFA 1NRXA 1NVBA 1RRMA 3ZOKA 3CE9A 4QGSA 1NVFA 1DQSA 3JZDA 1TA9A
chains in the Genus database with same CATH superfamily
4Z54A 3FNIA 1LNSA 3IAAA 4H1HA 3VHXB 1YR3A 3O6VA 3WVNA 2VBFA 4B8ZA 2Y1XA 1X13A 4JEIA 3WMXA 2I0FA 1ZCJA 2FYTA 3FTNA 5K3CA 3PJDA 3IV6A 2FY8A 2CXNA 1A96A 2WJAA 2YYZA 4LZOA 5FYDA 4EFNA 2DRIA 3BGVA 3LQ2A 4G1UC 1I7DA 1T6ZA 1VJCA 2L69A 3FPCA 4FONA 4HADA 4DXAA 3R9KA 3FNHA 1NN5A 5JNRA 5HIIA 3L1IA 1ST2A 4K2AA 2JLXA 1EZ4A 3Q9NA 4DQXA 1LY1A 2EARA 3DJYA 3RROA 2NSJA 2JAHA 1VM6A 4C01A 3HSYA 1LPOA 4BXOA 1HT3A 4HN4B 1QCZA 2I7XA 3NI2A 2BI8A 1TQ2A 4K88A 1OYYA 3AV0B 4GXQA 3RAFC 1KJ8A 3AI3A 2V3WA 4JK3A 2P9FA 3WKCA 4P4LA 4J1SA 2VS1A 1HETA 4D4KA 3ZV6A 3R6WA 3LHIA 4YECA 1YS2X 3KZCA 1U4NA 1USUA 4DDUA 5IWCA 4GPD1 4EEKA 2E2WA 5HX7A 1R6BX 2GARA 8MHTA 5LB4A 1J8FA 3CVYA 4IWYA 1JSLA 4HWOA 4TWAA 3DYIA 5IFKA 4RUKA 4DKJA 2WWRA 5EIEA 4BO3A 4MUMA 4X20A 3W1EA 1WZUA 3HA5A 1CJTC 4HTAA 3KZOA 5LMNB 2ZRPA 1DAPA 2A0YA 2CHGA 2D1QA 3F7NA 1OX4B 4PRZA 2C82A 4AULA 5CVEA 4JYCA 1JHMA 3IE0A 3W9YA 3ZLTA 3EEBA 1OILA 3NO4A 4UM5A 5EP2A 3RC9A 2J5XA 4U1RA 3D5QA 3Q2KA 4DYVA 4FSXA 5IABA 3QHQA 2IBMA 1AK9A 1XQWA 3PEVA 4RXUA 4U7WA 3R7FA 3X0DA 4ND4A 3CTPA 3WGYA 1OZHA 1TIBA 1F48A 4W7HA 1E9VA 4JN6B 1JGTA 1XZPA 3H13A 1H1LA 3QJYA 3M4XA 4Q05A 2P35A 2DAPA 1FIUA 1WUYA 3R3YA 1IJBA 5HQTA 4G07A 3B6MA 3PUZA 1JG2A 3BWDD 5B4VA 1MJGM 3NBKA 1C8LA 1NN3A 1M8GA 2WAAA 4AJ9A 2W22A 2ZT5A 1ODFA 3GEIA 1EIZA 1ZWLA 2XTAA 3CKMA 2FH5B 4RJIA 5EKXA 4MRSA 1FDRA 1XZBA 5MN6A 4TVBA 4ZPXA 5DWDA 1QCDA 3P26A 4Y2XA 3HJGA 2YWHA 2J3MA 3JTEA 4JSRA 4FCCA 1NI4B 2BP7A 2M1ZA 3ES9A 1C1HA 3TM5A 5A5DA 4C2UA 4CMGA 2YBEA 1L0BA 3AFGA 3WV5A 3L7NA 1UPUA 2ZVQX 3PEWA 4JMLA 1E66A 3TIXB 3VTFA 3CPSA 3H84A 2BRUC 4RETA 1NBWB 3NALA 1IN7A 4OQ4A 3WGMA 3EGXB 5F78A 3QYFA 4QQNA 2PH7A 5IBRA 1Q1NA 2PWAA 4ZHSA 3MEQA 4RHYA 4E2FA 6YASA 4E7PA 4IG4A 1QU3A 4EQZA 1K7YA 2I87A 2R0QC 4C4OA 5C5CA 1DKUA 2VP3A 4TL6A 2GF0A 3ASZA 5K0JA 1NZJA 3PR2B 4X6XA 4KFRA 3PL1A 3OTIA 3QW4B 4WCFB 1NVBA 1QGUA 5DCUA 2YHUA 3DGEC 4LY0A 4ZOQI 1SCUB 3VPGA 5KKNB 4KLCA 5DT2A 3RODA 3PNMA 3K9LA 4MO2A 4A4DA 4XFKA 5AM5A 3ZS9A 3KSAC 1PT6A 4QU5A 4HUTA 1QFZA 2BKXA 3EG9B 3VUFA 4C3VA 2DKNA 4I55B 2AJBA 2V54A 4OGKA 4A8JA 1PQPA 5KWSA 1KI6B 4NG5A 5JAOA 4R7TA 2ONCA 1LVGA 2Z1MA 4FNAA 4LQLA 5IDVA 3KFLA 5K2MA 4DMFA 5IYZA 4P0QB 3P4YA 4D6YA 1X8LA 4MDFA 3ND5A 1KQOA 1FDVA 2IBTA 1AUOA 1ZL0A 2RONA 4H4EA 2AI1A 4MS4B 1BXKA 2IVZA 1DIOB 3BA1A 2PRYA 3NOQA 3T9EA 1FJ2A 1P39A 2QAJA 3IJ5A 4BPBA 1IK4A 3G0DA 1PN3A 4IQFA 1BA2A 4P82A 2A0KA 4KBFA 1PVDA 2VTKA 2BGJA 4WK0B 1R66A 1KBZA 1QQAA 5JNVA 3LCMA 4L6AA 2WAOA 2AJDA 2G83A 3GB9A 3HY4A 3L92A 3SZGA 2I78A 3QH4A 2KSQA 3BF7A 4Z9AA 2PT6A 1X80B 4YJHB 4YP1A 4C06A 2WWGA 3R9XB 2OAEA 5BPFA 3ZDDA 5F3WB 3JVDA 2F17A 2FGKA 2JK1A 2ZBUA 1JLLB 4FYWA 2H2AA 3GXBA 3RU2A 3DUWA 3GIDA 3S2SA 1XMQB 3TFWA 1AX9A 3BRCA 4LBWA 3A9VA 1T2DA 2B37A 3HR7A 3MFQA 4EB6B 4E5NA 2A84A 2BV3A 2C3MA 2DPHA 4RMIA 1ZGBA 2CXSA 2BFBA 1XXHA 4FXPA 4RDXA 4XX0B 3WL8A 1ZOIA 2A7QA 3CWQA 3ML1A 1MVLA 3KDAA 3P7MA 1DUIA 3Q5DA 2FRDC 2QX4A 1AQIA 2ZETA 4A23A 1Q11A 4KC0A 5EE3A 3SQOA 1MD9A 2FXVA 4H7EA 1G98A 3IUNA 4CWAA 1NJ8A 2Q4EA 4D0LB 1K75A 2LZ0A 1OJ7A 1WVGA 3URMA 1Q1QA 1XZNA 4BYMA 3DOEA 2FR8C 3L7BA 5T3YA 4MUEA 4CV2A 4MDEA 4C2BA 1TYDE 1ABFA 1JMVA 1GPMA 1GY8A 1XCGB 3RDPA 3AP2A 3P2EA 3D3QA 3B5IA 2CV2A 5FYQA 3QP9A 3E0QA 1XLUA 3F3KA 3KUKA 1XD9A 2CE2X 2FFQA 2RHHA 4GOJA 3R09A 3BEDA 4UAVA 5IWAB 2V6GA 3IQWA 1IHUA 2WI8A 2P1ZA 5ICSA 2X5OA 2XGSA 4XGRA 3L01A 3EEOA 3OZRA 4K8RB 2FNAA 1H5QA 1T25A 1NLYA 1TL7C 2NU8B 1B8UA 4CKZA 2CJFA 2O0MA 4J6EA 1Q1AA 5AKHA 5IJAA 3NHMA 4C4XA 5FLYA 2GCGA 3O2SB 2LKCA 2O1XA 5K4AA 3WIDA 1KMNA 1QUEA 3GRRA 4JJZA 3AEUB 1G7RA 1HEUA 2NZXA 1JPVA 4MUXA 1MXFA 3HZRA 4ML3A 1KVQA 1G20E 2OAP1 2KPOA 3ZCQA 4F5ZA 5U1PA 4DDTA 3R40A 5K3EA 1D0IA 2PEZA 1Q17A 5DTQA 1N36B 2HSGA 3O8BA 1ADYA 3BSYA 3PWSA 4N54A 3QE2A 4K3UA 5EJEA 5AW1A 2OPBA 2W6CX 5TR9A 2DBRA 3F90A 4KQGA 1W6UA 1X15A 2UZ4A 4RPCA 3L6DA 1RJDA 3N2GA 1TD9A 3DYBA 4J91A 3ZLVA 3LBIA 4UHKA 1RT9A 1L5WA 5CXQA 5ALLA 3T4PA 3UAYA 4YX9A 4KQFA 4XUCA 2PJZA 2WHYA 4R1MA 2PX4A 4L4RA 4EENA 2NMVA 1R9JA 1MHTA 2Q62A 3LXRA 2PUEA 1U2DC 2ZS7A 3ZWDA 1EE1A 2AK3A 3EOZA 1GQRA 4GRIA 2OL4A 3ZKWA 3LCJA 2ZIXA 1IBMB 4N7RA 1YZVA 3ER9A 3EPHA 2OTCA 2F9FA 2GRAA 3O3OB 3O4JA 2YS6A 4IF4A 1HQCA 3ZU4A 4R54A 4BJ1A 2D5AA 5FULA 4QGAA 2G0AA 1GGMA 2HEGA 4Q9KA 2P2DA 1T2UA 4UTRA 1C4OA 4GI5A 4MKFA 2HJHA 5HJ7A 5F76A 4JP8A 4F85A 1XZIA 3DDSA 1CHDA 1J8VA 2E6KA 4QATA 4I5DA 1IONA 3E9CA 4XUEA 5KDDA 2HU8A 4HJXA 3KFXA 3OZCA 3WGQA 4DR6B 1TKCA 1UWCA 1ZNWA 3BE6A 1UDAA 2LE0A 2B5VA 3VI4B 1AKQA 2C95A 4ZVVA 3OWOA 3TLKA 4DCSA 4DWWA 4MQFB 1YU9A 2JJ1A 5JOQA 4W6QA 3CLTD 4XM1A 3FPAA 4G6ZA 5FR2A 3PB3A 4UUMA 5BSVA 4IMPA 3LK6A 2Q1SA 3I45A 4KX3A 1WLSA 1U0BB 1H22A 1KC1A 1GR0A 4O2BB 1TU3A 3V1UA 4BFTA 1T0BA 3COYA 1XQXA 3WIOA 2XVYA 5JBIA 3HB5X 4ZDWA 3BFVA 3GJYA 5KNCD 4TKMA 2GEVA 1Y8CA 4ZKEA 4AWXA 5ICEA 4NXNB 3WL3A 1LK0A 1A9RA 3C5CA 3EF1A 4RS4A 2Y8EA 1OC4A 2Q2WA 4QLAA 1Y63A 3UUEA 3ZU2A 1ZUNA 2FQ1A 4C2AA 4MR8A 4DR2B 5LCXA 1JNXX 2P0YA 2GEKA 2BISA 2XWQA 5FUBA 4V0KA 1DAKA 4TUYB 1SR8A 2X5NA 3B1WA 3RJMA 2IDMA 3TOSA 1EFRA 4M0CA 2VSFA 5KTSA 3ASUA 4EFLA 4RFLA 3ROEA 4ZC8A 3Q1LA 3EZXA 3T3GA 5J4KA 1Y37A 3FI0A 4MOWA 2NO1A 1D7AA 1MA0A 1BAPA 5DN6A 1TJYA 4LV6A 4G0PA 2BGNA 1HE1C 1W75A 3L1UA 1MFZA 3MELA 3PC4A 4R68A 2ZTSA 4FC7A 4D3DA 4ENTA 4RZXA 5JVDF 4M76B 2YZKA 3D7RA 4TT3A 3TAXA 4W5TA 3THYA 2V58A 2ILVA 3FTQA 2IP1A 3G0BA 1XR3A 2DCUA 2RBEA 3ITKA 3K96A 3NAZA 5K9ZA 1N5MA 1KBOA 3KEFA 3AERA 4L4ZA 4MPPA 1P1IA 3R2JA 4A6EA 2DGDA 1KE2A 3RASA 1ODSA 1GPJA 1E1CA 1RHQA 4LDPA 2YIMA 4ZU1X 3W5SA 3GDHA 2AEJA 2VJOA 4M0KA 4KR6A 2ZRNA 1P9WA 4YRQA 5KUTA 1JEOA 3PNBA 3HFRA 2WZCA 2AJLI 5ULLA 3O83A 2AJ8A 4P3YA 5BOSB 1UPCA 4Q7LA 3IL2A 5AJXA 1JR3A 1UANA 3GEDA 3OCUA 2OZEA 4E11A 3REGA 1B8PA 1N0HA 3A9SA 5LQUA 2H07A 1CJUC 1Y7HA 1FY2A 3FSJX 3OPNA 3MWEA 2HLHA 1LSOA 1UBLS 4NTZA 1QIKA 3IYLW 4P1ZA 1CERA 4Y2JA 3CRRA 3Q0EA 3TNJA 3U3JA 2P40A 3W3ZB 2L18A 3ZZUA 1YFJA 1H05A 1TCVA 5LR6A 3JSXA 4RYDA 2JAOA 1NVMB 1DU4A 5IM5A 3RYFA 1FTQA 3OY7A 2XF8A 3L2OB 3KOXA 3B1JA 3V7FA 5JUWA 3HCBA 4NS4A 3ZJVA 2WVHA 3HVJA 5FUYA 1GSHA 3LJKA 3TW8B 4LRTB 3U49A 3FCYA 4EPXA 3DOFA 1PWHA 1NMXA 4B3FX 4EJSA 4W82A 1CULC 2KWIA 4PO1A 3ZNOA 3FZNA 1ZXBA 2BZ1A 4G2TA 2QS9A 2DF8A 1GRCA 2F64A 3MJFA 3JW8A 4HAIA 4KFUA 3R8XA 2YNMA 3FHLA 4R8KA 4MWDA 4QTUB 1WO8A 1H1TA 2CDRA 1FK8A 4Z4EA 4EY7A 5BRAA 1UKAA 1YIDA 4JLOA 3TSZA 5D1NA 2IOFA 3QX9A 4M1YA 5GONB 3HYRA 1PYOA 4H0CA 1OGIA 1CEXA 3H65A 1T2NA 1CLUA 1R0WA 1WPXA 2WWXA 1GITA 1Z7WA 4PZDA 4QECA 3PIIA 1JR4A 1USIA 3D8UA 2YN2A 3E23A 3H6GA 4RE6A 5AKKA 2GPTA 1FS5A 2ADOA 2PJUA 1KMHB 5ALQA 1F2UB 1KI8A 1P3DA 2W2QA 4AI6A 2GUWA 2B4KA 2D0DA 2I71A 2QVGA 2X23A 4LJLA 4TZKA 2OFWA 2A59A 3GMSA 4R6WA 2XTJA 4P5PA 3EXIB 1ML4A 5I4CA 4F4JA 2JH3A 3VDMA 4B83A 1CYEA 2C84A 1VQ1A 3IXQA 2A1TS 4P4NA 4OLAA 1T91A 2VF7A 1BD3A 1LC3A 4FT4A 3O3CA 3PC7A 5IDWA 4IJUA 2FR1A 5HS4A 1Z8HA 4KCGA 2C4WA 1DT3A 2MSDB 3M2PA 3MJSA 4YXWD 3M9LA 3LI2A 4Q3KA 5HW0A 3ZUPA 3I5MA 1ZJJA 1XA0A 3NH6A 2GLXA 1JEQB 1LW6E 1H4VB 2B9VA 2MSCB 2O7NA 3D2LA 1Y48E 2BELA 2C00A 4KPYA 4PSDA 1J5EB 2JD2A 1L5LA 1EVQA 1XI2A 2OCLA 1Z18A 5H83A 2PUTA 5H5JA 4HD8A 4HMOA 1V2HE 4B32A 4W8OA 1BHJA 1FP6A 1EJ6A 2CE7A 2Z2IA 3QVSA 5CPFA 4XIIA 1V3UA 5AJHA 4QT4A 5ALDA 2QJTA 5CGQB 5EZYB 2Z9DA 3DQZA 4IZIA 2FG7C 1YUNA 2HIHA 1ISIA 1Z6QA 1B3BA 3AR8A 4GQBA 3UXMA 4CEIA 1SA0B 3FPEA 4UPEA 1K63A 2FQYA 4DCUA 3R6LA 3AHGA 3LAWA 2EFDB 4NBNA 2P27A 1D6JA 3UV6A 2V4MA 2OP1A 2PZLA 3A6FA 3DVQX 3NRCA 2Z58A 5CLQA 3KWJA 4CQJA 4EMUA 4FWIB 1O0CA 2ECPA 1OXMA 3RF7A 2WKQA 4KSYA 5F5NA 1L1FA 3X44A 4ON9A 5TQ2A 5AXCA 2RAFA 4YWJA 4D43A 1H85A 3BORA 2WV7A 5EJFA 4BMPB 1GL7A 1LJ8A 4FE7A 4LDRA 3CNOA 3DVAB 4H3HB 4K9MA 4LQCA 5KHOC 2C2HA 1LD3A 3CN7A 4MKRA 1W36B 1Y3DE 3OEWA 5KNDD 5DNEA 5TSDA 1Z0IA 1NFQA 1JALA 3C48A 4M9QA 4TVKA 5IS2A 1I0LA 4AO6A 2O05A 3OCCA 1SXJA 2M98A 3QUTA 5A4AA 4JSYA 2XF2A 2ZSUA 1AS3A 2FF5A 2E6UX 3CSDA 3HA7A 4GRAA 1K0UA 2Q8NA 4U00A 3VV2A 4E6EA 1SOVA 2CFTA 2CLKB 2CF6A 4O2AA 2JA2A 2X58A 1Q6YA 3G0CA 4OQZA 4A3SA 4BGVA 4GDMA 3QFHA 5DW0A 2O3UA 2YCBA 1W88B 4GS5A 1DNPA 4ZCRA 2ZRGA 2QMZA 2ZJZA 3FOAA 4GNRA 4PGAA 2WM8A 1FXUA 1KZ7B 4P53A 4XUDA 1TJ3A 2Q2OA 1P4AA 2R9VA 3N58A 3JXEA 4NMLA 5T4EA 2V9ZA 4ARBA 1V0JA 4BGUA 3W5VA 3X1YA 1JEYB 4E7OA 3CLKA 3PNKA 3HVIA 1JHPA 1ODTC 3BPSA 5GP1A 2GBLA 3ND9A 4B76A 1JT2A 1RYMA 4KIUA 3EQ6A 1KWGA 1UXIA 3RYCA 1CQJA 1ECBA 1FQKA 2GCOB 2CXOA 4OM7A 4REOA 1EFDN 3STUA 2WJGA 2PPVA 3G2HA 3NC4A 1JS1X 2FEPA 1YKSA 2H18A 5C46F 1CCWA 1J9EA 1KFKB 3LNCA 4IX9A 3ISVA 4N9QA 5EYPA 4Z1MD 1HDIA 2GCEA 1LW7A 2LBPA 1IJEA 2VOEA 3QOXA 5DOVA 4ETWA 4HAYA 2ZS9A 1E99A 4K9NA 4BWVA 5IH3A 1F2DA 3CYFA 3GAMA 4DSUA 1FPQA 1L4GA 4OXKA 1TQ6A 2IHTA 1O8CA 4Z5XA 5J59A 3HJRA 1VGVA 1OY1A 3H1FA 4J7CA 4L75A 1YA6A 1D4ZA 4C6HA 3FYUC 4LWPA 1UP7A 2DG2A 3P9IA 4TM7A 4K1LA 4CLHA 4OG2A 1XV5A 1JAIA 4NYJR 5EP3A 2X6QA 3QVWA 1EX6A 4ENVA 3LKVA 1ZM4A 2HSDA 3A1UA 3NOXA 1LS6A 5LYJB 2I6UA 4QXOA 3H9EO 5TEVA 1V6CA 4UARA 4DC0A 1QGZA 2OUIA 5ALTA 3ZGLA 1WRBA 1GZSA 3GEMA 3DLHA 5F2EA 4D8TA 4ENSA 4YGXB 1L8QA 2XNSA 4UBKA 4XWTA 4G5OA 3OAAA 1ZJYA 4GWGA 3TUJC 1VPLA 4BV2A 2ODTX 3D6NB 5D7BA 4Z7JA 4J43A 2RJ3A 1H2HA 1YCFA 1U0OC 1FJGB 1WSBA 3HGMA 3MWGA 4DCPA 3IIMA 3N2EA 1ZIPA 1GKIA 2AF4C 2AOVA 4M0MA 4N41A 3PRJA 1DC7A 4FDUA 4B6OA 2CNDA 2CVHA 4BBAA 3VNQA 3KZ1E 1FSGA 4V38A 3F96A 3CMCO 3RHTA 4ERNA 5K0BA 3WB2A 3PJFA 4GKBA 2CHEA 4WXHA 4EEZA 1N0IA 1K5DA 3AFMA 3NKLA 3ET4A 4U7HA 4CEHA 3NRBA 4TTRA 2RE8A 4MRMA 3PXDA 4OP3A 3BFPA 5DW3A 2J4DA 4ZAVA 2W11A 2WT8A 4J16A 1V3QE 4CIYA 4KKVA 2VJMA 4R2KA 3N9IA 3L6UA 1RQNA 5DM1A 5HCNA 3MQFA 2HU7A 4U2FA 1ZW1A 2VDNB 2VZEA 3HU2A 1VBMA 5C4GB 3ZEIA 2AQHA 1S2NA 2R1VA 4HWPA 3U2QA 1GZVA 1XB2A 5AOBA 4FKZA 1JA1A 1P91A 1G8KA 3B8HA 1I2ZA 1MDFA 4HX9A 5CRIA 3S2FA 1HLFA 1R9MA 1NIJA 4OQNA 4BCBA 5BWLA 2KLHA 5GVSA 4JXXA 4P9NA 1LH0A 1FMTA 3LO8A 4PZPA 4YPOA 2V0GA 1FYFA 1I1QB 1AUVA 1U8FO 5EIAA 3H97A 3G2IA 3SKXA 4BC0A 2GR9A 3FIUA 3E48A 3WZLA 4CKEB 3WK6A 1R0KA 4GX2A 4HWGA 1AQJA 5LP1A 1RM4A 2QAGB 1SQ6A 2J0QA 3IQZA 5DMHA 1E0DA 1JECA 1EA7A 4NCHA 5HILA 4DEVA 3FSGA 5C8ZA 1X87A 4WFKA 3ST7A 1T5TA 1Z68A 1XCPA 2HX1A 4Z1OA 1P62B 5CBPA 2W2PA 3CC8A 5NULA 3UAGA 2DU8A 2JFGA 4EZBA 3KEQA 2JLBA 3JD3A 3EGWA 3GLUA 1PJ3A 3Q9UA 3C14C 1JAXA 1RU3A 4IZHA 4Q34A 3PQ7A 4MQMA 1LRKA 1P1HA 2OD9A 2G1KA 1G0NA 2VDJA 1J0AA 1WXIA 5GJBA 1B6GA 1JVNA 3PT5A 5LBIA 1OLSB 3MTGA 5ANRB 3UH0A 4OO3A 3AVTA 3KKNA 1WV0A 1QX4A 2CMFA 3QSYA 3BDAA 3FUUA 3QYAA 4MUNA 2NU9B 3P4UA 1N1DA 2WWWA 3N1UA 3O8QB 4B0PA 2JIDA 3DBHB 1ZONA 4B7XA 4DOMA 4YAGA 2JJ8A 2HSWA 2VDVE 4UU8A 2VP9A 1YD7A 4BV3A 4KODA 4EY5A 1E1MA 2IHJA 3CRNA 2IKSA 4L74A 5EWMA 3AGQA 3DVSX 3L4KA 1VCNA 2CLOB 2CFSA 1CUVA 3EBPA 1VA5A 4I55F 2OO5C 3FIJA 4G37A 3L8FA 4A15A 4J0EA 4MLPA 1T3HA 5DF1A 3G7NA 1VLHA 4O1HA 2IIQA 2FN3A 2RBKA 5LYYA 3SJAA 4FCWA 4HFNA 4RA6A 3MBOA 1NKSA 4C7JA 1RFGE 3JARA 1QKJA 1AZLA 1OBFO 3NBMA 3QE0A 5K4GA 2Q6IA 3GFFA 2NP6A 3VVMA 3OU7A 3ILHA 4JLUA 3PXUA 3MCAA 4TL7A 4LVOA 4UNPA 1DDGA 3MWYW 1H69A 4ANFA 4TL9A 5G4KB 4ZN6A 4WKPA 1IXYA 1O6CA 2FN7A 3F7TA 1RW4A 1KEVA 2R8XA 4YJ3B 3LRTA 5EPEA 5IM4A 3EZ6A 2F3QA 1B26A 3MRXA 3HNOA 5IT0A 3KR1A 3V5NA 2ZYAA 3NJ4A 1KGSA 1F5SA 3BHNA 1YDEA 5ECGC 2FPSA 5KQMA 2QMUA 1ORTA 4O6VA 1K5GA 2X0RA 3HJAA 4NJMB 2BGTA 2IIVA 4IV8A 3L4SO 4OHOA 3PDHA 1Y7IA 1ZS9A 4JVLA 4UNSA 2BKAA 4UVIA 3SCZA 1E20A 2VHJA 4HEQA 5JLJA 3CQ9A 2G1AA 4OJMX 4EKIA 1GXSB 2C59A 3T61A 3CR7A 4RDHA 2XZOA 1XPRA 1R18A 4MYCA 4RO0A 4DLRA 1QDUA 1CDEA 2C94A 3GBPA 3KLBA 4RGVA 5TPZD 2E5FA 1SG9A 3NASA 1T2CA 4FDTA 4MP8A 3N2IA 1QU2A 4WUTA 5BSEA 1XZHA 4K9RA 3V42A 2YASA 3MSXA 1I30A 3H9UA 3AEQA 5JAZA 4MCHA 3IR5A 3RVBA 4WADA 3VO8A 4GI3A 2LDXA 1XUOA 1O97D 5EP1A 5CTAA 1YH3A 3ROPA 1T8YA 4V0LA 2BCGY 1FFXB 2WUVA 1J56A 5GZ1A 2QUIA 1NFFA 1W4CA 1OR8A 4PC1A 1QTRA 2WABA 1LQTA 2FQQA 3KOYA 4X1KB 2CYBA 3WADA 3EIHA 1TUEA 2IW1A 3K2QA 1L8XA 2QTAA 3MMPA 4BVHA 5HM6A 3X2SA 3FDFA 1CNEA 1J8MF 2J9FA 1PHPA 1PJTA 2ZAGA 3CZMA 3BQNB 2BW0A 1N25A 4UE3S 7MHTA 1KH2A 3WB0A 1ICEA 1JMYA 1PGOA 5IAKA 3UPTA 2E85A 1X9HA 5D1HA 4BQNA 4PWZA 3NGLA 1SVOA 1XVLA 2ZIZA 3KXDA 3WFJA 4G0MA 5LD2C 1BKSB 3ESAA 3DNPA 2O20A 4RJJA 3T1VA 3HB0A 4Y18A 3DFIA 1YQXA 4BO1A 4HWKA 3UMJA 4BX3A 4DIKA 5CG2A 3M8KA 4D45A 3M4ZA 4ZIRA 1Z2DA 7GPBA 2QVBA 4US2R 3ZVNA 2YR0A 1BEUB 1YFKA 2WIGA 1C2YA 5TGZA 4JGBA 4FZJA 1T2VA 3PE6A 2IHKA 3IDQA 5LQNA 2B92A 3ANTA 4EHDA 1AXEA 4QHYA 1E8MA 5KC9A 1P5FA 1ZH8A 2Q9CA 3NT2A 4NATA 3PQCA 4W9NC 1ECJA 4Z8YA 3WS7A 4KN6A 2PWPA 5JJ5A 2YTZA 5GJVC 2V98A 3BJMA 3VYTB 3KK0A 3Q7RA 3UYKA 5TQ0B 4FC6A 5FUXA 1I5EA 3I2KA 1LV8A 4J1NA 5B58C 1BX3A 2FPRA 3QJGA 5DX0A 3CUUA 3TEJA 2NW6A 3VO1A 5TARA 5J4VA 4C0KA 4LFBB 1XJ0A 2RCYA 1OC2A 3CRW1 3M6MD 4HLNA 1G21A 1ZCAA 2Y93A 2YWJA 4DABA 3DUFB 4CMEC 3COPA 3FYCA 2IZ5A 4RE5A 3HCAA 3H0EA 4TMFA 5EFOA 5B2ZA 3EZGA 3MS4A 4E33A 1DS6A 3WGIA 2VF8A 4R16A 2IGTA 3RS2A 2XZTA 3OC6A 2G9VA 3QKSB 3AVWA 5A0TA 4JHLA 5GPBA 1N9KA 3D8BA 3DLAA 1GFSA 4JI1B 1KO4A 3AR7A 4YP0A 3GP3A 3G0HA 2X9VA 1DIBA 2AA3A 3DV2A 4DUPA 5CX4A 1BDMA 1DC3A 2V55B 4P3NA 3ZJ4A 3UMFA 1OU4A 2EERA 4IV0A 3W3AH 4X8LA 4OHMA 3WGKA 5HWSA 1Y1LA 3OTOB 1R6DA 1COZA 1WEHA 4IDQA 2K87A 1WDMA 2MT9A 4JUIA 5TNXA 5GZ3A 4KQJA 4X61A 1XK7A 1YR9A 1WJGA 2FPIA 4BNNA 2OHFA 4MA0A 2XB9A 2FPPA 3LUGA 4J1TA 1EAMA 1XMVA 4U5QA 5K0GA 3E1GA 4QICA 1Z13A 5C4MA 1QTQA 1T6YA 4HFRA 1BXRA 1LEHA 3ORFA 4QRDA 4AZTA 1GKYA 3MLEA 4MV7A 3VNSA 1TC1A 1UMBA 3DEZA 5DN6D 5BVHA 4XWKA 4O2BF 4A0HA 2JFBA 5TVGA 2ZJBA 1Y6RA 1KEKA 3I4CA 3TK1A 4XKJA 5AH0A 4LZPA 3GY0A 4TT3D 2A3NA 2M6LA 1VL0A 4QWWA 2VSXA 3L04A 3N5CA 3GQBB 1ZR4A 5HKLA 3QEKA 3T7SA 3FF4A 2Z6QA 2H51A 4Y0AA 1JIQA 4YDRA 4EKDA 1E2GA 4FK8A 3K4HA 2B99A 4D99A 3UJ7A 4PLYA 2XHEA 4IVPA 2PZKA 2E18A 4RY0A 4BX8A 2GPBA 4XPIA 2Q0XA 2VK1A 1M7GA 3O8NA 5B36A 3RS3A 4ZI3A 1QR2A 1D5CA 3D6TB 5L3QA 1JR3D 2M2IA 2HWUA 4XSVA 4KZKA 4RH1A 2FEKA 2O5VA 3SVLA 2Z98A 3PKZA 2HCFA 2AWNA 1OLXA 3GZJA 5EE1A 3GA0A 2PZMA 3EH1A 5C9ZA 4MO9A 2IHVA 2AYZA 4PAOA 1NQVA 1IHDA 3IRUA 3IULA 4AXBA 3LLMA 3U7FB 1RLTA 1XJCA 4OKIA 4HXYA 2VUUA 4A8TA 4RQUA 2BE7A 4I50A 4LS3A 1K8ZB 1TA0A 3LYUA 3CG4A 1F8XA 1XTRA 4FX2A 4Y2HA 5CLHA 3S2GA 2Y4OA 3BZBA 2HJSA 3UEOA 3HYLA 4C0LA 4Y30A 4DIDA 1II8B 2HT6A 2QPOA 3NFYA 3ZXSA 3BVPA 3BE8A 5DHAA 1NOJA 3AY3A 2OYCA 4M1WA 5FB3A 1JHVA 1IQRA 5FR1A 3GG9A 3NDJA 2ZTUA 2IU4A 5GINE 2YNMD 1BXZA 3VHLB 4BEBA 2O3JA 4FTWA 4HZUA 3OMXA 4IAOA 2G25A 1M7BA 4KFSA 4OQYA 3RU7A 1JDZA 2DYKA 3LUFA 3KS9A 1CVRA 4DR5B 1NU8A 3HCCA 2O3QA 3TMYA 5EZ6B 3U3RA 3WYNA 3ZHZA 3GT7A 4KSBA 4YJKA 4MW5A 2ZB4A 1YZNA 1J0BA 2XE7A 3M89A 4DRXB 5IDQA 3VU9A 5KSZA 2H85A 3H8VA 3SVTA 3C0KA 3PC3A 3FPLA 5CXXA 5DT9A 3P2OA 1S01A 2RHJA 4PZYA 4NR0A 1U5AA 5T6MA 4CLRA 5AW6A 4X1IB 1EP1B 2YIVX 3GAZA 5ALFA 1Z0JA 2V6FA 4B34A 3MAAC 2Y1KA 4PYJA 4OJYA 2RG1A 1D09A 1VB5A 1PZHA 3G8BA 3UGKA 621PA 2WFLB 1JIUA 4LYGA 1KOFA 3HWSA 3ZX5A 4ZAFA 3IKMB 3WFZA 1LX6A 4OHCA 3LBFA 5TS2A 3LPNA 1D3AA 1KHHA 1UXJA 3MM4A 1EI9A 2JLVA 1W9MA 3JS5A 1EXVA 1KI3A 1DFGA 4Q00A 2CZQA 2N9UA 2Z8YA 3C6KA 3GFOA 1XDUA 3Q6NA 3RGWS 4A82A 1HOTA 4LMRA 1F1JA 1P7CA 4JB0A 5GONF 1Y3BE 5J3JA 3JQGB 2VDLB 4DZTA 4O1IA 3M1AA 4ER6A 3DKKA 4K6GA 1CVLA 5KVVA 2D2VA 1A1SA 1LLDA 3P0HA 4G4SO 4HAOA 5G3YA 3V00A 1KI4A 4AKEA 4UAJA 2VK2A 4M22A 3ANSA 4GQIA 3BG5A 1JYSA 3H2BA 4JEHA 4AMZA 1KI9A 5E8JA 2IPNA 1VSBA 5JDIA 5MGBA 3C3EA 3HMKA 1UBJS 2FMIA 4K6KA 5HM8A 3T6KA 2I54A 1UFOA 5FHRA 2FPLA 4X41A 3RQIA 4F6RB 1ISPA 3MJEA 4Q48A 5KU1A 2X14A 1T9ZA 4NCXA 1Q0ZA 1Y82A 1LSJA 1J21A 1P2UA 1R6VA 2IYLD 4LNUA 4UFOA 1Q95A 4A9AA 1YS1X 3E7XA 2HV8A 4YHBA 1WOMA 1CEQA 1QE3A 3AP3A 3GMDA 2XX3A 3HXLA 3L46A 4XIJA 2C8LA 4RQTA 1BS2A 1SHLA 5LLTA 4KMSA 1S3IA 1XLTA 3FZGA 1OXKB 5KTKA 3ZNNA 4I4TA 2OB2A 4Z0PA 5EMHA 5BORA 1GTMA 3VA7A 1OI3A 3SX2A 4RH3A 4YHHB 4JJEA 1H2EA 2RGAA 3IURA 5EZYF 1SXJD 1RJWA 3KNZA 1BHSA 1UIRA 1YQUA 1UADA 2Q45A 2ZB7A 4ZJYA 3V4RA 2A9QA 3NIDB 4BASA 1A9QA 4GMHA 4MGEA 2C4KA 1Z74A 2P1RA 3BTUA 2PG3A 4KWCA 2AYYA 4X8MA 5KTMA 5MGNA 1Y6GA 3ROFA 4LF6B 1Q7CA 1C9YA 5SZIA 1XF9A 2YWBA 4LECA 4XQEA 3PWKA 5ESDA 4PHFA 4RKEA 1MB4A 1DX6A 1FS6A 3QVLA 1RBMA 1YHYA 3P94A 1TF2A 5FXMA 2CGEA 1EWRA 1NVUQ 2Q9UA 3H4IA 1QBGA 4MSUA 1P5ZB 3R7NA 1VL5A 3ZJUA 4QEZA 1QG4A 2XCIA 1VPTA 4N0MA 3RREA 3S8MA 5C3MA 1AMNA 4R8VA 1E6WA 3D7MA 1E2LA 4AF6A 1DG1G 1PX0A 2OECA 3NP7A 2VP0A 1A98A 2Q28A 3FMOB 3L4BC 5K3DA 1JTFA 4FB4A 1IPFA 3QEMA 3L0PA 2XD9A 5JMOA 1NM5A 1QZZA 1E2UA 3ETJA 1GA6A 1J9ZA 1KP2A 3LWDA 1FMJA 2PH3A 4GI2A 3HC7A 4Z2AA 4ENRA 1XMPA 3AEKA 1OVGA 2DBQA 3SIWA 2IHYA 1C1DB 2CKDA 5HF8A 1N9ZA 2X4DA 5HFJA 3D2BA 1OIVA 4MGHA 3BTOA 4I1IA 2OHOA 3EH2A 3V33A 3NIBA 1GNVA 2P5YA 3IX7A 4LE1A 1K8RA 5IPFA 4RTPA 3THRA 1DGQA 4PM4A 1GFWA 3HKEA 3JAWB 4WZBB 1QE5A 2BZ0A 5DBGA 2ZUTA 3GLFB 2R6GA 1MH9A 3ZXIA 5KOJB 1I10A 1YBMA 2AL7A 2VLIA 3GWGA 3HKCA 2C3UA 3FH0A 2EWMA 2QI9C 5F4BA 3WA6A 2IUSA 1KYXA 1SJ9A 4MV4A 5L53A 4OTZA 3WLQA 5F1OA 4LF4B 2WHEA 3OAAD 1FTGA 2OGZA 3IAS6 2YVAA 1UJ4A 2CD9A 2QNBA 4HH1A 3ZJTA 2JVKA 5ERXA 2H9YA 3SD7A 3S81A 2X15A 1V5IA 2V9CA 3O8OA 3EPKA 5FPYA 2ODAA 4I1RA 3LVRE 3MC1A 1J49A 1K5PA 3EIXA 2BFMA 1FYXA 3I83A 2C97A 2W2TA 3GJ3A 3R5XA 4GBJA 2GSDA 4UUPA 2ZSFA 1Q0SA 1Z7GA 2X2EA 3NYWA 3UJPA 4G67A 1KYWA 1RAAA 1KS9A 4HVAA 1Y5NA 1EVIA 2B98A 3DHWC 1L6IA 1T4CB 5F52A 4Z7OB 4WZAE 4E07A 1FQJA 5T3UA 3T1TA 1J07A 2HDHA 4C0HA 1C0KA 5JIBA 3RS7A 4H16A 4DR3B 1V8DA 2FKNA 2D2IA 5LYJF 2C2MA 1YMQA 4MV1A 2APJA 3PHHA 1V4VA 4IHJB 4NRDA 2GB4A 3ACDA 4QOSA 3EWSA 5H0IA 4XYLA 5L4LA 4TTTS 2OMEA 3TGPA 1PNTA 1RS0A 3LF1A 1T1GA 2ATCA 2XSZD 3KDPA 3DWGA 5THKA 1FX0A 3V1TC 5JO0A 3QKWA 1ZMTA 3FW1A 3SM9A 1IHYA 2QW0X 2J67A 1DAFA 2P6OA 2VNAA 3AXTA 4WNAA 4X0EA 3WDSA 2FQXA 2EP8A 2B8NA 3DOOA 4KUHA 4Q66C 4TV8A 1MW9X 3UQZA 2B25A 3MD0A 4BCDA 1C7IA 4ZMRA 5LP6B 1ORWA 2R00C 4KQIA 4LOJA 4DG5A 5DOZA 1NI3A 1IH8A 4IEIA 3HZZA 3AEXA 2Z2KA 1J2EA 2Q6TA 1PJBA 5UKDA 4G0ZA 2VTEA 3V1NA 3TO5A 4WESA 2AOXA 2KBEA 2P11A 4G5RA 2LR0A 3QUAA 2VQFB 1Y6ZA 1T8WA 3DWIA 3WK9A 1UBOS 1T4BA 4YRFA 2X4GA 2XKBA 4FB5A 4AQYB 3WTBA 5CT9A 5G4KA 4KQCA 4WDRA 4BUCA 2P3SA 5BSUA 2D54A 3TQIA 3SSMA 1H2BA 4L78A 4A5SA 4ZYTA 4QG3A 1KK2A 4B09A 1RM0A 4I3FA 4CLDA 4B4KA 4KLNA 3EXHA 4TLMB 4TRMA 2HNAA 2JASA 1FMFA 3S8EA 5EUQB 1I1OA 2EX0A 2JVJA 3C41J 3D7SA 4P4SB 5KSWB 2GNOA 3OQNA 2FOXA 3AHHA 5LU9A 2F1KA 2R79A 4U5XA 4NDAA 3RVDA 1DAHA 3EHDA 2IEZA 1XQYA 1YTLA 5JZOA 1TQ4A 2R6FA 4M0UA 4WNYA 4AICA 4AJKA 3GCZA 3KXIA 2I2CA 3GJ5A 2FMXA 3HB1A 1QPGA 2NZWA 3ZQJA 4AZSA 3NP9A 4F1KA 4ZGWA 4MRPA 3K5HA 4ZI2A 3HGQA 4K9DA 1V45E 3U7EB 5J43A 3DZIA 1OCEA 4J9VA 2ACWA 4U3JA 3HJNA 1HG0A 4OL0A 5CK4A 4XDZA 3LA8A 1R37A 2ON6A 3LW8A 3M33A 1W59A 1E5XA 1T9BA 4FEGA 4D9EA 3FWZA 1SVLA 5A02A 1K3TA 3D59A 2OCXA 2H4FA 2MWMA 1M2HA 1AE1A 1LBIA 2BDUA 3VBEA 4D26A 2X7JA 2CCGA 5FPPA 1K6JA 4ARSA 2FW9A 2C7QA 3RC1A 2OO7A 4EA9A 1JZSA 1Q1GA 2ZQ5A 4KR0A 5LNK6 1SKQA 1UFRA 3PHGA 5HZGA 3W04A 2C5GA 3QA3E 4BQEA 1PJ4A 1AXGA 3WICA 4EJ6A 3SS7X 1IQ0A 2DHCA 1IXZA 4XVHA 3QEAZ 1AGPA 2G7MC 1UC8A 4JZKA 4FHEA 4RFSB 2JKZA 3HN7A 3W6UA 3VTAA 1AZTA 1ZGHA 1H4SA 1QIHA 2PKQP 2CXHA 1M8JA 1TJ4A 3AEYA 3BMNB 3D1JA 3KUXA 3USCS 5I4IA 1B15A 1N5LA 3GVCA 4KN9S 3D0KA 4U9HS 5AI8A 4B47A 5HXAA 1ACMA 4J0JA 5C2JB 3MBIA 4FSHA 4OP2A 4TTSA 1U0SY 3SHTA 1MFPA 4N5LA 4R8SA 4WCDA 3UENA 3J7TA 1NE2A 1XEXB 4UMEA 2A4KA 3GQVA 3V34A 2WLSA 3V8PA 2P75A 1PVOA 3E84A 4GM1A 5J2UA 2BH9A 3EAGA 3EFOA 4NBSA 1EYZA 1Z26A 3FE2A 2Z2XA 3FETA 5CH8A 3HY6A 4YJ3F 2AC2A 5ELLA 4ZARA 3J81k 3MWDA 1CY6A 4NBLA 1TGYA 4XXHA 5JISA 3WAGA 4TMKA 2BFEB 4G4SP 1M0WA 3RUDA 1FUUA 4BNFA 1WCXA 3C3BA 5FOSA 1SELA 3NNDA 4PIVA 5AJTA 3NEJA 3U40A 4E21A 1BX0A 3I53A 2DFPA 3VMFA 5KNBA 5FBRB 2DM6A 4XYBA 3T99A 5A4FS 3A25A 2JZCA 2H1FA 5LFAA 4OXRA 1U4OA 1UFQA 2EZTA 2FCRA 2AEMA 3N2KB 1JAHA 1E6MA 1PQ4A 4G85A 5B1DA 1FCJA 1JKJB 1UMCB 5AHXA 2LWIA 3QEBZ 2I29A 4GPAA 4YMTA 4BV8A 2BJWA 4G0OA 4MV5A 3MTQA 3OT1A 1UKVY 3D3WB 3EGEA 1DFIA 1Z3CA 1ZM7A 1E2BA 5HGJA 4JC5A 1AQUA 4MRRA 4L0DA 1VCOA 5B12A 2EEZA 4YROA 4BTEA 1ZDMA 3TL2A 4HPJB 4PGFA 1RZVA 5I45A 2J32A 2PRSA 4QNNA 2H3EA 2VEDA 4D56A 4GP7A 3A28A 4C6RA 1JFRA 2PGLA 5I5GA 2N1MA 3NQ41 3TTWA 3ZXUB 4X65B 5JXIA 1R9NA 2JH9A 3P32A 4TXMA 2Q5CA 5KB3A 3VNUA 5HUJA 2WMOB 2QD4A 1UPFA 4ATNA 4XQGA 2WG2A 3K53A 4OV6B 4BU0A 2X9NA 2YIDA 4LTMA 4R1UA 1ESEA 3QVGA 1HA3A 4I2NA 3WNBA 3X2EA 2OWEA 2WIAA 3KHTA 3KU1A 3VBCA 2JCGA 3Q98A 5TE9A 4ZTUB 2XGOA 2F3PA 3BXXA 1RWBA 1PW7A 2PX3A 2VIIA 3OF2A 3EEFA 4PNPA 4TLDA 1OD6A 5AK5A 1QLHA 4F3YA 5F98A 4D82A 3SF8B 4M0FA 3BL6A 4EG4A 1VI6A 2QLNA 3CH6A 2GEDA 2VFAA 3C3XA 4FN5A 4M53A 1N5KA 4YRLA 5DGTA 1YQDA 3K0CA 2CBZA 3S1SA 2VA9A 2G40A 3CUKA 3G49A 1RADA 2C42A 3L6OO 4WT7A 3RNOA 3GUUA 3ZLUA 2EATA 2BD0A 3JY6A 1Q7RA 1HDXA 3MMXA 1FDSA 3WJAA 2VZLA 3A4LA 3UN1A 3JQDA 4HDRA 1QRAA 2E89A 3TB6A 3VU1A 3M34A 4EBFA 4Z4GA 4XVRA 3NH9A 1NVXQ 3CONA 2RC5A 3I0ZA 4UTOA 2R6JA 4GP6A 1OXVA 4NEHB 4OOEA 3HKBA 2OQVA 5JADA 1EE9A 2X1VA 8LDHA 4Q37A 2COUA 4OAOA 5TT1A 4YMWA 1CJKC 3ZV5A 1SCJA 1UMDB 2RHRA 2W8BB 4KE6A 2LV8A 5KSPA 4D9BA 2PX2A 1FQOA 5JCZA 1TAUA 2GYUA 2Y1WA 3F7OA 5AESA 2A5DA 4F93B 3QLEA 3TS1A 2VF5X 2ZIAA 4CV0A 3KL2A 3A1EA 1UJ6A 1FMLA 1YC5A 4UHEA 1U8UA 3ADCA 5CGZA 1GQ2A 3KYJB 3R3JA 1YQQA 3R4CA 1WVMA 2FZLA 5TGTA 2CY0A 2OXRA 3BGOS 3MJHA 4ARAA 3ZI4A 4EX6A 1P45A 1LF5A 3AKCA 3CCFA 3FDZB 4HVCA 3OQJA 4M37A 2I67A 1ZI6A 4OUKX 1DIGA 4S12A 4RW0A 4IJWA 4NONA 5LXTB 5FRDA 2FN4A 3WGLA 2VUTA 3B12A 5BR8B 4BIIA 1QRRA 4QO7A 1XTJA 1WXHA 1E94E 2NAPA 4MW7A 2QVCA 2FWNA 5CH3A 3C4QA 3W2TA 2J4FA 3CF0A 3QLJA 1GUAA 1QR6A 4D25A 3W5CA 4BRWA 1E3MA 5JPCA 1EFCA 5I9LA 1AV6A 1DJLA 2YMPA 2ZIEA 4CM8B 2C2GA 2P6PA 1GPKA 4FYMA 5BP7A 3GPIA 1T6XA 1KTVA 1E60A 5CLIA 2MJLA 2DXIA 4RY9A 1HE8B 3U0VA 4QJBA 2IZOA 5EIOA 1V9LA 1L5RA 2OXFA 2C3PA 3HV0A 4IFIA 3T7CA 5INTA 4HYQA 1GPNA 3V4OA 5JPDA 2P67A 3VAZA 3CKKA 3I61A 5L8VA 2P6NA 1MORA 3K9FC 1FLNA 1NQWA 3L6CA 1FS4A 4NQRA 4TX1A 3GGPA 3MTDA 3NUQA 1EUCA 1AKNA 1GAQA 4WA7A 4UPVA 3NATA 1B3RA 1E4OA 3CINA 3DOUA 2Q29A 4R0VA 5DEIA 2O5CA 3H8JA 4RJKA 4V02A 5TQJA 1M8FA 4YRBA 2C2WA 2PA3A 5FNVB 4YH1A 1JPJA 3FDJA 4OA5A 4EWLA 3QNMA 3VH2A 2AT1A 3G2KA 4U2KA 3ZQUA 1CZOA 2DTEA 4UULA 4DG9A 3ZVKA 1GTZA 4B79A 1SBQA 2JEOA 4JLNA 3VNBA 4DIEA 3N8HA 5C7YA 3LT5A 5L7TA 3EGDB 1UPAA 3DDCA 2H08A 3QPCA 5KBYA 2DCMA 3EEQA 1G7CA 3NPAA 4PAWA 4GFDA 7ADHA 3CZRA 2WTMA 3HP7A 3MWLA 3RFVA 1YQEA 3CVXA 5CFMA 2G7ZA 5FUQA 2REQA 1F06A 2CDAA 1NULA 1WMEA 2GTIA 1I6MA 4QOGA 3TLGA 3PF8A 4DCGA 4NCKA 1U0NA 1ZLYA 4MS1B 4IIJB 4MTCA 1WZCA 2ZB2A 3PUKA 5D00A 5CD1A 1H2XA 2FP4B 3EZNA 3H86A 3P8ZA 2I6SA 2I1VB 4REQA 1F2VA 1YJCA 2ERXA 2XIQA 4MGIR 5I01A 3EK2A 2YS7A 4H17A 1AF4A 1SFRA 1V35A 4ESVA 2E0IA 4JQZA 4MQ6A 2SHKA 1PJCA 3MMZA 3QLUC 1PJ2A 2PS9A 3UY4A 4JP3A 1KDYA 4E2YA 3OE5A 5ED4A 5HG0A 1E2PA 1SPBS 4MI6A 4Y9UA 2HJVA 2NO6A 4YAUA 1OLOA 5KDLA 4DC1A 3PXCX 2IV7A 2GF2A 1A71A 4KXVA 4FOSA 3BA6A 1U99A 2BEWA 4XFJA 1TM3E 3OQHA 5JE8A 2HIAA 4BNTA 4PSCA 4F7WA 4M6WB 1DRVA 1M74A 4PR0A 4R9SA 3UYLA 1EBBA 1VKNA 1A27A 5EE5B 4D3YA 1K2WA 4ZVUA 6LDHA 5DASA 1DEHA 5EJ8A 1HYEA 4D9IA 4ZYLA 4OHUA 3UAVA 4ARZB 1ILWA 4M2LA 3TTVA 3ZHVA 5CFRA 1J39A 2ZRIA 5LKRA 5I7SA 3HCFA 2OD7A 4HO1X 2H48A 4QOEA 4UHBA 3FTFA 3G8AA 1Q22A 3ZQ4A 5JEDA 1N9GB 4OI1A 1GRQA 4JI7B 3GRZA 1GZ4A 3PRKE 4OLJA 4B81A 2FSHA 4RANA 1ULZA 2QZPA 3JWJA 3ZH9B 4GSKA 1PR4A 1PZNA 1WF6A 3U60B 1A7UA 2ISSD 4LOLA 4DYHA 5SYNA 1U31A 3LXUX 4XD7D 1Z0ZA 4G01B 1JAYA 1JW9B 1NBMA 2CL0X 2QN6A 3EW9A 3K2IA 2NYUA 1ETUA 4DREA 5FBKA 3KEMA 2HBQA 3D9QX 4LOHA 5DE3A 2JIZA 1LDYA 2Z5LA 3B1VA 3B1ZA 1UBHS 5F2NA 4TLEA 3MCVA 2PGIA 1J0CA 4K05A 4II2A 1XQ9A 2HMAA 3HSKA 3KCNA 2CJXA 2GH1A 3EQ2A 3R7WB 3F6RA 3WGVA 4DA7A 3QX8A 2FEOA 4RA9B 5DYNA 3PNVA 2GZAA 4IIDA 2ZJ1A 4I1PA 4NVRA 4AJ4A 4AD8A 2HLNA 5JR3A 1RVV1 4QPNA 2PUJA 4ONEA 2VJLA 4RC9A 4CR8A 1GKLA 2JBWA 5ILQA 5DWVA 3CY6A 1HDZA 2YVQA 1X9IA 3FFTA 3LFUA 1ZUIA 4PPQA 5K3FB 2C78A 4R9UC 3IUBA 3PHLA 3QPAA 1KVTA 3TL6A 3W6ZA 3E5NA 3AIOA 2Y2UA 4OIFA 4RXTA 3JQFC 1JFFA 2V5VA 3M6UA 1QVAA 4I2VA 2H57A 4JWKA 2VT2A 2BHLA 4WXMA 4QXAA 1C3VA 2PVSA 1QC5A 2H17A 1CRWG 1CQXA 2NSHA 2WHPA 1KL7A 4GXTA 4WN9A 2PIDA 5F1PA 2GK6A 4AZ3A 3DD1A 4AN1A 4UASA 1QS0A 2JFNA 5B1YA 1YF3A 4F9EA 3VAYA 3PNYA 3FD8A 1FSZA 3AFNA 4QAJA 4BL5A 4HNSA 1PL0A 4QA9A 3BZWA 3C8HA 3OOJA 1YI8A 3TMKA 1G8SA 2KQUA 4EY6A 1YOBA 5BV0A 3MD9A 1OFUX 1O77A 3ZWAA 2Y3IA 1U0EA 3IAS1 4EA7A 4EFDA 2XMBA 2NQ8A 1HLPA 1TNDA 4IJVA 1V6SA 3HEAA 1IATA 1VKZA 4IDNA 2EJVA 3GAAA 1AQ6A 2C9MA 1Z6PA 3QMVA 1EWYA 4IGFA 4BB9A 1Z62A 2BEVA 1HSZA 4N4AA 2C0PA 1TEVA 3FOEC 3A3YA 2L42A 3D6AA 5AVJA 3DDHA 3C1UA 4F2WA 4RQBA 2VRCA 1NBHA 5LN1A 4DM3A 1W1UA 3DL7A 2JGAA 5KYXA 3LY9A 1K9SA 1E1NA 1I9GA 4XGQA 1PTJC 3E4CA 5M7EA 5AKJA 4O4HB 5IN5A 4LN1A 1VYVA 1XQ6A 3N7AA 2BEKA 2DWUA 3EZ7A 3MRVA 3WC4A 1RKXA 3LKDA 3KJHA 2QX7A 5ALNA 4JI2B 2GZ2A 2GN4A 4TTQA 4CIAA 5FAKA 1RBYA 2WPNA 2ASEA 4ZT3A 4MV0A 3X2FA 2P9YA 2EKZA 2AG6A 1I3OA 4GYWA 3AW9A 4CF5A 1A2BA 3RTAA 1Z4IA 4TQGA 1T0JB 1EUDA 4H60A 4L7QA 1UT8A 1G3MA 1HDGO 3L0ZA 2RHGB 1R4MA 4KK4A 3REOA 4WCVA 4IDOA 4FFRA 1JQAA 2GEBA 3KV3O 3HMQA 2V3CC 2UZ1A 2QJOA 1WHSA 2DP4E 1YB4A 1NONA 1SG6A 3QRWA 3V2IA 4BNZA 4QUAA 4U4AA 5I8WA 4JIMA 1Z5PA 1GL9B 1BMDA 3IP8A 4WWHA 3IUSA 1IXRC 3ZLBA 1BW9A 2PKXA 3GEEA 3QEOA 4Y6QA 4P08A 7REQA 5KYVA 1ISSA 1H1LB 5L6MB 4Q7EA 4BNJA 4BE9A 3V4ZA 4O4IA 1LI4A 1L4HA 3CZ9A 3OT4A 4QYWA 3BUSA 1EDDA 1UMKA 3R3UA 1Z07A 2ZJAA 2ZWOA 4R81A 2XGJA 1FFWA 4NC9A 5ARDA 4PLCA 1HORA 3QLTA 3Q87B 4FDLA 1JNYA 1MX9A 3CEAA 3AT1A 1Z5VA 4J0GA 4ZAZA 3TB4A 5J4YA 5J40A 3T9DA 3QBTA 5IKEA 5JAQA 3I5AA 2BP7B 3I23A 3Q0IA 1RAHA 2GA8A 2PR7A 2V7XA 1USGA 4IW3B 2VRNA 4EPTA 4MJ7A 3RRJA 1RRMA 2EGUA 4KDCA 3WBFA 5D8DA 4PN7A 2NG1A 3VR6D 1CP3A 3AYXB 2ZLBA 1EDOA 1KO7A 3AOEC 5B1IA 4EGFA 4H4DA 1E0AA 4G1MB 5HUHA 1TM1E 3QTLA 1UCFA 2H65A 4LHZA 3PXAA 3KWFA 2WJVA 4IG9A 4RVOA 3LLUA 2J0VA 3MRTA 3G2NA 4FKMA 4LSWA 4RGYA 3B3JA 5I7VA 1MABA 5G0SA 2JLYA 2I3GA 4O4JA 1QJ4A 4UM7A 4ZQEA 5ENVA 1QGUB 2H2HA 2H1CA 4UUOA 5CHYA 1ONSA 4MWTA 5DK6A 2AG5A 2HA2A 4DANA 3AKZA 1Z2AA 4IHJF 1A77A 2BR5A 1TXGA 1ZHFA 4WLVA 3ZIUA 3EVTA 3OQ1A 4A8JB 5LZ5A 4JVMA 5KMGA 4B7AA 1NQOA 2WRZA 2PUAA 4R1TA 1EESA 1C7ZA 3G3EA 2ZK7A 3DZJA 3PXXA 1KA9H 1XZQA 3RIYA 5BYBA 5JHHB 1M2EA 2G07A 4B3XA 4FZVA 5ENDA 2VTBA 3CX8A 1V41E 3ER6A 5AFSA 1VCMA 1WW8A 3U26A 5LNK1 1W76A 5EOVA 1FRVA 1KIMA 1DO0A 5CURA 3V1KA 5LP6F 2OD2A 2WU8A 2Y1CA 3FHJA 2DE0X 3OFNA 4PC6A 3E5MA 1IZZA 3A6LA 4L95C 4QPZA 1H6BA 1NQUA 5ALVA 3GIWA 3BH0A 3KQUA 3WYAA 1ZD3A 1P0FA 2XNCA 5LB2A 4EECA 1FOEB 2AZ4A 3K0EA 3QVUA 4PZCA 1WQ3A 2VAPA 3D54D 5DLEA 3CVUA 4IUDS 4EGAA 2Z30A 3B3QA 3ER8A 2QW8A 3O94A 1EWKA 1PNQA 2HQSA 6AT1A 4ABTA 2QUKA 4F91B 2C7VA 2I1QA 5FWYA 4DBLE 1PJAA 2VAXA 2H1IA 3H6KA 5AI0A 5CA0A 5JJCA 2I4NA 4CEJA 4DCJA 3L6EA 3SC3A 1OBVA 2GXUA 3T7RA 3T0IA 1NPYA 1R12A 3BXOA 2YHBA 3R7DA 1QKKA 2JAPA 2HV9A 1W29A 4ALKA 1JZTA 1S3FA 2KM1A 1NRIA 5MHTA 1ZM9A 4L27A 3EF3A 1K06A 2P6RA 3B6KA 4RSMA 3WP0A 4QUEA 1DLJA 3L7DA 1Q7TA 2BFBB 2VDOB 2IYNA 1XXHB 4QUGA 1QO0A 4UVGA 2LCQA 1KJQA 1IAVA 3UK6A 2EKLA 3G1UA 4AMYA 4X94A 3RCBA 3WAJA 2O8FA 4CQMA 3JQ9A 4C7OA 2PL3A 2OESA 1EK5A 5DIZA 3T94A 1QHEA 4DZRA 1RXSA 2VOJA 1GO2A 1A88A 1I36A 2W6JA 3OICA 4M1SA 4LYAA 4N7MA 4LNHA 4IV5A 1J8YF 4RHXA 1CIJA 1ABEA 4YO8A 3DTYA 3HB9A 4TRNA 5D6OA 5E0OA 4CIDA 1E9DA 1ZY2A 3UUFA 3UMRA 2JFYA 4O63O 1T2AA 3ZK9A 4C4RA 1HI9A 2JEZA 4XASA 1WBBA 3JRNA 1Y7PA 1KOLA 3F6BX 2IUTA 1ZX1A 3KIPA 2YZMA 1RHUA 2F1IA 3WBBA 1GZ6A 3M6XA 1CY0A 1EK1A 2QOEA 4KB5A 3S7ZA 1HH4A 2YUTA 4FNOA 1Z8FA 4KQ1A 4YREA 4PFQA 4H59A 3HDTA 2YMQA 2QP9X 1OPRA 2W83A 3GRKA 4AO8A 2HHHB 1L4MA 4RGBA 5EERA 3N0VA 4XAQA 5DNWA 2J6IA 2JLAA 2PRJA 4NIMA 1VL1A 2CXQA 4BRZA 1QP0A 1E64A 1AHHA 5D2CA 3MTAA 1L7OA 3EGIA 4YMSA 4NFLA 2WAXA 3T7DA 2XXJA 2B94A 4HCJA 4RHFA 2JBHA 4UZFA 3DB2A 1C0EA 4E46A 3NMUF 4BMOB 4MX8A 3VR4H 3FAZA 2PD4A 2BFAA 3CXUA 1T9CA 2G77B 3D2AA 4IIEA 1BC5A 4DJ5X 3BH6A 4CMHA 3HXMA 4AS1A 4XWGA 1H8EA 1HGXA 4OJQA 3UMBA 2RGGA 3HO8A 3NHFA 4RK0A 3OM1A 3K71B 1VJ0A 4IDBA 4BRSA 2HBZA 4TRRA 2G5CA 1RACA 4QSMA 3N2GB 1A72A 4AO7A 4CDNA 4P34A 4DLNA 3SZ3A 3D4OA 5CB0A 4QODA 5IK2A 2RHBA 3VOBA 5IEBA 4RK5A 1WXEA 1XKQA 3GGDA 4WKNA 1W7AA 1GADO 3MG9A 3ND6A 4QIHA 3WL7A 4J7AA 3U3DA 1T4DA 3A2NA 3H5IA 3DBLA 3HBNA 2CUZA 3RIMA 4FGLA 2CBGA 4FYIA 3K0BA 3ZKWB 1GTVA 5THQA 1I24A 1UBNA 1XOIA 1I14A 2QF7A 2ZIXB 3B3FA 3FM9A 4KO4S 5AK4A 1JIIA 4DLXA 2XBMA 3K72B 2WIFA 3VGPA 5TB5A 1W47A 1VDZA 4K87A 5F7JA 3H2JA 4XW2A 3PSAA 2PN1A 5JRZA 2CXXA 4CM1A 1Y4DE 3BCUA 3V7NA 2CFIA 2V45A 3T3EA 1KXZA 2VYFA 3Q3HA 2PQ2A 1EA5A 1ELOA 3AUJB 3JPYA 3KBOA 3ASVA 4HGQA 4I08A 1NW3A 2GD6A 4PXSA 3DP9A 4QUBA 4V0ME 5CU7A 4WDQA 2DFKB 2Q6OA 2RGCA 2UV8A 3KP1A 4LHWA 4Q7JB 3OQ6A 4BDSA 4CIXA 4OUDA 1U2SA 3IESA 5CEJA 3GF4A 3FNQA 5EHXA 1NG9A 1Z28A 4OHBA 1T0IA 4MR7A 1RDFA 1TUBA 1Y9AA 2W48A 4ZTZB 3W8FA 1LWOA 2ODEA 4LWZA 1EUYA 4HPXB 1RE0A 2NZUG 3PR3A 3OLVA 4M54A 4K81B 4XLLA 1MG0A 4LCEA 4KN5A 1EJBA 4WH0A 1BGWA 2Q5EA 4JLDA 3Q11A 1IDOA 1YDFA 4G0VA 2QD5A 4YRMA 1ZO8A 3EZ2A 1UWLA 1QZTA 2Y1OA 2XMQA 3KTFA 1L6RA 2H4JA 3LKBA 4JAVC 3WLNA 5LQKA 1SHUX 2PAAA 4I6EA 1WL8A 4S2EA 3ZE2B 2D8MA 2OBYA 1VLLA 1QHHA 1ORHA 4ILKA 2Z9CA 4LXTA 4AF8A 4BTVA 4DM7A 2B3TA 4NAHA 2H29A 1U04A 3TD2A 4BLPA 1DHTA 2H1RA 3PDIA 4BAGA 1W4AA 4Q1VA 2O2DA 4U7PB 4K9LA 1UEXC 5FX2A 1KYQA 2D5BA 1QAQA 2QM8A 1NQ5A 4I8DA 4MR8B 1VA4A 2TMGA 1JEEA 2ZTMA 3A6JA 1O89A 2RKOA 3LQFA 3S44A 1CF2O 1QWOA 2CEAA 2NO0A 4DILA 4Z4CA 4I4NA 4TWRA 1LTHR 1CSEE 4AWBA 1J90A 1YIAA 2B69A 5ER6A 3TTYA 1JG1A 1A9OA 1N2GA 4LGMA 4RK1A 1UPTA 1U6IA 4ZI5A 4QRHA 2ZSAA 2R7MA 2CDBA 2FW1A 2EBFX 3L0BA 2Z6UA 2C4HA 3INTA 4NXMB 1YTUA 3DLCA 4ZQBA 4PNZA 3A9UA 4IDCA 3QBVA 3TM4A 1CU1A 4WN3A 4Q7QA 3THYB 1NTOA 1CQWA 5CEFA 1VIDA 3WK8A 1YDMA 2PMBA 5GZ6A 5AM4A 4NDZA 4UXJA 2TS1A 2VPYA 3AERB 3D1VA 2KW5A 1W5SA 2VH1A 1BVYF 5FLEX 1ECLA 3RJZA 1E1CB 4Z49A 5K51A 2XUGA 4D0RA 3QTBA 2QV7A 2QTGA 1CD5A 4TKUA 4XJXA 2WUGA 5L51A 3OEHA 1V7QA 3AB7A 4PVDA 1CBUA 2DWQA 1I3NA 3NDIA 4EELA 3DEKA 1M2VA 2ZWAA 1Z73A 1KHTA 4FZ5A 1Z8DA 1AS2A 1Y3AA 3N8DA 3UMMA 3IKTA 1J4AA 2X5JO 4HDQB 3FFAA 4GUDA 3WKEA 3AF0A 2Y1EA 2A1UA 5LXTF 3IOYA 1EXWA 1V5WA 5BR7A 5JNWA 4B6EA 2VJBA 3ZK7A 3MWEB 1TJ5A 3KSZO 3PFGA 4B43A 3I6ZA 3SOPA 2VYVA 4WZAA 1HT0A 3K9BA 1K08A 4HRYA 4ALMA 1P0MA 2XCTB 1NW5A 3BF8A 3RYFB 4DA0A 1JQEA 3TOXA 1N2CA 2BFCA 5KREA 5EN4A 3TJMA 3NHWA 3DE2X 1BYUA 2Q9AA 3GLQA 2B8WA 1KZ6A 2DUUA 1F20A 1J8QA 4N3NA 2FHSA 3TX6A 1ZCFA 3F49S 4L3WA 4OXXA 3B82A 4EJSB 1E5DA 3BL8A 4NSNA 1O57A 4CN8A 2WKPA 5WRFA 3ID6C 1QV6A 2JI7A 1S3SA 3EDRA 1PWZA 4N8SA 4GM0A 5BW5A 3FUWA 1IZ9A 3LL4A 3N0WA 821PA 1F8GA 2XNKA 5KVSA 2AMJA 2DKOA 1FFYA 2Q6VA 4DPMA 1AGNA 2Y0CA 3D6MA 4M21A 4DCOA 2B9EA 2QLBA 3TUZC 2XNDD 3EXFA 4RNDB 1QQBA 3DDOA 5LQAA 3B3GA 2AFHA 1GNPA 1YOVA 5CVTA 3DPSA 1F0NA 1TO2E 1E6CA 1YRQA 5FNVF 2XQFA 2JI9A 1E9CA 4LQDA 2N42A 2GK7A 4PQGA 1Q50A 4OYYA 3B6IA 4XM0A 4XDYA 5EESA 4ETMA 3RFFA 4A0RA 4G81A 3D3JA 4CU2A 2HTEA 2LP4Y 4ZAXA 3ZX4A 2RGDA 1GG5A 3UJDA 5JAUA 3ICVA 2O5RA 3IPRA 3PNLA 3OD1A 2GDZA 3MJTA 3NHZA 3QX7A 5ALGA 4IIJF 4MVJP 1A04A 2RKBA 1PZEA 1YWGO 2XUHA 2BRUA 1IYZA 1C81A 1TM7E 3L05A 4PC2A 2Y0DA 3IMGA 5SYMA 3KOWA 1FTWA 2GWRA 2VYND 4DAOA 3R8FA 3PYLA 5LPNA 1R0ZA 1MC5A 4O59O 1MQ8B 3L7CA 1S89A 1E61A 4Q1DA 3TEFA 1J99A 1OLUA 1NBMD 3VR5A 1A5BB 4W5HA 2ATIA 2ZRHA 1TEZA 3IDAA 5HRAA 4FMBB 4FYKA 1A5TA 4GLFA 3MQ4A 5BO5A 2QYOA 3FB1A 2R2AA 8ATCA 3USZA 1K4MA 5HDBB 1G8FA 3BRSA 4WNCA 5H70A 4CEIB 2SNIE 3FJ1A 4L02A 4DNOA 2NXEA 1QOZA 3GOQA 5L95A 3F3MA 1ACLA 1P77A 4URWR 4QVKA 3FPKA 4EITA 4ZDJA 5A6VA 5LU8A 2UVPA 4JR2A 4J0IA 1NZDA 2R8OA 1KZHA 2IGBA 2PFGA 2ET6A 4H18A 4NE2A 4TT8A 1K8QA 3IHKA 4U6QA 2BZGA 4K26A 1V47A 4OHVA 1AKMA 1IL0A 3GRVA 1WUKS 4FFLA 5TQ2B 3JZAA 3LFTA 3CS3A 4I5EA 5IHXA 2V7QA 3AI1A 4DQVA 2QL6A 2HA6A 2XQKA 721PA 5FH9A 1PFQA 3IUYA 4WZBE 3DOHA 1HKUA 3GLFE 4WXEA 3DA8A 3GCGA 5L3SA 3I05A 4J2HA 2UUBB 1ZC3A 4FE3A 3EBOA 3TDKA 2WQ7A 3WG9A 2WWVD 3ZGYA 2IYQA 3PYXA 1U4SA 4QUDA 1SXJB 3D3NA 4M9RA 2C7OA 3ELUA 4HUJA 4QPPA 3C97A 4WY8A 5EXSA 2C2KA 2ZGVA 2ZM6B 2OFPA 4PVCA 4O2AB 1W44A 3CF2A 3I4LA 3IUQA 1OBCA 4MKHA 2IUEA 4XGNA 3R6DA 1KEUA 4MLDA 4ZVPA 3THSA 3ZYZA 4JUBA 4ZV9A 4G0QA 4CETA 5D5HA 1WEKA 1U2GC 3QHAA 1NGSA 1YZTA 4XTRA 2IS4A 1SEVA 3NHPA 2F8LA 1WUIS 2J1LA 3DCIA 3HYTA 5SY4A 2P1DA 1WABA 5LMUB 3AF5A 1U3VA 2YW9A 2BKVA 2A58A 1PR0A 2JI6A 1JYFA 1N6NA 5JQWA 3AK4A 2FRDA 3AQ4A 4OK3A 3DAOA 3QI2A 1F9AA 3RYCB 1CQJB 3GUZA 1NQTA 4YY3B 4HT3B 2ZUSA 4MDHA 4A2CA 4P92A 3JASB 4IP0A 2WJYA 1OH5A 1FRFS 3C85A 4AS2A 2D1YA 2FR8A 1A4UA 3DMNA 4AYTA 2WYOA 5EYPB 2P8JA 5LWQA 1CZNA 1O6GA 1CDOA 1NSYA 2XMGA 3SFZA 1KJYA 5CA1B 3GLGA 1NW4A 2WM3A 2EHJA 1RYFA 1QO7A 2J7PA 3GK3A 4HAZA 4UEWA 5AKLA 5HMLA 5CCDA 4A0SA 3R7LA 4P36A 3SQXA 1P6QA 3SR4A 3ELDA 3DL4A 2F9MA 3IUJA 1K8YB 4V0QA 1KIFA 5F21A 3SX0A 4HB0A 5C3UA 3QU9A 2FEXA 2OXTA 4F4HA 3CX6A 3VYSB 1RJ9A 3AONB 3VJRA 3DQQA 1RSZA 1MDBA 3WLEA 5ISMA 4S1PA 3VYWA 3NTXA 5CDFE 5ARCA 3GT4A 1O94D 1TW3A 3U3XA 4ZHQA 3F71A 3W5AA 1F2TA 2CVOA 1BU8A 4LISA 3C15C 4JELA 4Y0VA 1L8AA 3KZNA 5CAEA 2JLUA 1RKUA 4O4HF 1NNLA 5B2FA 3WMFA 1VHWA 1L7RA 2X8AA 2NZYA 2ZUVA 2XE8A 3S1LA 1UAYA 4TKLA 5LZ4A 4RKFA 4GR9A 1MJHA 1ESZA 3BXHA 5BSHA 2WD7A 5E2AA 2KB0A 1AHNA 4RPLA 3GD5A 2OYRA 3U3KA 2ZB3A 4JQOA 4C6SA 1ATIA 1T1EA 5KDOA 1VRCA 3LDGA 4PLGA 4HSEA 3DULA 1UBTS 1ZD8A 2PYIA 3EEIA 1DE0A 1U2DA 2XUOA 2JZOA 1SXIA 3IP7A 4MA5A 2XVMA 4YJDA 2BE9A 1MNAA 4E5SA 5IANA 4DVJA 4S05A 2UXCB 4MRMB 2R60A 3B3AA 2EW1A 3X43A 2C5FA 4FFSA 1B76A 2YDYA 1NASA 1SC4A 2AF3C 1FLAA 2AOUA 3LUKA 2NP7A 2PRZA 2VJMB 1XF1A 4RORA 1LTKA 2QXUA 1OFIA 3NBFA 4MV6A 1G5HA 1JQ5A 4TWIA 4R51A 1XJWA 1JTVA 1I13A 1VMEA 4YR9A 3W5BA 2PBLA 2RJNA 3JYNA 2R1VB 3Q3CA 3DAHA 3OZGA 2J07A 1FJHA 3IVCA 4DEXA 2FETA 4DUYB 1VG9B 3ONDA 3WLPA 4XTCS 3K31A 4MJLA 2MOKA 2WVJA 3DTNA 5CNJA 1X2BA 5C8DA 2B4YA 1LNQA 1MQAA 3DO6A 4GVLA 3GLIE 2BHRA 3ZW9A 3HYNA 4MQUA 2QL7A 1P31A 3MBKA 4HLDA 4ZC1A 3DXXA 4INOA 4QHSA 1DINA 4OM8A 5C7LO 2ONYA 5DYWA 3DR5A 2IEYA 3RAPR 5A2GA 1JDNA 4FUQA 1FUIA 1XPJA 3W05A 1UOOA 4DA8A 3PQ4A 3W5DA 4Q9HA 3I9OA 3VYUB 3WMWA 3B5JA 3PLRA 4PX5A 4QOJA 1QONA 4Y6SA 5IUKC 3TH5A 5CBPB 4UFNA 3W8EA 3JQ8A 4FLEA 3U31A 4X44A 2ZUDA 3FR7A 2WE7A 4GICA 2QTVA 2CD7A 4H31A 3LQKA 4QUHA 1B00A 5L45A 5FV4A 4I36A 1H8HD 4NH4A 2IJGX 3TX2A 4JKIA 3OFND 5HDQA 1ITZA 2PUFA 1RXYA 4JJGA 4OYLA 5IZCC 4M99A 1BS1A 4DPKA 1E3IA 4KVZA 4P80A 1B42A 4IIHA 1A8IA 4EBBA 3T54A 2H5JA 4ERXA 1GQSA 1RI1A 1IWOA 2C7GA 2X76A 2ZE8A 1LLFA 1SB8A 2OG2A 5I9BA 4GOND 2VHXA 1GAWA 4IM7A 3AJ8A 3PQ5A 5AIBA 1YA8A 2PUBA 4NOKA 1M83A 5EWMB 3HXPA 3I04A 3SJZA 3BFXA 3A05A 3Q3GE 2OWDA 4PYNA 1UJ2A 4ND6A 3B6JA 2P9EA 3EIOA 4QEKA 1V8PA 2QMYA 2JKVA 1YZQA 3CJTA 3EMVA 3QXXA 5I8ZA 5D01A 5DULA 1ECGA 5LQRA 4QBFA 1VXOA 3PX7A 3WGUA 3AZQA 4ZP1A 3RBZA 1Q0PA 4B33A 1A2KC 4G4JA 1LRJA 3NWOA 2B2XA 3K9WA 4RA6B 2LD4A 3BJZA 3JARB 4YIHA 4N3BA 1QO0D 4RIGA 2PS0A 2ZYWX 1IIRA 1XRMA 3HBAA 2WWYA 3E35A 3HBLA 3RYIA 1ZR2A 2JRLA 2QTNA 3KCQA 1RM5A 3EBLA 1KI1A 5AXDA 5JS1A 3L8EA 1KU0A 2AR0A 4AKTA 1M67A 4RCZA 4NK4A 4HDSB 1E1RA 4JBLA 4GYJA 1TM2A 4QFDA 5KWEA 4DNQA 2YV5A 3S2ZA 2BFNA 2QBYA 5BV8A 2XNHA 4TXLA 4XYMA 5F51A 3AB3A 3E7PA 3GR6A 2JANA 2CL5A 3OOHA 2IP2A 4HS9A 4LHYA 4Q6BA 3ZCXA 3AHDA 2I4OA 2E5LB 2RI0A 5A9SB 4BVEA 1ENZA 1KZGB 4MVJM 4I9HA 4OK5A 2B4AA 2X13A 1BFUA 5FTJA 1A9YA 1ZQ1A 4PX3A 5AHKA 3DT8A 3EG5A 1K0FA 3UHJA 1E2FA 5ERGB 1XN1A 3CNBA 5JCXA 4LCBA 1V48A 2HRQA 1DBVO 2IF2A 4YRRA 4EPYA 1N7JA 5DGDA 4D4LA 5ESRA 3IDSA 1FNDA 1Z15A 5JCJD 1EXMA 4FYJA 3AEQB 1TKAA 4GWKA 2Y0EA 3WSVA 3A4TA 4JYPA 1LXCA 3AILA 3OCYA 2D7JA 2JF0A 2VPWA 4B3BA 5JFGA 1ZNYA 2L2QA 4I9GA 4PG7A 5AVUA 3L4JA 1N78A 1AH2A 3ONFA 4XZ3A 3UJNA 1NR1A 4IDHA 2QAIA 1SZDA 2WW8A 1WQ4A 4O5OA 4TXJA 1H8ED 2VT6A 2Y05A 3VRHA 3NVDA 4KPEC 1KJZA 4F3KA 2OBXA 1ESNA 2OGUA 4P2GA 4G5QA 3OQMA 1BVUA 4OI2A 2ZAOA 3S40A 4EM6A 3GHHA 2IHUA 1T6NA 5IK2D 3E82A 3KTOA 3KUUA 1IY1A 1AF7A 3P9SA 1SGWA 3ZEAA 4V0NA 5B3KA 4JCCA 5CBKA 2IK8A 4MEAA 2J9FB 3KWMA 2O2JA 5DBEX 2V5AA 3GGOA 3A6GA 2HU5A 1GU0A 2WU3A 4K0RA 4JLKA 3UOGA 5JWHA 1V5GA 3QFSA 3EDYA 2IX9A 3ZZ1A 2P2NA 3MJCA 2O1WA 5GVRA 4GLJA 3DE3X 3UCXA 4EB0A 2UYCA 1U2ZA 4FWBA 5C35A 4ZIRB 2Q21A 3E53A 4FU0A 5TPWA 4DJDC 4HGRA 4B85A 4B31A 3I8OA 2VJYA 3VU8A 4FYYA 1ODLA 3H9GA 1A82A 2G76A 3WK7A 1TA9A 4JC8A 3ZHUA 4F71A 3L7OA 3VUEA 1SU7A 2PUDA 1Z5UA 4IQ0A 1DKNA 4D4GA 2FZCA 4F4DA 2DWCA 4IEEA 1ZI8A 2YYYA 5JROA 3VHQA 3EMBA 2Z3VA 1ONBA 3IMCA 4BXOB 1O5TA 4KW7A 2OM6A 3SQLA 3KSDO 2R85A 1CY7A 3NTOA 9GPBA 1A76A 5KU7A 2IOFK 3RB8A 1XYYA 1X7WA 4Y6OA 3GBVA 3HUFA 1T2EA 5B53A 4JI4B 2QUJA 1F51E 5HEKA 3SU8A 1G21B 1ZKMA 3ROQA 3SDZA 5JTTA 4N6GA 1YXMA 1G55A 1W8DA 3HZHA 4RMHA 1TYBE 2E48A 3I1JA 3K94A 3LGAA 2Q4TA 1L1RA 1J00A 3KVVA 1LVHA 1X1CA 3B51X 1XZJA 3IHLA 5JO9A 3TW4A 2OOKA 4IBOA 1UJCA 1VYUA 1CX9B 3BZUA 1QBKC 4X00A 4C87A 4DA9A 1BJKA 4JJ6A 3I01A 4EP1A 1HTTA 3VM6A 2X77A 5BSMA 3DCNA 3IKVA 3INYA 4U7DA 4DLZA 3WGGA 4BN0A 4QOFA 4ZO7A 3CW8X 1I32A 3H83A 3R0VA 3R7SA 4HNUA 3BB4A 5L7WA 1ENPA 1ZD1A 2G5PA 2H3HA 3NVMB 3FRHA 4PLFA 4IGAA 4Y2YA 4BFVA 5F77A 5HZMA 3CE6A 4L9WA 3UGJA 3F5FA 5J5VA 4KVGA 4NY1A 4QARA 1C7RA 1JH8A 2GBPA 2QLMA 2FPIB 1VPEA 1E9AA 3O75A 1CRZA 1F1BA 2V0CA 4DDKA 3K1AA 3UOAB 2FPPB 1DWPA 4JKOA 1GDTA 1QVWA 2D2EA 4RV9A 1Y1RA 3RTGA 1XZEA 2J46A 4TYPA 4BC1A 5ICMA 2WYIA 1KAGA 2Q2VA 1UMBB 5CP8A 4BMVA 1E1KA 1B4DA 5BVHB 3C98A 1NXXA 3JQAA 5FA6A 5C1PA 2B78A 2VI5A 1JFTA 1E3LA 5EUCA 4PE5B 3HJFA 3F4LA 3E27A 3JVVA 1U7HA 1I5OA 4LX8A 3VKFA 2GBFA 2IWRA 4MIOA 2O5EA 4NICA 5KYYA 3LHKA 4DGQA 5B2EA 5CLFA 4EPRA 4FS8A 1E5LA 2NTYC 4MV8A 4ZZIA 4JC4A 2DFLA 4EFKA 2IDJA 2X5XA 3ICCA 4X3CA 3CF4G 1EQUA 4J0CA 1FP2A 4C9BA 3I6BA 3KRTA 4XPIB 1FNNA 3GLKA 1SRQA 1O3YA 5L3QB 1HWYA 2GD2A 4J2TA 3EY9A 4XH9B 4GH5A 2BONA 1MAAA 2GZSA 4Y9RA 5JJBA 1SK8A 1OLXB 1Z2NX 5CT4A 3DW3X 2Q0QA 3G0OA 4H6VA 2JIRA 3U37A 2Q3FA 2W00A 4YJFA 5AW7A 2C5HA 5IVPA 2VAMA 3MT7A 1NJGA 3AUYA 1UK6A 1XNRB 3OU2A 4OF4A 4ZANA 3U16A 1T8UA 2LVBA 3NIWA 1NOIA 1I7LA 4JCOA 2BSXA 3MLBA 4MZDA 1Q14A 4B2IA 3I1IA 4I50B 1UQUA 1G9TA 2Q0SA 2W6IA 2WJ6A 3T35A 1CEYA 5LDDC 4KSCA 4BY9E 3JALA 1GPLA 1R4NA 2W42A 3MCTA 2BKLA 3AZPA 4I4IA 4C0WA 1ORVA 3NWPA 3FYUA 3NXSA 3WISA 1XZ8A 3GPCA 1DQSA 2EJTA 3FMVA 2MR5A 3MCWA 4JB8A 3ZE8A 3UB3A 1P74A 3LD9A 4B3CA 4OREX 1JIJA 1VECA 3N6VA 4KXWA 2WBLC 4WNIA 5B1HA 3VC2A 4BFWA 4HYEA 2EZ8A 4HZUB 1YBVA 1L4BA 3IEVA 5DVZA 1SVWA 5JH7B 3DV0A 5C18A 2QD3A 5F4ZA 5TMBA 1XAJA 5H80A 3CWZA 3NM6B 1R27A 1UAAA 1Y3IA 1C8KA 1RQ2A 3SYLA 5K45A 1CS0A 1GGKA 2E37A 3MVEA 4R98A 1P72A 1EGVB 3G59A 4PYQA 5EJ6A 1BDIA 1SHKA 3BCRA 1J9GA 2XQIA 1GUYA 1Y4SA 4MUHA 3O47A 3VU9B 2PXAA 1CUZA 2X8LA 4PG5A 4MARA 2Q4DA 4JDUA 3M4YA 1Y4UA 2BZSA 3EARA 3WNDA 4G5YA 1B0UA 1IRIA 2OBNA 4NZYA 2P0AA 4NCNA 1NMQA 4JJIA 4L50A 2J3HA 2RSLA 3RAEC 1SVSA 2B6HA 4L15A 4L7VA 3T4UA 1BH6A 5I47A 3C2QA 1W5TA 2VPIA 1Q5PA 2AN1A 2PO5A 1P2VA 1Z3IX 2QUAA 4PTYA 4C0JA 4J3JA 4B8YA 1M5RA 3PJRA 2Q6LA 3OOEA 3G5UA 3L6BA 1RKVA 3NEYA 1KI2A 4UREA 5JHGB 5SZKB 5DGCA 5K8CA 3R0IA 1CZLA 2GT1A 5K0LA 1P17A 3R7BA 1ZN9A 2ORED 2BGIA 3HHEA 4W9MC 1RI3A 1XDDA 4CIVA 1JVSA 3WWYA 2DKFA 1GA1A 2RGXA 4WLOA 1DUVG 1EFLA 1LFAA 1ZVMA 4XUGB 1IOVA 3MT0A 1JJFA 4JL8A 3ZVLA 4KK3A 1K98A 3LDHA 1JHYA 1UUFA 1PCXA 2PANA 4G56A 4MYTA 5DTIA 3U09A 2O2CA 3DC2A 4PXAA 4Q9DA 1IVYA 4CODB 4F84A 4NS1A 3BX1A 2B34A 3H1PA 1UBFA 1ZFNA 3RS5A 4B6QA 1PG5A 2K6GA 4HAVA 4HEJA 4AT1A 2ORIA 3QELA 4HNQA 1BE1A 1V25A 4RY8A 1WD5A 5T57A 3ZV4A 3MUOA 2VHVA 4NHEA 1H94A 1M0EA 4J49A 4L8YA 2X4LA 1XTZA 2Q27A 4YB8A 3K0KA 2R62A 3ZBPA 4LNUB 1U7TA 1PGQA 5HKAA 1I7PA 1WKCA 2JDID 4G1BA 4IIGA 4Q3DA 2PY6A 2EP5A 3N5KA 2FUEA 3U81A 5A4MS 2IZ0A 5KVCA 1XMXA 1G8GA 2O2ZA 2OFFA 1U98A 2B3DA 2V7UA 1T1IA 1KBQA 2ZW9A 3TDMA 1SBCA 3GD7A 4XVUA 4I4TB 4P3KA 4PSUA 3BRQA 4XWOA 1R6TA 2W2LA 5C7OO 3LV8A 3IMKA 4KYTA 4PO3X 2ZJYA 3GDFA 4RDCA 3G9TA 2I9PA 1Z2OX 1QIGA 3UT5A 1CLEA 4OVKA 4LW8A 1TF7A 1IN6A 4ZICA 5CB8A 2LW7A 2FAXA 1FU4A 5IXSA 1OWNA 1NJ6A 3E9QA 2BM0A 2XVXA 3QVTA 4LGCA 3ZPXA 3O9VA 1DKPA 2N75A 1CNMA 2WF8A 4C4TA 5LOVB 4G8DA 1XD2A 1JDPA 1SULA 3LBNA 3OLXA 2Q2QA 4RVUA 1FC0A 4RZUA 4AWAA