4QGHA

S.aureus tmk in complex with potent inhibitor compound 47
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
204
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 195
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qghA00
5EJEA 3HU3A 1NNEA 1D9ZA 1KJZA 1W2GA 2D2FA 1W47A 2ORWA 1KDRA 5DGXA 1M7HA 3RS7A 1FFHA 3VU9A 3NC0C 1HEIA 3MWKA 3OAAA 1KKLA 2A5GA 2IA5A 2ZUCA 1R0WA 1U81A 2Z5FA 3AVOA 3LV8A 2J45A 4WW0A 5EP4A 1N6RA 2FFQA 3W34A 5A0FA 4NYMQ 5LDDC 1T8UA 3X2SA 1MO5A 1JJ7A 4LYJA 2XZOA 5TV2A 4K81B 3VHXA 4XWKA 4DCVA 2BCGY 1AZTA 3SOPA 2ZYVX 1WE2A 5G40A 3KKOA 2J0QA 1W4AA 5CLLA 1IY1A 4C2UA 1LS1A 1VCMA 3OZXA 3RWMB 1EFRD 3VX4A 4EAQA 4AKGA 1EK0A 1G1MA 2YWGA 1U0LA 1Z2AA 2D7CA 3K0AB 4TMTA 1M7GA 1H8HA 2GBLA 2VP5A 1S3SA 2F1IA 1SKYE 3FHOA 2GZAA 2GZHA 1W44A 5EXSA 2NO1A 3ADDA 1J7KA 4JSYA 1Z6TA 5JCZA 3BAFA 4QGAA 2ZSFA 2H16A 2CMKA 4H1UA 3A1VA 1R8SA 2C5LA 4BFUA 4KO8A 4LDJA 2BKEA 3KZ1E 2ZSBA 4IEEA 1S96A 3B9PA 1A82A 4B3FX 2CNWD 1KI9A 4I1OA 2XITA 3UWOA 2O8CA 2YOHA 5BYKA 4NYIR 5C2JB 4KYIB 2WHXA 1NY5A 2P3SA 1OB2A 5LBIA 1NLFA 3MAAC 2P6RA 1TQ6A 3EZFA 4AI6A 3PUZA 1E9DA 4P31A 3TE6A 1SXJA 2QNRA 3SJAA 1F5NA 4GSYA 3GQBA 4XVRA 1A5TA 2I1VB 2RCNA 3GLHB 4R7ZA 1V43A 2ZRJA 1E0JA 5EE0A 4CZ2A 3QJYA 1XWIA 1F3OA 3QXHA 5FUXA 4LV8B 4OQMA 2ECKA 2DY1A 3PEWA 1PJRA 2QGZA 1GITA 1KI7A 3SBEA 4BZPA 5H8WA 1YZLA 1KK1A 2JLRA 4PXAA 2BV3A 4EJSB 3CKLA 1CEEA 2FX3A 3IO3A 1E2NA 3KKMA 3KUDA 3MMPA 4I1VA 1QHGA 2RMKA 3RS4A 3LX8A 2JJ1D 2QP4A 2BBWA 4YMWA 3O8BA 1HT1E 1N6OA 3QQ5A 1GFIA 2E87A 2EWWA 2VP2A 2IF2A 3QI2A 2HF9A 3RANA 4RVCA 4IOKA 4TTRA 2ZR0A 3WRYC 2I3BA 4ESHA 2PZFA 3AP1A 4HDQB 2AK2A 4IVPA 3A4NA 3Q8XB 5DN6A 1IY0A 3K0AA 4HLQB 2YOGA 3EZ9A 1EESA 3CR7A 2RGBA 3QEOA 1VIAA 3CW2A 1KY2A 4CEIB 5KHOC 2RGNA 3ZQ6A 1KYIA 1KO1A 1D5CA 2O8FB 2N1BA 2PH1A 1X8LA 2ZM5A 4HAXA 1EXMA 4CT4B 3U7HB 1AKYA 4QL3A 2ZI3A 3RS5A 3W8NA 4Q48A 1BO6A 1U8ZA 2O0HA 3OFND 2QG6A 4LPSA 2R2AA 2NO6A 1JR3E 1O87A 2FV8A 3HDTA 1GP2A 4YDHB 3VR3A 3AF1A 1XCMA 3ONWA 1XEWY 5EE5B 4M9XA 1KOFA 3WNDA 2V7QA 3BB1A 4TMZA 1IAQA 3VNVA 2FEMA 4HATA 3H1TA 5FL3A 4A8JB 4DSTA 1CR1A 4M1TA 5F2EA 2NQ2C 2OBMA 3AUXA 1OT3A 2JJ2A 2JASA 2H18A 3I92A 4V03A 1BMFD 4JL8A 4WZ6A 2QPAA 1ZYUA 3GLHA 1Z08A 1W36D 1EX6A 2EFEB 2GWHA 4BRWA 4YMSA 4X8OA 1XJQA 5K8UA 1SVWA 5DH9A 4C7OB 1DELA 3LWNA 4JLPA 2HLDD 1RYHA 3CBQA 4FMDF 4QM6A 2A3RA 2H5EA 4EPWA 2WOOA 2AWOA 2PMKA 2IYQA 4BE7B 3LO5A 5JCPA 3EC1A 3K9NA 3B1ZA 2ZR9A 1WBBA 4JLAA 1M6NA 2ZS8A 2ZEJA 5KTYA 1Q21A 3F5FA 1IJFA 1C4OA 1QHIA 1T5IA 3ADKA 1K8RA 3I1FA 5F9FA 3I61A 2NOAA 4LI0A 2HYDA 3FMIA 1N0VC 1S2MA 2ZJAA 4XIGS 2VH5R 4UQOA 1N6PA 2OAQ1 5GVRA 5B2ZA 4CEIA 5FUWA 2GA8A 4HAVA 4JIMA 2GXSA 4TL7A 2HYIC 1KAGA 2CL6X 2O8FA 3P27A 4UXHA 2C8VA 1Q44A 3I8XA 5EE3A 2BMDA 5EP3A 3NBXX 2VQSA 1R2QA 3U3RA 4BEBA 2LKDA 3TUIC 2FDCA 1S9DA 4B47A 1P2VA 3E1SA 4B6EA 4RD1A 4GMXA 3EX7C 3Q72A 4K46A 1NL3A 3HYTA 2IX3A 2FFHA 4EUNA 3EWAA 1GM5A 3DZDA 1GNPA 5HKKD 4YONB 1E0SA 4FMCF 4NBSA 4RD0A 1A2BA 4A8JA 4CRWB 1QG4A 3CRW1 1GRRA 5BN4A 2IF0A 1GG2A 2HEIA 4WBSA 1XPUA 2Z83A 1LY1A 3QKTA 4MKIA 1FTNA 4MYTA 1TUEA 4KSCA 4YXWD 4YC7A 5AJWA 1OFIA 1G9XA 3IQXA 5FBWB 4WAUA 1GRQA 5L3SB 3FMFA 4KAXA 1CXZA 3EZ7A 1RRPA 4UNPA 3RRMA 4C0LA 4C7OA 1NIPA 2BWJA 2GEVA 5L3VA 4NHOA 2WVJA 2C77A 3QVUA 2W6JD 1TF2A 1VKJA 1EFRA 1G21E 3TW8B 2Y8EA 4DSNA 1E3MA 4TT3A 4DLRA 3ZVMA 1VG0B 2ODBA 3HWSA 4DLWA 4L8GA 4US1R 1OH7A 4IOLA 4HAUA 4EFNA 3CRVA 4TMVA 3TQFA 2QL6A 3KDSE 1E2EA 3ZZ0A 3LW8A 3RS0A 4MYUA 3CWZA 2NMVA 4CEJB 3GJ0A 1EFCA 3UANA 4JS0A 2HXSA 4PSAA 3B7GA 3NVAA 3C4JA 3THOA 2NG1A 2OZEA 2R8RA 3LNCA 4PPNA 4EDHA 4CEHB 2YC4C 4RKEA 1SVOA 5DI3B 4BUJA 5JHHB 3NKVA 1Q1QA 1AZSC 1E9EA 4YMUA 2REOA 1G7RA 4D0GA 1AS0A 2J5XA 1IY2A 8OHMA 1AA9A 5DE3A 1W36B 1IN7A 3NHAA 4B44A 3Q3JB 1NMZA 4I81A 3IHWA 3TAHA 4Z8YA 3OEHD 4P3YA 2C99A 5FOTA 2ZUDA 4MGZR 2ZRNA 4OI1A 4CGZA 5DHAA 2IS2A 2WWWA 2A5FA 1T5LA 1ZC4A 2VP0A 1XD2B 4RD4A 5L3SA 4DB4A 4XOIA 2O8BB 2GF0A 1QDEA 1UBFA 1NN3A 1NMXA 2HXYA 4TMXA 3RVBA 5C1BA 4E07A 4Q1DA 3ASYA 1UBGA 1XMJA 2J0SA 5J4VA 4M1SA 4LZZA 4UJ3A 1D2NA 5DYIA 3U5ZB 3C14C 1VYVA 1Z6XA 1NBMD 1N6LA 1GL7A 4OK5A 1OXUA 3EPKA 4XWOA 2CCJA 2KJQA 1VCNA 4MKHA 1DOAA 3Q9LA 2BMEA 3CX7A 4F91B 1RVDA 3ZS8A 2CE2X 3THYB 3V9PA 3OHMA 1UPTA 4L15A 1CJUC 4X8MA 4MRNA 4US2R 1EWQA 3GLFE 2RGAA 4IKEA 1YJ5A 1DTSA 4QBHA 1NLYA 2OV2A 4H9GA 4CEHA 1Q1BA 4C30A 4FCVA 1AIPA 5KNBA 2V55B 5ELXA 2G83A 3NXSA 5DI3A 1E69A 4UNRA 4EIWA 5IF9A 3HU1A 2QE7D 3EA5A 4ESVA 4A15A 3TSOA 1W2HA 4RZUA 3MJRA 2JLWA 1N6IA 1XNJA 2J0UA 4LUCA 4NZYA 5F3WB 2EQBA 2VBCA 1E9AA 3REFA 5GVSA 3QVVA 3JZMA 3QKUA 4BLRA 5G53C 3CLVA 3R20A 3D31A 2XZPA 4LYFA 2ZYTX 4Q47A 2GVZC 4HLDA 2HLDA 1G8YA 4IDNA 2D2EA 3ZVNA 4YLGA 1U0JA 5GJVC 2L0XA 3ZZUA 4ASUD 2CHQA 2FE4A 1CKEA 3B85A 3M6AA 5LD2B 1XD2A 3DVLA 5DYGA 2IS1A 1VCIA 2X77A 2O8BA 1IXSB 3A1TA 2ZAOA 5BN5A 1WXQA 1TF5A 2BKUA 2JLQA 5G41A 5SZJA 5JJKA 2OHFA 1KK0A 1T3HA 3B60A 4RZ2A 1Z47A 3M4YA 2FG5A 5LB2A 1U98A 1CJMA 1GKIA 3PV0A 4G3XA 4LWZA 4KSBA 4NCIA 1ZU4A 2EWVA 2NGRA 5TXGA 4HLCA 4Q18A 3U3JA 3IHLA 1GILA 4JL5A 2ANCA 1G8FA 3F3YA 4M2LA 1G7TA 4UXJA 1NSTA 3THYA 4L9SA 4C0HA 1OKKD 5JWHA 3TGPA 4W5HA 2PEYA 3UATA 3EIQA 2BOVA 4IHQA 4Q1CA 3D3QA 3OIVA 4KYUA 1Z3IX 4JVNA 3VKWA 5FOUA 1DAFA 5J5CA 3VQTA 2J59A 5HKKA 3TRFA 3W5IA 4PPGA 1Z5ZA 2VO1A 3AQ4A 3I8SA 4FIDA 2W2VA 1KSHA 1R0ZA 3KL4A 2FSIA 1DAMA 2P2LA 5FPSA 2WZQA 4WVFA 3A4LA 4H1VA 5DISB 4OQLA 4F7WA 2ZYWX 5K8TA 2GCOB 3GJ8A 4PC3A 2VP9A 4LHYA 4QKQA 1NI3A 2REBA 3GLIB 3ZIAA 3T06B 2FGKA 1JALA 1N3BA 1JNYA 1XBTA 1U9IA 1A7JA 3AVYA 1WDTA 1Q12A 1IN5A 2KBEA 1CIPA 2C98A 3NWJA 1XTIA 2XXAB 2JGNA 1TEXA 1OXVA 2BMJA 3IQWA 2BBTA 3M1IA 1DAEA 1AQUA 4KXFB 2FMXA 2AL7A 1CTQA 2YNMA 1H8EA 3VR4A 3C8UA 1N5LA 4Q5IA 4HAWA 1IXRC 1D2EA 2CVHA 1I4TD 2Z4RA 3TSZA 4II7A 2CVFA 4JLJA 1U8YA 3MJHA 1G3UA 1KI4A 3CF0A 1W0KA 1M7BA 1JQLB 1I2DA 2VSFA 1ODFA 2IYLD 2R6GA 4MDFA 5H1YA 4DUGD 4B6FA 4A0HA 2FA9A 4NL4H 1ZUNB 4JLDA 1JQJC 4LY6A 3I62A 2WSSA 1SXJE 1GTVA 1E9CA 4C2TA 3UG7A 1X6VA 2D06A 4JT2A 4D82A 1ETUA 5KSOA 2F7SA 1NJGA 1YU9A 3L0SA 3R8CA 4PANA 3QUSA 5JI3E 4ABYA 4F4JA 4HI0E 4DKXA 5J4YA 4HLUA 1E2LA 1A2KC 1UDWA 2H8KA 5FPKA 3OEHA 3CX8A 2OBLA 2ZSAA 3AF0A 3VR5A 3LXXA 3SE0A 3THWB 1LW7A 1E1QA 2GCOA 1F2UB 1G17A 2BMFA 2NO9A 4V0LA 3GLIA 3T15A 2QGNA 1GL9B 1U94A 2ERXA 1R7RA 2FF7A 2BDTA 4R9UC 2ZS9A 4WOPA 3W6NA 3AKEA 1T3SA 3TJZA 4DXAA 4DT1B 3R7WB 3IIJA 2F9LA 2ZE6A 4QFMA 2XXAA 1AQYA 1MH1A 1SHKA 2W6IA 1P73A 5E95A 4WZAE 4KV9A 3SBDA 3DKPA 1G7CA 1M1YE 5KPJA 4K8OA 1Z63A 5J47A 4NU0A 4QOSA 1NBMA 4HB0A 3NEJA 3WXMA 2ZROA 4P32A 1S4QA 2WWFA 4PO8A 2ZSEA 5P21A 1W4BA 4B2LA 3ADCA 4B75A 1G19A 2IW3A 4XVQA 3HJNA 3X1WA 4FINA 2VP4A 4KFRA 4QGFA 5FH9A 2Q0HA 5B30A 3ZLJA 1KZGB 4TYPA 3K0EA 3SNHA 4EJSC 2Z0MA 3GLHE 5EP1A 1RIFA 5CM9C 3MUFA 1CBUA 3SYLA 2C9CA 5JSZB 4KVAA 3CPHA 5DNYB 1G5TA 1DADA 2WTUA 1XTKA 3DDCA 4LJAA 1UEJA 1ZJ6A 1KDPA 4IVQA 2WICA 3RWOA 2NPIA 1ZD8A 4FMBB 3ZZTA 1E2QA 1DS6A 1TL7C 2QROA 2ZRFA 3W3AA 3UXMA 3LBNA 2A5JA 1XTRA 5DLQC 4A2QA 2IHBA 4HUQB 3WMEA 4TQ9A 2OEPA 3EW9A 4URWR 4M1WA 4UNNA 1Q1ZA 4MRPA 3THWA 4EPTA 1F2UA 1TUIA 3A8TA 5TY0A 4BFTA 1OJLA 5CIQA 1B23P 4ASUA 4V0NA 3G0HA 1QF9A 5E7IA 1J8YF 3VKGA 1SVMA 1W46A 2UZIR 1W5SA 3AP2A 4IXMA 4DT1A 3TNFA 3R7WA 1BYUA 2DWPA 3H0KA 4AG5A 4LBYA 2W2TA 5BXQC 1YHNA 1QVRA 1XEFA 2ORVA 1P62B 3KXKA 1G8HA 4CW7A 2QZ4A 3MRSA 5CM8B 4TYYA 4LJ6A 4GMDA 3K9LA 2PCLA 2ZVQX 4AWXA 5EE1A 1JECA 4HDCA 1NVVQ 4PSVA 1GWNA 2OFOA 3K9GA 2QSYA 3BRWD 4MRSA 3VAAA 3WP1B 4D80A 1XEWX 3EARA 4OYHA 2ZI7A 3W6PA 3KQNA 4JLKA 1KIMA 3DOEA 1ZW6A 4MA4A 5JRZA 4HB3A 1OKKA 3SDZA 2GAOA 3LA6A 5HPYB 2ONJA 4I1UA 3K70C 2GEUA 2TMKA 1TF7A 4FN5A 1SQ5A 1Z28A 4LV6A 4DWJA 4URXR 4R2HA 2JDIA 2RGEA 1OIXA 1TQDA 4TLDA 4NPHA 1GKYA 2XTMA 4Z8XA 2WAXA 4Q9IA 2ZI6A 3MG9A 2ZI4A 4BLSA 4TWZA 4B71A 1TX4B 2PBRA 5JSZA 2RGXA 5M04A 4JLNA 2GK7A 3RS3A 2YOFA 3C5HA 3RSOA 3WMGA 4DCUA 2ZS7A 1CJVC 4JMPA 1P4SA 4W5WA 4NDZA 2CDNA 2ASEA 2JIZA 2JLSA 4HUQA 3TAUA 1M34E 4FWTA 2HCBA 4MUBA 4TYQA 2IYXA 3E5HA 4URVR 1KZ7B 3KFXA 4C0SA 3K1JA 1D8TA 1D2MA 3CM0A 5FTKA 3K09C 2JA1A 2IYSA 1G64A 3CZPA 4LJYA 3W90A 3VMFA 1NMYA 4A2PA 4EKDA 3SU8A 3CRMA 3K8YA 4D26A 1E2MA 4JL6A 4IXNA 2OG2A 4DIDA 1KJYA 1FMLA 1KAOA 1CS4C 2IWHA 1W7AA 5EZ5A 1OHHD 2IYVA 5E4FA 3QKRB 2DFNA 2A30A 5CB8A 4BZXA 4DUGA 4GRAA 1QZXA 2V9PA 3IEVA 2EYQA 3CPJB 1FX0B 1ESNA 4B43A 1FNMA 1P75A 4D4JA 1G4UR 1IOZA 1FQJA 1HUQA 1N5IA 1YZKA 4OK6A 6Q21A 3KJHA 3H84A 1HH4A 2W58A 1X3SA 4TQUS 3RAPR 3CNOA 4LBWA 3NBYC 2VSOA 3SN6A 2FEOA 4PC1A 4LHWA 4QJ3A 5JLJA 5F9HA 2XEXA 1CLUA 3DHWC 4PHGA 4TN1A 3T1OA 4E09A 3RLFA 1YZNA 1BOFA 4TSFD 5FR2A 3PUXA 2WJGA 2X2FA 3W9YA 4M22A 1L4UA 1US8B 3UIEA 5DI9A 2ZJOA 3FPAA 3VNUA 2C04A 4N3NA 2ZU0C 4FWIB 1I4LD 2QM7A 1GRNA 1YRAA 3K0CC 4OHZA 3JZAA 3KB2A 3BB4A 2XTZA 4E22A 1P9RA 4M53A 2ZJYA 3AM1A 2WSMA 1ZINA 5HZKA 4TLBA 2QAGA 4ILEA 3LQRA 1RZ3A 1U2RA 1G8GA 2V1XA 3KB1A 2WJIA 3MFYA 5EZ6B 3B6EA 3SJBA 1NLZA 3NTUA 1KMHB 2FSGA 1E79A 1S9HA 3Q85A 3I32A 4XH9B 4KBFA 5FL7D 5HE9A 4NYIQ 1P72A 2AK3A 2B6HA 5HTKA 2G88A 5E3HA 4D4KA 3PVSA 4DHEA 1JEDA 3NBZC 1KO4A 3SYKA 1TTTA 3B1XA 2DCUA 2QTFA 3L2OB 4KFSA 4ZDWA 3AF3A 2IEZA 3EASA 3QKRA 5JS8A 2C95A 4KFUA 4O2RA 3DPUA 4RFVA 1N5KA 4PO9A 4Q7MB 2A9KA 3A1UA 3AV0B 2SHKA 4U02A 1FX0A 2XJ9A 3K0FA 2R9VA 3VFDA 2WBLC 4DLXA 4Q01A 3U2QA 4AK9A 1OB5A 4JJZA 2VHQA 4M9ZA 4KCGA 3A36A 2CL7X 4G01B 1AM4D 1ZVQA 2XSZA 1N5JA 1QVAA 2ZETA 5GJBA 1L2TA 2QT0A 2DFLA 4C3ZA 4P4UA 3ZVLA 1W1WA 3FFAA 1NRJB 1W49A 2W0SA 2PJRA 2JATA 1HTWA 1MO4A 3ZQJA 4NKRA 1XCGB 2YVUA 1BS1A 1G3IA 4DLVA 4ARZB 5JS7A 1US8A 3O8RA 4NP6A 3ICQB 1QHYA 2DFTA 2B21A 1T0JB 1G291 3L8YA 3AGPA 1ZIPA 3FKSA 2XOKD 3WRXC 3PJRA 2YC2C 5IK2D 3OIUA 5FBVB 1E1RD 3MGCA 5CJPA 2UKDA 1Z29A 1RW4A 4G5QA 4OI0A 1D6JA 3GJ3A 2GCPA 3LBIA 4RJLA 3LQQA 1ZRHA 1W0JD 1UKVY 1XF9A 1KMHA 1Z0JA 5IDVA 3CWQA 1ZD1A 2BIFA 2ODNA 3LXRA 2RHMA 4GOKA 4O25A 4W5JA 1EX7A 2ZU6A 4Q7JB 2R62A 3CUEF 4A0RA 1HYQA 3AVWA 2LWIA 4TLEA 1FL9A 1AS3A 3B9QA 4QBGB 5EXXA 4A9AA 2IS4A 4Q02A 4F4CA 4BLPA 2GTPA 1F48A 2QRNA 3A37A 1TPZA 5AUPB 1KMQA 4TL9A 1Z0DA 2GF9A 4Q66C 1NG1A 2WOJA 1ZNYA 4DCNA 4GL2A 3AF2A 4RCYA 1ZBDA 1Y63A 5AJVB 4PHTA 5CIWA 2F3TA 4MRRA 1COWD 4NONA 1CRQA 1VG8A 4P0TA 1VPLA 4DCTA 1KK2A 5AUNB 3CB4A 3LVRE 3TKLA 1AN0A 1RJ9B 4BFSA 3LFUA 3O8DA 2OCBA 1G3RA 1KKMA 1LTQA 2D3WA 1LNZA 1ZNXA 4PX9A 3U3OA 3OEED 2QTVB 2XZLA 1NSFA 2BBSA 1OFUX 2IYRA 4HUTA 2XGJA 5CB6A 3IIMA 3BC1A 1WCV1 3LAWA 4I4LA 3UPUA 4U7DA 1UM8A 2JEOA 4URUR 3KJIA 4RZXA 2RGCA 3BORA 1E9RA 3SR0A 1L4YA 1KSFX 1KY3A 3VR6A 4ARZA 3GEEA 5EUQB 2AD5A 2KBFA 2ZRBA 2GNOA 4XD7D 1QHXA 1ZUHA 5L8VA 4IDPA 1E99A 2V8OA 3R8FA 1N25A 4WIAA 3T61A 4CVNA 1KI2A 1Q57A 1SKQA 3X1DA 2DB3A 2UVQA 3GEIA 3GD7A 4OK3A 4Q4AB 2VHUA 3VR2A 3NHBA 2QUZA 1TQ2A 4EPXA 2Q3MA 2AXNA 1R0YA 3IILA 4IDOA 1OHHA 3JVVA 3LRPA 1E2IA 4C9BA 3D7MA 1XMIA 1XTSA 1ZC3A 3BIFA 2R44A 3ICEA 1E4VA 2CNWA 1LS6A 4L5BA 3ETLA 1XDBA 4MITA 4O2LA 2AXPA 4Y0VA 2QP3A 1KK3A 2CLCX 4Y0AA 2P6NA 1XJCA 5KOYA 1Q1EA 1VG9B 4JLMA 3VHLB 3KQKA 2EW1A 1NKSA 1II0A 3B13B 1BYIA 2J0UB 1PUIA 2DHRA 2PZEA 3GLIE 4QNMA 3RABA 2ZQ5A 3BS4A 2GDJA 1N6NA 3LX5A 4FMDB 1RJ9A 4TSFA 1YZTA 4BGDA 4TTQA 1G18A 1QG2A 2F1JA 5FR1A 3LH5A 5DO9A 2D74A 1CR2A 4JVSB 1Q3TA 1KI3A 2BVNA 3LBHA 2MMGA 2JJ1A 1OXTA 1VMAA 5FOWA 2IC5A 1T91A 1XXHB 1OYYA 4RKFA 1UBEA 2OILA 4ZDJA 4BPBA 5KSZA 3PENA 1NBME 4ZCMA 3ZD6A 2O5VA 4JBXA 4Q7LA 2OUKA 1SVSA 2ATXA 4N0DA 4OJQA 4DB2A 3A6PC 3KQUA 3L0OA 2BCJQ 1II9A 3AB3A 1NY6A 2IUSA 4Q9JA 5E7MA 4Q4AA 5H70A 2ZRAA 4Z1MD 3CF6R 4GP6A 5IHPA 2H92A 1OLOA 1WMSA 3OFNA 2W00A 3WY9A 2KE5A 3VX3A 2OCAA 5FOXA 3CIOA 3WYGA 3AVQA 4OBEA 3X1YA 1IXZA 1A1VA 1NN0A 2BC9A 4B76A 4FMCB 3UK6A 4C4PA 5J4KA 5LPNA 2P5TB 5KNDA 4JLOA 4NE2A 1GOTA 2GCNA 4XSGA 2ZANA 2ZE8A 1KI1A 5CK5A 3B5JA 1Y3AA 1ZAKA 4JYBA 1N0UA 2B8WA 2D7DA 2JCSA 3IBYA 1IN8A 3Q7PA 3H86A 3Q5DA 4LK2A 1Z6YA 1BMFA 2FSHA 2AFIE 2J87A 3AVTA 4PC2A 3REGA 3PR1A 1KSGA 4OQNA 2ZVPX 5BQ5A 4Q4JB 2FZLA 1R4AA 3NH6A 1MKYA 4JKIA 2XJ4A 5JRJA 3ZJYA 1VHTA 2ZRGA 3DZ8A 4EFMA 3CH5A 4Q4LA 5IT5A 3ZD7A 1XEXA 1KJWA 4YQFA 1KDOA 1S1CA 2C78A 3AH8A 4NYJR 4GZMA 4A6PA 3V00A 1WP9A 3HP1A 1E2PA 2XOKA 3TR5A 4B3BA 4QJ5A 2ZJ2A 2QORA 1N6KA 1XXHA 2ZTSA 4IJMA 5TARA 5BW8A 5KU1A 2GXQA 1E6CA 4R71A 1YKSA 3BD9A 1G5RA 3U7GA 1G6OA 2GZDA 4I99A 1W0JA 1Z0FA 3DEFA 1XRJA 2WWIA 2ZJZA 2X2EA 3CPEA 2YV5A 2IYUA 3CNNA 3IDQA 4JLVA 2HJGA 1R5OA 4PO1A 2ZRHA 3U3MA 1G8PA 4DEYA 1GDDA 1E32A 4OL0A 5HCNA 2Q3HA 1NP6A 2WPDD 2A2ZA 4HZUB 5AWFC 1I4DD 1Z6GA 2VSXA 4A1FA 5JEDA 4W7SA 4BLOA 4OHVA 1CULC 3EAQA 3GPLA 4NCNA 4QGGA 3TMKA 1X8KA 2QAJA 1CR4A 2C2HA 1X8JA 3UWKA 1GNQA 2PZGA 2LCFA 2P6UA 4NYJQ 1FP6A 1J90A 3P4YA 5FPYA 1E9BA 1Q3HA 3EWSA 3GFTA 3KJGA 4NCJA 4BECA 4Q7KA 3OIYA 1OFTA 4TZ0A 1P9WA 2GBLC 2AD1A 2W0MA 3OEEA 4R2IA 3AKYA 4YXWA 1JPJA 3HPRA 2IEYA 5FI0B 3EPHA 3WHLA 1NN5A 3L43A 3I3SR 3M0EA 3BERA 3MCAA 4POAA 4AG6A 3LW7A 1JPNA 5KDOA 2BJVA 4Q4JA 5UKDA 1YR9A 4JVLA 5DIFA 4JBYA 4BASA 1P9NA 4MQBA 2J0VA 2FOLA 2GXAA 1U99A 2WJYA 3BH7A 4OHXA 3SJZA 2W6JA 2K5UA 3R9XA 1QHSA 2Q9AA 3A1WA 4XD7A 5J4LA 2GAAA 4ZCIA 4URYR 2QMHA 2QENA 3I5XA 1R10A 5K8IA 1N0WA 1YZGA 5K8LA 2P67A 1OV4A 2AKYA 4LC1A 5AJZA 4OQXA 3O8CA 3HR8A 2B7BA 4PPQA 4TL6A 4UXIA 2ATVA 3PCRB 2R6CA 3PEYA 2H7VA 1E9SA 1MOZA 2OSBA 4A0FA 5TB5A 2VHCA 5SZHB 1SXJC 4EPYA 3J81k 4LC0A 2YHSA 1E94E 3BH0A 2ODWA 4D25A 1J2JA 4A4DA 3T5GA 1YZUA 5L3RA 3EC2A 4B48A 3TUZC 1UKYA 4BZQA 4TZ6A 4US0R 2DWOA 2ZJ8A 3SHWA 4HZUA 3AVVA 2OFWA 1TU4A 2WMNB 1E2HA 4Q1EA 3TR0A 1T8TA 2FPMA 4RCZA 5FFMA 3CX6A 721PA 3QIAA 2RH5A 2XAUA 3WYFA 3AVXA 1VCOA 1KI8A 2G0NA 1BH2A 1P2TA 2NZJA 2C9YA 1OFHA 2LKCA 4DDUA 2WWXA 3LVQE 1Z06A 4MH0R 3FOZA 4GI7A 3IKJA 4A2WA 5JHGB 4LYHA 4O3MA 1KSJA 4D4LA 4GOJA 4BLTA 2GHIA 3I5YA 1GL6A 2EFCB 2Q9BA 4AKIA 1ZCAA 1T0HB 1E4YA 2IXEA 2PLFA 2RGNC 4WA7A 3U61B 1XPOA 4GFDA 3CO5A 2F3RA 1YVDA 3OE7D 3GJ6A 2VTKA 4ZCLA 4KU4A 1J70A 1LF0A 2DYKA 3RRZA 1SXJD 4IOJA 2E1RA 1XX6A 4LJ8A 2BM0A 3L82B 4B3GA 3QSYA 3IBGA 3I73A 4JZKA 4EFLA 2NIPA 4UJ5A 1GSIA 3NDPA 4V0OA 5HCIA 4ZI3A 4YMVA 3SYNA 4Z51A 2ODEA 1XFAA 3EA0A 5HZHA 2X8AA 2Z43A 2VYFA 3QF4B 3CRRA 4DDVA 3TUJC 4ZIRA 3CONA 4IDHA 4NMMA 2GRJA 3T1TA 3C5CA 2UZ3A 1AGRA 3TSWA 5EXPA 1KI6B 4MKGA 1RKBA 4Z1MA 4LCBA 1YR7A 2OXRA 3UMRA 5JFGA 1PLKA 121PA 2IYTA 2OLKA 1JAIA 3DMNA 4M1KA 3KXLA 4JSTA 5DN6D 2OT3B 3A4MA 1FUUA 3U60B 4E5UA 1G3MA 4KVGA 2ZRDA 4LPKA 2ZE5A 4GNKA 3R9IA 1QHNA 4Q4HB 4RFSB 3NBFA 5FTJA 3MSXA 2Q21A 4KODA 2FU5C 2QE7A 4B33A 2HUPA 4G1UC 2FN4A 4CYMA 3EZ6A 4PQYA 2EFHB 2ZIAA 5KNCA 1OIWA 2J7KA 4QC2A 1D9XA 4DLSA 5EQTA 3PXGA 2CBZA 3ZS9A 3ADBA 3B1WA 4FCTA 4B2IA 1OH6A 4UNQA 1DVRA 2V7QD 3H4MA 3Q5EA 3RS2A 2YWHA 5TMPA 3H2YA 4IVRA 4P4SB 3U6BA 1XP8A 1YRBA 2KI5A 2ZYUX 4I1SA 1XPRA 2FJUA 5AR1A 1NIJA 3OESA 4XVUA 2AHOA 2JJ2D 1UKEA 1UKZA 4XTCS 3SQXA 1PV4A 3RYTC 4XSHA 5AUOB 1XD9A 1MT0A 1J8MF 2GEDA 3WBJA 4BWYA 2YWEA 2BEKA 3G5UA 3SEAA 2HV8A 4OQFA 2C96A 1LVGA 2CLDX 1K6MA 3KKPA 1DAKA 3GLGB 3AEZA 5KDDA 1C9KA 1O3YA 4V0KA 2VIIA 3P20A 2D4HA 2IYZA 3QF4A 4NH0A 4HB4A 4A8JC 2ZREA 2PX0A 1TNDA 3SZRA 4O0MA 1VDZA 2WPDA 1NVXQ 2IL1A 1KI6A 2WKRA 1TU3A 2NO0A 5EUMA 1UAAA 3FWYA 3A58B 1JR6A 3C41J 2CHVA 1XZPA 1G41A 2CHGA 1MRNA 2QPOA 3PFIA 3WYAA 2BJWA 2N46A 1PVOA 2IBMA 4DLTA 4C0AC 3AGQA 4AURA 2QP9X 2QMEA 3F8TA 1G16A 3EPJA 3GP8A 2ANBA 4EPRA 3RC3A 4CF7A 1S1MA 1VHLA 3ZDQA 4G5SA 4Z54A 3SHFA 2VLIA 3WP0A 3RDPA 4OHWA 4PQRA 4RFSA 4Q4HA 4DCSA 4HEJA 5KUTA 1R8QA 5BWMA 2F1HA 3AVPA 3LLMA 4LGMA 2J1LA 4HSEA 4ON9A 5EP2A 5GJWC 3K0SA 1OXSC 2IS6A 2PX3A 1ZM2A 2R65A 1HE8B 2AR7A 2OBNA 1I2MA 4P4TA 2JLXA 4KLNA 1II8B 2GJAA 1QHHB 2C9OA 2WKQA 2ZPTX 3AKDA 2IYWA 4ZPXA 1E2KA 5BN3A 3KX2A 4WXRA 821PA 1F60A 5JZVA 2J41A 1UF9A 2QAGB 2PCJA 4P4SA 5JWOA 2QI9C 2XTNA 4DDWA 2I1QA 4RD6A 3VKHA 4AD8A 2C03A 4N1AA 2Q3FA 2WJVA 5FBQB 1C1YA 2ZUBA 4X8LA 1RPZA 1AK2A 4QBFA 1Q20A 1X1SA 3T5DA 4TYWA 4ITRC 3K70D 1G7SA 1ZM3A 2GESA 2WWHA 4WZBE 1DG3A 1DPFA 3QE0A 2ZRIA 4FCWA 3QOFA 5FTNA 1KO5A 3ZVRA 3K9HA 3GLGA 3EZ2A 1R5BA 2B92A 3WMFA 3B1VA 2FPKA 2NTYC 4PZYA 2YJTD 1QBKC 1IN6A 4JKYA 3EG5A 3TVDA 2X19A 4XJXA 1ZUIA 1P7CA 4TT3D 1GUAA 1DEKA 2DBYA 2G3YA 2NO7A 3K0FB 3PUWA 5TVKA 1AJEA 1JB1A 2PT7A 3DMDA 1ZMXA 2F1RA 4ZO4A 1DARA 1PUJA 5JECA 2WM9B 1FPMA 4ZDIA 621PA 1MR3F 3KXIA 1F6BA 2FH5B 2PMDA 4BLQA 2FPLA 2VEDA 2FFAA 5B57C 1Z0AA 3NEYA 2HDNB 1Z83A 1LFDB 1KDTA 3GJXC 4LHZA 4MGYR 4ZDKA 4QBIA 2ZXUA 2CL0X 3BWDD 3T34A 4QGHA 3TW4A 4LYAA 1CJTC 1CR0A 5A5GA 2WV9A 221PA 5DHFA 5HR5A 1CP2A 1WRBA 3QNUA 3L8ZA 1IHUA 2Q9CA 2IXGA 4Q00A 3THXB 1II8A 1NVWQ 4OI2A 1QHHA 4DSUA 1E98A 4DDTA 5H68A 5B64A 3SJCA 3F0TA 1TADA 1ZM4A 1Z07A 2EYUA 3OE7A 3W5JA 1RC8A 1KGDA 3QKSB 4LJ4A 4Q9KA 1M74A 1U90A 3TIFA 3D8BA 3SQWA 4DBLC 1OH5A 3KFVA 4AYTA 4BFWA 1TQ4A 2G77B 3P1JA 2P5SA 1E2GA 4C0BA 2PL3A 4E03A 1H65A 1XTJA 2MSCB 2ZAMA 4KFTA 1X86B 1GKUB 2XNDD 4D6PA 3EXAA 4EQ6B 3GFPA 2R6FA 4M8NE 4BFYA 3AF4A 3AP3A 3JVUA 5CYOA 1XB2A 4BEJA 1DAIA 1FNNA 4L4UA 5KYKA 1W5TA 1XCPA 1MABB 3T1VA 4CT5A 1W36C 3IPYA 3UMSA 1G3QA 1L8QA 1K5DA 1EFTA 1HY3A 1MRSA 2OCPA 3QPVA 4HAZA 3GJ4A 2IT1A 1U8AA 3SS8A 4TTPA 4KLZA 3TBKA 2GJKA 5LB4A 1Q22A 2YINC 3FE2A 5JI2E 5FBRB 1XMSA 1ZM9A 2E9SA 3QG1A 3RNLA 2PJZA 1ZNWA 1ZCBA 4RSGA 4PTLA 1X1RA 5C46F 2J46A 5J40A 4F4IA 3LDAA 2JLYA 4M1MA 1S0UA 4TLCA 2ZSDA 3IGFA 421PA 1UDXA 1XXHE 3ZH9B 4PPFA 1KNQA 2DR3A 2O8EB 2QA5A 4LJ9A 3V4RA 4BFVA 1FOEB 2J9RA 1EFHA 1FTSA 1JR3D 4EPVA 3THXA 2AKAB 2FSFA 1SHZA 3FGNA 4G5RA 3QKSA 4M1OA 3U4QB 2FGJA 4OKSA 4LHVA 2KWIA 4B3CA 5CDFA 1T4GA 4YMTA 2B7CA 4F93B 3K70B 2CCGA 3KKNA 1XTQA 2IYYA 4R98A 4D2IA 3NDBB 4ZKEA 2GXUA 2ORIA 3FYHA 1FQKA 4EJSA 5CYPA 3LY5A 4QHTA 1BKDR 2EFDB 2WIAA 3B82A 4F38A 5CITA 3SFVA 1YE8A 5HE8A 4EQ6A 2XB4A 1IM2A 2OAP1 4QRHA 4MKFA 4PQFA 1NF3A 3IIKA 1P2UA 3AUYA 1MABA 2RB4A 2RGGA 2JJ8A 4ZI2A 2BM1A 1U9IC 2QQ0A 3FFBA 2GK6A 4DC9A 1SVIA 3W3ZB 2WKPA 3V4FA 1WQ1R 4IFBA 3U3KA 1SKYB 2GKSA 1CU1A 2ZJBA 2CE7A 2OLJA 1KO8A 3PG5A 5JBQA 5LD2C 1UADA 3SFZA 5CLQA 4B73A 4HZIA 5A4JA 4FXPA 1DBSA 1IBRA 1JJVA 1SGWA 1VYUA 2R6DA 4XWAA 4NCKA 2V4ZA 2HT6A 4B3XA 2ZE7A 4V0MA 1P2SA 4XTRA 5DSZA 4AC9A 1WF3A 2BHRA 2RGDA 1EG7A 2O8EA 3EPLA 1Z0IA 4URZR 4A6XA 3KQLA 1T3LA 1JXOA 3DO6A 1E0AA 4Q21A 5D3MB 4W9MC 3TQCA 5FBLB 3X1XA 1TMKA 1NG9A 3U4QA 1GVNB 3DKVA 3QXCA 1XZQA 4PR0A 3ZIAD 2FZ4A 1UEIA 3GJ7A 2F43B 2XB2A 2XX3A 3MWYW 3WBKA 4C0KA 2F55A 5FTMA 2PLRA 3KTAB 3UMFA 2FNAA 4AIIA 4B34A 1XU4A 4HLUC 1P6XA 3ND9A 1P5ZB 4C0JA 2ZR7A 2OFXA 1Z6AA 3R9WA 2GETA 2JLVA 4DVGA 2GJ8A 2VHJA 3A1SA 4S35A 2QMUA 1H8ED 2PT5A 1PZNA 1KTVA 3I72A 3HU2A 3BE4A 3CNLA 4GOXA 2CCKA 2QMOA 1WB9A 4DLUA 4QHYA 3WNBA 1ESMA 3QG5A 4J0QA 2ZJ5A 4L9WA 2O52A 5F98A 1W0KD 5KPDA 3VTKA 2WAYA 3QPWA 4G5GA 4DRZA 4PSKA 4QG7A 1HQYE 2QT1A 2ERYA 2CK3D 1E2DA 3FKQA 1HA3A 2WSSD 2VF8A 1ONBA 4AKHA 4ERNA 5JEEA 2AFHE 3K09A 1XEXB 2QN6A 4A92A 3RC8A 4YDSA 3D6TB 4B74A 1SVLA 1S8FA 1DAHA 4LBVA 1Z8FA 2QPTA 1ZNZA 4GBMA 3C15C 3TLXA 1E9FA 2VP6A 3E70C 3ASZA 2QSZA 1BIFA 2W83A 4G5OA 4M0LA 5GJCA 4KBGA 2GJSA 5JWRA 3MWJA 2OM2A 4MYCA 1A4RA 2AWNA 5D3MA 2D62A 1RFLA 2AN9A 1E1QD 1JBKA 5FL7A 2OXCA 2VF7A 1T6NA 2BBOA 2XNDA 1LF5A 4IW3B 4QHSA 4WXPA 4X8HA 2WWGA 4Q19A 4A0GA 3CF2A 2JLUA 3LD9A 4TQAA 4PFSA 1TEVA 2F43A 4NTZA 4F92B 1SVKA 2G1KA 4PZLA 1YR6A 4AYXA 3KTAA 1Q0UA 4NCHA 3CH4B 1FW6A 2QBYB 4UKDA 4U5XA 5BYJA 1IN4A 2QQEA 2OCYC 1ZP6A 2ZRLA 4QJ4A 3SI7A 2W6ID 4HAYA 2JLZA 2ZRCA 1CJKC 5G3ZA 2ZI9A 3QY0A 4DLYA 1FMJA 3X1ZA 3QBTA 1HE1C 4Q9LA 1TAGA 5KSPA 1ELOA 4ACBA 2A5DA 1EFUA 3S1AB 1XMVA 3K0CA 3PQCA 4D0LB 1OW3B 1MO6A 4D0NA 4BFXA 4M21A 3CZQA 1M8PA 4B32A 5FTLA 3PEUA 4AY2A 1G20E 4LJ5A 3TVTA 4CEJA 3PUVA 4PAMA 2RAPA 3W6OA 3NH9A 3ZYCA 5KO2A 2WJHA 4TMWA 1Z0KA 3IEUA 3O47A 2EFGA 1QRAA 1PLJA 4JYCA 4DZZA 1YQTA 2VHTA 1JR3A 4IFEA 4IOMA 3FTQA 5IK2A 1VG1A 1E1RA 1E2FA 4IEIA 5CK4A 2XNSA 4TL8A 2DPXA 2V54A 2CLSA 3BJIC 3U6KA 2F6RA 1W4RA 1UBCA 2FWRA 3PIRA 4Q1AA 4Q1FA 4B3DA 2DWQA 3UG6A 1RRFA 1G6HA 2A7QA 2CXXA 2MSDB 3QF7A 2IWRA 1LB1B 4ZKDA 4QM7A 1EWRA 1W4CA 3FDIA 3RSLA 4FI3C 3BFVA 4IDQA 3N2EA 2ZRKA 1W48A 3BK7A 3DM5A 3EIHA 1RYFA 3QXSA 1FUKA 2J7PD 2P0EA 4M9SA 4PHFA 5AK0A 3LLUA 3QENA 4N0EA 5FOVA 1SULA 2QBYA 1CF4A 1B0UA 4TMKA 4D81A 5TDHA 1N2CE 1IONA 1N6HA 1PLLA 2PEZA 2O8DB 4LV5B 1VYTA 3NIBA 3EIEA 3QEJA 1COWA 2F9MA 1F2TB 521PA 2DFKB 2G6BA 5L3QB 4HB2A 1OIVA 3MLEA 4LX0A 4M9QA 2JAQA 3GCGA 2REXB 2J3EA 3S1AA 2KB0A 1GIAA 4GPTA 1ZU5A 3U44B 4HYYA 5EE9A 4P33A 5JMTA 3BH6A 2RHDA 4DJTA 4GP7A 1G4AE 3DL0A 4MYHA 4AKEA 3TK1A 2OO7A 3DM9B 2OESA 3FHTA 5KDLA 2JDID 2CJWB 1ZD9A 3AVUA 2A5YB 2V1UA 3KKQA 4S2EA 5GADl 4PZZA 3N70A 3U7EB 1P3JA 3QXXA 3ND8A 1S3GA 2YZ2A 4PC6A 4PHHA 1UJ2A 2H17A 3GLGE 3ZGXA 3OAAD 1DG1G 2HCJB 4PC7A 1VIYA 4ZIRB 2Z4SA 2YYZA 3Q7QA 4L16A 3T12A 2KSQA 2A78A 3B2EA 3VR1A 5J4HA 3B78A 4BRUA 2JIZD 1U0HC 4LRWA 2AX4A 2ZRPA 4LJ7A 4RD3A 2MSEB 1J99A 5IRCD 4FD2A 3E2IA 4DLZA 3BGWA 2IUTA 3P26A 3DOFA 4M1YA 4Q03A 2G9NA 4B2PA 1KHTA 4KHZA 4D4MA 1LV7A 4CDGA 5JJLA 3BOSA 1H8HD 4MUAA 3QPUA 1GAJA 2YWFA 3IUYA 3L0IB 1YZQA 5ANRB 1KO7A 2NPFA 1HT2E 1WA5A 1XJ0A 2EU8A 5E7JA 5FOSA 3G82C 2O8DA 2QU8A 5D3QA 2G1JA 3PUYA 3CR8A 3T35A 1DO2A 2QAGC 1F2TA 3KUCA 2W2XA 1NJFA 3GJ5A 3WHKA 4ACAA 2BEJA 5FI1B 5L3QA 1OH8A 1AS2A 2V6JA 2WIBA 5FUYA 2CK3A 5FPHA 1GZSA 2QTHA 3QBVA 4MGKR 3WNCA 3RRYA 1Z2CA 4C0QC 4GDFA 5SZIA 3U44A 1R0XA 1OF1A 4JJKA 4FW9A 2GJ9A 3PITA 4BQSA 5C4MA 3GLFB 5CJ2A 1ZIOA 1Z22A 1V5WA 4OHYA 1XD8A 1YR8A 2IHYA 3BFXA 3FMPB 3L0PA 2CJWA 1RRCA 3GEHA 4LBZA 1WBDA 4HDOB 3CRQA 3C16C 2N42A 2IK8A 2ONKA 3GMTA 3C7KA 4JT4A 1VTKA 1JAHA 4LOAA 3BFKA 5B58C 1JEEA 4QNRA 3B8HA 5KSYA 1OPXA 2ZRMA 4UNSA 1JI0A 4DEXA 2QY9A 4IRUB 2QM8A 2HF8A 3PEVA 2VRWA 2I4IA 5EXTA 1G5PA 3SC3A 3ECCA 4BFZA 5FUVA 3I4LA 4A36A 1E2JA 3RRNA 4TLAA 1E96A 4GZLA 5G3YA 2NZ8A 3KQHA 4V02A 2R6AA 3KJEA 2VPPA 1NKTA 2H1LA 2MMCA 4JBWA 1RRGA 5AUQA 2P65A 3IO5A 4TYNA 4OJKA 2Z6VA 1HURA 4MDEA 1OSNA 1E79D 3MWLA 4KI0A 2B8TA 3B1YA 4KJZA 1DAGA 4PAQA 2IXFA 1MV5A 3N5CA 1MO3A 2V6IA 3NC1C 4GT1A 3T1QA 3IPXA 3BXZA 4B35A 5FPTA 4QXAA 5C4GB 2RKOA 4RY2A 2IUUA 3FVQA 2HJVA 3RHFA 1OYWA 1T9HA 4G0NA 2CEAA 2WMOB 2O0KA 3GFOA 2GILA 1IJEA 2WJJA 4RD2A 2GVDC 2ZITA 2Q6TA 3FMOB 4LSGA 5CDFE 2H57A 1HQCA 2FFBA 4LHXA 5SZKB 4MRVA 1KNXA 5AJYA 4JVMA 1OE0A 3VU9B 3GLFA 1NVVR 1HV8A 1VECA 3BBPA 2XSZD 3OF5A 1IQPA 3K53A 3N2IA 4PAOA 3HR7A 1UFQA 3AKCA 4DIEA 2QRZA 1RE0A 2V3CC 1E0KA 3HPQA 3NG1A 4M4SA 2EVWX 2HT1A 1R6BX 2OE2A 5C18A 1GNRA 3UKDA 1AGPA 1SZPA 2WWYA 1CRPA 2O0JA 3FB4A 1P60A 4KITB 3FKSD 4U00A 4DSOA 2J7PA 2X1VA 4JLBA 3HYRA 1NN1A 3P4XA 2ZI5A 3TH5A 4AYWA 1JXMA 1ANKA 1ZM7A 4NYMR 1L7VC 1OXXK 5AJXA 1FP7A 1EGAA 2VL7A 1M2OB 1R5NA 4A82A 3FHCB 2YKGA 4MGIR 1DO0A 2G0TA 2QEQA 4Q1BA 1NVUQ 3OIWA 4CIDA 4ZV4A 4V0ME 1P61B 2O8CB 3P32A 4RZ3A 5JJIA 3U7FB 3W8RA 3QXJA 4OI4A 2VA8A 3BB3A 1SXJB 1AKEA 1FZQA 4Q9HA 1DE0A 1K5GA 3MD0A
chains in the Genus database with same CATH superfamily
3DD1A 1MNQA 5EJEA 2PNFA 1KJZA 3FCAA 4FFWA 4AT1A 2NPOA 2I80A 1Y8RB 1EWVA 1UAYA 2XNCA 1JIXA 2FX5A 1L5OA 2HWWA 1ZGCA 3EUEA 4XDGA 3VISA 1PFQA 2XQVA 3E9CA 4YJ3F 2WFLB 1NASA 2IA5A 2A5GA 2ZUCA 3PXXA 3AM1A 4EFKA 2QK4A 1RHQA 2FFQA 1LPAB 2JS7A 5A0FA 3CGWA 1T8UA 4BV3A 4ZTUB 1JJ7A 2XZOA 4K81B 2R8PA 1AE1A 1KARA 3PDIB 3E58A 3VHXA 2ASVA 4XWKA 3A06A 2ZT6A 1G42A 3AIKA 1EHIA 2PN1A 2ZYVX 3QVSA 3TDKA 4TVKA 5G40A 2BM8A 4QT4A 5LFAA 1VCMA 4QYIA 1MB3A 5KMGB 3DL4A 2E85A 4PICA 4AKGA 4WD3A 1QE3A 4R8LA 2NAPA 4CV3A 1A8PA 2QRVA 4N3BA 4I66A 1PG5A 4OA8A 4ZU1X 2B2XA 1SKYE 4ZREA 3W2TA 3WWDA 2Z58A 1W44A 1IOVA 2NO1A 1AU9A 2QJFA 2XQGA 3AB8A 4NRDA 4YCJA 3VBEA 4B0PA 4A3SA 1VKNA 4JSYA 2IKQA 3UAGA 3HY3A 1A7KA 3KZOA 3VR2D 5JCZA 3RIYA 2ZSFA 4MS3A 5T7BA 1T1JA 3OJWA 1GPUA 4LDJA 4R41A 4TKUA 5DBFA 2JI4A 4DJJA 2O7VA 3FYUA 5HF9A 2BE7A 2VG8A 4JI8B 2XYHA 3B9PA 3VZBA 3FR8A 3IP5A 1IZZA 1L5KA 3QEBZ 1Y8CA 2CNWD 2H4JA 3IODA 3TBFA 4B4VA 1P7PA 5HJ7A 4B0OA 2BZ0A 2WHPA 2XITA 3UWOA 3T52A 3KRTA 1AZLA 1SXIA 2Q8QA 2YCLA 4PEVA 4AY4A 3KHUA 5C2JB 3ZWQA 4F2HA 4OP3A 1OB2A 4DYVA 1JH8A 2LR0A 2ZSJA 1NLFA 3MAAC 2QTNA 3ZXYA 3KHTA 1RXVA 2UAGA 1E8DA 3PUZA 5F2OA 1E8MA 3LGAA 4FEYA 4P31A 5G1NA 5D84A 2M6KA 1QTIA 4RY0A 3FOAA 4O6VA 5K0EA 3C3KA 4XVRA 5J1TB 5TF4A 1PQWA 4R7ZA 5EE0A 1JWLA 1THMA 4D4GA 4HRAA 2NNWB 2IYAA 1Y42X 1XTUA 4AY3A 1XNRB 3K5HA 4P54A 1KU0A 5IC4A 1DT3A 1V4VA 1Y8RA 5H8WA 3IH5A 2O4UX 2JLRA 1P17A 3HKDB 5HOQA 5B1DA 1RPAA 2WFLA 4MIKA 3P52A 2GSDA 3KUDA 3MMPA 2MHCA 2I2DA 3INRA 3PGA1 1QHGA 4KQFA 4ER3A 2LIVA 3SBOA 2BBWA 1N6OA 2BGNA 1GFIA 1SBHA 3GMSA 5B7GA 2EWWA 1FNSA 3PDIA 3NAMA 3UY4A 5FORA 3RANA 4C5BA 4C20A 4TVSA 3LIIA 3WDMA 3LY9A 2POQX 2DOKA 3NHJA 4LDAA 4OBXA 2K6GA 5BWNA 3SZ3A 3ZHQA 1UK6A 5KMGA 1XLTA 4IVPA 5F4BA 3KWFA 4MVWA 3Q8XB 3S70A 2Q27A 5DN6A 4E12A 3G9QA 2W2KB 3CR7A 3V4SA 2W4IA 4NCXA 3UTCA 1V5GA 4IX1A 5KHOC 1N77A 3H17A 4JIGA 2O8FB 2BN4A 5ILQA 4N8SA 5SY4A 3AX6A 4LKOA 3ZK9A 1KQFA 4OF4A 3IV6A 4QL3A 2ZI3A 3TFOA 3RAFC 4Q48A 3OFND 2O0HA 1PZFA 1Z7EA 1N57A 2XNJA 3KEFA 2Y1DA 2HU7A 2ZOSA 2FV8A 4QWMA 1ZHFA 3CB2A 3AF1A 1ZOIA 1G60A 1UWCA 4M9XA 4YJKA 5ECWA 3N0WA 2PKEA 4JK3A 1VPDA 5DV9A 4BP9A 2E82A 4XCXA 3EF1A 4TMZA 5AW9A 1N3YA 3VNVA 1Z82A 2FEMA 5IKXA 3PBKA 4HATA 3H1TA 5FL3A 4A8JB 4DSTA 1CR1A 5CCEA 5C3UA 3ZE7A 5F2EA 4ZPJA 1XDSA 2B9EA 2JPDA 4IQ0A 3VC1A 2JASA 2JH8A 3KVYA 6REQB 3HZOA 1GGVA 3A1NA 1P19A 1PS9A 3I92A 3EFHA 2VXYA 3RTAA 2FMFA 2B5VA 3ZCTA 5T3UA 3FI9A 4JL8A 2QPAA 1PN3A 2NW6A 1W36D 1T8SA 4WY2A 1HETA 1D2RA 1SPXA 2GWHA 3A32A 3CE9A 3DGEC 3O4RA 3E27A 1YZYA 4UBJA 4X7RA 1SVWA 5ER6A 4IIFA 1V3QE 4LY3A 3FTPA 2EKLA 4OCZA 3H83A 3LIPA 3RM3A 4F96A 3EGXB 5FPQA 2QG4A 2BONA 3TW6A 3IT3A 4E11A 3OZFA 3HKDA 4FMDF 4F12A 5I48A 1H05A 1CETA 1PX2A 1SHJA 3QVLA 2XWQA 3FSEA 1PF7E 2VRCA 3VR6H 1SU8A 2WOOA 4M0KA 3T5AA 3D6MA 3E8MA 2IYQA 2QZJA 1RMTA 1M34B 3PNMA 2GPJA 3B1ZA 1YWGO 2ZR9A 1F8GA 2ZS8A 1C9JA 4I19A 4RPHA 5EZSA 3ASUA 1QHIA 1G8KA 1T5IA 3ADKA 1K8RA 3F6CA 1FDRA 2HRZA 1V95A 2HYDA 2EKBA 2YZGA 1WXFA 2W2MA 3IEPA 2W2KA 3HCAA 1HPLA 3NBMA 4TKVB 5J3JA 4YBZA 4X1OA 4FSHA 3QU7A 4JIMA 1YDEA 1KAGA 2O8FA 1YQUA 3SPXA 3C3DA 4NZOA 3ILYA 4D9HA 1ADGA 1AO3A 1VE9A 1YZ3A 2R7KA 4OG2A 2J5KA 3CKMA 3AKZA 5CTAA 4BEBA 3NPAA 4HRVA 3ED5A 2IOFK 1NR7A 3FUCA 5ECDA 3L6RA 1G5FA 3E1SA 4PIMA 5CTJA 4CM9D 3RYFB 3IP8A 3Q72A 4K46A 3WIDA 2FFHA 4EUNA 1GM5A 5C80A 4NIMA 4IDBA 2RI1A 4KO1S 4E2ZA 3DAHA 5AKXA 1WDMA 2CXTA 3P9SA 5HKKD 4Q0MA 1R6TA 3OHSX 3WAGA 3UOGA 1JDUA 4A8JA 4CRWB 2P91A 4DPKA 3CRW1 5CD1A 1L5YA 1YUBA 3FPLA 3QKTA 4MKIA 6REQA 3F2IA 1EHCA 1SC4A 2HBZA 2H6EA 3UCEA 4YXWD 4J16C 3FUVA 1NPTO 1G9XA 5FBWB 4KXYA 4EF6A 3EZYA 4I4NA 4FJ0A 5JJCA 3EZ7A 3RRMA 4UNPA 4C0LA 2IY7A 4J07A 1NIPA 3NUZA 3EGXA 2NT4A 3GUHA 5FI5A 1BGWA 3QVUA 2C77A 4WFIA 3BGDA 3LVFO 1TF2A 1VKJA 2VVTA 3JSXA 1EFRA 1G21E 3GN1A 3NYRA 3OX4A 4QOEA 3T7IA 4DNOA 4YCCA 5FNVF 3KPYA 5LWHA 3KFLA 2I2FA 2FXIA 5CA1F 1E3MA 3WQRA 2WF5A 3FIJA 2AE1A 3HB7A 3VI3B 4GM1A 3MD9A 1M34A 2ZB7A 1F4PA 3HWSA 5LLDA 2GK3A 1OX4B 4Y6QA 5ILGA 4PYRA 4NSNA 3PNLA 5JD5A 1KAMA 1G8SA 1ZWKA 4L07A 2CKMA 4LI3X 4Y6GB 1K0FA 4CM6A 4MPRA 5U4XA 1KS2A 3FAKA 1RQXA 4EFNA 2QL6A 5DM4A 5I3CA 1NDHA 2G07A 3L7MA 3CU5A 4IIVA 2CLHB 1NZDA 4JDUA 5A6VA 1JJIA 2BF4A 3V1LA 4JLSA 5HILA 3TZEA 1OC4A 4PBTA 5IVHA 2VJNA 3KK0A 3OZVA 2MCFA 1EFCA 1IU9A 1QKKA 2WAAA 4TKVA 3L8HA 5L6MB 4OKIA 3BWYA 3NVAA 3OQBA 5H83A 5LMCA 2OB1A 3C4JA 3OTOB 1N5MA 3PNBA 2HO4A 2R8RA 4WK6A 2MTBA 3WXBA 3LNCA 3MJTA 4PPNA 3PR3A 3PPIA 5AH0A 3IIIA 8ADHA 4X7PA 2QS9A 1EUCB 2GWRA 4BUJA 1CW2B 4KIGA 4Q3LA 4MW0A 1E9EA 3JQFC 2A94A 1BXGB 1RJFA 4PG4A 3RYFA 4XD7A 2QRQA 4EUHA 3QX3A 1I32A 4DNQA 1IY2A 2O48X 1G66A 4WX2B 5LQAA 4N47A 2IDMA 3S1SA 1KH1A 1IN7A 3HA5A 3Q11A 4MVJE 2VDOB 4B44A 4AYWA 4ARIA 3PTAA 2VBGA 1PWYE 3IHWA 5PGMA 2G36A 3X43A 2W2QA 4I3HA 4PU0A 2V0NA 5F3RA 2J33A 2VH1A 3K4PA 3VR5D 2ZUDA 3WX0A 3F46A 4AO8A 2IS2A 2W7TA 1TT7A 2A5FA 1YNOA 4JU9A 4C01A 2VP0A 3IB6A 1UWVA 3DT8A 3QFCA 4GMGA 4P34A 5E1OA 3UJBA 2FW7A 4RD4A 1D4OA 2P69A 3ORHA 3QSGA 5BUCA 2WB4A 1RWKA 3ZI7A 4WXPA 4Z2YA 1NN3A 2QR2A 2VZ0A 3K4HA 2NSJA 1A9OA 1IB0A 2X9LA 2Y0CA 3Q3EA 4N6NA 5JALA 1XMPA 3L1VA 3RYIB 3K8OE 3SR3A 1EBBA 1XMJA 3C48A 4JWTA 4OQPA 5AVWA 1L7XA 2VPYA 3C8MA 3NRCA 2ROQA 4YK7A 4YH1A 1UINA 3U5ZB 2WY2D 4L74A 1N6LA 1VLVA 4OK5A 4UTXA 5AOAA 5EJMA 1ENYA 4CTJA 5TMDA 3RSCA 1DTWB 4BMYA 1AC5A 3PFWO 4OMUA 1ZOOA 2HLNA 2PQ6A 1QQBA 3HH8A 4F91B 2VJAA 1GLNA 2CFCA 2OL4A 4J90A 3C4VA 3V9PA 4LXTA 4RKYA 1CJUC 1XN4A 2XB9A 3GGDA 3OX1A 4X8MA 3VOTA 4B3JA 4US2R 2WM2A 4WLUA 3CF4A 1F5SA 3RSFA 1AK1A 1WZUA 5ENDA 1JIJA 2JBHA 3H5VA 1G2OA 3N0VA 4M8SA 4DLBA 4QBHA 4JITA 3EH1A 1ONSA 1OVGA 2EZ9A 3BXGA 3KC2A 1BGXT 4CEHA 2Y0PA 3HCCA 4OLAA 1Q1BA 4FCVA 5KJEA 5ALKA 2G83A 4RQAA 2VNAA 1H6DA 3LY7A 5EJ9A 4NAUA 4DLPA 3HJGA 3HU1A 4ENSA 4ESVA 1WULS 3HBNA 1BXGA 3MJRA 3QLUC 1N6IA 1XNJA 1Y6RA 2J0UA 1QP0A 5F3WB 3ANXA 2R3SA 1R0KA 3ILXA 1IZ8A 4IIBA 3JZMA 5JT1A 3L7LA 2VTEA 3UHPA 1H0SA 1R27A 3H2KA 5FB3A 8AT1A 1KQGA 3R20A 4LYFA 5D01A 2ZYTX 4YUZA 4JX9A 2FPIB 4HLDA 2HLDA 1V3TA 2OK8A 1QUEA 2Q9UA 4XLZA 3HB0A 2D2EA 2AOXA 3STWA 4A16A 4D9JA 3EK2A 2VDMB 3PJDA 1NFFA 1Y6FA 3OCYA 4KVFA 4MVJI 4MW2A 3ZZUA 2YIVX 3CUUA 3RUPA 4XQEA 1QGAA 3DVLA 2PSSA 3GFGA 4QG3A 5B1YA 5BT9A 1TF5A 5G41A 5SZJA 5JMOA 1CDOA 4C4SA 3V5NA 1A5SB 2IY9A 1EAMA 1T3HA 4D5EA 1W4ZA 1EDBA 4XX1A 3BIOA 4ZHQF 1K75A 3RYIA 3UMJA 5BWOA 1ZLYA 2CVZA 5LB2A 1UP4A 3BKWA 3PQ6A 4PIVA 2NXWA 4LZPA 1S2OA 3PV0A 4ZEVA 1I10A 1K7EB 1LZLA 4JOSA 3IEMA 4WK2B 5IVKA 1MV8A 4IS2A 2G63A 5JYDA 5DASA 3OBIA 4KUGA 1DTWA 3I6IA 4HXEB 3U3JA 1I5OA 3DNMA 2NZ2A 3IHLA 3IT0A 2OYCA 2ANCA 5K6AC 3D8HA 3NCTA 4UXJA 3SGLA 3RS8A 4PX5A 2QW1A 1ADCA 2MYUA 5JWHA 1N1DA 4W5HA 5KKAA 3LFTA 1WQ3A 2PEYA 3WLSA 4B40A 3DP7A 2P4UA 4JUAA 2P9GA 3VDXA 4BNMA 4NX2A 5LZ9A 3EFOB 2NSDA 4XIYA 1GYPA 1FTQA 2G5PA 1AOXA 2I7XA 2J59A 3C1OA 5FF9A 3TRFA 3WAJA 4LJLA 1JXQA 2H1VA 4FIDA 4OSEA 5A6SB 4D0SA 3KL4A 1ZISA 2VSYA 1DAMA 3OPYI 1EKXA 5KJCA 3QUTA 1VSTA 1SC1A 2GCOB 2ZIZA 4P4LA 2FMKA 3FNQA 3GLIB 1OFGA 2V03A 4UCWA 2ZTVA 1A95A 1DZ3A 3T06B 1JALA 1JNYA 1A7JA 1AT1A 1HTBA 1U1DA 1UK8A 3L5KA 3L0DA 1CIPA 2C98A 3RK4A 3SLRA 4P7BA 2QLBA 4D3ZA 2FPIA 1L1FA 1UC4B 2JGNA 5CVUA 1JMVA 3WKDA 1XMQB 3FF1A 4I4TF 1OXVA 1Y0BA 3D6VA 1JG3A 1N7HA 2BMJA 4ERXA 3ER9A 2BBTA 1CUXA 4AMUA 4I14A 3NGXA 2ATCA 4IQ8A 4KXFB 2FMXA 4AU1A 5H9WA 1QGDA 1CTQA 3MM4A 1YUNA 5JFTA 3I5AA 1QPZA 1PK7A 2WE7A 4CM3A 2Z4RA 1QHFA 5FAKA 3KZVA 3TSZA 3NOOA 4KRFA 2F00A 3CISA 3MJHA 4FYVA 1G3UA 2O8NA 1KI4A 1GRVA 4R54A 1T6XA 1W0KA 1NLUA 4BJ3A 3IOYA 4F5EA 3LCCA 3M9XA 2PXAA 4YLEA 5DCLA 4E33A 5EEHA 4DUGD 1N7JA 3GV0A 2CLLB 1Q17A 4R1LA 4NL4H 2HIGA 1ZUNB 4JLDA 1M1XB 2WVGA 4DPMA 3U19A 1RWMA 1GTVA 3IX7A 1E59A 2XCRB 1CZLA 3DWFA 5H4HA 3LA8A 4C2TA 5K03A 1TK9A 4IHAA 2QN8A 1FVFA 3DB1A 3OQOA 5KSOA 2BYTA 5FO0A 3WK7A 1NJGA 3L0SA 4PLCA 4PANA 2DFPA 3I76A 4PWZA 2X86A 3UMCA 3EFOA 5D85A 5COAA 2QLJA 2MYNA 3DDWA 1NMSA 3IMCA 3KAPA 3OOSA 5TIIA 4BKUA 4D7AA 3OQ1A 4EW6A 3R7LA 4HLUA 3K6SB 1E2LA 3PVZA 4HY3A 1UDWA 5JSFA 2VK2A 3RFVA 5A6SA 4XRGA 5BSWA 3EVBA 1NGSA 2V6BA 1Y1SA 3FYTA 4ZT4A 4MV8A 1LPSA 2GCOA 5LP6C 3RQIA 3THWB 1WZEA 2Y77A 2NO9A 3BG5A 1O6CA 3GLIA 5IT9A 4D9GA 1L8OA 2ERXA 4R9UC 1N9KA 2Z1DA 2A0UA 4L02A 4MGHA 4J0GA 2R4TA 4RHYA 1Q19A 2XWJI 3D8RA 3QUBA 3D9QX 1I6WA 4IUBS 4KKVA 4LDNA 1P0IA 3ETHA 3SHTA 4JODA 3TJZA 1Y1LA 4Z3KA 2JGMA 1J1UA 1JSZA 2F9LA 4QFMA 4GMFA 3VUFA 4Y6RA 3C3BA 3IXLA 2AQ8A 2W6IA 3TEFA 1P73A 4WZAE 4KV9A 2M1ZA 1G7CA 2Q99A 3DNFA 1B6RA 1KYWA 5H59A 2BEUB 1N5OX 4NU0A 5AD1A 2XCLA 5BVHB 5J47A 3D7RA 3AHHA 3T0GA 1NBMA 4HB0A 4ND1A 1PFVA 1PS0A 2NVBA 2OQVA 4JKOA 4ZZ2A 2ZROA 3H4TA 2OK7A 3FYDA 4RLFA 4ECEA 3E48A 4P32A 4XCQA 2OWDA 2J09A 2VJDA 3MMNA 4Y3UA 4B2LA 1G19A 1M6VB 2GN4A 3FSJX 1RTKA 1E64A 3GRZA 4LRUA 3U0BA 5JNTA 5F76A 2VP4A 2NQTA 4IMIB 1ZUNA 2Q0HA 3ZLJA 5HZGA 3NLLA 1BE6A 3LI2A 3CX3A 5KC9A 3K0EA 3RH0A 1M33A 5JMWA 3ELWA 2Z0MA 4G56A 1O4WA 5AKYA 4D6YA 3CS3A 1NC3A 3TDMA 4I50B 1LVUA 2QVZX 3PI6A 4DOMA 1U3CA 1Z17A 4KXLA 1DADA 2M32A 1XJ5A 2E4ZA 3QPAA 3ZHZA 3EVFA 4RY9A 4WINA 4N8DA 2PIAA 2WICA 3RWOA 2PXHA 3PC8C 1ZD8A 1XA4A 4BNDB 5B2EA 1TL7C 3I01M 2K7ZA 1K86A 4LOLA 4LZWA 4FFMA 2A5JA 1OQAA 3OZAA 3ABRB 4RPKA 2IELA 2IHBA 1NZFA 1Q91A 4A2QA 2NYUA 1KU6A 2Q1YA 4ZVUA 4ZMSA 1TW3A 1A7AA 4MPDA 3ZGZA 1Q1ZA 3E3MA 4EHKA 3THWA 1LWNA 4YACA 2QQGA 3WJ2A 3E5RA 4BFTA 4NXMB 5IJ0B 1QTNA 3EIFA 5ITVA 1WPQA 1F51E 1WABA 3LQ4A 2MDTA 3WBBA 1QZTA 1W46A 4LXUA 2DQKA 4NZ9A 2IEIA 2KQUA 5IKPA 1TGVA 2O2XA 4IXMA 1L9XA 3AP2A 4R5MA 4W5TA 2DWPA 4XJTA 1V35A 1WTAA 3D3NA 4ZT6A 1XKTA 2QU7A 4DIBA 1ULSA 1VHWA 1CDEA 3GNLA 3WB9A 5IKOA 3A3KA 4F5DA 1TYCA 1YIOA 2FUKA 3U5TA 1M5RA 1TCBA 4KWEA 4BKQA 4G81A 5F4ZA 2BEUA 3ZU3A 5BVHA 1XU7A 4LJ6A 2PCLA 3ZHUA 1R9JA 2ZVQX 1B0AA 4OMDA 4XWYA 5EE1A 3WRVA 1GWNA 2OFOA 1Q77A 3FNRA 5K3SA 3KQNA 2CXPA 3EARA 3G2MA 4RNCA 3P2EA 5DHTA 3B36A 1VQ1A 3MGKA 4CMHA 1ZW6A 2O6HA 3DE3X 4XLTA 3URKA 2C0CA 4KE9A 1M6VA 4DZTA 5LNK6 4RHTA 3DONA 2TMKA 2WTBA 3E9NA 4FN5A 4I8XA 4LV6A 5EKXA 1KFCB 2HU2A 2JDIA 1JIIA 4MSUA 4EITA 1D1TA 1N1EA 4ETWA 5CEFA 4NPHA 4ZO9A 4Z8XA 2ZI6A 2C97A 2ZI4A 2A84A 3FTFA 1BD4A 1FSFA 1OU0A 3KV1A 4OJYA 4X6YA 2JGJA 3E0XA 1NBOA 1VPEA 4MB0A 5LU9A 4ZGGA 3BGOS 5M04A 5F21A 1ZK0A 4YAGA 4YT5A 4JQZA 3RS3A 2VAPA 3RSOA 3WMGA 3KALA 1FXSA 1OT5A 1PSWA 2PRYA 2IHKA 4YAJA 3T5TA 4JMPA 4BNDA 1P4SA 4W5WA 1XZ8A 4Y2YA 1HTTA 1KEZA 3RBAA 2JIZA 3IDOA 4EHNA 4N5DA 4Y2TA 2R1TB 3IDZA 1SQ0A 4FOPA 1C30B 2OHVA 3EB9A 5K0CA 3OT5A 1UZUA 5JZ9A 1Z5PA 5IMBA 5YASA 1EP2B 1JB9A 2GD0A 5IJ0A 4TS4A 3T4PA 4NC9A 4DR7B 2O7NA 3ELYA 3CZPA 3QWHA 1NTRA 4YY3B 1SURA 3JQDA 2E4UA 2A4MA 4HBGA 3NHMA 4UW9A 4WNCA 4EMTA 2GN2A 3DYIA 2GLXA 4D26A 4JR0A 5DSTA 4IXNA 4O08A 2REQB 4IJUA 1HZJA 1BE1A 2G8LA 3Q8KA 2Z6AA 3VPSA 4P4GA 1K8ZB 1SD5A 2DFNA 1J1ZA 1R15A 1RYZA 5JAOA 1AHNA 1KAHA 4RNDB 3S2SA 4CIVA 4F06A 5ALPA 2EYQA 3IEVA 3E8SA 3DG9A 3CPJB 4CTMA 1ESNA 3ZXSA 4XB2A 5AOVA 5CT5A 4EO4A 1G4UR 3DBOB 5T57A 1N5IA 3B2QA 3UENA 3BXEA 3KJHA 1ZMOA 1HH4A 1C3XA 2PH3A 3Q0TA 1JDZA 1VL2A 2JHFA 3NBYC 2RHCA 1DBPA 4LHWA 4QJ3A 2OB2A 2FW9A 1SIWA 2XEXA 3LQKA 3SXUB 4AJLA 4ZYLA 5CFQA 5K3EA 1I0IA 1Z13A 2VXOA 4R3UC 1JPVA 4U1RA 3UQYS 3ZZ1A 2AMYA 5D5HA 5FR2A 3HL0A 3W7BA 3ZXUB 5I7RA 1IY8A 1W0CA 4ZJZA 1WEHA 1L4UA 2C4VA 1PEYA 2I1LA 2ZB8A 2YS7A 3BHMA 4M22A 2ZJOA 2P9CA 3W8EA 1H69A 2C04A 2H9YA 1NF2A 4QDTA 4MW4A 5DTEA 4FWIB 1I4LD 3LQYA 5TX7A 4ETMA 3O9ZA 2IDKA 3DPSA 4QFDA 1KEKA 3BB4A 1BG6A 2XTZA 3WL4A 1SCAA 4BLUA 1U8EA 1P9RA 2YIDA 2O7RA 2FR8A 4QJIA 4E3WA 2R1TA 4OQDA 2YASA 3PX3A 4MQ5A 3LQRA 4IXTA 1NQOA 4QDOA 1C30A 3PF9A 1P7WA 1NLZA 3Q3IA 4PQGA 3NTUA 3SJBA 3D4PA 4KK3A 1KC3A 4WCVA 1HDIA 2VWQA 4MV6A 1AURA 1HKHA 3IQIX 1OASA 4XH9B 2ZUWA 1J22A 5FL7D 5HE9A 1Y8ZA 4ZVNA 2B6HA 4YX9A 1OLXB 5BSVA 5HTKA 4I7EA 3ZBTA 5E3HA 4KNWA 4D4KA 2VUUA 4DV3B 1C7IA 4O8CA 4RK4A 1U8FO 3LGXA 4KO4S 2REQA 3NBZC 3SZMA 3SYKA 1UPCA 5JAHA 2YQ5A 4FGLA 2DHDA 3V8BA 4MR9A 4GVPA 3AM3A 1DOZA 4WXYB 4X1IB 3LWZA 2Y1KA 2HK7A 3H11A 2UYGA 2C95A 3PGKA 5L6LB 4OB7A 4MKZA 3DPUA 2AQKA 2GI4A 1VHDA 3N2YA 3OKPA 4UZFA 4YO8A 4Q7MB 2JH3A 3A1UA 3AV0B 4E5NA 3R4VA 4U8GA 4COOA 1T9GR 1CE8B 1KFKB 2W6QA 2WBLC 3VFDA 4W5RA 4UHHA 2UUPA 1MAVA 3U2QA 3CSDA 1OB5A 4JJZA 3TI7A 1CX9B 2YZNA 4R9VA 2QNIA 5F7OA 1JMYA 4W1RA 2MINB 3NCHA 2O59A 1ZVQA 1ZZEA 1N5JA 4F97A 1M2JA 5GJBA 4EKEA 5BN1A 2BTEA 1GADO 4P4UA 3SXUA 2HZBA 2HTEA 2Y2UA 2PJRA 3CW8X 4OYYA 4B74A 1HTWA 4K2AA 2X41A 2YVUA 3ED1A 1C3VA 1XG5A 3KBBA 1KP2A 2X4IA 5CVJA 4MMXB 4DLVA 2JK1A 5CNMA 5LDGA 4MYRA 1O95D 1OI7A 3EGEA 3IAXA 5DK4A 5I7FA 3O8RA 1ZRNA 2AEFA 4CMGA 4IRXA 4P7GA 1QHYA 3VJRA 2DFTA 5EN4A 2GARA 1G291 4ARSA 3AGPA 1C2YA 4KQEA 3ZC3A 3IAM1 1F9AA 4I9FA 2FP4B 1YVEI 3AI7A 4JA0A 1E1RD 4XLLA 1E77A 4JU8A 3ZOZA 4R81A 2M9MA 3GLTA 5GY7A 5DXFA 3KUXA 2Q7DA 4EL0A 1D6JA 5JW6A 3BIXA 3EVGA 2GCPA 5AVOA 4RJLA 5DHPA 3SIRA 2GUWA 3JTMA 1FS4A 1MEOA 2VHVA 3KO8A 2QTWB 3KYIB 4G1BA 3UAYA 2J6CA 4A8HA 2OD2A 1ZMBA 2Q41A 2V7WA 1R0SA 4GOKA 4XIJA 4AM8A 3UBTA 3HXTA 4L2IB 4Y2HA 4X54A 5TJHA 3C3YA 3IAEA 4AJIA 2R62A 4A0RA 2Q4RA 1HYQA 1OLXA 2FRXA 3MINB 5K99A 4RKRA 4TLEA 5BSUA 3VU1A 1FL9A 3GI1A 2LDXA 4A9AA 1C8KA 2VDWB 1LJLA 4ME6A 3ST7A 3GP5A 1F48A 3A37A 5LYJB 1NAIA 4X1IA 1DQYA 4U7TB 2QW8A 3EIUA 4Q66C 3JR3A 3CXUA 2H1IA 6YASA 1ZBDA 1CY0A 4FHFA 2V7EA 4H27A 5AJVB 3LCVB 3UWMA 2XE7A 5IT0A 3AY3A 4BIIA 2OZPA 4N39A 4AJJA 3EMBA 1WIWA 3BULA 1CE8A 3JVDA 4C76A 4DCTA 4RXUA 4C6RA 3H0CA 2FHPA 3HSYA 3TKLA 4FFNA 3LFUA 3ROKA 2OCBA 4OY3A 5B36A 2DFVA 1KKMA 3NV9A 5LBUA 5CFMA 4P08A 2MINA 3U3OA 1A5BB 2OBFA 2ON6A 3OEED 5ELLA 1NSFA 2XZLA 1BS2A 3NNNA 4DYHA 1QH1B 2XGJA 3RC9A 4QAJA 2G9UA 2YV2A 2AJTA 3EW7A 5J23A 3LYLA 4UHFA 3RB8A 1PGJA 5B6IA 1EX9A 2LUOA 3L7BA 4XD2A 4UD6A 4Q24A 1C4KA 3GOHA 3T7KA 4F72A 3PNYA 1QOQB 1RBZA 2PPLA 1Y8AA 3GEEA 2DQZA 4PAGA 2ZRBA 1CUYA 1J0AA 2WF6A 3E9QA 1RYDA 4XD7D 2SECE 1DJPA 3RTDA 4UOZA 4XWWA 1T26A 2V8OA 4CL3A 3BDVA 1XLUA 3O4JA 2POCA 3R8FA 2FP4A 3AUAA 1R8XA 2GFHA 2C8JA 4OQZA 4MICA 5AMXA 3F67A 3X1DA 4ZA2A 3TTTA 3KPWA 4YT4A 2EEZA 4F46A 3GD7A 4FZ3A 3CE6A 1TE2A 2AC7A 3DHVA 3VR2A 1QHEA 4Y9RA 4G97A 1AB6A 1H2YA 1IWPB 3UA3A 4EPXA 2HPAA 1UMKA 4IGIA 3DLTA 4C9BA 1AQIA 1X1AA 1ZC3A 2NXEA 3DZBA 3G23A 3SQMA 2GOYA 2C9ZA 2CNWA 1RCTE 3BCUA 1YCDA 1DQRA 4TYMA 4EY8A 4RSRA 1MXHA 2VDWA 4MITA 3V34A 5JJ5A 3WGNA 1HYEA 4V1CI 5FEUA 2DC1A 5BW4A 5LYJA 3CLKA 1LSJA 4ARBA 4F3KA 3QVXA 4GMKA 5C7LO 1Q1EA 2ZUUA 3G68A 2EW1A 5FLXA 1KVRA 1BYIA 1R8JA 2X15A 4C0XA 3KE8A 1NUQA 3F74A 2DHRA 3HBLA 2PZEA 3G1TA 2C7VA 3P5BA 3R7NA 1R50A 1TAHA 2QJOA 5EKUA 2IZ6A 4MI6A 3WK9A 3KUKA 3OPQA 5JCJD 2EBHX 3PGJA 3LP5A 3PC7A 1MB2A 4HVTA 4FMDB 3WGLA 5JROA 4TV9F 2R84A 1G18A 5FR1A 1PV2A 4BTLA 4R1OA 1ZAYA 2N3ZA 3AB7A 3QNMA 5HIAA 1QH1A 2BGJA 4KE6A 4D9FA 3VNBA 4D8TA 1E9VA 4A5SA 1Z5GA 1VMAA 2O2IA 2IC5A 1QIIA 4OB8A 4DC0A 1UBEA 4ZDJA 4BPBA 4QRDA 4U5QA 4YVFA 4U0JA 1UBLS 2PRZA 2B98A 4FYHA 2O5VA 4NABA 5JATA 5J59A 2PBFA 3KG2A 1SVSA 2PGNA 4F5ZA 2HA0A 1W2WB 3QYFA 5IKEA 3AWDA 1Q15A 1LA2A 4LIPD 2BSXA 2HNBA 5H82A 1TXGA 3EXG2 4LXHA 3KQUA 4C6TB 3Q8LA 3L0OA 1KBQA 3FGPA 4L5AA 3HKCB 3OY7A 4TV8F 5ESWA 1II9A 1BDJA 1UIRA 1FTGA 3FMGA 3LCJA 4OP2A 3LTNC 1WAMA 1FYEA 3FXAA 2IDZA 3VJMA 5AVTA 1WMSA 3OFNA 2A58A 2C7OA 4M55A 1LW6E 3VX3A 1QCYA 1Q1AA 2GN6A 3JYQA 2JCBA 3TNJA 4BLWA 3X1YA 2QUAA 3U7RA 4WLFA 1QCZA 1UC9A 3CGGA 3INTA 5D1NA 3J81A 2BC9A 3I45A 3TKAA 5IFKA 3UFBA 2J3KA 2I99A 4GM0A 1DU4A 4B83A 4BO5A 4I08A 4C4PA 2F67A 2QVXX 2OO3A 5J4KA 4XSGA 5C51B 1GOTA 4RMIA 5C35A 2ZE8A 3MPOA 3DMGA 3IMFA 2PWYA 2HREA 3NOVA 4BX3A 1ZAKA 1UMBB 5D8DA 3BWMA 3ESXA 3ENZA 1VGRA 2QQFA 3NHFA 1W5EA 4R69A 3YASA 3HO6A 3QOWA 5I7SA 3Q5DA 1AKUA 4BBPA 2D0DA 5CNKA 1PJQA 2ZB4A 3PR1A 5LP1A 3KKKA 4FC6A 4OQNA 2C61A 3HCBA 4KXVA 3KQMA 4RENA 4IIEA 4YP5A 5EQJB 5JRDS 4Q4JB 1HKUA 3ELDA 3H1PA 2JEYA 5C1OA 1EVEA 1IQ0A 2HC9A 4EFMA 1AF4A 1XEXA 3ROTA 1TZKA 2B7LA 4DA9A 2C78A 3UJCA 5CA1B 3B3AA 2QZSA 4PG7A 4L8LA 3WKCA 4WTOA 1NPYA 4Q3CA 3NX4A 1K2VN 4NPAA 5BW8A 2VHZA 1IRIA 2YY6A 1E6CA 5CNIA 1UKBA 1XUOA 5FOQA 1G5RA 2Z2IA 4EL5A 1XZJA 1GTL1 2QG9A 4FC7A 5CLGA 4I8DA 4I99A 1JKMA 2H59A 1W0JA 4WOBA 4ISBA 1IY9A 1XRJA 2WWIA 1QRRA 3I9MA 1M5TA 2B3TA 1JJBA 2X2EA 3IBSA 4QU0A 4WASA 2YV5A 4L3VA 4E5KA 1B93A 2WILA 3Q3HA 4MW6A 4PYLA 4Y1EA 5KKCA 2HJGA 1F8FA 1R5OA 4FS3A 1MJFA 3T3IA 1G8PA 1ZL2A 2IOQA 4C6TA 1CSEE 4PX3A 1KRXA 1S2IA 3HKCA 4YV1A 5LQJA 2Q3HA 3RVLA 2Z1NA 3BFPA 3S27A 2NUPA 5B58T 3C3EA 3WKBA 4G8DA 3E3NA 1Z6GA 4HGNA 2PV7A 5AHWA 4L72A 5H5JA 4E5YA 1QGOA 1Y1RA 3P9PA 4NV1A 4AX8A 5HRUA 1RWOA 1SOVA 3K20A 4KXNA 1I6KA 1ULBA 3OZEA 4CM9A 1Z36A 3NT4A 1YA6A 2C2HA 4RK7A 3WIEA 1EG2A 3VZDA 3L1IA 3REOA 4DCMA 4MWZA 1A96A 4LDQA 4P4NA 3NTRA 4FFRA 2LCFA 1FP6A 4NCJA 1Q3HA 3KJGA 4BECA 1EAYA 2YMQA 1OFTA 5AW8A 1UMBA 2RG1A 2Q3LA 2GBLC 4Y9TA 3DFFA 4E5SA 3M34A 2HA6A 5BPHA 3P7MA 1U63A 4LFAB 4YXWA 1JPJA 3HPRA 1JAZA 1E1KA 1QXSA 5B1HA 4B3TB 2XT0A 4AG6A 2HSJA 1X2BA 2ZWVA 4ID9A 4YREA 1KE2A 3T3OA 3B6ZA 3ENKA 3BSWA 3JPYA 4Q4JA 3L0YA 4YRLA 5BWBA 1T24A 4HEA6 4DQKA 1U99A 4IUCS 3E8XA 4OHXA 4PLPA 4QYSA 2FAXA 5CA1A 5F51A 1WLYA 3BMCB 1C0IA 2XUPA 2FN8A 3WYBA 5A9RA 2C2OA 2QENA 3RU7A 3WISA 1N0WA 4DMGA 3H05A 1CF2O 4E08A 4LC1A 1OV4A 5LXTB 3HUFA 4RJ2A 3PCXA 1L3IA 2VJCA 3H3FA 1YTLA 3E18A 4TL6A 4BUCA 4LGYA 5K3OA 3AL3A 3DOIA 3KKLA 4CCWA 4NXNB 2B4YA 1MOZA 1SXJC 1P4RA 3NWOA 2WM3A 4PLVA 1ZUD1 4G6ZA 4L22A 4N54A 3SZOA 1TM3E 2JIPA 4D25A 5EJ7A 1J2JA 1Q11A 4KTVE 4QYMA 4A4DA 3T5GA 2JFFA 4D3XA 4KKXB 2I2XB 3VZSA 1BMQA 2HA2A 4B48A 4DMRA 2FUG1 2E4VA 3O2QB 2OGTA 5CAEB 4AO6A 3OZTA 3UW1A 1PBTA 1FUIA 1D04A 3HABA 3QKIA 2O3UA 3FRHA 1BTOA 1GQYA 3E9RA 3AUKA 1YI1A 1GZ3A 2PBLA 1H66A 4RANA 2P9BA 3FTDA 1AN9A 4GUDA 5FFMA 4J16A 4RCZA 1DRKA 721PA 2OSVA 1A97A 2C84A 3A3YA 3PE4A 4YAWA 5K0TA 2JKYA 3AJDA 3O83A 2VBIA 3MAJA 5KVVA 4M86A 3EEYA 3AVXA 4KGZA 1EZZA 1A4UA 2B6NA 2COEA 4UHJA 1YL6A 5DTJA 1W8DA 1OFHA 3DGFC 4DDUA 2VUIB 1TKCA 4GI7A 4A2WA 3B9RA 3LOPA 4WLOA