4QGHA

S.aureus tmk in complex with potent inhibitor compound 47
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
204
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 83
structure length 195
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qghA00
2R6AA 3QKSA 3DKPA 1SXJE 5HZHA 3NH6A 5FBLB 4FCVA 4PC7A 3B1XA 3N5CA 3MWLA 1E9FA 1LTQA 4DUGD 3AM1A 5IDVA 2ZVPX 3IEUA 3LBNA 4R2IA 4AYTA 1CEEA 2GRJA 2H18A 2C98A 1OKKD 2D7DA 2IYTA 4D82A 1KAOA 1NVVQ 3H86A 2QTFA 2FGKA 4JLBA 2W6ID 1S9HA 2BBSA 2OAP1 2ZSDA 4S2EA 5DHAA 1OKKA 5FR2A 4LYAA 1DO2A 2Z4RA 1N6KA 1XTIA 2QROA 5FI1B 1MH1A 1IY0A 4UXJA 2WJHA 2ZRFA 2W0SA 3A4MA 3HYTA 3TKLA 2W2XA 1GSIA 3HR8A 4JYCA 4GMDA 3K70C 2FZLA 2QM7A 2V3CC 1VG1A 1KSHA 4DC9A 2REBA 1UEJA 4PPFA 2PBRA 3DZ8A 1NG1A 1P7CA 2VQSA 2EYQA 2QAGC 2FE4A 2JIZA 4L4UA 4I1UA 4LJ9A 1YR9A 4RD4A 4C0BA 2ZAMA 4Z8YA 1JBKA 2GJ9A 2HYDA 1SVSA 3T61A 3QJYA 4RD3A 4A0GA 1GVNB 3MSXA 5FL7D 1G6HA 3W8RA 4AY2A 1TQ6A 2JASA 4IDQA 2HT6A 4LYJA 3RRYA 2D4HA 3B1YA 4ASUD 4Q1AA 3HPQA 3U61B 2ZRBA 4LPSA 1E1RA 1SXJB 3PIRA 5FOXA 5FI0B 2J1LA 2D06A 3NVAA 4WZAE 1P62B 4ASUA 4MUBA 4NCKA 4IVQA 5FFMA 1P60A 2GJ8A 4KI0A 2V6IA 4KSCA 4AKEA 4TYPA 3B7GA 1YRAA 4ZDWA 5TDHA 2ORIA 3KQKA 2JAQA 4C7OA 3LLUA 3LRPA 4HB4A 5BQ5A 1XDBA 1KMQA 2FJUA 4QNRA 5ELXA 4RCYA 1PUJA 4C0LA 3R8FA 4CGZA 4DB2A 3K53A 3TVDA 3M0EA 4LHZA 4C2TA 4A92A 3VNVA 4E5UA 1ZU4A 4B71A 2NIPA 2KBEA 3GJ6A 1D2MA 1COWD 1G7RA 1KI2A 4Q9HA 1MR3F 3FVQA 5LB4A 5L3VA 3K9LA 1KDRA 1N0VC 4RD0A 4TLEA 1LF0A 1U0JA 3ZVLA 4ZCLA 3K0CA 4TZ6A 5A5GA 3D31A 4M9QA 3W5IA 4EFMA 3GJXC 2JLYA 1W4CA 2GVDC 2VPPA 3GLIE 2WHXA 4BE7B 3B6EA 3RNLA 4HUTA 1UBFA 2J0SA 4C0HA 2DWPA 1P72A 4EUNA 4ACAA 4QHYA 2KBFA 3GLHA 4Q7JB 3SR0A 4NDZA 3K0AA 2JCSA 3BRWD 5C2JB 1E2IA 1TNDA 2CVHA 5AK0A 4GZMA 2PJRA 1ETUA 1JR3D 2ZAOA 4JVMA 1IJFA 4NZYA 1MO5A 4B3BA 1X8KA 2OXCA 3EX7C 4CEIA 1F2UA 1XMIA 3A1SA 1CJVC 2BWJA 2O0JA 2R65A 4EJSC 4F38A 1X86B 2ZE7A 3IBYA 3FHTA 1ZNXA 3IIJA 4A6PA 3P26A 1G291 4DCVA 4A15A 5FPSA 2FEMA 1V5WA 3M1IA 4JJZA 1EFHA 2ZI9A 4YONB 1HT1E 1Z0KA 2I1QA 1FUUA 1W5SA 3K70B 1XMVA 1P3JA 4DEXA 2W2TA 4TZ0A 3TLXA 3GJ8A 2BBOA 3K9GA 3WP1B 1QHNA 1E0KA 3U3RA 1KI6A 3B1WA 4FXPA 1T6NA 3NTUA 2PT7A 3OF5A 4A2WA 5DISB 3EWSA 1NMZA 1YZGA 5E7MA 2GBLA 4YMTA 1ZM3A 1OSNA 2A2ZA 2O8FA 2WIBA 1Z0FA 4YMVA 2H16A 1YKSA 1UBGA 4PPQA 2C04A 4WIAA 3SU8A 3UKDA 5FTLA 3NEYA 3A1UA 4XH9B 3NHBA 1Z83A 1Z0DA 4GFDA 5IK2A 3CX8A 4OHZA 4I1OA 4XSGA 5SZKB 5FUYA 1COWA 1OV4A 3FTQA 4MITA 4AC9A 4P0TA 1KY3A 4US0R 3BIFA 5KSZA 1A82A 3E2IA 2O8FB 4DIDA 1IQPA 5DI3A 1W0JA 4IVPA 2F9LA 2JLVA 2B92A 3TUJC 4B35A 1F48A 3HP1A 5FBVB 1A4RA 1UPTA 1JB1A 1AS0A 1EX7A 4ESHA 1WCV1 4MRVA 4NCHA 5BW8A 4Z1MD 4D0NA 3KKPA 3T35A 3DDCA 4RKEA 2X1VA 2ATXA 4B2LA 121PA 3B85A 2DFLA 3R20A 4IOLA 1HQYE 2R2AA 1G9XA 2ZRHA 3AH8A 4K8OA 1AK2A 3CNNA 3FWYA 4NYMQ 5F2EA 5C18A 3PCRB 4FWIB 2PCJA 4B3CA 4NCJA 4HI0E 5DHFA 4O25A 3K0FB 2REOA 3SS8A 3LX8A 5CIWA 2IYQA 2Q0HA 4PZLA 1VCIA 1CRQA 3SJZA 2BBTA 2HT1A 1ZUIA 2DWOA 1XRJA 2ZUBA 2BEKA 4XWOA 3WMEA 1I4LD 2J0UA 4BZXA 2OFXA 3CRW1 1E2JA 3CPHA 4Q1DA 2GEVA 1Z6GA 4EPYA 2WWIA 1YRBA 1ZM2A 1R0XA 1QHHB 4XTCS 3PJRA 1KI1A 3EG5A 1GNRA 2DWQA 4QBIA 1R2QA 4MRRA 3ND8A 3KTAB 3KFVA 3EAQA 2F55A 4V02A 1UBCA 1Z47A 2GILA 3JVUA 2AWOA 4IW3B 4LJ6A 3GEEA 4DCUA 1YR6A 1BMFD 1W49A 4R2HA 1XF9A 2VA8A 2JJ2A 4ZO4A 2JEOA 3KTAA 5CB6A 3C8UA 5GADl 2FZ4A 2J87A 1S3SA 2J41A 1EGAA 3BH6A 3UWOA 2WICA 1KO5A 4HSEA 3VQTA 4FW9A 1XTRA 4BFTA 3GFTA 4M8NE 2VP4A 1VG0B 4IJMA 3CKLA 1EFRA 4QOSA 3LAWA 4QGHA 1OHHA 4IVRA 1ZP6A 4Q4AA 3P4XA 1OE0A 2BDTA 4JS0A 4L15A 1VYTA 1XMSA 4HLQB 3RSOA 1IXSB 3T1QA 1VPLA 4MDEA 1NN0A 3TW4A 621PA 3TSWA 4Q66C 5K8LA 3KKMA 1G20E 1XNJA 5FOSA 4KYUA 4C0QC 2VSOA 1U8ZA 2ZUCA 3RHFA 3FFBA 1C4OA 2ZE8A 1OFIA 1AA9A 4DLVA 2BIFA 4UNNA 4Q9KA 3O47A 4Z51A 3ADCA 2D7CA 5L3SB 4LBZA 3WNCA 2FWRA 4URWR 4HAUA 1PVOA 5CJPA 2B21A 3OAAD 5E4FA 1R5BA 1KI6B 1G7CA 3DOEA 1JEDA 4Y0VA 1XXHE 4DDUA 4LHYA 3PEWA 4TYNA 5G41A 1E9EA 2V8OA 2XTNA 1Q20A 2ZROA 3B9PA 3KFXA 3V9PA 2Q9AA 1E1QA 2V9PA 1T8UA 1DPFA 3ZYCA 2HF8A 1XTJA 3G5UA 3RRNA 4D6PA 1NSFA 1MOZA 4BLQA 4OQNA 2F43B 1KO4A 2EW1A 2R6FA 1M34E 3IHWA 4B34A 2C9YA 5KSYA 2MSCB 1P75A 3CR8A 3DMNA 3GLIB 1SHZA 2ERYA 4Q4LA 1EFTA 4R9UC 4LJ4A 3AVOA 5FL7A 4DLXA 4TL8A 4ARZA 2BMDA 2WVJA 4PQYA 2MMCA 3I5YA 1CR1A 3WBJA 4Q1FA 3SEAA 1DAMA 4F91B 2BVNA 3VX4A 4WXRA 2OESA 1M7GA 1CR2A 4IRUB 821PA 5JSZA 2WIAA 1IONA 3AP1A 2FU5C 1KJYA 3SYKA 4LJYA 1BYUA 3QG5A 1UEIA 4EPRA 5AJWA 4A6XA 4OK5A 3ND9A 5JHGB 1Z6AA 2ZJOA 2HXSA 5JCZA 5TXGA 3WHLA 1G7SA 1FNMA 4NU0A 1NP6A 2NOAA 3RS0A 4DCSA 2GZHA 4LCBA 3WYGA 3GCGA 2VBCA 2CCJA 3GLGE 4MKHA 5E95A 4HYYA 1EFRD 3KJGA 2OM2A 3LO5A 1M7BA 2QQEA 3NKVA 3SC3A 4BZQA 3KXKA 4UQOA 1G41A 3KX2A 1NMYA 4R98A 5H1YA 2VF8A 3RVBA 3GJ7A 4QFMA 1NJFA 3RS7A 3ZVRA 2WJYA 5JFGA 2OBMA 1ZYUA 1AM4D 5JI3E 1XJ0A 2XB4A 1CJUC 3QY0A 1XFAA 2FFQA 2IYLD 4PAQA 1SGWA 1J90A 2VP6A 4LYFA 4KVAA 4B6EA 2PEZA 4QC2A 2ZIAA 3E70C 5IF9A 5KTYA 5F3WB 4DLZA 1GUAA 1FP7A 3VFDA 3QF4B 5EE1A 4MGZR 1LF5A 3A37A 4Y0AA 1TF7A 1PLLA 2GJSA 1UF9A 4PC3A 3DM9B 4Z8XA 4EPVA 4V0MA 5FPKA 2NTYC 1E79A 3ZDQA 2O8CB 4NE2A 4NKRA 2ZTSA 4PAMA 3ICEA 3GLGA 2VP9A 5J4KA 1ZC4A 3H0KA 4URZR 5DNYB 3X1ZA 4LK2A 3GJ3A 2EFEB 1ZIOA 2CK3D 4Q47A 4W5JA 4XIGS 2RGXA 4G5QA 2ANBA 4KCGA 4A0HA 4EPWA 3F5FA 4DWJA 4NTZA 1QF9A 4DJTA 2QBYB 3A4NA 3Q7PA 3UG7A 3TSOA 4QJ3A 221PA 2VP5A 1L4UA 1JPNA 1E2KA 3TBKA 3AVXA 3UXMA 4D81A 1XCPA 3LBIA 4G5RA 5L3QB 4U5XA 2RH5A 3KXLA 5KSPA 2G0NA 2ZS8A 1E6CA 2ZRDA 1P61B 1FMJA 4PSVA 4DEYA 4DLYA 3I62A 3SHFA 1KSGA 3TE6A 3I5XA 4CEJA 1XCMA 5FBWB 2N42A 3NBXX 1U81A 3PUWA 4CT5A 1IN4A 1VCOA 4M1TA 4D4LA 1W5TA 3D8BA 5E7IA 4TMXA 5L3QA 1XD2A 3CF0A 4PHTA 4US1R 2BV3A 3EPLA 1NKTA 1ZMXA 3I3SR 3R8CA 2C78A 1E4VA 2DFNA 2ZQ5A 2B8WA 4PC1A 3K70D 2BMFA 3K09C 2W2VA 5EE9A 3C5HA 3EC1A 4BFZA 2PMDA 1JAIA 1KO7A 1OHHD 1DELA 4MA4A 4OI2A 4EIWA 3U6KA 2V55B 3T34A 2LKDA 3U3JA 4QBFA 3RDPA 1P9NA 4G3XA 4EAQA 5FOWA 5TV2A 3IUYA 4A82A 2V54A 2DR3A 4EPTA 2P67A 5AUOB 3I8SA 3GFOA 4V0LA 1B23P 1WP9A 3HU3A 3NDBB 1QG2A 4LBWA 3A1WA 4RVCA 1EG7A 1YZNA 3BH0A 4P31A 4X8MA 5DO9A 5AR1A 3JVVA 1ZNZA 3DO6A 3W8NA 2IYUA 3MMPA 1MT0A 3RSLA 5GJBA 4QHTA 4L9WA 1UDWA 4DT1B 2E87A 3F3YA 1L8QA 4NPHA 1NLYA 5B57C 2R8RA 3B78A 4DCTA 4M1KA 1GTVA 2J9RA 5UKDA 1RVDA 1KZ7B 2VYFA 4HZUA 5JRJA 1M74A 2D3WA 1PLKA 1GNPA 1DAKA 5FPHA 2QMUA 1H8HA 2CL7X 2QE7A 2RMKA 4U02A 2O52A 1IXZA 3W6NA 3E1SA 2NMVA 3ICQB 4KFUA 3EASA 4H1UA 4V03A 5HPYB 4LPKA 3TH5A 1Z6YA 3BD9A 4PXAA 1GM5A 3QSYA 1CF4A 1TU4A 2YHSA 1R10A 4K46A 3T5DA 4QHSA 4Q1CA 1A2KC 2Z6VA 1KOFA 2QT1A 2GF9A 1OH8A 2W83A 3VX3A 4EFNA 4FMDB 5H68A 1ZUNB 4LRWA 5DYGA 2BHRA 4OI4A 2GJKA 4YC7A 4PHFA 4DSNA 1RJ9B 4LC0A 4CEHB 4CT4B 5JEEA 2OT3B 1G1MA 2FPLA 2GXSA 3WRYC 4WW0A 2PJZA 4CVNA 1AN0A 1AS3A 1KK2A 2RGNC 5JWRA 3H2YA 5BYJA 2IXFA 4JLMA 3RC3A 4ZIRA 3W6OA 2HCBA 5EXPA 2QAJA 1VECA 3RWOA 2I4IA 3L43A 1RE0A 1X8JA 2VP2A 4OQXA 2IA5A 3HYRA 3PR1A 2WSSA 4MYUA 2WWYA 3L8ZA 1FW6A 4CEHA 2VHJA 4NONA 4JLVA 3P4YA 2J0VA 4JVNA 4K81B 1I2DA 1XEXB 1Z08A 4GBMA 3THOA 1W0KD 5FOVA 1VHTA 1G8YA 3CNLA 5HZKA 4YXWA 2YWHA 1M6NA 4BGDA 4JT4A 4N1AA 3TR5A 1XWIA 2JLWA 4B44A 1CS4C 4NCNA 5A4JA 3SHWA 3F8TA 3UWKA 5CM9C 4FWTA 1XJCA 4OL0A 1ODFA 2QNRA 4NP6A 3TGPA 2OHFA 4BECA 1U8YA 3TVTA 1NN3A 4A0FA 3BBPA 1HURA 2ZSBA 1KTVA 2QL6A 4M1SA 4ABYA 4QXAA 1LVGA 2QP4A 4A8JA 2CL0X 3BERA 3W9YA 2QPAA 1UFQA 2GJAA 5EJEA 1Q3TA 3FGNA 1UDXA 4B48A 4URUR 2QMHA 3BB1A 5J5CA 2PZEA 1U94A 2EFCB 4U00A 2SHKA 4TYQA 4IDPA 1XPUA 1ZNWA 5BN5A 2ZYTX 3LW7A 2ZUDA 2IS2A 2YWEA 3MRSA 1WRBA 4MH0R 1GILA 3KB2A 4Q9LA 2FOLA 4AG5A 4TMKA 4GDFA 3GFPA 1GFIA 3VTKA 1N0WA 3A58B 2EFHB 2IBMA 2IF2A 1KMHA 2XJ9A 1QHIA 4XTRA 3W5JA 3U2QA 1TTTA 4C0KA 4NYMR 3TMKA 4RZXA 2EWWA 1OXTA 4L16A 4HEJA 1WBBA 2O8BB 2HEIA 4IEIA 2XITA 4M1WA 5GVSA 3EIHA 1XMJA 3ZVMA 3H4MA 2QGNA 3K0SA 4BQSA 2HJGA 4PO8A 4RZ3A 2IYZA 4B76A 4PQRA 3VR2A 1AZSC 2P5SA 4TTQA 3FDIA 5EP4A 3T5GA 1SHKA 4QKQA 1PJRA 3GLGB 4BLTA 2ZANA 4KVGA 3AVYA 1NSTA 1B0UA 1Z8FA 3F0TA 4RD1A 2GKSA 4PHHA 4L5BA 4E22A 5LBIA 4KSBA 5JWHA 2JLQA 1VG8A 2F7SA 2IHBA 1E0SA 4XD7D 1II8A 3ZH9B 2ATVA 2WOJA 1E9RA 3QENA 2VSFA 1H8EA 1DVRA 1EX6A 1Q21A 3EIEA 3O8DA 1UKEA 2IW3A 1LW7A 3CBQA 2XGJA 1SVLA 3U6BA 1E69A 1ANKA 1H8ED 2RCNA 4OQMA 1QVRA 2GCPA 2ZJBA 3IILA 4BFWA 1LNZA 1IHUA 4DLTA 2OLJA 1KDPA 2RGGA 4JKYA 1HYQA 1OT3A 1JEEA 2JLZA 4TMTA 3CPJB 3GLHE 2P6NA 3H1TA 3WBKA 2N1BA 3KKOA 1TPZA 3N70A 1G5TA 4Z54A 4LWZA 3G82C 4F4JA 1E0AA 2HF9A 2ZI3A 4XVQA 1ESNA 4YLGA 1CJKC 3ZZTA 2FA9A 2UKDA 2C77A 2ODNA 2OFOA 3NBFA 1NBMD 2FG5A 1KO1A 4KYIB 4HB0A 1U99A 3IHLA 1PV4A 1WE2A 5C1BA 3ZZUA 2GETA 4BFXA 2UZ3A 3H84A 1P73A 1S3GA 1W36C 3WP0A 2BKEA 1QBKC 4PHGA 2Q9BA 2I3BA 3X1DA 2UZIR 4JLAA 1U2RA 3U3MA 2NO7A 2QN6A 2CK3A 4GOKA 5J4HA 2AKYA 3AVQA 2QORA 4GOXA 3CX7A 3B2EA 1JPJA 2YV5A 3C4JA 4PO1A 3TJZA 1G64A 1NBMA 1NG9A 2R62A 4JBXA 3KQNA 1JALA 4HLUC 2F3TA 2CLSA 1P5ZB 2H92A 4KODA 3BJIC 1G7TA 1YHNA 2QMEA 4V0NA 3NC0C 2GAOA 3EA5A 2F1JA 4FCWA 4TSFD 4P32A 3RS2A 1RKBA 3IGFA 4PPGA 1WXQA 4PTLA 5JECA 5KO2A 5F98A 1FUKA 1US8B 4E09A 4TSFA 3Q5EA 1J99A 2FGJA 4UXIA 2ZM5A 4NYIQ 2GXQA 5CK5A 2DFTA 1F3OA 4P4SB 5CJ2A 2AN9A 5BN4A 2FH5B 1DE0A 4DDTA 1S4QA 1FNNA 1W4RA 1Z63A 3PV0A 1G5RA 3EPHA 4HDQB 4QRHA 5AJYA 4JBYA 1XCGB 3ZQJA 3NBZC 5DN6D 1US8A 6Q21A 2RGAA 4TMVA 4Q19A 4QL3A 5E3HA 4ZCIA 1W0KA 2HLDA 2ZR0A 2IUTA 3QKRA 1MV5A 4PAOA 3A8TA 5FOTA 5A0FA 4LX0A 1KYIA 5EXSA 3SN6A 5FPTA 2N46A 4RD2A 2AFIE 2ZSAA 1HV8A 3EZ7A 3OFNA 1J70A 2F43A 2OFWA 3U4QA 2IK8A 4JLOA 4YXWD 2GA8A 5FUWA 3ZQ6A 2H5EA 3VR3A 5KSOA 1BKDR 2W58A 4MKFA 2E9SA 4YDSA 1AGPA 4NBSA 4XWAA 4OHVA 3AEZA 1BYIA 3O8RA 4PSKA 2L0XA 3NH9A 4H9GA 1W7AA 3FMPB 3WMGA 1SXJA 4FMBB 3VHXA 5JLJA 2IEZA 1KGDA 2KB0A 1N6LA 3PXGA 4BLSA 1BS1A 1YQTA 3QF7A 3T1VA 2GVZC 3BFXA 3OFND 4URXR 3I92A 3AF2A 1ONBA 2PZFA 4QM7A 3GJ0A 2RGDA 5DI9A 1RC8A 4MRPA 1RW4A 4HDCA 2ZRNA 2CHQA 521PA 1E9BA 4Q1BA 4UNQA 2QP3A 2IYXA 3B13B 1GL9B 5L3RA 1FQKA 3QXSA 1R6BX 3AKDA 3CRMA 1YZUA 1K8RA 1E1RD 3MJRA 4M53A 2KJQA 2QPTA 1QHHA 4LV5B 4AK9A 4TL6A 3K8YA 3DKVA 5TB5A 2LWIA 2D2FA 4GNKA 5FTNA 4IOJA 3VHLB 2A9KA 2Q21A 2F1IA 1HEIA 3Q5DA 3LY5A 1M2OB 2AXPA 2B8TA 3SBEA 3TQFA 3HU1A 2IUUA 5KOYA 2OBLA 5EUQB 4D4MA 1MO3A 2CJWB 1OJLA 3OHMA 3QXCA 4KO8A 1KK3A 4KFSA 2FSFA 4HAWA 3LBHA 4RD6A 4B32A 1G3MA 1TX4B 1CR0A 3OE7D 2TMKA 4NYJR 2OZEA 4POAA 1II0A 3KKNA 2J0UB 4WZBE 2DHRA 3U44A 3PUYA 3K0CC 4I1VA 2KE5A 1IN6A 5CYPA 1DOAA 3V4RA 5IHPA 2CNWD 2ZJAA 3RAPR 3A6PC 3MD0A 3SE0A 2GF0A 1QG4A 2RGBA 3PEUA 3PENA 1YE8A 1D8TA 2RKOA 4UNRA 2FFHA 3L82B 3SBDA 1TMKA 3RS4A 2W6IA 2G9NA 1CJTC 1IOZA 4Q1EA 2AWNA 2AXNA 3GLHB 1S8FA 1X3SA 2G77B 1P6XA 2GTPA 5F9FA 2F1RA 3NEJA 3UMRA 3HJNA 3WXMA 3G0HA 4H1VA 1XEWY 3IBGA 5HE9A 5TY0A 4DSTA 2CHVA 1CJMA 3CWZA 2W6JA 4HUQB 2ZRCA 5EXXA 1YZQA 2WWGA 3KJHA 4IXMA 1PLJA 5KDDA 2ZRMA 2ZXUA 5KUTA 2V1UA 2VH5R 2X2FA 1N6IA 4G1UC 4DSUA 2NO6A 2GHIA 2GNOA 5L8VA 2GBLC 5FUXA 1KKLA 3AUXA 4KLZA 4Q21A 2GZAA 4M1OA 4BWYA 1GAJA 4A4DA 3X1YA 4JL8A 2A5JA 4GMXA 4JLNA 4ZI3A 4B3XA 2IS1A 2F9MA 1QHGA 5FH9A 2Q6TA 2W6JD 2IWHA 4OJQA 1MO4A 3GD7A 3ASYA 1RYFA 3LLMA 1P2SA 3MGCA 1NN1A 4JLPA 3LFUA 1HUQA 3ASZA 1JJ7A 3OIVA 4ZIRB 1UKYA 1DAHA 1HE1C 1FZQA 1N6PA 1XZQA 4P4TA 8OHMA 1Q1ZA 4C3ZA 3TUZC 1ZD8A 2Q9CA 3KUCA 1CIPA 3UK6A 2QI9C 3KZ1E 4ZKDA 3U4QB 1HH4A 1VCNA 3IKJA 1OH6A 5ANRB 1JXMA 2QMOA 1Z6XA 4MYHA 1PUIA 3AKYA 2K5UA 1FOEB 5CYOA 2RAPA 3AVPA 3SZRA 4DLRA 2FPMA 4HZUB 1NLZA 2CE7A 1FP6A 3DHWC 3OIUA 2DYKA 3REGA 4GI7A 1ZINA 2PLFA 1YR8A 1X8LA 4MRNA 1OXVA 2BC9A 4F4CA 1E9SA 3EZ2A 3QVVA 3QUSA 1OB5A 4B73A 2V6JA 3A36A 3BH7A 3CZPA 3MG9A 4JKIA 2YWGA 4LJ8A 4LY6A 4V0ME 1YJ5A 1NL3A 4JBWA 4LBYA 2F3RA 4TT3A 3RANA 1ZD9A 1G8FA 3LNCA 3DOFA 2GK6A 1ZC3A 1GKUB 1TQ2A 2ZU6A 4TT3D 4B3FX 2JLXA 1H65A 1LFDB 2QY9A 4M0LA 4FINA 5FL3A 2E1RA 3CNOA 2AHOA 2IXEA 5FTJA 4HDOB 3QKSB 1XD2B 4O0MA 4LJ5A 4OK6A 3RLFA 3B1ZA 3K0FA 5JEDA 1QHXA 1VIAA 1Z2CA 2XEXA 4UXHA 4CIDA 3ZVNA 2P2LA 3VMFA 3ETLA 1FFHA 3E5HA 4A9AA 1Q57A 3K1JA 4A2PA 4MGKR 5EE3A 2ANCA 5B58C 4KLNA 1IXRC 3EZ6A 2FF7A 4GT1A 1T0HB 4Q7KA 4AKIA 1WA5A 5CDFE 3FB4A 3ADBA 2P6RA 1Q0UA 2PLRA 5DLQC 1DAFA 4IXNA 2Y8EA 4FMCF 5AWFC 4BEBA 1NY6A 2ZI5A 1OXSC 2RB4A 4MQBA 1Q3HA 2J0QA 1E96A 4CZ2A 2WWFA 3L0OA 1K5GA 1M8PA 2FSIA 3CONA 3KKQA 4ZDJA 3B8HA 4QM6A 5DGXA 3U7EB 4XVUA 4PSAA 4B33A 4AYWA 4DSOA 1D9XA 2XSZA 4W9MC 1AKEA 3FHOA 4US2R 2ZJ2A 2OCAA 2VO1A 2QAGB 3C5CA 4TLCA 1AS2A 1KI3A 4TYWA 2VHTA 3SDZA 3LXXA 1EESA 1KAGA 3RC8A 3ONWA 3QKUA 4GRAA 2AX4A 3D3QA 4LZZA 5KDLA 2OO7A 1Q1BA 4UJ5A 1KDOA 1CULC 2YVUA 3AVUA 2NG1A 1G21E 1A1VA 3THXA 2ONKA 5KU1A 1LY1A 1ZVQA 2BMJA 2ZRJA 4W7SA 2XX3A 5KNBA 3SFVA 1F2TB 2QM8A 5DE3A 3PQCA 3GPLA 3VNUA 2A5YB 1Z0AA 2ZEJA 2YOHA 3PEYA 2XZLA 1G3QA 2AK2A 1KMHB 4A1FA 1GKIA 2EFDB 3UG6A 4JZKA 4OK3A 1E2DA 1TUEA 2BKUA 4CRWB 2VSXA 1CXZA 4C30A 3MUFA 2REXB 3PUVA 5L3SA 3ZZ0A 1DARA 2CXXA 3DMDA 4IEEA 3CRQA 1ZD1A 3OEHA 4RZ2A 3SFZA 3BB3A 1OIWA 3U3KA 5G3YA 1NIPA 5LPNA 5EZ6B 4ZI2A 5CK4A 4MRSA 3TUIC 3QEJA 2HUPA 2XAUA 5TMPA 1Z29A 1IN8A 2OCBA 4I4LA 4W5WA 2BMEA 3U5ZB 1O3YA 4TQAA 2PEYA 3R9XA 5DH9A 2VL7A 4V0KA 721PA 1KKMA 4R7ZA 5IRCD 1RJ9A 3EIQA 1C1YA 5HR5A 2G1KA 4IFBA 1W46A 4M4SA 4PZYA 3FPAA 4TMWA 4BFSA 2Z83A 3I72A 3GLIA 3GJ4A 1AKYA 3FKSD 4L8GA 3LV8A 1KSFX 1IY2A 4BUJA 5EP3A 2CVFA 4E03A 1VYUA 1JR3A 3BFKA 1E2PA 1S0UA 1XPOA 3LA6A 1GRRA 2BBWA 2ASEA 2ZU0C 1P2UA 1U9IC 3R9IA 2ZJ5A 1Z28A 1OF1A 4HAZA 5KYKA 1U9IA 3Q85A 4TQUS 2ZRKA 4OQLA 3V4FA 1Q22A 2ORVA 4WA7A 1NNEA 3QBVA 3SI7A 4AI6A 5F9HA 4AURA 4HATA 1FL9A 1KNQA 3NBYC 4PANA 4WZ6A 3T15A 3VR1A 4DLUA 4LV6A 3B60A 1DAIA 1J8YF 4IKEA 4J0QA 4O2LA 2ZR7A 3EA0A 2BEJA 4G5OA 3TAHA 1T5IA 4PC2A 2CEAA 4OYHA 4EQ6A 2CL6X 3ZIAA 5D3MA 4DHEA 5J4YA 1G16A 3AVWA 3QG1A 1J8MF 2AD5A 4M21A 3BB4A 3L8YA 4GZLA 2WZQA 4JL5A 2OG2A 4A8JB 5SZHB 3GP8A 3HU2A 3PITA 2FDCA 3R9WA 2O8EA 5LDDC 3U7HB 2XNSA 2O8CA 2A30A 3TAUA 4HAXA 2H7VA 1Q44A 1Z6TA 4KV9A 2JJ1A 1SXJD 2C2HA 2C03A 2ZSFA 4D2IA 3IPYA 3BE4A 4N0DA 4XWKA 4Q01A 3GLFE 1SQ5A 2WKRA 1JECA 5KPJA 3PUXA 4TL7A 4AG6A 3P27A 1FTNA 4M2LA 3O8CA 1E2NA 1R7RA 3ZIAD 1U0LA 3R7WB 1VKJA 2W00A 4TL9A 3QPWA 4GP7A 1SKYB 2FMXA 1FMLA 4Q00A 2FSGA 3NXSA 2VF7A 2QRZA 2HXYA 2JA1A 4QG7A 1XTSA 2DPXA 5CLQA 4YMWA 3ECCA 2BCJQ 1E0JA 2PT5A 2CE2X 3AGPA 1TF5A 1CKEA 2OCPA 4UNSA 2VHCA 2ZI4A 2ZREA 3SJAA 4D0GA 2QTHA 2OE2A 2C95A 2VEDA 2P3SA 1RRCA 2O0KA 4BFUA 1NVUQ 1XD9A 4PPNA 4WVFA 3ZGXA 4II7A 3VKGA 1JI0A 2EWVA 3IDQA 4L9SA 2O8BA 1OFTA 4WAUA 2H17A 2ZI7A 1QRAA 3HPRA 4CYMA 4ERNA 4MYTA 3QXHA 3TNFA 1FX0A 2GEDA 4URVR 3EPKA 1D9ZA 1WDTA 2WJVA 3UPUA 4A8JC 1C9KA 3QPVA 2QT0A 1R0ZA 2FV8A 3TK1A 1YZKA 2X8AA 1Z5ZA 3PVSA 5AJVB 3Q72A 3LH5A 2OUKA 2XOKD 2KI5A 1W36B 1N5IA 1P2VA 4E07A 2P65A 5JBQA 1Q1QA 4F7WA 4DXAA 3ZS8A 2ODBA 1VMAA 2IYVA 4B47A 2ZS7A 2PH1A 3I32A 2WKQA 5FTMA 3IO3A 1NVWQ 2ZE5A 3EZFA 1GOTA 3AKEA 1E2QA 1G4AE 1T3LA 4AIIA 1G8PA 2XNDD 4DKXA 2WJJA 4CEIB 1GP2A 5CIQA 4KBFA 3AP2A 4FIDA 4QGGA 1YZLA 3NC1C 5HTKA 2XNDA 5AUPB 1XXHB 2GESA 2VHQA 1V43A 1JJVA 1FPMA 4P4UA 2VTKA 2WPDA 3M6AA 4DT1A 2GXUA 3BOSA 1SULA 5FUVA 5C4MA 3GLFB 1KY2A 2NO0A 2QSYA 1E99A 1M1YE 1DBSA 2ZS9A 3HR7A 3L2OB 3LQQA 4JSTA 4P4SA 4MDFA 2FX3A 4YDHB 2FNAA 1XB2A 4NHOA 2P0EA 1CRPA 1KO8A 3FMFA 4FMCB 1SVIA 1TQ4A 1U98A 1Z2AA 2R6CA 2CCKA 4TLDA 1RIFA 1EK0A 2QQ0A 4F92B 2B6HA 2RHDA 4KHZA 4CW7A 3NDPA 3CM0A 2BOVA 3T12A 2QZ4A 3TSZA 2XZPA 3A1TA 4BZPA 2EVWX 1AJEA 5JRZA 4RJLA 2AD1A 4FMDF 3RRMA 3LXRA 3Q9LA 1QDEA 1NI3A 3L0IB 2NGRA 3SQWA 3K9HA 2VRWA 4EKDA 1T5LA 1AQUA 3DM5A 2ECKA 3B82A 1DS6A 2VIIA 1Z22A 1N6HA 1U90A 3GMTA 4FN5A 4HLCA 5DN6A 1F6BA 1W2GA 4TYYA 4JL6A 4BLOA 3S1AB 2CLCX 2QRNA 4A0RA 5J4LA 1RPZA 4DDVA 3P32A 1W47A 3AF1A 1HE8B 3TIFA 4WXPA 1OH7A 5BWMA 4C0AC 1F60A 4ZCMA 5JI2E 1I4TD 2WV9A 4JIMA 3BAFA 4NCIA 2R6DA 2JDIA 4Q9IA 4ARZB 2FN4A 1OLOA 2G0TA 4XD7A 3QOFA 2GCOA 3QVUA 1XPRA 2WTUA 2Z4SA 4HLUA 3IIKA 2GDJA 1XBTA 1G6OA 2B7BA 4MGYR 3X1XA 3TQCA 1YZTA 3DL0A 5JSZB 2X2EA 1HY3A 4Q9JA 5E7JA 2AFHE 1G5PA 1S1CA 1CU1A 1E2LA 3CH5A 5EXTA 1QVAA 1D6JA 1TEXA 5B2ZA 1IN5A 5K8UA 1VG9B 4B43A 2O8EB 4JSYA 1BOFA 4F4IA 4TQ9A 2GWHA 4C2UA 1P4SA 3D6TB 3W6PA 4OI0A 3IPXA 1OXXK 2A78A 2XTMA 2IWRA 3VR6A 4FCTA 2V4ZA 4DBLC 5D3QA 1CR4A 3L0SA 1SVOA 3KL4A 4I81A 2AK3A 4ITRC 1ZIPA 1R5NA 3BORA 3GQBA 3TW8B 2KWIA 3WY9A 3FMOB 1NRJB 3HWSA 3ZS9A 1G17A 4C0SA 2GXAA 3VKWA 2R44A 3P20A 3P1JA 1SKYE 1EFUA 3R7WA 4DLWA 2ODEA 4UNPA 4EDHA 3JZAA 1IM2A 4IOMA 4B75A 4RFSA 3NG1A 2HJVA 4HLDA 4C4PA 1Z0JA 4WOPA 1KSJA 1TQDA 1N6NA 1DTSA 5FPYA 3VU9B 2Z43A 1K5DA 1IJEA 1ZNYA 3K9NA 1O87A 5HCIA 2ORWA 4F93B 3OZXA 3THXB 1M7HA 3N2IA 1NY5A 1N6RA 1GG2A 3FMIA 2P5TB 2O0HA 3QE0A 5G3ZA 3UMSA 1Q1EA 4ZV4A 2NQ2C 4M1MA 1OYYA 4OBEA 2WBLC 5FOUA 2IS6A 4KFRA 3AF4A 4V0OA 3I4LA 2BCGY 4QBHA 4ON9A 4JT2A 4FI3C 3THYA 3C16C 4TLAA 1ZBDA 3T1TA 1GKYA 4GL2A 4WBSA 4QGAA 3M4YA 2VHUA 4LOAA 4DDWA 4PZZA 5M04A 2O8DA 2ZRGA 3B5JA 4BRUA 4IDHA 2J7PD 5GJCA 3WYFA 2WWWA 4OKSA 1TL7C 3LQRA 2FEOA 4URYR 3QXXA 2DCUA 2EQBA 2CHGA 3THYB 2ZITA 3EW9A 2QPOA 4YMSA 2MSDB 2C9OA 4LHXA 2ZJ8A 1X6VA 3CO5A 2WAYA 1F2TA 1Z07A 4RY2A 3GEHA 1LV7A 2G6BA 4O2RA 3EPJA 5G40A 4DCNA 4PR0A 5SZJA 3SOPA 1A2BA 5HKKA 1UADA 1DO0A 4XSHA 2FSHA 2HDNB 5JWOA 1GDDA 4N3NA 2IS4A 1NF3A 1MRSA 5FTKA 1P9WA 2UVQA 1II9A 3Q8XB 3X1WA 4RFVA 2LKCA 4JVSB 2IYRA 4NYIR 3SJCA 4HZIA 4RSGA 5JHHB 1DAGA 4XOIA 1JQLB 3ZJYA 1VYVA 1JR6A 3Q3JB 4QBGB 4JVLA 1UBEA 2G88A 4KJZA 3AKCA 4BPBA 1A7JA 2XZOA 2NO1A 1TUIA 4EJSB 1ZUHA 1MABB 3QIAA 4B3GA 5BXQC 2QAGA 1RRFA 2G83A 1ZCAA 1R8SA 3AB3A 2JJ8A 4GSYA 4JYBA 2MSEB 1G18A 4D25A 1G8HA 5EP1A 1KI7A 5CITA 2ZVQX 5SZIA 1UKVY 1L2TA 1KDTA 5FR1A 2A3RA 2IUSA 4Q18A 1KK1A 3CZQA 1BIFA 3VR5A 2MMGA 3KXIA 1ZM4A 4EJSA 5JS7A 4DRZA 5KNCA 4QGFA 3IEVA 4KFTA 5CM8B 1G8GA 3CIOA 3WYAA 3OIWA 1U0HC 4ZDIA 1Z0IA 4TMZA 2D62A 4LBVA 4BFVA 1ZM9A 2J3EA 1YU9A 2WJIA 1E79D 2JLRA 5LD2C 2JLSA 3AVTA 1JQJC 2OSBA 2I1VB 4A36A 3WNDA 4LHVA 2RGCA 3OEEA 4RKFA 4HB3A 4KAXA 5EP2A 1R0YA 3VR4A 2FFBA 3FFAA 3SNHA 3QKTA 1J7KA 2BJWA 3CLVA 2H1LA 1L4YA 3OIYA 3D7MA 4OJKA 1KI9A 1D2EA 1I2MA 1ESMA 5BYKA 2J46A 3SJBA 3FHCB 1U8AA 2DBYA 2WAXA 1Q12A 1KI8A 2VP0A 4Q5IA 1T9HA 1EFCA 2GK7A 5DYIA 1OPXA 1XJQA 4Z1MA 1GWNA 5DI3B 4AKGA 1NVVR 3MJHA 1G4UR 3BXZA 2CNWA 5AJXA 5AJZA 4D80A 3S1AA 3SYNA 2PX3A 1CBUA 5JJKA 1ZJ6A 1QHSA 4LSGA 4Q4HA 3AP3A 5LB2A 4PC6A 1G3RA 1KIMA 5HKKD 2ZSEA 2ZJYA 3EARA 3MWYW 4JLKA 5D3MB 3U3OA 2H57A 1DEKA 3FKQA 3AGQA 5BN3A 3REFA 4NYJQ 5FBQB 1XU4A 3CRVA 1OB2A 1FX0B 4Q4JB 1NLFA 1W2HA 3MAAC 5KHOC 4G5SA 4BLPA 2BM0A 1YR7A 2YINC 2BM1A 3ZD6A 3LDAA 2XXAA 2CDNA 2IX3A 5GJVC 5AUNB 2DB3A 1DG1G 3LVQE 1CTQA 3NHAA 4XVRA 3PUZA 2QA5A 1E9CA 2AL7A 2V7QA 2ODWA 1DG3A 2ZYWX 4HAYA 1AZTA 3WHKA 2C5LA 2LCFA 2J59A 2WSMA 2IC5A 2OILA 4TTPA 4RCZA 2ZRIA 3CR7A 4ZKEA 1H8HD 1TAGA 4LV8B 3C14C 5EUMA 2CBZA 4M1YA 1E98A 4LJAA 3BFVA 4KITB 3O8BA 1W48A 1N0UA 2EFGA 2OEPA 1T3SA 2HCJB 3CPEA 1E2EA 1LB1B 3RABA 4BASA 3B9QA 2FFAA 3LX5A 1KJZA 5JS8A 1W44A 5H70A 1A5TA 1II8B 1S96A 2NO9A 3AQ4A 3OAAA 1BH2A 3DEFA 4P3YA 2JJ2D 1OXUA 5P21A 2XSZD 3ADKA 1ZRHA 2DY1A 3QQ5A 2X19A 1G3IA 1N5JA 2NPFA 1D2NA 1E2MA 1NKSA 2J7PA 4X8LA 2GZDA 421PA 3KB1A 2RHMA 4NL4H 5B64A 1P9RA 2IT1A 1E1QD 3BGWA 4B3DA 3UIEA 2YNMA 2YJTD 3C41J 3U44B 5JJLA 2ZRLA 1WF3A 4JLDA 1WBDA 3PG5A 2ZJZA 2C99A 4O3MA 3CF6R 4M22A 2GEUA 3W34A 1TU3A 3CUEF 5CLLA 5FBRB 4D4JA 4TTRA 2ZRAA 1UKZA 3C7KA 1KHTA 3FE2A 4EFLA 4AD8A 4LC1A 1SXJC 1E2HA 5DIFA 2R6GA 4M9SA 4HUQA 2IYSA 2NZJA 2PCLA 1UJ2A 1IBRA 1S1MA 1ELOA 2BJVA 4TN1A 2C96A 1XEWX 2D2EA 2CMKA 1VHLA 2CJWA 2A7QA 1VIYA 1S9DA 2YOGA 3GEIA 3SQXA 2CLDX 3AV0B 1XZPA 5EE0A 2JLUA 4DZZA 1KJWA 2WM9B 1N5LA 1J2JA 1TEVA 5TARA 1KNXA 4C7OB 4LHWA 1X1RA 2ZR9A 4PO9A 2Q3FA 4LUCA 4TWZA 3EZ9A 2D74A 1IY1A 4LJ7A 3KJEA 5TVKA 2QP9X 1JNYA 3QPUA 4LGMA 2KSQA 5J4VA 2JATA 2JIZD 2IYYA 4KBGA 1NBME 4EQ6B 3I8XA 5G53C 4IOKA 1QHYA 2JGNA 4GPTA 4UKDA 4IHQA 3RS3A 2ZPTX 2QE7D 4UJ3A 1XTKA 4AYXA 4B6FA 1OIXA 2R9VA 3HDTA 2ONJA 4S35A 1I4DD 3QNUA 1CP2A 4Q48A 3CF2A 5KDOA 2F6RA 2XOKA 3CWQA 3DZDA 3MFYA 1AIPA 2H8KA 3AVVA 1W1WA 4OHWA 3JZMA 1XEFA 1N2CE 3KJIA 4HB2A 3THWB 3I73A 5JZVA 2JDID 5DSZA 3ZLJA 4KXFB 3LWNA 5HCNA 5IT5A 4LDJA 4G5GA 1WB9A 5AUQA 4D4KA 1DADA 1WQ1R 1RRGA 2W0MA 3OE7A 2VLIA 3EWAA 2QG6A 1N25A 2QGZA 1D5CA 3KQLA 1GL7A 3OESA 5EZ5A 3GLFA 3QKRB 4IDNA 4D26A 3AF3A 3LVRE 4PFSA 3J81k 3BK7A 1R0WA 5JCPA 2PZGA 2QTVB 1E32A 2YZ2A 3FOZA 3THWA 1OH5A 3MWKA 3CX6A 3BS4A 3ADDA 1W36D 2IEYA 4Q03A 1IN7A 3QI2A 4MUAA 1T8TA 5EQTA 2YC2C 3TRFA 1EWRA 1EWQA 4OQFA 2AR7A 3NWJA 1R5OA 2QEQA 4FD2A 3RYTC 4AWXA 3EXAA 1NVXQ 1KZGB 1XP8A 2ERXA 3C15C 2YYZA 2WMOB 4TLBA 4M9XA 3QBTA 1L7VC 1RYHA 2O8DB 5JJIA 5K8IA 3CB4A 2XTZA 5LD2B 4ZPXA 3WRXC 1KK0A 3DPUA 2QU8A 5IK2D 3KQUA 4Q7MB 3N2EA 1RFLA 3OEHD 1K6MA 1W4AA 3A4LA 2Q3MA 2C9CA 4A2QA 3A1VA 1IAQA 2OV2A 4MKIA 1ZAKA 1OIVA 3KUDA 4ZDKA 1YVDA 2JJ1D 2O5VA 1W0JD 1ZU5A 1DAEA 1SVMA 2RGEA 4JJKA 4RZUA 1GIAA 4X8HA 2QUZA 2ZE6A 2ZRPA 1S2MA 4Q4JA 1N3BA 4C0JA 3CH4B 1T4GA 2DFKB 1AQYA 1JR3E 3KQHA 1MO6A 2IF0A 3BC1A 4NMMA 4Q4HB 2PMKA 2AKAB 2C8VA 5B30A 5EE5B 2V1XA 5C46F 1HQCA 2J45A 1E9DA 2WWHA 5K8TA 5GJWC 4Q4AB 4YMUA 4N0EA 1EXMA 1G3UA 3QF4A 2P6UA 4R71A 3RRZA 4Q02A 1E2FA 3CW2A 4OHXA 4OI1A 4NH0A 3RWMB 3SYLA 3IIMA 4CF7A 3BWDD 5GVRA 4B2PA 1KI4A 1LS6A 1TADA 3B1VA 1XXHA 1GNQA 5J47A 5KNDA 2IHYA 1FTSA 2EU8A 3K09A 2XXAB 4G0NA 4GP6A 2YWFA 4BRWA 1VDZA 3PFIA 2J5XA 1SZPA 1NN5A 3GJ5A 3T06B 1R4AA 1MKYA 4U7DA 1NIJA 2A5FA 4LI0A 1T3HA 4IDOA 1OW3B 3VAAA 2PL3A 4QJ4A 4W5HA 1SVWA 2QSZA 3QEOA 4PX9A 3RS5A 4D0LB 1PZNA 5JMTA 4MKGA 4DB4A 2QBYA 1AGRA 1OFHA 1XTQA 1Z3IX 3FYHA 1W4BA 4CDGA 3VKHA 1Y63A 1RZ3A 4ESVA 4DLSA 1T91A 1E9AA 2WWXA 2Z0MA 3UANA 4MYCA 4KU4A 1E94E 1BMFA 2OLKA 2B7CA 2WPDD 4I1SA 2F1HA 2NPIA 2ZYUX 3WNBA 3ZD7A 2QENA 3QXJA 3MLEA 3U7FB 2X77A 4CEJB 4BFYA 1R8QA 4B74A 4BLRA 1UAAA 1SVKA 2GAAA 2WOOA 2CCGA 2ZETA 3W90A 4EPXA 2HLDD 4M9ZA 3K0EA 1ZW6A 4I99A 3AUYA 4PQFA 2A5GA 3VU9A 1GRQA 3IQWA 1VCMA 5CB8A 2XJ4A 3W3ZB 1FQJA 3IQXA 1Z06A 3I61A 3I1FA 4P33A 2YOFA 1GRNA 4GOJA 4DIEA 1HT2E 1MRNA 2WKPA 1MABA 3IO5A 3K0AB 4LYHA 4BEJA 2OAQ1 1OYWA 3PEVA 2XB2A 3WMFA 1GL6A 2OXRA 4IFEA 2IYWA 1ZM7A 3MCAA 1VTKA 4B2IA 5J40A 1F2UB 3LD9A 2J7KA 2OCYC 2ZI6A 4OHYA 3LW8A 2V7QD 3CRRA 2YKGA 3W3AA 4JMPA 1JXOA 2YC4C 2Q3HA 4ACBA 5C4GB 1Y3AA 2HV8A 2PX0A 2ZYVX 3T1OA 1XX6A 1ZCBA 4XJXA 3V00A 1XD8A 1BO6A 1LS1A 1F5NA 1N6OA 4DVGA 4YQFA 5CDFA 3FKSA 3L0PA 2RGNA 2FPKA 2WMNB 4G01B 4AKHA 1NJGA 1G19A 1T0JB 1E3MA 1WMSA 3OEED 3TR0A 4ILEA 1E2GA 3NIBA 1GITA 3Q7QA 4MGIR 1CLUA 5H8WA 3UATA 4JLJA 2HYIC 2IL1A 3AF0A 3DVLA 1QZXA 1HTWA 2WSSD 1X1SA 4QNMA 3MWJA 1UM8A 3KDSE 4QJ5A 3U60B 1N5KA 1OFUX 4HAVA 3EC2A 4RFSB 4DUGA 2G1JA 1HA3A 1XEXA 3UMFA 4Q7LA 5KPDA 2WJGA 4C9BA 3X2SA 2NZ8A 2A5DA 1NMXA 1P2TA 2GCOB 1JAHA 1SKQA 3U7GA 2IXGA 1RRPA 1E4YA 1TF2A 5HE8A 2OBNA 1GZSA 2Z5FA 4X8OA 2G3YA 2GCNA 2EYUA
chains in the Genus database with same CATH superfamily
4KAAA 1LQTA 5EWMB 4O6VA 2AUMA 1JLKA 5ECYA 1SCQA 1QLWA 1SZDA 5CPFA 5TPZA 3UJ7A 3RBXA 4L0QA 1KJ8A 4PC7A 3MPOA 1I9GA 5AVWA 1E9FA 3AM1A 4DUGD 2OCIA 3IEUA 5EOVA 2H18A 2FN7A 2WSLA 2IRWA 2H2FA 4C3VA 3ZY5A 3K2QA 2HDWA 3WFIA 1TT5B 2ARKA 5BYBA 4BMPB 4JC8A 1KAOA 4LSZA 2AN3A 5JY6A 1S9HA 2BBSA 2HA0A 3SZ3A 1ACJA 4U7TB 4AO8A 4CM6A 1OKKA 1AKUA 2J5RA 3CIFA 5A9SA 4CM9A 1QZTA 2W4QA 2W0SA 3HI4A 1JFRA 1VKOA 3G7NA 1JA1A 2HWXA 2EBHX 3HYTA 4WOBA 3TKLA 3SX2A 4B6SA 1W35A 2ZFUA 5IAEA 3CV3A 4FGKA 4GMDA 4P86A 4FB4A 3ICPA 5KVVA 2O6HA 1Y8CA 4BQFA 4S24A 2FZLA 1ISHA 2WP8J 1KSHA 4IHJB 5JAQA 2CMGA 3G1WA 3EUEA 5I9LA 2GN0A 4XWWA 5H5JA 2KQUA 3ZV7A 4EZEA 3WGOA 2I91A 5IFKA 2EYQA 3B3QA 4C0BA 4YJFA 4AF7A 4TMFA 3P9RA 5ES3A 3KPVA 5TVGA 4HL6A 3JX9A 1SVSA 4BMXA 2GBFA 3MSXA 5ALUA 2Q3BA 2FWMX 2HB6A 2IY7A 3G2JA 1SUFA 3W8RA 1TQ6A 2JASA 4RMJA 1ZGCA 3RRYA 4G5XA 1ZSYA 3IP1A 3HPQA 3IV9A 4LJSA 5AJUA 4Y30A 3S40A 3U61B 4UHBA 5HVNA 1FS4A 1F20A 1E1RA 2WHQA 3PPIA 3VHXB 2B69A 2YNMD 2Z2IA 4NCKA 3WISA 4JC0A 4H77A 4NAUA 1P60A 1J1IA 1FMTA 2GJ8A 4PLVA 4EF4A 1HMPA 3D9QX 4KI0A 5EKXA 4I5EA 4WXEA 4AKEA 4TYPA 3WMXA 4ZDWA 1NFRA 4UEOA 5TDHA 5SYNA 2Y4OA 1LK7A 1PDVA 1DBWA 3DMTA 4UDNA 4EW3A 1A9XA 2QQGA 1C9MA 3LRPA 1JE1A 1V16B 2W6NA 2H1VA 2V59A 2FJUA 2HPHA 3QSGA 4N3GA 5E7QA 4C0LA 3R8FA 4G0YA 2JI4A 4IMJB 3N59A 2Z98A 3W2GA 1CQJA 5IAOA 2FZEA 5AHRA 1COWD 1G7RA 3PD7A 3BZWA 3E5RA 2WT8A 3IMFA 4AF6A 1M2JA 3DAHA 3PZRA 1A1SA 2O2YA 2IHTA 4NBVA 3K9LA 1KDRA 4LF7B 3JQGA 1S8AA 1N0VC 3BMNB 4P7BA 1LF0A 4RD0A 3T8YA 5LWHA 3UJNA 1TZ2A 3QVGB 4M37A 4HPWA 3CXUA 4DJFC 1R0SA 1GA6A 4Q9NA 4OGWA 3HN7A 3LHSA 4OMDA 4JASB 1RHQA 3H42B 3R5FA 4M9QA 4BNNA 5DYWA 1D6MA 2GPTA 1PJ4A 2ONYA 2VPPA 5KTMA 3GLUA 4K9DA 1ZJJA 2WHXA 2VSYA 4LA4A 2B1IA 4FHFA 3U7JA 3TOSA 5BNIA 4E13A 3ZXSA 4C0HA 2ZKLA 2ZYGA 3AIMA 3NWBA 3M4NA 4ACAA 2XRZA 2KBFA 3FPHA 3KOMA 3R74A 3SR3A 3VTAA 3R1IA 2ZK7A 3G1UA 3PGJA 1UZNA 3K0AA 2JCSA 2IHNA 5SY9A 1SPXA 5EN4A 2VBIA 1XQVA 5C2JB 1UZAA 2PJRA 1YNSA 3LTNC 4JVMA 4NZYA 4EQZA 1O94C 4HQKA 2GHTA 5L4SA 5HRAA 2OXCA 2PNJA 1E7SA 1F2UA 2H00A 3VYVA 2C7OA 4FFOA 4BKMA 4D3SA 3ZE2B 1J06A 1FTYA 2BM9A 4KZPA 3K92A 1JXAA 1ZLXA 2QAIA 2P1ZA 3AONB 3V4LA 4BBJA 5LKRA 1P29A 4WBXC 3RYFB 4DCVA 2H2DA 2Q0QA 1TZKA 1V5WA 2ZTHA 4Z9AA 4AVYA 1R37A 1ZVMA 1Y9EA 3WGZA 1GTL1 1T3ZA 2JFGA 5AI8A 3K70B 1JHZA 4P3OA 2P4UA 2W2TA 4KTVE 4X61A 3MMSA 5D6NA 3C7DB 4YCCA 4YQEA 4RA6B 4D02A 1K0FA 2I5PO 3FDFA 3TLXA 3URMA 1FMFA 4ZXPA 3WJ2A 2FYTA 1OWLA 1PQUA 4CL8A 1L8XA 4P53A 3A4YA 3DZCA 1OMOA 4KQWA 4G81A 4I50B 3BEDA 4N4AA 1FP2A 2ZBGA 4IYJA 3TG2A 3NTXA 4GXNA 3ME5A 4CG0A 3NTUA 5E2AA 3OCJA 4Z2YA 1JLSA 4YRPA 3DZBA 1CUEA 4A2WA 2J3MA 1MJHA 1NATA 4G4JA 1N57A 3DV0B 3I6IA 4N54A 5TGTA 4F9TA 4YMTA 4HDMA 4OHPA 1M34B 4BP9A 2AC2A 3PUJA 1ES9A 1UBGA 2KLBA 3FGPA 1L4GA 3UKDA 3BWCA 1UOPA 1V6AA 1GPUA 1OTYA 2D0OB 2FN9A 2XVZA 3A1UA 3NHBA 4HWKA 1N1GA 2AMYA 4MVJM 5EGSA 1LSSA 1W52X 4REQA 3VOBA 1KEWA 3OBIA 2CNOA 3CUWA 4MP3A 3V1UA 5IS2A 1XTUA 3CX8A 5JFTA 1IJBA 3Q7RA 1G6Q1 2N75A 4MITA 1JLRA 4EGCB 4GRDA 3DMYA 2WQ6A 2Q45A 4DMMA 2VYNA 3BIFA 5KSZA 3RVSA 4G1CA 1SR8A 3I52A 5DVZA 1K06A 3D2AA 1M75A 2Q6IA 1G20A 1PRYA 3QBDA 1JEOA 4INPA 4W8GA 3CVXA 4B35A 5BXYA 1S7CA 1PTJC 3E5MA 4QYIA 3HP1A 4R3WA 3K35A 4M86A 1JTEA 1K4MA 4G1MB 4FI3F 4K6GA 4OHRA 4Z4FA 2KM1A 2Y2UA 4MVJH 2F64A 2X4LA 3ZCUA 5FV4A 1XTVA 5BSWA 5CB0A 3RC9A 1ZL2A 4A6EA 3FPJA 5PNTA 1QVVA 3L1IA 1XHLA 1U0OC 3DDCA 1EGVB 4KXNA 2ATXA 4H6VA 4QXOA 2DFLA 1YQQA 1HQYE 1QC5A 2BAGA 2WF6A 4IBOA 3UCXA 4DDMA 3CNNA 4E51A 4HAIA 1QNFA 4Q6BA 2DHCA 4BIIA 4RPHA 3DHEA 5KNBH 1RD4A 3TL3A 2IPNA 4BVJA 3RTCA 4YCMA 2FR0A 3G8DA 2IU4A 1HYEA 1M2EA 2IYQA 2VNHA 3L0DA 1VCIA 4LQDA 1KMNA 3MMXA 5TF0A 2BBTA 2HT1A 1I10A 1AGYA 1U8TA 1ZUIA 4YRBA 1NOIA 1XLTC 2VAXA 2W6QA 4QASA 4XWOA 2J0UA 2Y76A 4GC5A 3QLTA 2WTAA 2WHPA 2OFXA 4Q1DA 5EHGA 4EPYA 2WWIA 2B37A 4PQGA 1YRBA 1B8VA 1RYNA 5JNSA 1FP4A 2W37A 4GOMD 1KI1A 4WZZA 1Z7WA 5F3RA 4EUKA 1EPUA 1GNRA 4ZZ2A 3M89A 4QBIA 5SICE 5HJ5A 1NQUA 3TG8A 2D13A 4JHLA 5I7RA 3EAQA 2F55A 2WUFA 4ARSA 2CVOA 1Z47A 5LZ5A 3JVUA 1X70A 5ED4A 2OHXA 1WHTB 2VUIB 2HPZA 1U9YA 2GA9A 1VCHA 5CGZA 3VSEA 5LLDA 5FO1A 3GEEA 4DCUA 1M9NA 1YR6A 5L53A 3WK7A 3HVHA 1UKCA 3KZMA 2VCEA 3LUGA 4UM7A 1AK1A 1K4YA 2VDWA 2JJ2A 1PTKA 4ENUA 1R12A 1P0FA 4GGPA 3A26A 3GZ4A 1W581 1XG5A 1S3SA 4CCAA 1EGAA 1N77A 4YRQA 2XOXA 2JLBA 4XGNA 1W75A 2D1QA 3CE9A 4M46A 5ALEA 2PLWA 3FXAA 4HSEA 4DBLE 3VQTA 2QWXA 5HOQA 3ESXA 4WNIA 2EBWA 4JR0A 2ZWAA 2OHJA 1MIHA 3DDWA 3IXMA 2PRSA 2VP4A 2Z2ZA 3OQ1A 4X62B 1VG0B 2ZYSA 5IJWA 2ZDQA 2D1FA 2FWPA 1JR6A 4QOSA 3LAWA 1OHHA 1C14A 2VYND 3GN2A 3TIIA 4PWZA 2A0XA 5ARBA 3B6ZA 3H11B 3W1VA 3H1AA 2DFVA 3RE1A 3N2KB 1CJBA 3LMKA 5JXHA 3T1QA 4NQZA 1UXGA 2DBQA 1AXGA 3V55A 1ZHFA 2JKZA 3Q0IA 3KVNA 3RFXA 3LA8A 5D86A 2V4MA 2VOEA 3KKMA 1G20E 1GKLA 1WOMA 1XNJA 4GRIA 4LRYA 4RJJA 2X0KA 3HUFA 2VSOA 4E0BA 1TD9A 1IOWA 1RJWA 2ZUCA 4GVLA 2I4OA 4PG5A 3FFBA 4TROA 4YJ2F 2ZE8A 1VQ1A 3G7UA 1QKIA 3KJFA 3IP7A 3OM0A 2BGWA 3GJRA 3UGQA 4D9FA 1AA9A 2OHOA 1HL3A 4JOSA 1P1FA 2SCUA 2D7CA 3JY6A 4H27A 1WZEA 1PVOA 5CJPA 3OAAD 5L51A 1SURA 1I3LA 2XKKA 2CHEA 1PW7A 4HJXA 1JEDA 3V42A 5IULC 5LXTA 3KRTA 1E9EA 4FU0A 3B9RA 3V9PA 3KFXA 4LVNA 2GN4A 3VDMA 2Q9AA 3B9BA 3JYNA 3SS9X 3KR9A 2B83A 3FZEA 5IJXA 4X3OA 3DDHA 3R4CA 4CETA 2HF8A 5U9CA 1HWYA 3G5UA 4DDHA 3LRTA 1T8SA 5JASA 5ADVA 1KO4A 4DABA 5KHLB 4HNQA 2EW1A 4G0ZA 4Z9FA 3K31A 3ICOA 1YS4A 4AX8A 2R6FA 1M34E 1U9ZA 1XZKA 2Z2XA 3G2MA 2BI8A 2CFIA 2FETA 2MSCB 4TS1A 5COBA 5C34B 4FGJA 3SF8A 2GUGA 3FNEA 3BWVA 4EGAA 4KPEC 1J7JA 3DUFB 1SHZA 4JQOA 4Q4LA 4WNCA 3TQSA 3UO8B 5KOHA 3DC7A 3ZHXA 3I5UA 2BMDA 2XGGA 5CG1A 4DRYA 5J58A 3I5YA 2F17A 3RADC 3LZ6A 2A14A 1DAMA 3AUAA 4U2KA 1NZJA 2HZ7A 4C6RA 1M7GA 4PG8A 2GCIA 1N2EA 2Q5FA 1RJGA 3LF2A 4ZQFA 3ADOA 3F7NA 5LFAA 2HBYA 1T15A 3WGKA 3HEBA 4W5NA 2GZSA 2BPOA 5J63A 3QG5A 3N3AC 4B4VA 1UEIA 1C1HA 3IEPA 1LBIA 3JYPA 2R86A 2VJCA 4OK5A 2X7HA 1KAHA 2XI4A 4LS3A 3E0XA 5AVVA 1GHTA 4DV5B 1NI4B 3U16A 3P96A 1H2AS 2V7XA 5TXGA 5EIXA 1NP6A 3I09A 5DHSA 4CLXA 2UDPA 2EATA 1TYBE 1GFZA 1YB1A 2CCJA 2G40A 5BORA 3GLGE 3NANA 3BDIA 2WFZA 1A9RA 1Z0ZA 3LT0A 4MS1B 4RACA 3NKVA 2QQEA 1J8FA 3DTYA 4MKZA 2Z8ZA 5A5DA 1O95D 1G41A 2Z3VA 1VKZA 2AKEA 4RTJA 3A9CA 5H1YA 4KR6A 2Z5LA 4QFMA 2WJYA 1P31A 5JFGA 1PK8A 2EDCA 2VG8A 5JI3E 1XJ0A 4E4RA 3NW9A 2XB4A 3D4LA 3V1LA 3O21A 1J90A 3D81A 3WQQA 5LN1A 2IQIA 2Q4TA 1ITZA 1RVV1 3GFGA 3QU5A 4RJKA 3RHZA 3E70C 4MLZA 2XIQA 3DEKA 3D0QA 4OYRA 5KTYA 2PA3A 3LBYA 1GUAA 2J9FB 2OGTA 3NRCA 4PRYA 4OF4A 3T3DA 4AWBA 4ALLA 1Z68A 5L45A 1XZMA 4TKUA 1YVPA 4E2FA 1LF5A 3Q6IA 1NW3A 3QFRA 2YV4A 4NJMB 4PGHA 5FIUA 4HRXA 2MYUA 1DHTA 2D3TA 3B7WA 3UW3A 1GAXA 5JXGA 4DUPA 1UF9A 2XTAA 1PE0A 2WIJA 4ZGBA 4V0MA 5IJ0B 5ALGA 2NTYC 5DBIA 1RC1A 4M99A 1K3UB 3SE7A 2GFIA 1VDMA 3QOYA 5IFLA 2O0MA 1EFVB 2CJXA 3MS7A 2VP9A 4K05A 4MDHA 4N5DA 1PS0A 2D7JA 5J4KA 2RDMA 4JEHA 4KIFA 5L40A 4M83A 2O5CA 4TMYA 4R1UA 1WEHA 2FG7C 2EFEB 3MJSA 1PJ2A 1RHJA 2CK3D 5SY6A 5K7SA 4RH0A 1AT1A 5ECDA 5ESWA 5C80A 4EPWA 3F5FA 3QJGA 3EOBI 1QF9A 4NTZA 2OHHA 3A4NA 2QBYB 2C97A 3NNDA 1YV9A 1L4UA 1JPNA 3QEMB 3AVXA 1U5AA 3FAKA 5CG2A 3LBIA 3W8EA 4Y9UA 5A6SB 3OCYA 2P41A 4JXZA 3KKKA 3WC4A 1ISFA 3KXLA 2G0NA 1BMTA 2BKXA 2CVQA 2ZRDA 3RJZA 1Q0HA 1NBIA 2PX4A 2I87A 1FMJA 1BMDA 3BJRA 1Q0TA 3I62A 1KJIA 1MEOA 3BIXA 1YCGA 3GARA 1CUHA 2FN3A 1H05A 1W6UA 4CEJA 2HW8A 3FZNA 1PUXA 4H1HA 5EZYF 5A1TA 1X15A 4D4LA 3WLNA 1OYVA 1ZMXA 2CYAA 2FHSA 2PQMA 2C78A 2DFNA 4NDAA 2B8WA 4E5DA 3MT9A 4CTMA 3K70D 3ZHCA 3OZRA 4R6WA 5EE9A 5E6SB 1WY7A 3QWBA 1R0KA 3ZQ4A 1MGOA 1ZCZA 2I78A 4YA6A 5SYAA 2VKTA 4DANA 2IQ5A 4MRAA 4MA4A 2V55B 3WA6A 2XRYA 4AJIA 4WK6A 1C8LA 3KQTA 5TV2A 1DIRA 1F38A 4X71A 2VPIA 4MULA 1WUJS 4UFPA 2CUNA 2PJDA 3C7AA 2ZXFA 3F96A 4JBIA 4DMLA 3MJTA 1H4TA 3JQAD 3WK5A 1J2YA 3L49A 5IBPA 2IE8A 4MSUA 5TGZA 1JKJB 1Q77A 1QRDA 4X8MA 5A03A 2X6TA 3B51X 3VOSA 3EHDA 3W8NA 4N76A 5C7YA 2XQGA 1J1ZA 5CHEA 2DBZA 4QHTA 1EHCA 2C84A 2PWZA 2X58A 4MKXA 3E03A 3STWA 4FNAA 3F3YA 4L0MA 2Q62A 1L4KA 1OI3A 2QKYA 3ZHVA 1P91A 5B57C 3MLAA 4P5PA 4DCTA 4B3JA 3PI7A 4ERXA 4EH1A 2H2AA 2H51A 3BDVA 2JD2A 4GMKA 4HEQA 3TI7A 4ZYTA 1PLKA 3NTRA 4ID3A 4D3XA 1GNPA 1BGWA 3ANSA 3ELWA 4W1RA 4EJFA 4DG8A 1Y4UA 3P2YA 2NWQA 2DHQA 3JAWB 5GONF 1H2FA 4OQPA 4JODA 3NBUA 2Z3WA 1A77A 4CJXA 1U31A 3UCEA 5C5IA 1ODJA 1C3EA 4OSEA 2GBGA 4NESA 4V03A 1Z6YA 4PXAA 1YONA 3QSYA 1FEZA 1TU4A 1R10A 1VI5A 2Q3JA 2B4YA 2VCHA 3ABSB 1ECCA 1PL7A 3ET4A 4JP2A 1A2KC 1LU9A 2IIBA 4YT5A 2AJLI 4XYGA 5J5VA 3OPYI 5CW2A 5HYVA 2W83A 2OOKA 4JB8A 3E82A 4FMDB 4ZO6A 5H68A 4P4NA 3BRCA 3V7WA 2GJKA 3QX7A 1I3NA 2COEA 4ND3A 2XDWA 4CT4B 4K28A 5JEEA 2OT3B 4HTFA 1F9EA 1TDJA 4RANA 5E3IA 4CVNA 1YFJA 1ORDA 3H2YA 4AZSA 1XDZA 3HWRA 4LHEA 5CCBA 4JLMA 5HBRA 3RC3A 1USKA 4FT2A 5EXPA 1RT9A 1VECA 2X8WA 2I4IA 3RWOA 1F1BA 4AICA 2YFYA 4OQXA 4DSAA 5A9RA 2BP7B 2IA5A 3G0CA 3OX4A 3Q3GE 4N5MA 3C3CA 2NT3A 4MQUA 2RKWA 1FW6A 3UUEA 2JGDB 3GNLA 1M1UA 3P4YA 4JVNA 1EUZA 1JZTA 1XOIA 5JPCA 4HWTA 3S4YA 4TV9B 2W8BA 5BSRA 1G8YA 5BOVA 4Y6LA 1M6NA 3W6ZA 4JT4A 4PSDA 3ZU2A 4X66B 3ZI4A 5FUBA 2DC1A 1JHRA 3OMXA 3OQVA 2BHSA 1JBQA 2YW2A 3DHVA 4NCNA 5C9ZA 1AO3A 5CM9C 4FWTA 1XJCA 3SDSA 1K86A 1ODFA 1YE3A 2W70A 4BECA 1AQLA 2G67A 4J91A 5CX4A 1ZESA 3TXYA 4BMOB 4HY3A 1IK6A 1MA3A 3L6CA 2VQ6A 3GELA 1KTVA 2H5JA 2HQBA 3AJDA 1YI1A 3NDRA 3NDIA 4MVJF 4UBNA 4ABYA 5BSFA 4AQ7A 3UMCA 4EOGA 1CUBA 2GWRA 1X14A 3BERA 3G0OA 1L0BA 5GIOE 3EN0A 4Y1RB 5THQA 1B6TA 1G63A 3FGNA 4B48A 1THMA 3WNZA 4URUR 4TWAA 5J5CA 3CLTD 3IHKA 4HXEB 1FSFA 3ODPA 4KQEA 5LA6A 2QVYX 2VHZA 1CDZA 3R3XA 4IDPA 4PG4A 5BN5A 4MQFA 2ZYTX 2ZUDA 2IS2A 5JNWA 3VJRA 1TC2A 3MYRA 1WRBA 1TM1E 2B82A 4QULA 4FYXA 4BWVA 2WNHA 3KB2A 5LJIA 1I3KA 2FOLA 1OA1A 4NU8X 4LVCA 5H0IA 4ZO9A 4TMKA 4K6CA 5B2FA 1XVUA 3RFVA 3K1TA 4BLWA 2BRUA 3V8BA 5HMMA 1AF7A 4FFDA 2QUAA 1B6SA 1KMHA 4J2OA 2XJ9A 1QHIA 1L5LA 3ZWAA 4NYMR 1ADJA 4HNVA 3HC7A 4RZXA 1OXTA 1PS8A 4GF5A 3EXHC 1K66A 1GU0A 2HEIA 3JWHA 1XZIA 2OWDA 2XITA 5LQCA 5EFOA 3HXQA 3S3TA 3FYUA 1WEKA 4QPCA 4MHSA 3U9TA 4KIWA 4PO8A 3BF7A 4OL9A 2UUBB 3TLZA 4YAKA 3LI2A 5ALVA 1M5TA 4FKMA 1Q0ZA 3HCPA 3D3WB 4F86A 2Q99A 4QKQA 2Q1WA 1ZAYA 4KVGA 4AJNA 3AVYA 1YU6A 3F0TA 2Y0CA 5P8WA 4BO9A 2HRRA 2Q5JA 2G04A 4G1VA 2L82A 1A9QA 2B6NA 2IHBA 2FKAA 2FWNA 3NHKA 1ADYA 1VC2A 2B3DA 2UVDA 1E0SA 1KYYA 2W90A 4MV6A 5HIIA 4ZJPA 2ATVA 4X5OA 3IKMB 1E9RA 5ITWA 5HDQA 4KWIA 4DW8A 3GZTB 3QENA 2VSFA 3VO1A 2HEGA 1GRCA 1UKEA 3FX2A 1LW7A 4G5HA 4TTSA 5JR3A 3COVA 3T7SA 5CLGA 4HWSA 4OIMA 1ZHOA 2RCNA 3OX1A 4Y2TA 3WWZA 3ESQA 1FTWA 1NXPA 1MVOA 3IILA 2EF1A 4BFWA 5EMLA 1JLLB 1XVLA 5I9MA 5AW2A 5JNLA 1FNSA 2PL9A 5GM1A 3A6LA 5EWLB 2P30A 2QTMA 2RGGA 1HYQA 4BNFA 4FYKA 3EODA 2CD7A 1ISMA 3KALA 8MHTA 4YP6A 4YDQA 3CPJB 4WFIA 3GLHE 4EO9A 4RVSA 4XJTA 2ZGVA 5D1NA 2W2QA 3VV2A 4CIVA 4BNUA 2VF5X 1U0FA 3IDAA 4J9VA 3B1KA 3MQFA 1SC1A 3FHLA 3G82C 2C2WA 3U5TA 2GAJA 2YWBA 3AHJA 3ICVA 1G8KA 3OZWA 4P82A 2IJGX 1T8YA 2IY8A 2XCOA 1VPVA 4XVQA 2UKDA 5CLHA 1W96A 1C41A 3A3NA 3V8EA 1C0KA 5IYZB 4WKPA 3MQ2A 1XFDA 2J3QA 3FWHA 1WDMA 4MVYA 3LNTA 4O4IF 3IEIA 2IEBA 1CDDA 4P0PB 4QOGA 4BFXA 1EP2B 2YBDA 1CX9B 4ND8A 1HFKA 2JJQA 3PE6A 4TTTS 2HQRA 4GKVA 4BUCA 4NK4A 1V4BA 4PHGA 1QBKC 5K4AA 5K0CA 4J7UA 1ODIA 1GCUA 2P2ZA 1DAOA 3AFGA 4Z0TA 3ROKA 3RS8A 4DMRA 4DCGA 1VMKA 2NO7A 2X8JB 2QN6A 3II6X 4OH7A 4UHDA 4F6RA 4GOKA 5H3HA 1PNTA 3DFFA 4PG7A 3AVQA 4W1QA 4M87A 5FFNA 2B0CA 3CX7A 5JVDF 5KJ1A 2DLCX 3HK2A 2YV5A 3C4JA 3QUQA 4QUHA 3GVXA 3A9WA 4UDXX 5EIBC 2OGUA 2QN9A 3K1YA 3TLGB 2WHRA 2GPNA 4CF6A 4JBXA 1VHJA 1D8AA 4HLUC 2ZSHA 2GNPA 2IDZA 3UAGA 4CM1A 1DT3A 1P5ZB 2H92A 3HKDB 2JB9A 4YY3B 2PMEA 1WW3A 4V0RA 1F0YA 2W93A 4V0NA 5JI2E 2IP2A 1XO1A 5B3KA 1PSDA 4P32A 3AEKB 1SBHA 4M89A 3VSBA 4MR8A 4LECA 3HA3A 1WXQA 1RXUA 2DU8A 3UYKA 5K3FA 1ODKA 2IHJA 5DOZA 5KO2A 2PWYA 4F1WA 3BGVA 4CNBA 1UOEA 3I9V6 3TDMA 2FGJA 2HAEA 5F1OA 2E4WA 5I7EA 3PHGA 1JU3A 3NB0A 5LYJA 3ZW9A 1F3OA 2PIAA 1HTTA 4P4SB 5CJ2A 5A7GA 5BN4A 3QVXA 1DE0A 4QARA 1W4RA 5EIAA 1Z63A 3PV0A 4G23A 3DTVD 5JU6A 4HS4A 3NHMA 1M6VB 3OQPA 3PVZA 1PJ3A 4PU0A 4QRHA 1XCGB 3DFZA 1GUDA 3IUSA 3NBZC 5K3FB 1M2GA 3EZXA 3ZV6A 4MR9A 5CA1F 6Q21A 4YFYA 4JROA 1U2EA 4ZCIA 4PX2A 5DULA 5IVIA 1LDNA 1ZVVA 2HLDA 1JSXA 1YD7A 3QKRA 4JI6B 4LF5B 3TRDA 4WNYA 1MEJA 3LPCA 4BVLA 4MUFA 2YCLA 5A0FA 4ZTZB 3E0QA 2J32A 5EXSA 2YZMA 1FBNA 2E82A 2RK3A 3SN6A 4H0NA 3GFSA 3KSDO 2AFIE 5DT2A 4JOCA 5T6MA 3KYDB 4J0HA 4JNKA 1J70A 3L3BA 5IM4A 3T4PA 3PFKA 1R9MA 1J42A 3ZEAA 1DKOA 1SOVA 2XMRA 1A98A 4WE3A 3C97A 4NS4A 3ZQ6A 2H5EA 4GWLA 4YI3A 3UK0A 3ZLTA 4BHTA 1G60A 2R8OA 4JJ6A 1MCZA 2VUSA 3TB6A 2QTNA 1R0LA 3MBIA 3K6SA 3JQFC 4B4OA 1BYIA 2FLKA 4RK5A 3RF7A 1JL3A 3W9UA 1YBVA 4AM8A 3MB8A 4G24A 5GONB 1W7AA 3GT7A 4R3NA 1SXJA 2XMPA 4FMBB 3WMGA 3JASA 4P1ZA 5F35A 1H4SA 2IEZA 1L7RA 1SD2A 3LL7A 2G70A 2HJ9A 1Z2NX 2G17A 4BLSA 5BV0A 3KVOA 1Z4JA 1LW6E 3QF7A 5KINB 1T6XA 2FAXA 1SHUX 3OFND 1ONBA 5F7XA 3PRHA 1BVHA 3V7UA 4KWEA 3GJ0A 3EK2A 3B48A 3K5PA 5DI9A 4HGPA 5FWXA 3ZOKA 3D1JA 4MRPA 3HE3A 2J30A 1SCIA 3GRYA 3FTCA 4CFYA 1UPCA 4X41A 1V3TA 4Q1BA 4UNQA 2IYXA 2QP3A 3B13B 2J3JA 5L3RA 4AULA 2BFWA 3P7MA 4WKNA 1PFGA 3CRMA 1Z4IA 1E1RD 1P77A 3MJRA 1QCZA 1K7EB 3PRJA 3EJWA 5EIWA 1E3IA 1QHHA 2JGAA 2VDWB 4LV5B 1PSZA 3H9UA 4N9WA 2IP1A 4J49A 4RZSA 4WINA 4ZT3A 3ZCTA 5B4UA 4P38A 4X3PA 1F2VA 2BEUA 1O94A 4IOJA 4MJXA 1XA0A 3M6LA 1XZHA 2VUTA 3FYSA 4RPLA 4WOKA 2YMMA 5K01A 2ZJ7A 4G0VA 3T3OA 3NOXA 4P54A 3I53A 3HCEA 1AF4A 3HU1A 4RL4A 1U3DA 5THKA 4BX2A 5FWDA 2CJWB 1N2BA 1KK3A 4KFSA 5JDCC 3AFOA 2PWBA 4HAWA 1QDLB 3GJSA 3LBHA 4B32A 1CY2A 4PLFA 1DKUA 1O89A 2FEAA 1TX4B 3H11A 2BMWA 3KB6A 2Q4OA 2XMCA 3CLRC 1TM5E 3KKNA 1P1IA 4NICA 1MPTA 2J0UB 1VYHA 3PGVA 5FLYA 1H6DA 4ZN6A 3DBOB 3PUYA 2FP4B 4MROA 1IN6A 4J07A 1U9CA 4EKYA 4RORA 2I6SA 1ADBA 2BDEA 1OLXA 2CNWD 2WHEA 1V7ZA 1FP4B 3T3NA 2ZSKA 3MD0A 4Z7OB 3WLAA 1JE0A 1U4OA 3OKFA 4RGBA 5AJTA 1QG4A 2RGBA 2VT6A 1TEHA 3RVRA 1WPQA 3T3GA 1KFJB 3V6MA 2E37A 1UPAA 3STUA 4Y3UA 4EENA 2REQA 2R47A 3E4DA 3L7AA 4FUQA 4HT3B 2ASVA 2EL7A 2J85A 4GYYA 2YJ5A 3WE7A 1UAGA 1C7EA 2AXNA 4C4RA 3KEOA 1X3SA 3HL4A 2GYVA 2RI6A 2QW0X 3U7QA 1EUQA 4E2YA 2AOUB 3QWFA 2Z8YA 4RQBA 1CY7A 5HKAA 1D6NA 3FPKA 1TJ5A 1E60A 5HE9A 2PU5A 3PFGA 4UTOA 5TY0A 1IXKA 2VFAA 1FDVA 2IOFA 1GQQA 2PJUA 2QDKA 2IPXA 2ROQA 3PF8A 3RIEA 1YZQA 3TQQA 4IXMA 1MUUA 1PLJA 2RGYA 5IYZF 1XN1A 3CLSD 2FWJA 2NXJA 3O74A 3RD5A 5J2TB 3JQEA 2CDRA 3V8RA 4OXXA 4ETMA 2NO6A 1NAIA 2GNOA 4CTJA 2GBLC 3DAPA 4IGAA 3MMZA 2R7LA 1AMNA 3SEZA 4ZHQF 1P3Y1 4Q21A 3H65A 1J0BA 3EYWA 3G9QA 2JFWA 3F78A 4M1OA 4ZVQA 3WIOA 3BMQA 3ZTWA 3PA8A 4UHHA 1FFAA 3SD7A 1MJGA 1ECPA 2RHTA 4JLNA 2Q8PA 4ZI3A 5JW6A 2Q4RA 1JMVA 8AT1A 4B3XA 1XZJA 3PSHA 4MARA 4GSLA 2Q6TA 1QP4A 3NT4A 3GD7A 3NYRA 4PTZA 1E7QA 3JD2A 1RYFA 3W2FA 1P2SA 4O4HA 1E5QA 1H9CA 1QVZA 1KZ4A 3LFUA 3WZ2A 3LHFA 4O4JB 3EDMA 2XZTA 1GLGA 2FTKE 4PBTA 1IVNA 5E9AA 3WL5A 1UKYA 3RRBA 4P4TA 3RV4A 3EMVA 8OHMA 3TUZC 2JIMA 2QZJA 1EJ0A 2R96A 1CIPA 3C4VA 2PSSA 3KUCA 3KZ1E 4RV9A 5IDQA 1JP7A 3V2HA 1GA4A 1PGQA 4YI5A 2ZVDA 1RYDA 5T57A 4MS1A 1NJ5A 3CTPA 5A3SA 4OM7A 2QMOA 1Z6XA 3T9EA 1FNBA 2Y93A 3ZC3A 3PC2A 4M8SA 2C2KA 2RAPA 3DTVB 3SZRA 2FPMA 1FP6A 1GPDG 2IXTA 1IEXA 3OIUA 2DYKA 2FHPA 4IJQA 3MIZA 4AQYB 3QE9Y 4ZU3A 2I2BA 5HTOA 3B1FA 4MRNA 1OXVA 4Y9SA 2DHEA 1E9SA 4FGSA 5B1HA 2BP7A 1Z7EA 1SC6A 2V6JA 3QY9A 3VISA 2YWGA 2NU6A 4CCWA 3DT6A 3HJGA 3NHSA 3MRXA 1W5AA 1SOUA 1ENZA 2VBFA 4LBYA 1NURA 2F3RA 1ZD9A 1IM5A 1KFEB 3AETB 2CMDA 3RUHA 3DOFA 4QREA 2WAAA 2G36A 2QD1A 1ECJA 2P7IA 3GP3A 5IKOA 2QY9A 5FL3A 2E1RA 2NNWB 3B20A 3CNOA 4BYGA 2Y6UA 1NXVA 3RLFA 4ZMSA 3ZVNA 3K0FA 2XUQA 1QHXA 1SBTA 1VIAA 3FNFA 1N2HA 2VH1A 4LQCA 1IWOA 3F9IA 5ALFA 1YR3A 5HF9A 5IVDA 3T9CA 1FFHA 1JG3A 4BXOB 3BICA 3NHPA 3RKRA 4LDAA 1UMCB 3SKXA 3NATA 3PVCA 5IMSA 1LDMA 3AUJB 3W77A 2FDRA 3WO1A 3K5WA 4BTLA 2FF7A 4NDNE 1I8TA 2BFPA 3GN1A 1V1MB 4J8PA 1XLVA 4Q7KA 4QOEA 4E5NA 3JQ7B 2DLDA 5CDFE 2P6RA 2HWKA 4G0QA 3KVVA 3KSBC 2XKAA 4K86A 2XMZA 4TWIA 1OXSC 2RB4A 1LDEA 4YT4A 2VRCA 4LXHA 4MQBA 2XYRA 5CDGA 1TU0A 1E96A 3LZDA 5IKEA 2FSIA 5F1KA 4GEGA 4UUMA 1GPWB 1X0VA 4G8CA 2QRQA 1I36A 3IAEA 1YQUA 2XT0A 3IDSA 3U7EB 4OHCA 1DX4A 4J0GA 4B33A 4DIBA 1Q0SA 1D9XA 4W7HA 3NMUF 2KYRA 5FADA 1KIFA 2P6MA 4L9AA 3W2IA 4W9MC 1JQAA 1EX9A 1AKEA 2PPVA 4BGVA 3ZOZA 4AN4A 1NPYA 4JJFA 4US2R 3TTYA 3MPUA 2JC3A 2VO1A 2VDKB 5B1EA 4OBXA 3RIMA 3IUPA 3CT4A 3DNMA 1UQTA 3QH4A 1XKXA 4G8BA 2FPWA 4LCJA 4O1MA 4LXGA 1DKRA 2DRIA 3BWBA 2ZBDA 4GRAA 4ZK2A 1J9EA 4CF5A 4PY2A 1DIOB 2VA9A 3FN4A 2OPHA 4LTMA 4DLBA 4IQ4A 4RKRA 1C7RA 1YCDA 2CYCA 2J3KA 1P7WA 2P11A 2YVUA 3J7TA 2CXSA 3NUQA 3QV1A 4UATA 5JXIA 5HX7A 4MHTA 3THXA 1PQPA 2WINI 3AU9A 1ZVQA 4W7SA 2ZRJA 4F1JA 1LJLA 5AQEA 3VNUA 3U4MA 4XW2A 3TZCA 2ZEJA 1DOHA 4TKLA 4EDFA 5F21A 5JAUA 1OBOA 2XZLA 1E61A 3O94A 4G0XA 3PEYA 2HWWA 4MW1A 1D0IA 1GKIA 4J7CA 4UHKA 2VXYA 2NO5A 2WKWA 4L9RA 4OK3A 1TUEA 1YVRA 3CX3A 3FWPA 3WB1A 1ZH6A 2VJPA 2R66A 2R0QC 3UK1A 1XK6A 4C6SA 5AXAA 1X9GA 5BYAA 4QWWA 1CXZA 3TCXB 5CVDA 3FYUB 1M6YA 1P0CA 3F4KA 4LW8A 3BMQB 4LVOA 3ZZ0A 5L3SA 1KXJA 1J0AA 3ECAA 4XDHA 4CL3A 2F4NA 4OXNA 3FBTA 4HWOA 4RL6A 3HVRA 2EJWA 3AJAA 2YYYA 3LYUA 1NIPA 4PRZA 3F8SA 2A58A 2Y92A 3LUCA 1NHGA 1NZDA 4MRSA 5CK4A 5H16A 2GPAA 3KVRA 2RCYA 1SU8A 1KARA 1FFWA 5TMPA 1YL5A 2CUZA 2OCBA 2RG1A 1XQ6A 4I55A 3B53X 1MAWA 5EHXA 3HA5A 3KOZA 2BELA 2RB5A 3ZVKA 4TQAA 2PEYA 3LWDA 3R9XA 4Z49A 2CWWA 3KU1A 2IEAA 3H83A 2O7VA 2A5LA 2V0GA 3JRWA 1J4AA 2QW1A 3WGNA 4B8YA 2G1KA 4CDMA 1Y7HA 2G71A 3ASVA 3BX1A 3IAM6 4X6UA 4BFSA 3SEFA 5C8DA 2W6PA 1Q91A 1MB3A 1NUTA 2OFPA 3WJ7A 3GJ4A 2V7GA 1JIVA 3LV8A 2NXNA 4GR4A 5JDIA 5EP3A 4MEJA 1DP4A 3WLJA 3BFKA 4E03A 1E2PA 1S0UA 4CHTA 5LP1A 3LA6A 3TMAA 2BBWA 4UEWA 2YXBA 5LZ9A 3QLEA 4R1QA 2ZJ5A 5U4XA 3A3KA 5KYKA 3FH0A 1EP1B 1JQKA 3L9XA 1ZI6A 3B3FA 5IASA 5AOCA 4XX1A 1PFQA 4KDCA 4CQMD 3WKEA 3CJRA 3MW8A 3OA2A 3PXEA 1HDCA 2IZ5A 1Q22A 4WA7A 1YNOA 1NTOA