1E59A

E.coli cofactor-dependent phosphoglycerate mutase complexed with vanadate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
239
structure length
239
Chain Sequence
VTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHOGLYCERATE MUTASE
publication title Mechanistic Implications for Escherichia Coli Cofactor-Dependent Phosphoglycerate Mutase Based on the High-Resolution Crystal Structure of a Vanadate Complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 88
structure length 239
sequence length 239
ec nomenclature ec 5.4.2.11: Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent).
pdb deposition date 2000-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 1e59A00
2P30A 3DB1A 3F3KA 3NTLA 4GPIB 3E9EA 2WNIA 1DKPA 2YN0A 2RFLA 3OI7A 3C7TA 3HJGA 1SK8A 3PGMA 4D4JA 3GP5A 2P77A 1FBTA 3QPWA 3D4IA 2H4ZA 3MXOA 3E9CA 1T8PA 4QIHA 3GW8A 3O0TA 1DKQA 3D6AA 4FDTA 4D4KA 2ENUA 1ND6A 1C80A 4JOCA 5AJVB 5AJYA 1TIPA 4HBZA 2H52A 2BIFA 3MBKA 1K6MA 1RIIA 2P9ZA 3GP3A 5AJZA 5CDHA 4JODA 2P75A 1UJBA 3E9DA 1DKLA 3KKKA 4TSRA 1DKNA 2AXNA 2HIAA 3IT2A 3NFYA 4AROA 4ARUA 2I1VB 2EKBA 2P6OA 2A9JA 5PGMA 3EOZA 2DWOA 4PGMA 2OWEA 5HR5A 1RPAA 1YJXA 2HPAA 1UJCA 4IJ6A 5HTKA 4EMBA 2P2YA 4PZAA 3FDZA 5CU7A 4D4MA 3IT1A 1FZTA 1H2FA 2P6MA 4FDUA 2H4XA 1SKBA 4ARVA 2H0QA 2DWPA 1IHPA 1C7ZA 4PZ9A 2QNIA 1H2EA 3EZNA 3DCYA 4EO9A 1SKAA 1E58A 1BQ4A 1V37A 4ODIA 1DKOA 1CVIA 1QWOA 2ENWA 3D8HA 5AJWA 2OWDA 1C81A 2WU0A 2A6PA 2F90A 3F2IA 4GPZA 4E3WA 2EKZA 2P2ZA 3QPUA 1E59A 5AJXA 2PA0A 3LNTA 2YN2A 3LG2A 2WNHA 1QFXA 2P9YA 3FDZB 1ND5A 4JOBA 1XQ9A 2P79A 1EBBA 3FJYA 3ZHCA 1NT4A 3IT0A 1QHFA 3BIFA 4ARSA 3IT3A 1V7QA 4IJ5A 5AK0A 5CX4A 2IKQA 4MA4A 1YFKA 3QPVA 3LL4A 2HHJA 3K4QA 1BIFA 1SK9A 3R7AA 1BQ3A 1DKMA 2P78A 2EOAA 4D4LA 1RPTA 3K4PA 2GFIA 2P9FA
chains in the Genus database with same CATH superfamily
5DHSA 5AM1A 4EA7A 2RGYA 3SAJA 4EEKA 1AE1A 1EWTA 1W2HA 1TJ4A 5C0OE 3BERA 4FYHA 1E4EA 3BRWA 1CHNA 1PSDA 3D2AA 3FGOA 1E2QA 1TADA 2VHTA 5B2FA 5C46F 3NVAA 2XF2A 4EA6A 1JYFA 3SP1A 4J0QA 1UP4A 3SR3A 4RD1A 4CT5A 4ENTA 2EHJA 3CEAA 3U4IA 1D6MA 5DGHA 3E9RA 3WB0A 3DMTC 3VO8A 1F2VA 4FLEA 3ZEAA 2P91A 1O94C 2R6R1 2FPOA 4MQLA 5EYPA 1OHHD 3SIRA 3LP5A 4A6PA 1JPUA 1V4VA 2R44A 2VSNA 3OQNA 1KGSA 2O2DA 5I9BA 1N0HA 1ZGBA 1HEYA 1WMFA 3AEYA 3P5SA 3Q6IA 3C74A 1VYTA 3UJPA 3ZU5A 3ZVNA 3KKEA 3UXHA 2HHHB 4LF8B 1VLMA 2BP7A 1D2GA 3U16A 1O57A 4KXUA 4A10A 5I51A 4C21A 3ZX5A 4CKZA 4LF4B 2ATIA 2IZZA 3RVBA 1CRZA 2B1QA 3TEMA 5B7NA 5EIXA 4HR7A 2YY5A 1SG6A 1PL8A 2DCMA 1FRQA 3FVWA 3QITA 4J1TA 4FLFA 4WE3A 1U1CA 4CFZA 3KXDA 2G1UA 3EASA 1JJ7A 1VIYA 4KQ1A 4RWZA 3MZ0A 3KAKA 1FNCA 1YB2A 2F3PA 2JIDA 4S0ZA 3R5JA 3BS4A 1M2NA 1XA4A 3GFBA 3IDZA 3A7EA 3IDFA 3F96A 1BHQ1 4G4IA 1I4OA 1T9DA 4PS0A 2A0YA 4FIDA 4TXLA 3J80A 2GS9A 3BMCB 4B6SA 1ZSYA 5IMSA 2NV2B 2JGDB 3ON5A 1W5FA 3L5OA 3IOCA 1T3SA 1JHXA 3EA0A 2ZG6A 4PO1A 4HEQA 4EJSB 1O0CA 3KQQA 4R9NA 4YPFA 2C07A 2L69A 3H2IA 2EQBA 1NRIA 4CM4B 1KVRA 3LSYA 2B1GA 3PJGA 4M6WB 4YAIA 4ZYWA 2TMYA 1AY0A 1H23A 4LZZA 4ZDJA 3OQIA 2B61A 3L07A 5J2TB 1T5TA 1E9BA 1HI9A 2V7UA 4Z3KA 3ZCRA 1CULC 4JQYA 3H4TA 4CDNA 2KWIA 3I9OA 2ACEA 5HRAA 4HPXB 2UUCB 4GUAA 4WOPA 4U2EA 4UQLA 4U6NA 2YIVX 3QNWA 5AWFC 2Q3EA 4RGYA 5B2ZA 1B3BA 3FNRA 4EKEA 1T1GA 1QHHB 4PBTA 5EN4A 1TEVA 2ASVA 4AKTA 4DPKA 2ECPA 3Q40A 4Q18A 3JQEA 5JBQA 4DR6B 1P61B 5CB0A 1ZIPA 3GAMA 1JDBC 1ZWKA 2PKRA 2HJWA 4YCMA 3PHCA 4KQWA 1Q22A 3H3XA 4KPUB 3VKGA 2WOOA 1OOEA 1JDZA 2HWKA 3L6OO 4DM3A 1E3SA 2LCFA 5F64A 4D9JA 5HJ5A 4L8YA 1NI4A 2OXTA 3LT4A 1J7JA 3T0GA 2X2PA 1Q2XA 3ND9A 2ZWVA 3OPYI 1BOFA 1CPYA 2FA9A 4LBVA 4D96A 2YWBA 1HZZA 1H9BA 1G9TA 1X1QA 2GKSA 3QV2A 4GR9A 1FTNA 2G80A 3NM6B 1JBQA 4ZVVA 5T6MA 3E27A 1K9VF 4N82A 4EOGA 4OBXA 2ONCA 2GTHA 2GBPA 4LJSA 3V7FA 1CJBA 4ILEA 2WAMA 4WRRA 3WAJA 3CUTA 2I2FA 1GT6A 1UQTA 4PCVA 3OT4A 4K9PA 5HPYB 2GN0A 1AKRA 4ND8B 1C8LA 3E9YA 1SXJE 2BM0A 2X8BA 3T7RA 3WGOA 1LKZA 1N0WA 3FLMA 5CEJA 4F91B 3D4IA 1JXAA 1YZUA 3PENA 3QNUA 3PUVA 3TVDA 5KJFA 1NN0A 2CFSA 3TQFA 3AR8A 3CF4A 2C4NA 5FR2A 4IOLA 4YMLA 3VTKA 2PCLA 4IWYA 1EM6A 2QR2A 1Q0PA 4QRIA 2DF8A 1WP4A 3NANA 3BJZA 5C7IO 4CGZA 2JI6A 5IAJA 5G0UA 3BH0A 2DZDA 2ODAA 3JPYA 1Y6JA 1SVUA 5IK2D 1LC3A 2ZB8A 5LQNA 1NOKA 3AUUA 4Z1OA 1JHYA 4L5CA 3KAPA 1DAMA 2QIOA 3AINA 3FUTA 2C0QA 4RF3A 4RH0A 4UHDA 4YREA 4EYKA 3KKKA 1TCBA 3PUHA 1F20A 5AKHA 4C2TA 4NBTA 5JZ9A 1XMJA 1MF7A 2GAIA 1ISIA 2WTXA 4HP8A 3DTTA 4PCUA 4QPDA 2WP8J 4E94A 2JAUA 4OQ4A 4RJIA 2D2IA 5A7HA 2P4QA 3SHOA 4B40A 3ZXUB 7REQA 1EPUA 4I50A 5DT9A 1DJLA 3IHTA 4EW3A 1L8OA 2VHCA 4HDMB 3T7IA 2W6QA 3IAS1 1IQUA 1IG3A 2X4GA 4BECA 1SURA 4Z4CA 3PTAA 3DKKA 3ORSA 2PXCA 1TAQA 3EZGA 4MNTA 1WUTA 2HMSA 4NMLA 4D4MA 2DT5A 4AY5A 4K8RB 1ZQ9A 3G17A 2Z2XA 4O4JF 1ZH2A 2VPQA 4IO1A 4M1EA 3PDWA 4DTCA 1K27A 4ZJUA 5ITWA 5F3RA 2OGZA 3H2BA 4BO6A 3PGLA 1KMQA 2A5DA 4CF7A 3KHTA 1RCTE 1Z6QA 3WLAA 4P82A 4CF4A 5D3MB 4KAJA 2C2BA 1NSYA 2XMGA 2ZRAA 5BMVA 5DT2A 1DLIA 3GCGA 1KDTA 2QU8A 4G1CA 4QBTA 1AA6A 3KQNA 3OZXA 3BL8A 3RVMA 1SHJA 1TZMA 3OTQA 4MW6A 4AP9A 4YP5A 4N6GA 4LGVA 3L9XA 4ZCLA 4YDQA 2PZGA 3UGJA 2GEDA 3JRWA 4ER0A 1IMJA 1MV5A 2HQOA 2PH7A 3NM4A 3MTJA 2E4WA 5ENZA 2VIIA 3RRXA 1GPDG 4PCAA 3EOBI 1KAOA 4GC5A 1Z8NA 4DG5A 3ZCTA 4MQ4A 1GUBA 1MENA 2GT1A 4MGKR 4NDAA 1M2KA 1XD8A 4U7WA 1ORHA 2OCPA 3TI7A 2VVTA 2GPYA 2GM9A 1D7OA 4NVRA 2QYTA 1R0SA 5G1OA 4PGHA 3KB8A 2CFRA 4GOKA 1CUGA 1E0DA 4PZYA 4RY0A 2GUWA 2OQRA 5BYKA 3U9SA 5A9SB 1J2RA 3VM6A 2QE7D 3P2IA 4MMYB 3BWXA 4N76A 1X7YB 4UEQA 4JX9A 1HNXB 3UWOA 2BEVB 2QX6A 1IVNA 2POQX 2PT7A 2VK2A 3HVIA 4GOLD 4WOBA 3KT8A 5IVKA 5A5GA 5ALUA 5JSKA 1L7AA 4GM4A 4H15A 4WZ6A 1YASA 5TIIA 4Z4FA 4KAAA 3T7KA 2DQ4A 3SJZA 3HRHA 1BX3A 4PLGA 4B74A 4P7GA 3FCEA 4D98A 3MYRA 5K4HA 4OHFA 1PP4A 2LBPA 2J3IA 1Y5MA 2HLHA 4YHBA 1B6GA 2QTCA 1P3JA 1XNJA 4TWRA 2RGWA 3FJOA 2H1CA 3DPSA 2YHSA 3Q12A 4GLJA 5IWAB 4RDIA 1A9YA 3S68A 4CUJA 3W2FA 4GYYA 3NPAA 2V97A 3E8SA 5JISA 3W78A 2C88A 1W5SA 2F48A 2B99A 1VSQA 2PUHA 2HW8A 3I3SR 5SYAA 2YNMD 2FN7A 5TQ0A 5AJYA 2WUVA 3C3YA 2NPFA 3IUPA 1M83A 1JIVA 2OKGA 2Z43A 3O4JA 2QMOA 4JL8A 2LCQA 1Q5PA 2V98A 4NDNE 4R40A 5KQSA 1MJGA 4YRCA 4MV8A 1XZHA 3ABRB 3HBFA 5DGTA 1V8FA 4DV4B 1QV7A 1NXPA 1R37A 3TRHA 3SN6A 3UAWA 1GEGA 2LDBA 3GH1A 3Q85A 4LNUA 4U2GA 2QY6A 1C14A 4MJLA 4XARA 1P4AA 2C99A 3HJAA 4G5RA 1WD5A 5CYFA 5ELMA 3S44A 4D92A 1DG3A 1WB5A 2CVPA 3ND6A 1OAAA 5LU9A 2B4RO 2XTZA 1CRWG 2O2JA 3I45A 2CF6A 4G0ZA 4M53A 3GPBA 1QYIA 2OXFA 3EIFA 1GXSB 3I6ZA 2GDJA 1VSVA 4HVAA 1O97C 4HLNA 1CS4C 1U28C 3IIKA 2Z6VA 4BP8A 1NURA 2C92A 5H02A 3U4QA 3STTA 3BMQA 2O9JA 1RSZA 1Z33A 1DG9A 5ECWA 2WVGA 3PGKA 3C85A 3IVCA 3ROQA 2QZ4A 3KWLA 1HLFA 3U7EB 4F96A 2FFRA 1CLEA 1ZRSA 2G83A 5LA6F 2ACWA 5FOWA 5KNCD 1YR8A 1QS0A 6ABPA 4JA2A 2BZGA 2PO5A 2I2DA 2HI0A 1ZCZA 3HZZA 3DF9A 4LVOA 3WIUA 3EHDA 3SOPA 1Z47A 5KU1A 1XU4A 4P6VF 4GAEA 4ZO6A 2C03A 3KJQA 2D0PB 3RSSA 2EBFX 5J43A 4QHYA 4EHBA 3NT2A 4P5PA 1B2LA 1NXVA 3N5CA 4KH0A 1QFXA 4I8IA 1FYXA 3SJCA 1MB2A 3IRUA 1W52X 3DFIA 5AHRA 1U3CA 3ZU2A 3QKWA 2E89A 2R1VB 2GHTA 3TIXB 4HGQA 1GZVA 3C7KA 4MUNA 2B21A 2DUWA 1HYBA 3PIRA 5DYWA 5ARDA 3A26A 5CHEA 2SECE 2J9XB 2VBCA 5FJIA 5TGZA 3H1TA 4KQEA 2I4TA 2VAVA 2ZQZA 3EZLA 5FBHA 1NW3A 1P81A 3ICEA 3TJMA 4QO8A 2Z58A 3H7IA 4Y6SA 1B73A 4ENWA 2QG6A 4UFPA 1PS0A 1WY7A 1Y1SA 5JASA 4DNXA 3VKWA 3CMMA 2FF7A 4Z0NA 3LE8A 2WUWE 4L95C 2J6HA 4BBPA 4D46A 1SWVA 4FNOA 4DCMA 1Q14A 5E0KB 2QM7A 2QPLA 3IMFA 1JGTA 1DE0A 1P1FA 3ORRA 2Y93A 4M88A 3MELA 3BJMA 2P9FA 3HCFA 3PGMA 2VDUE 3C3WA 3T61A 3VOTA 3GRCA 1J2UA 5K20A 3W6ZA 4MR9A 2VN8A 4FN4A 1NUUA 3F7MA 2ZJ0A 5JS8A 3IBTA 3AI2A 4AX4A 5D86A 4ZU6X 2C98A 4Q7EA 1XUOA 1W76A 2MSNA 3JQ9C 4DJJA 2YJGA 4WXHA 1N9KA 3E84A 4GECA 4FFBB 4KNWA 4BN5A 1IXYA 4DQUA 1SCJA 3AHDA 3DFMA 2G1JA 1W29A 4HAIA 4HNSA 3ZDRA 3UPTA 4NBKA 4QBGB 3VZSA 1SU4A 5B4TA 2H1RA 1Z5NA 2QAGB 4H0NA 4WSOA 2BCJQ 1PVVA 4MMZB 1M0TA 4HCJA 1CE8A 4LHWA 5TMBA 3A3OA 5E9AA 2X0EA 4MW1A 2YS7A 5CEEA 1WW8A 3VZRA 3DBHA 5JAHA 3QEAZ 2WWHA 4MWZA 1U5CA 1VFPA 4BAUA 1RWOA 4IZIA 4KE9A 2QR5A 4JLJA 4QSMA 1NNSA 3HKDA 5DHRA 3LT5A 3W9BA 5CITA 2O2XA 3IUEA 2VJMA 1KYWA 5EXDA 2DQYA 4B2LA 3TAXA 2O3RA 3PQ3A 4ZZIA 3D1JA 3HV0A 1KZ7B 2I66A 3MBOA 4JSTA 1R0XA 1JMVA 1HFJA 2RHGB 1QH9A 1HV8A 1NMQA 5A6SA 2JAQA 4RZUA 3M1AA 5GY7A 2MWMA 1C30B 2ODTX 3KD2A 4PO9A 4XRRA 1I5EA 4IGFA 5EE1A 4B7AA 1ZH8A 2O2EA 2X14A 5HK8A 1J97A 2BFBB 2JFGA 4H2DA 1XHEA 4JYPA 3AILA 3ER8A 1AKEA 1EG2A 3FPKA 5IP5A 2FWMX 3KYDA 3WTCA 1ZJ4A 4ZHSA 1ZNYA 3B8EA 3ACDA 2WTMA 2MYUA 4KR9A 1EK5A 3N2LA 3AVUA 1XTKA 1MG5A 1QHEA 2QF7A 4LCJA 2YFYA 4LF6B 3SC2B 5CFQA 2P1ZA 2OCDA 4E33A 4DV3B 3IV7A 1QZUA 4N01A 2RBKA 5ANRB 4D79A 3T5AA 2OG1A 4PO8A 3G1UA 4DLYA 5AXCA 1Q17A 1PUJA 3KSZO 3OKFA 3T34A 1Z6XA 2JFNA 4J94A 1E9EA 2G7ZA 2Y6VA 1C9MA 1I6WA 4Z4QA 1YMUA 3IFSA 1H3EA 4QBKA 4H35A 3NR2A 4I5EA 3DL7A 5EGNA 3D8NA 2QS9A 4LS3A 1V11A 2XA9A 1USUA 4Q01A 1X8KA 4UTXA 1FFDA 2CJWA 4I55B 2WHYA 5F7ZA 5H7XA 5FLXA 3ABQB 3SLGA 3RSGA 4C22A 5K0FA 2F55A 1I3NA 2BCEA 2XODA 2XUZA 3DFUA 1R0ZA 1L7QA 2H7YA 3QTLA 1ZGCA 5FRDA 2NUTA 5YASA 1JDBB 3I72A 4XW2A 6YASA 4NBWA 3NPMA 3GEGA 2XEDA 1Z35A 5GADl 3ZW8A 4MW5A 2XB2A 1OFHA 2IH2A 1QP0A 5LYYA 16PKA 4YACA 2O3JA 4WZBB 2RBGA 5F76A 1EGAA 2NSLA 2GEFA 2HDOA 1F5NA 1G59A 1SXIA 3F9CA 3I9V1 5BOSB 4BFUA 1Z2DA 2CZCA 4WKOA 2JFHA 1V16B 2GM5A 2REOA 2LTAA 3KEOA 2PSHA 3FYSA 2AJBA 2JK1A 3OOWA 4W1RA 5FF9A 3WMGA 1O6CA 1JKJA 3N2GA 4UEJA 3WLJA 1O7JA 1SRQA 3TH5A 4M0UA 1YKFA 1Q1BA 5LOVA 3I0ZA 4XR9A 3A70A 2Y3IA 4LKOA 1L7RA 4N5IX 4PC3A 4IEIA 4C6SA 3IGFA 2ANCA 3AL3A 3PL5A 4X84A 3UT5A 1NLFA 5JFGA 1T2VA 3DAOA 1CR0A 1NTOA 3FOBA 3MWDA 3EWAA 4Z9BA 4NFLA 2COKA 3UW1A 4NCNA 4BVFA 4HL6A 3MCWA 2VXYA 1N2JA 2GAOA 2DCUA 3T9FA 1X9HA 2QN7A 4PG8A 3W06A 5I8PA 4S0XA 2BC9A 4PU0A 3VI3B 5BSEA 3DHEA 4GIBA 4Z4EA 4IUDS 1AHHA 2L42A 2WT4A 1E1CB 2XIQA 5DW0A 5EPEA 1QMPA 2HV9A 3LCUA 4OVKA 4JXJA 4RH1A 1KH3A 1U9YA 5E9QA 4FJ2A 3RS2A 4F3NA 2Z2ZA 2HU7A 4YXWD 1E79D 3NHWA 5IARA 4CEIB 1UOOA 4IH4A 3OJWA 1PYDA 4F71A 3A6JA 1FSSA 4JI8B 5BR1A 1F14A 4IRXA 3BRWD 4GGPA 1AKTA 4TXJA 4PX2A 1IONA 1Q16A 1PUXA 1ECLA 1WSDA 4RNDB 1JHRA 4ZRMA 5L7WA 2FPPB 1W7AA 3UUFA 4GW3A 4B4WA 4W5TA 1Y34E 2I1VB 4BP1A 4XQGA 1L4EA 1G8SA 4U2BA 1B43A 2EP8A 2F3TA 4DR4B 1Q20A 3VU8A 1Q0UA 5T7BA 2BR5A 2VP5A 4LDJA 4FNMA 5EJGA 4PY2A 2DBZA 5HCIA 2MU1A 2WJIA 4HLCA 2ZSKA 4Y2HA 2Y1CA 5L45A 2AOUA 3NTXA 3HXKA 4KR3A 2F17A 1UIMA 2WE7A 2NUPA 4JI5B 3ZZMA 4EZBA 5JJKA 4X65B 1DZIA 1N2EA 2QRVA 2ZYAA 1L7NA 1MO2A 4U0JA 1TO6A 4B87A 2X19A 1Y4DE 2VHJA 3C3DA 4NR0A 1VKZA 3ZWKA 4WY5A 3TQTA 3LK7A 5K05A 5KQLA 1F4LA 2HWWA 1C9KA 2DPHA 2YHIA 2AG8A 1YK1A 2WDZA 4FMPA 5CIWA 2OG2A 4S05A 1S2OA 2ZYVX 1GRNA 2EBHX 5EIWA 3KVRA 4KGDA 4UM5A 1UWCA 1XWIA 4IHJB 3SF0A 1XD2A 3EEBA 3G2HA 3GLIB 3RH0A 3EIHA 2PUTA 5KYYA 2OK7A 3A25A 3AU9A 3HB5X 3M6XA 2EYUA 4O2AF 3ZCUA 3OZRA 2DFLA 3N2KA 1YIAA 4UHCA 2H5IA 4XYGA 1V7QA 4EG8A 2ZK7A 5DJ5A 2C9MA 1ZHFA 4IJMA 2O8VA 2EJBA 3DDUA 3HXTA 3ROKA 4MYDA 1L0BA 2GHQA 2XCLA 1DCKA 2A14A 3QZUA 2MIIA 2WF7A 4AQYB 2Q3CA 5JE8A 2QXYA 2QJRA 5DGCA 3IIMA 4HEJA 1H0HA 4KFRA 4B75A 1SNYA 2FAXA 5G0TA 2VZ0A 2Z9DA 4EJMA 3BWDD 3PQ6A 3IKTA 1M1YE 2O59A 4Y8VA 4QT0A 3W6NA 1I9GA 4DSZA 4Q15A 5EJMA 2GX6A 3A31A 3BMXA 4QXQA 1HE5A 1DAFA 1WKBA 2WQZA 1VHLA 3HXLA 3T94A 3VVCA 1N0UA 3ANYB 4JLKA 1IXKA 4P1ZA 3DBIA 2QVYX 3GCXA 4M1TA 4Q4JB 2EL7A 3DE0X 5TMDA 1QP4A 1M2VB 1E8MA 1U8ZA 2ZSAA 3IOEA 4GEKA 1G2QA 1NJ5A 2GCOB 4BU0A 2XCSB 1DOZA 1FPQA 4MYSA 4MA5A 5FKJA 3NVMB 5U1PA 1TC1A 4QQRA 5KYXB 4HAYA 4QREA 3H4MA 5FL3A 3IBYA 3UWMA 1HSOA 3MWGA 6Q21A 2HGSA 3AF0A 1OI3A 1YFZA 3D1LA 4YAOA 4F93B 3EFOA 2IQ5A 3QENA 2XQKA 4MS4A 4GYKA 4MUAA 2OBNA 3COVA 5AJVB 5T3YA 5UKDA 4CKWB 4R1SA 2QGZA 3HCBA 4G23A 1ANKA 4DNOA 3PXBA 5JO0A 1ZRHA 2R7LA 5LMCA 5JJLA 5DWVA 2GB4A 4UHEA 2CLKB 5CK5A 5GMOA 1SUFA 2FQWA 2X8JB 3ESQA 4KXQA 4GS5A 4BFYA 2WR8A 3I3OA 5JXHA 1EUCA 2J5RA 3V55A 2JFPA 5DM70 1JA9A 3DZHA 5E9WA 1X1DA 3SE7A 4RD4A 4TS4A 2XGOA 5HM6A 1V71A 3BZWA 3LF1A 4YJ3F 1N75A 3NBFA 3ZNOA 1FZTA 1J06A 5FWYA 2PKXA 4LSWA 4ETNA 4KIJA 1MTOA 3UHFA 1W88B 2F1JA 4FN5A 3ED1A 1YHZA 2WU1A 3WNCA 2OZLA 5EIEA 4BQEA 2HO5A 3RV4A 3FWPA 5COAA 1WXIA 4ZV4A 3R3YA 2OZPA 2QM0A 4KIGA 3PKIA 3ME5A 4JJZA 1KORA 4DVGA 3JAMA 2WWYA 1ZIYA 2XKAA 5JAUA 3GRUA 4W1SA 3TLAA 3OPYA 3V7WA 4ZN6A 1DIBA 4G9EA 4YRFA 1PDWA 5DLYA 4AZ3A 3Q6MA 4DE5A 4DIBA 2I62A 5D5HA 2YN2A 5AQEA 3MK31 1ZH6A 2XUPA 3ABSB 4KO3S 1DBRA 4GL4A 5I7SA 2IX3A 3TG2A 1J9GA 2ZUSA 5C9ZA 3D6MA 2WOJA 3MJTA 2PTGA 4L76A 1JECA 4ZC1A 4CMEA 1THMA 1ENPA 1HDCA 1Q0SA 3D4OA 1YB7A 4YMIA 2HMAA 1TFUA 1GAJA 1QLWA 4TYMA 5C52B 1GSHA 5JH7B 2YJ4A 2HXSA 3GHHA 1LZLA 4K6KA 2A35A 3RABA 1UMCA 1YOVA 2W2MA 4C0QC 4EUKA 2HQRA 1KSHA 4JP2A 5A6VA 2O7RA 5F51A 4NKRA 3A2KA 2P3QA 5ARCA 1QOPB 1JTVA 5CA1F 3L4BC 2O3TA 4IHAA 5A3VA 3ZWDA 4BFXA 2HMVA 5EIAA 1FRVA 1TA0A 3BEDA 4URVR 1Q19A 1WPQA 5AKJA 3HFRA 2QAJA 3FNEA 4NXNB 4JN6B 4TT3A 3KE8A 1ESDA 1Z0JA 4KXYA 5EKDA 5K4AA 3SXUB 4XFDA 3S2GA 2KBEA 1KKLA 1Z38A 4WLVA 3V1KA 2ZROA 4BC1A 1IULA 3CEPB 4KVAA 4OA5A 2ZB4A 4QQ8A 4DQLA 4WW0A 1R8XA 1TZBA 1Q7GA 3HBLA 5EMKA 4R8LA 2WIBA 4TYPA 2C04A 3T3HA 1RWBA 4RQBA 3KNZA 5CUQA 5CD9A 3TRJA 2VP6A 2VKQA 3KPVA 2O2YA 1TUBA 3DS8A 3OE5A 1BMFA 2X0RA 1LBEA 1NE2A 3AL2A 1BVHA 3VYWA 1GL7A 4XEUA 1M6HA 4PIMA 3TTXA 2D0OB 4DC9A 1A7AA 3OIGA 4CODB 3ADCA 4BEBA 3ZHQA 4GGMX 13PKA 4N0QA 2PRYA 3X1WA 3H6GA 1F38A 3IEXA 2FRDC 3UTDA 5HZMA 4U4AA 2FZEA 2F1IA 2ZDQA 3CNOA 4ZZ3A 4YS6A 1W8DA 2FP4B 2MINB 3AUJB 1PJBA 3KOUA 4CCYB 2ADMA 4BO4A 5CLIA 2B25A 2Q62A 3NBUA 1LI7A 4P34A 1E32A 1USKA 4DV7B 1A1SA 2JGRA 1DCTA 4KXNA 2OY0A 3G89A 2I4RA 3TOSA 4WBNB 4TKUB 1SOAA 1UMBA 3K73O 4UEOA 2RHJA 3DFFA 5JV5A 2I91A 1U8XX 3RAJA 1U7PA 1F9EA 4UD2A 4KQCA 4CNQA 3H9UA 2Y27A 2Z4TA 3TOCA 3WIBA 3OMLA 3BE5A 5C53B 4RZ3A 1G5HA 3MTIA 4C87A 4US1R 2B0CA 5FEMA 4HGNA 1Q3KA 3DYVA 3T41A 1LVHA 3FMPB 4UHHA 4KPEC 4YA6A 3LQYA 3VTFA 3WYBA 4DLPA 2JLSA 1D2NA 9ATCA 1W96A 3U2QA 4B1FA 5BV8A 3DF7A 1FB5A 4KDEA 3SVTA 3BDAA 1R0YA 1LSSA 4WLNA 5FUBA 3K9NA 1FUKA 1XT6A 5K3BA 3AIOA 1Y3DE 2VDKB 3K1JA 5TB5A 3RYHA 3ZVRA 1WW2A 3ZWBA 1ISPA 3ZJ4A 1AQJA 2AL7A 2VSYA 4MQEA 5U4QA 5E8RA 3BD7A 1YACA 3LAWA 3GZNB 3OEED 3E4DA 3DMFA 3E1KA 4U7JA 3AF5A 1QU2A 3ZHCA 1RE0A 2P5YA 1FVXA 3JQBC 4LJ4A 4LXQA 3O4RA 4B3GA 1L6RA 1YXMA 3INRA 4DAEA 1DBPA 1V5GA 3JTMA 1PKXA 4OYHA 5JIBA 2QBYB 4BNGA 4D9EA 1DI0A 3PXAA 1U3UA 1YVDA 2GYUA 3UMJA 3HXQA 4PX5A 2IKQA 5JNUA 4E7PA 1AB5A 1T15A 3MAJA 4JROA 4LY6A 2JGNA 3C6ZA 1I3MA 5IKEA 3GVCA 2CUKA 5FOXA 3AKYA 3OZSA 3B12A 1W5EA 3TD2A 5B36A 3ZE1B 4US2R 3SQNA 2PUAA 4EY4A 5EE3A 3I9MA 4GMKA 4OX9Y 1BRTA 1XYVA 3NRJA 5GVSA 5K6TA 1NQOA 1JG3A 2RJNA 3AR9A 1PSWA 3OPMA 1YNOA 1Z4KA 1V8BA 1BQ3A 2I3DA 2Q5QA 3DOOA 3GJ3A 5GGYA 3DOIA 3QGMA 1WZCA 4DSAA 2RGGA 1KI2A 3BSFA 4I14A 1PD0A 3UJ6A 4KYTA 5I4BA 3TQCA 3HL0A 3ILYA 3IPLA 5A5VA 4HNRA 1I6LA 4BGDA 2WKSA 4DV1B 3N75A 3OT1A 3OG9A 2NVUA 1BW9B 4H4DA 3N7AA 3IULA 1F2TA 1RAHA 4FOTA 2QAIA 4L72A 5KWEA 1P18A 1IY9A 1UXIA 3W5CA 1IAQA 5G41A 1JEQA 1XZMA 4R7GA 4YAJA 3G8YA 4ZT3A 4FILA 3UWPA 4I5DA 5JAQA 4I4TA 1IPHA 2GPTA 2YMLA 3IRVA 5F1YA 5H9VA 1O5IA 1Z4IA 3H8VA 4MUEA 3K31A 3LUFA 4FI3F 4G0OA 4EDFA 4KRGA 1WJGA 3ZV3A 2AIRA 2QRLA 1A2OA 4HB0A 4XD2A 4UBNA 1KIMA 3GT0A 2YIMA 4JOCA 5TE9A 2EC5A 2PLNA 3RVQA 2CHUA 3V2GA 2UZ0A 3MBKA 3UZUA 3K30A 4HFNA 5ENVA 1DZ3A 2HT6A 1Y48E 4AD8A 1RHKA 4PV7A 2AUTA 4QDKA 3HADA 5TSDA 1GTL1 2KX7A 3F7OA 3ROTA 4EGFA 1BTOA 5F5LA 1C3OB 1L9XA 1ORTA 4FXPA 1E2NA 3I1IA 4WXRA 1E6LA 4OLFA 5EKUA 5CDFE 1G7TA 3LUAA 1KRXA 2C31A 4E6EA 1M8FA 1D8TA 4LDRA 4RMNA 4Y0NA 3MWYW 5E3JA 3ZWQA 1H9AA 2XVZA 1JLKA 3WIVA 3NOVA 2CC2A 3QBEA 4XIFA 2A59A 2OP0A 3CZPA 1R6DA 3I9FA 4GQAA 1NBMA 1CR2A 4PZZA 4E30A 2ZBPA 3TR0A 3JQPA 2HA5A 2X5NA 4BLPA 3EXHA 2W4QA 3RTGA 4C43A 3KQPA 6NULA 2ZJ7A 2AMLA 4S1OA 2X3UA 4YQEA 2I6SA 3EZ9A 1O4WA 5SZIA 4QEDA 2PZAA 3IHLA 4NICA 2ERCA 1ZK3A 5C35A 4BQRA 2DUNA 3GFVA 3TCKA 2PMCA 2XE4A 4XQ9A 3E03A 3C41J 5JSHA 1V8DA 1SKAA 3LK6A 4TYQA 2JI8A 5CX1B 4MSUA 2EKLA 3AXTA 3ECSA 1E0SA 1X7XA 4UUBA 2O4UX 1CR4A 2ZS8A 5FAXA 1AV7A 1KNQA 1N1DA 4MKHA 1APBA 3GGCA 1XEWX 5KHOC 2Z5VA 5AJTA 3L7AA 5AJWA 4DXDA 1BN6A 2E4XA 3WNVA 1UKAA 3CUVA 4RJJA 4JT4A 1R3DA 2PA3A 4NZPA 4CQNA 2EZ8A 2I7VA 4J0FA 4JQOA 4F2WA 1U0NA 3K71B 4Y1RA 3ZXYA 2JFUA 4BJHB 4WECA 1WBJB 2BEUA 4EQ6A 5CB4F 4L6IA 1BU5A 3VSBA 4FYMA 1J99A 2Q4RA 3E2IA 1JAXA 3N3AC 5G4KA 5B6PA 3DEAA 1ZM3A 2PK3A 2I99A 4TMWA 4BKMA 2W9XA 1ZVQA 4TVBA 3KB2A 5CFRA 2AKAB 3BFPA 1CD5A 3MMZA 5I9NA 3DDHA 2IVFA 1XROA 3DAFA 1NUAA 1UBTS 2QUZA 3CRRA 3QKSA 4F6RB 2BFAA 4FB4A 1X2EA 4OQNA 3ZW9A 2ONZA 5E6UA 2ANBA 4ZT2A 4H7IA 1DKUA 3PVCA 4FLMA 4B5KA 1P39A 2FWAA 4NBRA 5F3WB 1VL6A 5JCOA 1LQTA 3CMCO 3IUBA 4IUBS 4BNMA 4C0HA 1HOXA 4F56A 3CX7A 4IDAA 4QOSA 4O29A 1VIAA 2IBMA 1FVHA 1GQSA 2A84A 5CXQA 1WKCA 3QXGA 4HTFA 1OLUB 1OIVA 1VJTA 2VPXA 1JQDA 2WDPA 1LUAA 1ZUHA 2Z98A 3HU2A 1XPUA 4Y2VA 1W1WA 1QIKA 2I4IA 2J8ZA 1CETA 1TYBE 3A4IA 3F46A 3GGJA 3HFGA 2HWXA 2AVDA 2JAWA 2XMZA 3LPLA 3W8DA 4RA6B 5FTMA 1XCMA 3CONA 1V9LA 1XKLA 5DOZA 4P35A 3X1MA 2I2BA 3Q11A 4A8JC 4RK7A 3O4HA 4O4IA 3KG2A 3N0WA 3RROA 1E99A 1UDBA 3HU5A 4E2WA 1U0RA 3LFHA 5FUYA 5JHHB 1O9BA 1VKNA 4HUQB 1JT2A 4IDGA 4EY7A 2O48X 1I0IA 4OGLA 2BGMA 4RJ2A 4YMVA 5GZ1A 4MGEA 4YDRA 2G1PA 3NFRA 4Q9NA 3IE1A 2L82A 2ZOSA 1NFRA 2LIVA 4RZXA 2B2NA 4AL4A 4QKQA 4HGZA 3M6UA 4O1MA 5JROA 4EENA 1OH8A 1M75A 4KSYA 1UBFA 1GPKA 1GU1A 2YV1A 2P1DA 3IPCA 4O5AA 5CB8A 3RC3A 1B8OA 4IXTA 2VDWB 1OUMA 4AN1A 1GRCA 5DYTA 4YP1A 4BX0A 3L1JA 2P9JA 1T9CA 1HY3A 2GN2A 3BILA 4PZ0A 2H7XA 5CT4A 3H8SA 5FPYA 1S1CA 4A6DA 3K1TA 3Q87B 4EUSA 3TSWA 5K0CA 1KZ6A 1GPBA 2OCKA 1P7VA 2P3LA 1GO2A 2HU8A 2PT5A 3M5WA 2HD4A 4A16A 5C7LO 1INLA 3FDZA 3OIFA 5DXJA 1KQNA 1BXGA 4QFCA 1T6ZA 2AQKA 2GEUA 2FSHA 3UXYA 1CUIA 4BVJA 2RC6A 2DKFA 3AKZA 3MS2A 2XUGA 2GPNA 1H2ZA 1NVTA 5I4KA 2PX6A 2HCTA 2FP3A 3ISTA 2HAEA 3PHHA 2WTUA 1DIRA 1EHCA 2J9FB 1HLDA 4EEXA 3AF3A 4L85A 2CFOA 4DCOA 4ZIRB 2JDID 2WMOB 1OILA 1RWPA 4EPVA 2Q3LA 4GE0A 4YHHB 2C4VA 4G24A 4UHJA 5CH5A 3S0JA 3KLNA 1YQWA 2WPDD 4S24A 2INGX 1P2UA 2V7EA 3AX6A 4N54A 4D0NA 1YRAA 1B14A 2IPMA 5JO9A 5T6BA 1HYHA 1JFRA 1J1ZA 1KFEB 3HNPA 5KWJA 3QLVC 1BGXT 3H83A 4L3WA 4UE6A 4HV4A 2I6GA 3S8EA 1ZO8A 3FSEA 2JFVA 1IZZA 1VDZA 1Q7RA 2XX3A 3N59A 1Y63A 4NH4A 5K3CA 3EPJA 1T1SA 3DEZA 4OSPA 5L8VA 3TECE 3MG9A 4E5VA 1Q1EA 3LQFA 3H18A 4HZUA 2MCFA 2HV8A 1FRFS 2GZAA 3MWEA 3RO7A 4AF6A 3QVWA 1J39A 3STHA 5EHGA 3VPXA 4B6GA 1M34B 1YJ8A 1OXXK 4LJ8A 4RZHA 1C7IA 4RD6A 1MO4A 2HJVA 4V0QA 4XJTA 3GVXA 5AIBA 1D03A 2WG2A 4EB8A 4HFMA 3BZUA 4OLHA 3NALA 2IIBA 2JVIA 4XA8A 4YQYA 5FPQA 3FOFC 4CV3A 5FX2A 1G0NA 1KI9A 3QYFA 1FOEB 4NATA 4A2PA 3FNFA 5LQJA 1WM1A 3CINA 2GN8A 5F52A 5KB3A 4YWHA 4KITB 1KRWA 5JRZA 1W36D 1US8A 3ZHZA 4KDRA 2ZJAA 4KNYA 5HILA 1MFPA 4X5OA 3R0IA 2E9SA 3DMRA 3IP1A 4I1VA 1X74A 2XRZA 3GCZA 5JMOA 3ZDEA 1CS0B 2YN0A 4KWHA 2GR9A 3E18A 3R5KA 4DIMA 1XN4A 4KMMA 1I3LA 2I55A 5KVSA 3AHGA 3V4ZA 4C0SA 1K98A 4JC5A 4WZBE 4O2BA 1ODCA 1Q0QA 2AOTB 3OX1A 3QUAA 2PZFA 2P9QA 3Q7EA 2BTQA 1FRZA 4F72A 3A2MA 5K6RA 5L4SA 5AT1A 2E5FA 6CHYA 2JAXA 3PFCA 1KI6A 5ICEA 3CUSA 5J2UF 2L2QA 3N8IA 4Y2GA 1XRMA 2GKGA 2IBTA 4LTMA 4G01B 1ND6A 5COBA 1IZ7A 1W4LA 3E81A 1VCOA 4FFPA 4J1QA 3PBKA 3CVOA 2VSFA 4MQBA 4U02A 5B3AA 4DNPA 1HR0B 2UXBB 3DWEX 1Q21A 3HBJA 3W3AH 3GLHE 4X95A 4YUAA 1C4KA 3CNNA 2PBZA 2Q2QA 3EGEA 1E5TA 3IAAA 5BN3A 5HK9A 4ALJA 4HT3B 2WYWA 1X87A 3ANNA 3UF0A 3DT8A 3TZHA 3I92A 4I4CA 1TYAE 3EGXB 1MB4A 1F7VA 2A33A 2FJUA 2ECOA 2NUAB 5JOQA 1W8IA 3I76A 2PMWB 2ZWIA 1FXWF 2DAPA 3QE3A 1XZQA 1IXRC 3B82A 4OAPA 1IY2A 5HF6A 4LI0A 4MVJM 3OESA 3VJMA 5KDLA 2EIHA 4HYQA 3PIIA 4MJXA 3TS1A 4QRHA 1P2FA 3NM5A 2C4MA 1AVTA 5K7SA 1PK7A 1XYGA 1JDNA 3DBRA 1VCHA 3N76A 3OPNA 3GJYA 3IBCA 3GJQA 3JD4A 3K0BA 4HB4A 4J1NA 3SG0A 3SSMA 3BICA 4ZT6A 2B7LA 4PLHA 4HNAA 4S12A 1EFPB 4DR7B 3OZGA 1V7CA 1IHPA 2ZTVA 4PSDA 5B1SA 5H68A 1UBUS 3HY3A 4CF3A 2X0KA 4OQEA 5KNDH 4ECEA 3BE4A 1X7WA 2ZWOA 4KGXA 4O4JB 2Y0PA 4RV4A 5C34B 1Q0TA 1VB5A 1F4VA 3V34A 1KPGA 5GJCA 4Q39A 2AK3A 1GG8A 3FKQA 1CR6A 4RFSA 5A1JA 2D7DA 3FZYA 1DGQA 1SXJA 5B1DA 3JAKA 3WIDA 1WMDA 5G3ZA 4MVJP 2OSVA 3I61A 1FS4A 4NEQA 3I73A 1LPBB 3K16A 3WQSB 5EJEA 4WIAA 3DCIA 3EDMA 3QWFA 2GNOA 3AJAA 2AEFA 1UWKA 1PT7A 1CR1A 2YJTD 2VK4A 2DPLA 2ONJA 1EZ4A 1GDDA 3TLBA 4ZODA 1NG1A 2VBFA 3G0IA 3UENA 4RSRA 4M54A 1WCIB 2GD6A 2XD9A 4G1EB 4RKRA 3SHQA 5BN4A 1GGHA 1N2HA 4QXMA 1ODLA 3EQ2A 4DQ0A 1NVWQ 1L3CA 3K0CC 1KNXA 4N47A 4BNXA 2PX3A 4C7VA 3EA4A 2BLLA 2AOVA 2ON6A 1H6BA 3W6UA 4P83A 3WGMA 5BSRA 1C29B 1RAFA 1OA0A 2ZRKA 3O1JC 3QVJA 4YDSA 3I32A 3RS9A 2EVWX 3RTDA 1YB4A 3PEFA 1ZVMA 2NSHA 4ND4A 2V1UA 2YZ7A 2PL1A 4E21A 4RS3A 3CBQA 1QG0A 4ZQBA 3IVGA 1PT6A 2N0SA 3UHPA 4BX3A 2ALJA 3CPEA 3GG2A 3SZGA 2XUAA 1B26A 3DLIA 3RF6A 4NV3A 3RLFA 3R3JA 4KO4S 5E0OA 1DO2A 2OQ2A 3PTZA 1N3YA 5JXJA 3RUIA 4DV6B 2LV8A 3F5SA 1ZL0A 4Q1VA 4IH9A 1UBGA 5BN1A 3PE6A 3P9YA 2G4CA 4R2MA 3T5CA 2MYPA 4C4YA 3Q2KA 1OWMA 3D5EA 4PLYA 1D0SA 3I2YX 2DPGA 2EQ5A 2G17A 4KK3A 3R3SA 1RYHA 4YJKA 4ZJYA 5KNDA 1KKMA 2D0DA 2D74A 2FF5A 1DUVG 3QF4A 7ABPA 2W6PA 5KTNA 5FEUA 2ZSBA 2E4ZA 4D3FA 1U1FA 3A36A 4RPJA 2OE2A 4YMGA 1MIOB 2WZQA 4GWLA 4B4DA 4NNJA 1VE7A 2AF4C 2PGDA 3PITA 5HFNA 1PEKE 2QN1A 3ONNA 2V6FA 4I66A 5LBUA 1W34A 1CRQA 1G18A 1NW7A 1T24A 2V74B 1J21A 2HBZA 2PXHA 2NU9B 2HYIC 2RK6A 1JWAB 2O8EB 2DFDA 3EUEA 2VSXA 4JKYA 4WERA 3AVXA 3C5VA 3S5JA 1K3TA 4WNAB 3RD5A 1XXHB 1RC1A 2GF2A 4MH0R 4MIKA 2Z6AA 2B5VA 2H18A 2OGSA 3E7PA 3KVYA 4CMCA 5A4IS 3JAWA 3SQXA 4M0KA 3UMBA 2B94A 2QIPA 1MUUA 2WB4A 1LBTA 5EJ5A 1GVHA 2VAPA 2ZRLA 4IL5A 4ZQGA 1L1RA 3GMIA 4KREA 4GSYA 4HXGA 2HSGA 4ZZ0A 2ZEJA 4TMZA 1JR3D 2C5BA 2R6JA 4OREX 4UDXX 5K2OA 4E32A 2ZDHA 3P27A 3RODA 1GR0A 1YZYA 4M8LA 5FBLB 3RYTC 2GARA 2CJPA 1SRRA 4MPPA 1GV0A 3QHQA 1UJ6A 4HAZA 1YVEI 1IHUA 4DBLC 5HSGA 3LC2O 2XNSA 1UP6A 2Q4OA 3ZCPA 6LDHA 3WWYA 1I4LD 3HDYA 2ZXFA 4BO7A 4BPRA 2ECKA 4Y98A 4IFEA 5B3KA 1ZY2A 8ATCA 3R5XA 4Z7QB 1C1XB 1S8NA 1VZ3A 3AVOA 4J0HA 4U7TB 4E4RA 5K3FB 4HWKA 4UM7A 1GPUA 3ZGZA 2EYQA 3K0KA 5JPIA 5KC9A 3GGDA 2IA5A 3GD7A 3MFYA 3OU6A 3Q7TA 5GZ6A 4BNJA 5BXYA 2FX5A 1YRQA 4P31A 4GDFA 2W43A 1RYDA 3LXUX 4HH0A 3C7DB 1N9GA 3D0QA 4N1AA 2R97A 2Q45A 5A4MS 3PFIA 3QLJA 5LA6B 1H0KA 1AQ6A 1W75A 4XOUA 2VJNA 4NL4H 1LJ8A 3VYRB 1YE8A 1PHRA 4BIMA 3E2PA 2AE2A 1ZNXA 1WZNA 2JRLA 3E7DA 4DMKA 5BPHA 3Q2IA 5JDCC 2J5XA 2X3YA 3FPGA 2EJVA 2VUIB 2IOHA 4MUJA 1WXFA 3WOVA 1F3LA 4LE0A 3SM3A 3JR7A 2YZGA 1Y3FE 2ZWAA 4K0RA 4BQPA 3R9XA 4WHMA 3I04A 2I5PO 1Z08A 2ZE6A 2Q6KA 2VZ9A 5DHPA 4DV0B 1X13A 4H6VA 3B3FA 2QD4A 1XMOB 1XQ6A 2RIRA 2ZRDA 4OA8A 1P2GA 2D1YA 3ZY4A 3UICA 3HDHA 1H3NA 3F4LA 2R6HA 5LP6C 1D4AA 2CV1A 5T41A 4AJ9A 2D8MA 4NK4A 2H08A 2Z2YA 4IIGA 3PYXA 5CDGA 4LBWA 2JAHA 2WWWA 4B6FA 3CJTA 3KJXA 3G2NA 1RJGA 1J5XA 2PX4A 5KYWB 1QYDA 3H2YA 2B4QA 1JQEA 5EJ2A 1S9DA 2DQKA 5MGNA 3ODPA 3FWZA 4KPFC 3UJDA 5SZKB 5T8KC 3PA6A 3NH6A 4TN5A 5TX7A 3LKZA 5LN1A 2W8BB 4IH1A 2ARKA 4LK2A 1YJQA 2R6FA 4J3JA 5EWMB 3SNKA 4B2PA 2O8CA 4DREA 1F8YA 1THZA 3S55A 4IJKA 1RKQA 1E2BA 4ZOAA 1OLSA 2VJOA 2A94A 4G5GA 5IJ9B 2C8JA 2N46A 3SCZA 1Z29A 4ZYZA 4LV5B 1U4OA 1SCBA 3OFJA 4UNQA 4RK6A 2QQFA 4IIJA 4A8JB 4EPYA 2IDKA 3HXPA 1CF4A 2E1RA 2X1MA 3I9JA 1W5BA 5CCEA 5I01A 3MT7A 1XZFA 2J7PD 4X20B 4P33A 4YRPA 3GJRA 3P52A 3KUDA 5GOZA 1AO3A 3TW0A 4E5DA 4RVUA 5BQOA 1P33A 1VJGA 2GZMA 4G07A 3TL2A 3ZIDA 4CM7A 1ST3A 4F84A 1NXTA 4AKSA 1H1LA 4MRAA 4A15A 1QMGA 2V9PA 3G9XA 2BTOA 3NATA 4FMBB 3O6VA 4HNTA 3CVJA 4FOPA 2W6OA 2ZJBA 2KS6A 1JT9A 2QI9F 3R9KA 3TX6A 1CUSA 3ZD8A 2O3SA 2Y67A 2W90A 1N8SA 2QY9A 1U2ZA 2QSJA 3KLOA 4Q24A 5ADWA 3RU7A 5EKSA 5IULC 1R6TA 3OOYA 1Q6ZA 2H4HA 3ZWYA 1VL8A 3LLCA 2GFHA 2CVQA 5EY5B 3W6PA 4F3RA 4PRYA 3PXCX 3VC7A 2E87A 4AJHA 1JVSA 1PVDA 1TPYA 5HKKA 4ZTZB 3A9RA 2PKQO 3M8KA 3INTA 2JGAA 1ZD8A 1DDGA 4BQNA 3B13B 3AR3A 4EF5A 5EXTA 5H16A 2XCUA 1E7QA 3Q2OA 4YUVA 2Q3JA 4C2AA 4CG2A 1CQXA 2H1SA 3PQ5A 4G0YA 4Q4HB 4PFSA 3AM5A 2P2DA 2A9OA 3W2EA 3WHKA 1T35A 4Q3EA 1LPPA 2LDXA 2V59A 4KB5A 4U9UA 4Y9RA 2HSJA 2I33A 2XB4A 2WHXA 5EZ5A 1LB1B 1N6IA 4OFZA 1ESCA 3FYHA 1X3LA 3D02A 1ZEJA 4YLGA 4P4GA 3WGIA 1C41A 4DA4A 1SC6A 3BUSA 5LUBA 1SKMA 2HIHA 1IVSA 4V1CI 5CLQA 3CNEA 1KZHA 1QG2A 1UZUA 5KS2A 1RAAA 2O0HA 4XDYA 1OPXA 2UVPB 4K1LA 1CIVA 1WR8A 3WGGA 1V8OA 5FNZA 2GJSA 1P3Y1 4JQCA 3K6JA 3G8CA 3AI7A 3OY2A 3Q3IA 2FPGB 3CC8A 4QSHA 5JMTA 3G2OA 5HNKA 3KB6A 5CVJA 4ENUA 3HL4A 2Q5CA 3K1AA 4X93A 5FXMA 1II9A 2PANA 3V1NA 5HIJA 5CYGA 1G19A 4EFLA 5AVVA 2DBVO 5CPBA 3VI4B 1ZNQO 3VH3A 4BWVA 4Z7JA 1ICIA 4Y2JA 4C6TB 1G7RA 1K5DA 2I1LA 1T4CA 3DLCA 5H4GA 4G0MA 1RTTA 3TJRA 2A9FA 1NJFA 4MVJE 3QEOA 1EDDA 2XB8A 4DA9A 1XNQB 3OOJA 1Y1PA 1X80A 4FYWA 1GNVA 2YOFA 1HXHA 4B3XA 1XTBA 5TARA 3V1LA 4A2QA 1TVKA 3HDGA 4WGGA 1MJFA 4MRSA 1PGOA 4F3CA 4M8SA 1TQ4A 1DFIA 1O96A 3LGSA 3W2TA 3UCEA 4YROA 2P2GA 5HOQA 3L06A 1YT5A 1MEJA 3B6ZA 3FF4A 4YUZA 2CW5A 4XLLA 4IDEA 3AIMA 2NO9A 2LCIA 2GVZC 3K70C 3N8NA 4LXGA 1ECBA 2CYCA 4GLLA 4L02A 3KJEA 2AI3A 5CTJA 4WLFA 5B1HA 5E6SB 3T9AA 1Z07A 5HE9A 4ZEOA 4KVZA 1LBIA 4YT2A 5LD2B 2OD2A 3UMRA 3AVWA 2ZT8A 3BZBA 4EMSA 3DONA 3TRFA 1UZNA 4BUJA 4YJGA 2O0JA 2XMCA 5AVOA 1ML3A 4B44A 3PPXA 4EG4A 2Y68A 3IAS6 5JYDA 2D2EA 5F35A 3TZKA 1KAMA 2CLMB 1AMOA 3Q7PA 1EK0A 3KBOA 1YTLA 4ZOLA 3EFBA 2VYCA 2OCIA 3WTBA 4AULA 3ESAA 1SXPA 4DMLA 2HYDA 1YS1X 5C8YF 1QXSA 2YINC 2NU7A 3DTYA 2WW8A 2K5UA 1E7MA 4RZSA 3OT5A 5KJ6A 1AKQA 1W30A 3P0FA 4EB6A 1NYQA 3PFWO 4AB1A 4L0QA 3DEHA 3T9EA 4XQCA 2FFHA 2ERXA 3DV2A 4WI1A 5DHUA 3O8NA 2VHXA 4FS8A 2R6GA 4E70A 3KZKA 5BT9A 3PEEA 2UYQA 4HDSA 1Y9DA 4MMXB 1JHAA 1NT2A 3HBAA 5ICCA 2QX8A 3KQOA 4AX8A 1S6YA 3P9IA 1ULTA 3PUIA 2YC4C 2J09A 3UFXA 3B70A 4Q9KA 4EHLA 1GU7A 4ER3A 2ORED 1DRUA 1UBEA 2MYNA 3EZNA 3HVRA 4K6HA 3OIWA 3EHEA 3UPUA 4IV5A 1WS6A 3AJRA 1KBZA 3H1BA 1BJTA 3SVZA 3U26A 3J7TA 5HA5A 1DKOA 1OW3B 4Y6OA 1VJ0A 1UKBA 3S99A 1UDRA 3AOEA 1OA1A 1B2RA 2M32A 4DCSA 5FI5A 1TU0A 1FJXA 2FPSA 2I2WA 4EKYA 5F3DA 2C7BA 2GUGA 1IDN1 2RGNC 5LZ5A 3H5TA 3IP7A 3HFSA 3OLYA 4ND5A 1IIRA 4WESB 1VB3A 1JQKA 2H5JA 3HO8A 1NUPA 1MN6A 3KQTA 4IZHA 4X63A 4XFKA 3FSRA 221PA 1YZTA 4AY4A 4RHXA 4Z1MA 3WRWA 1M1XB 1UPBA 2H2HA 4GDMA 2POCA 1AG9A 4DVJA 2BBSA 2XV1A 3D31A 4S1WA 3WL3A 3ZV6A 2PZEA 5JZOA 1FBNA 4YASA 2WAXA 4O0MA 5IASA 2ZBEA 4MA0A 3ZGVA 3LQQA 2B37A 2CNWD 2JIMA 2QNRA 1E2UA 4I81A 1HSZA 4OBWA 1DQRA 4B6EA 3D8SA 1E9FA 3PG5A 3EE6A 1QGED 2V7BA 4G4SO 3GEPA 2Q3HA 2ZITA 4G0XA 3WFJA 5FBQB 2CXPA 1FLVA 3S40A 2MJLA 2PLFA 4W5QA 1QORA 4NPAA 3D5TA 3MILA 4HDNA 4GX0A 4M22A 3WDKA 3OP1A 3RRJA 1D6NA 2WP0A 2A30A 5KI6A 3TSAA 4D43A 2CBGA 1KVQA 1H6AA 2AMVA 2FJPA 3MOGA 3NIBA 4JU9A 2AUNA 4QG7A 4X90A 5FBRB 5C8ZA 1VIMA 1XSEA 3WHIA 2CDAA 1HLGA 1TLFA 2CLSA 1UEIA 1XU7A 1UAGA 4GMXA 1ZOIA 2Q9AA 3UK0A 1EYZA 1WIWA 2J3EA 3C3PA 2YDXA 3GBPA 3E9EA 1FX1A 3HGTA 2AJCA 4DMRA 4UUPA 5DGDA 2FB9A 1UZLA 3BMOA 3MBIA 2W6NA 4FGSA 3GNSA 1CQJA 3HO6A 4S1TA 5E6RB 5EMJA 5I7UA 1VXRA 2SKCA 4NCAA 4MPDA 1JFSA 4IVQA 4OHCA 3QVUA 1IUOA 1YQDA 3U7IA 3ZWXA 1CJCA 1FMCA 4BRSA 3D54D 1NNI1 1RNLA 5BQXA 4BO3A 2CHGA 3GRYA 3M4NA 3V46A 3ZNQA 3T99A 1JR2A 3T9DA 3D4NA 4PGAA 4NCXA 1RWVA 2YHAA 2OFPA 5IJ0B 1YA4A 2B98A 3R7NA 5LQDA 1ZMXA 3K6SA 4MWCA 4DSTA 1M6VA 2IHJA 2OM6A 4JSYA 3OUZA 4MRMB 2X0FA 4AMVA 4GKVA 3LUGA 2VJKA 4DYVA 4QUJA 2VT6A 3E1GA 5CDHA 2GM4A 3ZDAA 3A32A 2IODA 4RK1A 5KU7A 2COUA 2ZUEA 3B20A 4KW7A 4GZMA 3DE3X 4IDPA 5E7QA 3ZVMA 2I6UA 1CDOA 1EBFA 1NTRA 1XLTC 2W2KA 1Y4SA 3ZU6A 3ZEIA 5JBNA 3G2KA 5KOJB 1I7SB 4KLZA 4OXXA 4EHAA 1XJ5A 2ZBGA 1JXOA 4F5DA 1MAUA 4ZT4A 3IAHA 3BF7A 2QT0A 3RKSA 5B12A 2B1IA 2JHCA 3GAFA 3RWBA 4DLSA 1V6AA 2C2XA 4L4UA 1UBJS 1R0RE 5EWJB 1IEWA 3C8MA 1GAQA 4CM6A 5L51A 3QTBA 1CQWA 1JUDA 1NIJA 2QX4A 4EDHA 5K3OA 1LEHA 3GLSA 1M2GA 1S2IA 4I6JA 4LJ7A 2VJAA 5CCBA 3HK2A 3D7KA 4HDRB 4YJ3B 5F9HA 3O4IA 1M1YA 4BAZA 1XK6A 4TTVA 1DX4A 5I4IA 5K0SA 1T3LA 2CEAA 3RS8A 4M98A 4ENVA 4HVCA 4CEJB 8OHMA 5FR1A 1JA1A 2IZ5A 3MIZA 3ZBUA 4CIXA 4DLWA 1AMNA 3L0SA 1V25A 2CHQA 3RSLA 5JPCA 3AVYA 3QJGA 5BSWA 1AS0A 3OZCA 2X8WA 3N8KA 1UMDA 4GMHA 1NC1A 4UNIA 5U4XA 4EA9A 4IW3B 4QZVA 5K8UA 5DCYA 1G63A 2IHYA 2RGEA 4D9NA 1RXEA 2D7JA 1QRRA 2TMKA 1FMFA 1JAZA 1NN3A 5JD4A 5CLHA 1QVZA 2HK6A 1SA0B 2ZRMA 2IYNA 5FQOA 5LQKA 3GGOA 5EUMA 5ELXA 1ZGJA 1C9JA 1QUEA 4XB6B 5D85A 1SKQA 4O4HF 5A04A 3R5FA 4U6QA 3RVSA 1RLOA 5ICSA 3QUQA 5E1OA 3QEBZ 1KP3A 1NVGA 4P93A 4W1QA 1CEQA 1R1DA 1W44A 2O2HA 4R2LA 3VVMA 1H2BA 2OHOA 1RKVA 4J4BA 3SBXA 3TBFA 1KYVA 3U09A 4OK5A 3SS7X 4CUZA 3QBDA 2KW5A 3OCYA 3R5TA 4TZ6A 3JCZA 4OXIA 4JP3A 2JVKA 2HSDA 1UKEA 3HSKA 2QKYA 5I7AA 3TDKA 4X1IB 1KVSA 2M6RA 3EB9A 4RMGA 3GDGA 4C4XA 1IJFA 5CA1B 5BYAA 1L4BA 3IA2A 3O75A 2WUDA 3OIVA 3VHXB 1WETA 9MHTA 1M34E 2IPXA 3PJFA 2LWIA 2VNJA 5CM2Z 5HP4A 2D1TA 1ULBA 3VYSB 2ZR9A 3WMEA 4PWZA 2WU4A 4RVDA 4CW7A 2W2QA 3CIOA 3NHPA 3JQFA 4N0DA 3V97A 2HLPA 4DLLA 1T6BY 2C84A 3LL7A 5IFLA 5JJBA 4BEJA 1PFKA 1Z2PX 3IP9A 3QFFA 2P8JA 2REXB 2WM3A 5CXUA 4ZAGA 3KTFA 3N2IA 1XK7A 1DWUA 1E92A 5EZQA 1RLJA 4LY0A 4CIWA 3BMNB 4BMSA 1N0VC 4MO2A 1L5LA 3TGWA 1V2HE 1M8JA 5HYVA 1QV9A 3D6AA 3AUXA 4W1PA 2WRZA 2PU7A 3BMCA 1G66A 4WASA 3JVUA 4RLQA 2RHRA 4Q16A 1JS1X 4GRIA 5ILQA 1S89A 2H65A 4DLUA 1SVKA 1TYCA 2FUG6 2NYAA 4RV5A 4Z4IA 3I2IA 4EJSA 3B5IA 4R51A 4JI2B 1TT5B 2H52A 2BGLA 3F6YA 3PE3A 3OPXA 4LV8B 2YWCA 1R50A 3IPYA 3FGPA 3MRXA 4OK6A 3URKA 3PD7A 3DT6A 4C7KA 1DKNA 4I8XA 1LDEA 3FI9A 5J2TA 4I1PA 4RESA 3NFYA 4INJA 3KFXA 4BMZA 1WNFA 5FNVF 4ZDKA 1JDSA 2RHMA 2YQ5A 4XSGA 3TCNA 3CVYA 3UMVA 3WDMA 1G1MA 1VGRA 8AT1A 5KNDD 4N6NA 1EWRA 3HYLA 1D2RA 4KJZA 4X91A 1XLWA 2G08A 4CKXA 3KYJB 3CWCA 4QUDA 4XSHA 1IM8A 1QHHA 2DBQA 4MI6A 4ARBA 4UUQA 4C1NA 4M99A 3S2ZA 1QVWA 3O4VA 1E2FA 1QYXA 2CKMA 4U9IS 4ZPJA 4NF2A 1A9SA 2VRCA 3IERA 3NZEA 1XD9A 2DWPA 4L16A 4PZ9A 1RRMA 2BCGY 1RLUA 4KPUA 5CTAA 3JQAB 3WRXC 3TLCA 2XQFA 1FFAA 1HYGA 1WY5A 1JNYA 1DCMA 5EKXA 1HL7A 3W4JA 4G2TA 1S1MA 4KBYA 2R00A 3UHOA 1P31A 1YZFA 1RWKA 2OP1A 3BJIC 4ZMRA 5A06A 5CT8A 4CM9D 5LBTA 1W4ZA 1RT9A 3FUWA 3ZIUA 1G42A 2D2XA 1U7UA 1Z37A 2YJNA 4GBED 1MB3A 5MDHA 3E48A 4GL2A 5FPPA 3HYCA 3FHLA 1QG4A 2Q3DA 3GRFA 3X0DA 4J4TA 4GR4A 2HIMA 5DX1A 3VYTB 1VGQA 3FCYA 1WDLA 3PI7A 5BORA 2YV5A 3G2QA 1C3LA 5J23A 1T9GS 1UDCA 4DCJA 1E4YA 4ND8A 1GAXA 4CYMA 2YVQA 2ZYSA 3B2NA 3LHKA 3VR2A 1KYQA 3GT7A 2A7XA 5BQPA 1N8TA 3TFWA 3OE7A 1QZ3A 2WUEA 3R3UA 1JZTA 1EXDA 2VS1A 2CJYA 4I6GA 2CXRA 2FQXA 2XNHA 3KOWA 4FYXA 4ZO4A 4QTYA 1NYTA 3SDZA 3TW6A 4AJJA 1DELA 4FDMA 3OM8A 3JWJA 4GG1A 1OXMA 1SFRA 3AMVA 1Z7WA 4EARA 1KTIA 1KETA 1FE8A 1DU4A 2X4LA 3P0HA 4GFDA 4X61A 1EXWA 1TD1A 5AO9A 4EO7A 2PV0A 1M6YA 2XZOA 1CY4A 1HQKA 3NRCA 4DCPA 3TLYA 3PUXA 3VNBA 3QVKA 4XE5A 3PXDA 4DR2B 5IM4A 1EX7A 2AKYA 2ZSFA 5EZ6B 1CUAA 1R0LA 2UZ4A 3OF3A 2J4CA 4HYYA 3TRDA 1TW2A 4UAJA 3OHSX 3EIWA 1KMMA 2ZE5A 1V3UA 5CVDA 1ECCA 2F4VB 2OHVA 4JJKA 4RZIA 3H9JA 5ABPA 5BV0A 1DC5A 3EVNA 4RM2A 2R8YA 4OB8A 7AT1A 3DDSA 4RANA 1GTG1 1GV1A 1TO2E 3NDRA 4Q9DA 1XVTA 1YQXA 2BFMA 3FR8A 1KZGB 2AFVA 3H84A 3I8XA 3LPCA 3LU1A 4GOMD 4LWPA 4ITUA 3IS3A 4UAVA 5DNCA 1D9XA 3WV5A 3AFHA 5A62A 1R7RA 3KSDO 5JQGF 3EXEB 1XZIA 3R7SA 4JLPA 3K1ZA 3Q1KA 5D1HA 1WD7A 2OBBA 3NV9A 1PJQA 4BQFA 3ZR4B 1IWPB 3AWDA 2FOLA 3VTAA 4PONA 3JV7A 1HT3A 1SU6A 3IXLA 2JJ8A 2JJQA 2YQZA 3T1QA 2V5UA 5A5EA 2WG0A 2IJGX 3GFQA 3V7NA 1AKYA 2QVLA 5I45A 2DEUA 4TL6A 4M55A 5D3MA 3DXZA 4ARUA 1UPAA 1NPTO 3A1VA 3C4VA 3FCSB 2ZTSA 1P72A 4D81A 1P6UA 5L7TA 1NP7A 3S1AB 4ES6A 1LPOA 1K08A 2R1TB 3M70A 2BE7A 1TF2A 3GQVA 3MSXA 5AVXA 1R8JA 5KVQA 4JB8A 4R98A 1VGVA 2AG5A 3LW8A 5H59A 3DMDA 4TMFA 5CBKA 3L1VA 1DFHA 1XXHE 4AMZA 3WGVA 3P9RA 3UAZA 4DTIA 3HH8A 4NMMA 2FWJA 1MB0A 3G49A 4KQGA 3H0EA 2ZXUA 1EVQA 2HK7A 2FMUA 3M6MD 3AESB 4F7WA 4XUGB 2XE8A 1CUCA 1OWLA 2IP2A 3JVEA 4AZSA 3M3PA 1VL1A 2GPJA 3R7LA 5A9SA 1ESZA 1T2DA 2VQDA 1TF5A 3SIWA 3WKDA 1XRJA 1E77A 2C7VA 3QPUA 3NX4A 1KS2A 3OEYA 1X7YA 3UB3A 3JY6A 5LU8A 1TM1E 2BEVA 1AHNA 2IOFA 4RDCA 5GJWC 1NAHA 1QGAA 2NOAA 4NZ9A 4WGFA 2EX0A 4DA0A 4E2ZA 1K92A 2G82A 4FVTA 1XZDA 2EF1A 1Q44A 1TUGA 4MVJI 2QRUA 4KZPA 1L4GA 3ML1A 1JG4A 2WKRA 3QY9A 3DLPX 1BD3A 5HKKD 1KZYC 1LS6A 1RS0A 3FVTA 3ZLBA 1T2CA 5CB4B 1OZHA 4JLUA 3JALB 2H3EA 4LOHA 1RXWA 2WTEA 1RVDA 1J1IA 5KKCA 4ZJPA 2CFTA 4JUIA 1ULZA 1QF6A 2HF2A 2G0AA 5TEWA 4AU1A 1OCEA 4CM3A 1H4SA 4YT5A 1NKSA 5FOUA 4ALLA 4F3KA 3H9BA 2J3DA 1Y8QB 4K7JA 4WADA 1GARA 5I5GA 3ZIAD 5J4YA 3EG9B 4RLFA 2BFNA 3LOUA 1KO5A 4KE6A 5EGSA 1RJEA 3EXIB 4QULA 4BZQA 2R5NA 1OBCA 1DEAA 4D8VA 2ADFA 3C39A 1KHTA 4HXYA 4P9NA 3F67A 4DDKA 4TN1A 2QTZA 3QEKA 3WG9A 2NP6A 3JX9A 4MZXA 2O8FB 1WAMA 1ADBA 2FPLA 3N0RA 1TZJA 4N3BA 4FBGA 5CBPB 1GFIA 3C7TA 3SZOA 3HVKA 4V0KA 3SXJA 1TKAA 3RQIA 1XZLA 3HQ4O 3NAQA 4AWAA 3U49A 2UUAB 1PDVA 2HMTA 4Q6WA 3EXFB 1CQIB 1GADO 4L28A 1ZRMA 3X1XA 2V55B 3D9QX 1AZSC 4CR6A 4FGKA 2ZWPA 3L8EA 4MZDA 2G28A 3BYZA 2ZBUA 3E9NA 5TXGA 3ZOKA 4BX8A 1MJHA 4H77A 2LR0A 2ZREA 3I5YA 2LZ0A 1GXSA 4CKCB 5I47A 2HOQA 1XZGA 2C9YA 2Q5IA 4B8YA 2C29D 1KC3A 2BMVA 2DY0A 2OLKA 5ALFA 3GFTA 4YJ2F 4UCQA 1M0EA 1I13A 3OAAD 4A26A 1QJCA 2FGJA 2FW1A 3M0EA 3MQFA 4R4JA 5TVKA 4CL8A 4IUCS 5K6AC 1UXHA 3NU1A 4NE9A 1NATA 2OYSA 3CWQA 1U9IC 5AI9A 2AZXA 4TYNA 3VR4A 3ETEA 3PJEA 4D4IA 4UTVA 5ALOA 4LIPD 3I8OA 4ZAVA 3UMGA 4YRGA 3AY3A 2RKOA 1G0OA 5LQAA 3O2JA 1KYIA 2QI9C 1V45E 3AUAA 3OMXA 5F7JA 2XHZA 1WZ2A 1W6UA 2Q4TA 4UREA 1PNTA 2Z3WA 2F8MA 1H05A 1UBRS 3R09A 1P74A 1G16A 4PRZA 4BQSA 5K1ZA 2X15A 4CMAA 1ISHA 4URWR 2IH4A 3TD6A 2EFYA 3PTLA 1COWD 3HEMA 3FFBA 3HABA 5DGXA 2R1VA 2OHJA 2A0WA 4ZALA 3BL5A 5JHGB 3H9QA 5CM8B 4CBVA 1N6RA 3EVBA 2FYTA 3KPUA 1GILA 2EFDB 1PLKA 3HJTA 5CFPA 4P0PB 2QV7A 2ZYRA 3CA8A 4HK4A 4TWIA 2C58A 1RWWA 3TBKA 4ZU1X 4GQBA 1HDZA 3KC2A 2JAPA 1QIMA 1R9GA 2EHDA 2MSKA 4JJAA 4B3FX 1USWA 1VBNA 1FXUA 1Z7EA 2G3YA 3ZNPA 4W7HA 3FIUA 5JSFA 4RZ2A 3IQFA 1QH1B 4FEYA 2YRWA 2GAAA 4LWOA 3IP8A 3EDOA 1E7SA 2BHSA 5THXA 4LHEA 4Z0PA 2EJUA 3GVIA 3EA5A 5TQVA 1J9ZA 1GCOA 3CLUC 3S8YA 2GBLC 2QM3A 3BB1A 4MUFA 4RMHA 5HKLA 3EISA 4ZK6A 2D5IA 5EJ6A 2VHEA 3KZ1E 3NT4A 4I50F 5IZ4A 1VBMA 4TMYA 3IILA 1Z7YA 1XDSA 3K5WA 1FX0B 5CCXA 3UG6A 3N7TA 4GBMA 1I2DA 4MVYA 5AUQA 4FFBA 4ND6A 4OL9A 3F3SA 1JNXX 1SHKA 2HU2A 2RG7A 3OJLA 3HMKA 5G40A 5KBYA 1SPBS 2AK2A 1JG2A 1O94A 2JZNA 4IIVA 4QD3A 1VI5A 3M3DA 4CFYA 3CF6R 1DTSA 1FY2A 2QAGA 4BGIA 3Q8XB 4ND1A 4HQ6A 1E1LA 4E2FA 2RGCA 4NJMA 1P6QA 5JZMA 3LI2A 1BX1A 4LXTA 3WYNA 3FOCA 4MKXA 1IMOA 4MPJA 4GPBA 2WAAA 4BRZA 4EZEA 5IBCA 1FQKA 4JV5B 2PGXA 2OV2A 1G21B 3WYAA 4IMJB 1RQXA 3K2EA 2MDTA 1UBCA 5CW2A 4CTMA 3FAZA 3HO1A 1J2YA 2V7TA 2G0TA 2X7JA 2XJ4A 2Y05A 2O6LA 3STWA 3MMNA 1CNFA 1N5JA 1II8B 1OX4B 2C3OA 4Q3AA 5IBPA 1HUQA 4GOJA 1C30A 5K8LA 1RZVA 3ESXA 1P5HA 2YN4A 4OD0A 4Q9JA 1Z0ZA 3V3TA 3PQ8A 4DGQA 1VSTA 2BFBA 4RHFA 4PYMA 5SYNA 3T9CA 3RAFC 5J2UB 3PE4A 4LZAA 3MRVA 3W6OA 4H0CA 3WGQA 4DJDC 5THKA 4QPPA 4WKPA 1OE0A 2ZETA 4F9TA 3A27A 3AHHA 3OTIA 2ADOA 1L7DA 3OWXA 2FSVC 3JD1A 5A7GA 3SC2A 3CXUA 2PEZA 4K88A 4ZQHA 4B80A 4BVLA 3U44B 4M4SA 5LLTA 3JU3A 4C0XA 5HIAA 3GLFB 5HQJA 4A7PA 2ZPTX 1K7EB 2WKWA 1Z75A 3WL5A 1JLLB 2OBMA 4UNNA 1ISSA 3FGNA 2VR1A 3L93A 4M1QA 1GNSA 1KQPA 1XDDA 2VLBA 4WZZA 4MOWA 2JARA 3ZK8A 2HPAA 1EESA 4MX8A 1X92A 2QYSA 4X54A 4Y18A 3WGZA 2R65A 2V96A 2IDMA 4UOZA 2RCNA 4G36A 1WVIA 4NONA 1NVDA 3Q15C 2O05A 4GF5A 3VSEA 5FWNA 3BD8A 1ULHA 4I55A 1I7LA 4N49A 3OZVA 2FMXA 3EARA 5LQSA 3AUYA 2B35A 4RQUA 2QVCA 2VDRB 2R1ZA 1A76A 2EV9A 3DCJA 5I9MA 3UN1A 3IQXA 4YBRA 4A4DA 1YZVA 1ETHA 3MJVA 1DXQA 4LI3X 1XVAA 1NXWA 4B5LA 2IS2A 5G1PA 2GI4A 4KYVA 4QL3A 4UVGA 4K40A 3FMGA 1IBSA 4I3FA 4AWBA 5IKXA 2HPVA 3PNSA 4WZBA 4YCCA 5EVCA 3DYIA 4L7VA 3EZFA 5BOSA 5AH0A 1KP2A 4BVGA 1V16A 1R88A 4CG3A 1MFZA 1OREA 3AHIA 5HTOA 1ZKMA 4CTJA 1EUQA 3R1IA 3S3TA 4D9KA 2QEQA 5EI5A 5IMBA 1T3TA 2AFIB 3CISA 5CVEA 3A0UA 1LPMA 2VQ6A 2IQIA 1XYYA 4QTZA 2IXEA 2VNIA 2YWJA 3KDAA 1WPXA 5LL6P 1RPZA 1QYCA 2Q46A 3TTTA 2I54A 3AR4A 1OSNA 1MG0A 4FCTA 1T43A 3PCRB 4II2A 1ZD5A 4JT9A 3I23A 1GGEA 2QW1A 2IUEA 3B6MA 3I4LA 4B3MB 2ATEA 5JQGB 2FR8A 4YMSA 3D4PA 2XWJI 3TNLA 5EP4A 3PLAE 1BIFA 1LS1A 1N34B 1MLDA 2ZRIA 4KQIA 3ITDA 3WLQA 3OZAA 3T7DA 2VPPA 5KYUB 1T2EA 4PC1A 2GCEA 2Z9CA 2EZ4A 4F3YA 3U56A 1HDOA 1TGVA 2EOAA 2X9LA 1VPLA 4XKJA 4Y2TA 1QGUB 5ALNA 1EFRA 5DN6A 1E7WA 1SAYA 2IY9A 1CJVC 3LLSA 5TGDA 3ZTYA 1UKYA 1AK2A 4CEIA 1E2PA 4O3FA 3TFOA 4JFRA 4D3SA 1P1CA 1PW7A 1G6KA 2X13A 3OI7A 3CRW1 2ZR8A 2WPNA 1VM6A 2PRJA 1MIHA 5DNAA 4DS3A 1JP7A 3GROA 3A4VA 1HKUA 3I12A 2YZKA 1ZH4A 1VHWA 2F4NA 3ADBA 1ZJJA 3A1DA 1JLMA 3OUUA 2DB3A 5ALEA 1GG2A 4QPNA 3MJDA 1WULS 3SVLA 3S5UA 3OCWA 3L0PA 2UDPA 3FOAA 1ZA1A 4OMCA 3R8XA 4QU5A 1PBNA 2PH3A 2CVZA 5BSMA 1JFVA 1GA4A 4JLMA 1QFSA 4ND3A 4JEHA 2W6JD 2UUOA 2YH2A 5FA8A 4DQDA 4MROA 5IEJA 4HBZA 4MP3A 4E5PA 5C32A 5ALQA 1HNNA 4RAOA 4CDMA 5HIIA 1FU8A 2RHOA 1KPHA 2PR2A 1QJ4A 2YWRA 1IOZA 3EUFA 3GVPA 3TSCA 4FONA 3OCCA 5IC4A 5KMGA 1OX6A 1XP8A 1AN0A 2R8BA 5ED4A 4XAQA 4Y1FA 1J33A 3EIQA 4X60A 1CU1A 3A6HA 3QX3A 4R81A 2CXNA 5TQ2B 4UCWA 2A9JA 1RJWA 2HN9A 2XGSA 4UBLA 3KP1A 1IAVA 5H70A 1Q50A 1HDEA 3MAGA 4OMUA 4WA7A 1JEAA 2J5KA 3WGTA 4A2CA 4BMOB 2G63A 4RDXA 2E37A 4Y6RA 1RRVA 4IHJA 3QF7A 4EJ0A 3RAGA 3T1VA 1RXUA 1ZKDA 3IAUA 1TKCA 4LECA 4H7JA 2O0KA 1YI1A 1XTQA 3JWEA 3QU4A 3BSWA 4K6MA 3UY4A 1SKBA 3VJLA 3EPLA 4HQRA 5KQGA 1OKKD 4KUEA 1OV4A 1TMOA 2P3OA 1EP9A 4IJQA 4MR8B 2O7QA 3FRHA 3OTGA 3C5HA 5D3ZA 5KTYA 1CYDA 2ZRCA 1UWVA 2VAWA 3ABOB 4K26A 1NW5A 3GDWA 3D64A 1M5TA 5F98A 2Q1YA 5SICE 1UL1X 4M1OA 2ZUBA 3RHFA 4B09A 3KCQA 4I5FA 2BL4A 1IUNA 1U8FO 1NE7A 3MLEA 1DCFA 4OMFG 3WLMA 3EJWA 3G85A 4K3UA 4NBNA 5JW6A 2WF6A 4NRDA 5HF9A 3VO9A 1LK7A 5CDUA 2ZVDA 4IFTA 4KJXA 3G0CA 1HETA 4IMIB 4KTVE 3F6EX 2WM2A 5FYQA 2WZDA 4OU5A 3UH1A 2QSYA 2AXPA 4WXEA 2VRCD 1X42A 3DZDA 4CWAA 2AN9A 2YV2A 3PX3A 2COEA 4Q4JA 3NJ8A 4WY8A 4M1ZA 5AXBA 1WUKS 1JEJA 1M2VA 1J0EA 2GCOA 1J0AA 5H5JA 3A06A 3D6NB 2IYYA 3FROA 3PB3A 3W79A 3MINB 1JU4A 1SK9A 3B36A 3OCZA 3N8GA 4M9UA 5JTUA 3TTSA 1QC5B 1GDTA 4LF7B 1A9QA 4LJ9A 5AKYA 2C9CA 3O91A 1WUJS 5D87A 5KVCA 1Y0BA 4D99A 1WP9A 5LZ7A 4OM7A 4X64B 4CKWA 3RRYA 3LCCA 4U5XA 3HB1A 2O3UA 3FI0A 1FDTA 3K2QA 1CNMA 1QVRA 2OQIA 2PZLA 4HAXA 4LOJA 5BWCA 4FGUA 1DBIA 5JSQA 2FSSA 1XJQA 3N53A 4O4LF 3F97A 2GXSA 3KOMA 4UTOA 1KVUA 4JB3A 4U2CA 1ZL2A 4EWLA 1O95C 1H8ED 2X8JA 3VR2D 1FTGA 4JXKA 3L4KA 3ZVLA 2Y76A 3L18A 3OE7D 4W9NC 2H07A 2V65A 4GI1A 1TU4A 2DSNA 1OZFA 3PFFA 3TQIA 1Y9AA 3E7XA 4TZKA 1Z16A 4OP3A 5J9FA 2IEZA 3RC9A 3U7JA 4E6PA 3L8YA 3GIDA 1PFYA 1XDUA 3ECAA 3OQJA 1Q11A 3QPDA 4XJXA 1N57A 7GPBA 3PU6A 4G1UC 4DQXA 4C2BA 1DAEA 1B4DA 3C6YA 3H11B 3ITKA 2NIPA 2UZ3A 4ZQEA 2PL3A 621PA 3QA9A 2QK4A 5CXXA 2Z0MA 4JVMA 4I5GA 1U8YA 5JTTA 1PV4A 1DADA 3L7NA 4JHLA 1QIJA 4R0NA 1N4DA 1SZCA 2JHGA 3WP1B 1RZ3A 2E2WA 2ZUFA 1QCCA 1W88A 1XV5A 4D6YA 4CIYA 2I7TA 1ZAYA 1LW7A 2F43B 1N2ZA 4D9HA 4RF2A 3NEPX 3A1UA 4J0KA 4GSLA 4OGGA 3FNQA 3PYMA 3VX3A 3ZXSA 5BR8B 5BWMA 4AO6A 2A58A 4D44A 4OPMA 3MGKA 4IO0A 5DCLA 3WICA 1ODTC 2XVYA 3QBJA 1O9GA 1ONOA 1OFGA 3RYIB 1X8LA 1BMTA 4AYXA 5KNBD 3EG5A 3F9IA 3T5TA 3L8FA 3OHPA 1V4BA 1AKWA 2YOGA 3L8DA 5AVWA 3CG0A 4FUTA 4UPEA 3P0EA 3WWDA 3USES 1CZUA 4D5GA 5CFOA 4DHWA 3R76A 3PC8C 1QGZA 2A5YB 5AVUA 1ZG3A 2Q1XA 2OILA 2GVNA 2HDHA 3RHSA 3MGBA 1QQ7A 1NQTA 3VAYA 2GK6A 1SCAA 3HRIA 4BLTA 3PHJA 4TL8A 4BX2A 2I3AA 2VOJA 2AWOA 4X1YB 3V4PB 3WB9A 5CD1A 3TLZA 1M1NB 5JH7A 1V37A 3AVQA 4U1RA 3UWSA 2PGOA 3ZQUA 1QWOA 1N3BA 1I6MA 1VSBA 3KRTA 5DM2A 2GBFA 4D0RA 3AVTA 5BWOA 1N5KA 5MN5A 4O5OA 1WPGA 5DN9A 1Z4JA 2W83A 2A86A 3PA8A 5K0ZA 4BL5A 2YJ5A 2O7SA 4GZ3A 5C3UA 3SR4A 3VR3D 5EHXA 1NHGA 3C98A 4WWHA 5GIPE 1M8KA 2QTRA 2FZVA 2ZUWA 3EW9A 3GZTB 1W0KA 4W63A 4N7JA 4MTCA 2EFHB 3QPCA 4UZEA 3U1TA 3R3VA 1MX9A 2PU5A 2JLZA 1KY5A 1T8UA 1TC2A 2H8GA 1M7HA 2IGTA 2QLLA 2PUVA 1AHIA 4X6XA 3T5BA 3SXUA 1PIWA 3BTUA 2KI5A 3UTCA 4F3TA 1B3RA 1E61A 3QYJA 5JXGA 4PPFA 1KARA 1Q1AA 1VE9A 2IUTA 1O6FA 5F1PA 3LXMA 4QAQA 1GTJ1 3ZCVA 3VJRA 4FQ8A 4GX5A 2OORC 1MPXA 2SHKA 3PD0A 4E22A 4R8VA 1VIVA 2IYAA 3G79A 4EY8A 4YMWA 3KU1A 2I80A 3RFTA 1CQPA 1CF9A 1B0PA 1SVNA 3TPCA 5INTA 3PZBA 3PHGA 2B3DA 1M2JA 3NOQA 1XCLA 3MS7A 3ENWA 3D3WB 5KYVA 3G3EA 5I9TA 1EGHA 1A8PA 2GZ1A 3ESCA 3OX3A 2AX4A 2PH5A 2PV7A 1RQRA 4JQSA 3U7RA 3DB2A 1JQBA 2FEMA 1PJLA 1JSRA 4I1YA 5LP6F 4HS4A 4PPQA 2PT9A 4XIJA 1FF9A 4LDPA 3RS5A 5B7QA 3DWFA 4BO0A 1FBTA 2FXVA 2FP4A 3M9XA 3NWBA 3PQDA 2H4ZA 2VFAA 2PX8A 2VJQA 3MXOA 1C7EA 2F2TA 3TZQA 4P2GA 3ZCQA 5JALA 4CCYA 2J9RA 1OTHA 2G0NA 2RGUA 3G5TA 3HEBA 1SXGA 4FHEA 4N5NA 1KS9A 5AM0A 1B6SA 4DWWA 3MGAA 3Q88A 2M9MA 2VQSA 1IQRA 4E5MA 4BLRA 1N6PA 4MPRA 3FB4A 3F8TA 4L3VA 3SSAA 4LYYA 2IHVA 3DAHA 4WBNA 1VDMA 4TKUA 3HWSA 4KCGA 1CY8A 1W0JD 1YRHA 4W5WA 3N74A 1MQ9A 3NWJA 4P3PA 1Z36A 5AJHA 1OYYA 4FR2A 1EFUA 1O5OA 1VG8A 4Q3KA 4EO4A 4F46A 3TE7A 4A82A 4AMGA 2WLSA 1PV2A 3A4TA 1ZK0A 3T5DA 4EGQA 4D82A 2VNSA 2PMBA 5TY0A 1DOAA 1O9HA 5C1PA 1YV9A 4INOA 1W73A 4E5KA 4CTNA 1IJBA 2GPBA 5D5PA 1SUSA 4RPGA 4NJOA 3V4SA 4W5RA 4QVGA 2PGLA 1IB0A 4Y30A 3FLBA 5FL7A 3ONEA 1U2DA 4QECA 4RSGA 4D9IA 4L27A 1U2QA 5C8YB 4J7CA 4O1HA 5IH3A 4W7SA 4QICA 1NWHA 4FDAA 3IB3A 1FFWA 3GZNA 5MGBA 2GK4A 3TXXA 2AUMA 4ITVA 1L8QA 1KJJA 2WT9A 3PL1A 1QO7A 2QBYA 3CO0S 2MSLA 1QKIA 2DP4E 2H6EA 3K32A 3OIYA 2AD1A 4CZ2A 5JJCA 4MGYR 1N2CB 1BCSB 5FI3A 1E62A 1NMEA 4QYTA 3U60B 1ZN8A 4K9LA 4LYEA 6GPBA