4QGHA

S.aureus tmk in complex with potent inhibitor compound 47
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
204
structure length
195
Chain Sequence
SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNQRFKSVNADQPLENVVEDTYQTIIKYLEKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 195
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qghA00
4JBWA 1P3JA 2RGXA 2VP2A 2GNOA 1XPRA 4N3NA 4C4PA 3UATA 1E9FA 1D2MA 4YMTA 4US1R 4CZ2A 3EPJA 2WJVA 2V7QA 3MGCA 1G21E 1E1RD 1E99A 3AP1A 3D31A 2QT1A 1GKUB 4AURA 4DIEA 4AD8A 4D6PA 1FMJA 4MKGA 2NMVA 3EX7C 4JYBA 2XEXA 4D4MA 3TSZA 5JLJA 4EJSA 1YJ5A 4YDHB 4M0LA 4GMXA 3Q7QA 2F3RA 4LHYA 1LW7A 2IYLD 4LJ4A 4D25A 1DAEA 4MRNA 1UBFA 2CCKA 2ZYVX 1GKYA 3QF7A 1X8JA 3PEVA 1YRBA 5FR2A 1NI3A 1YZNA 1Q1ZA 3F3YA 4FW9A 3LFUA 3QE0A 1I4DD 5TV2A 3ZYCA 3RSOA 3PG5A 2DFKB 1OXVA 4M2LA 4YC7A 4A82A 1NJGA 3UK6A 2GAAA 3OIVA 1N5KA 2VP6A 1GTVA 1S0UA 3GFOA 3THYB 3AKYA 4NCJA 4ZDIA 4KU4A 5KPDA 1O3YA 3TH5A 2WJGA 4HAVA 4QRHA 1IN4A 2ZE7A 3GLFA 3NEYA 3VX4A 1WE2A 2IHBA 1K5DA 2NO6A 3WRXC 3CH4B 1GUAA 3Q8XB 3LA6A 5JWOA 5JSZA 2G3YA 3GLFE 4Q4LA 4ARZA 2HV8A 5L8VA 4XOIA 1P72A 3GLFB 2FOLA 4Z51A 1QBKC 2BBTA 4CYMA 1LFDB 1XJ0A 4QHSA 1HUQA 2BCJQ 2J45A 3QG5A 1G41A 4ARZB 2FX3A 3AUXA 3OEHA 4R2HA 3SJAA 3MAAC 2XGJA 4LJYA 2W0SA 1F2UB 3UMSA 1T8TA 4MGZR 1OHHD 2CJWA 2A2ZA 5FBRB 1ZYUA 2BM1A 2A3RA 4HDQB 1GFIA 1TAGA 3GFTA 3SDZA 2OV2A 4QJ3A 1OFHA 1OXXK 1RPZA 5B57C 1W0JA 2CJWB 2RGNC 4A4DA 5BYKA 4D0GA 1UADA 3FOZA 4C2TA 2C95A 4PHHA 3ZGXA 2WJIA 1E4VA 1GAJA 4V0OA 4GT1A 4NZYA 1E32A 3GLGE 5AR1A 2G6BA 1W49A 3MFYA 1C1YA 4MQBA 5GJWC 2OE2A 1E4YA 4IOMA 1VG8A 3GLGB 1KAGA 4B3FX 4FMDB 3K0FB 2Q0HA 4UNRA 4IOJA 2CK3A 4WXPA 3ZZ0A 1I2MA 4ZI3A 1H8HD 5DH9A 1N2CE 1Z0AA 2LKDA 2VA8A 1SHZA 2CL7X 4NYMQ 2FFHA 3UKDA 3T5GA 4BGDA 3SBDA 2G77B 1KK2A 4HDOB 2WOOA 2EWVA 4A0RA 4C9BA 2ZS7A 1KI2A 1EFTA 3TE6A 5FL7D 2ZANA 3BH6A 3K09A 4CVNA 1DVRA 3QKRA 2IXGA 3U61B 1T5LA 4C7OB 5FH9A 4DB2A 3AKEA 1GRRA 1U99A 1TUEA 3EA5A 3KXIA 4QGAA 3TKLA 5GJVC 3ZVLA 3EC1A 5FOVA 2WSMA 4CDGA 3QKRB 4QJ4A 1F6BA 1KI9A 2OEPA 2BEKA 1QVAA 1RYHA 3SOPA 1NSTA 3FMPB 4IDQA 2QQ0A 1T4GA 3P20A 4HAZA 5CYPA 1JAHA 2OHFA 1Z83A 3FTQA 3HU1A 3N5CA 2PCJA 3WBJA 5JEDA 2QRZA 4DJTA 4NDZA 1E9BA 2WIBA 3DKPA 4TSFD 4V0KA 4Z54A 5L3QA 3U7HB 2ZU6A 3ETLA 4WZBE 1QHHB 3ICEA 2JCSA 3FHTA 1G18A 2OCBA 3UXMA 4F93B 2BHRA 4M1YA 1D8TA 4KAXA 2IYVA 1P75A 121PA 1Q3TA 4NU0A 5SZJA 3PEWA 2G0NA 3G5UA 4TLAA 1JPJA 1LNZA 1J2JA 3FE2A 3K0EA 2HJVA 2FFBA 1KKLA 1TU4A 1A4RA 1T0HB 3TQCA 3SYKA 4FINA 1GSIA 3RDPA 5CYOA 1E2DA 4LPKA 1GKIA 2ZR7A 2C04A 3EZ9A 2PX0A 1K6MA 3K1JA 3O8BA 2BC9A 2CVHA 2EFHB 1TPZA 2CXXA 2YYZA 3QVUA 2JA1A 4JL5A 1JNYA 1R4AA 1T6NA 2CHGA 2IXFA 4A36A 4B48A 2CMKA 3GJ5A 4TT3A 4YMWA 1QG2A 4MYTA 3C7KA 2MSDB 4YLGA 3QXCA 2OCYC 4TMTA 2GA8A 4Q7LA 4TL6A 5KSYA 1ZRHA 1ZM7A 2QPOA 1OIWA 4B44A 2J1LA 4I1OA 1OFIA 2JGNA 1EG7A 2QA5A 4QL3A 5EQTA 1M6NA 3BD9A 3K9GA 4HATA 2DCUA 2FU5C 2E1RA 5B2ZA 2X8AA 1KI6A 3MWLA 1DAMA 4PSKA 2BMFA 3K9NA 2QE7D 2PMKA 2RAPA 2DWOA 1AZSC 5HE9A 3ZS8A 3HWSA 4DSNA 5HZHA 1XTRA 3U3KA 2PCLA 2O8DA 3H1TA 2FG5A 3BRWD 2N46A 2DWQA 4AG6A 4YDSA 4EPYA 2QG6A 1GG2A 5FUYA 4MRVA 1UBGA 4WAUA 1G1MA 4C0LA 4TMZA 4A6PA 4A2PA 1U0HC 3A58B 3KJEA 2KBEA 4XJXA 2REXB 4OI1A 4I1SA 1XPUA 1TNDA 1OPXA 4R7ZA 2XTZA 2DWPA 3K0CA 1G3RA 3IIMA 4FCWA 1YR6A 2V4ZA 5DISB 3MUFA 2GVZC 2ZRJA 4M1WA 3T1VA 3VAAA 1NF3A 5EP2A 3KQUA 4O3MA 1NKTA 5KDOA 1SVWA 1GP2A 1MABA 2IBMA 3ZLJA 2JLZA 2IEZA 5K8TA 3V4FA 2HLDA 3HYTA 1QG4A 1R5OA 1VYVA 2GCOA 4POAA 1FQJA 2V7QD 2ZI3A 5FTMA 2NIPA 3V9PA 4A9AA 4TTQA 2JLVA 4HZUB 4UXIA 1E3MA 1TF5A 2P5SA 4M1TA 4Q1AA 4URUR 4NHOA 2ZETA 3LVRE 2ANCA 1E2HA 1G7TA 2EFCB 4BLRA 1X6VA 2LKCA 3DZDA 5HKKA 4F4IA 1EFCA 1WB9A 1OT3A 4M8NE 1ZIOA 3KDSE 4IRUB 4OL0A 4IEIA 3J81k 2ZR9A 1I4LD 1SKYE 1ZUIA 5DGXA 2QTHA 1E2JA 1KSFX 1HURA 3SYLA 1SKYB 3U7FB 5CLQA 2P0EA 3B6EA 5E7JA 1S9DA 1DEKA 3QBTA 5FOTA 5FTJA 2ZIAA 1Z5ZA 2CE7A 3B5JA 3H2YA 2DFLA 2WJJA 1IM2A 1NMXA 2ZRBA 2R44A 3HR8A 1EX6A 3D3QA 1YRAA 4LHVA 2G88A 5IDVA 4FCVA 2BMEA 2VEDA 4EUNA 1AS3A 5L3VA 1BS1A 5TVKA 1YZGA 1N6KA 3BH7A 4JVSB 3GPLA 2BWJA 3QF4B 2VP9A 1OH8A 1Q1BA 2ODEA 5HCNA 4GZMA 1UKZA 1PUIA 1N6PA 1DADA 1FZQA 3B9PA 3CX7A 3RRMA 2WJHA 1RYFA 1SVMA 2ODWA 3N2IA 1RC8A 4B43A 5C4GB 3WMGA 1CRQA 2AFIE 1YZTA 5BN5A 4XVRA 4CRWB 4TTRA 1Q1EA 5FPKA 1VCIA 3G0HA 3BB4A 2WAYA 4LJ5A 3OEHD 1XTSA 3L82B 3LY5A 4DUGA 5FOWA 4AKIA 4ZIRA 1FUKA 4TTPA 1N6LA 5HTKA 1HV8A 4CGZA 5TXGA 3U3JA 1XDBA 4K81B 4P4TA 1XZPA 3KZ1E 3WHKA 5EXSA 4URZR 1FX0B 1W0JD 2NZJA 3VNVA 4M9QA 4JKIA 3WHLA 3C4JA 3OZXA 5FI1B 1RJ9A 1NLYA 4GOKA 3B82A 5FBWB 4KVAA 3UIEA 1IHUA 3DL0A 4XTRA 4QHTA 3VHXA 5B30A 1GITA 5JI3E 4KYUA 2OCPA 3C8UA 1Z6TA 2ZI5A 4QJ5A 1O87A 1GNRA 5F98A 3BC1A 4TL7A 3ADKA 4AKHA 2Z83A 1IONA 4NYJR 2WWIA 2Z4RA 4Q1CA 2CK3D 2WWYA 2BBWA 1DOAA 1KKMA 2G83A 3EWAA 3JZAA 5AUOB 2KI5A 3I8SA 4BZPA 4G5SA 5D3MB 1N0VC 4XIGS 5DHAA 4PX9A 2NO1A 1P2SA 4LK2A 1S8FA 4ILEA 3BFVA 3BOSA 1JI0A 2HUPA 5FPTA 5LB4A 1OH7A 1G6OA 1KSHA 2AXPA 2IS1A 2RB4A 5TB5A 6Q21A 2R6FA 4MKFA 4PSAA 3ZZTA 4C0SA 4UJ5A 1ZMXA 3QXHA 4B75A 3LBIA 5J4LA 4RD0A 4ABYA 4E09A 4G5RA 3U44B 2VF7A 3W5IA 3VR3A 1AGPA 4G1UC 4P4UA 4GOXA 1MT0A 1B0UA 1Q22A 4U00A 4Q9HA 3C16C 4XWKA 2ZXUA 1GNQA 1G5PA 2JEOA 1ZAKA 4LYAA 4BASA 1A7JA 4W5HA 4A0FA 2YC4C 2CL6X 1DO0A 2ZRAA 3NIBA 3QOFA 1GL7A 3SHWA 1MO6A 1SGWA 3CZPA 4M4SA 2ZM5A 4C0BA 2ATXA 1S4QA 3K53A 2NPFA 1E2LA 1YQTA 4A92A 1VG0B 3TBKA 4LJ6A 3QKSA 2NO9A 3GJ6A 4X8OA 5EZ6B 5KSZA 4W9MC 1SVLA 1HE8B 2ZRLA 4DLSA 2F43B 4URVR 2QY9A 4HI0E 5LDDC 1E2GA 5JBQA 3R8FA 4TZ0A 1AGRA 2ZRPA 3HR7A 1T91A 3IDQA 4OHYA 3QKSB 3LD9A 2O8CA 2C78A 1YE8A 5EE1A 2ODNA 3QSYA 3THXA 1G4AE 1M1YE 3PVSA 2DY1A 4BFTA 4DLRA 3BH0A 4L4UA 4OKSA 2FF7A 2IUSA 5CIWA 3IPXA 2ZS8A 2HXYA 2IX3A 3DO6A 2RKOA 3GJ0A 5AUNB 2O8CB 2AR7A 2QU8A 4WA7A 4DXAA 3AB3A 3EPLA 4TLEA 4A15A 3ND9A 1DG1G 3BWDD 2E9SA 1L7VC 2Y8EA 4BZXA 3AF3A 4IFBA 4TT3D 1XXHA 1AS0A 4LOAA 2RGBA 1XCMA 4CEJA 1W36B 4DWJA 1H8EA 1XXHE 3L8ZA 3RS7A 4H1UA 4MGIR 3NH9A 5FBQB 2QTVB 4Q9LA 2C96A 3EA0A 1XXHB 4JKYA 3MD0A 1XFAA 4OHZA 2L0XA 5FTNA 4CEJB 1PV4A 1W46A 5C1BA 4OI0A 4RD4A 5H68A 2XXAB 3KXLA 2X2EA 4PZZA 2J3EA 3JZMA 5AJYA 4A0GA 1Z0JA 4ESHA 2VIIA 3A1TA 1ZM9A 3F5FA 3IQXA 2GJ9A 2QM7A 3IHLA 2C98A 3X1ZA 1DELA 1J7KA 3H0KA 2JJ1A 1KDRA 3FYHA 1T3SA 1KHTA 2QQEA 2FN4A 1HH4A 4LHZA 4D4LA 1KI8A 1TL7C 2RMKA 1QF9A 3ZQJA 1NBMA 4TMKA 2GESA 5B58C 4HYYA 4G3XA 1JR3A 3RWMB 4B3DA 2G1KA 1KO7A 2ECKA 2GZHA 3HP1A 2R6DA 3NVAA 3O47A 4B47A 2BEJA 1M2OB 2IF0A 1JR3E 2HLDD 2IT1A 4NPHA 4OK3A 4DHEA 1NG9A 1BIFA 2X77A 5J4HA 1M7BA 5A4JA 1CF4A 1N6RA 5TDHA 2DB3A 1JB1A 3AF1A 3AKDA 2ZRHA 3CKLA 1E79A 2HEIA 3JVUA 4D0NA 1JAIA 1NVXQ 2V6IA 4HLDA 1R10A 5KTYA 2AN9A 1TMKA 2F3TA 4NE2A 2OESA 5HKKD 1XEFA 3DEFA 4OQXA 3EXAA 2DYKA 4D26A 3OIWA 1UM8A 2O0JA 3PUVA 3LNCA 3TUIC 3THWA 2WJYA 3KFVA 4PQYA 4TYQA 1KZGB 4DSTA 2GRJA 2VYFA 4FIDA 1LF5A 1E9AA 2CVFA 1Z63A 4N1AA 2O0HA 3B60A 5JHHB 4UXJA 3PUXA 3THWB 2IYQA 1MO3A 2W0MA 4JZKA 3FKSA 4GP7A 4ACAA 4JSTA 3RABA 3RAPR 2I4IA 1MH1A 1S3GA 1E2PA 3DHWC 2WKPA 4S2EA 5E95A 5FPSA 2P2LA 1EFRA 2P3SA 4D4JA 2X1VA 1W4AA 1K8RA 1U81A 4HUQB 2GWHA 3LX5A 4JJKA 1NY6A 1KAOA 1Q1QA 1XZQA 4IOLA 3BERA 1T3HA 2R6AA 4LY6A 1AQYA 2GK6A 1KTVA 5UKDA 3JVVA 5CITA 2BBOA 1S2MA 3T1QA 1E2NA 1GILA 1OKKA 2REBA 2LWIA 4F4CA 1YZUA 1T3LA 1ZM3A 2ZQ5A 4KFSA 3SQXA 2GJ8A 2UZ3A 3T15A 4V0NA 2O52A 2YHSA 4HZIA 2XOKA 1UPTA 4OBEA 2ZJAA 3C5CA 1Z2CA 1Q44A 1UDXA 1G16A 4DUGD 3TUZC 2H8KA 2GEVA 2GEUA 4YMVA 3LW7A 1P73A 1F2TB 2OLJA 4LYHA 2VHUA 1IN8A 3GJXC 3SHFA 4GRAA 2MMGA 1DBSA 3NC1C 1R5NA 2PMDA 4BE7B 4EKDA 3T35A 4B2PA 3H4MA 1ZIPA 4MYUA 3VFDA 1DG3A 5BWMA 4ZCMA 5F9HA 2K5UA 2HF8A 1XP8A 3CNLA 1DAGA 5DI3B 2GJSA 4DKXA 3OEEA 3NXSA 2IEYA 2NQ2C 3BFKA 3PUWA 3IBYA 4TMVA 4AY2A 4B2LA 1KI1A 3KQNA 1CTQA 4KFRA 4GZLA 3V00A 3SJBA 3TK1A 2QPAA 3IIJA 4C2UA 3CWQA 3ZZUA 2WKQA 3SBEA 2WICA 3EIEA 1W7AA 4BLOA 4KLNA 3CUEF 4Q00A 3ADBA 1D2NA 5CIQA 5FUVA 3NHBA 5KNDA 1XMIA 1TADA 2J46A 3WXMA 4GP6A 2C9CA 4FMCF 3SJZA 2C2HA 3E1SA 5G41A 5G3YA 5F3WB 3P32A 2EVWX 1JXMA 3WYFA 1E9RA 4XWOA 4B74A 3QKUA 3CONA 1CEEA 1TQDA 4I81A 2ZI6A 4B3GA 3K9LA 1W5SA 221PA 4DDTA 3AVUA 2WSSA 4KLZA 4AKEA 1A2KC 2CNWA 1Q57A 4II7A 4RZXA 1UKEA 3TW8B 3EC2A 5EXPA 4JLDA 1W48A 5DHFA 5EUQB 3FDIA 3T06B 5ELXA 1ZM4A 3KKPA 3VMFA 1OSNA 1L2TA 2OT3B 1Q3HA 1YKSA 1J90A 1ZCAA 3K8YA 3AVXA 2FSIA 4EQ6B 4JBYA 2WPDD 3THYA 1KO1A 1F60A 2GF9A 2ZI4A 1OXTA 4WXRA 3CX6A 4FD2A 3WMEA 3NBXX 2IK8A 1EK0A 2Z43A 2JLXA 2QMEA 2WBLC 2GXAA 1NVUQ 3LV8A 3A4MA 4YXWA 1S1MA 2H16A 4FN5A 1GVNB 3VQTA 4US2R 2BM0A 1VYUA 3P4XA 1SQ5A 4U02A 3G82C 1ZINA 3IO3A 5DIFA 2ZPTX 2ZRDA 4LYJA 2JDIA 621PA 4NYIQ 3AF2A 3GEIA 5FUXA 3LXXA 5FOUA 3MRSA 5AUPB 4JLJA 3I1FA 2RGNA 2VL7A 2WVJA 4PQRA 1F2UA 1LV7A 1U98A 2ATVA 3KQHA 2GBLC 1COWA 4LV8B 1W1WA 1W36D 2C03A 1KSGA 4ZCIA 2LCFA 1TF2A 3ICQB 4L9SA 3NEJA 5JECA 1X86B 4K46A 4HLUA 4HAUA 4NH0A 2RGDA 4XTCS 3F0TA 2PBRA 1H8ED 3AVTA 4TYWA 1OF1A 1T5IA 4RCZA 2GEDA 2ZVPX 1HQCA 2VF8A 2CHVA 4GDFA 1Z0IA 3R7WB 1UKVY 2KB0A 4PC2A 4RD1A 1JPNA 3OE7A 5G53C 4QFMA 4BLPA 4XD7A 4CEHB 1XD8A 3MWKA 5GJCA 5CB6A 2PLFA 3GLGA 1E98A 3AGQA 1G7CA 2CLDX 1PLJA 4TN1A 4YONB 3VR2A 1ZU4A 4LI0A 3K0FA 3KJHA 4KXFB 4DB4A 2XNSA 3PENA 2QEQA 3ZD7A 2GILA 1P2VA 1U8YA 4HLUC 4MYCA 1FFHA 3QPUA 1NIPA 2D2FA 4DEXA 2IC5A 1Z47A 3I4LA 1DAFA 1GIAA 2OAQ1 4MGYR 3U3RA 2AHOA 5GVSA 3ASZA 2FE4A 2JJ1D 3IQWA 3GP8A 2ZRMA 4QGHA 1NJFA 2IYYA 4Q4HA 3EASA 4R98A 4WZ6A 1RFLA 1NN3A 1DO2A 4D4KA 1NBMD 2J0QA 4LHXA 2BMDA 4C7OA 3FHOA 1JR3D 4OJQA 2G9NA 4R9UC 3RNLA 2GVDC 2H5EA 4GI7A 4HB3A 4Q4HB 5BQ5A 5JJLA 4C30A 2FA9A 1NKSA 5DSZA 4L15A 1AN0A 2Q9BA 3KJGA 4Z8YA 2D74A 2A5FA 4JLAA 1E79D 4JS0A 1W5TA 1G20E 1WMSA 2R62A 2UZIR 5SZHB 4XSHA 4F4JA 1ZD1A 4OI4A 3ZJYA 1FMLA 1R8QA 1DAKA 1X3SA 2XAUA 4QNRA 3GMTA 2FH5B 4HSEA 3MWJA 3SR0A 1QHHA 1IAQA 1NVVQ 4P4SA 1U0JA 2YZ2A 3UPUA 3EIHA 2PJZA 4BPBA 5FBVB 5AJZA 4F91B 2Z6VA 4P4SB 3FKSD 4M22A 2JLWA 3BIFA 3B85A 3CNOA 1SVSA 1EFRD 1JXOA 4BFZA 4Z1MA 1DE0A 1OE0A 2C5LA 4CF7A 1EESA 4A0HA 4BRUA 1E9EA 2YJTD 4N0DA 2ZRNA 1N0WA 3WNDA 3FGNA 1T9HA 2IHYA 3FVQA 4JT2A 1VG9B 5FFMA 1OFUX 1II8A 4M21A 3C5HA 1E0SA 1KJYA 1P9NA 2BMJA 3CX8A 5JS7A 1GM5A 4MDEA 1NG1A 1CJKC 2NO0A 3R20A 4A2QA 1Z06A 1CKEA 4UNQA 3I61A 1OKKD 1YZLA 4R71A 2NG1A 4ZKDA 1II8B 1XTIA 3CBQA 1GNPA 2TMKA 2FPLA 2ZSDA 3AV0B 4QXAA 1VDZA 1AIPA 1E2MA 3H84A 2XOKD 4EPWA 3L8YA 4Z8XA 3EAQA 2ONJA 2VSFA 2AK3A 4D81A 3ASYA 1N5JA 2E87A 4KFTA 1OH5A 1HTWA 4MITA 4LWZA 1RVDA 4B6EA 3EZFA 2F9MA 3B2EA 2ZSBA 4HUTA 2XSZA 4OHXA 2PEZA 2F1RA 5EUMA 3UWKA 2BIFA 1FL9A 1Q0UA 4DCUA 1XEWX 2IS4A 4F38A 4KVGA 1ZVQA 2ZRCA 1VYTA 5DI9A 1BOFA 1N5IA 3RANA 5EXXA 4TL9A 4DCNA 4LBZA 2ZE6A 4KITB 2VRWA 4M53A 3MJHA 3W8RA 3LBNA 3M0EA 4OQLA 4Q47A 1ELOA 521PA 3M6AA 4AC9A 5BN3A 2O8BA 1K5GA 2FFAA 3L0PA 2VSOA 3A4LA 3OEED 3WMFA 1OB5A 1OIVA 1X8KA 4LUCA 3I72A 1RRCA 2ORVA 4NTZA 5JWHA 3RHFA 3TVTA 4WZAE 2ORWA 2EQBA 5CM8B 3RC3A 4KJZA 2J87A 2FGKA 2B8TA 2O8BB 5CJPA 4QBHA 4MRSA 4AG5A 4C0JA 1WCV1 4NYMR 3QPVA 4HZUA 1XMJA 2P5TB 3REFA 1IJFA 3BB1A 3LAWA 3TVDA 2KJQA 1XMSA 2OXRA 1JQLB 2CL0X 2OILA 3CNNA 1SXJE 3KB1A 1NSFA 1P6XA 2P67A 2HT6A 4R2IA 4W7SA 3VX3A 1IY1A 4MRRA 1SXJB 2Q9AA 2WSSD 2CNWD 2OUKA 2XX3A 2J7KA 3AF4A 4M1MA 1E1QA 3B7GA 3EARA 3H86A 1CR2A 1RKBA 2W6IA 2MMCA 4KO8A 3LW8A 2X2FA 2EWWA 4X8LA 3KX2A 1N25A 1KI4A 2DFTA 2FEOA 4HLQB 1SXJC 2XTNA 3I8XA 1MR3F 3IKJA 4LJAA 3CPJB 3FPAA 3QUSA 4BFUA 3U4QA 1M74A 1EXMA 1J99A 3QF4A 2QPTA 3AP3A 3GCGA 3QKTA 1TEVA 2CLCX 4YXWD 3TRFA 3U4QB 5AUQA 3QJYA 3VR4A 1NLFA 2FJUA 3BBPA 5AK0A 3RS3A 1G64A 4GFDA 2D06A 2BV3A 1GOTA 5JJKA 3D7MA 3DVLA 3KKMA 5CJ2A 1S3SA 2JDID 2JIZA 4US0R 5KUTA 2UKDA 2VQSA 3SC3A 1Z6GA 2W6JA 2XNDA 4DZZA 2V3CC 4QHYA 5GADl 5L3SA 3VKGA 4MKHA 1KNQA 4LDJA 4XVUA 1KY3A 4IW3B 2O8FA 4KBGA 4QKQA 1MO4A 4TQ9A 1COWD 3BGWA 1N5LA 4LGMA 4RJLA 1TQ4A 1J70A 2O5VA 4IVPA 4NCIA 4PPGA 5L3SB 4GPTA 2YINC 2VHQA 4Q4JB 3CIOA 3CRQA 2PZGA 2O8FB 4BLQA 4C0HA 1Z0FA 3U5ZB 4B76A 4Q9KA 1FX0A 2QROA 3SJCA 3SU8A 5K8IA 4PXAA 4E5UA 4DSOA 5G40A 1T0JB 5JCPA 2FZ4A 3O8RA 3L0OA 4OK5A 1XD2A 2HCJB 2WWFA 2I1QA 3OE7D 2QAGA 2OAP1 4XD7D 4ZPXA 5BXQC 3GLHE 3EPKA 4IOKA 1CXZA 3LH5A 4ERNA 1N6IA 2OSBA 1XD2B 4Y0AA 3GLHB 2YOGA 4TLBA 1XMVA 4L9WA 1XEXB 2QAGB 1M34E 3O8DA 1GL6A 1BKDR 2PZEA 2IYUA 2ZI7A 3VTKA 4A8JA 1RRPA 1UFQA 2ZE5A 1FUUA 1QHNA 5D3MA 3FFBA 3DKVA 4UNPA 4Q9IA 2A5DA 3IUYA 1EGAA 1P2UA 2QAGC 2QENA 1AKYA 4A8JB 1DARA 5CM9C 3I5YA 3KXKA 2FWRA 1RRFA 2JLYA 3ZD6A 5DN6A 2IYXA 4J0QA 4PSVA 3K70C 2F7SA 2ZSEA 1ZUHA 2ZUCA 1D9XA 1HT1E 3U44A 5JHGB 1CULC 4A8JC 4IDPA 1RE0A 1S1CA 2ZITA 3AVVA 2SHKA 2GXSA 4AYWA 5KHOC 1GRNA 2J59A 1IJEA 2V6JA 4C3ZA 3W3AA 3QXJA 2R8RA 2B92A 1ZP6A 5HCIA 1L4UA 4G0NA 1Q21A 3LWNA 4DLTA 3ZVNA 1NN1A 2F9LA 2FNAA 1F48A 5B64A 1VG1A 1RRGA 1GWNA 3AVWA 2ZAMA 1LS1A 1E9CA 2AWNA 1N6OA 2JLSA 4ZKEA 2F43A 3RS2A 2WPDA 4YMSA 1VECA 1IBRA 1OIXA 4JLOA 1R0ZA 1G3QA 1VMAA 1Z2AA 3MMPA 1SVOA 5EXTA 1G7SA 1F3OA 1HQYE 2QGZA 4Q19A 4JLPA 5D3QA 4M9ZA 4G01B 4LJ9A 4KV9A 1FNNA 2NGRA 2J41A 2XJ9A 2ORIA 3LQQA 1E9SA 4LZZA 2FFQA 4Z1MD 1ZU5A 3BJIC 3ND8A 2F55A 5SZKB 4F92B 4DCSA 4AIIA 3I62A 2KWIA 1NMZA 3B1VA 4BFSA 4EAQA 1XTKA 3DM9B 2XITA 5J47A 3REGA 3DMNA 1V43A 5DE3A 2O0KA 5EP4A 4B3XA 4LC1A 4PPNA 2GHIA 4WW0A 1Z6XA 3K9HA 2FSHA 2IWHA 5JEEA 4BLSA 4JLKA 4C0KA 1E96A 2IF2A 2N42A 5IT5A 2IYWA 4MUAA 2GZDA 4LHWA 2R6CA 2J0UB 1PVOA 2DR3A 2JASA 4PC6A 5AJWA 3KTAB 1XX6A 4Q1FA 2XXAA 2NO7A 1KY2A 4OHWA 2AXNA 3U2QA 421PA 2XSZD 3TAHA 2W83A 4MUBA 4URXR 1US8A 1XF9A 2ZU0C 2VHCA 2C77A 2Z5FA 3RRZA 2HDNB 1DS6A 5ANRB 2F6RA 4BZQA 2FV8A 3RRYA 2AD1A 3ADCA 2PL3A 1R0YA 1US8B 2IS6A 5DLQC 2H1LA 3I3SR 1G291 4U5XA 1WDTA 4OYHA 1Z28A 5JJIA 5KNCA 3AVYA 3AKCA 3PQCA 2QP4A 4MRPA 2RGEA 5EE9A 4IEEA 3FWYA 1KYIA 2HCBA 3S1AA 1OJLA 2VH5R 3WY9A 1AA9A 4JSYA 2B7BA 2AL7A 8OHMA 4BQSA 4OQNA 3CRMA 4I99A 3W6OA 1U8AA 4P0TA 4V0ME 4PO1A 2OFOA 4F7WA 3S1AB 1W4BA 4MYHA 1KDPA 2WOJA 1P5ZB 2ZROA 2QP3A 3PIRA 5GVRA 2DHRA 1ZNZA 4WOPA 1MKYA 1SHKA 4TLCA 1V5WA 1OYWA 1WQ1R 5DO9A 1NP6A 3UANA 2VPPA 2A5JA 5TY0A 5C4MA 1CJVC 1TQ2A 2YWGA 2V55B 1XPOA 1Z6YA 3A37A 4B73A 4CT5A 3AUYA 1G8FA 4M9XA 1ZJ6A 4IJMA 1NL3A 3FMFA 4ZO4A 1CLUA 5EZ5A 2C99A 1ZD9A 1NIJA 4D80A 2AWOA 1E1QD 4B34A 3CR7A 4IDNA 3SFVA 3TJZA 2YKGA 2WWGA 3C15C 2W6ID 1VCNA 3P26A 4DCVA 4P32A 3OF5A 3BE4A 1DTSA 1E2KA 3GJ7A 4B35A 3EIQA 1XCPA 1E0KA 3BS4A 4QC2A 4FMCB 4QBGB 2HT1A 3KQKA 1Q12A 2V1XA 1HYQA 4AKGA 3GJ8A 5M04A 2RH5A 2WM9B 4HUQA 3QPWA 4O2LA 5KO2A 2RGAA 1QDEA 2QP9X 2ERYA 4ZV4A 4Q5IA 1ESMA 1GL9B 1E6CA 2F1JA 1RZ3A 2BJWA 2R6GA 4B33A 3KKNA 1IY0A 4PC1A 2FMXA 4QNMA 4RFVA 1G8GA 1UF9A 1FP7A 2ZRFA 3IEUA 3NWJA 1ZNWA 2BKUA 3LRPA 4FMBB 4B3BA 2V1UA 3RLFA 5K8LA 1G3MA 3Q9LA 3AVOA 1R0WA 2OBNA 2QZ4A 2JIZD 2YWFA 2W6JD 2XNDD 1ZM2A 1VTKA 1G5TA 2ZRGA 5J40A 3Q5EA 1P9RA 4JVLA 4KBFA 4MGKR 4ZI2A 3V4RA 5H1YA 4DCTA 3RC8A 2V54A 2WMNB 1YR8A 1UJ2A 4EFNA 3CRW1 1F2TA 3HU3A 4GL2A 2REOA 3QXXA 4PHTA 3U60B 1BH2A 3TIFA 1NY5A 1UKYA 1G8YA 1VIAA 4ZDJA 2PH1A 3NG1A 5AWFC 1ZC3A 5AJVB 1WXQA 821PA 2QMOA 1KO8A 1W2HA 1G6HA 3R9XA 2A5GA 1G9XA 4V03A 5JWRA 4LV6A 4PO9A 4PTLA 1U9IC 5DI3A 4HAXA 1S96A 1KI7A 4JLMA 3I92A 4QBIA 1XB2A 3VR6A 2QN6A 1J8MF 2X19A 5KU1A 4D82A 5FOXA 2C9YA 5JRJA 4PHGA 2N1BA 4P31A 4LBVA 2ZR0A 2C9OA 2GJAA 3D6TB 1IN6A 1N6NA 3KB2A 3QG1A 2P6NA 4BUJA 4XH9B 3HDTA 2ZSAA 2ZUDA 2HXSA 3HU2A 3VHLB 3OHMA 4WBSA 2CLSA 3B13B 2PJRA 4NKRA 2VLIA 3IPYA 2RHMA 3AVQA 3RS0A 3CPEA 2A5YB 1L8QA 5FBLB 3TW4A 3EPHA 1OV4A 2FEMA 3WP1B 1VIYA 3RSLA 3ZIAA 3BXZA 5DN6D 1G8PA 5H8WA 3LO5A 3TAUA 1R7RA 4RSGA 2YWEA 1QZXA 1SZPA 5JCZA 1NN5A 1JQJC 4IHQA 3FFAA 3W9YA 1T8UA 1FP6A 1KZ7B 2VSXA 3K0AB 1MO5A 2XZPA 1AS2A 2WTUA 2H18A 1W44A 3AF0A 4OQMA 4M1KA 3WYAA 2JLQA 1IXRC 2OCAA 3CWZA 5JRZA 1A5TA 4ZDKA 2GXQA 2CHQA 3B1YA 1XTJA 4EQ6A 3GJ4A 4LRWA 4RVCA 1JEDA 1W0KA 1P9WA 5EE3A 4GBMA 1QHGA 4TQUS 1NLZA 2CCGA 3GEHA 3SNHA 3FB4A 3AVPA 3CZQA 5KDLA 4B2IA 3D8BA 3DOEA 4L8GA 1MOZA 3L2OB 4JVNA 3UMRA 3AH8A 2OG2A 2H92A 2ZTSA 2GBLA 5CK5A 3L43A 4M9SA 721PA 4KODA 4NMMA 2V8OA 5KDDA 3VKHA 1D9ZA 2GCPA 2I3BA 1XU4A 5J4KA 1IOZA 1KK3A 3Q7PA 3IBGA 2OO7A 1X1SA 4PAMA 2IS2A 4RZ2A 2QNRA 4EJSB 5IF9A 5J5CA 2XZOA 2IWRA 2WZQA 3BFXA 4M1SA 3PJRA 3OIUA 4G5OA 1N6HA 1E9DA 1LVGA 4E03A 2PEYA 4IDHA 3WNCA 4Q1DA 1Z29A 4Y0VA 3MJRA 1GDDA 2Q21A 4EJSC 4RD2A 4FXPA 2EU8A 3CF2A 4PANA 1CR1A 3NBYC 4KYIB 3TR5A 4PQFA 1R0XA 3R7WA 1NRJB 3Q5DA 4QG7A 3BAFA 3E5HA 4CEHA 3SI7A 5H70A 1R8SA 3QY0A 4L5BA 2GAOA 5FPYA 4Q1BA 3U7GA 1PUJA 1C4OA 1ETUA 3C41J 4NCNA 3MLEA 4FWTA 3ZVMA 2VHTA 2ZYUX 4NCHA 3A1SA 2G1JA 4HAYA 4OJKA 4LC0A 2ZJ2A 4TMWA 4ITRC 3CLVA 5JSZB 2P65A 5P21A 1TQ6A 3W3ZB 1KO4A 4ASUA 3EG5A 4O25A 3CRRA 1XWIA 3CR8A 2D2EA 3ZH9B 2FDCA 5BW8A 3IHWA 1UAAA 1FOEB 4PFSA 4ACBA 4CT4B 2ERXA 1MRNA 3HJNA 4ZDWA 2DFNA 2P6RA 3FHCB 4IXNA 5JI2E 4LPSA 1M7GA 3GLIA 1Z0KA 4RCYA 3L0IB 4B71A 3LDAA 3MSXA 1G8HA 4DLUA 2ZE8A 2QORA 4XWAA 5E7IA 2FPKA 1ZBDA 1U90A 2WWHA 2EW1A 3GLIE 1UEJA 4NP6A 3K0SA 1EX7A 4DDVA 5EE5B 5FL3A 2BVNA 3TSOA 1YR7A 3W8NA 3WP0A 5HZKA 3GLIB 1Z0DA 3IGFA 4O2RA 1Z08A 2VO1A 1ANKA 2A78A 5E4FA 4DRZA 2Q3FA 4OQFA 5E7MA 2IYTA 1KSJA 2D4HA 3PR1A 2GTPA 3CF6R 3IILA 2QGNA 4Q1EA 2BDTA 5LD2B 2XB2A 1QRAA 1II0A 4JL8A 3WRYC 1CBUA 3Q85A 3QIAA 2FPMA 2NPIA 3QENA 5DNYB 1R5BA 3CF0A 4U7DA 1E0JA 5HE8A 5A0FA 2IXEA 2QM8A 4H9GA 4I4LA 5FI0B 5LD2C 1A2BA 1DAIA 5FPHA 2YOHA 4PAQA 2JJ2A 4B6FA 4DSUA 4URYR 3X2SA 1C9KA 3AM1A 3ZDQA 4O0MA 1EFHA 4HEJA 4JMPA 4BEBA 4QGFA 4DBLC 1W4RA 1XBTA 5LPNA 1WP9A 1KIMA 3KJIA 4EPXA 3QI2A 1Z3IX 3EZ2A 4TLDA 3LBHA 2F1HA 3LVQE 4KCGA 1U94A 4KHZA 3SYNA 3T34A 3X1YA 4Q01A 4KI0A 1GZSA 1KK1A 3U7EB 2R9VA 4NYIR 5EP3A 1XEWY 3K09C 5FTLA 1XNJA 2UVQA 2ZJYA 4NONA 1QHSA 3DPUA 2IUTA 2H17A 4I1UA 1CIPA 2YC2C 1AJEA 3CB4A 3PCRB 1Z8FA 1R6BX 2QTFA 4AYXA 4RZUA 3ZVRA 5L3QB 3P27A 2JJ8A 2WWWA 4Q7KA 3TNFA 1OYYA 2DBYA 2YVUA 1R2QA 4KSCA 4DLVA 2B21A 1FTSA 4TYNA 4QOSA 2R2AA 2EYUA 4IFEA 4B32A 1UBCA 2V9PA 4HB4A 4RKFA 5KPJA 1HA3A 2IYZA 1AK2A 2EYQA 4LV5B 4ON9A 4Q66C 4S35A 4Q7MB 2FZLA 3LLMA 1GRQA 3KKQA 1FW6A 1II9A 1IY2A 3MCAA 1G3UA 4E22A 4ZCLA 4M1OA 1I2DA 5CK4A 4TYPA 1HY3A 3T12A 1TUIA 3I73A 2QSYA 4FMDF 4UXHA 3QXSA 2NOAA 4CIDA 1VHLA 2IUUA 2IW3A 2W2XA 2GETA 1G5RA 2H7VA 2JLRA 4KSBA 4JVMA 4BFVA 2W2VA 4IVRA 1DPFA 2PLRA 5FUWA 5IK2A 1E2EA 1E2QA 2MSEB 1WF3A 1ZC4A 3IO5A 3CM0A 1IQPA 5HPYB 5JZVA 1N3BA 4JLNA 4AYTA 3HYRA 2B7CA 1ZCBA 2XZLA 2ZSFA 3NBFA 2Q6TA 4EPRA 3PUZA 1KI6B 4MA4A 4PHFA 1ZNYA 2YNMA 5FR1A 4E07A 4OI2A 1KI3A 3DOFA 2CCJA 2O8DB 1X1RA 2EFGA 3ZIAD 3UMFA 4MKIA 1IN7A 2BJVA 3T1TA 1SVIA 3P1JA 4MDFA 1SXJA 2GF0A 1SULA 2OBMA 4A1FA 2ZVQX 3A8TA 4LCBA 4TWZA 4Q21A 4NYJQ 4DC9A 4ESVA 1G7RA 5SZIA 1D6JA 3U6KA 4Q48A 2O8EA 2A30A 3UG7A 1P2TA 4HB0A 1KDTA 2ZYTX 5J4YA 1CJUC 1S9HA 1XD9A 5KSPA 2W58A 3QEOA 3NDBB 3HPQA 2CBZA 2BCGY 1X8LA 2BKEA 2O8EB 4HDCA 5IHPA 1NVVR 1W0KD 3NBZC 4DLWA 2QAJA 1MABB 4FCTA 3TSWA 3X1WA 2ZYWX 5F9FA 5GJBA 3K0CC 1H65A 3TLXA 2GCOB 2QMHA 3OFNA 2ZJ8A 2XJ4A 4QBFA 5J4VA 3B1WA 3RYTC 3LX8A 3A1VA 2JATA 4I1VA 1LY1A 2GKSA 1W4CA 4FI3C 2ZUBA 4D0LB 1G17A 3ZQ6A 2PX3A 4TL8A 2PT7A 1QHXA 3N2EA 2QSZA 1U0LA 2QMUA 2GDJA 2ZJZA 1PLKA 2D3WA 1M7HA 2GJKA 1Q20A 4LX0A 1Y63A 4UQOA 3DM5A 5C2JB 4Q4JA 4RD3A 4WVFA 4JBXA 1AKEA 1UEIA 4PC3A 4OK6A 4BFXA 3KQLA 1E2FA 1PJRA 1W47A 4A6XA 4PZYA 5TARA 5CB8A 4TYYA 5G3ZA 2FSFA 2H57A 1KNXA 4LBWA 2F1IA 3EZ6A 1KOFA 3OESA 1CS4C 2AKAB 3CH5A 2EFEB 2KE5A 3W90A 4TZ6A 1CRPA 3OAAA 1JALA 5IRCD 2VTKA 2J0VA 2YWHA 5AJXA 5C46F 1TX4B 2WIAA 3GD7A 3B8HA 3GLHA 2VBCA 3CPHA 1LF0A 2GZAA 3MWYW 3SS8A 3SQWA 1XEXA 3KL4A 3P4YA 1BMFA 1JBKA 5L3RA 5A5GA 1HEIA 5HR5A 2WV9A 4EPTA 4MH0R 3NTUA 4ASUD 4CW7A 1P7CA 2FSGA 4CEIA 3NH6A 2ZS9A 3B9QA 2J0SA 1M8PA 4NL4H 5KOYA 2JLUA 1AQUA 3SZRA 4X8MA 3SFZA 2HYIC 1IN5A 2J7PA 4CEIB 2QI9C 3QNUA 4XVQA 3X1DA 2GK7A 2OFWA 3K70B 4YMUA 3PXGA 4ZIRB 4PC7A 4DIDA 1LS6A 2A9KA 1VKJA 3WBKA 3W6NA 4BFYA 2WWXA 2D7CA 4JIMA 2OM2A 4QM7A 5C18A 5KNBA 1XJCA 1YR9A 5LB2A 3THOA 1B23P 2IYRA 1EWRA 2CEAA 1XCGB 3ONWA 4AWXA 1RJ9B 1AM4D 1KMQA 3UG6A 3WNBA 2KSQA 1UDWA 3MG9A 5K8UA 1VCMA 2CE2X 4RKEA 1YHNA 3VNUA 4IXMA 3R8CA 1G19A 3GFPA 3I32A 3HPRA 3CRVA 3VR5A 2WKRA 2AKYA 2RGGA 1E0AA 3SN6A 2XTMA 3R9IA 3VKWA 5BN4A 1E1RA 2VP5A 1IXSB 2ONKA 4FWIB 3RS5A 2IL1A 1KO5A 4EFLA 2B6HA 2JJ2D 1ZW6A 1OH6A 2PT5A 2ASEA 5DYIA 3SEAA 2VP0A 1FPMA 2BOVA 1AZTA 3NHAA 3DZ8A 4UNNA 4BECA 4DEYA 4YQFA 1CR4A 1E69A 3CW2A 2ZJOA 1TU3A 1G4UR 1Z6AA 2Q9CA 3SE0A 2VHJA 3GJ3A 3R9WA 2J5XA 2Q3HA 3KUCA 4LSGA 2XB4A 1BYUA 3ECCA 2HYDA 1ODFA 1G3IA 2OBLA 4IVQA 2OLKA 1WRBA 3AQ4A 4GMDA 4Q7JB 3T5DA 2ZEJA 4GSYA 5JS8A 3IEVA 5CDFA 1J8YF 1PZNA 2ANBA 2ODBA 2Z4SA 2AX4A 2J0UA 5CDFE 1NN0A 1E94E 4JT4A 4Q4AA 2BBSA 4EDHA 1UBEA 3KTAA 4LBYA 4BRWA 4GNKA 4DLYA 3VR1A 1WA5A 4W5WA 1JECA 1JJ7A 5EE0A 4Q4AB 1KK0A 2YV5A 4A2WA 1OXUA 2CDNA 2QBYA 1KJWA 2RCNA 3TQFA 3U6BA 4IKEA 4PR0A 1CJTC 1TEXA 1P61B 1YZKA 3U3OA 3I5XA 3TR0A 5FTKA 3TUJC 4BLTA 3THXB 2QBYB 5JFGA 2C8VA 2OFXA 3LLUA 3A6PC 2MSCB 4C0QC 1OW3B 2ZJ5A 1HT2E 1KDOA 3VU9A 5JMTA 1ZD8A 3B78A 4QM6A 4V02A 2ZI9A 4JJZA 2ZRKA 2W2TA 1OHHA 4JLVA 4Q9JA 2W00A 4EIWA 2JAQA 3AGPA 4N0EA 3VU9B 2KBFA 4RY2A 4URWR 3A4NA 4JYCA 1P62B 1TF7A 3NC0C 4BWYA 3X1XA 3RS4A 3BK7A 1XJQA 3PV0A 1P60A 4KFUA 4PO8A 1Z22A 5IK2D 3BB3A 1W36C 1OLOA 3E70C 2AD5A 2WAXA 2ZJBA 4V0MA 5CLLA 4IDOA 4DDWA 1WBDA 3RVBA 1CJMA 4PPQA 1W2GA 2QT0A 5TMPA 1F5NA 1EFUA 1OB2A 1RW4A 2AK2A 3IIKA 2Q3MA 1MRSA 4EFMA 4Q03A 3DDCA 3B1ZA 4AK9A 1A82A 4RD6A 4C0AC 3GQBA 1QHYA 4P3YA 5LBIA 1OXSC 3F8TA 1FQKA 1LTQA 1SXJD 3AP2A 1D2EA 3EWSA 2QUZA 4UJ3A 1H8HA 1JJVA 4AI6A 1SKQA 1FNMA 2J9RA 4W5JA 4X8HA 2QRNA 3W34A 1D5CA 3OIYA 5F2EA 2GXUA 2OZEA 3GEEA 5EP1A 3ADDA 1QVRA 3TGPA 3PUYA 5BYJA 1NBME 2IA5A 1PLLA 1EWQA 4LJ7A 4V0LA 4L16A 5FL7A 2WHXA 2ZRIA 3PEYA 1RIFA 3PITA 2AFHE 2I1VB 3TMKA 3QEJA 1OFTA 2NTYC 3A36A 3LXRA 3M1IA 2G0TA 3QVVA 3A1WA 3OFND 4P33A 2P6UA 1MV5A 4PZLA 4DLZA 2A7QA 1VHTA 3QQ5A 2VP4A 2NZ8A 1FTNA 4BFWA 4G5QA 3W5JA 1CU1A 1I4TD 4PAOA 4UKDA 4B3CA 4NCKA 3EW9A 4H1VA 4DT1A 1CP2A 3L0SA 1YVDA 3QBVA 2IYSA 4TSFA 4EPVA 1JEEA 4DVGA 4WIAA 2WMOB 4RZ3A 3FMOB 2B8WA 1XRJA 4D2IA 1ONBA 3B1XA 4DT1B 2EFDB 1BYIA 1QHIA 1U9IA 4LYFA 4NBSA 2FGJA 1A1VA 4Q18A 1SVKA 3C14C 3PEUA 3M4YA 4JLBA 4DLXA 1WBBA 1HE1C 1N0UA 3KUDA 4HAWA 3CO5A 4UNSA 1KMHA 3EZ7A 2DPXA 4XSGA 5KSOA 3N70A 3OAAD 4TQAA 3FKQA 2QL6A 4RFSA 4TMXA 2HF9A 2ZREA 5FOSA 3Q72A 1KGDA 3O8CA 1NNEA 2D62A 1KMHB 1NVWQ 4Q02A 1P4SA 1BMFD 3PFIA 4HLCA 4K8OA 2RHDA 3DMDA 1L4YA 4RFSB 3WYGA 1U8ZA 3NDPA 3NKVA 3RWOA 2RGCA 1BO6A 1XTQA 3Q3JB 5KYKA 1DAHA 3K70D 3UWOA 4DDUA 4PPFA 1VCOA 4HB2A 1E2IA 2R65A 2PZFA 4OHVA 2QE7A 1CR0A 3KKOA 2J7PD 1YU9A 1LB1B 4QGGA 1IXZA 1ESNA 1Y3AA 3T61A 4JL6A 1JR6A 1NMYA 3BORA 1YZQA 2OXCA 2ZAOA 3FMIA 4BEJA 2HJGA 3AEZA 2YOFA 3ZS9A 3A1UA 3E2IA 3K0AA 2Z0MA 3KFXA 5E3HA 1ZNXA 4GOJA 1KJZA 1U2RA 1TTTA 1ZUNB 2GCNA 3LQRA 3RRNA 1VPLA 3T1OA 3W6PA 3U3MA 5EJEA 2D7DA 4LJ8A 4G5GA 5DYGA 1Z07A
chains in the Genus database with same CATH superfamily
4JBWA 3HLKA 4ZGWA 1W4ZA 1KARA 5EIXA 5L9AA 4COOA 3DOCA 3LDUA 3VR5D 2EV9A 4C4PA 1I2CA 2W2KA 5CG2A 4MYSA 1OI3A 1WXXA 2HAEA 1CUEA 3EPJA 1FJHA 4RM2A 4UBNA 1WVMA 2ZP1A 3VZQA 3U7QA 1E1RD 1ESCA 1E99A 3F46A 3DOOA 3LYHA 4LEIA 5AQEA 4AURA 4AD8A 4ZYWA 4K28A 5KQGA 1XNQB 4EL5A 2QXYA 4N9QA 4I5DA 3MJTA 3ZWBA 4S24A 5CRIA 3O38A 4JYBA 2WU4A 2XEXA 3C6BA 4AKTA 4EJSA 4YDHB 2QRVA 3O0TA 1AHPA 1JDUA 3OWOA 3AUSA 4MB6A 1K5PA 4EG6A 3P5BA 5LLDA 2CFCA 3ZE1B 2WU8A 1C3XA 1NQVA 1DAEA 3RK4A 1C7JA 3IB6A 4EL0A 4UBJA 4PM4A 3QF7A 1RXVA 1BEZA 1X8JA 2P3LA 2BKVA 3EUFA 5IBPA 1UXGA 2YFHA 4HMPA 2PUBA 3IPAA 1Q2UA 4LIPD 2JGFA 3F3YA 3LPAA 2DPHA 1I4DD 1JG6A 3LFUA 3QE0A 1XAIA 3OX3A 3RSOA 2X76A 1ZG3A 1SCJA 1WULS 1OXVA 2QLTA 4RL6A 4A82A 3QNWA 4U0JA 4EGJA 1EE2A 3H9BA 2R1ZA 4NABA 1DLIA 5HSGA 4MS3B 5L7TA 2IYOA 1GTVA 1LK7A 2VP6A 2XT6A 3I2JA 1U1CA 3K31A 3NB0A 4JYPA 2HW8A 1CC1S 1GA6A 1ZIYA 2PFGA 1O3YA 3JRWA 4KMMA 3TZKA 4BBAA 2PV7A 1BGVA 1VP9A 3WISA 3VOSA 2WJGA 4HAVA 3C3MA 2DBRA 2ZE7A 3NEYA 3PQDA 1WE2A 2C5BA 1K5DA 1IUNA 2IHBA 2NO6A 1GUAA 3CH4B 1GPLA 4KQ6A 4EG0A 3LT4A 2DQZA 3SYRA 1VL1A 5AI0A 5JAOA 2P69A 1F8UA 3FI9A 3PFWO 3DT9A 2HV8A 1T43A 2RC5A 4EFDA 2GX6A 1SK9A 2Q2WA 3P0JA 4BGEA 1PBNA 4Z51A 2JKVA 4ZZ3A 2W6MA 3QE4A 5G0UA 5JO9A 2BBTA 4MV7A 4KQWA 3V4LA 3BICA 1XJ0A 3E84A 4MJ7A 3WB9A 4HNUA 4YJDA 1G41A 1N2XA 4ARZB 3AUXA 4R2HA 5JPDA 3JPYA 2D7JA 3L0YA 1BMDA 3UBTA 1Y8RA 3ETCA 1F2UB 5ELMA 3U9LA 3UMSA 1U0BB 5TSDA 3SIPA 2RBKA 5JJCA 3WLJA 5AMXA 3HCNA 3UJPA 2A3RA 3B6JA 3SDZA 4D57A 3SJUA 1GVHA 1MJ5A 5FEMA 5C8DA 4Z4CA 1ZKDA 1OXXK 2CLMB 1WQ3A 5EKXA 4NBLA 3VU1A 1JHRA 5DN9A 3FETA 1WZIA 2GK3A 3F78A 4PGGA 5D7BA 5LP6C 5BYKA 1OFVA 3PFKA 4EBBA 3G8AA 3TI9A 1X2EA 5JV5A 5T3UA 1UADA 4C2TA 1BE8A 4PHHA 1J7JA 1A71A 1E4VA 2CT8A 4V0OA 3ZPXA 1E32A 1RDFA 4UVHA 3KR1A 4MQBA 4TWIA 4LY3A 4U8HA 5DTEA 1C7RA 2WM3A 3AEQA 3R24A 1MUUA 1UCFA 1VLHA 4DMMA 2NSLA 2R5FA 1LBSA 4C1BA 3GLGB 3TF5A 3DHNA 5JMOA 1ECBA 5JD4A 4N12A 2Q0HA 2Y4OA 2Z2ZA 1S02A 3QLUC 2O1WA 3AHGA 1U2DA 4BVFA 4ZI3A 4K6KA 2JLXA 5DH9A 1KAEA 4V0RA 1N2CE 3BMQB 4P98A 4UAVA 4YT8A 1CE8A 1Z25A 2Y4NA 2FR8A 3N6RA 3BRQA 2GPNA 4NNOA 3Q98A 2FFHA 2JHGA 1BGXT 1U8CB 4TKLA 2FDRA 3R74A 3H2ZA 3TOZA 4MLZA 1M1ZA 2EWVA 4FOTA 3QA3E 4C9BA 4G5HA 4X93A 3AEUB 3TE6A 1VZ2A 5E6UA 5FL7D 1X77A 2LDBA 4MAMA 1WUTA 4DJ5X 4C7OB 1GA4A 4DB2A 3PFNA 3MPUA 4AUNA 3PF8A 2FZGA 4LYYA 3PFBA 3GV0A 3QFSA 4CF4A 3PRYA 4HNSA 4J16A 4R7GA 3E9NA 4NZNA 5HF9A 4MAAA 1AOXA 1IB0A 1UAGA 1GQOA 1WMAA 2RBGA 1XALA 3WIDA 1G59A 3SOPA 4AULA 1NSTA 1A8PA 3RIEA 4YCMA 3WX0A 3DLHA 4HD8A 1JN0A 2QVZX 1YB2A 2ZKIA 1ABEA 5CYPA 1JAHA 1DRJA 3HU1A 3AI1A 3A7DA 2UUPA 3BD6A 3S2SA 3V7YA 2I2FA 2JJYA 1N0HA 3H9EO 3MZ0A 1EUCA 2A57A 4NDZA 2WIBA 4PAGA 3GAFA 4V0KA 4DXHA 3ICEA 3WK7A 2JCSA 3FPGA 4YJ2B 4FFVA 2OCBA 3HVJA 1MN6A 4UDYX 4ZQCB 4C4TA 4F93B 1D8TA 3CUYA 1HSOA 4QATA 3NWOA 1P75A 4WZBB 4L27A 2Q7DA 4NU0A 1SBTA 2IY7A 5SZJA 2G0NA 4ERXA 3PEWA 4LJRA 1Q11A 2E4VA 1OX4A 1OAKA 1JPJA 1LNZA 2LV8A 2XODA 4BX9A 4LQ4A 2WR8A 3OZAA 4XB2A 2FFBA 4S0XA 1C81A 3TQCA 3IMEA 3SYKA 2SKCA 4FINA 5A7GA 5IFKA 3S5UA 5CYOA 1E2DA 2RH8A 2JGJA 4XVCA 5ED4A 2C04A 1KVSA 1L1QA 1F9EA 1H5UA 1LBQA 2BC9A 3O8BA 3QVUA 3R23A 3R3SA 2G5TA 2CNOA 1CIVA 2QMZA 2A0XA 3DT6A 4FKBA 5COAA 3RTEA 2DFPA 3S5JA 4CM6A 3TE7A 4JI4B 3QVGB 2QTWB 4D8XA 3R5JA 4MYTA 3OHPA 1DQYA 2MSDB 3TQSA 5A5DA 1GV0A 1T9GR 4H60A 4L73A 4Q37A 3W2GA 2Z6QA 2JFUA 5KSYA 4GH5A 1VPWA 1Y5IA 4KQXA 1ZM7A 4QG3A 2QPOA 3RTBA 1C1XA 1WDKA 1PEDA 2FHSA 2ZWOA 2J1LA 4I1OA 4H1TA 1EG7A 5MFPA 1JEAA 5DOZA 5EQTA 4RULA 5D6NA 3HBAA 1DQPA 2FU5C 2X8AA 3HCBA 2EZTA 1KBZA 2X5NA 3K9NA 2ATEA 3OTQA 4CKWA 1U5CA 2QE7D 3HSSA 2D1YA 2DWOA 3IL2A 3ZS8A 3HWSA 5BUQA 4LVUA 4UMVA 3U3KA 2PCLA 2HSJA 5LZ7A 1NE7A 5MN6A 3BRWD 4KNYA 4YT4A 1M5UA 2QLBA 2DWQA 1VLLA 3LKBA 4KMOA 3FZYA 3ILVA 4V1CB 5AIAA 2BL4A 1GG2A 2Y71A 5FUYA 4MRVA 3E58A 3W1VA 1UBGA 7GPBA 1VJ0A 3BE8A 4AJHA 3VV2A 1U0HC 3M4XA 5HP4A 5DT9A 3KJEA 5CBPA 4I1SA 1TNDA 2BELA 2XYGA 3H1AA 4RIGA 4XCQA 5AKXA 3ZUGA 1C0EA 1G3RA 3IBFA 1Q1NA 3IIMA 4DQDA 5DISB 1YR6A 1VSTA 4BJHB 4DFDA 1JA1A 3TKAA 4FCCA 3VAAA 4O3MA 1L5NA 1DJLA 1NKTA 2DAPA 2E7ZA 5HG0A 5KDOA 2DUNA 4PRZA 2IBMA 2R8EA 4JR1A 1Y6RA 1WDMA 4MUIA 2WFZA 2YHIA 4E30A 1QCDA 4DSZA 2WDZA 2F9FA 2HLDA 4CKYA 2D1FA 1JG3A 3HYTA 4JI8B 2HN9A 3G8CA 2Q1UA 3G1UA 4QVGA 2GCOA 4F4DA 5CFNA 2JH9A 3ILHA 2I76A 2PKQP 3OX4A 4S1NA 2VP3A 2FCRA 4TTQA 4MV6A 4YGXB 4Q1AA 4CNBA 3NTQA 1JLRA 1RZRD 3LVRE 5TF4A 5HF5A 4KE6A 1KVQA 1V96A 4EGSA 2EFCB 1BTOA 1FA9A 5EEHA 4AP9A 3L02A 4FKMA 4F4IA 1JHXA 3N87A 3AJDA 1MJHA 1O89A 1ZIOA 1GGHA 1GGVA 2CZGA 2JFYA 3KDSE 4YJ3B 4Z0TA 4IRUB 3WB0A 4FJ1A 4D6XA 4BVHA 4I19A 1E5TA 2PRJA 3IRVA 5E9WA 3E3MA 2ZWVA 1HURA 2DZDA 5DEOA 1F20A 4RZIA 4XWGA 2ZIVB 3SYLA 1KPGA 1MEEA 3VYTB 3BGSA 4CCWA 1P4HA 5B5SA 1QH9A 1D07A 4ISBA 4F3RA 4U5QA 3ZJVA 3WG9A 2BZGA 5IX8A 1LLFA 2ADOA 4QTXA 2DFLA 1HNNA 4N6GA 4ZVNA 5KHAA 2GOYA 4R8KA 4DIKA 4RTMA 1LC0A 2R44A 5LD2B 2V5VA 1MV8A 1V1MB 1YRAA 2E4AA 1XE3A 4G37A 3ECAA 1YCFA 3RJMA 4U2KA 4CKBA 2HIAA 4Y2SA 3ER9A 1AS3A 1ADBA 1Q50A 1CS0A 1IMOA 1F2DA 2PKRA 4YUYA 2HQ1A 3QF4B 1YA4A 4K9SA 4UBIA 1XVLA 3GLFA 4DRYA 4ENRA 2C8JA 2BM9A 3GJSA 1KQOA 4HV4A 3EGOA 3EC7A 2EF0A 1N6PA 1AQIA 1U1EA 2PT9A 1XMOB 1DADA 1JZTA 1LC3A 2G5CA 4R1OA 3WGUA 4IJKA 3RRMA 4Q1VA 1OFGA 2W4QA 1W1UA 4YH1A 2XUFA 1SVMA 2ODWA 3N76A 1RM5A 1JVSA 1K7EB 3GJYA 4V39A 2ZRQA 4IGEA 4OGLA 4QD3A 3ABZA 5COBA 3EA4A 4LF7B 3WMGA 1POWA 3DZBA 4MR7A 1NFQA 3BWMA 5LYJF 3FTDA 3ZWKA 2QF7A 3LOQA 5C1IA 4G41A 4YAUA 2MIIA 3P2OA 4FLFA 1FPQA 2Y67A 1RSZA 3OEHD 2GPJA 3FZNA 4GD3Q 3OF2A 5LA6B 1PQPA 2WSLA 2VDWA 3UFXB 1FUKA 1ZK4A 1NDHA 3FA2A 3ZWQA 4X7RA 2C82A 4QPNA 5EAIA 3C98A 5TXGA 3RVNA 2L69A 3U3JA 2P1DA 4J0GA 2F3UA 3Q8MA 1LBEA 4DA0A 1BDIA 5EXSA 4O8CA 1Z4NA 3SSMA 4QUEA 5TC4A 3GCXA 1XOIA 2FZWA 3QFFA 4YBZA 4GEGA 4PF1A 3C4JA 3TCXB 3BQ9A 3U37A 2YHBA 2YXBA 4GOKA 5FBWB 3GFSA 1NQOA 2J67A 1IHUA 3DL0A 2IZZA 3MT0A 1IH8A 3GJTA 1WDWB 2Y1LA 1GITA 3MOGA 3O84A 4G9EA 4QHTA 2C2XA 3VHXA 3GP5A 1FDWA 2WHRA 1UAYA 4MHSA 1O9GA 2IPOA 1QUFA 1GRCA 3QVMA 3L4BC 5DP2A 5E6SB 3UXYA 4IRXA 1P0CA 4HWTA 1L5MA 3EOBI 4K3UA 1M34B 3ADKA 4NV0A 1N3LA 3C3DA 2VAXA 2X3UA 3K1YA 4O4HB 3O1JC 5K09A 4AKHA 1KJNA 1NT4A 2D0IA 2J31A 2CK3D 3LP6A 2BBWA 3ZDFA 3R5SA 4B7AA 2JIDA 2TYSB 3JATB 1KKMA 2G9QA 4GSLA 3RKSA 5AI4A 3ACBA 2KI5A 3V4VB 3LQ1A 3FUUA 2RHBA 4ZVSA 2HBYA 3TQHA 3HA7A 5KKAA 1DDOA 2PMBA 2NO1A 3NGXA 4OP1A 4RHEA 5EYPB 2J9GA 4FEYA 3HXQA 2WTEA 1HFJA 4XUDA 3BFVA 3BOSA 4KB5A 6REQB 4BLVA 2P7IA 4D7AA 1G6OA 3HM2A 1KXZA 4QARA 2R6FA 4MKFA 4PSAA 3UH1A 1CNEA 2MYUA 3ZZTA 5B7GA 1EFAA 1QFSA 2FEKA 1ZMXA 1N8TA 2NZWA 2PO5A 3EBPA 4OFZA 4D97A 1OBCA 4BO5A 5J4LA 4ABYA 2KM1A 1IM5A 2VLBA 2WJAA 5M34A 1PG0A 2VF7A 4EKEA 3VR3A 1AGPA 1UJMA 4DV1B 2PGNA 4Y6PA 3L8EA 3DEZA 1RADA 1QYVA 2HHHB 1SA0B 1VPDA 4MKRA 1ZN8A 4U00A 4XQ9A 4AWBA 2ZXUA 4W5NA 2ZCUA 3QVWA 4I8IA 4YAEA 1GNQA 1G5PA 1YWGO 1ZAKA 3KKKA 3LZDA 1M6EX 1PTJA 1A27A 2XBUA 2XQKA 3PUJA 5J9FA 1KIAA 2PZ8A 1VHQA 1SEVA 1GL7A 1PX0A 3ZCTA 3PPVA 1SGWA 3V4ZA 3WS7A 4G63A 4G1FA 1VLZA 2RHTA 2XCOA 3I6YA 4L51A 2R79A 1KE2A 5A05A 1D6NA 2FPXA 4ZEVA 2NO9A 3GJ6A 1RLUA 1E66A 3F8SA 2PG3A 1SVLA 5EZ6B 3Q2IA 1A8IA 4C14A 3MGBA 1ZXBA 2OM6A 4M8IA 1WABA 3KJZA 4HI0E 1H93A 1R0RE 2WIKA 3LQYA 3PUKA 1I36A 1AGRA 5JBQA 3HR7A 3NBUA 5CVTA 3A1FA 1JILA 3OG9A 4OHYA 2DKFA 3ON5A 3G2HA 1YE8A 3JQAD 4C03A 3PWZA 3HCCA 2ODNA 4EKGA 3QSYA 4AMUA 2I0FA 3ZDZB 5EFZA 3IUNA 3PVSA 2DY1A 4UPVA 5D2CA 4L4UA 4QU9A 2WTAA 1PZGA 2ZS8A 2HXYA 3M9XA 1L1FA 5FWXB 2RKOA 5TMBA 1M1YB 2O8CB 2NSDA 4OQ4A 1ZD2P 3ZC3A 5JXIA 2C9DA 1Q0LA 4GI2A 4HQ6A 5HYVA 4G67A 2WD8A 3AB3A 3UWPA 1R15A 2QL5A 2QR5A 2W7TA 3ZCXA 5KQSA 1IB6A 1WDLA 2Y8EA 4BZXA 1RWWA 5COQA 2VJCA 1EI9A 2EZ4A 1XXHA 5FQNA 4RK1A 4Y7CA 4PRKA 1AS0A 1EVEA 4KQGA 3NIWA 1B6RA 4I5GA 2CKMA 2HK6A 4XIIA 4IBOA 2UYCA 3L8ZA 2IXBA 3GNSA 3CJRA 1OBHA 2QTVB 3B12A 4EVRA 1PZXA 1WZEA 1XFAA 3MD0A 2CY0A 1U7WA 1W46A 5C1BA 4OI0A 4HYTA 2WUWE 4MEAA 4WEQA 1EHYA 1KVTA 1Y4SA 4AP5A 3KXLA 3RADC 2XXAB 4PZZA 4F9GA 2R87A 4K2HA 4OXQA 3PNOA 3ZWYA 3G0DA 3N2GA 5AJYA 2NO4A 2IOFK 5EWMA 4ESHA 3A1TA 1SIOA 3W4IA 1ZM9A 4ZVRA 4D56A 4DM7A 2QM7A 1GGMA 3VGPA 1ZLXA 2X0KA 2B34A 3RSZA 3THRA 5DULA 1J7KA 3A06A 5HJ7A 1DBIA 1FVHA 3SDSA 2QE6A 3H0KA 5I5GA 2O7VA 3KQYA 2ZT5A 4Q12A 2CJFA 2C54A 2JJ1A 3T9BA 3WI7A 4R2MA 1CQPA 2CBXA 3UTDA 4PLZA 1GU1A 3HZOA 2QQEA 5KOHA 2G0AA 3PXCX 4U7HA 1DRUA 1JQDA 2J3IA 2RMKA 1RI4A 2GESA 4RVUA 1YUMA 4G3XA 1VBNA 3OMWA 1JR3A 3W1EA 4B3DA 2ESRA 2ECKA 1A5AB 1Q7GA 2GZHA 3A1NA 5CLFA 4R51A 4AJLA 8MHTA 2IF0A 3HGQA 2IT1A 1FP2A 1P1JA 3P9CA 2DE0X 5ALTA 1TJYA 2GR9A 3FBGA 3LVBA 5DYYA 4B83A 5AVZA 2ECPA 1N6RA 4R5MA 2OCKA 3LYLA 1Y7IA 3ZU2A 3SOZA 1UK9A 3FGZA 3ZQKA 3ZQ4A 5IT4A 5LU9A 2ZRHA 1C14A 13PKA 3N6XA 4R1QA 1FMTA 3JVUA 4D0NA 4KKVA 3IFSA 2JRLA 2V6IA 1TLTA 5KTYA 3FOAA 2AN9A 2QOEA 3NC4A 2ISSD 2VNJA 1AX9A 2WIGA 4D26A 3OIWA 2GERA 4N5IX 3LNCA 3STHA 4E0BA 2OVFA 1NXQA 2PT6A 2RAFA 3FFXA 4ND6A 3ORHA 3WKCA 3FH0A 4DSTA 4FIDA 4P5EA 3GLKA 3RSHA 2CVFA 3FM9A 2ZM6B 1Z63A 3B60A 4UUQA 5JHHB 4IG4A 3WADA 3ESCA 1CUIA 3PC2A 3QPAA 2CUZA 3U4AA 3NBKA 1PJ3A 2NTEA 3D3NA 2XYHA 4GP7A 4OYLA 4CEHB 3W9SA 3RAPR 1FYXA 1MH1A 3BHNA 4G23A 4RORA 3DHWC 2WKPA 4HGZA 5ILQA 4EARA 2P2LA 1JLLA 1SC1A 2X1VA 2VAWA 1KE1A 4QELA 4OGFA 2GWHA 3KV3O 4M9RA 4L0MA 4DHWA 4JUDX 4UU7A 2QQ5A 4QJIA 2VZLA 2CUNA 2RSLA 1J49A 2VPIA 4MVJH 3R3UA 4TWAA 3B2QA 4R2WA 3VZDA 4IKOA 4DWWA 4JOCA 1KTVA 3JR3A 1QKJA 1U6JA 3WFJA 4CKZA 3COJA 3T1QA 2I4RA 1ATZA 2ZJFA 3IR6A 5TQ2A 2CZQA 3BXEA 3ND7A 4HQ0A 4KFSA 3BXGA 2GJ8A 2UZ3A 2JEYA 3EIFA 3KJXA 5LZ4A 2A3NA 2HWUA 3H5OA 2XOKA 4L75A 1J2EA 4Y6RA 5DHPA 2YV1A 2B78A 3ABOB 4A03A 1P19A 3ESDA 3MTAA 2ZJAA 4ZYLA 3WA7A 3KYDA 3G13A 3DFMA 2NV0A 3L7MA 3R0XA 1ML3A 4GLFA 4CIYA 3TUZC 2JFWA 2AUNA 2WUVA 2GEVA 1TYDE 3GRAA 4KDEA 2CEKA 1UZLA 1U7OA 4KG7A 1WY5A 3BDVA 3DKIA 3R44A 3PC3A 4NZMA 4B09A 3FWKA 1WMBA 1U0RA 3AIOA 4WK2B 1IN8A 3EEIA 3SHFA 4H27A 1DBVO 4UEKA 2JL1A 4YI3A 1MHPA 1UFVA 5T4BA 4I8DA 1YJBA 4BE7B 1M54A 5KMGB 3BWXA 5DM4A 3SHTA 1C4WA 1YA8A 3T35A 3V8RA 1PSDA 3PPIA 4QLAA 4X7PA 2VRCA 1QE3A 3VFDA 3ZQUA 4ZCMA 2K5UA 2ZWMA 2HF8A 2W2NA 3OLZA 3OLWA 1JE0A 3HI6A 4ZFNA 4MQMA 5DNEA 1NUSA 1OYVA 1SZDA 1O58A 4LE1A 1LEHA 1HMPA 3GGSA 4P7FA 4XA8A 1WV0A 1DBQA 4P80A 5ELLA 1XN1A 2FYTA 5MFZA 4R9VA 5IYZA 3QPCA 5AICA 5KNBH 1G8KA 3DUWA 3V00A 3SXPA 3SJBA 3OIGA 3IP9A 1JHYA 2VS1A 2XMGA 3BBLA 4C2UA 1XWFA 3HKEB 3EIEA 3L6OO 4FVTA 3O8QA 4BLOA 2VZ8A 4Q00A 4QTYA 1D2NA 3CR3C 3FHLA 1N1MA 2Q7OE 5KNDA 1XMIA 1XC7A 5FHQA 1AV6A 3VXKA 2C2HA 3E1SA 5G41A 5G3YA 2EVWX 1H1LA 2QYHA 4IH4A 1E9RA 3Q0IA 5JTTA 1RM0A 1I94B 1BFDA 1FRFS 2AG6A 2VJBA 3IX7A 3PU6A 4I81A 3JY6A 3MOIA 3NPAA 4JDPA 4JQSA 5FV7A 2PQ2A 2WEKA 1V8BA 1Q57A 2V0CA 4II7A 4MARA 5K4HA 4QPCA 1ZFNA 4WXEA 3DTYA 1KP3A 2E5FA 4YRZA 5MF6A 2PKCA 1Z2NX 4JLDA 4L2IA 3RU2A 1W48A 3KB8A 4NK4A 3M83A 5CAEA 3L4SO 2WD7B 3MGGA 5EUQB 4QPJC 3LDFA 3ZKWB 3KKPA 3E23A 1OSNA 3VMFA 1H4QA 2HM7A 1YRYE 1YKSA 1TD1A 2NX2A 1J90A 3AVXA 2FSIA 2BHTA 3BA6A 3HL0A 4JBYA 1DKQA 1KO1A 1F60A 1QZZA 4NC9A 3R2JA 4IP0A 1DQNA 3L7NA 1YQDA 3CX6A 4FD2A 4YJFA 3WMEA 2IK8A 4Y67A 4F86A 3HH8A 5LQSA 2QMEA 4B84A 1V2HE 1QMPA 3A4MA 1S1MA 2H16A 4US2R 3U1VA 3VPHA 2BM0A 5C52B 2MT9A 3MSCA 3G7NA 3C6MA 1W19A 2GO7A 2WNIA 3PHJA 4IHKA 3EQZA 4JC0A 5A4IS 3HTXA 1PG5A 3IO3A 3NX4A 3AX6A 4LF4B 3DUFB 3OX2A 1HDEA 621PA 2J5BA 1RI1A 2YXPX 1L4KA 2JCGA 3LXXA 3NIGB 4RTQA 4R5HA 5AUPB 1EUDA 1S7GA 1TCAA 4YTEA 3DCIA 4RVDA 1V5FA 2ZATA 5E2BA 4PQRA 1V8OA 5EIOA 2ATVA 2P5UA 4PX3A 1QRSA 3V80A 4Q3KA 3TIXB 4C05A 1FSZA 2X40A 1U7PA 4RPGA 1DC3A 2I6TA 3TSCA 3ELBA 3NGMA 3KM0A 1R64A 3P97A 4EK9A 2AQHA 2G8LA 2V7XA 5DYGA 4PSDA 2D1TA 3PRJA 1X86B 5JECA 4K46A 3N7TA 3WL3A 1T8YA 4XTCS 3TFWA 1NP7A 4EHNA 4N76A 3L05A 3EIUA 3HVKA 3HVIA 4L4XA 3H19A 4DR1B 1T5IA 1X3LA 3DVQX 2GEDA 1HQCA 2IZ1A 2VF8A 4H7EA 2CHVA 4JCOA 2YL2A 2Z6AA 1NUPA 2RHCA 3PGA1 3QEBZ 2FAXA 2Z5LA 3NLLA 4UTVA 2I6XA 2QRGA 3HNRA 3HYLA 5DYNA 3N39C 1XD8A 2YVLA 3MWKA 4MDYA 4OQYA 5EKTA 2PLFA 5FHRA 1LPOA 1E98A 3AGQA 1NUQA 2CLDX 1PLJA 2FW0A 5FCDA 5ICFA 1ZU4A 4LI0A 2AI3A 3RCBA 1EZ1A 3PJRA 4MDHA 1JEQB 1WD5A 2QEQA 3WQSB 2FUNB 3ZD7A 4ZO7A 1U5BA 2JARA 3PICA 1K2WA 3E5NA 3FWNA 1Y42X 1UJ5A 5K7SA 3FRHA 4NOLA 4ZYZA 3FJYA 2QDXA 3I4LA 2BMWA 1DAFA 1GIAA 2OAQ1 4MGYR 1KU6A 3WVNA 1C4XA 2EDCA 2BUAA 3QELA 5B1EA 5FP0A 5HMMA 4A6EA 3FTFA 1REQA 3IQWA 3RC7A 1P3Y1 1I0ZA 4G0VA 4B3JA 1E7MA 3RTAA 4WLFA 3P9YA 4Q4HA 3SQDA 3TW0A 3BRCA 3IVGA 4R98A 3HJFA 1RFLA 1M2VB 3ZHYA 4RNDB 4OJQA 3W9UA 3RNLA 2GVDC 3AJAA 2BEVA 1PVVA 4KWCA 1FYDA 3ZBUA 1A97A 2VWPA 3IMFA 4MV0A 4UVGA 5F4BA 5BQ5A 1I1QB 3VNQA 2Y9PB 2Q3CA 3T94A 2Z30A 4QUKA 3OCXA 1BKSB 2PZBA 3KG2A 4JODA 1AN0A 3MBIA 1G20A 3MWDA 4YR9A 2Q9BA 3JQGA 5D87A 1X94A 3VKFA 1OZFA 4RIFA 4JLAA 4WHMA 3OJLA 2H11A 4JS0A 4F8YA 4MWTA 3T3DA 3DXYA 3BXHA 1Z39A 1ZD1A 4XM0A 4LXUA 5FWAA 1FMLA 3VOTA 1DAKA 1D04A 2C07A 2XAUA 4UPDA 4CDMA 1IRIA 1Y81A 2EEZA 1WW8A 1YO6A 3LC0A 4QNRA 3PRHA 3GMTA 3L0DA 4FFDA 4H3SA 5TQ0A 1YR2A 4K6HA 3SR0A 1L7PA 3T9DA 3DAGA 3PDCA 3EDQA 3W2IA 3BD8A 2FFRA 1ZUD1 1RQPA 5JDIA 2XNHA 4PXYA 3EIHA 4H7HA 1YB5A 1XXLA 1F4PA 2W9XA 3G8BA 1RBYA 3PFFA 4ZD6A 5FBVB 5EJ7A 1S2IA 1VCHA 3CZCA 3THSA 4I4CA 2C4NA 4P4SB 5D00A 2RHLA 2OV4A 4FS8A 4M22A 2JLWA 3BIFA 3B85A 4WKOA 4DNOA 1KXJA 5KYYB 4KO2S 1SVSA 1KZ4A 4YRQA 1EFRD 3EEBA 1E92A 5TPWA 2N0SA 3HA3A 4QYWA 3PXDA 4DLLA 2C5LA 2QUJA 3HJCA 4FQ7A 1UK8A 1E9EA 3D02A 4ZCPA 3ZOZA 3QFTA 5HJ5A 4PFQA 4F2PA 1VG9B 5FFMA 4BUZA 1SC9A 4HPWA 3E9YA 4ZRNA 5JS7A 3EQ7A 2P30A 2ZSIA 4LECA 1U2EA 3S28A 4IZ6A 4CTNA 1CKEA 2BF4A 3JAKB 1OLXA 3QUQA 4ZO6A 4F12A 4NCXA 3AR5A 1CB0A 1II8B 4GLLA 5G0VA 1U04A 2YMMA 4UDNA 1U6IA 2FPLA 1Z33A 4UZFA 1V8FA 1VDZA 4KV7A 4DMFA 1E2MA 4TZTA 4LSZA 1L0BA 1LZKA 2VYVA 4Z8XA 4P81A 4D81A 1N5JA 4IR7A 4AF6A 4M0PA 3ZK7A 3IS3A 2IKSA 1RVDA 2OHGA 4BO2A 4FYMA 1O96B 2HMYB 3LKVA 3MEQA 2PEZA 4C6RA 4H7PA 3DLTA 3W05A 4LZJA 1RIIA 4BV8A 3CVYA 5JAZA 1MW9X 2I87A 4FHGA 4CLOA 1QGOA 2I9KA 3EF3A 4LZAA 1RCTE 2IH4A 1DQRA 1BS2A 2ADFA 2ZVDA 3AIMA 2ZRCA 2XE4A 1V6CA 4FT2A 3F6BX 4KR7A 1C3VA 2HO4A 2IEAA 4TL9A 1FCJA 2P8SA 1D3AA 2SCUB 3UPTA 1Z74A 4TTIA 2HRDA 2P9HA 4KH0A 4OQLA 1F0NA 1O4VA 2OBFA 4Q47A 5E3JA 521PA 4AC9A 3HCAA 5T3YA 1ZD4A 1K5GA 1ONPA 3RJ9A 3A4LA 3TQQA 4DGSA 4AL4A 1O6BA 3NEPX 4JUBA 1Y1QA 3I72A 4AJ4A 3C6KA 4DF3A 3F9CA 1YS9A 4U8GA 1NXTA 4DJJA 5DNVA 2EQBA 2ZQYA 1KH3A 4RH3A 4KJZA 1EXNA 3RC3A 3ZE2B 2B8TA 3RIGA 1CVIA 5CJPA 1RQRA 4BTVA 2P2CA 1SN7A 2JIRA 4MRSA 4W63A 3SQNA 4WZAB 4QYSA 1SUCA 1WCV1 2EZ8A 3QPVA 1PNQA 3BSSA 3DHVA 3LUHA 3MS7A 1X7WA 3UZUA 1IJFA 3RVKA 4Z4HA 2AMFA 1D7OA 5B2FA 5CMLA 3NUGA 2JFZA 3H1FA 4OUDB 3BJZA 1MPXA 2OXRA 2ZDGA 3DWEX 2WTNA 1NAIA 3RF7A 2CL0X 3F3KA 3CNNA 3I09A 4U3JB 2X0EA 3VX3A 4E08A 2HT6A 2ZBEA 1IY1A 1CPYA 4MRRA 3B3AA 3WGYA 1EVZA 2WVHA 2WSSD 3TJMA 3WGOA 4CV2A 1GGKA 3A1EA 2O2HA 5AIBA 4JJ8A 2J7KA 1PNVA 3I1JA 2BP7B 3LS2A 1D1SA 1TAQA 4DG8A 1RKBA 2W6IA 2MMCA 4XDHA 1T36A 3LW8A 2E4YA 2XYRA 1KI4A 2DFTA 1Q7BA 2H1RA 2FEOA 1RWBA 1T4BA 4W8OA 1SXJC 1EX9A 4GHWA 1TVEA 1CZHA 3RVDA 4TM8A 4QOIA 2I34A 3JZFA 4LJAA 4UTOA 1N5DA 3MJ4A 1ZI9A 4JI1B 2IU0A 4W8GA 3QUSA 4MIEA 4QBKA 3UB4A 4X60A 1T9BA 5JOQA 3UW1A 3IP6A 1I1HA 1QXSA 2ZQZA 1W96A 1P91A 2CDRA 3AP3A 1H3NA 1IEQA 1AF7A 1NWCA 1BXRA 1PGNA 3I1IA 3OFKA 4Q3AA 4YJGA 3G2KA 4JR2A 1DIGA 3R4VA 1WVGA 3TRFA 4W6QA 5AUQA 1NLFA 2YY5A 3DLCA 5AK0A 5DKFA 3A6JA 1X80A 2D06A 2BV3A 3KKMA 2R60A 3I2IA 3WC4A 1S3SA 1M0EA 4WASA 1TM2A 5KYUB 1O6CA 5KVAA 1Z6GA 2XNDA 4EO9A 4QEDA 2PGIA 1ND6A 1F1JA 2AFIA 4B0PA 4FZJA 1COZA 4P4NA 4BAGA 1TUBA 4HDSA 4O4LF 1EDDA 1KNQA 4J43A 4LDJA 1L5OA 4A10A 3FOBA 3W2TA 4CLRA 5AHXA 1W6RA 1Z73A 1GPMA 1D2CA 3BGWA 4LGMA 2RD2A 4RJLA 3EFEA 4PPGA 4IVPA 3P2KA 3EZYA 4V0QA 4GPTA 6ABPA 2YINC 2VHQA 1WW2A 3CIOA 3EXG2 3LSYA 3L7KA 5IAEA 4LF9B 2O8FB 1Z0FA 1FX0A 4J2OA 5AW5A 1YAJA 2H7YA 4UE6A 1N9KA 3O8NA 4AWAA 1T3TA 5TX7A 1YFZA 2HJ9A 4X7BA 2O14A 4DQLA 4ZT3A 2FW8A 2FZ4A 3O8RA 4KDCA 5J1TB 4D3DA 5DCUA 1R8JA 1XD2A 4DY4A 5ECDA 2GB4A 3EXHB 4YRDA 4L4SA 3EG9A 3Q88A 3LPDA 4KX5A 4NJEA 4YRPA 1MDBA 3JWGA 2WMYA 2CD7A 2RJNA 4EG1A 4IQ0A 3G1TA 3QHQA 3EPKA 2OSBA 5HKOA 1TEZA 4Z7JA 1PNOA 1RXWA 3D6HA 1XMVA 1LFAA 1RVV1 1XEXB 2QAGB 1M34E 3DNPA 5BNTA 4UM8B 1KERA 1T8PA 3QHPA 1GL6A 3WRWA 2TRSB 1B41A 1BKDR 2IYUA 2PZEA 2A0KA 2HI0A 1UFQA 4JB2A 4XYGA 3LCMA 1QGZA 3DWFA 5BSKA 1DGQA 2XTJA 3CW8X 5ERGB 3HXKA 3DKVA 4PCUA 4Y7DA 2Q50A 4P1ZA 2JBWA 3NTLA 4BNTA 4BDTA 1T25A 3H9JA 5BORA 2QENA 4BNVA 5IBRA 3ZV7A 4EENA 1OI2A 3T7EA 4EVIA 3HCRA 4PLWA 3KPUA 4LKRA 3RHTA 4A0SA 4OU5A 2BFCA 3C3EA 4X1YB 4CWAA 3HVRA 3K70C 2DMRA 1J1UA 2ZUCA 1HT1E 4ZQBA 3O90A 3U44A 4L8YA 4LDRA 5JHGB 3GRPA 4YI5A 2PL9A 4XX0B 1Q2XA 1S1CA 2ZT7A 4BNDA 4QODA 3SVZA 1I3NA 2GAIA 2VXCA 4JUAA 2H9IA 4FNGA 5BNZA 2QD4A 1FNCA 2B92A 5HCIA 1L4UA 1HC7A 2Q27A 4D9BA 3LWNA 4XQEA 4MR9B 2OMKA 3JALB 3JYQA 4EYKA 3H4TA 1Z8DA 3F4LA 5D8DA 5A03A 2AW3A 1Q74A 3Q0EA 3D3WB 1JLKA 1WSAA 3VJKA 5B64A 1BDHA 1XHEA 4H16A 4MOWA 4YUZA 5FYQA 1GWNA 2PS0A 3WGVA 5DCLA 4MMZB 1N6OA 1BCSA 4KLAA 1BD4A 1GG8A 2F43A 3QUBA 1RCFA 4JXKA 4D9EA 4WSOA 3PEEA 4RGQA 1Z2AA 1LVHA 3MMPA 5DLEA 5HKBA 2IPNA 1HQYE 4Q19A 1OQAA 1FYVA 3PHBE 4JLPA 1BXGA 4OMUA 5D3QA 4M9ZA 1XUOA 3GFFA 2SNIE 4S05A 3AR2A 3AF6A 3KKEA 2HPHA 1HTTA 2I54A 2O7QA 1YASA 1FUIA 1P5RA 2MINA 2HHJA 3DBHA 4DG9A 2W4IA 2G9RA 4L08A 2ORIA 3LQQA 4LZZA 3CVWA 3GRZA 1SUFA 2J9YB 3OVMA 2JFGA 3ANTA 1ADGA 4F92B 4E70A 3JARB 1T2CA 4EHJA 5GONA 4FYIA 5GGXA 4QQKA 4U9HS 3HLYA 5J47A 2XITA 3DMNA 1V43A 2Y0DA 1IATA 4YRKA 1JKIA 3EDYA 1VE1A 3GT3A 1SXPA 4PPNA 2GHIA 5JEEA 1Z6XA 1LGYA 2D13A 2FSHA 2NSJA 2Q4OA 3EEFA 3K9HA 3EZLA 3QWAA 4BLSA 3TGLA 1B0AA 4JCCA 2IF2A 5IKMA 3SY8A 5IT5A 5DGCA 4AJNA 2R6CA 4FBGA 4QTTB 2LRHA 4FGKA 5CA1B 4HZGA 2PKYX 4MWBA 2G1PA 3IBTA 1BHO1 1QIGA 3NEAA 5AJWA 1MTOA 3GEPA 1Q7RA 4L8VA 4Q1FA 4HGYA 1X1AA 4RM3A 1EJ6A 2IIBA 1JDBC 3EIXA 3N6VA 4N3AA 2B5OA 2O2IA 3L1KA 5ARDA 1JSLA 4B5KA