5K8CA

X-ray structure of kdnb, 3-deoxy-alpha-d-manno-octulosonate 8-oxidase, from shewanella oneidensis
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
358
structure length
358
Chain Sequence
GHMSFKNFKVVEKMIFGRGSFVQLDDVLAAQRKADDDFVVFLVDDVHQGKPLEARIPVKAQDLLIWVNVDEEPSTIQIDALTEQVQAFNGKLPVSVVGLGGGSTMDVAKAVSLMLTNPGGSAMYQGWDLIKKPAVHHIGIPTISGTGAEASRTAVLCGPVRKLGLNSDYTVFDQIIMDSELIDGVETDQWFYTGMDCYIHCVESLEGTFLNEFSKAYAEKAMDLCRQVYLEDHPEKDDKLMMASFMGGMSIAYSQVGACHAVSYGLSYILGYHHGIGNCIAFDVLEEFYPEGVAEFRLMMKKHNITLPKNICKDLPDETIAKMVAVTKSMGPLWANVYGPTWEEKVTDEMLTALFRRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of KdnB and KdnA from Shewanella oneidensis: Key Enzymes in the Formation of 8-Amino-3,8-Dideoxy-d-Manno-Octulosonic Acid.
pubmed doi rcsb
source organism Shewanella oneidensis (strain mr-1)
molecule tags Transferase
molecule keywords 3-deoxy-alpha-D-manno-octulosonate 8-oxidase
total genus 134
structure length 358
sequence length 358
ec nomenclature ec 1.1.3.48: 3-deoxy-alpha-D-manno-octulosonate 8-oxidase.
pdb deposition date 2016-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00465 Fe-ADH Iron-containing alcohol dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 5k8cA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5k8cA01
1VLJA 1NVFA 5EKSA 1JQAA 1SG6A 3OWOA 3UHJA 4RGQA 1O2DA 1NUAA 1NR5A 3OX4A 2GRUA 2BL4A 3ZOKA 1XALA 1NVEA 4FR2A 5K8CA 3RF7A 3QBDA 3HL0A 4QGSA 3BFJA 1KQ3A 1VHDA 2D2XA 4RFLA 1XAGA 1NVDA 3CLHA 4RGVA 1UJNA 4P53A 1XAJA 3ZDRA 3W5SA 1JQ5A 1XAHA 1DQSA 1NVBA 5HVNA 1RRMA 1NVAA 3IV7A 1OJ7A 1JPUA 3CE9A 4MCAA 3JZDA 3OKFA 5BR4A 1XAIA 1TA9A 2BI4A 1NRXA 5FB3A 3QBEA
chains in the Genus database with same CATH superfamily
1II8B 3FMGA 5KMGA 1PL7A 2IJGX 1ZD5A 4AS3A 1M7HA 2CFOA 2GQ0A 2F43B 1XVUA 2QJWA 2RHGB 3AOEC 5F2OA 1ZISA 2XUKA 3FZGA 2UYCA 4N39A 3JRXA 5I9TA 1KAOA 1NHGA 5HGJA 1T8SA 3DT9A 5LKAA 2OO5C 4PYNA 3DFFA 4WAUA 4ZVTA 2D62A 1U0BB 1YDHA 3VAYA 3SJCA 1YB5A 4UVHA 5DXJA 4TN5A 1CUXA 3SM9A 4B1FA 3Q6MA 3ED5A 2GAIA 3H13A 3ZDQA 4MS4B 4O4LA 1F7VA 1ZO8A 1K89A 1M6YA 3ZPXA 4I81A 4CM8A 2QNIA 1R66A 4BPRA 3U7FB 2GM4A 4LUCA 3ZG6A 3TLXA 5CTAA 5CDFA 4DSUA 4YT4A 2FHSA 2FPPA 3U0BA 3RU2A 1URPA 1QTNA 1BWSA 3OD5A 1N9KA 4G1CA 4GAEA 4IDQA 1X7WA 4Q03A 1QFSA 3OM8A 1U5BA 1G291 3NJ4A 4BBJA 4HB3A 4WADA 1YZKA 2G4LA 4PTZA 5D3KA 2IBMA 4P0QB 2BGJA 2YY5A 4H4EA 3V97A 1XJ0A 3KVRA 1WA5A 3OM0A 4K6CA 3HI4A 3NTQA 1F06A 2A5YB 4MJLA 4QLAA 4W9NA 3AY6A 3L04A 4WY8A 1QRAA 4XJTA 3RTCA 1UPUA 1MT0A 5FWXA 1EK5A 1NMQA 3KXPA 1AC5A 1AIPA 4Q02A 2R5FA 5ALRA 4ENQA 3NV9A 1ZESA 3MYRA 1D2NA 3H2SA 1KI7A 1JEQB 2EL9A 2C3YA 3RIMA 5C1DA 4XDZA 1WHSB 3FROA 5DM70 2ZUSA 2X8JA 2F9FA 3TGPA 4HMQA 3JQGB 4IRUB 2AMYA 4YROA 1H0RA 3JZAA 1PWHA 4AS2A 4B4UA 1NKVA 3NNNA 4TL7A 4BAZA 2ZVPX 3WYCA 5K0SA 4EA6A 2FPUA 3D9QX 1QYXA 5EP3A 16PKA 4GYWA 1QH0A 2YUTA 1SCIA 3OM9A 3PKIA 2QR5A 4M0CA 3ZC3A 1M0WA 2VHCA 1QGAA 1BW9A 2CL5A 2FPMA 2GHTA 2Q0XA 3HWWA 3PC7A 5BURA 4HB2A 1RXWA 1W2GA 1M2JA 1XZFA 4MYCA 4MQ4A 4Y1FA 1PJ4A 4FX2A 4BCCA 2FWNA 2QL7A 3K0SA 4DV7B 3KX2A 3O8QB 1YS7A 2Q3JA 2BKVA 4DLVA 1D2HA 2ZRBA 1VLHA 4BGUA 1F9AA 3CW2A 721PA 1DDIA 2YVQA 2RGXA 3ISJA 5AKLA 1QGUA 1YQUA 4PHCA 4PWYA 2VF4X 2RFLA 4NBNA 3F74A 4O02B 1GT6A 2RGUA 4E1BA 2B78A 3WGZA 4EHIA 3HM9A 5CFZA 2B1IA 4PNPA 3OLXA 1X38A 3AIMA 4BAGA 1JDSA 2OAGA 3M2TA 1WB9A 1P81A 3G59A 2XA2A 4LVOA 3MJEA 4ZOEA 5ALZA 1CPYA 5E3JA 4QGAA 2ZIZA 2GN6A 4YFVA 1YTUA 4JR2A 1MABA 2ACEA 2PTHA 3FWYA 3A4VA 5DB4A 1BH6A 1H1LB 2IQIA 1ZBDA 4NICA 1ISGA 2EFYA 3TX2A 1I4WA 1RLJA 3GGPA 1LDYA 2FDRA 3AUSA 3QHAA 4AJEA 3LBAA 3TX6A 1FLNA 1UKVY 1QYCA 2VDPB 2W6IA 3O92A 4G1UC 4Y2TA 4CQLA 4QG7A 1II9A 4F5EA 2NO5A 2G82A 3OUTA 5EQTA 4Z0NA 2VCEA 2ZRIA 4X24A 3FIJA 2PYZA 1NVXQ 2PA0A 3E27A 4IXNA 3U6KA 3BDAA 1OBVA 3BMCA 3UCEA 3GN1A 5BWBA 4MYDA 2J85A 2XLBA 4QJIA 4QIHA 4YJ2B 1WTCA 2P79A 1BS1A 3QXXA 2QHXA 3G68A 4J90A 4LV6A 1E5VA 1YRWA 1A04A 5FFNA 1KQ3A 3AINA 3H8WA 4FGWA 2YOGA 5EIBD 2I2AA 1QHYA 4TXJA 4Q3BA 2OBXA 5AJWA 3UJCA 3VFDA 1SXPA 3B1JA 4CM5A 1DB3A 2IYVA 2WU8A 4HWTA 4I1OA 1LV7A 1LY1A 5FWAA 4MA5A 2QRKA 3PXXA 3SQWA 2B7CA 4JLSA 3TXXA 2YC2C 1T0IA 1BU5A 4BFSA 1O96B 2X0RA 3H2ZA 1AZLA 1SU4A 1YFZA 3EGOA 1PSWA 2QVLA 5I7AA 2CJWA 4WY5A 2VAPA 4BMZA 2F7SA 2A78A 2X4LA 3P4UA 5B6IA 1F8GA 2RI1A 3PLAE 2WE7A 2XHEA 3I01A 1OMOA 1GQFA 2XKKA 2I99A 4IIVA 1GGVA 4AJ9A 1NBME 2HM7A 4WE3A 3RAFC 1HE2A 4CMKA 3EEBA 4S05A 4C43A 3DLHA 4B09A 4EJ6A 1IL0A 1I4EB 5ALNA 2Y6VA 1BGXT 2O07A 4GT1A 5EIAA 2IKSA 2D5LA 2J87A 3E8MA 3FKSD 4ZVRA 3WC4A 5BV2P 1Z13A 2HWUA 5E7MA 1HT3A 5LLDA 4IGKA 1LLDA 3HO6A 1CYDA 3K92A 1ATZA 2FPWA 2QVGA 3G6WA 4RF5A 3ORSA 4F4HA 3F90A 4RH0A 3LZDA 1EK6A 1MC8A 2E48A 1M8JA 2F1JA 1PJLA 2JLQA 3KXKA 2PMEA 1IATA 1NATA 3DHWC 2H9YA 3MCTA 3DEJA 5EE1A 1FX0B 4TL6A 2O05A 3GPDG 1LTKA 4QYIB 2OHOA 5BNZA 1ID1A 3FOCA 4YCSA 4MS1A 2I8LA 3FYUB 1JG1A 2PX2A 4LXGA 3MJCA 3KUXA 5DLYA 1NAHA 1ZVQA 5A0TA 1CV2A 1QBGA 1JR3A 1JKJA 4FS3A 1SCKA 4TWIA 1JQDA 1PNRA 1NVAA 3O21A 5AW2A 1G3UA 2P9ZA 3E4DA 3GRYA 4M38A 3S0JA 1GPLA 3ODGA 4GIBA 1TUEA 1WZIA 1ZRSA 4Z4EA 2ZCUA 2VCHA 1UMBB 2JEOA 4HDCA 1XFAA 1VLMA 2E4ZA 3IHKA 4YV1A 1WW3A 1MMFB 4NARA 5CLGA 5K45A 5ALSA 3RJTA 4U3JA 3RYCA 4ZODA 2IEGA 4BNHA 3I05A 2WAOA 3RBZA 3KWJA 3BWEA 3HB0A 2FZVA 4RPKA 4YGXB 1Y0BA 1Z16A 3K1TA 3OZAA 3WLNA 1KOJA 3CVOA 1XTQA 3FVVA 3BBLA 5FOUA 2PQ0A 3DZFA 3H2GA 4NBKA 1OVMA 5BWMA 3B1XA 1VSUA 1Q21A 2V6BA 5DYGA 5EIWA 4KDEA 3U0VA 4FQ7A 4GC9A 2MHCA 1C3OA 4OQFA 4C6RA 2V54A 1ML4A 2FW8A 4N54A 1AV6A 3T34A 3H11B 3I0MA 1JDPA 5C3UA 4YFYA 1W2WB 4MLCA 4PCLA 1U2TA 3QVVA 1NQ5A 4P54A 4ND4A 5JS7A 1CHNA 1XNHA 5JAOA 2GCPA 4YALA 2W0MA 3ABQB 4RK5A 4C4RA 2ZJ0A 5KU7A 3J7AC 3HB1A 4TYMA 2PG3A 4PX2A 3RS2A 3W79A 4EPRA 1D2MA 4RGBA 3WYGA 2O8EA 5IKEA 1E9VA 3U31A 5CB4F 3BJZA 2J48A 3C5VA 5GMOA 2C5LA 2E21A 5IW8A 1RTKA 2XSZA 5E1OA 2IDKA 2R62A 2XH8A 4MR9A 5DO9A 3SICE 3VH2A 3HZHA 5DK6A 3KQKA 4UHBA 2YXDA 1A88A 1KFCB 3CUSA 2ZAMA 2CE2X 3N8DA 3V33A 3WGNA 4B3HA 3CUYA 5KVSA 3H4TA 4AJNA 1CNFA 2DBRA 2BWJA 2CLCX 2RARA 3BD6A 3KAPA 3OEHA 4JIMA 5FQOA 1N6OA 2C4MA 3UOGA 4Q01A 5HZMA 2JIDA 3AI2A 1UXKA 2GF9A 5HFJA 2FXVA 1ECJA 2Z95A 1TC1A 3N87A 4V0LA 5IH3A 2VXBA 4X8HA 1QPBA 3QG5A 4ZMBA 1T4GA 1J1IA 2AEMA 2XB9A 3U4IA 2YIJA 5ED4A 3FLMA 2ORYA 4EA9A 3OZEA 3UV3A 1Z08A 4KX3A 5J59A 3B3AA 1QV7A 3GEEA 4MGEA 4HEJA 4NZMA 3PPWA 2OV4A 3ONEA 3Q6IA 4YRKA 1FMJA 5HWSA 1XZNA 3VGPA 4DZTA 1GPJA 2VS1A 1O6CA 3I9LA 1W8IA 3PQFA 4MO9A 5KHOC 4NU8X 3IQWA 3A6PC 4TV9B 3JZIA 3AB8A 2ID7A 4RJKA 2LGJA 3AY3A 4OLJA 4DJJA 3URKA 2HCBA 1YB6A 4AP5A 2IOFK 3QPDA 5HGXA 2BFBB 3CNHA 2X3YA 4L4ZA 3WWDA 2BV3A 5AW8A 3U44B 2X2EA 2QV0A 4B2IA 2Q5JA 4EQ6A 2GH1A 4LZWA 4Z54A 2B36A 3K4PA 1TIKA 3QFHA 5K2OA 3NYQA 1P4HA 4TQUS 4YP1A 1M73E 1QG2A 1C3XA 1TM5E 1M6HA 4RTSA 1BDJA 3FZNA 5LZ8A 4B87A 1V6CA 1JAIA 1PT6A 1QV9A 3MTEA 4ZO7A 2VDWA 2AG1A 3G2MA 4QXQA 1PR1A 1UT8A 2V4UA 2XMSA 5EWMB 2REQB 4WDQA 2DUUA 1K7XB 1X70A 5EHQA 3CEPB 2QAGB 5IARA 3HL4A 3ITKA 3VYTB 1EFRD 5T3YA 2WLTA 4MGIR 1FDIA 3TIIA 3E05A 2JFGA 3K9NA 2X41A 4RQUA 5B3JC 2J5KA 2PZFA 1SXHA 3BMXA 3TJRA 4BB9A 2QAGA 3AFOA 1D07A 1KS9A 2Q3FA 4MUAA 5TPWA 1EX9A 2ONYA 4IEFB 3HYCA 3HXMA 3QSGA 1UWVA 1DEOA 1MOPA 1QKKA 2VT6A 2HT1A 1P80A 4TQ9A 3VKHA 2UVPA 2QRHA 3OZFA 4GRIA 1E6WA 1N0UA 1WM1A 2FOLA 2JLSA 4WXYB 1T6XA 3KDSE 1S2NA 2QL9A 4ZYTA 1PG5A 2QPTA 3ZI4A 4C5BA 2YZKA 1WKVA 4N40A 4XM1A 1GUZA 2FAXA 4EI8A 1S8OA 4BC0A 3SHVA 3MBOA 3DEAA 2J32A 5IABA 1MH9A 4UFOA 4BIMA 4A3SA 4RL4A 4PG4A 4NJMB 3LQ4A 4GL4A 4IFBA 2A5GA 3GDGA 2BISA 3ZS8A 5TIIA 1PJCA 3A28A 5HF9A 2V9PA 3U62A 1F0PA 3C8DA 4P7JA 5C9ZA 3F3YA 4K87A 3FCUB 4XIGS 3VI4B 3SBXA 2OLKA 2X9QA 2HIGA 5KC9A 5TF4A 1XF9A 2ZT6A 2QT0A 5E6RA 5BYBA 3WA7A 2PMDA 3LK7A 4J0JA 1LLUA 1DAMA 4G01B 1G9TA 2HF8A 1G8AA 3UW3A 2ZIXB 4P6VF 1E5LA 4RGVA 1LPSA 1FOEB 1O4VA 3FFAA 1AH2A 1NM5A 3AP2A 3GL9A 1GL7A 1U94A 3H5AA 2IXBA 3OIGA 4H1VA 4UHHA 5KQGA 1P3DA 4BQEA 3LVRE 5ICGA 1LTQA 1QHHA 4D8TA 5HCIA 5IWCA 1KC1A 2PAFA 4GECA 2O2GA 3DC7A 1XZKA 1FFXB 3LXXA 3RYHA 4E88A 4YWHA 3WKCA 1C7ZA 2PRIA 3R5JA 4C4SA 1P2UA 2PBLA 3LYUA 4QHYA 1KY2A 3OC0A 1GGHA 5LXTB 1OWOA 1MKYA 2MINB 5HDQA 1RABA 4B3XA 4ER6A 3ZE7A 1Z4IA 4PZ9A 3AI1A 4Q15A 4NF2A 3TZKA 2DC1A 3PR1A 1LS1A 1KEEA 621PA 5LOVA 4F97A 2PNFA 1Q0RA 4E6EA 1D0VA 3HJRA 5BSHA 5HJ5A 1S4QA 3TZQA 1VSBA 5IDVA 1WDWB 1VZ2A 1JLLA 2H7YA 5LUBA 3WBKA 4TZ0A 1NRIA 4KQ6A 1YFJA 4EYQA 1U5BB 4U2GA 3ZY3A 2YHUA 2WUFA 2X3UA 4HLQB 5CA0F 1N8TA 1XD2B 1N57A 3A9UA 1W6RA 2Q45A 1NUHA 4P80A 2DFVA 5COQA 5FKJA 2DUWA 3T15A 2B69A 4FINA 5HMMA 4DUYB 3NMUF 1ZK3A 2J0EA 3EH1A 3DKVA 2XLCA 1LB1B 1Y9JA 2OGZA 5BUZA 2FWPA 2WD7A 4H7DA 4WOCA 1JT2A 4J9UE 2JIPA 3ZLTA 1R4AA 2ECKA 2W2OA 3D5TA 1NQWA 3FLBA 1EUQA 4RZXA 2IOFA 1COWA 4XYLA 2WI8A 3IBCA 3R3WA 2H4HA 1J9EA 1R74A 2XA9A 1NASA 2CMFA 3DKPA 3DOEA 3OIFA 3IL2A 1JJBA 1Q1NA 3DEYX 2X13A 3K9HA 1K1EA 3PRHA 5EI5A 4RTNA 3A1WA 4XB6B 4N48A 4D3SA 1ZH2A 2FWRA 2CNNA 2E85A 2GAOA 2WSBA 2WTBA 3MT8A 4HH4A 3MQFA 4ID9A 4JBIA 3OKFA 1NF3A 4K05A 1L5GB 3ZVRA 4TYNA 1ITZA 1GZUA 1HG0A 1L4MA 1NDHA 4GYJA 4G4IA 1LBSA 1VL8A 4HWRA 5L3ZA 3VU1A 3KB1A 3TMAA 2BMWA 2FG5A 3A6GA 4MQFA 4UNNA 4ACAA 2QYOA 4JK3A 4MVJG 4HDKA 2PLNA 4YP5A 4JGGA 3DE2X 3K94A 4FJ1A 4WZBB 2KE5A 4LKRA 3IXMA 3K3PA 1P2GA 3OPVA 4IXDA 3U7IA 1WY5A 4UXIA 2O5RA 5C1PA 4GXNA 2EOAA 1IHOA 4Y0VA 1SBIA 3SYRA 4BQSA 1XKLA 5ESRA 5CA0A 4MIOA 1J22A 3ZTWA 4GUDA 4E4YA 2G0NA 2PT7A 4A8TA 4AROA 3KCQA 2OAP1 3K8YA 3ORQA 4RACA 4LGCA 5KYXB 3C97A 2FOIA 1VGVA 3D8SA 3Q5EA 1RYMA 2Z4RA 2MT9A 4A5SA 1B8PA 4KQEA 2FSHA 4RTMA 4MXDA 3TIXB 3BD8A 3V34A 5DM0A 4F3TA 5TVKA 4HFJA 4DADA 4WX2B 5TS2A 1AQ6A 3UHJA 2FMXA 2HY7A 2VHJA 4QLOA 2KPOA 2DCUA 5KJ1A 1NJ6A 3CJRA 2BI8A 3IIIA 1DX6A 2BFPA 3FBTA 4N0EA 5A1JA 1KS2A 1Q44A 3TOXA 2R6ZA 3SC3A 4MUHA 2WIBA 4X6LA 1KMNA 2VYND 3KRTA 5FORA 2YRFA 1Q0SA 4R2WA 1WNFA 4CV0A 3AVWA 1EXMA 2GBFA 3UK2A 1EFUA 2CLMB 5K6AA 1LNSA 1CIVA 1MEJA 5CCEA 1QZ3A 1UK7A 2JRCA 3KC2A 2HSDA 5GZ3A 4R2KA 1SVNA 3I9MA 3QVJA 1BHSA 3K0BA 1M1ZA 4TQAA 5ADVA 2GETA 1JKFA 1IY2A 4JQSA 3FKQA 1RMYA 2AB0A 5EZYA 3S2EA 2XQKA 1E2GA 2YV5A 1EFRA 4G5GA 1F0YA 5E2AA 2ZSHA 5AXCA 1G59A 5ULLA 3LG2A 1WXFA 4DY4A 1QOQB 2ZIWB 4BRZA 5KYNA 2GWHA 1IVNA 2HTFA 2WV9A 3PGJA 1LWNA 4DXDA 3RSOA 2R47A 1YU9A 1OXXK 3E1GA 3VR5D 2Z2IA 1XEXA 1DC7A 3LX8A 1CYEA 1WHTA 1T6ZA 5EEGA 3UWSA 4M8LA 2PUTA 2RH8A 5DN6A 4HDOB 5FFMA 4NENB 3MJRA 4XLTA 2FEMA 2CCJA 4IYRA 4DG9A 4HNVA 3IHWA 4K2HA 4KTTE 5EUMA 3DD5A 3E61A 2HMTA 3KSDO 2IUUA 5EJ9A 4XWYA 1E1KA 2BIFA 2QN8A 2QSZA 1K3UB 1T91A 3DQQA 3QXGA 1UC4B 4HADA 3F2VA 4HXEB 1JJFA 1TF5A 3G9UA 2C03A 5JYDA 4QUEA 5SV2A 1NBIA 4L51A 4MPTA 4E3WA 1QM5A 1U9ZA 1E8NA 4NPAA 4B84A 3L1VA 3TRIA 2H2HA 3BEOA 4G63A 3TNDA 5F76A 1HY3A 4XIJA 3IILA 4E6PA 4LRYA 5DP1A 1VHQA 1Q0PA 2X6TA 1RWKA 5LD2B 5JS2A 1LLQA 4B76A 2OLJA 1I2BA 3LTNC 3SF8B 2VWQA 5L6MB 5C51B 3JD4A 4C6SA 2QPLA 2YFHA 2J5XA 5HIAA 1PFYA 3JWJA 1MO5A 1M6NA 1JFLA 2FJ0A 2VYNA 4XVQA 3AUTA 1W76A 4JJGA 4WZBA 5BQ5A 5A02A 7GPBA 2B98A 4DB4A 3MRVA 1YS4A 4QUGA 2H59A 3TEJA 2XXAA 2JGAA 2FEPA 4WASA 3O03A 1NYQA 2Q0QA 3I72A 5F21A 2ST1A 1K8RA 3IT0A 5EJIA 3PC2A 4EPWA 1E61A 3FTDA 3RGGA 1EX6A 2WIJA 1RTTA 2DVMA 3FSEA 3PTLA 5GJVC 5FPQA 2XXAB 5JAMA 4PC7A 1QKJA 3HI6A 1G20E 4KQMA 5LJIA 5JR3A 2VPXA 3U9LA 1NYLA 2O20A 2WNHA 2QN9A 4GLJA 1A9SA 2JAQA 5DX0A 5CH3A 4Q19A 3JQGA 2JGFA 2EGGA 1GJRA 4KBYA 4ATNA 3OHSX 4RZHA 1SWVA 1NUPA 4AG3A 2CWDA 1GZVA 2BDEA 3GEBA 4Q4HB 4HNHA 1H6BA 1X9HA 2RHRA 1O03A 2VRBA 4HGPA 4J0DA 4UU8A 3TVDA 4FB4A 1U1DA 3TR6A 1GCAA 3GJ0A 3OESA 2ADMA 1QNFA 4K81B 4WJKB 4BNYA 3I3SR 2HWYA 2Z5LA 3FB1A 4JJZA 2QYSA 3MXOA 4DVJA 1A50B 1WO8A 3C8UA 3DW1X 3LIIA 3G2NA 1DKOA 5FPSA 4Z53A 4OGFA 4NYIQ 5AW6A 1F2TA 1WVMA 4DDUA 7MHTA 1TLLA 2Q1XA 4KVGA 5EJ4A 1TAQA 1H9AA 2YWJA 4CG1A 1OU4A 2ZWPA 1KRWA 5KYYA 2JLVA 4WTOA 3CNBA 1IAVA 4RADA 1UC5B 4AMGA 2I33A 1YULA 4I6EA 1EMDA 1P31A 2O0LA 4OHRA 1L7BA 4BBPA 4JI7B 1AGXA 4H6PA 1YCFA 2ZT7A 3N3AC 4F6RB 3CUVA 3V6LA 3HKCB 1BD4A 2J7PD 1NLUA 3TAUA 4B45A 3O2QB 3FI9A 1C9NA 4JLBA 3VTFA 4G2NA 2Y68A 3BE8A 2YYAA 4JI1B 2Q4EA 4ZQEA 1I0LA 2L2QA 3BFKA 4FBGA 1Z22A 4RGYA 5KJFA 2C98A 4MVJI 2NSYA 2ZUTA 2GK3A 2P6PA 2IKQA 3SVZA 3L77A 3HBFA 1A8SA 3P9XA 4GXQA 4MITA 2MCFA 2BEJA 4D02A 2O0MA 2PKQO 2SKCA 1U9YA 3G7NA 4BP9A 5KWJA 3HUDA 3NZEA 4ZTZB 2WNIA 2FMIA 1NXVA 1MB9A 1G8GA 2XUPA 1I4DD 4R9VA 1NBMD 1EP2B 2JFFA 2JIQA 1EB9A 4I4TA 4URHA 3SC2B 3OPXA 4RV5A 3L01A 1LX6A 1V41E 3UYKA 3H97A 3DKKA 2P6OA 3N0WA 4JZYA 5FPYA 3I9KA 4E03A 3OZVA 1FX1A 4A26A 2WHQA 3IBTA 5HMLA 5F1YA 3A6EA 3R9IA 3OZSA 3S8EA 1OI3A 5B1DA 3R7SA 3KD3A 3QOXA 1J24A 2V7XA 3VHLB 5FOVA 1F8FA 1K3TA 1T24A 1ADFA 2D0IA 3R7FA 4IDHA 2DYKA 5D3MA 3C1UA 1D2AA 4PSCA 5F9FA 3RRJA 1UBMS 1A5ZA 3JYOA 1XMVA 2BUCA 2OKCA 4CIYA 1ZM7A 2EHDA 4ZO4A 3HZOA 3IJPA 3R4VA 4M0PA 3S1SA 4YCNA 3MFYA 3PPXA 4PFJA 4Z3KA 5DBHX 1SQGA 3HBLA 5DIZA 1SEVA 4BMVA 3PNBA 2FPXA 1K98A 4KLNA 1OI7A 2WMNB 5EPUA 3KJNA 1GSOA 2W2LD 3WO1A 5KQRA 1W7AA 1QRUA 4YQYA 3O3MB 4FR2A 2NAFA 2H8KA 1E1NA 1P5RA 3B48A 4Y6LA 3A2KA 3VU8A 2BFCB 1UP7A 4LNHA 1XQ6A 1ZOSA 3W8DA 4FGLA 3NUGA 4TTJA 3IPAA 2OCAA 2Q29A 4I7EA 4NY1A 2XUDA 2YDYA 1CJBA 3CF2A 4IM7A 1WDLA 3GRCA 2X1HA 1HZZC 4IBOA 4ZQIA 1M1YA 3SFVA 1FDRA 1XAJA 5FNZA 4DL9A 1B3BA 5FD8A 4JVNA 2OQ2A 3NAMA 4PZCA 1WCIA 4BN5A 5P8WA 4LF8B 1Q19A 3DMNA 3P9YA 1C0PA 3HJGA 3P9KA 4JD5A 3IDFA 5JI3E 2VWGA 2JEYA 3OOSA 4TTTS 1WLSA 1UADA 4GKBA 5LP6A 2XCRB 4QTTB 4UEOA 4X1KB 2BKLA 3ZHQA 4BU0A 2DLNA 2B1RA 2BEWB 3GJTA 4FZ5A 4K0RA 3DLPX 3OZUA 1XTBA 3U4QB 3EFBA 1C9JA 3NYWA 1MIHA 4LC1A 4CV3A 5KPDA 5IPFA 4XX0A 3QNMA 5LXTA 3FMOB 5AUQA 3I4FA 2I6SA 1L7RA 1HBJA 2ZE5A 3AR6A 4DLUA 3ZWMA 3W5UA 5T41A 3LDFA 4GRDA 1L9KA 2ZBDA 4KNYA 4RZIA 1UP6A 3B12A 3B38A 1RFLA 1NP6A 3EWAA 1EBFA 4UULA 4RO0A 5DHQA 2VL7A 3IVMA 2Y4OA 5T7BA 3OU6A 2ZM5A 2M1XA 1TZJA 2VUSA 3HV2A 3HZZA 3C7KA 2FZWA 4IO0A 4ZVNA 3NP7A 2HF9A 3L8EA 4NTZA 4MV5A 4N8DA 2JJ8A 2X6RA 4M55A 4CW7A 2FUNB 2YWGA 3GLFE 1UEJA 1XZJA 3TPCA 5IJ0A 3GFRA 4AZ0B 3FPHA 4RSHA 8ABPA 5TF0A 4RTKA 2FY8A 1QK4A 1LBEA 2E1RA 4MV8A 1S8AA 3BRCA 4R3UC 2FDCA 1QLJA 3SYTA 3PL5A 2J5BA 1NUUA 1G98A 2CKMA 3M6MD 3ZWBA 4JI5B 4AZ0A 3HFGA 2HD4A 3ROZA 1SQSA 3L18A 3SFTA 2AS0A 2Y1LA 3F2IA 3T7EA 4C5AA 5JHGB 1YBAA 1VE1A 3EXHA 4KOAA 4Z4QA 2KW5A 1YQEA 4J4TA 4NNJA 1AGRA 1YIOA 2WHEA 1XQXA 2Y67A 1WIWA 3QELB 2BGUA 2D3TA 5HILA 4EFMA 4H7PA 4ILEA 5CLJA 5J47A 5KTYA 3WKAA 2FVXA 4V03A 3REQA 5KNLA 4TTAA 1YUNA 3BFPA 1KO4A 5JE8A 4G65A 3WRXC 4R1TA 5JZOA 1MOQA 5LDDC 1SXQA 1IN7A 2O2YA 2VT7A 3A3OA 3DONA 2WSMA 3VOSA 3EGDA 5SZHB 4EGSA 4QUBA 2G88A 1CE8B 1W88A 3ABRB 2B8TA 1P8AA 4I5EA 5HCUA 3HDGA 4RK0A 1E9SA 3DZKA 3WL8A 2AG8A 4ZV9A 5ALQA 4BO6A 5AO9A 4EBFA 1RRVA 1JJAA 2GR9A 1KTIA 4LHYA 3SVTA 5FUBA 1X1DA 1QHEA 1C7FA 3L0DA 5WRFA 2YWFA 1COWD 1DV1A 3GD7A 4B6JA 5E4JA 5B7PA 1WLYA 4IMPA 3Q3HA 3A9CA 1T1EA 4KRYA 2O3UA 4GPIB 2QDKA 1SU8A 1J6UA 5LBIA 2OV6A 2DBQA 3IMEA 4J49A 3ONNA 4JYPA 3GT4A 4MKZA 4Y9UA 3SEFA 1QR2A 1T43A 3WHKA 3IVXA 2QMOA 4HGRA 1M72A 4JY7A 2ATIA 3AR9A 4R31A 4MWTA 5BSRA 2O8FB 5ITSA 1N6RA 2CGEA 3LQ2A 3UJBA 2QJRA 2EU8A 3ZJVA 5J1SB 4MKHA 4MEBA 4E5NA 3LHFA 4QPCA 1PL6A 1LJLA 4B6OA 4UVEA 3ZGNA 5AVVA 5BXQC 1GTSA 1X94A 3LZCA 3MCUA 4ZYVA 4AB1A 1UDCA 5JWOA 4IS3A 2HHAA 2OV1A 3T54A 3DAGA 3QLJA 4WK2B 2X9VA 2ZRFA 3KKPA 3KSRA 3E3MA 2HBZA 3QV1A 3SXUA 1FS4A 3LD9A 1ZCJA 4WINA 2XVAA 1OR8A 1QZTA 2DPGA 4IIEA 4C01A 1UOOA 3UB2A 4OIFA 2VBIA 4ZO8A 2UDPA 3L6EA 3W5JA 4BFWA 4EJ0A 5KYXA 2F8LA 1YR6A 1JQBA 4GC5A 4GOJA 4MZDA 3ILHA 5DLPA 5E3IA 1FNCA 1GRRA 1XAHA 1Q17A 2HA6A 4K40A 2O2IA 1KP3A 2V45A 2EGHA 3HMQA 4GNRA 4YB8A 5LYYA 5AHRA 4YUZA 4ZYWA 3HM2A 3L7AA 3BXPA 4JEUA 3WRYA 1NMEA 4P5DA 4XQEA 5LVAA 4JJ4A 4J0KA 4XJXA 2RHHA 2D1TA 3E48A 4JBNA 4B3MB 3P26A 3DXZA 1ZL0A 2KHZA 4BKMA 2GD2A 4TRMA 1N2OA 3WQSB 2R4UA 4OQLA 3OZIA 3ZD6A 1XP5A 3FDZB 1K6XA 3FTPA 5JNSA 4UM9B 4CUKA 4E12A 2Y71A 1Q74A 3A1SA 2VTEA 3EAFA 3RKRA 1DJMA 1YI1A 1QIIA 3IPCA 4BEJA 1SD5A 1EFLA 2HV9A 3K15A 3GCXA 3WY9A 2B4KA 2HNKA 5SY6A 2PUDA 4FLEA 2C58A 4MUMA 4YRPA 1VSTA 1TQDA 4PF1A 3WOHA 4HG2A 4OI4A 3DMPA 4LEIA 3H05A 5FUXA 1D1QA 2VJKA 1KOLA 3T1HB 2E3JA 1CZOA 1O3YA 1SBQA 3LTEA 2TRSB 3A4MA 4IUCS 3B2EA 5LA6B 3K09C 2QW0X 5KQPA 4I9GA 3PEUA 4QZVA 3A3PA 3ECSA 1KH2A 3D54D 3LNCA 1LI7A 5BYAA 1D4FA 1UJCA 3ABOB 3I4CA 1M2OA 3CWCA 3JQ7B 4DMKA 4FD3A 8ATCA 3G2OA 3K72B 1L7PA 3FDFA 3EPJA 2F9MA 2ZUUA 1KU6A 4CEJB 3N0RA 4D45A 2IHBA 3PDIB 3ZXSA 1M83A 1Z8DA 3LQFA 4FIDA 4JT9A 3MW8A 3EF1A 5KCMA 3H11A 4MKIA 4YMWA 1NI3A 3ET5A 2E4YA 1WMEA 2DHCA 1X1TA 4HEQA 1JGTA 1KK2A 4NOLA 2VP2A 3E3LA 1SXGA 5LDGA 3OQOA 1D2EA 1A4IA 2QX9A 3F5SA 2OHJA 4OHOA 3E5MA 1NDUA 3ZY2A 4WJZA 2N42A 2JGRA 3LX6A 4GMKA 4FB5A 1RJDA 2Z04A 3QVKA 4ARSA 4B7UA 1AZTA 3UAGA 1UBUS 2HA7A 1BHJA 4GLFA 4UMFA 1EP9A 1WD7A 1G5FA 4KFRA 2J59A 4G25A 3OX1A 2QSJA 2PGIA 1SK9A 5EXTA 1K7YA 4MYSA 4NCHA 1CQZA 3MTJA 3NKLA 5D7NA 3AESA 1N9ZA 1I7PA 2CWWA 3W78A 2EFCB 1PKXA 1B8NA 3W4IA 3AUXA 4LYEA 1NMYA 1LD3A 4HDKB 3RUEA 3TDMA 1OV6A 3ANLA 1RSZA 3IUNA 4MRSA 5KJEA 3W90A 2CBXA 2PBRA 4L0CA 1E92A 1ZINA 3QKRA 1FFEA 2YHIB 1ESCA 2VO1A 4Q24A 1P0QA 1XRLA 1JKJB 3B51X 3EA0A 3OE5A 4M7OA 3AL0C 3M0EA 4YV7A 4MUEA 2QRMA 3OMWA 4LFBB 2IEIA 4BX3A 2REXB 3RUHA 3TOCA 1NRXA 1AGYA 2Y1EA 4XUGB 4KRFA 3P0JA 1UXJA 1G8PA 4BMPB 3FW1A 4IHJA 4K9MA 4OXNA 3WGIA 1IXKA 3FSRA 1NOKA 3BK7A 3ANNA 3BZWA 4ZANA 1XL0A 1V3TA 1DAKA 3PQCA 4Z4HA 5KOYA 3II6X 2YQ5A 1LA2A 4HUQB 2GMWA 1B6GA 3AHJA 5JNLA 3WJ2A 4QJ5A 2CJXA 4KQWA 4RCVA 2ZAYA 3WXMA 4EK9A 2GTPA 5B4TA 2IHZA 1MTOA 1RLOA 3GP3A 4F2PA 2OORA 2ICAA 4OREX 1B6RA 3B9RA 4JENA 6NULA 4G4SP 3C5HA 1IPEA 4JOSA 4TMVA 5JSYA 4PIVA 3WNCA 4OHZA 1FIUA 4JLWA 1MX3A 1IDN1 3IDQA 1NDQA 2PXHA 2NNLD 3X2FA 3GMSA 5EJMA 1CS0B 1T0BA 4NJEA 4DSNA 3GLKA 2DY0A 2YVLA 3QUAA 3RWBA 1WXWA 1CIPA 4NWIA 1OKKA 4Z8YA 1IBSA 1WZCA 5G41A 3NBMA 4Z0TA 2IH2A 2PZKA 4JWKA 3ZWQA 1L8XA 2G5PA 3FUTA 3PFHA 2CNWD 1GYRA 1EU1A 1NJ8A 2AQ8A 1SUFA 3CTMA 1USVA 4TM8A 3FGZA 4E2FA 1VPTA 2JB9A 1QZXA 2VJBA 2A9QA 2ZBGA 3LY9A 5F64A 3ZWWA 4EEKA 1XT6A 2H11A 4Q3CA 4YHHB 6REQA 4C0HA 2W2KA 4BX9A 1MQAA 2FRXA 3WYFA 2HSZA 1SM4A 2FMKA 1WZEA 3DEZA 3EVDA 3GR6A 4L50A 2VAXA 2VBGA 5J1TB 1O89A 1GQYA 3HE3A 5C80A 1KI1A 1SXJA 1A27A 4CKCA 1BXZA 1DMRA 2B83A 1OWPA 3EZXA 2PT9A 5EXXA 2ZVDA 4MR7B 2O3QA 2G04A 2BJWA 1EVLA 2JFVA 2D54A 3GLSA 1C1XA 5H59A 4RZ2A 3OOJA 1NVEA 4LRWA 4BVLA 5DTMA 1TK9A 5CLFA 4HQKA 4G85A 4C04A 5HF5A 4HL6A 3A14A 4OYHA 4N8EA 3WVNA 1YNSA 4FONA 3K1YA 1Y9ZA 2W8ZA 5AI4A 4BJ3A 1KQPA 4G1EB 3SBOA 2M6SA 3GFSA 4YCCA 1JA1A 5H82A 4P4LA 2RD2A 5IU6A 1FP6A 1QYRA 1DE0A 3BIFA 3DV0B 5BWCA 4PX9A 5KJCA 1U0NA 3L06A 4YI3A 5FLXA 5EGNA 2D0DA 5KWVA 4WZAB 3ZWNA 2EC5A 4EJSA 3GP8A 4DA0A 4B3IA 3TOVA 1ZH8A 4JC0A 3QXJA 2AN5A 2Y6UA 4NL4H 2GI4A 2N47A 4IDPA 3NHKA 1NR7A 2P5UA 2WTUA 2BR3A 1CS0A 1JEEA 1TCAA 4NJEB 1GNRA 3RUDA 1T2CA 2WWGA 3BG5A 4FN5A 1WXEA 5IANA 1NN3A 3F7OA 4LDPA 4B4VA 3G9ZA 5E9AA 3C39A 2WMYA 1U6JA 4R0MA 1HNZB 1TO1E 2B0CA 3A7DA 1Y8AA 2FSVC 3LY8A 3ROQA 1QDLB 2YMQA 3BMNB 4NYMR 2PX8A 3FG9A 4G5FA 1IEVA 3CLSC 5G0SA 2R1VA 1ZIXA 4J91A 3I12A 3K31A 1WVIA 4E46A 3DUFB 3OWXA 4BO0A 2QTHA 4DM3A 3E2MA 3WIBA 1NC1A 2CNWA 2I4LA 1O6ZA 4DT1A 3ZZ0A 2Q4OA 2LIPA 4RA6A 1ADJA 3SAJA 2ORIA 2R7LA 3SZUA 1CVLA 2OO7A 4G3XA 4ME6A 3JASA 3PGVA 4GWGA 1P7YA 4TL9A 3O8CA 3D0RA 1J2EA 1J70A 4YRMA 3KTDA 4MDYA 4WA8A 3T9FA 1F8YA 1NNSA 1AQYA 4RPGA 3IE1A 4YT8A 2I67A 4BO5A 5FJIA 1SRRA 3BEDA 2PWPA 1E5XA 1KQOA 5DCLA 4A16A 3MF4A 5I9SA 4UKDA 1SVIA 1THZA 4LHVA 5L51A 3V42A 1P7CA 4PYKA 4MWBA 2CMGA 1P4RA 1EP3B 5JC8A 4PSKA 1NVVR 2REBA 3LGAA 3AH8A 3ZI0A 2RHMA 3OO1A 3PX3A 2CXXA 2MSWA 3MOGA 3K32A 1ZXXA 3C45A 3IOBA 4D9IA 1R6VA 1XVTA 3VR6A 1DKQA 1LTHR 4KGVA 4E51A 4ND2A 3EPKA 2Y9MB 1AY0A 2OWDA 2DH6A 4JLKA 2HT6A 4OHPA 3EXG1 3GLGE 4UU0A 1G7CA 1U1CA 2H31A 3HKEB 3SJAA 1XZDA 3GFQA 3NRBA 1PBTA 3VTZA 4BNDB 4IEEA 4N3NA 3P4YA 1XI2A 4MUIA 3UJ7A 4DLAA 1ECLA 4KMOA 4Q34A 3L40A 2LDXA 3K5IA 4MDEA 1EXDA 2VDJA 4A0GA 2NYAA 3W34A 3STWA 1WNTA 2I1LA 3JQFC 3QVWA 1DSSG 1TLTA 1XCBA 4M6WB 3LHSA 3GX1A 2CV2A 2I2DA 3I30X 2ZSUA 3MCVA 4JUBA 1HZZA 1L3CA 2C84A 2PFSA 9ATCA 4QODA 4WN9A 4UNRA 4UM8B 1GPYA 2IZ5A 2Q49A 4R9RA 1OH8A 3ERCA 1PDWA 1XTRA 4K3VA 4LX0A 3HP1A 4UUPA 4B2YA 5JZSA 5K0JA 3K35A 4LRQA 4RTOA 4PICA 2ZIGA 2ZR9A 1UANA 5DBIA 5HE8A 4ERNA 1X86B 3OJOA 3DFMA 3NVDA 1LF0A 1UDBA 1NNEA 4M9UA 2BVNA 4O5AA 4K7JA 1U9CA 2VJLA 2IYEA 2YRWA 1RPTA 3ZTYA 4DC1A 4TWZA 3KWLA 1JDJA 2EERA 4FILA 4KQGA 2BKUA 4PYMA 2DLCX 3I2HA 5KMGB 1ZMOA 1P33A 1CSEE 2VHXA 1HFWA 5T67A 3KZCA 3SSOA 3RC8A 4YAJA 2GPNA 2UAGA 3CZMA 5THKA 1GKYA 1PX2A 2EVWX 2OXCA 4PQFA 2NYUA 3WIUA 1INLA 2P77A 1JT9A 4BNGA 2EP8A 2ZYVX 3A10A 2WYHA 1DHRA 2LVBA 1BXKA 2JIZD 4CEHB 5TV2A 3MGKA 2ZIEA 2H1FA 2QQEA 2ZIUB 3MMSA 1LWOA 3PNVA 1JDBC 3K0EA 3UJAA 2R1VB 5BOSB 3ABIA 2EF1A 5A7GA 1HFEL 2GJ4A 4EY5A 2V1XA 3VAZA 4MKFA 2CUKA 3Q7QA 4DJ5X 4ZGGA 3E4CA 4B5KA 3ZE2B 1ZD2P 3C16C 3UB4A 3DMDA 2VHWA 3C3AA 3ICQB 1D9ZA 1GZ7A 4EVRA 3O47A 4GSKA 4IWXA 4QL3A 5JROA 4ZMSA 1T9ZA 3BCUA 5K3DA 4A8HA 4AKSA 4QBGB 2O52A 1W0CA 3C3EA 4YYEA 4BKQA 2VA9A 1W5BA 2O1SA 3TZBA 4GVLA 4FSXA 4GLLA 2O1XA 3GYBA 1Y5IA 4V0KA 4Q0MA 5EHXA 1AF4A 1VJ5A 1W4AA 3IJRA 3TWOA 4D41A 4DUGA 3HQ4O 4ZT3A 4R5MA 2ZCJA 2FUEA 1RQLA 2OGSA 3K70D 3KSUA 4PPFA 5BSUA 2QRLA 3DE5X 3ZHOA 2W4QA 3DMFA 1SXJC 4W8GA 4X90A 3MGGA 3PRYA 2OD2A 4C89A 4QBFA 2DKNA 1LK5A 5AVYA 3EBPA 3SJUA 1GL9B 4MULA 5JPCA 2G4VA 4BLRA 3QVMA 4G5YA 1XB2A 1U8AA 4IOJA 4YAOA 2IHVA 3T7SA 4CG0A 3WDSA 4OJMX 4PW0A 1P9NA 4WK4B 2PHZA 2WU1A 4MA4A 2Q4TA 2VNHA 3INYA 2FN7A 1ZGGA 3EZFA 3CVYA 2CB9A 1U7TA 4Q00A 3I2GA 4ASUD 2AK2A 3IEPA 1M66A 2BDUA 3MRSA 5D5HA 4E2XA 5LQJA 2Z5GA 3TE6A 4KYTA 3D31A 1POWA 5DW0A 2HLHA 2YCLA 5CDYA 1QR6A 1G3QA 2IOYA 3BA6A 2NZJA 2R751 3UKOA 4OUDA 2V3WA 1F2DA 3FUWA 2G76A 1GG9A 3D8RA 2C82A 3LKBA 1F3LA 3NAQA 5BR1A 4K03A 4OKIA 3WLTA 2I3ZA 2J4DA 4ZTBA 3RE1A 5KQLA 4BNFA 1DCFA 1QYWA 2IGTA 1DJQA 1U8FO 2A1TS 2ZYUX 3Q7EA 2HMYB 4MPPA 4P1ZA 4QEZA 4CF3A 1J21A 2WTNA 3PC6A 4M98A 2W0SA 3NHJA 1ZUWA 2XGOA 4OSEA 2M2IA 3R7BA 2DMRA 3GG9A 1AD2A 1ENZA 3R41A 2XB2A 1J39A 4AG6A 1YQQA 3IEUA 5ALFA 1Z35A 1C9MA 5AOVA 5BP7A 1ZCAA 4B34A 2PMBA 4MR8A 4X00A 4AP9A 3SHWA 1G16A 1I51A 4EKYA 1T0PA 3DVRX 4HSEA 3K2EA 1FSFA 1L7QA 2QRUA 3EXFB 3PUVA 3PFFA 5EHGA 5AICA 1G20A 4MQEB 4WFIA 4C08A 5HUQA 6ABPA 1PR0A 1FNDA 1OILA 1MV5A 2JLBA 1H1TA 3ZH2A 2VYQA 1QP7A 3LLSA 1H94A 3D3JA 1ZN9A 1V2GA 2GT1A 3HR8A 4OP1A 4BJ1A 4EW1A 3PLRA 4MWOA 4RTQA 4D25A 1K88A 1AO3A 5PNTA 2ECFA 2ERXA 3O75A 1JHXA 5MFZA 4BLUA 1TZBA 4DDTA 1KWKA 9LDTA 4XUEA 1DO0A 3A1CA 4XQ0A 5A3JA 4BY9E 3D2AA 1UMDB 2A33A 1PE0A 2R7MA 3IUSA 4J94A 1YU6A 5H3CA 3W9SA 3IAEA 3OT4A 2H6EA 4CMBA 5BN3A 4BMSA 1TGYA 4FE4A 1EQUA 2SCUA 2CJFA 5IBPA 1EWYA 4RTLA 1PR4A 1J7JA 2QTGA 3QI7A 2JPDA 5ED0A 1GYPA 2DHQA 1H2BA 5F1KA 3VPGA 4AQYB 1GWNA 3IUMA 5IN5A 2W00A 4QPNA 1KR5A 3AUUA 3VNQA 1AKNA 1C3JA 5J2TF 2NV2B 2C1EA 3QJ5A 4R83A 4Z3DA 2Z30A 1X9IA 3IEKA 3KHSA 4HNQA 4FSHA 2F9LA 2NO9A 3A37A 3IAHA 3MJSA 3OY2A 2O14A 3P0HA 4WXHA 4G0ZA 4EA7A 4YX9A 3FY4A 4LMRA 2WIAA 3N6XA 2OAQ1 4LF6B 3NRJA 2ZJ7A 3SDSA 3G0DA 3N5CA 1KJZA 1GOTA 3AZOA 3Q15C 4WOBA 1ZS9A 3A0UA 4CM7A 1LLCA 4EB6B 1HZJA 3E9CA 1V4BA 5CG2A 4ODIA 5FL7A 2LKCA 5EYPB 5HBRA 3ZY4A 2O4UX 2ORVA 2QW8A 3RDPA 4A03A 4LMBA 2Z8XA 2W90A 1HRKA 7REQA 1PWZA 4JCCA 1KQGA 3QKTA 2I1QA 4C7KA 4ZZ1A 3MGCA 3F3MA 1E96A 1EM8B 2HJVA 4K6MA 2FZ5A 5KWEA 3LLVA 5AI6A 2FPRA 5AW1A 3SZMA 3PQEA 4CWAA 4MLZA 3QLVC 1HE1C 3BE6A 4QLBA 3BT7A 1XNJA 4AKGA 4LFAB 2NMVA 5FOXA 1KZ4A 3GRAA 10MHA 2YOFA 1ZCFA 1BXRA 1SUDA 3QFTA 1U31A 1ENOA 3MINB 5AKHA 2XVYA 4UPVA 4DIFA 5K0CA 4DABA 4A5OA 1HYQA 4QHSA 5E9WA 2VJMA 3W05A 4U7DA 2VYFA 4WK6A 4CETA 2Q27A 1T2VA 1T35A 4RFSB 5AK4A 4M1TA 5ALIA 5BW8A 4X20B 5F5NA 3OTOB 1XE3A 2QI9C 3A3NA 4FNAA 1SULA 3KYIB 3LC2O 5FI5A 1BHQ1 4CIXA 1TT5B 1A77A 4BFLA 1JIUA 4E08A 1IG0A 1N5DA 4Q6BA 4QTYA 4BE9A 4NFHA 2I3GA 1Q77A 4E3ZA 3K9QO 2QJOA 1MBZA 2PO7A 1TJ3A 1GG8A 4Q05A 3GLIE 3ZK7A 1M2EA 3D7MA 4FFBA 4NI5A 4LBVA 3TQTA 1SXJB 3BQ9A 4G97A 4F85A 1CR6A 4F92B 2QZZA 1TB4A 1D04A 2JW5A 1I3OA 2O6HA 5KOIA 3TE7A 4PR3A 2RAFA 1ESMA 2Z9DA 4GQAA 3RG2A 4FC6A 4DJDC 3MRXA 4Z4GA 1GUDA 2G5GX 2UVPB 4HB0A 1KE1A 2Z56A 3LH5A 1ILWA 2COUA 3WGLA 1XPJA 4BEBA 4FE7A 2QD4A 1XRNA 4S2EA 1FNSA 1MQSA 1SXJE 1OLXA 2NU7B 3K05A 4RQTA 4HEA6 2PH7A 2P2ZA 4GX5A 2DJIA 2FA9A 3AWDA 2ODQA 3WB2A 4DDHA 1GV1A 4D9NA 2YNMC 1PFGA 2DUJA 2JGNA 1ZHFA 3V1KA 3AO0B 1KTVA 3SJ7A 3M1LA 4RIGA 3FLEA 3JQBC 1BXGB 3HDTA 4LHEA 3TFQA 1SK8A 5ER6A 1XJQA 1KGDA 3AFHA 4ZV7A 2GHIA 4FKZA 2E6UX 1Y42X 5A0VA 4X7BA 2QPAA 4DG5A 1MA0A 4AJHA 1ZWKA 3MIIA 4OHVA 5HFAA 1A9OA 1RWMA 1TADA 1BXGA 3IEIA 2A9FA 3PD0A 2OCGA 3O2JA 3AHEA 3E03A 3QA9A 1A7JA 1QHGA 3ANXA 3EIEA 2Q5HA 3DLAA 4JBLA 2VSQA 2JBAA 2L0XA 3OVMA 2FEKA 1OH7A 4P7GA 2PSEA 5DGDA 4R2JA 1HYHA 3DZHA 4HPWA 4M88A 1FW8A 1IE3A 3TTXA 4DKXA 1M2GA 2IELA 3G82C 3LHIA 3DTVD 2APJA 4MKGA 5T8KC 5KOHA 2ZLBA 1C9YA 4GSYA 4JL8A 5A06A 3T3OA 2WE8A 1QOZA 5AIAA 3F97A 4RTJA 2Q9UA 1Q83A 2QM8A 3OTHA 2XJ4A 2CVOA 2BN4A 2POQX 1CD5A 3CPJB 4TV9F 1FNMA 1ECPA 2HBRA 2O8NA 2ZSEA 1LPAB 3CZQA 3FCOA 2E4VA 3E5HA 1W52X 5D00A 4YT2A 3A4NA 4H7HA 5FTMA 2FKAA 2QN3A 2O7QA 2Q50A 1D5WA 3COZA 1KETA 3OCVA 2WHPA 3U26A 2TS1A 3T7RA 1UUFA 1NYRA 3O83A 4XYBA 2XOKA 1JIKA 2QNBA 3BWMA 4G9EA 2OR3A 3VR5H 3RFCA 2C2BA 4GOND 1V8BA 1M0TA 2ZSJA 3OWHA 2JAWA 5EP1A 1RT9A 2B1JA 3GH3A 1WV1A 5FRDA 1LDBA 1XDBA 3OE1A 4RA9B 4D4GA 4E2YA 1DGQA 4QDUA 1W47A 1WU8A 1PJRA 3OOHA 1U0TA 4PO1A 4CFSA 4C7VA 1DI0A 2QDXA 3I2FA 5I7UA 5MN6A 4HVAA 4ZCPA 3KTFA 4XVUA 3KYJB 5C5CA 1WDMA 1AB5A 2PANA 3JATB 4PC2A 3FB4A 2EFEB 4QYTA 4R68A 4HWSA 5CFPA 1HDZA 1Q6YA 2VP4A 4PX5A 3CU5A 3RVOA 2QM0A 5DTQA 3DE6X 3C1TA 3VR4A 1P5FA 4YAKA 3MCZA 3ITNA 4XPZA 2RHOA 1PRYA 1GA6A 4P0TA 3KKQA 2C7RA 4MVJP 3IUPA 4MTCA 1N32B 4OQDA 4PQRA 4PSUA 1U3FA 2VAVA 1EGMB 2NUPB 1HX7A 4R1UA 1XUOA 1I3LA 2JIOA 1E7WA 1JLKA 1Z7WA 5HG0A 1T26A 5FNVF 2D74A 1BKSB 4NMHA 5EKDA 4TKUB 1DXQA 4KHZA 1JIQA 2BFEA 5B3KA 3U16A 1PV4A 3DHVA 4UXJA 3TNYA 4L9RA 2VCYA 2VHVA 3HY3A 3IV7A 1PDVA 4DOMA 2PNJA 1IY1A 1Y3AA 4JLJA 1H2ZA 4UHKA 1R0WA 1BOOA 1TI7A 2VSFA 2RAUA 2P68A 3USES 2YHAA 4Q1CA 4J1QA 2PMWB 3B7WA 3C15C 1V7QA 3ZDAA 3I0NA 3KQLA 2HRDA 4BJ6A 4DEVA 1PQYA 3GBSA 3ML1A 4UW9A 3MJHA 3QUQA 4BCBA 1GR0A 3JVEA 4NZPA 3EJ6A 3SHFA 2CZCA 2GD0A 1W5EA 1WF3A 1YQTA 2X8WA 1CUEA 5HIJA 3C5WP 4H1UA 5JVDA 1Z2NX 2CVZA 2GK6A 3AGPA 3L7CA 4MYRA 4B32A 3PEWA 3HPQA 3ANTA 1NW8A 2GBIA 3O9VA 4R0NA 4BMNA 3ZNOA 4XWWA 1GM5A 3DZDA 2ZTHA 4TYWA 2ATXA 4R98A 1KRHA 3T3IA 2WMOB 1Z29A 1WBJB 2NN3C 2KLHA 1BWRA 2YYSA 2ZE7A 1OLSB 3FZYA 4KVFA 5D86A 5BWLA 3U61B 4R71A 2Q6OA 1IWOA 4IUBS 3QHQA 3N3BC 2HSGA 1II8A 4JWTA 4OATA 5CTJA 2VNKA 1U28A 4NFYA 3U9TA 4BN0A 4A8JC 2OMKA 4CL8A 5BUQA 1NKSA 4OG2A 4RSRA 2VDNB 4I36A 1FFYA 2EBWA 4FDAA 1BVUA 4DXHA 2BKEA 2WM3A 4M8NE 3RO7A 3L7YA 4CT4B 4E31A 2AEJA 4A1OA 1Z0UA 2DQ4A 2EKQA 2ONKA 2B4AA 2GA9A 2HK8A 4GVPA 3H2HA 2E4XA 3SHTA 1X7XB 1MNAA 1PG0A 3O4HA 5I8ZA 3SS9X 3G1TA 3UC5A 3ZQ4A 3VHXA 1CDZA 4A82A 1YA6A 4JJIA 5CW1A 3B2NA 1GPWB 3IUYA 4KSBA 2INGX 3AL3A 2FN4A 4L4UA 4CVNA 3JASB 4DJAA 1QH8B 1UFVA 2XWPA 4REQA 4TS9A 3ZBUA 5CBPB 4H15A 4IHJF 4HZGA 1F0NA 3MCWA 4US2R 3T52A 3EA4A 1R5OA 4D9CA 3A6FA 5EP2A 5IKOA 2AE2A 2V96A 1OC2A 2IK8A 3DV0A 3PFGA 2JVIA 5FNVA 1FRVA 2G8LA 4C76A 4RCYA 5IYZA 3L4BC 2JDID 3L1IA 1EWTA 1VLZA 4JLNA 3W1VA 4JQOA 2L82A 3PDJA 4UD2A 4RV4A 3DB2A 1PTKA 4TLLB 2IHKA 4PLHA 4M0FA 5I8PA 2L17A 4KEAA 2E4UA 3M8KA 3VXKA 1YASA 4HQ6A 1MGOA 2P9CA 3QU5A 1Y6QA 3V8VA 1T2NA 3HGTA 2UZIR 3KUDA 2I62A 1OGYA 1N3BA 4UTXA 3H6HA 4Q9HA 1HDXA 1MB4A 4RWEA 2CMKA 3AEKA 2BH2A 2RKWA 2NM0A 3STHA 4Q3AA 5K4HA 3V4PB 1YBHA 3ENVA 4RBNA 4S2UA 1G7RA 4IG9A 1Y5LA 4AY6A 1E89A 1ZJ6A 2YL2A 4LI3X 3DVQX 1T29A 4IIUA 3CN9A 1Z73A 3OQIA 5AKEA 1YQ9A 1CZNA 1RU3A 2FN9A 4EA8A 2PXAA 2G40A 1WETA 4QJ4A 1Q3TA 4Z51A 5IC5A 1MORA 2P1DA 3P9CA 3AI3A 3CUKA 3F6YA 4FQ8A 3TKAA 1IM5A 3NASA 4EWLA 1T2EA 4WT7A 3R3YA 1OKKD 4YCDA 2PZMA 1NBHA 3CRZA 4E5PA 1ZH0A 2I4MA 2JKYA 5CJJA 2PX3A 4GPEA 4ED9A 5ERGB 4QBKA 3WNVA 1L4GA 1TM4E 3C7CB 1QAMA 4R8RA 4Y2QA 3ZNQA 3ZQUA 4AZVA 4CIAA 5JMOA 1TQ6A 1SH7A 4Q4AA 3S3TA 4BNVA 1E4OA 3LM8A 1LDEA 3HSKA 4V38A 3V55A 5D87A 3TSZA 4S1NA 1QJCA 2OO3A 5C4MA 3F8SA 2YS6A 4ZK6A 3U19A 3H8JA 3TJZA 1BAPA 1WULS 1PAUA 3K9CA 5A5VA 4CQLB 2W22A 3HJAA 1H66A 4Y98A 1GRQA 3IR5A 3QWIA 3ZLVA 4YRAA 5CFRA 4CXMA 5ALLA 4PYRA 3CX8A 3ZCVA 1DTSA 2HU2A 1B15A 1V43A 3R5FA 1QHXA 1P45A 1LJ8A 4XTRA 4ARIA 3BMQA 4FCCA 3D0OA 3M9WA 4FNMA 1A9TA 4CRWB 4FFOA 4HVCA 4I8IA 4DC0A 1P18A 1A7AA 1DWUA 2NU9A 2VEDA 1BRMA 4NEQA 3WWZA 4ENPA 1AVTA 3R6DA 3GXBA 4GG1A 4NMLA 3RKUA 1A2OA 4MV6A 5AVTA 5CYPA 2GBCA 2P9FA 3HC7A 6Q21A 3QBJA 4D0RA 4DLWA 2BHLA 5BO5A 4YCAA 2AFRA 3LCJA 1IZ0A 1QCYA 4DV2B 4D5GA 3NDRA 2QS9A 3BMOB 1EBBA 3THWB 3H4IA 3W6UA 3UOWA 3AEQA 1UKCA 1BQ3A 2NXEA 3OQHA 3NAZA 4O1IA 3VJLA 3WL4A 3PUXA 4QTXA 1X77A 2VQ3A 4BDSA 5HIKA 1Y6GA 1LSOA 2R1TA 3GNTA 2EZ9A 3OFNA 4TWAA 2A4KA 1USWA 4GM4A 4EG5A 1Q1AA 5F5LA 2WEKA 2IZ1A 4MR7A 2I03A 1Y1QA 2YJNA 1K86A 4IWYA 4MWDA 4ARZB 5JZ9A 1IJFA 2YWCA 4PYJA 2EJWA 4LNUB 1PWXA 4ZARA 2VXYA 3QEMA 2QTFA 1BDMA 3HSSA 4FMDB 3V4FA 4DR5B 5J4KA 4L5BA 2J9FA 5KS2A 3RABA 4RLHA 4PGFA 5CM2Z 4UZEA 5IDYA 3RTDA 1SIWA 1U2QA 1KERA 1GCOA 3TQQA 3U81A 2XXJA 3DBHB 1OROA 1BYIA 2Q4RA 5A4KA 2VTDA 4M0KA 4U6NA 3U7RA 2ZBRA 1JSCA 1LZKA 1T4BA 1DG9A 1VGRA 3Q2OA 5DM1A 3T3PB 2CDCA 3B1YA 3SZOA 1O5TA 2Q6KA 2ZATA 3ZXUB 4PQGA 2B6NA 4L6AA 2AZTA 4EGCB 4L9AA 2ZOSA 1ADCA 2TMKA 4ZHQA 1X74A 5J4VA 4UAVA 4CV2A 3CLRD 2BP7A 3OEEA 4E2WA 2HEGA 3W2FA 1J8DA 2Q21A 5ADWA 4F4FA 4MVWA 4UNSA 2F67A 3A1EA 4N3AA 4PONA 3S2YA 4BNWA 4PANA 3WQHA 1ADGA 5K6AC 1KJIA 1X19A 2VF5X 4MAAA 4UCFA 2FFRA 2ZQZA 1V16B 5FBVB 4WECA 3WK4A 3K8QA 4CM8B 1UJ4A 4V02A 4ID3A 4KH0A 4E09A 2J31A 2HK6A 2XYRA 3UOAB 4MS4A 4O4LB 2BKXA 1FXUA 4YCBA 3WTBA 3NIDB 1YA4A 2FJPA 2R87A 2GPWA 1SBZA 4AF8A 1S02A 1Z07A 5FBHA 5DIFA 3ZQKA 3GWZA 1F2UA 1JEDA 3NHAA 1NT2A 1T8TA 4ZI7B 3FYHA 3LXUX 5CAEA 1IN5A 5M3BA 4YMLA 2EQBA 4H7JA 3FNQA 3O5AA 3M4JA 5AKXA 3FBWA 1MB2A 2ILTA 1V9SA 1SHUX 1RC1A 3FNRA 5EOVA 2QKYA 3SE7A 1OFUX 5AOCA 2WSLA 1X1CA 2Y93A 3RBAA 1PNQA 4UOEA 3A2NA 4ML3A 2BBOA 3R7LA 1Z0ZA 1NKTA 1XLVA 4LRTB 1FEZA 4FHCA 2CJYA 4JBHA 1F6BA 4MQUA 4N6OA 4RDHA 5EMMA 4DFDA 4EPTA 1R18A 2VEOA 1H65A 3DTVA 1OXVA 4PC1A 7ADHA 2G4CA 2BBTA 4IQFA 4UNIA 1FP2A 5AJTA 3RS5A 3AEUA 1T8WA 2GM9A 3OP4A 1AOXA 2O0KA 3GAMA 4HDRA 3MNFA 4RETA 3SR4A 2PGDA 1L4KA 3WKBA 3QOYA 1YQDA 4D46A 1PT5A 3MMPA 3A70A 4KW7A 2EZTA 1W59A 3H9QA 4NABA 3RRYA 2QTZA 3TUJC 2ZYSA 1KPIA 4QJ3A 5LIPA 4E2ZA 4LV8B 3J81A 1RVDA 2A1UA 3FSGD 2Z5FA 2ZT8A 3SIRA 3ZYZA 3GI1A 4YHBA 4OKSA 1FJHA 1L4HA 4ERXA 3TECE 4N6GA 1O6FA 4OIMA 3UA4A 1PGQA 2VKQA 1SBTA 2JATA 2ZANA 1HL3A 1SZPA 1N3YA 1RBZA 2DHRA 1EX7A 3Q10A 1PV2A 1MX5A 4BNNA 2ZU6A 4G5XA 3AUYA 3R20A 3RWOA 4C07A 2GN4A 1P2VA 1KEWA 5ENZA 3KSBC 4TXNA 5EMKA 1WR8A 3RODA 4LCJA 1IN4A 4C78A 1QUFA 2CEKA 3ZBQA 3EGXB 4N3GA 3W4KA 1G4UR 1NV8A 1ZKDA 2JVKA 5KDOA 5KYUB 4FEEA 1QGUB 4J3NA 2JIZA 2D2EA 3PQ8A 2IP2A 3ZZUA 3ZY6A 3FNFA 5E6SB 1KVUA 1SCBA 3I64A 3NHUA 3AF1A 3V3KA 2GYWA 3CISA 4P3NA 1NQVA 3IKJA 2I54A 3JTMA 3N0VA 3PUZA 4MZXA 3FFXA 2PT5A 2PD4A 4J6EA 4KV9A 9GPBA 2H63A 3QZUA 4P36A 5FLKA 2H5LA 3TRHA 4I1PA 1B23P 4KI7A 3R3ZA 3L82B 1OD6A 1L5KA 1RBYA 4CNBA 3U3MA 4MRAA 1M54A 3U1TA 3UJ3X 2NTVA 4KO4S 3KKOA 4G0OA 3UV7A 5IMBA 3UVEA 4PGGA 4QSHA 4ZC1A 4JLVA 3NVAA 1DRKA 1OA0A 4JYMA 2WVHA 3K5HA 4Z86A 5TQ2B 1XMPA 2QM7A 2HWXA 2W98A 5BSVA 3EPLA 1D5CA 4C2UA 1DC8A 3NUZA 4Q6WA 5FJJA 4F5YA 3A6ZA 3SQDA 1DC4A 3PNOA 1XYYA 4WHMA 5LQKA 2PKWA 4ZZ0A 4NK4A 5I4CA 5JJBA 3QEBZ 3OC6A 1DO2A 1PJBA 1VE7A 3JPYA 3WLHA 1WOYA 4BBAA 1NVKA 3QPWA 5HA5A 6REQB 1GIAA 4C9BA 3AZQA 4TTVA 1ZWLA 1P7WA 2PR2A 4NZZA 2OFWA 2IHJA 3PNSA 4K1XA 3D3EA 2X0DA 3ZHTA 3TVYA 1PL0A 5F2KA 1G55A 3NBUA 1PK8A 3QVOA 3ZWCA 1K66A 3K6KA 1QHFA 2DUMA 2C4WA 3DWEX 5F7JA 3EF0A 4O2AF 1KARA 3JYNA 1MJGM 2VAWA 2GCNA 3T5DA 4A0HA 3GNLA 3AK4A 1Q95A 2QG4A 2UYYA 4C7BA 5BSTA 1JFSA 5FOQA 4LOHA 4BVAA 1X0XA 1JU9A 1EA7A 3MUNA 3RUAA 3OCZA 2GCOA 1KBZA 1OTXA 3IUEA 2ZM6B 3BFXA 3HLKA 2VHTA 4MROA 5KX5F 1IOVA 4AZ3B 1U2SA 3KLMX 2RGAA 1DKRA 1R2QA 2F48A 4I5DA 4LAFA 4MI6A 3AV3A 4ZVSA 1C7JA 1RYFA 5BOVA 3UG7A 2PMFA 4RKQA 3TFOA 3HKDB 2HL6A 1YR7A 3ACBA 5AM4A 3QNUA 1P2SA 5JCJA 5L40A 3GLHE 3EXIA 3EMDA 3QFCA 1D4ZA 3UBMA 4GXTA 3IXLA 4R1QA 3R4CA 1DC3A 4NCIA 2VP6A 4RVOA 1F6WA 3NI2A 4XJSA 4WCFC 5IK2A 5JZMA 5AH0A 1GNSA 1SQFA 1CG6A 1SIOA 3FTNA 1KXZA 3B89A 3SYMA 2FMHA 4CI0B 4ZDJA 4KDCA 4JS0A 3D7LA 4N5IX 3HUTA 1MFPA 1H6DA 1Z3CA 1KWGA 1QVRA 1DZ3A 3GVHA 2WK1A 5KTSA 4K9DA 4BN4A 1PBNA 1HOTA 3OQNA 1H69A 4JXXA 1UMBA 4Q9DA 4YTEA 4IGIA 3QGMA 2CHGA 4LOIA 1SBCA 4RFLA 2VDUE 4ZYUA 3VU0A 1MN6A 4EAAA 2ZJ2A 2YFKA 1YONA 3JQEA 2R1ZA 1FBTA 3WMGA 3R5XA 1QHIA 5E8RA 4QNRA 5EY5B 4ZAGA 4PZLA 1ZGAA 4RDXA 1TYBE 2LD4A 1TTTA 2G63A 1J42A 4NU0A 2TMGA 3WADA 3IAS6 2O5VA 3V7YA 2FSSA 4MW4A 1WDKA 1U2GA 2A94A 1BS2A 4BLOA 5LUAA 1IRXA 5K2MA 1Z83A 3VHXB 2OXIA 2MYPA 4IJKA 1Q50A 3H1FA 3KB2A 1O57A 3FXAA 1GDDA 5KX5A 1EH5A 3T5MA 1W29A 5A71A 3T7DA 4CHGA 5F3DA 1RC8A 2NQTA 3HMKA 4E5MA 3C1AA 1KVRA 5AKIA 5DX1A 4JJFA 3TIFA 1PUJA 3LAWA 4TOIA 4X8OA 1G5RA 4ZK2A 3GFFA 2WKQA 5E6UA 2YVUA 4LE0A 2EIHA 1FQJA 2C8KA 2LBPA 2I29A 2JVJA 5IAEA 4F8YA 5HQTA 3ADDA 3G2PA 2XE7A 2VQEB 4JJKA 4G1FA 5DULA 1JUDA 1LRJA 3EXHC 1A5BB 1WB4A 1FP4A 4MCAA 3A4YA 3MFQA 4NYIR 4M1WA 4AQDA 1RQNA 4J4HA 4O2AA 2HA4A 4BZWA 5CHEA 3WV5A 1HXHA 2ZQ5A 1L7AA 3COYA 4FDTA 3NKFA 1ZFNA 4OM8A 4NOKA 4TKMA 2FXIA 3N2NA 5HF8A 4M0DA 5JEEA 3MWLA 5DPMA 2QRVA 1DAIA 1T4CB 4F8EA 1M8FA 2NU8A 4COKA 3Q5GA 1VKRA 4FDLA 5TQ0A 2O7RA 4EMBA 4HY3A 4W5QA 2DOKA 4R54A 5E4YA 3W5AA 1NVMB 2C95A 3BA1A 3SEAA 1EEHA 5KSYA 3K1AA 1MJNA 1E1QA 1YRBA 5KEIA 1QC5A 2GFIA 4BRUA 1UEIA 4NV0A 2IYRA 4J0QA 3TQHA 5BR7A 5B58C 1DUIA 4ZYZA 3N2KA 4O2LA 4B8ZA 5IZCC 4C7JA 1KFBB 2VFAA 2FTKE 3OTGA 1LV8A 3JQQA 2CFSA 3UHOA 3CHYA 1PZFA 2BSXA 1H93A 2VWHA 4O4HB 3KLNA 2G72A 4JUCA 4R3WA 5AI5A 2QUAA 3R9KA 1PZMA 3SHOA 4QRHA 3JXEA 3N2GA 5AOBA 4ND8A 1D09A 3T7AA 4ZDWA 4E5DA 4DTCA 4AZ3A 3JZFA 1KOGA 2I7CA 4ZN6A 2I4TA 2P7IA 4OFWA 4RHUA 3H9EO 2AOTB 2ABWA 4WLOA 2GN9A 2C3PA 1G6KA 1KDTA 1KMQA 1I7QB 2R5WA 5U1PA 4EB6A 1FDTA 1ZJ4A 3H2YA 4NEGA 2VOEA 4FMPA 1IPHA 3BRQA 3RRFA 2HYDA 2XE6A 3E9QA 3K8OE 5IAOA 4P4GA 3RK1A 4I55F 3AF3A 1FRFS 3HU5A 2NO6A 5TXGA 3VZSA 3T3DA 1TVEA 3CZCA 3ZIDA 2ZK7A 4EPYA 3A9WA 8OHMA 3EQ2A 3AG5A 1OXTA 1YB7A 4IILA 4C2BA 5A2GA 5FTKA 3M4YA 3OLVA 4ETIA 1AKEA 4Y6QA 1B42A 4MYHA 2XKJE 1QH1A 1GPUA 4FHGA 4FYIA 1KIMA 1NI5A 1YR8A 1ZXLA 4GWLA 4B0OA 4IL5A 2AG6A 4LOAA 3ER8A 5AOAA 5CNMA 5E0KB 4K3UA 3CLTD 3MWKA 1NQXA 5CT5A 1XLTA 3UGTA 2ODBA 1Z12A 2JLCA 2WG2A 3CM0A 1V9CA 3PZBA 1ISFA 4RY0A 5BV0A 4KL8S 2R8RA 1NBWB 3DDCA 1DL5A 1V8OA 2OILA 5G53C 1V5FA 4DNQA 2ZUEA 1GKIA 1E1RD 1EAYA 4KFTA 1ZUD1 3CSUA 1TZMA 3EZ9A 3KDPA 4GM1A 5IYZF 3VSAA 2YJ4A 2NP7A 1WW2A 3ENQA 4NG4A 4LQDA 3ZHXA 3A27A 1E6UA 1FDVA 1C3LA 2UKDA 4A6DA 4YMUA 4LPKA 2HO4A 2ORWA 2POCA 3O0TA 4HLUA 3T5TA 5LNK6 1A8PA 4ARZA 1Z8HA 4D96A 9LDBA 4QAJA 3UIEA 3V7NA 3CEAA 3EYAA 4XEHA 4KR3A 4BMYA 3DWFA 1NI4A 1FQWA 1P3Y1 1FP1D 5HM8A 3G1UA 4LDQA 3I01M 3WIOA 5LZ4A 2VG8A 5J3JA 1UODA 4HDNA 2PUVA 4P31A 3RV3A 3N59A 5I3CA 1POXA 2Q1TA 1E66A 3WSVA 3GC6A 4YECA 4W5TA 2WJ6A 3X1WA 2MYTA 4D9EA 4QGFA 2CXNA 2V5AA 1DAEA 1E2HA 3FMPB 2AOUB 2JAUA 3BICA 2E4AA 3INRA 4YMTA 5KOJA 1NW7A 4B8YA 5JYBA 1D03A 5D5QA 3ZWKA 3LOQA 2SNIE 2XNCA 3WYBA 1F48A 1ZGHA 4YVFA 1LEHA 1KO1A 3DV2A 4LY9A 2ZJ4A 4QREA 4DMRA 1F60A 1X7XA 1Y5MA 1T13A 2ATEA 2BTQB 2VUTA 3HDQA 3T9CA 4AMYA 2X15A 4JBYA 4Y6RA 4ZDIA 5DP2A 3RBVA 3AETB 4J0IA 2JJ2D 1CFZA 2I9KA 1OBHA 1KE2A 2OG2A 1QTQA 5J4HA 3IDOA 5BXYA 2DWUA 2HQSA 1QAOA 3DFUA 3SZGA 3IP7A 2H8GA 4JR1A 3QBEA 1ZD4A 1ONSA 4ND8B 3UUGA 1AS2A 4I55B 2W58A 3GELA 1W96A 2MSCB 3MLAA 3G6KA 4LJ5A 4M7RA 3LDUA 3UHPA 2VYVA 1VZ3A 2P2GA 2XF2A 1WCIB 3RTGA 2C2MA 2D4HA 4PBRA 1RW4A 3CB2A 4HQFA 3QBDA 1E6MA 3O7WA 1W4BA 3AUAA 5H80A 1C4OA 3U4CA 4Q9KA 2AZXA 4KP7A 4CG3A 1PD1A 2O8VA 3G5UA 1JYEA 3CLTC 3GVPA 4GP6A 3O4VA 1PHPA 1GARA 2F1HA 2NSJA 3DLCA 3G7SA 1KI8A 3P94A 2COEA 5GOTA 4O0MA 1JHPA 4ADSG 1J8YF 5CK4A 1GSIA 2FF7A 1YCGA 3M6VA 4PV7A 4IKOA 5B64A 3CVVA 3JYQA 3F1LA 4UBJA 4NXNB 3BHIA 5FI3A 5JBIA 3AIKA 2ACWA 2A7QA 2ZYGA 1K7EB 2A9JA 4HXYA 4C4ZA 1Y5RA 1GP2A 4MWSA 3I5YA 4JI8B 5KNCD 2CLHB 2VHQA 2O9JA 1HLPA 1ID8A 3PPIA 1CJKC 5FBWB 1W4CA 2AOXA 1Z15A 1YB1A 1VHDA 1I2CA 2LXNA 1WUJS 1V47A 3ZWOA 4GQBA 4KE8A 2WJWA 4RCZA 2EDCA 4W82A 4CYMA 3AJRA 3TBKA 2FQ1A 3OSZA 4CLDA 3O8RA 2WJHA 2B0JA 1VI2A 3AP3A 3KQQA 4TT3A 5BQFA 5JNWA 2NZVG 2XQFA 2DM6A 3DMGA 1ZVVA 5CPBA 3OI7A 2QGFA 2B8EA 1HWYA 3AFIA 3PWZA 1VHJA 3FPJA 3TINA 3UCXA 5K6RA 4IRMA 3S99A 4B3GA 4EGJA 3R1IA 1P72A 4IV8A 3LUFA 4PZEA 1OYVA 4HRYA 4GPZA 1J1ZA 2GD1O 3JVVA 4XX1A 3UMVA 2XCIA 2G8NA 3NVMB 4DEYA 1XPRA 1GGNA 4M7WA 2ANBA 2H0AA 2C2KA 3PNYA 1GU7A 4ETMA 1CJCA 4OYLA 4MRMB 4TRNA 5FLEX 4F2DA 4BXOA 2IW1A 3TW6A 3X2SA 4E5VA 2P8JA 2TSYB 3SYLA 1Y6RA 3AHGA 1YUBA 3COPA 3NNDA 5CIWA 3QEMB 2LV8A 3SDZA 1QANA 2QTCA 2KWIA 3AB3A 2FHPA 2Y3IA 5JVDB 1NWHA 3NOXA 3HU3A 3UAXA 3HA5A 1WUHS 1UBSB 2PQ6A 4WFJA 2OFOA 4PQYA 3VPFA 3HVHA 3HO8A 1SRQA 2R48A 5JATA 2NV6A 4C29A 2O8CB 2R9VA 3PE3A 2Z3WA 1JV2B 2F00A 1QK5A 2Z3ZA 3ED1A 3EWSA 2VPZA 3SI7A 2K87A 4M22A 4DSZA 1APBA 3G8AA 4UUOA 4OHUA 3SOPA 2JKVA 5KNBA 4AJOA 1Z0JA 5CURA 3INNA 4R69A 2QMQA 2AI2A 1I0ZA 1NMXA 3P0EA 4NU5A 2J6CA 5KNBH 5AJXA 2BMDA 2PH5A 1ZLXA 3D6HA 3UF0A 4YRTA 3RFFA 3AETA 4NJOA 5LQAA 1SY7A 2P3OA 4DM7A 4DMUB 3VMFA 5I4IA 1RWNA 4I1VA 5GJCA 5E1DA 3BIXA 1P7PA 2NO1A 5EMHA 1K2VN 3EFEA 3D5EA 3E9NA 3CNEA 3JATA 4NG5A 4G5RA 5BSEA 3NBKA 3R7DA 5E2IA 4G8JA 1TTQB 1XMIA 1MVNA 1KAHA 3B9QA 3ND9A 3N05A 4IAOA 4UUQA 4D6XA 2IZZA 3W6NA 5GQSA 4YRRA 4YJHA 3RUIA 3VKUA 4RGQA 1I4TD 4CT0A 4HJRA 3GYGA 2OHVA 4HNSA 1GY8A 1VB3A 1TW3A 1ZPDA 3HYTA 4DNXA 2FSIA 4HBGA 4G2TA 3LC7O 4GXRA 3UGQA 3UMFA 2HLNA 3PJEA 1VXOA 4ZCMA 4RHCA 1AKMA 2ZI7A 4X60A 1MO4A 5C8YB 4P0PB 1OZHA 3O95A 1M2WA 4BECA 2H1CA 2NU7A 3DA8A 4G5SA 1UPAA 2CUTA 3IERA 1V3QE 1R0YA 4IQ8A 1KNXA 4REOA 4RMNA 5DYNA 4FZ3A 2AI3A 1AU9A 4LCBA 2R66A 2WD9A 3A1FA 4QELA 4ZVVA 5CEEA 1L8QA 2K7FA 1TT7A 4IXWA 3DUWA 4U2FA 5CBPA 2QYHA 2Y0EA 1BE0A 2P7HA 4OX9B 2XSZD 3VNAA 1ZEMA 4BQPA 4EJ2A 5L3RA 1P2DA 4P4SB 4BMCA 1JH9A 3MTAA 4OXQA 4I4NA 4YAIA 2OCPA 1P44A 5AVQA 1VBFA 2JIMA 4NJMA 2JFNA 3S2FA 3IKTA 5JD4A 3ZDCA 4Z9YA 1U2DA 2YOHA 5C7LO 1Z6QA 3DM5A 2Z4SA 2B25A 2X1VA 2FSPA 1P74A 3AYXB 3PUHA 1JDTA 3Q1KA 5FXMA 1O94C 3OQVA 2O7NA 4I8DA 1JU4A 2ISSD 3P27A 3C3KA 4PLGA 1TKAA 3OEHD 4L8GA 3ZV3A 3ZCRA 4F1JA 1OF1A 1B43A 1KEZA 3D6NB 4M0UA 3QIVA 4J2TA 2BEVB 1CUWA 4BNTA 1C1DB 2EQ5A 4MEAA 1L1FA 1WXIA 3OT1B 4E13A 1JHMA 1E2DA 2I80A 3EGXA 2VJMB 1WXGA 2H0QA 3FOEC 5CVJA 2G7ZA 4L7QA 1V5IA 1XWIA 2OENG 5A9TA 1YMVA 5A3QA 1N25A 3TEFA 3HU1A 5DX8A 3WLSA 3IAAA 4KXYA 3BMNA 5K4GA 3A32A 2EP5A 2LRHA 2GF0A 1RWVA 3QE9Y 1UFQA 4C22A 4CGZA 1KK0A 4RHEA 2NYRA 1YF3A 4TV8F 1ICEA 2IYPA 1W1IA 3LYLA 5AM2A 3S1AB 2QORA 2X22A 3IULA 1PGOA 1U7XA 4HF7A 3BH0A 1L5HA 4DDWA 4W1SA 2UZ1B 2BMAA 4OMCA 3EE6A 4I2NA 1QSGA 2PZAA 4B3DA 3IP5A 1LNZA 1BC5A 1WD5A 3I5MA 3WHPA 3ZXXA 4F4JA 1CY4A 3GK3A 3U44A 2X86A 4KO3S 4E33A 4MMYB 5KTMA 1S3GA 1GYQA 1A8IA 3ETJA 2AUTA 2FWBA 3IQIX 5D3ZA 1LQ2A 4JBXA 5KNDD 2WF8A 3ZX4A 4OO3A 3O7MA 5AI9A 4R51A 2P6UA 4NKRA 2CYCA 3OO0A 4TSFD 1EVIA 4RXTA 1G41A 1I7NA 1NQOA 2I71A 4M60A 5LXTF 5K05A 3DOCA 3HR7A 3PT5A 3RYFA 2C1ZA 3QYJA 1K75A 2FLVA 4ROTA 3EAQA 3PEEA 4P83A 2RCYA 3L6CA 4CM9A 4F93B 3A6KA 1V8FA 3M6LA 4RPLA 1SOMA 1TT5A 2J6HA 3OA0A 4AO8A 3JQ6A 1QO7A 4YRLA 1EA5A 5ALKA 2HU5A 3T99A 1FFHA 1HTTA 4U0JA 4M1SA 2IUFA 2WT4A 3GUCA 1Z9BA 1VHTA 3EIOA 2LR0A 2XRFA 2CDNA 3TD9A 1XA4A 3B9PA 4AD8A 1W4LA 1JI0A 4PPQA 2M6RA 2AZDA 2H52A 3TRJA 3TBHA 1UBKS 2H4FA 3UN1A 1ND6A 5B57C 4YP6A 2D1YA 3VOAA 2IS6A 1P5HA 3TVTA 5JDIA 4KLRA 4INPA 4PN3A 1OIVA 2JFZA 1TM1E 5I9IA 3LHKA 1SHKA 4Y9TA 3Q3CA 2F17A 1NTRA 3C3YA 1FNBA 1L3BA 5EIOA 2IY9A 5MHTA 3LPCA 3NGMA 1G64A 1B8VA 1YL7A 2YVAA 2JI8A 2YY7A 1EVZA 1WUIS 1TPZA 1OWNA 4JYAB 1K8QA 2Q1SA 3I92A 4KN5A 1KO8A 2RHCA 4YP7A 5TARA 2WQ7A 5HTOA 3I1FA 5B1YA 3NEPX 1PNTA 1N8SA 1SHZA 2CNLA 4KJXA 1KZ9A 1J0XO 5ALMA 2AOVA 3ZOZA 3GP5A 4CTOA 3Q85A 5I7RA 1SHTX 4MKRA 4U9IS 2G9ZA 4ALMA 2BONA 2G9RA 1CRPA 5C1OA 3F96A 2A35A 3QVLA 1E3WB 3U37A 4FDMA 2GZ2A 1NUTA 3V1UA 2EX0A 3G17A 2BSQA 4F96A 5M2QA 2WMDA 3CCFA 1I7SB 4Z7JA 1Z6XA 1VP3A 3QUBA 2OCIA 4IH1A 2PSHA 2FW9A 1WQ4A 2WB2A 1YK1A 1NR1A 1HF3A 3KOMA 2F43A 1R16A 2QEQA 2QX4A 2R4QA 4FHEA 4KUEA 4PAOA 3M5PA 1XVIA 5B30A 4LK3A 5M7EA 5KKNB 4K6GA 3S40A 1SOWA 5DM60 2P30A 2B4YA 4ZIRA 4Q1DA 3I39X 3FYUC 1VCIA 2GNOA 1EXWA 3W5CA 3U39A 4Y6GB 4B4DA 4HLNA 2SKEA 3ZD7A 2CMDA 3NB0A 4HCJA 4JUIA 4BGEA 4YCLA 3FFBA 2UYOA 3QXSA 4NESA 1RRCA 1Z8FA 1P4AA 3CURA 3GCZA 4QFDA 4XWKA 1TKCA 4JLAA 4KN6A 1L6RA 2QK4A 2ZRMA 4FFSA 1KEUA 4V0ME 5FTNA 4DPKA 4CFZA 4DIEA 4RAOA 1L7NA 2W2QA 1GL3A 2CXTA 5CT8A 1QXSA 3IR6A 2HU8A 1GPKA 1L5OA 1TGVA 1UFKA 3BB4A 3HWX1 3QK7A 3VAAA 4G1MB 3O1JC 2Z3VA 1UEXC 2Q3EA 1HDEA 2EL7A 3C8HA 3FN4A 5C46F 5ELXA 3O3NB 1BCRA 2Q9CA 1XNQB 2EZ4A 2ZRPA 2BCJQ 1IZZA 2PSFA 2PJUA 2WKRA 3MA0A 2BGTA 3OPNA 2JAHA 4E14A 2BZ1A 4WZAA 1E63A 1NBMA 4LJKA 4QATA 4S1OA 5FPKA 5ITZA 3NR2A 5IJ0B 4RORA 1AUPA 2Q7XA 4K9PA 2NVOA 2IV2X 4GYYA 2IYTA 5MF6A 2NOAA 1R5BA 3OLZA 5IKPA 3HVRA 4JSTA 2NU8B 2VTBA 5DBFA 4BLPA 4HYYA 1HA3A 1DIRA 3DJYA 1LUAA 1WJGA 2B5WA 3FPSA 2VRCA 4L02A 2XMBA 3ULKA 1CEXA 1U4OA 3LBFA 4L4RA 3ZBTA 1V39A 2ZRHA 1H0HA 1L7OA 3KR1A 4N3CA 3KQVA 4U7GA 2C9MA 6GPBA 3M5CA 1U8XX 1IIBA 2YZMA 4KGZA 3VZCA 1V4VA 4RYLA 1Q12A 2P5SA 5BN5B 3NHFA 4OUDB 3LYAA 4ZEVA 4PPYA 3W7AA 3UK0A 1KYVA 5EEHA 2YWBA 1TX4B 2ZI3A 3YASA 1E79A 3B7PA 4LBZA 3I2YX 3Q0EA 4JUDX 1Q91A 4AN4A 5FA6A 1UOQA 2HRRA 5IJ9B 3TXAA 1Q84A 1R0KA 1Y7PA 2A7XA 3GEPA 3NHZA 3SR3A 4D79A 2GILA 4TTQA 3W3AH 1NJ2A 2CLDX