4QGHA

S.aureus tmk in complex with potent inhibitor compound 47
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
204
structure length
195
Chain Sequence
b'SAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIKNDQEDLKFHEKVIEGYQEIIHNQRFKSVNADQPLENVVEDTYQTIIKYLEKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Antibacterial inhibitors of gram-positive thymidylate kinase: structure-activity relationships and chiral preference of a new hydrophobic binding region.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 195
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4qghA00
1OXXK 5JS8A 3KTAA 1ESNA 2CCJA 5CYPA 4F7WA 3PUZA 2JIZA 3GJ0A 2QSZA 4Y0AA 2GEUA 2J7PA 3MSXA 1IN6A 4HDCA 3VU9B 4D6PA 2CVHA 1T3SA 2J59A 5BWMA 1KJWA 2JLZA 1FPMA 1VDZA 2GEDA 5LDDC 2WAYA 3CBQA 2PT7A 3REFA 4U02A 5AWFC 4RY2A 1ZM9A 3RVBA 3RWOA 2XB2A 4PSKA 1D2EA 2QUZA 2ZSDA 1E2QA 2JJ2D 4N3NA 4W5HA 4U7DA 5LD2C 3LO5A 3CH4B 3AP3A 5E4FA 3BIFA 3TW8B 5BW8A 4US2R 1TF5A 3BB1A 3O8CA 1KY3A 1NLYA 2P0EA 3QG1A 2X1VA 2QPTA 1XPRA 4GOKA 1YRBA 4QGGA 2KBFA 3KTAB 3AP1A 4AKIA 2IYYA 1P2SA 5B64A 4BZXA 1HTWA 4Z8YA 4URWR 5J4LA 1E9DA 3GD7A 2ONKA 4MYCA 2XXAA 4B73A 3TH5A 1ZIPA 3U4QA 3BORA 3HU3A 5FTKA 5C4MA 1KGDA 4YQFA 1UDWA 4DLXA 1G6HA 2RCNA 5FPYA 1FOEB 3JZMA 4JBXA 3TSZA 2GILA 4JVLA 4J0QA 3WBJA 3OEED 2QBYA 1XMVA 4P0TA 4V0OA 4B44A 3FHOA 2VP4A 5BN5A 1YR9A 3KXKA 3I61A 3BFXA 2P5TB 1UPTA 2ZRNA 3CX6A 4JYBA 3BB4A 2ODBA 4MKFA 4LYHA 1KZ7B 1HH4A 3B1WA 1FL9A 4A8JC 1PUJA 5AJVB 2OLKA 4IDNA 4OQMA 5EE3A 2RGAA 4H9GA 3EIQA 1VKJA 3BWDD 4MDEA 3QKTA 4UKDA 5FUXA 3ICQB 4BUJA 4KVAA 2RH5A 3BB3A 2BBOA 4BFZA 2WPDA 1NKTA 3VHXA 1R7RA 1E2EA 1OFTA 3UMRA 4CT4B 1YZQA 2GZAA 2RGEA 4HEJA 3B7GA 5G41A 2ATXA 3U60B 2UZIR 4EUNA 1D2NA 2W2XA 3DMDA 3B9QA 3BJIC 3UMFA 1P9WA 3AP2A 3MJRA 4WZBE 2F7SA 3AUYA 3FMIA 1K5DA 2D7CA 3CLVA 4Q18A 4KITB 4A8JB 1U98A 5ELXA 3IHWA 4HB3A 4DRZA 2ZJBA 3LBIA 3KUDA 4ZIRB 3TRFA 4HAXA 4B48A 4F4JA 4YXWD 1IONA 2J87A 3K53A 4QGFA 4RZXA 4BFXA 4DLZA 1B23P 1SGWA 1QHNA 2BM1A 4QXAA 3FVQA 4TL6A 2ONJA 5F9FA 1DARA 1TADA 4JLPA 3X1DA 2AWOA 4ON9A 1QG2A 1G5PA 5CB6A 5JWOA 1S1CA 3CX8A 2HT6A 3KUCA 1KK1A 3KKPA 4DIDA 1SVOA 2D7DA 4CEJA 3LA6A 4JSTA 3K0EA 1Q44A 3U7EB 4TL8A 4DLWA 1L4YA 4LC1A 1QHYA 3SZRA 3AH8A 2YHSA 1XEXB 1FP7A 1OYWA 2J0VA 1KSGA 5JWRA 5L8VA 4FW9A 4NU0A 3R9XA 1O87A 4X8HA 2J0UA 3OIVA 4G1UC 2QTVB 1L8QA 1G7CA 1ZJ6A 1Q3TA 4A6PA 4TLDA 2WJYA 2CHQA 2GXSA 2WWXA 1E2DA 1H8HD 4M9QA 3B85A 2XJ9A 3MWJA 1R8QA 4U5XA 2RKOA 4LJ4A 5BYKA 2VF7A 3OIWA 4HUQA 1RIFA 4A6XA 3H2YA 2P67A 1Q1QA 5G40A 2AK2A 4NYJR 3AVWA 2QY9A 4Q02A 4OK6A 1E9SA 4M1KA 4JLKA 2QMUA 1Z6YA 4FXPA 3H84A 1XRJA 1Q0UA 4B34A 1AA9A 4F4IA 2J0UB 2ZRHA 2ZR9A 4BFYA 1F5NA 1NLZA 1RKBA 3LWNA 2BMJA 4HZUB 4RZ3A 2AKAB 1Q22A 1M8PA 2FX3A 4M2LA 4M9SA 1DO2A 2OCYC 2W6IA 4C0KA 3QBVA 4CEHA 2BEKA 4B47A 4M0LA 4RZUA 3HYTA 4DCUA 1TEVA 2C78A 4M1YA 4B43A 3S1AB 3UIEA 2NO0A 3W8RA 4C3ZA 3AF3A 4Y0VA 3NDPA 2C9CA 5E7JA 5D3QA 4PHTA 3O8BA 1N0WA 3L0SA 4OQXA 1W0KD 5KPDA 3FMPB 1SXJE 2ANBA 1U8ZA 3SFZA 2FGJA 3LVRE 1QHHB 4GMDA 4EQ6A 3ICEA 3K8YA 2FEMA 4ARZB 4QG7A 1N2CE 3KKNA 1ZNWA 2FPKA 4TSFD 4E22A 5C18A 3FHTA 1YE8A 3ZZUA 2W2TA 4CEHB 3A8TA 3I8XA 4Q4AA 1M34E 1MH1A 3E2IA 3KL4A 3NC1C 1WA5A 1T4GA 4QM6A 2IEYA 4A15A 3L2OB 2NPFA 1RRCA 4DB2A 4D2IA 3D3QA 2MMCA 3TR5A 1A5TA 2LWIA 4B74A 4Q03A 3U61B 1OHHD 1SQ5A 5LPNA 1W47A 1E32A 5DI9A 4D80A 2W2VA 1TUIA 1G3MA 4K46A 4LV8B 3GPLA 4FCTA 3CRRA 5EE5B 2P6RA 4FCVA 2IYTA 4LDJA 3UXMA 1OXVA 2ZJYA 3NEYA 2MSDB 3CB4A 2TMKA 3B1ZA 2C99A 4YMVA 5EZ5A 5AUOB 1E4VA 3IO5A 5DHAA 1N6PA 1SXJA 1KMHA 4O2RA 2OSBA 1Z6TA 1Z2AA 1M1YE 1SVKA 1N0UA 4RD0A 5JI3E 2EFHB 2GJKA 2GEVA 1HT2E 1G8YA 2BCGY 2FPMA 1GFIA 1GTVA 4F93B 2PEYA 1D5CA 1E0JA 2G88A 3CO5A 4K8OA 3UMSA 2MMGA 2Q21A 2VH5R 3WP1B 5CITA 1ZNZA 2XNDA 5AJZA 5TMPA 4RZ2A 4NCHA 1AQUA 5CJPA 3KJIA 2OXRA 1ZM4A 2CDNA 3EAQA 2B8TA 1WXQA 4UJ5A 4P4SB 2PEZA 4Q21A 1UDXA 1HEIA 2IBMA 3I3SR 4KFTA 4A2PA 3NXSA 2A30A 4EPVA 3WMGA 4EFLA 2QGNA 2OAP1 4PC6A 2XB4A 2ZRCA 2V3CC 1NN1A 3K70C 2XZLA 5JMTA 2WVJA 5FOUA 4GFDA 4DSNA 4Q47A 3BC1A 1OE0A 1PVOA 2O8DA 3VKGA 1E1QD 4ESVA 3V9PA 2QT1A 2YV5A 5JEEA 1M74A 1RYFA 3M6AA 1QVAA 4B75A 4PAOA 4WAUA 4URVR 2J1LA 2ZYTX 3T1OA 2JASA 4BGDA 2QAGC 1TNDA 4ACBA 2AXPA 1M6NA 2J9RA 4ERNA 3THWB 5F3WB 1KO8A 1V43A 1KSFX 3DKVA 4JBYA 1T0HB 2FF7A 3R8FA 4Q4JB 4BFUA 1NBME 1C4OA 3K70B 1A4RA 1GIAA 4FWIB 1ANKA 3CF0A 2OEPA 4NBSA 4C9BA 3K9HA 2W0SA 3RRNA 4DB4A 3GP8A 2ZRDA 1F2UB 1C9KA 1GRRA 2CK3D 2NZJA 4UQOA 5FTMA 3UWKA 4DIEA 2IS2A 1T8TA 1XTQA 1LFDB 3I4LA 4IOKA 2OLJA 4O25A 1DAKA 1GWNA 2NIPA 2QAGB 3QXXA 4LBYA 1CJVC 5E7IA 4LYAA 4C0AC 4EPTA 1FW6A 4R71A 1CJUC 2ZJ8A 1HT1E 1YZKA 2ZRPA 5IT5A 1S96A 5FUWA 1P2TA 1AGRA 3X1XA 4JIMA 2QENA 4KJZA 4OHVA 2O8BB 3HR8A 1LW7A 4LV6A 5FOVA 3K0AB 3K9NA 2QAJA 1G41A 4C0HA 1WRBA 1ZBDA 2AFIE 1ZUIA 5FPHA 3SNHA 4TYWA 4H1UA 2OT3B 5CK4A 4FMCF 3MFYA 5AK0A 2O8EA 3T1TA 1FNNA 1X6VA 2WSMA 2PT5A 2ZVQX 1NBMA 1OB2A 1PJRA 2EFEB 1XTJA 4PPFA 2REXB 3OZXA 1KI4A 4AKHA 1VHTA 2ZRBA 2DCUA 1U0HC 3OIUA 2ODNA 3D31A 3K70D 3TUIC 1FTSA 2ZUDA 3EWSA 3WYAA 2VHUA 3SYLA 1EFUA 2OILA 2WWHA 2ZJAA 4NYMQ 1W44A 2IYVA 2JJ1A 1D6JA 4IXMA 3TK1A 3ZZ0A 3R7WA 3WRXC 4FCWA 2JDID 2P65A 1E2LA 2A5GA 3AQ4A 1E1RA 1M7BA 3B1XA 1EWQA 1XP8A 1SVSA 4C0QC 2J41A 2JLSA 3F0TA 3LLMA 3WMFA 2QN6A 4GI7A 3AF1A 3ZD6A 4P32A 1BS1A 3Q8XB 4AK9A 5CLLA 4TMWA 1Q1BA 2GCNA 3A4LA 2GETA 4KYIB 2ZI5A 3CRQA 4I4LA 4M22A 4LPKA 4OL0A 3QUSA 3CUEF 4Q66C 1XD2A 2ZTSA 3M4YA 5B57C 2FSGA 5JJKA 2WAXA 4BPBA 2C9YA 3U2QA 2ZRJA 3MCAA 2CBZA 2ZE5A 4MKIA 2GNOA 2Z4SA 2O8CB 3B2EA 3G0HA 2DBYA 1S8FA 4OQLA 5A0FA 1RZ3A 1UBCA 2FA9A 3I1FA 3KKMA 2D74A 4M21A 4NCIA 4OHXA 2GJSA 1HE8B 4YONB 3LFUA 4OKSA 1X3SA 1T9HA 2AR7A 1R5OA 1II8A 2YZ2A 3AVQA 1PLLA 3N5CA 4IOJA 5CM9C 5FBWB 4AIIA 1KSHA 2P6UA 2X77A 1S3GA 1SKYE 2OESA 1DAIA 4DJTA 1G8GA 2ORWA 3FPAA 4M1TA 4FMDF 5J40A 4NYIR 4NKRA 2VSOA 4AY2A 3WNBA 2C98A 4Q9IA 1R6BX 2N42A 1E6CA 2ZSEA 3SJCA 3V00A 4BLSA 4JBWA 3SN6A 2EYUA 5G53C 1EX7A 2BJWA 4M1OA 4PAQA 4DDWA 4XH9B 5BN4A 5FBVB 1XTSA 5EJEA 4IXNA 1DAEA 3JVUA 1NIJA 3RWMB 1FTNA 4II7A 1JQJC 1COWD 1S0UA 3N2IA 1H8EA 2ZUCA 1G19A 1II8B 4TLAA 3LX8A 4Z1MA 2IC5A 3P32A 1DADA 4MKGA 5JLJA 4MKHA 1G20E 2JJ1D 1X1SA 4G5SA 1G17A 2DR3A 4LYFA 5IK2A 3EZ2A 2HJVA 4M1SA 3CRVA 1DPFA 5JHHB 1R0ZA 4EAQA 5DE3A 1PLJA 3CNLA 5IDVA 2QTFA 1KNQA 2YNMA 4JMPA 4BWYA 1RRGA 4WXPA 4UNRA 4PHHA 3GLFB 3NKVA 1YZNA 4MYTA 1T91A 3PUXA 4M4SA 1U2RA 4L16A 1G3UA 4MRSA 3CPEA 2HF8A 2IWHA 4BRWA 3QXSA 1W5SA 2PZFA 5JRJA 3AKEA 4V02A 4UNSA 4UNNA 2QMOA 3T12A 4BLQA 1AGPA 4AD8A 2ERYA 3LXRA 3C7KA 1F48A 2P6NA 2GJAA 1Q12A 2O0KA 3EZ6A 3QF4A 1U99A 1R0WA 1YZTA 2ZSAA 3DL0A 3B5JA 4EJSA 5EP2A 2OFXA 4XWAA 4TT3A 1GKIA 4D81A 3ZYCA 1WBDA 5FTNA 1XTRA 3SOPA 4HYYA 4BEBA 3GFPA 5EXPA 2GJ8A 1DEKA 1W46A 4I99A 5FUYA 1OIWA 3ZVRA 1KZGB 3PEVA 2GRJA 3SHFA 3QQ5A 4HB0A 2EW1A 1RRPA 2R2AA 4B3DA 2FOLA 2W6JD 4FMCB 4CZ2A 4DLUA 1KK2A 3RRMA 5KHOC 1M7HA 5DGXA 1J8MF 2ATVA 3U7GA 4CEIB 2MSEB 3AVPA 3IBYA 1GNQA 3LW7A 1JPNA 3RYTC 1XF9A 3U44B 3U7HB 4RKFA 4DCNA 3IEUA 4JLMA 3RRZA 1Z6XA 4C0JA 1KDRA 1SVMA 2QU8A 3QF4B 3ZD7A 3CR8A 3OE7D 4D4JA 1E9BA 1E79D 5EP4A 2VO1A 3RANA 3K0CA 1IN7A 1D9XA 3K09A 3MAAC 4PC7A 4TTRA 3TVDA 2XEXA 1CR0A 1P6XA 1GAJA 4HLUC 5F2EA 1OIVA 3DVLA 4JT4A 3PUVA 1JALA 2JLYA 2J7KA 3U7FB 1PZNA 4HZIA 4N0DA 3RS3A 3WYFA 3ZGXA 2ZS9A 3RLFA 2GCOB 2ZYVX 2GZHA 3SBDA 3OESA 1JR6A 1RJ9A 1ZM3A 1US8B 3NHBA 4G01B 3T61A 4DEYA 2ZQ5A 3BH6A 3MD0A 3ND8A 1ZNYA 3UKDA 2X2EA 4F4CA 4US1R 5HZKA 4TLCA 2AWNA 4F38A 5F98A 4QM7A 2YWFA 3GJ8A 1U8AA 3VU9A 1VIYA 4LJ7A 3VR3A 2WM9B 3MLEA 3LBHA 2HCBA 4B2IA 3ZS8A 1P75A 4MYUA 2F1JA 1XNJA 3IBGA 2C5LA 3P27A 3VKWA 4GBMA 5B30A 1T6NA 2D2FA 2GXUA 4JZKA 1X1RA 3PITA 4NHOA 5FPTA 2IA5A 1L7VC 5C2JB 4B33A 2F1RA 4FMDB 5BN3A 221PA 4KAXA 4TT3D 1Z07A 1G4UR 2H8KA 3EX7C 3OFND 2VHQA 1ZMXA 1VYVA 1GL6A 3IIMA 4RD2A 3SYNA 2RMKA 1E2FA 4PR0A 721PA 1E0SA 5JHGB 4XJXA 3A1WA 2IL1A 2C04A 1K8RA 3REGA 4JS0A 2CCGA 5TDHA 1EFTA 2W00A 4TL9A 1J90A 2Z5FA 4CIDA 2JCSA 2IS4A 3RS7A 1M7GA 4KU4A 3ASZA 1TEXA 3MWKA 3TLXA 4ABYA 1YR7A 2BEJA 1SVWA 1ESMA 4DDTA 4YXWA 1G3IA 1TX4B 1P62B 4BFSA 2WMNB 3NBFA 1EGAA 4QHSA 3UG7A 1JJ7A 3RS2A 2VTKA 3LH5A 1OH7A 3CIOA 5J47A 4QHYA 4ESHA 3IIKA 3N2EA 5AUNB 3MG9A 1UBGA 1YR8A 1ZINA 4P31A 1I2MA 1TMKA 1Z22A 4L9WA 1JNYA 1NJFA 5KNBA 3QSYA 3O47A 1ZD1A 3Q7QA 3FFBA 2HJGA 1NP6A 4TMKA 4E5UA 1E2NA 4MDFA 1XWIA 4I1VA 3HP1A 3PG5A 2B6HA 2PBRA 2A5YB 5LD2B 4ZKEA 1AS3A 3K0SA 5JJIA 1H8HA 2VEDA 3TMKA 1E9RA 1V5WA 2GAOA 4OI0A 1EESA 3OF5A 1R8SA 3B6EA 2PJRA 2QT0A 5EP3A 1GL9B 2N1BA 2OBMA 4TMTA 1KK3A 1DELA 1KO4A 3K1JA 3ZVNA 3CKLA 1E9CA 1G7RA 2W0MA 4PSAA 4A8JA 1U0JA 3LV8A 4ZIRA 2PH1A 1JQLB 3CZPA 4IVRA 2BKEA 2EWVA 2RGCA 1G3RA 1YQTA 2DFKB 2XJ4A 2EFDB 1R2QA 2PZGA 1S9DA 1WDTA 3Q72A 2R6FA 1RW4A 2F1HA 2I3BA 3LLUA 5KPJA 1Z47A 4B6FA 3KQLA 3L0OA 3PJRA 3TAHA 1O3YA 1Z0AA 4JL8A 2L0XA 2KWIA 3TGPA 5DNYB 4OHWA 1Z2CA 1Q57A 3U6KA 1WP9A 1ZC3A 2FSIA 1EFHA 4WOPA 2CHGA 1XEXA 2IWRA 1Z83A 3LQQA 2PLFA 3EA5A 2JEOA 2QRZA 4UNQA 5GJBA 2Q3MA 5K8TA 4PXAA 3BH0A 3TR0A 2BM0A 2J45A 4AC9A 3QY0A 2PX0A 1WE2A 4AKEA 4D82A 4I1OA 3R9WA 2PCJA 3A58B 1W0KA 4FINA 5GJWC 4A9AA 3GJ5A 2UVQA 3VFDA 1LF5A 4PC2A 4QFMA 2CHVA 4DT1B 2IHBA 2AXNA 4POAA 1HUQA 1Z28A 521PA 4TSFA 4AG5A 1W7AA 2I4IA 4G0NA 2ODWA 1ZRHA 2A9KA 2QORA 4L8GA 4L4UA 3ZS9A 4DVGA 3LRPA 3C16C 1NVVQ 2Q3FA 1SHKA 1IXZA 3QVVA 4MRVA 1GDDA 2A7QA 1KHTA 1N6NA 4TZ0A 1OHHA 3IGFA 1P73A 3PFIA 3UK6A 2B8WA 4HZUA 4S35A 2BKUA 2OG2A 1XMJA 2HXYA 3BXZA 3LXXA 4TLBA 3QJYA 1TU3A 2CCKA 2HXSA 2FPLA 4HAYA 2WWGA 3FMFA 1ETUA 2CE7A 4DCVA 4TLEA 2FH5B 2YWHA 2GESA 3EC2A 3D7MA 4S2EA 2JJ8A 2WICA 3F8TA 3S1AA 2WJVA 3PUWA 3QKUA 1UFQA 2PMDA 5AR1A 3FWYA 1VMAA 3CZQA 4JLBA 5FR1A 2CE2X 3W8NA 1VCOA 3FTQA 4JLDA 1E94E 5CYOA 1Z0IA 4FD2A 1XEWX 2Y8EA 3I5XA 2KSQA 3C15C 3ZH9B 1QHHA 4A1FA 2R44A 3CM0A 1LS1A 2GVZC 4ARZA 2OUKA 1E2HA 1WB9A 1Z8FA 2ZRIA 1T5IA 2E87A 2WJIA 1LNZA 4YDHB 4DC9A 4JKYA 4NP6A 3W5IA 2NMVA 1E2GA 3DKPA 4D0NA 1F6BA 1RYHA 3QENA 5DLQC 3DZ8A 1AKYA 3TBKA 4DBLC 2YOGA 4OI4A 1AS0A 1D9ZA 1Z0DA 2IYZA 3QIAA 4HLCA 3VR2A 2BMDA 1CR2A 1UEJA 2WSSD 3EIHA 1E2PA 2HCJB 1R10A 1LB1B 4RJLA 3FKSD 2H7VA 5BXQC 1EX6A 4Q7MB 4WZ6A 1E1QA 3BS4A 1QHXA 5CIWA 1U0LA 2PCLA 3H4MA 2CLSA 4HSEA 3H1TA 4US0R 3A1UA 4W7SA 2ZRKA 3LW8A 4KLNA 1T8UA 5EE1A 3TQFA 3CRW1 2OO7A 1HQYE 4ILEA 1VG1A 1ZM7A 1SZPA 4Q1CA 4V0ME 5GVSA 1NVWQ 4Q4LA 3WHLA 4HLDA 2ZR7A 2H16A 2F6RA 4PZYA 1R0XA 3DMNA 3OHMA 3R20A 4FIDA 5JSZB 3RC3A 3QPWA 4QJ3A 1NVUQ 4M8NE 1IBRA 1T3LA 3V4FA 1LV7A 3QNUA 4IDOA 3CF6R 3F5FA 2V7QA 2GDJA 1HA3A 2YJTD 4IW3B 1HE1C 5H1YA 3BAFA 3VQTA 3WXMA 2YWGA 3U5ZB 1U8YA 4JJZA 1BYIA 2CK3A 1UKZA 2IF0A 3CRMA 4P4SA 3WMEA 2XSZD 2HYDA 5SZJA 1MOZA 3GMTA 5LB4A 2CNWD 3TW4A 1DAFA 1W0JD 1BH2A 2CVFA 1C1YA 2IXEA 2QQ0A 2WOJA 4OQNA 3X1ZA 2JA1A 3X1WA 1G7SA 4AKGA 1DBSA 1L2TA 2OV2A 4PO9A 5AUPB 3HJNA 4ZV4A 2WWIA 121PA 3PUYA 1MT0A 1DE0A 1I4DD 2GXAA 3CWZA 4U00A 2VA8A 4V0MA 3OIYA 2ZPTX 1ZCAA 1E2IA 1ZCBA 2NOAA 2IYRA 3OAAD 4W5JA 1VHLA 2XAUA 2EVWX 3N70A 4L15A 1NMZA 4NYMR 3GLGB 5EE0A 1KY2A 2FWRA 2QRNA 3EC1A 4IEEA 1UEIA 4KLZA 3ADCA 1FUUA 4A2QA 1T0JB 1CR1A 4LYJA 2NZ8A 3KKQA 4V03A 1SXJC 5EXSA 3NTUA 3THWA 2GF0A 4D25A 2DY1A 4W5WA 3IILA 5FOSA 1DTSA 4Q4JA 5K8UA 2WIAA 3SU8A 1QG4A 2GJ9A 1JXMA 4KVGA 2BMEA 2F43B 1DG1G 2EQBA 1EXMA 1RC8A 1P72A 5CK5A 4XWOA 3EW9A 5IRCD 1F2UA 2CMKA 2JDIA 3T1VA 3A4NA 2OM2A 4EFMA 2CL6X 3GLHA 3KXIA 3ETLA 2BVNA 3H0KA 4H1VA 2H18A 1IN5A 1LS6A 4B71A 1D2MA 621PA 2HDNB 1E2KA 1G5TA 2CL0X 2QAGA 4C0SA 2Q9CA 4B76A 3W9YA 3TQCA 2JLWA 4C0BA 5J4KA 4W9MC 2BCJQ 4NZYA 3JVVA 4D4LA 1ZM2A 2O8BA 4Q4HA 2C77A 2QEQA 5GJVC 3K0AA 5C46F 2QM8A 1OH5A 5GADl 4OHYA 4KBGA 2HLDA 3BD9A 1LY1A 1TQ2A 1CRPA 2ZYWX 1NN3A 2F3TA 3HU1A 4HB2A 5JJLA 1E2MA 4BECA 2V7QD 4Q1FA 3ZVLA 5EZ6B 3GLHB 5IF9A 4UXIA 3GJXC 5M04A 2G3YA 4L5BA 3QG5A 1G6OA 3P20A 4TMXA 1F3OA 1E9EA 4ASUD 2ERXA 3RNLA 1KI3A 4C7OB 1TQ4A 5D3MA 1EFRA 3BOSA 3KXLA 1KI2A 5CJ2A 4B3FX 1XPUA 1OFHA 4Q4HB 3R9IA 3SR0A 4BFTA 1PLKA 4Q9KA 1IM2A 4PQFA 4Q1EA 1JR3D 1QVRA 5CIQA 3RRYA 2JAQA 2OCPA 2X19A 4RFSB 4UXHA 1VG9B 1QDEA 1JXOA 4NE2A 3AVUA 3QOFA 4QRHA 4RVCA 2CLDX 1KI1A 4LK2A 1COWA 1YKSA 1UKYA 1W36C 5TVKA 4TYNA 1P3JA 3EZFA 5G3ZA 3FOZA 4PTLA 1JPJA 3W3AA 4JLVA 1KI9A 3I92A 1N5JA 3D6TB 3BE4A 5D3MB 2QA5A 1CRQA 2ZRLA 2RGBA 4OBEA 2O8CA 3DZDA 1KNXA 4N0EA 3GLIA 1NI3A 2LCFA 1U94A 1KI6A 1XD9A 1EWRA 2ZITA 4GZMA 5SZIA 3TNFA 2Q3HA 4OI1A 1P9NA 1ZD8A 3CF2A 4DUGD 2XNSA 2ZSFA 1RRFA 2ZI4A 3I5YA 3ZLJA 4A0GA 3B78A 4AWXA 4JLNA 4IOMA 4XTCS 4IHQA 3U3MA 3Q5EA 2IT1A 3T34A 2ZJ5A 3I32A 3X2SA 1NKSA 3HYRA 2HV8A 1IQPA 3GLFE 4BFVA 2VP2A 4LC0A 1CP2A 1Z29A 4NCKA 2J46A 1OH6A 2AKYA 4DCTA 2HLDD 3BH7A 4G3XA 2PX3A 4A2WA 3EZ7A 4LHYA 5FPKA 1N5KA 421PA 4XD7D 3GLIB 1RFLA 2J0SA 1KI6B 4RKEA 2PMKA 4Q01A 3SHWA 2REOA 1N6RA 4M9ZA 2QE7A 5E3HA 3HU2A 2KB0A 2A3RA 3KQHA 3F3YA 4WXRA 3A6PC 3ASYA 4M9XA 4GL2A 3A1SA 3QXCA 3T5GA 4CDGA 1H65A 2R6GA 2XZOA 1EFRD 2ODEA 2A78A 1N0VC 5JI2E 3IO3A 4Q00A 1NG9A 4PHGA 5FL3A 2QP3A 1U81A 1FMLA 2W6JA 4PHFA 3ZIAD 4B2LA 5L3SB 4ZCMA 2OBLA 1TQ6A 1CF4A 4ZO4A 2NO6A 1GL7A 3DM9B 4RCYA 4A4DA 3NG1A 3Q3JB 1Z0FA 2W58A 3NVAA 2FG5A 2D62A 1VIAA 4G5OA 1S3SA 2C03A 1DS6A 2QP9X 1W49A 2VIIA 4GP6A 4HUTA 1CU1A 1CULC 2EU8A 3OE7A 1E79A 3GEHA 1VCIA 1KDOA 4PAMA 5JFGA 1ZNXA 4LHZA 3P4YA 2ANCA 5KUTA 3KQKA 4MRRA 2LKDA 2AX4A 3KFXA 1N6HA 1NLFA 2JATA 1FP6A 3NHAA 4TQUS 3BGWA 2FU5C 3QXHA 2B21A 3GEIA 4NCJA 2RHMA 2IF2A 3U3KA 3CPJB 1HY3A 2REBA 3EWAA 1MRNA 2DFNA 3FYHA 4KYUA 3SFVA 3THXB 5KNDA 2G1KA 2D3WA 2CJWB 2BBWA 4PFSA 5FOWA 2GF9A 4WZAE 4C0LA 4OK5A 1A2BA 1XDBA 4ZPXA 2E9SA 3EXAA 3THOA 2HT1A 3RAPR 1RE0A 3B60A 3QI2A 4Q7KA 5EXTA 1G9XA 4TN1A 4EFNA 4PQYA 1OLOA 2WMOB 2DPXA 1DAMA 5JZVA 2BOVA 3SE0A 4JLOA 3RDPA 4CGZA 2ZJ2A 3QBTA 1W1WA 3TVTA 2H57A 1Y63A 5EQTA 5FL7A 4CEIA 4HAVA 1JECA 4DLSA 1FNMA 2GBLC 2YYZA 3U44A 3THYB 1OKKD 2XZPA 3KDSE 5KNCA 5FFMA 3FFAA 3SJZA 4LRWA 2QE7D 4F91B 1A2KC 3RS4A 2VHJA 4NTZA 1G1MA 2GCPA 2BWJA 4JSYA 4YMUA 4PX9A 5FR2A 3TAUA 4BZPA 1G8PA 2QGZA 3KQNA 2P3SA 3OFNA 5TV2A 4B32A 4MQBA 2Q9AA 1XTKA 3AGPA 2QP4A 2CXXA 4V0KA 4X8OA 1E9AA 3KJHA 3A4MA 3IIJA 1NN0A 3HR7A 5FUVA 2IW3A 2GCOA 5E7MA 2RGNC 1XX6A 2I1QA 3ND9A 1US8A 4N1AA 2H17A 1MV5A 2IXFA 1NVXQ 3IQXA 4URYR 3TUJC 2JLVA 1XZPA 1NY6A 4QNMA 3LBNA 2DHRA 3QKSB 4HAUA 3GLFA 2ZI7A 4HLUA 4IRUB 4BRUA 3MRSA 3VMFA 1I4TD 3ZJYA 2P2LA 2Q9BA 4Q5IA 2XTNA 1KAOA 3GJ6A 4QOSA 1ZAKA 1SVLA 1AKEA 1ONBA 3DHWC 4QJ4A 1JJVA 1P9RA 3KKOA 821PA 3W90A 3C4JA 1P2VA 1VPLA 4XVUA 3QPVA 3K9GA 4B2PA 1IY0A 3P1JA 1NL3A 4LY6A 4A0RA 5CB8A 1X8KA 1KDTA 2WJJA 1ELOA 2WV9A 3QPUA 4LWZA 3IHLA 1SVIA 2O0HA 4OI2A 1NG1A 4IOLA 3K0CC 4HDOB 2O8FB 4Q48A 3RABA 2AD1A 2Q6TA 3PV0A 3LVQE 2Z83A 5P21A 3SJBA 4DLVA 4YMSA 4C2TA 3C41J 4R98A 5L3VA 2WWFA 1QHSA 3KX2A 2Z6VA 2WWWA 4QBHA 2V1UA 3L0IB 1KIMA 2QL6A 4LJ6A 4DSOA 5DI3B 1W2HA 3L82B 2DWQA 3AUXA 2OCAA 2ZRGA 2ZI3A 5FL7D 1WF3A 4TMZA 5FBQB 3W6PA 1XJQA 1OT3A 1UKVY 3P26A 4KSCA 2RGXA 1AJEA 2X8AA 3ADBA 1OPXA 2BHRA 1P5ZB 4NDZA 3W5JA 2V55B 1R5NA 1OXTA 2B7BA 2YOFA 4Q9JA 5HCNA 3W6OA 4HAWA 1RVDA 4DHEA 1XB2A 1HV8A 3L0PA 1G5RA 1PUIA 2VP5A 3CNNA 2C8VA 4DWJA 3U3OA 1E0KA 4JYCA 1CIPA 3ZQJA 2VYFA 3QKRB 1U9IC 1HYQA 3I72A 8OHMA 1AM4D 2OAQ1 4PC1A 3T15A 1FQKA 2WOOA 2NQ2C 2NO1A 3KJGA 4BLRA 4TL7A 4QBIA 1Z0KA 2G1JA 1F2TB 3I8SA 3CW2A 3IEVA 2C2HA 1X8LA 4KV9A 4OJQA 2QM7A 2ZIAA 4K81B 1NVVR 1YZUA 5FI1B 2PLRA 2FGKA 2F1IA 3TSWA 3MUFA 5F9HA 1Q1EA 1VYTA 1MO4A 1P4SA 1W4AA 1EG7A 2QTHA 4GOXA 1GITA 5EP1A 4LBZA 5HKKD 5K8LA 4DEXA 1W4BA 5KSYA 2ORVA 4RD6A 5FOTA 4DLYA 4BFWA 2XOKD 3SQXA 2ZUBA 2V4ZA 5DSZA 5DH9A 4TTQA 3LNCA 4M53A 1HQCA 3LDAA 1N3BA 2WIBA 4WIAA 3W3ZB 2Q0HA 5AJXA 3LY5A 1CJKC 3I62A 3RS5A 2XGJA 4JLJA 2IYXA 1YRAA 4JLAA 4BZQA 2ECKA 3EZ9A 3X1YA 1Q20A 4JT2A 4LCBA 1KDPA 4LJ8A 3KB1A 1GM5A 2WJHA 2V1XA 4HDQB 1VCMA 4EPYA 1JEEA 4P4UA 1OFUX 2W83A 4I1SA 3WHKA 1NSFA 1BMFD 1JBKA 3B1YA 4CF7A 1A7JA 1YZGA 4HATA 3HPQA 1UBFA 1KJZA 1CKEA 1OXUA 3BFKA 4M1WA 4D26A 2GVDC 1X86B 4UJ3A 3TKLA 2AFHE 2DB3A 2ZSBA 1G8HA 2ORIA 3AVVA 3U3JA 2V54A 1AIPA 1UF9A 4YDSA 2OHFA 3VR4A 1E98A 4DT1A 1A1VA 2IS6A 1WQ1R 1X8JA 1XFAA 1N6OA 1XBTA 2KE5A 3E5HA 2OE2A 5BQ5A 4ZI2A 1N6KA 3HDTA 1OJLA 3KJEA 3ZVMA 3AV0B 2G83A 2H1LA 4DXAA 1E4YA 1Q21A 2IXGA 2YOHA 2XTMA 5JEDA 2WKRA 1OSNA 3C5HA 3OEHD 4G5QA 3SQWA 5UKDA 1OF1A 4JVSB 2XXAB 3IQWA 2WSSA 3U4QB 1Z5ZA 4MGYR 2V8OA 2IHYA 3FKSA 1TQDA 3DOEA 4KXFB 2FJUA 5ANRB 3MMPA 2NO7A 1TF7A 2OZEA 2ZVPX 3G82C 2V6IA 3QVUA 1NF3A 1NMXA 5JRZA 2QBYB 3VKHA 1OXSC 2JIZD 3AKDA 1KKMA 3CONA 5A4JA 1OH8A 1YZLA 1ZUHA 1W5TA 4CW7A 2QNRA 2EFGA 2J7PD 4URUR 2YKGA 1MRSA 1G3QA 2PZEA 2UKDA 1QF9A 4AURA 2F55A 4PZZA 3I73A 4ZDIA 2X2FA 1GOTA 3CWQA 4B3GA 4FWTA 2DFTA 4WVFA 1L4UA 3SC3A 5KYKA 4D4MA 4AYTA 5DYIA 4TQ9A 3T5DA 1TUEA 2C95A 5L3QA 4OK3A 3EPHA 4IEIA 5CDFE 2ZYUX 5KOYA 5EUMA 1Z6AA 1XJCA 3U6BA 3ZQ6A 2FV8A 4LI0A 4RFVA 4TYPA 1Q3HA 1Q1ZA 1DO0A 4QKQA 2G77B 4Q9LA 2XSZA 3O8RA 2QZ4A 5LBIA 2N46A 4O2LA 1EK0A 3GCGA 1KJYA 1T3HA 4XVRA 1FQJA 2CNWA 5KDOA 1KO1A 1YU9A 1XPOA 1W0JA 3Q85A 4YLGA 1CBUA 4PC3A 1II0A 3ZZTA 2ZM5A 3T1QA 1E3MA 1XMIA 2RGGA 3K9LA 1ZU5A 2NPIA 1GG2A 1Z6GA 4RSGA 3ADDA 4X8MA 3ONWA 4R9UC 3DDCA 1TPZA 5L3QB 2FFBA 3NEJA 3OAAA 4IDHA 5HPYB 4B35A 3FGNA 4D0LB 2FFAA 3WYGA 3EPJA 2GKSA 4TYYA 3RS0A 1IHUA 2CLCX 2IK8A 5FTLA 4XWKA 2FZ4A 4IKEA 3T06B 4CEJB 1OW3B 3BERA 3GLGE 1CR4A 1FMJA 1GRNA 1EFCA 4URZR 2VPPA 5CDFA 1B0UA 3J81k 4OQFA 5JSZA 1S4QA 2J5XA 2RGDA 3CPHA 1KAGA 3AVXA 4QHTA 2SHKA 1ZIOA 2BBTA 5EXXA 2D4HA 4PSVA 2R6CA 1UM8A 4F92B 4DCSA 2WPDD 3MWLA 1MO6A 3NIBA 1GRQA 5DYGA 4BLTA 4B3CA 3W34A 1XU4A 1CLUA 1Z0JA 2IYQA 2FSFA 5A5GA 2IUSA 4MH0R 1W4RA 4B6EA 2DFLA 2WHXA 2ZJZA 1YHNA 2E1RA 1E99A 3E1SA 3FDIA 2QG6A 1JR3E 5AJWA 4HUQB 2VLIA 1ZD9A 3WY9A 4EIWA 2RB4A 4QBFA 4URXR 4RD4A 1A82A 2WWYA 1FZQA 2FN4A 4ACAA 2AHOA 3GLGA 4MUBA 4V0LA 4BQSA 4C2UA 3EIEA 4WW0A 3FB4A 4IFEA 3A1TA 4ZKDA 1BYUA 3IPYA 5TXGA 1TU4A 1HURA 3IDQA 1IN8A 1Z63A 2NTYC 1N5IA 2O0JA 5FBRB 1KI8A 3UG6A 4I1UA 5J4VA 1TTTA 1XEWY 4IVPA 2A5FA 4OYHA 5BYJA 2V9PA 1D8TA 4ASUA 3EPKA 1NNEA 3DOFA 1IN4A 1VCNA 2PJZA 3B8HA 3GLHE 4KSBA 4ZDWA 4TMVA 2F43A 2ZE8A 4R7ZA 2JLQA 2R62A 4X8LA 2JLXA 4G5RA 1KOFA 3AVYA 3GQBA 4XVQA 3VTKA 1AS2A 3PR1A 1GZSA 3B13B 3AVOA 2HUPA 3AF0A 4BLOA 1XCMA 1E96A 1JR3A 1JB1A 1GP2A 2F9MA 2FE4A 4QNRA 3FE2A 4XSHA 2ASEA 2LKCA 5FBLB 4EQ6B 3RSLA 2EWWA 1FX0A 3PENA 1JEDA 3D8BA 4DZZA 1IOZA 4TTPA 1G21E 5DN6A 2GK6A 3VX3A 2OFWA 3MJHA 4Q1DA 4Q4AB 1K6MA 1XTIA 1KI7A 2GXQA 2GA8A 3CNOA 3IKJA 1MR3F 4O0MA 1QZXA 1R4AA 3GJ7A 3AGQA 4D4KA 4ITRC 3C14C 4LGMA 4PZLA 1N6LA 1KKLA 4NL4H 2QMEA 4DSUA 4KO8A 4MITA 3BFVA 1JAIA 1TF2A 1IXSB 1TAGA 2BMFA 4TWZA 2Z0MA 5KDDA 1UAAA 2WKPA 4Q1AA 5J4HA 4NYJQ 2W6ID 2JLRA 1OV4A 3DPUA 2VF8A 5JCPA 1FX0B 4DUGA 4KODA 4FI3C 2FFHA 2FDCA 3L8ZA 5FH9A 1CTQA 1IAQA 1AN0A 3EASA 3P4XA 1CJMA 4LBWA 4KHZA 3SBEA 4C7OA 2AN9A 1SXJB 5FPSA 2YC4C 1KMHB 5TB5A 4BE7B 2VL7A 2ZU0C 2QPAA 4MRPA 5FI0B 5JS7A 4BLPA 2QSYA 2RHDA 1CEEA 2IX3A 3LQRA 1NSTA 5KTYA 5SZKB 4B3BA 2OXCA 4RFSA 4QL3A 1WMSA 1DG3A 2UZ3A 4DLRA 3B1VA 4QC2A 4ZDJA 4XIGS 1YJ5A 4KI0A 5JWHA 4XD7A 2DWOA 4GDFA 2VHCA 4I81A 1CXZA 2NO9A 5EUQB 5C1BA 1E0AA 4LZZA 3PEYA 2ZRMA 4BASA 2DYKA 4A82A 2CEAA 2VP9A 5KU1A 4OHZA 4Q7JB 1KO5A 1AQYA 4TQAA 2ZANA 3LX5A 2R8RA 4Z51A 3GLIE 1UBEA 2F3RA 5DIFA 5J5CA 4EDHA 3UPUA 1K5GA 2O5VA 1WCV1 4MUAA 1IY1A 3SDZA 1NY5A 3GFTA 3O8DA 1P60A 1XZQA 2Z43A 4JVMA 2O8DB 1RPZA 4PO1A 3T35A 4ZI3A 3EARA 3IUYA 1GNPA 1P2UA 2AD5A 3ZIAA 2VHTA 3QF7A 2FSHA 4RD1A 2VSFA 1G16A 3VR6A 1S2MA 5DISB 2BBSA 1G64A 1ZW6A 2GK7A 3VNVA 4WA7A 1XMSA 5GVRA 3FHCB 1DOAA 4HB4A 5DN6D 2OCBA 2V6JA 5KDLA 3DO6A 1SXJD 2XITA 2CL7X 1QHIA 2JLUA 1NMYA 4LHVA 4LHXA 3RHFA 4R2IA 3L43A 5CLQA 2MSCB 2JGNA 4JL6A 4LOAA 1Z08A 3DM5A 4A92A 3GEEA 2XNDD 4MGZR 3AF2A 4NONA 4LUCA 1VG8A 1G8FA 5KO2A 3AB3A 3C8UA 4IDQA 3B9PA 3WRYC 2C9OA 1KYIA 2P5SA 2BJVA 4OJKA 1GSIA 3WP0A 2J0QA 1BKDR 1KMQA 2QPOA 3CX7A 1XCPA 2QROA 1W48A 2VSXA 3FKQA 2ZAOA 3AKCA 4C30A 3EPLA 1VECA 2QI9C 4FMBB 2F9LA 4Q9HA 1AZSC 3SEAA 3W6NA 1W36B 1S1MA 2EYQA 1Z06A 2OFOA 1NN5A 4XSGA 3AVTA 2VP6A 3QEJA 4LX0A 2YINC 1S9HA 1UJ2A 1ODFA 2ZU6A 1FFHA 2ZE7A 5E95A 1E69A 5B58C 5L3SA 4LPSA 1AK2A 4QBGB 2Z4RA 2HYIC 3TIFA 2DWPA 2R9VA 2ZXUA 1ZYUA 1KK0A 4C4PA 2KJQA 5H68A 4KFSA 3TE6A 1QHGA 2YC2C 2O8EB 4NCNA 2BV3A 4LHWA 1OKKA 3ADKA 4GOJA 4R2HA 3L8YA 2VBCA 3Q5DA 3H86A 4D0GA 2D06A 3CR7A 5HE9A 4AI6A 5IHPA 3HPRA 2FFQA 5HR5A 4IVQA 2ZI6A 3VX4A 2NGRA 3V4RA 4QGHA 3PCRB 1Z3IX 3U3RA 2WJGA 1GNRA 1XD8A 1LVGA 1ZC4A 1U90A 2NG1A 3EG5A 3R7WB 1OFIA 4FN5A 2C96A 3MGCA 1CJTC 4JJKA 4HAZA 5SZHB 4E07A 3NH9A 2GWHA 2VQSA 3NBYC 2B7CA 4ZDKA 2A2ZA 3AEZA 1VG0B 3PEWA 3THXA 2G9NA 1NRJB 2FNAA 2CJWA 4NPHA 1GKYA 2OBNA 1J70A 2ZS7A 3BRWD 3UANA 4DDVA 1J2JA 2BC9A 3PQCA 2ZJOA 4GRAA 4PPQA 4V0NA 4GSYA 1J8YF 5TARA 1W36D 5TY0A 2A5JA 2ZRFA 3G5UA 3NDBB 3GJ4A 1CS4C 4LJAA 2IEZA 5AJYA 5H8WA 1BIFA 5J4YA 4L9SA 2XX3A 1XXHE 1XD2B 2ZRAA 4UNPA 3PEUA 1MKYA 2IYSA 3ZDQA 3VAAA 3NBXX 4AYWA 5AUQA 1Y3AA 3BBPA 4A36A 2ZE6A 1IJEA 3QEOA 2IYWA 1SHZA 1MO5A 3R8CA 3B82A 3THYA 2IUTA 1R0YA 5HZHA 1NBMD 4NH0A 2K5UA 4RCZA 2H92A 1DAHA 3GFOA 3VR5A 2QMHA 1G7TA 1QBKC 3A36A 5LB2A 4HLQB 4ZCLA 3UWOA 2ZI9A 5B2ZA 4GT1A 3KQUA 1N25A 1DVRA 6Q21A 1I4LD 3AKYA 2G0NA 1I2DA 5HTKA 3VNUA 3NBZC 3GJ3A 2R65A 1E1RD 4IDPA 4PO8A 4ZCIA 2G0TA 2XTZA 4EPWA 1GILA 4KBFA 3PVSA 1ZP6A 1ZUNB 2A5DA 2ZREA 4NMMA 5K8IA 4MGIR 1QRAA 2D2EA 1E9FA 2GBLA 4GNKA 4DSTA 4JL5A 1KTVA 1XXHA 4MA4A 1YR6A 4CYMA 4AYXA 4Q7LA 4TYQA 3LAWA 3RSOA 4GMXA 1N6IA 3PXGA 3QKSA 2HEIA 1ZU4A 2VP0A 4IFBA 3LD9A 3VHLB 2WTUA 4M1MA 1G4AE 4YMTA 1XEFA 3DEFA 5G3YA 2HF9A 3WBKA 4CVNA 3KFVA 2G6BA 4LJ9A 3SI7A 2WZQA 2ZR0A 1AZTA 4PPGA 4E09A 3Q9LA 1TL7C 2VRWA 1SKYB 5HCIA 3VR1A 2RGNA 2I1VB 4MYHA 4XOIA 5H70A 2PL3A 5L3RA 3A1VA 3UATA 2KBEA 2H5EA 2KI5A 3KB2A 2GTPA 3IPXA 4DKXA 2R6DA 4YMWA 4EJSC 4P3YA 3NH6A 2O8FA 1XXHB 4PANA 2R6AA 1J7KA 2ZS8A 3NWJA 5JECA 1BO6A 3AF4A 4PPNA 3QXJA 1E2JA 4DDUA 1KSJA 1W2GA 3PIRA 3EA0A 4G5GA 5DI3A 4QGAA 1FUKA 4E03A 3NC0C 2IYUA 1OIXA 4MRNA 3TJZA 3TUZC 5HKKA 1J99A 1OYYA 4P4TA 4RD3A 2FZLA 3AM1A 1DAGA 3KZ1E 2ZROA 1GKUB 2RAPA 2ZETA 3SYKA 2FEOA 2XOKA 3FMOB 2BDTA 4GP7A 1VYUA 1H8ED 4LBVA 4NYIQ 5FOXA 3MWYW 1NIPA 3CH5A 2ZEJA 4KFUA 2JJ2A 1MABA 4EJSB 4JVNA 4Z1MD 3RC8A 2WBLC 5KSZA 1M2OB 4AG6A 3K09C 3SS8A 4A0HA 2IYLD 3QKRA 2EFCB 4LSGA 1JAHA 4HI0E 1G291 3K0FA 1G18A 4Z54A 2YWEA 2J3EA 2GHIA 5HE8A 5IK2D 3E70C 4O3MA 2B92A 4WBSA 4B3XA 2ZAMA 2IUUA 3JZAA 1LTQA 2YVUA 4GZLA 4BEJA 5JBQA 4MGKR 3M1IA 1XCGB 4KCGA 4KFRA 4Z8XA 2GAAA 5C4GB 1F2TA 4GPTA 1BMFA 1P61B 1NJGA 4UXJA 4Q1BA 5GJCA 2AK3A 3WNCA 1JI0A 4TZ6A 1UKEA 3A37A 1YVDA 2QQEA 1UADA 1MABB 1F60A 3OEEA 4P33A 1WBBA 2IS1A 1P7CA 1SULA 1MO3A 2GZDA 3WNDA 2FMXA 1U9IA 1PV4A 5DHFA 1ZVQA 4EKDA 1GVNB 4EPRA 5KSPA 1IY2A 3BK7A 3K0FB 3Q7PA 4QJ5A 5EE9A 5JCZA 5KSOA 4IJMA 4A0FA 1OB5A 3C5CA 4PQRA 4XTRA 1KO7A 1II9A 1LF0A 3ECCA 4JKIA 4CRWB 4DLTA 4EPXA 5FTJA 3M0EA 1GUAA 1R5BA 1VTKA 4Q19A 3TSOA 4LJYA 3OEHA 1T5LA 1SKQA 3HWSA 4LJ5A 5DO9A 2BIFA 4LV5B 1N5LA 1RJ9B 4CT5A 2O52A 3QE0A 2AL7A 5CM8B 1BOFA 1IXRC 2WKQA 1IJFA 3SJAA 4YC7A 1XJ0A 1W4CA
chains in the Genus database with same CATH superfamily
4UM9D 2AC4A 1WEHA 1GPKA 1VHDA 3P97A 4ETIA 5ALZA 4QO8A 1XVLA 3PUZA 3ZHTA 2JIZA 4DREA 2NO4A 2XHEA 3QFSA 3QVGA 4K1XA 3IAEA 2RC5A 3L79A 1N4AA 4E88A 5HQ3B 3GFFA 3H4VA 5JYEA 1IN6A 2HQ1A 4JD5A 3I9KA 4BUZA 2AN5A 3F6SA 2QV0A 5KKNB 3PUKA 1SBZA 3REFA 1DBPA 4AS1A 3EGIA 2CL5A 3PXCX 2VXBA 2XB2A 1D2EA 1YXMA 2ZSDA 1E5TA 3CU5A 4ECEA 3MGAA 2JJ2D 2VCHA 5FQNA 2BSQA 3KZOA 3CH4B 3PHLA 3MGGA 3PE3A 3TW8B 4DQ0A 2JFHA 1TF5A 5BW8A 2Y0PA 4US2R 3VYVA 4ITVA 2GR9A 1IPHA 4YIHA 1MVOA 1T3GA 4O2BB 2BHSA 2XW6A 3HNRA 1XPRA 4GOKA 2WYHA 4QGGA 5ESWA 1Q2XA 4UNIA 3RC1A 4E2XA 2OB2A 4ETNA 2KBFA 4B84A 2YV2A 5TNXA 3CTPA 4Q3NA 1G0OA 1OY1A 3O7WA 2B37A 2JVJA 3Q11A 1T1GA 2Y0CA 4LNAA 1OMOA 3WB9A 3QVGB 4PAWA 1UIRA 4RKWA 1E9DA 4NIMA 4K87A 2DG2A 3IOMA 3U4QA 4BL5A 1V3QE 4TWAA 3DAOA 1RWBA 3AJRA 1KGDA 3D3EA 4LXTA 5E2BA 3RW9A 4YQFA 5C4MA 3W5HA 4RTPA 2VDWB 3H16A 2YXEA 1QGYA 1J8QA 3L8CA 1V9LA 1I1QB 1J8FA 1T4CB 2WP8J 4J0QA 3MQ2A 4KIWA 3OEED 3G8CA 3QWFA 4HY3A 4B44A 4YUVA 4BQIA 1RFGE 3JD3A 4X92A 4E51A 5A0VA 3LF2A 1I9GA 3S2UA 1CUJA 5DTJA 1UXIA 1UPTA 3NHYA 1RTTA 4RIEA 5EI5A 3CNEA 4JYBA 3VR3D 3OX3A 2H3EA 4LI3X 2V0GA 2CNLA 3BB4A 1S4MA 4DNFA 3D64A 1HH4A 4Z9FA 1M2GA 1M1XB 1C3LA 1G8JA 4A8JC 2ZB4A 4IIXA 3B38A 3D7LA 3JVDA 1OZAA 4EA6A 2C2KA 4IIJA 5AXCA 5JZ9A 3ETHA 4UKDA 4F5ZA 2ATEA 1QRUA 4BUJA 1I10A 3TLKA 2HBQA 2BBOA 2MYUA 4C87A 4DQKA 1DFIA 5IJAA 1C50A 3ONEA 2JBAB 2WPDA 2O7RA 2QY6A 3PNYA 5JR3A 1OAAA 3G6KA 4L75A 1OFTA 3OY2A 1J23A 1SURA 5LUAA 4KPEC 4FFVA 1YZQA 3QU7A 3QELA 3ESCA 4HEJA 3MHTA 3BREA 3D0OA 4MHSA 4EUNA 2NUPA 2ACVA 1D2NA 2W2XA 2IELA 3PXBA 1Q77A 3B9QA 2ZKLA 1P9WA 1T8WA 3BSYA 3MJRA 3QJ5A 5IWAB 2D3TA 1FTYA 3V97A 1SOAA 3DZGA 1Y48E 1V16A 1KZYC 2D7CA 2QUHA 1GV0A 2R8PA 3JQBC 4WESA 3WLMA 5CVJA 4EJMA 2Q8QA 3IHWA 5IAJA 5LYJA 3KUDA 1LPMA 4KX3A 3WG9A 1IQRA 3VUEA 2B30A 1KDVA 4H4CA 1B23P 2DCMA 1ZI6A 1QHNA 1B0AA 4QXAA 3FVQA 3UUGA 4Z7JA 2DXIA 1DARA 3X1DA 4ON9A 1QG2A 2ERCA 3KYDB 5F3DA 1M6WA 3OPVA 5JWOA 1S1CA 3CX8A 4LY3A 3HQ4O 4B79A 3H5RA 5THXA 4JLWA 4J0KA 2B0JA 5GPBA 1B0PA 1MAUA 1SVOA 2CBXA 3KKPA 2CJPA 1PU2A 2JC3A 2XUHA 1Q44A 3U7EB 4DQLA 1Y1TA 1QNLA 4TL8A 4LC1A 4BQOA 4DLWA 2H08A 2NSDA 4O1MA 3JU3A 2P9JA 1TU0A 1W6RA 4RGVA 5AI4A 1YF3A 1C9MA 4NU0A 1O87A 4X8HA 2QLNA 2FRVA 2VNAA 4G1UC 2W2OA 3ACCA 3BEDA 1L8QA 3BK1A 4A6PA 4YRJA 4N5MA 1L1RA 4DUPA 5IJ9B 4GUAA 1H1LA 1Z5VA 1A76A 1SQGA 2YJ3A 1UBTS 4YRAA 5AVUA 2I03A 3F9IA 5CAEB 4JJEA 2W2QA 4FFDA 4OBBA 1E3SA 3AHGA 1RZUA 1DKQA 4B80A 1R8QA 2BN4A 5FFNA 4U4AA 2JGAA 5JAIA 5B12A 5BYKA 2C94A 3OM0A 1W1IA 3W06A 3CZMA 1JLLB 4IDCA 4ARAA 1XA3A 4JXJA 4DCPA 4BNDA 2JFVA 4G1FA 4WNIA 2HWUA 3CRZA 5LOVB 4O3FA 3P2IA 4OK6A 1T0IA 1VL2A 2EZ4A 3PPVA 4M1KA 3AUJB 1LKZA 2PLNA 4OXNA 2EJTA 1XLTC 4FXPA 1XRJA 1Q0UA 3O21A 4D9NA 1B42A 2BGUA 2QSUA 2ZR9A 4EUEA 2XVAA 4KDRA 4BFYA 1F5NA 1TTQB 2QUAA 4HH0A 3AOGA 1UC8A 4YS6A 4G0QA 1QYCA 5KJ1A 1H1LB 4BJ6A 3OURA 5KQGA 1Q22A 1B8UA 1DO2A 1DX4A 2W6IA 2OBFA 3QBVA 2ZWPA 4UVEA 1C0PA 3HWRA 2R86A 3NS7A 4PFQA 3T94A 2O7VA 4DLPA 4E6PA 2CWDA 3EGOA 3MAJA 2DGDA 1T5HX 2C78A 3M6WA 5KWSA 3C3AA 1MXHA 3PIIA 4GL4A 1MFPA 2H07A 3IUJA 2AOUB 4PZPA 4XPIA 3SZGA 3SWWA 2NO0A 3W8RA 4C3ZA 4Y0VA 5A5VA 2I34A 3F4LA 3EFOA 2C9CA 2IP2A 2JEYA 5E7JA 4Z4CA 1LDBA 3CEJA 3AUSA 4IXTA 3O8BA 5B5SA 4OQXA 3GRYA 2D13A 4HK4A 3PQEA 4J0DA 4YH1A 3WLRA 1SXJE 2ANBA 2WU3A 5KJFA 4QTZA 3SKYA 1FK8A 2WHYA 3SFZA 3LVRE 3VDQA 4EQ6A 3M3DA 3ICEA 2GN6A 4J1TA 5HGXA 4QG7A 2P11A 5KI6A 1JVSA 1QJ4A 1N2CE 4HTFA 3UTCA 3RH0A 1KYTA 1FYWA 5U4QA 1ZNWA 2FPKA 3JPWA 5C18A 1T1EA 2W2TA 1PGPA 2JARA 3A8TA 4WK0B 1ZK2A 3P0EA 1N77A 3NC1C 1SUCA 1CY0A 5AKLA 2J3QA 1ZOIA 1GPYA 4MKRA 4TS9A 9ABPA 5GZ6A 4D2IA 4DB2A 1E89A 1LU9A 2MMCA 4NI5A 4Q03A 3JXEA 2O54A 3D2BA 3DBLA 5LPNA 2G80A 3I0ZA 2R5WA 4JP8A 3HC7A 3LF1A 3RAFC 1W47A 1C9NA 2O05A 4R8SA 2VPXA 1EXVA 4JX9A 2D4AA 1TUIA 4KDFA 4EUSA 2Y92A 3CW8X 4O5OA 3LJKA 5DPMA 1G6Q1 1W8DA 5SYNA 2JJYA 3PDIB 5IJWA 1SXPA 1MX9A 1RQPA 1V95A 5JQGB 1CS0B 2OVBA 4LDJA 3UXMA 1AMNA 3R3WA 1TJ4A 4HTFB 3E4CA 2TMKA 3B1ZA 5JYCA 1C30A 1E4VA 4X6UA 1LSUA 2BEUA 3S2YA 4EB8A 1KMHA 4O2RA 4RXUA 1BDJA 5WRFA 1WV0A 1Z2AA 1M1YE 1SVKA 1Z6TA 1BCSA 2VN8A 1EJ0A 1O8BA 2VQ3A 3UFXA 4NBUA 2EFHB 1ABBA 1HT2E 1G8YA 2Y0DA 4R41A 4Y1EA 4PRLA 1GFIA 1GTVA 4F93B 2ZT8A 2PEYA 4HHEA 1C3VA 1IAVA 3AHIA 4AO8A 2VBIA 3QBDA 1X87A 3DHYA 1M34A 4BMPB 1GPAA 4HMPA 5D6NA 5BQXA 3I64A 3OOHA 5AJZA 4ESEA 1ZZEA 3K7EA 4NCHA 1AQUA 3TTUA 3KJIA 2FN8A 1JT9A 1CY2A 2R60A 4X7MA 4IZOA 2WLTA 4KVFA 3MB5A 4JP2A 2ZP1A 2HW8A 3OM9A 4P4SB 1PKXA 5JFGA 3QLVC 1XLWA 1V8BA 3DF7A 3IVCA 1H2RS 1RLJA 4Q21A 3I3SR 1HEIA 1KKUA 5CNIA 5CVVA 5BQPA 3M6VA 1VA5A 1NJ5A 5IVDA 3ABRB 1SCJA 5JPCA 1QR6A 3UV7A 4IHKA 3VR2D 4V0QA 1FTWA 4B45A 2XH8A 3LUHA 1HF3A 5JMTA 3KFLA 3P5SA 3ZZMA 3CLSC 1EP9A 4DSNA 1ULBA 1V1MA 1HLDA 2EBWA 2Y93A 1OE0A 3JD1A 3P9NA 4Q47A 2JH8A 3ELBA 1PVOA 3VKGA 1X77A 1RYFA 2HCFA 3KB8A 4JWKA 5A03A 3EUWA 3ZK9A 1IHPA 3GO4A 4F7DA 2QS9A 4FYYA 3OIDA 4YJ2B 2QJFA 4PAOA 1H0HA 4URVR 2J1LA 3G5AA 4CLOA 3W1EA 2JASA 2OOKA 4TXMA 1NV8A 1J5XA 1L8XA 1CWUA 1VLLA 3C6BA 1N5DA 1U2DA 3NJ8A 3GN1A 5DWDA 5EHZA 1UAAA 4ACBA 2AXPA 1JQEA 3O26A 1V4NA 2NN3C 3U17A 5F3WB 2VFAA 4BRZA 5IASA 4FLMA 1KSFX 4DA0A 4G63A 4EHLA 4JB8A 3ZWBA 4LDQA 2QIPA 4Q4JB 5TR9A 5DZSA 4NY1A 4BFUA 1ACLA 2W2KA 4G07A 4FWIB 2I4OA 4DEVA 2JCVA 4EYEA 2WJ4A 4XM0A 4KEAA 5DM2A 4NFLA 4WNYA 4BDSA 2JG3A 3DBRB 1XTQA 5A6VA 3PT9A 5JNTA 4NK5A 3ZLTA 5CP8A 1GWNA 1N7HA 5C32A 4B6RA 1FMCA 2P3QA 4LYAA 4C3VA 1RRKA 2IHUA 2OB1A 5IT5A 1S96A 2ZBQA 3UZUA 4FKBA 2B1IA 1AGRA 4MS4B 5KINB 1U9YA 4GQBA 4UCXA 3CNHA 3ENKA 1OAOA 4KJZA 1H1DA 2QVBA 3HL0A 4OHVA 1J56A 2VSQA 4PCLA 5KKCA 5FOVA 4MS3A 3K0AB 3EPRA 1M2NA 1Y1PA 3K9NA 3TZCA 3N0TA 4X84A 1KHHA 1TKRA 4ZO9A 5L7YA 4W5RA 2W2KB 1DKOA 1GNVA 3WGKA 1ULUA 2AFIE 2NT4A 3GGDA 3QHQA 2C4WA 1MB4A 3A27A 1AE1A 1C0IA 4H31A 5FPHA 3KETA 2OT3B 4XD2A 4TYWA 3MFYA 4FFMA 1VKRA 5DCWA 2B83A 1FNNA 1SBNE 4RK5A 3REQB 5BR4A 2YWRA 2QJRA 4FNOA 1OB2A 1PJRA 1ZGAA 1XTJA 1DUIA 4FT4A 4HDRB 3OZXA 1W93A 2Z5GA 4J29A 2ZRBA 3DUFB 4UHCA 3OIUA 3EJ6A 3OUTA 2YIMA 1FTSA 1PR1A 1UFOA 4NEGA 4RSMA 3FCXA 3EA4A 3EYWA 2VHUA 3CLSD 2OBBA 1A9RA 4NBWA 3NYWA 4RQTA 4XQ9A 2JJ1A 3QXGA 2D6FA 3TK1A 1R9NA 1QCZA 1H0RA 3BZWA 3R7WA 3ZJTA 3UT5B 2G76A 4C6HA 1E2LA 3Q7EA 4DJEC 2V7XA 5IT9A 1M7BA 3B1XA 1SVSA 4CR7A 3A06A 4NU6A 2J41A 2JLSA 2RI1A 3RYIA 3F0TA 1O9BA 1WS6A 2YXLA 3LLMA 2QN6A 4G41A 1WUIS 5K3FB 4D8TA 1CUWA 1L5QA 3NAQA 3M8KA 1Y8CA 3V2IA 2O2DA 3EXFB 3N1UA 3Q8XB 3ENWA 4FCCA 1P18A 3A4LA 3ID6C 4TMWA 5CLLA 1GZHB 1D7OA 3GZJA 1YIDA 1NP3A 1BVRA 2DPYA 3HGTA 4GH5A 3W4IA 4I14A 5D3KA 3CUVA 1L4KA 2YICA 4HKTA 2BP7A 2P4QA 1MNQA 4OL0A 2JFXA 3HTXA 1JKMA 1NUQA 2F4NA 2NU6B 4JC8A 4PXSA 4U7FA 5E1OA 3R75A 3IODA 2MINA 4BU1A 5JJKA 2WAXA 3U2QA 3U37A 3BJMA 4ZVVA 5IYZF 2ZE5A 4D3YA 2Z4SA 3E7XA 4B0PA 3ZDBA 3TZKA 5DGTA 3WBBA 7AT1A 1OQAA 4LYYA 4DIUA 2DBYA 5IC6A 3OFVA 1RZ3A 1UBCA 3DE6X 4JJ7A 3KKMA 4NC9A 1L5KA 3NEAA 1B0ZA 4M21A 4NCIA 1HE8B 5I5GA 3K4PA 4GEKA 5HDBB 4DYHA 1X3SA 1T9HA 2AR7A 3FJOA 3N7AA 1II8A 4U2BA 4H2DA 4YUZA 3F3SA 4AIIA 4CM8A 4R9RA 3H5AA 1S3GA 5A2GA 1B8NA 1Q92A 3ESXA 1G8GA 5H82A 4I3HA 1ZHOA 4EHFA 4FMDF 4EG8A 4NYIR 3BQMB 1FP4A 1PJCA 3E9NA 2LTAA 5CXXA 4B31A 1ZMBA 2C98A 2GK4A 3HHPA 4Q9IA 4HDSA 3TQIA 1R6BX 1IWBB 3NAGA 2YTZA 4M0KA 4H16A 3V00A 1KP3A 2C8JA 2I6FA 2XCRB 4CMJA 1G8KA 4KE6A 5G53C 1EX7A 3O4FA 4I66A 1NHGA 4XH9B 3WLLA 3ZTTA 1ZGHA 2BUBA 4GWLA 4BCDA 4PR3A 4EGCB 4C05A 5BW5A 1CQWA 2BHNA 1FTNA 3JRXA 1SUFA 4QNNA 5JMPA 3NYRA 1Z35A 3VNBA 3WL8A 1S0UA 2Q1XA 5GQSA 4F4FA 1II8B 4G1VA 5JNVA 5KJ6A 4W5NA 3WFZA 4Z4GA 4C2BA 4JK3A 4TLAA 3LX8A 1FQWA 4Z1MA 3U26A 4GXTA 1AG9A 1BFKA 1NASA 4MW2A 4AJPA 1XAGA 1NPDA 4EG0A 1VJ0A 3R3JA 3GA7A 4MKGA 1ZISA 2OQIA 3D8SA 4XJVA 4PYOA 3QUCA 4OQZA 1LWOA 1DT5A 4YO8A 2VJMB 2ZZNA 4DR6B 1PSWA 1ML3A 3IYLW 1G17A 4G5SA 4LYFA 1RQRA 3EFHA 4W63A 3VPAA 1GPBA 2QW8A 3E9QA 1NXPA 2Y1GA 2CUKA 5JT1A 3B1KA 3TZLA 2PUAA 3LP5A 4DRXB 4UUNA 2XB6A 3OEWA 2YNMA 3PFCA 3RRXA 5AH0A 1HNWB 1RRGA 3O4GA 1A04A 4WXPA 3RJ5A 1CSEE 3H17A 4DUZB 5EIXA 4HAOA 3NHWA 5FYQA 4XOUA 4OKNA 5A3JA 4AW9A 2L17A 4MYTA 4M4SA 5TQJA 4RS3A 1L5RA 1YU6A 3CPEA 3EDRA 4OVKA 1LGYA 4ZOLA 4P5PA 3MUOA 4KXNA 4YAJA 4O2AF 5IARA 1I1OA 2LCQA 2MWMA 5EKDA 3AKEA 4XVHA 3TXAA 2BM8A 4V02A 5LP6F 6ADHA 3CCFA 3ENQA 4ANFA 2PUVA 1KFEB 4FHEA 3QE3A 1X1QA 3JYOA 4OLBA 4MZDA 4RBNA 3AETA 3HNOA 4EI7A 4OXRA 5BRJA 2AG0A 1ISGA 1GVHA 3UUFA 4EAAA 2XYPA 4MVJH 1AHHA 1P2BA 2ZSAA 1G20A 3B5JA 2EKPA 4EJSA 1USIA 2R7AA 4DDKA 2D2VA 3IPAA 4XWAA 4DUYB 3H1PA 2FLWA 3L1HA 1GKIA 3LBFA 3NKFA 1ADFA 1DFGA 3ZYCA 5LQJA 5FTNA 3UM9A 4AZ0A 1WBDA 1ZRNA 2FMIA 1H69A 3JZFA 1DMRA 3RIYA 2PT9A 4YLYA 1DEKA 5KSWB 3WMWA 2YASA 1KZGB 2LZ0A 3PEVA 4WACA 2GRJA 3SHFA 3PNMA 1RXCA 2PGJA 4EF4A 5JXGA 1ILWA 4MXDA 4DLUA 3BXXA 3L6BA 2CDBA 5D51S 1FFBA 3C74A 2JHPA 4G6ZA 3RVNA 5KHOC 1V71A 2ATVA 3OZBA 2OPHA 1R9JA 3AVPA 4CMEA 4CEIB 3RYTC 4ENTA 3U44B 1GAEO 4RKFA 1N5MA 3UC9A 4DCNA 5KTRA 1I3LA 3RRZA 1SVMA 3O75A 4FYPA 4X6XA 3OE7D 1YB7A 3P0HA 3JALB 4EYSA 4YV7A 1L7DA 3LBYA 4MQFA 4QPDA 2VO1A 3K0CA 1WUTA 1D9XA 4UHEA 4N65A 4YT4A 5DM60 3MWFA 3QGMA 5H3HA 4WMLA 3IAS6 4HLUC 4GU5A 2VF4X 4AZ0B 1OC2A 1OIVA 3DVLA 4WBNF 4YT8A 5BQ3A 4O8CA 4J16A 1JALA 1Q74A 2FUCA 2JLYA 4MV1A 3U7FB 4N0DA 4PSUA 3RS3A 2QTZA 3VPBA 3DEYX 3UXEA 3ZGXA 3FWPA 4LF6B 5ALUA 1C8VB 2RHHA 5IWCA 1HZZA 2M2IA 2HRZA 4QEDA 2GCOB 3S8YA 2ZYVX 3SBDA 3OESA 1ORVA 1RJ9A 1TO6A 1P81A 2UYYA 3IP3A 1US8B 2FPRA 1FNBA 3NHBA 2EIXA 3NIFB 1P8AA 2AW5A 1W5FA 4BO7A 1BHO1 3BXGA 4DEYA 2Q6KA 3FOWA 1F4LA 3UMJA 5EY5B 2Z8YA 1ZD2P 1NQUA 2O2IA 3BJEA 4LSZA 3UKDA 3QK7A 4GLJA 4NFHA 4ZO8A 3STYA 3ZUPA 3S7ZA 5ECDA 3T5AA 3IR7A 5FAKA 1U63A 5SICE 2X76A 1ARZA 1ZH6A 3D6NB 1MBZA 5FI5A 1U8AA 2E4VA 3FOEC 2P40A 1Z4KA 5THQA 1U9ZA 1DTEA 3LBHA 1CUFA 4RM2A 4X7RA 2F1JA 1IPEA 3IBGA 3PBKA 5DX1A 4ZVQA 4F1WA 4GBMA 3C97A 3NRCA 1KRXA 2D2FA 1WNFA 2HBYA 4JZKA 4KQFA 4M8KA 3GDWA 4UU0A 4RMIA 1F14A 3ZHOA 4EB3A 5FPTA 4Z5XA 1TFRA 2NXJA 1ZUD1 3F5SA 3GDGA 5AKGA 1EFPA 2I6UA 1W76A 1JEQB 221PA 2YCBA 3M5CA 1SWWA 3N07A 4KAXA 4KAFA 1U2QA 1Z07A 2WU1A 3E9ZA 5LIRA 1XPJA 2F64A 3OCXA 4BKRA 2ZSUA 3NANA 4AMUA 2VHQA 1ZMXA 1SEPA 2H1VA 1GL6A 5T3YA 4DR2B 5JRDS 3C7DB 1PL7A 4EHBA 4EYOA 1E0SA 2WF9A 1KC1A 2IL1A 3KR9A 2HD4A 3BE5A 3REGA 1ULSA 2JEZA 2O7SA 4MUGA 3WLEA 2FW0A 2BFEA 4FFOA 1C14A 2EW8A 2H1WA 4DMFA 1M7GA 4KU4A 3S1LA 2Z3WA 2OC9A 3AU9A 1FBNA 3IUEA 2I2XB 4OXKA 5BOVA 1YR7A 2BEJA 3E84A 4OOEA 4OYYA 2ZWAA 2OHHA 1GLVA 2JIDA 4LK3A 5ELMA 2PVCA 4UFOA 5ALYA 2HWYA 1G3IA 2XYQA 4JNKA 1Q84A 4NEQA 2WMNB 2BT4A 2PBFA 5BN3B 1EGAA 5MN6A 4GOLD 3UG7A 5ERXA 1XN4A 4ZALA 3VKFA 1GZ4A 1A95A 2VUSA 3D02A 4TZKA 4EB6B 3LH5A 1OH7A 3GNTA 4NG5A 4KGVA 1H22A 2DF8A 3H7AA 4QHYA 1K7SN 1U2GC 3QLJA 3A6DA 1UBGA 1ZCZA 2AA3A 2V7GA 4YI5A 3CZ9A 3K92A 3DAPA 2NU9A 2VJQA 2DHDA 1NOJA 3H04A 4EJ2A 1NJFA 3AINA 5FKJA 5C1OA 3RIEA 5HUJA 5BRAA 4NZMA 4JA2A 2CHFA 5HIJA 5A5FA 3FFBA 4RZSA 6REQB 2FZCA 1E2NA 4WXYB 3BF8A 4MDFA 2WVHA 2PX5A 4QQKA 2B6HA 2IZ1A 5EMNA 1UPBA 3MCTA 3TEJA 5LD2B 2H51A 4R2XA 4MLPA 1N8NA 3K0SA 2PA3A 5JJIA 1RWVA 1MHTA 1KQNA 5CLHA 4DNQA 2R97A 1JG6A 1E9RA 2FWBA 4OI0A 5AKZA 3OF5A 3KAQA 1R8SA 3WGIA 3NNNA 5FDFA 5HIAA 1T25A 5IDYA 5EP3A 3TRIA 1VE1A 2N1BA 5ADWA 4UOQA 4RGYA 1KMMA 2H2WA 2IKQA 3K1JA 3L93A 2OMKA 1E9CA 2W0MA 3A04A 2JGDB 2ET6A 4REOA 3TOXA 1GFSA 3ACDA 1ZK4A 4HNAA 3SSOA 2HTEA 1D8AA 1RYBA 1XDZA 1RI1A 2PH1A 3DE3X 3OPXA 4BO4A 4XM2A 1FIUA 1Q0QA 4IVRA 2BKEA 3OX4A 4F9GA 1KRWA 2WR8A 1LI5A 2EWVA 3ZBUA 2FPOA 3MINA 1NTRA 4OL9A 2RGCA 3IUPA 4N3CA 2WINI 4PLTA 3I9V1 4TV8F 3TJRA 1S9DA 2NP7A 2V6GA 1RW4A 3NZEA 4M0EA 1H6CA 4MPRA 3KQLA 4B6FA 4PTYA 1ICIA 2RJ3A 2F2TA 3E35A 4OXIA 1PX0A 3TAHA 2B99A 1SOWA 2ZZMA 2L0XA 2KWIA 3TGPA 4BKQA 3EHEA 5DNYB 1M6YA 3SEQA 2FG6C 4AX8A 1ESCA 4UBOA 2FSIA 2TMYA 5KZMB 2CXQA 2FDXA 3AR5A 3HY3A 1XEXA 3HDQA 3NLLA 3JQRA 3WLPA 2H4FA 2PLFA 1J0AA 3B7WA 4UNQA 4XDHA 5JO9A 5JSUA 1H3EA 4AP9A 5DBHX 4Q15A 3D1VA 4FNMA 3NBUA 2QTVA 4CQLA 4PXAA 3BH0A 3T7EA 3JATA 2BEWA 3KOUA 1E6KA 4I1OA 3RYCB 1P3Y1 3WOHA 4BE9A 1M54A 4FINA 5K05A 1E5QA 1RI2A 4OFZA 3GJ5A 3I2GA 3SZOA 4OB7A 3BIXA 3HJCA 4RS4A 4YJDA 1GGMA 1YHYA 2Q6LA 3EN0A 5G02A 4NJEA 4ENRA 2XE7A 1ESZA 1KJQA 3I53A 1F8GA 1SD1A 3OZRA 1DKRA 2AXNA 1P5FA 4POAA 1HUQA 5HS6A 1GQOA 1Z28A 2AFHA 3M4NA 4QYIB 4TSFA 5FNVB 4AG5A 4OX9B 3AZOA 4G0NA 1I9CA 1LX6A 1MJHA 2XTJA 4PG7A 3ZWMA 4RQUA 1MO2A 3K6RA 2JVKA 3LRPA 1NNI1 1JAYA 1Y0BA 2YFKA 3CJTA 1XZEA 1R4NA 3FVVA 2P8JA 4G56A 5A2QA 5IH3A 1A9OA 4B8ZA 2IZ5A 3B3GA 1S8NA 3E05A 1P73A 2R7KA 3A25A 3PFIA 4CQNA 3KUKA 2GX6A 3UK6A 3LK7A 4HZUA 3JATB 4XGRA 3RFUA 3H5OA 3LXXA 3UNXA 1FNDA 3LBAA 1XNGA 2VZEA 2WU0A 4PICA 5LCXA 2WWGA 5ENZA 1WZNA 1PDOA 4YMLA 3AK4A 3ZHXA 4NPCA 4RIHA 4MW7A 4YQZA 5H9VA 1WB5A 3OU7A 2EAUA 1OLXA 2HGSA 4P8RA 2BY4A 4YBRA 3S1AA 1RZRD 3AFOA 4YRLA 2AFHB 5JS2A 3QKUA 4GPZA 4XFDA 5I3CA 4OHCA 3UGQA 2XBMA 1J8DA 5GOZA 1Y9AA 3L7DA 1X7XA 1N9ZA 3U7QB 4EITA 4ZJUA 4M9CA 1YJBA 1WX1A 2OLEA 3LGXA 3NQ41 2J32A 3UO8B 4JLDA 3PFNA 3CURA 4ZVMA 3SBOA 1NW7A 1KDYA 3QVJA 3C15C 3CV3A 3ANLA 4RE5A 2R44A 4ZV7A 1I13A 3U4AA 4A1FA 4RHUA 1QE0A 2GVZC 2ZZKA 3OC0A 5IKOA 1DX6A 3OJFA 1FFEA 1TGYA 3Q3HA 1G38A 1LNZA 3ROXA 4DC9A 4V1CB 2O2SA 3SSNA 3A3YA 2OORC 5TQ2B 4NP6A 4BC0A 1H2ZA 2A1UA 2WT9A 3MOGA 2AH5A 3A2NA 3C2QA 3DVRX 1Z2OX 3KS9A 3NCHA 1YIOA 4JP5A 5LQAA 3TBKA 4P80A 3KB6A 2QN8A 4OI4A 1AS0A 4MB0A 2C88A 2IYZA 1C9JA 3R0IA 3EIHA 1FS5A 2IGTA 4MUYA 1F1BA 1QQTA 3IUSA 3OY7A 1QUEA 1X7XB 3EGXB 1E58A 1RHMA 2B9VA 2WKSA 1U8UA 4KQXA 1R4ZA 2QZPA 3TZQA 1IUNA 2FUEA 1S89A 4BNLA 5CIWA 1U0LA 2PCLA 4CQMD 2BYTA 4LHSA 1WSAA 1JV2B 4TLMB 2IPOA 3LW8A 4GPD1 1T8UA 1EUYA 4PVDA 1VG1A 2IYPA 2JS7A 1ZM7A 1QGAA 4GECA 1HC7A 4LDRA 3DLIA 1YB4A 4O4HA 2R6HA 2XKBA 5GVSA 2D1TA 4Q4LA 1UP4A 3TL2A 3KOZA 2A1UB 1VIMA 2ZR7A 3DYVA 4JBNA 2AQIA 4PRZA 3VJRA 2DAPA 1SD2A 2D8MA 1GYRA 3GDHA 3CLKA 3G0CA 2PMBA 3QPWA 4L28A 2WG2A 4KL8S 4Q93A 2AMJA 2JGFA 5EYPB 5AP9A 2QYTA 5T41A 3RSZA 2YY7A 2P9TA 5JIBA 2W98A 4FDTA 4IDOA 4R1TA 3ZWQA 3CXRA 1HA3A 2ICAA 1VI2A 5H1YA 1OH6A 5DU2A 4K6CA 3O2SB 1EIZA 1Z17A 1YL6A 2IF0A 4KN8A 5AVXA 5KOJA 2WG1A 2JGEA 3NUQA 3WMEA 2BLNA 4BY9E 2EQAA 3ZXXA 3A9WA 5JXWA 1CQPA 4QWWA 4ZHQA 2XF2A 1N1EA 2QE6A 1PWEA 5ALLA 2BHTA 2R6ZA 4IWNA 3TW4A 1GRCA 1DAFA 3FR7A 4BNJA 3C70A 3S81A 1GSOA 2JA1A 2PIDA 1G7SA 1G5QA 2XNKA 1UC5B 4W9NC 5AUPB 1DNPA 1W88A 121PA 1DC5A 3GFQA 4K6OA 3IQGX 4H6PA 4BVEA 1SVUA 4HXYA 5E9QA 4V0MA 3G6WA 1B26A 4FFWA 1NNLA 4M83A 1GPUA 4OD0A 1ZCBA 3PTZA 4W5JA 3SZLA 3KG2A 1VHLA 1DC3A 4A5SA 3GLGB 4OJTA 1NMZA 4N01A 3GIWA 3KVOA 2DUMA 1H6BA 3L02A 4EA7A 1UEIA 1J5EB 2EKQA 3T4UA 4Y9RA 1BWSA 1ST3A 5CDGA 5AHWA 2P6MA 1GPNA 2GN2A 1NW9B 3TXXA 4V03A 1TIBA 4J7CA 1X2EA 5E4TA 2I8AA 1R64A 3W4JA 3WKAA 2CHEA 5KOJB 3THWA 5LBUA 5ALHA 1O94D 1K7CA 4P3OA 4W5WA 4ZHQB 5I3ZA 5JADA 3F73A 4CF3A 1XZFA 2OSVA 2WIAA 4XQ0A 3SU8A 2IZ7A 2GJ9A 5BURA 1JXMA 2CZCA 2HJ9A 4Q82A 2F43B 2HJHA 2Q8PA 1DG1G 4F9FA 1AQNA 3S2GA 4DWOA 1YFLA 2M98A 4C3OB 4GYJA 2YY5A 3LG2A 5CK5A 3SVZA 1JKJA 3O2QB 5EZYF 5C5CA 3R23A 3T1VA 2CMKA 4QXOA 1C7ZA 4EKYA 1TCAA 5JAPA 5K0JA 3GLHA 1K6XA 4XSVA 2Z1NA 3ETLA 4UTZA 5TS3A 3ZU4A 2VRCA 2X5XA 4DGQA 1TLTA 3HRKA 1P1KA 2Q9CA 3PD7A 1UXGA 1ZK1A 4HRYA 4YHBA 4B76A 3CLTC 3ET5A 3DFFA 2VAPA 1IYZA 2C2MA 4HXGA 3NBAA 5G0SA 1QANA 1WW3A 5KWJA 3TTYA 4MDHA 3R9WA 2VTEA 2BCJQ 2ZT7A 3GV0A 4TKMA 5BRNA 2OPBA 3KLNA 2QLTA 2O8BA 1ZGGA 5DLPA 4MVCA 3K30A 3HZZA 2VWHA 5HRAA 1FUYB 1DZ3A 2QM8A 2Y27A 3NM6B 2Y2UA 1AV6A 2I55A 4OHYA 4UMVA 1AD2A 2A84A 2AUNA 1IG3A 1ZG3A 2AXEA 1LY1A 4P7FA 1JYFA 4WLUA 1TM5E 2HRQA 1NN3A 2ZYWX 1YQXA 3SXJA 2HNBA 4Q1FA 2GUGA 3ZVLA 1HTTA 1O6GA 3F3KA 3GLHB 2IIVA 3KT0A 3NHSA 4UXIA 2CNOA 2C5HA 2P4EA 3RD5A 4L5BA 4EOGA 4FFLA 1MQSA 2LRHA 1QYDA 5MHTA 4OMDA 3GRKA 1E9EA 1E5DA 5AW8A 1D2HA 1SBIA 1Q19A 1JE1A 3L8MA 2WK1A 3UWMA 4BJ3A 1TQ4A 4C7OB 1EFRA 1XPUA 3KXLA 5BN3A 4NDAA 1YR1A 3IDOA 1DJQA 3MWDA 2ZR8A 5HF8A 1QAOA 4LZWA 5JDIC 4Q9KA 2WTNA 3RRJA 2VH1A 4JY7A 1G21B 2JFYA 2AOVA 1QDEA 5B37A 2FSPA 1CV2A 2CYBA 1JKXA 2Q4OA 3AHEA 2IZ6A 3IB3A 4NE2A 1G9SA 1KEZA 4AMGA 2FSSA 4HEQA 1KI1A 2BKXA 2DT8A 2Q7XA 2PKEA 4MP8A 1RM3A 2HLNA 1R74A 3DB2A 4ATNA 3NNSA 4JCOA 5IDXA 1EDBA 1JPJA 3LPMA 5B3JC 5JNUA 3EXHA 2DH6A 1N5JA 3D6TB 4MAAA 1TVKB 3IQDB 3ROPA 3CLUD 2KLHA 1GTMA 3MWDB 2PNJA 2RGBA 1R6UA 4OBEA 2O8CA 3DZDA 2CVZA 3U19A 1HEUA 3BJZA 3GLIA 4HOYA 1NI3A 2I2DA 2F9FA 3LHSA 1U94A 1KI6A 4KO3S 1XD9A 1D0SA 2XUAA 1PSZA 3OM1A 4GZMA 2JCGA 1CY6A 1FYDA 2DMRA 3CF2A 1ZD8A 3VVMA 4L76A 2XNSA 2ZSFA 3CLTD 3L49A 4GNRA 3EF1A 1NBIA 3RRBA 3UAVA 3TL3A 2RFLA 4XYGA 1DIAA 4FDAA 1C41A 3G85A 4IHQA 3U3MA 3UCFA 1SB8A 1JLMA 4J1QA 1GPJA 2R8ZA 4JQCA 4NK4A 3T34A 4B7UA 2ZJ5A 2POQX 3I32A 3DEZA 3OUZA 3X2SA 1AUPA 3LPDA 4MWTA 3A9SA 1QF7A 1DGQA 1AN9A 4PZDA 1SOVA 4BFVA 2VP2A 1CP3A 2C82A 4NCKA 4QREA 5DN9A 4CGYA 1UDBA 3BH7A 1LQ2A 4URHA 1PS0A 4A2WA 3ESDA 4LHYA 5FPKA 3T5CA 5K3SA 5GM1A 1V7CA 3O94A 4F4UA 2F00A 4YJGA 3GLIB 1QH8B 2P78A 3PP8A 4CV2A 1K9VF 2M6KA 2Z58A 1P5HA 4MVJF 1KI6B 3ZDZB 1PDVA 2POCA 3OHSX 4YGXB 4MR8A 5JALA 2REOA 2WJ3A 4M9ZA 2FXIA 3TRJA 2YN2A 2KB0A 4Y9DA 2BISA 3IUBA 5G4KA 3IPRA 3A6PC 3ASYA 4M9XA 1TA4A 2G9ZA 2DE0X 2R6GA 2ZYRA 2XZOA 2AC2A 2ODEA 1JLSA 1QGUB 2AI3A 4RPGA 1N0VC 1U04A 4L4SA 2YV4A 1VJTA 3HEAA 3V6MA 5A4AA 4KIGA 3V7YA 4B83A 1SCIA 4UCWA 4DXHA 2W6JA 3JARA 5FBHA 3ZIAD 4DNXA 1O58A 2W6ZA 1RNLA 3TQOA 1AKQA 3RBZA 2NO6A 5KCZA 4HN9A 3KYCB 3PC3A 1X0VA 3Q3JB 2AG6A 3HCPA 4H60A 1H0KA 1VIAA 4XSGA 3GLFA 2GH1A 2QP9X 4R1UA 3AKZA 2O3UA 1HPLA 4TV9F 4JOCA 4MR8B 1XZDA 5FUBA 3L1UA 1KDOA 1P0FA 1JFFB 1Y7TA 2QLMA 1Y6GA 3A6FA 1GR1A 3PPXA 3UB4A 4E3WA 3IJRA 2P9CA 2BFWA 3M3PA 4COKA 3QLUA 1L0BA 5CMLA 5C37A 3MJCA 1UQRA 1EU1A 5CLGA 5ALSA 1H2WA 2LKDA 2PUJA 4MRRA 2OQVA 3KFXA 1A5SB 3LWZA 1NLFA 4DMRA 2AJCA 1VZ2A 3GL9A 4BYGA 2XNJA 2PZAA 3ESQA 4BV2A 2B5VA 4D8UA 1T8YA 1ILEA 1VM6A 4NCJA 1T2EA 5KYWA 4BQRA 1DRKA 2NTVA 3GVHA 2REBA 3EWAA 2C8KA 1Z88A 2DFNA 3FYHA 5KWIA 3PDUA 1T9GR</